Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_47.186465.526ON63563527190.0
KLTH0G03740g5.526ON63163519460.0
SAKL0G04906g5.526ON60861612351e-162
Smik_13.1455.526ON7741324412e-45
TDEL0A039005.526ON6711344338e-45
YML006C (GIS4)5.526ON7741324368e-45
Skud_13.1485.526ON7791324342e-44
Suva_13.1565.526ON7721324332e-44
NDAI0C010705.526ON7571484243e-43
KNAG0B037105.526ON7111284181e-42
CAGL0K07271g5.526ON7761334172e-42
KLLA0A01782g5.526ON5281424041e-41
NCAS0H025505.526ON7431544111e-41
KAFR0C053905.526ON4551863992e-41
TBLA0D016605.526ON8661293572e-34
ZYRO0D12540g5.526ON5481493423e-33
Ecym_40615.526ON6631652938e-27
Kpol_1023.995.526ON551922615e-23
ADR198C5.526ON5491202143e-17
NDAI0H015905.526ON371802015e-16
NCAS0F010805.526ON379811944e-15
TPHA0K005405.526ON6751081958e-15
KNAG0C032405.526ON324571054e-04
TBLA0G009405.526ON78285880.055
NDAI0A083107.154ON138382761.7
KLTH0C07150g7.373ON40871751.9
Skud_13.844.321ON37650715.3
TDEL0A062608.681ON61347708.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_47.18646
         (635 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_47.18646 s47 complement(909622..911529) [1908 bp, 635 aa] {...  1051   0.0  
KLTH0G03740g Chr7 (295985..297880) [1896 bp, 631 aa] {ON} simila...   754   0.0  
SAKL0G04906g Chr7 (403654..405480) [1827 bp, 608 aa] {ON} some s...   480   e-162
Smik_13.145 Chr13 complement(244766..247090) [2325 bp, 774 aa] {...   174   2e-45
TDEL0A03900 Chr1 (698940..700955) [2016 bp, 671 aa] {ON} Anc_5.5...   171   8e-45
YML006C Chr13 complement(256092..258416) [2325 bp, 774 aa] {ON} ...   172   8e-45
Skud_13.148 Chr13 complement(242351..244690) [2340 bp, 779 aa] {...   171   2e-44
Suva_13.156 Chr13 complement(246662..248980) [2319 bp, 772 aa] {...   171   2e-44
NDAI0C01070 Chr3 complement(209024..211297) [2274 bp, 757 aa] {O...   167   3e-43
KNAG0B03710 Chr2 complement(710003..712138) [2136 bp, 711 aa] {O...   165   1e-42
CAGL0K07271g Chr11 complement(712294..714624) [2331 bp, 776 aa] ...   165   2e-42
KLLA0A01782g Chr1 complement(157216..158802) [1587 bp, 528 aa] {...   160   1e-41
NCAS0H02550 Chr8 (506755..508986) [2232 bp, 743 aa] {ON} Anc_5.5...   162   1e-41
KAFR0C05390 Chr3 (1080797..1082164) [1368 bp, 455 aa] {ON} Anc_5...   158   2e-41
TBLA0D01660 Chr4 complement(409692..412292) [2601 bp, 866 aa] {O...   142   2e-34
ZYRO0D12540g Chr4 (1059795..1061441) [1647 bp, 548 aa] {ON} some...   136   3e-33
Ecym_4061 Chr4 (133342..135333) [1992 bp, 663 aa] {ON} similar t...   117   8e-27
Kpol_1023.99 s1023 complement(232194..233849) [1656 bp, 551 aa] ...   105   5e-23
ADR198C Chr4 complement(1046482..1048131) [1650 bp, 549 aa] {ON}...    87   3e-17
NDAI0H01590 Chr8 (385963..387078) [1116 bp, 371 aa] {ON}               82   5e-16
NCAS0F01080 Chr6 (214243..215382) [1140 bp, 379 aa] {ON} Anc_5.5...    79   4e-15
TPHA0K00540 Chr11 complement(107389..109416) [2028 bp, 675 aa] {...    80   8e-15
KNAG0C03240 Chr3 complement(634593..635567) [975 bp, 324 aa] {ON}      45   4e-04
TBLA0G00940 Chr7 complement(228909..231257) [2349 bp, 782 aa] {O...    39   0.055
NDAI0A08310 Chr1 complement(1902537..1906688) [4152 bp, 1383 aa]...    34   1.7  
KLTH0C07150g Chr3 complement(618784..620010) [1227 bp, 408 aa] {...    33   1.9  
Skud_13.84 Chr13 (149982..151112) [1131 bp, 376 aa] {ON} YML060W...    32   5.3  
TDEL0A06260 Chr1 (1096512..1098353) [1842 bp, 613 aa] {ON} Anc_8...    32   8.5  

>Kwal_47.18646 s47 complement(909622..911529) [1908 bp, 635 aa] {ON}
           YML006C (GIS4) - CAAX box containing protein [contig
           191] FULL
          Length = 635

 Score = 1051 bits (2719), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 536/635 (84%), Positives = 536/635 (84%)

Query: 1   MPENSVKVDDYFGNDENGLWSWYLCNLRHGNFEELNNNQLKSALLRRFLNEQLMSETVPF 60
           MPENSVKVDDYFGNDENGLWSWYLCNLRHGNFEELNNNQLKSALLRRFLNEQLMSETVPF
Sbjct: 1   MPENSVKVDDYFGNDENGLWSWYLCNLRHGNFEELNNNQLKSALLRRFLNEQLMSETVPF 60

Query: 61  NKKLLLVSIPDAIHENTNLLENFLRDYFHLDDLQYIQIRKLTQEKCYNHENHYLICDNLS 120
           NKKLLLVSIPDAIHENTNLLENFLRDYFHLDDLQYIQIRKLTQEKCYNHENHYLICDNLS
Sbjct: 61  NKKLLLVSIPDAIHENTNLLENFLRDYFHLDDLQYIQIRKLTQEKCYNHENHYLICDNLS 120

Query: 121 NFNDKSFLEFGIKRVGACNGNELSGETSNNQYSIISGETSTDVTKSSLEIPLSPEFIRDS 180
           NFNDKSFLEFGIKRVGACNGNELSGETSNNQYSIISGETSTDVTKSSLEIPLSPEFIRDS
Sbjct: 121 NFNDKSFLEFGIKRVGACNGNELSGETSNNQYSIISGETSTDVTKSSLEIPLSPEFIRDS 180

Query: 181 KVTQEDPALQTQSTSSRSLRIENSGSLNXXXXXXXXXXXIVLRFKPRGTVGKRQLYSEVK 240
           KVTQEDPALQTQSTSSRSLRIENSGSLN           IVLRFKPRGTVGKRQLYSEVK
Sbjct: 181 KVTQEDPALQTQSTSSRSLRIENSGSLNSSDESDDTESEIVLRFKPRGTVGKRQLYSEVK 240

Query: 241 RSPLANDYIDTPSTGMSLRSEDVSSYDGEELAHIXXXXXXXXXXXXXXXNISELSSVDHS 300
           RSPLANDYIDTPSTGMSLRSEDVSSYDGEELAHI               NISELSSVDHS
Sbjct: 241 RSPLANDYIDTPSTGMSLRSEDVSSYDGEELAHIASRDEDSASLSADEDNISELSSVDHS 300

Query: 301 LNSLSYDSECTPGXXXXXXXXXXXXXXEKFGRFRLVLQSILIQQTDTRQLYTAVRQSNND 360
           LNSLSYDSECTPG              EKFGRFRLVLQSILIQQTDTRQLYTAVRQSNND
Sbjct: 301 LNSLSYDSECTPGSSSMTSIFPSISISEKFGRFRLVLQSILIQQTDTRQLYTAVRQSNND 360

Query: 361 PTVAHVNDDWLLYDDKFSMNNLQILALHDVLEINKFFPKVLFYSLIVVTDEVAIDAQEYY 420
           PTVAHVNDDWLLYDDKFSMNNLQILALHDVLEINKFFPKVLFYSLIVVTDEVAIDAQEYY
Sbjct: 361 PTVAHVNDDWLLYDDKFSMNNLQILALHDVLEINKFFPKVLFYSLIVVTDEVAIDAQEYY 420

Query: 421 PSASHQSPERTVSTSLLSENTLKLQXXXXXXXXXXXXXXXMGVNSSSLTPFYATAQGSPX 480
           PSASHQSPERTVSTSLLSENTLKLQ               MGVNSSSLTPFYATAQGSP 
Sbjct: 421 PSASHQSPERTVSTSLLSENTLKLQTTLTPSLTNTNSFLSMGVNSSSLTPFYATAQGSPD 480

Query: 481 XXXXXXXXXXXXXXGKTDDGEVFQLYSATRTNSNKSTAHRSIRTIKSIGDWAFHHDXXXX 540
                         GKTDDGEVFQLYSATRTNSNKSTAHRSIRTIKSIGDWAFHHD    
Sbjct: 481 RANDEDDYFDDERDGKTDDGEVFQLYSATRTNSNKSTAHRSIRTIKSIGDWAFHHDSTSR 540

Query: 541 XXXXXXXFLEDPRLDDEGNLMKIKSKSSVKSGLTKTFTLGSLSTVERSKSVPLPSILKTL 600
                  FLEDPRLDDEGNLMKIKSKSSVKSGLTKTFTLGSLSTVERSKSVPLPSILKTL
Sbjct: 541 RTSSAASFLEDPRLDDEGNLMKIKSKSSVKSGLTKTFTLGSLSTVERSKSVPLPSILKTL 600

Query: 601 SNFDEEALYXXXXXXXXXXXXXXXXXXNEPNCLLM 635
           SNFDEEALY                  NEPNCLLM
Sbjct: 601 SNFDEEALYLKKKVEKFKRKRLAKRKKNEPNCLLM 635

>KLTH0G03740g Chr7 (295985..297880) [1896 bp, 631 aa] {ON} similar
           to uniprot|Q04233 Saccharomyces cerevisiae YML006C GIS4
           CAAX box containing protein of unknown function proposed
           to be involved in the RAS/cAMP signaling pathway
          Length = 631

 Score =  754 bits (1946), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 392/635 (61%), Positives = 451/635 (71%), Gaps = 4/635 (0%)

Query: 1   MPENSVKVDDYFGNDENGLWSWYLCNLRHGNFEELNNNQLKSALLRRFLNEQLMSETVPF 60
           M E+SVKVDDYF NDENGLWSWYLCNLRHGNFEELNNNQLK ALLRRFLNEQL+S++V F
Sbjct: 1   MLESSVKVDDYFDNDENGLWSWYLCNLRHGNFEELNNNQLKFALLRRFLNEQLLSDSVLF 60

Query: 61  NKKLLLVSIPDAIHENTNLLENFLRDYFHLDDLQYIQIRKLTQEKCYNHENHYLICDNLS 120
           NKKLLLVSIPDAIHENTNLLENFLRDYF+LDDLQ+IQI+KLTQ++CYNHENHYLI D+LS
Sbjct: 61  NKKLLLVSIPDAIHENTNLLENFLRDYFNLDDLQFIQIQKLTQDRCYNHENHYLISDSLS 120

Query: 121 NFNDKSFLEFGIKRVGACNGNELSGETSNNQYSIISGETSTDVTKSSLEIPLSPEFIRDS 180
           NFNDKSFLEFG K     +  E+ G+ SNNQYSIISGET  D    +     SP  +  S
Sbjct: 121 NFNDKSFLEFGAKSRRPRDDTEILGQDSNNQYSIISGETEADPALPAAISSESPASVHLS 180

Query: 181 KVTQEDPALQTQSTSSRSLRIENSGSLNXXXXXXXXXXXIVLRFKPRGTVGKRQLYSEVK 240
           KV QED  L+T ++SSR L ++N    +           +VL+F+ RG +GK++L+ EV+
Sbjct: 181 KVVQEDVPLRTHNSSSRLLIVDNQECASSTDESDDASTELVLKFEHRGMLGKQRLHPEVR 240

Query: 241 RSPLANDYIDTPSTGMSLRSEDVSSYDGEELAHIXXXXXXXXXXXXXXXNISELSSVDHS 300
           +     + IDTPSTG+SLRS+DVSSYDGE L                  +ISELSSVDHS
Sbjct: 241 KMASTEEAIDTPSTGVSLRSDDVSSYDGEVLTQTITRDEDSVSLMIEDDSISELSSVDHS 300

Query: 301 LNSLSYDSECTPGXXXXXXXXXXXXXXEKFGRFRLVLQSILIQQTDTRQLYTAVRQSNND 360
           L SLSYDSE + G              EKFGRFRLVLQSIL+ Q DTRQL+TAVRQSNND
Sbjct: 301 LKSLSYDSEYSQGSSSLTSIFPSISISEKFGRFRLVLQSILVHQPDTRQLFTAVRQSNND 360

Query: 361 PTVAHVNDDWLLYDDKFSMNNLQILALHDVLEINKFFPKVLFYSLIVVTDEVAIDAQEYY 420
           PTVAHVNDDWLLYDDKFSMNNLQILALHDVLE+NKFFPK+LFYSL+++++EVA DAQ+YY
Sbjct: 361 PTVAHVNDDWLLYDDKFSMNNLQILALHDVLEMNKFFPKILFYSLVMISEEVAADAQDYY 420

Query: 421 PSASHQSPERTVSTSLLSENTLKLQXXXXXXXXXXXXXXXMGVNSSSLTPFYATAQGSPX 480
           PS   +SP+ T S S +SENTLK+Q                G  +SSL+PFY++ Q +  
Sbjct: 421 PSKPSKSPQPTASNSTISENTLKVQPTLTHSLTNTNSYLSTGAYNSSLSPFYSSVQHN-- 478

Query: 481 XXXXXXXXXXXXXXGKTDDGEVFQLYSATRTNSNKSTAHRSIRTIKSIGDWAFHHDXXXX 540
                          K  +G V  LYSATRTNSNKSTAHRSIRTIKSIGDWAFHHD    
Sbjct: 479 --HEQGEEDDYYDDDKNSEGVVVPLYSATRTNSNKSTAHRSIRTIKSIGDWAFHHDSSSR 536

Query: 541 XXXXXXXFLEDPRLDDEGNLMKIKSKSSVKSGLTKTFTLGSLSTVERSKSVPLPSILKTL 600
                   LED     EGNLMK++SKSSVKSGLTKT TLGSLSTVERSKSVPLPS+LK+L
Sbjct: 537 KLSPNDSTLEDSYQSVEGNLMKVRSKSSVKSGLTKTLTLGSLSTVERSKSVPLPSVLKSL 596

Query: 601 SNFDEEALYXXXXXXXXXXXXXXXXXXNEPNCLLM 635
           SNFDEEALY                  NEPNCLLM
Sbjct: 597 SNFDEEALYLKKKVEKFKRKRLTKRKKNEPNCLLM 631

>SAKL0G04906g Chr7 (403654..405480) [1827 bp, 608 aa] {ON} some
           similarities with uniprot|Q04233 Saccharomyces
           cerevisiae YML006C GIS4 CAAX box containing protein of
           unknown function proposed to be involved in the RAS/cAMP
           signaling pathway
          Length = 608

 Score =  480 bits (1235), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 281/616 (45%), Positives = 361/616 (58%), Gaps = 54/616 (8%)

Query: 6   VKVDDYFGNDENGLWSWYLCNLRHGNFEELNNNQLKSALLRRFLNEQLMSETVPFNKKLL 65
           VKV DYF ND NGLWSWYL NLR G+FEEL NN LK  LL+RFLNE LM + V FNKK+L
Sbjct: 5   VKVKDYFENDYNGLWSWYLSNLRDGHFEELTNNVLKFTLLKRFLNEHLMQDIVQFNKKML 64

Query: 66  LVSIPDAIHENTNLLENFLRDYFHLDDLQYIQIRKLTQEKCYNHENHYLICDNLSNFNDK 125
           LVSIPD IH++  +LENFLR YFHLDDLQYIQI+KLT  + YNHENHYLI DNL+NF+D+
Sbjct: 65  LVSIPDNIHQDITILENFLRSYFHLDDLQYIQIKKLTDSQIYNHENHYLISDNLNNFHDR 124

Query: 126 SFLEFGIKRVGACNGNELSGETSNNQYSIISGETSTDVTKSSLEIPLSPEFIRDSKVTQE 185
           SFL FG K+      + +  + S N YS++SGET     +++ E   +    R S V ++
Sbjct: 125 SFLGFGQKK-----HDNVRPQLSYNGYSVLSGETGYASLRTTEEQNGTH---RPSGVVEQ 176

Query: 186 ----DPALQTQSTSSRSLRIENSGSLNXXXXXXXXXXXIVLRFK---PRGTVGKRQLYSE 238
                PA     T+   ++       +           IVL F    P+  + +R+    
Sbjct: 177 CNGNSPATPRDVTAVEPVK-------SSEDEEDQESGEIVLNFPHKPPKNIINQRE---- 225

Query: 239 VKRSPLANDYIDTPSTGMSLRSEDVSSYDGEELAHIXXXXXXXXXXXXXXXNISELSSVD 298
                     + T S  +S+ SED SSYDGE L                  NISELSSVD
Sbjct: 226 --------QEVVTTSEDVSINSEDASSYDGEALIQTITRDEDASSADEDNSNISELSSVD 277

Query: 299 HSLNSLSYDSECTPGXXXXXXXXXXXXXXEKFGRFRLVLQSILIQQTDTRQLYTAVRQSN 358
           HSLNSLSY+S+ +                + FG FRLVLQSILIQ  DTR+++TAVRQSN
Sbjct: 278 HSLNSLSYNSDISSDDYSMASIFPAISISDTFGTFRLVLQSILIQNPDTREIFTAVRQSN 337

Query: 359 NDPTVAHVNDDWLLYDDKFSMNNLQILALHDVLEINKFFPKVLFYSLIVV-TDEVAIDAQ 417
           NDP VAH+NDDWLLYD+KFSM+NLQ+L+LHDVLEIN+FFPK+LFY+++++ T+E+A +A 
Sbjct: 338 NDPNVAHINDDWLLYDEKFSMHNLQMLSLHDVLEINRFFPKILFYTMVMLDTEEIADEAH 397

Query: 418 EYYPSASHQSP--ERTVSTSLLSENTLKLQXXXXXXXXXXXXXXXMGVNSSSLTPFYATA 475
            Y P+  H  P  +   STS LS+NTL+L                +   ++S       A
Sbjct: 398 AYIPNDPHLPPPSQGIASTSTLSQNTLRLLPTATSNVTYTRHNELLNAAATS-------A 450

Query: 476 QGSPXXXXXXXXXXXXXXXGKTDDGE---VFQLYSATRTNSNKSTAHRSIRTIKSIGDWA 532
           Q +                   DD E   V  LY+ TRTNSN +TAHRSI T+ SIG+WA
Sbjct: 451 QDA-------ENYFPEDNHDDEDDQEVNGVMPLYAPTRTNSNSTTAHRSILTVNSIGEWA 503

Query: 533 FHHDXXXXXXXXXXXFLEDPRLDDEGNLMKIKSKSSVKSGLTKTFTLGSLSTVERSKSVP 592
           FHH+              D      G + ++ SK S K+ L KT T+GSLS VERSKS P
Sbjct: 504 FHHNEPYPQNNHSNISFADQNTSTAGKMKRVSSKGSSKNTLQKTTTVGSLSAVERSKSTP 563

Query: 593 LPSILKTLSNFDEEAL 608
           LP++L+TLS  D+E +
Sbjct: 564 LPTLLRTLSGLDDETM 579

>Smik_13.145 Chr13 complement(244766..247090) [2325 bp, 774 aa] {ON}
           YML006C (REAL)
          Length = 774

 Score =  174 bits (441), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 81/132 (61%), Positives = 101/132 (76%), Gaps = 3/132 (2%)

Query: 3   ENSVKVDDYFGNDENGLWSWYLCNLRHGNFEELNNNQLKSALLRRFLNEQLMSE---TVP 59
           + SV+V DYF ND+NGLWSWYL NLR G+FEEL  NQLK  LL+RFLN     +   +V 
Sbjct: 2   QKSVRVGDYFDNDDNGLWSWYLTNLRLGDFEELIGNQLKYTLLKRFLNSHFYGDNSISVR 61

Query: 60  FNKKLLLVSIPDAIHENTNLLENFLRDYFHLDDLQYIQIRKLTQEKCYNHENHYLICDNL 119
            NKK+LLVSIP+ +HE+ ++LE FL+DYFHL+ L++IQI KLT   CYNHENHYL+ DNL
Sbjct: 62  SNKKILLVSIPENVHEDISILEIFLKDYFHLEKLEHIQISKLTHSHCYNHENHYLLTDNL 121

Query: 120 SNFNDKSFLEFG 131
           +NF D +FLEF 
Sbjct: 122 NNFQDPTFLEFA 133

 Score =  124 bits (310), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 53/83 (63%), Positives = 69/83 (83%)

Query: 328 EKFGRFRLVLQSILIQQTDTRQLYTAVRQSNNDPTVAHVNDDWLLYDDKFSMNNLQILAL 387
           +  G FRLVLQSILIQ  DT++++TA+RQSNN PT+A V DDWLLYD  FSMNNLQIL L
Sbjct: 447 DSLGYFRLVLQSILIQDPDTKEIFTAIRQSNNRPTIASVTDDWLLYDSNFSMNNLQILTL 506

Query: 388 HDVLEINKFFPKVLFYSLIVVTD 410
            D+L+I + FPK+LFY++++VT+
Sbjct: 507 QDLLDIKRSFPKILFYTMVIVTE 529

 Score = 63.2 bits (152), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 47/136 (34%), Positives = 67/136 (49%), Gaps = 35/136 (25%)

Query: 504 QLYSATRTNSNKSTAHRSIRTIKSIGDWAFH-HDXXXXXXXXXXXFLEDPRLDDE----- 557
           Q+Y  TR  SN +TAHRSIRT+ SIG+WAF+ H+             +D   +D+     
Sbjct: 599 QMYIPTRMESNVTTAHRSIRTVNSIGEWAFNRHNSVTKINKSNSNESDDSENNDDRLSSD 658

Query: 558 ------------------------GNLMKIKSK----SSVKSGLTKTF-TLGSLSTVERS 588
                                    N  K+ SK    S+ KS L K   ++ ++S VERS
Sbjct: 659 EPYPMTQISNFNTSSSNFSHSLKKKNTSKVNSKINNESNSKSELKKIKNSINAMSAVERS 718

Query: 589 KSVPLPSILKTLSNFD 604
           KS+PLP++LK+LS+ D
Sbjct: 719 KSLPLPTLLKSLSSID 734

>TDEL0A03900 Chr1 (698940..700955) [2016 bp, 671 aa] {ON} Anc_5.526
           YML006C
          Length = 671

 Score =  171 bits (433), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 77/134 (57%), Positives = 100/134 (74%), Gaps = 2/134 (1%)

Query: 3   ENSVKVDDYFGNDENGLWSWYLCNLRHGNFEELNNNQLKSALLRRFLNEQLMSETVPF-- 60
           + S+KVDDYF ND+NGLWSWYL ++R G+FEE + N+LK  LLRRFLN    S    +  
Sbjct: 2   QKSIKVDDYFDNDDNGLWSWYLSHIRSGDFEEFSRNKLKVTLLRRFLNSHFDSNRSHYGQ 61

Query: 61  NKKLLLVSIPDAIHENTNLLENFLRDYFHLDDLQYIQIRKLTQEKCYNHENHYLICDNLS 120
           N K+L VSIPD +H + +LLENFLRDYFHL+ L++I+I KLTQ   YNHENHY++ D L+
Sbjct: 62  NTKILFVSIPDKVHRDLSLLENFLRDYFHLEHLEHIEITKLTQSPVYNHENHYILIDKLN 121

Query: 121 NFNDKSFLEFGIKR 134
           NF+D +FL+F   R
Sbjct: 122 NFDDPTFLQFASTR 135

 Score =  125 bits (313), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 63/132 (47%), Positives = 87/132 (65%), Gaps = 10/132 (7%)

Query: 290 NISELSSVDHSLNSLS----------YDSECTPGXXXXXXXXXXXXXXEKFGRFRLVLQS 339
           NISELSSV  S+ SL           Y++                   +  G +RLV+QS
Sbjct: 346 NISELSSVSRSMKSLGSQTSLGDNNDYENNSDSSDYSVVSILPSISISDARGHYRLVMQS 405

Query: 340 ILIQQTDTRQLYTAVRQSNNDPTVAHVNDDWLLYDDKFSMNNLQILALHDVLEINKFFPK 399
            L+Q  +T+++YTA+RQSNN PTVA V+DDWLLYD +FSMNNLQ+L L ++L++N+ FPK
Sbjct: 406 SLLQDPETKEIYTAIRQSNNQPTVADVDDDWLLYDSQFSMNNLQMLTLQELLDMNRSFPK 465

Query: 400 VLFYSLIVVTDE 411
           ++FYS+IVV+DE
Sbjct: 466 IIFYSMIVVSDE 477

 Score = 77.0 bits (188), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 46/112 (41%), Positives = 60/112 (53%), Gaps = 7/112 (6%)

Query: 505 LYSATRTNSNKSTAHRSIRTIKSIGDWAFHHDXXXXXX-----XXXXXFLEDPRLDDEGN 559
           +Y+ TR  SN STAHRSIRT+ SIGDWAF H                  +   + D +  
Sbjct: 536 MYAPTRLQSNTSTAHRSIRTVNSIGDWAFVHKNETKRQGSHRGSTSQAGVSGVQFDSDNQ 595

Query: 560 LMKIKSKSSVKS--GLTKTFTLGSLSTVERSKSVPLPSILKTLSNFDEEALY 609
            ++      V S  GL+K  T+ SL+ VERSKS PLP IL + SN D E+ +
Sbjct: 596 NLQFLHPERVHSRNGLSKVSTMASLNPVERSKSTPLPVILISFSNLDGESKH 647

>YML006C Chr13 complement(256092..258416) [2325 bp, 774 aa] {ON}
           GIS4CAAX box containing protein of unknown function,
           proposed to be involved in the RAS/cAMP signaling
           pathway
          Length = 774

 Score =  172 bits (436), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 80/132 (60%), Positives = 100/132 (75%), Gaps = 3/132 (2%)

Query: 3   ENSVKVDDYFGNDENGLWSWYLCNLRHGNFEELNNNQLKSALLRRFLNEQLMSE---TVP 59
           + SV+V DYF ND+NGLWSWYL NLR G+FEEL  NQLK  LL+RFLN     +   +  
Sbjct: 2   QKSVRVGDYFDNDDNGLWSWYLTNLRLGDFEELIGNQLKYTLLKRFLNSHFYGDNNISAR 61

Query: 60  FNKKLLLVSIPDAIHENTNLLENFLRDYFHLDDLQYIQIRKLTQEKCYNHENHYLICDNL 119
            NKK+LLVSIP+ +HE+ ++LE FL+DYFHL+ L++IQI KLT   CYNHENHYL+ DNL
Sbjct: 62  PNKKILLVSIPENVHEDISILEIFLKDYFHLEKLEHIQISKLTHSHCYNHENHYLLTDNL 121

Query: 120 SNFNDKSFLEFG 131
           +NF D +FLEF 
Sbjct: 122 NNFQDPTFLEFA 133

 Score =  123 bits (309), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 53/83 (63%), Positives = 69/83 (83%)

Query: 328 EKFGRFRLVLQSILIQQTDTRQLYTAVRQSNNDPTVAHVNDDWLLYDDKFSMNNLQILAL 387
           +  G FRLVLQSILIQ  DT++++TA+RQSNN PT+A V DDWLLYD  FSMNNLQIL L
Sbjct: 444 DSLGYFRLVLQSILIQDPDTKEIFTAIRQSNNKPTMASVTDDWLLYDSNFSMNNLQILTL 503

Query: 388 HDVLEINKFFPKVLFYSLIVVTD 410
            D+L+I + FPK+LFY++++VT+
Sbjct: 504 QDLLDIKRSFPKILFYTMVIVTN 526

 Score = 59.3 bits (142), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 45/136 (33%), Positives = 67/136 (49%), Gaps = 35/136 (25%)

Query: 504 QLYSATRTNSNKSTAHRSIRTIKSIGDWAFH-HDXXXXXXXXXXXFLEDPR------LDD 556
           Q+Y  TR  SN +TAHRSIRT+ SIG+WAF+ H+            L++ +      L  
Sbjct: 599 QMYIPTRMESNVTTAHRSIRTVNSIGEWAFNRHNSVTKIDKSNSNELDNSKTGESTVLSS 658

Query: 557 EGNLM---------------------------KIKSKSSVKSGLTK-TFTLGSLSTVERS 588
           E + M                           K  ++S+ K+ L K   ++ ++S VERS
Sbjct: 659 EPHPMTQLSNSNTTSSNFSHSLKTKNSHKPNSKGNNESNSKNELKKIKSSINAMSAVERS 718

Query: 589 KSVPLPSILKTLSNFD 604
           KS+PLP++LK+LS  D
Sbjct: 719 KSLPLPTLLKSLSGID 734

>Skud_13.148 Chr13 complement(242351..244690) [2340 bp, 779 aa] {ON}
           YML006C (REAL)
          Length = 779

 Score =  171 bits (434), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 80/132 (60%), Positives = 100/132 (75%), Gaps = 3/132 (2%)

Query: 3   ENSVKVDDYFGNDENGLWSWYLCNLRHGNFEELNNNQLKSALLRRFLNEQLMSE---TVP 59
           + SV+V DYF ND+NGLWSWYL NLR G+FEEL  NQLK  LL+RFLN     +   +  
Sbjct: 2   QKSVRVGDYFDNDDNGLWSWYLTNLRLGDFEELIGNQLKYTLLKRFLNSHFYGDYNTSAR 61

Query: 60  FNKKLLLVSIPDAIHENTNLLENFLRDYFHLDDLQYIQIRKLTQEKCYNHENHYLICDNL 119
            NKK+LLVSIP+ +HE+ ++LE FL+DYFHL+ L++IQI KLT   CYNHENHYL+ DNL
Sbjct: 62  PNKKILLVSIPENVHEDISILEIFLKDYFHLEKLEHIQISKLTHSHCYNHENHYLLTDNL 121

Query: 120 SNFNDKSFLEFG 131
           +NF D +FLEF 
Sbjct: 122 NNFQDPTFLEFA 133

 Score =  161 bits (408), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 114/316 (36%), Positives = 157/316 (49%), Gaps = 66/316 (20%)

Query: 328 EKFGRFRLVLQSILIQQTDTRQLYTAVRQSNNDPTVAHVNDDWLLYDDKFSMNNLQILAL 387
           +  G FRLVLQSILIQ  DT++++TA+RQSNN PT+A V DDWLLYD  FSMNNLQIL L
Sbjct: 451 DSLGYFRLVLQSILIQDPDTKEIFTAIRQSNNKPTMASVTDDWLLYDSNFSMNNLQILTL 510

Query: 388 HDVLEINKFFPKVLFYSLIVVTDEVAIDAQEYYPSASHQSPERTVSTS----LLSENTLK 443
            D+L+I + FPK+LFY++++VTD      +E + S+SH+    TV TS    L SE +L 
Sbjct: 511 QDLLDIKRSFPKILFYTMVIVTDSGHQQIEEEHKSSSHRG---TVDTSKEEPLNSELSLS 567

Query: 444 LQXXXXXXXXXXXXXXXMGVNSSSLTPFYATAQGSPXXXXXXXXXXXXXXXGKTDDGEVF 503
                               +         + Q  P                        
Sbjct: 568 HDPQQYFPTAYNIDYDEYTDDEDEGDDASLSEQSGP------------------------ 603

Query: 504 QLYSATRTNSNKSTAHRSIRTIKSIGDWAFH-HDXXXXXXXXXXXFLEDPR--------- 553
           Q+Y  TR  SN +TAHRSIRT+ SIG+WAF+ H+            L++ +         
Sbjct: 604 QMYLPTRMASNVTTAHRSIRTVNSIGEWAFNRHNSVTKINKSDSNELDNSKEGVNRNSLG 663

Query: 554 --------------------LDDEGNLMKIKSK----SSVKSGLTKTFT-LGSLSTVERS 588
                               L  + N  K+ S+    S+ K+ L K  T + ++S VERS
Sbjct: 664 EPYPMAQLSNSSTTTSNFNHLLKKKNSYKLGSRDKNGSNSKNELKKIKTSINAMSAVERS 723

Query: 589 KSVPLPSILKTLSNFD 604
           KS+PLP++LK+LS  D
Sbjct: 724 KSLPLPTLLKSLSGID 739

>Suva_13.156 Chr13 complement(246662..248980) [2319 bp, 772 aa] {ON}
           YML006C (REAL)
          Length = 772

 Score =  171 bits (433), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 80/132 (60%), Positives = 100/132 (75%), Gaps = 3/132 (2%)

Query: 3   ENSVKVDDYFGNDENGLWSWYLCNLRHGNFEELNNNQLKSALLRRFLNEQLMSE---TVP 59
           + SV+V DYF ND+NGLWSWYL NLR G+FEEL  NQLK  LL+RFLN     +   ++ 
Sbjct: 2   QKSVRVGDYFDNDDNGLWSWYLTNLRLGDFEELIGNQLKYTLLKRFLNSHFYGDNNTSIR 61

Query: 60  FNKKLLLVSIPDAIHENTNLLENFLRDYFHLDDLQYIQIRKLTQEKCYNHENHYLICDNL 119
            NKK+LLVSIP+ +HE+ ++LE FL+DYFHL+ L++IQI KLT   CYNHENHYL+ D L
Sbjct: 62  PNKKILLVSIPENVHEDISILEIFLKDYFHLEKLEHIQISKLTHSHCYNHENHYLLTDYL 121

Query: 120 SNFNDKSFLEFG 131
           +NF D SFLEF 
Sbjct: 122 NNFQDPSFLEFA 133

 Score =  123 bits (308), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 53/83 (63%), Positives = 69/83 (83%)

Query: 328 EKFGRFRLVLQSILIQQTDTRQLYTAVRQSNNDPTVAHVNDDWLLYDDKFSMNNLQILAL 387
           +  G FRLVLQSILIQ  DT++++TA+RQSNN+PTVA V DDWLLYD  FSMNNLQIL L
Sbjct: 443 DSLGYFRLVLQSILIQNPDTKEIFTAIRQSNNEPTVASVTDDWLLYDSNFSMNNLQILTL 502

Query: 388 HDVLEINKFFPKVLFYSLIVVTD 410
            D+L+I + FPK+L Y++++VT+
Sbjct: 503 QDLLDIKRSFPKILLYTMVIVTN 525

 Score = 57.0 bits (136), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 47/138 (34%), Positives = 67/138 (48%), Gaps = 39/138 (28%)

Query: 504 QLYSATRTNSNKSTAHRSIRTIKSIGDWAFH-HDXXXXXXXXXXXFLEDPRLDDEGN--- 559
           Q+Y  TR  SN +TAHRSIRT+ SIG+WAF+ H+             E   L + G+   
Sbjct: 597 QMYLPTRMASNVTTAHRSIRTVNSIGEWAFNRHNSVTKINKSSSN--ESDNLKECGDRIS 654

Query: 560 ----------------------LMKIK----------SKSSVKSGLTKTFT-LGSLSTVE 586
                                 L+K K          ++S+ K+ L K  T + ++S VE
Sbjct: 655 PVEPYPMTQLSNSNTVTSNFSHLLKNKNSYKRTSKGNNESNSKNELKKIKTSINAMSAVE 714

Query: 587 RSKSVPLPSILKTLSNFD 604
           RSKS+PLP++LK+LS  D
Sbjct: 715 RSKSLPLPTLLKSLSGMD 732

>NDAI0C01070 Chr3 complement(209024..211297) [2274 bp, 757 aa] {ON}
           Anc_5.526 YML006C
          Length = 757

 Score =  167 bits (424), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 82/148 (55%), Positives = 100/148 (67%), Gaps = 19/148 (12%)

Query: 3   ENSVKVDDYFGNDENGLWSWYLCNLRHGNFEELNNNQLKSALLRRFLNEQLMSETV---- 58
           +NSV+V DY+ ND+NGLWSWYL N+R G+FEEL  NQLK  LL+RFLN    S       
Sbjct: 2   QNSVRVRDYYNNDDNGLWSWYLRNIRLGDFEELTGNQLKYTLLKRFLNSHFYSNATTTDT 61

Query: 59  ---------------PFNKKLLLVSIPDAIHENTNLLENFLRDYFHLDDLQYIQIRKLTQ 103
                          P  KK+LLVSIPD +H + +LLE FLRDYFHL+DL+ IQI KLTQ
Sbjct: 62  AIDDNNNTNSVNDIKPTVKKILLVSIPDKVHSDISLLELFLRDYFHLEDLENIQITKLTQ 121

Query: 104 EKCYNHENHYLICDNLSNFNDKSFLEFG 131
            +CYNHENHYL+ D ++NF+D  FLEF 
Sbjct: 122 SECYNHENHYLLTDKVNNFDDPMFLEFA 149

 Score =  119 bits (299), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 50/80 (62%), Positives = 68/80 (85%)

Query: 331 GRFRLVLQSILIQQTDTRQLYTAVRQSNNDPTVAHVNDDWLLYDDKFSMNNLQILALHDV 390
           G FRLVLQS LIQ   T++++TA+RQSNN+PT+AH+ DDWLLYD KF+M+NLQIL L D+
Sbjct: 473 GHFRLVLQSTLIQNPITKEIFTAIRQSNNEPTIAHITDDWLLYDSKFAMDNLQILTLQDL 532

Query: 391 LEINKFFPKVLFYSLIVVTD 410
           L+ N+ FPK+LFYS+++V +
Sbjct: 533 LDSNRTFPKILFYSMVIVNE 552

 Score = 44.7 bits (104), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 18/30 (60%), Positives = 23/30 (76%)

Query: 504 QLYSATRTNSNKSTAHRSIRTIKSIGDWAF 533
           ++Y  TR  +N +TAHRSIRT  SIG+WAF
Sbjct: 654 EMYLPTRMQTNVTTAHRSIRTANSIGEWAF 683

>KNAG0B03710 Chr2 complement(710003..712138) [2136 bp, 711 aa] {ON}
           Anc_5.526 YML006C
          Length = 711

 Score =  165 bits (418), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 72/128 (56%), Positives = 97/128 (75%), Gaps = 1/128 (0%)

Query: 3   ENSVKVDDYFGNDENGLWSWYLCNLRHGNFEELNNNQLKSALLRRFLNEQLMSETVPFNK 62
           + S++V+DY+ ND+NGLWSWYL N+R G+FEEL +N+LK  LL+RFL     S     N 
Sbjct: 2   QKSIRVNDYYDNDDNGLWSWYLQNIRSGDFEELTHNELKYTLLKRFLKNHFTS-LEGINS 60

Query: 63  KLLLVSIPDAIHENTNLLENFLRDYFHLDDLQYIQIRKLTQEKCYNHENHYLICDNLSNF 122
           K+L +SIPD +H + ++LE FL+DYFHL+DLQ I+I+KLT   CYNHENHYL+ D L+NF
Sbjct: 61  KILFISIPDKVHSDISVLETFLKDYFHLEDLQNIKIQKLTTSNCYNHENHYLLTDTLNNF 120

Query: 123 NDKSFLEF 130
           ND+ FL +
Sbjct: 121 NDRKFLRY 128

 Score = 90.1 bits (222), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 42/85 (49%), Positives = 58/85 (68%), Gaps = 1/85 (1%)

Query: 331 GRFRLVLQSILIQQTDTRQLYTAVRQSNNDPTVAHVNDDWLLYDDKFSMNNLQILALHDV 390
           G FRLVLQS+L+Q+ D + ++TA+RQSNN    A V DDW+LYD  FSMNNL ++ L  +
Sbjct: 472 GHFRLVLQSVLLQRED-KAIFTAIRQSNNKVDRATVQDDWILYDSDFSMNNLMMMTLRGL 530

Query: 391 LEINKFFPKVLFYSLIVVTDEVAID 415
              ++   K+LFYS+I+V D    D
Sbjct: 531 FNFSENMSKILFYSMIIVDDAETAD 555

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 17/30 (56%), Positives = 24/30 (80%)

Query: 504 QLYSATRTNSNKSTAHRSIRTIKSIGDWAF 533
           Q+Y   +T S+ +TAHRSIRT+ SIG+WA+
Sbjct: 590 QMYLPQKTASHATTAHRSIRTVNSIGEWAY 619

>CAGL0K07271g Chr11 complement(712294..714624) [2331 bp, 776 aa]
           {ON} similar to uniprot|Q04233 Saccharomyces cerevisiae
           YML006c
          Length = 776

 Score =  165 bits (417), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 77/133 (57%), Positives = 97/133 (72%), Gaps = 6/133 (4%)

Query: 5   SVKVDDYFGNDENGLWSWYLCNLRHGNFEELNNNQLKSALLRRFLNEQLMSETVP----- 59
           SV+V DY+GNDENG+WSWYL NLR G+FEE+  N+LK  LL+RFLN  L+    P     
Sbjct: 4   SVRVGDYYGNDENGVWSWYLSNLRSGDFEEIIENKLKYTLLKRFLNSNLLGNFSPESPTR 63

Query: 60  -FNKKLLLVSIPDAIHENTNLLENFLRDYFHLDDLQYIQIRKLTQEKCYNHENHYLICDN 118
             NKKL+ VSIP+ +H++ ++LE FLRDYFHL  L   QI KLTQ+K Y+HENHY + D 
Sbjct: 64  FINKKLIFVSIPEDVHQDISILELFLRDYFHLKVLDNNQIHKLTQDKVYHHENHYFLMDE 123

Query: 119 LSNFNDKSFLEFG 131
           L+NF D +FLEFG
Sbjct: 124 LNNFEDPTFLEFG 136

 Score =  119 bits (299), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 53/96 (55%), Positives = 71/96 (73%)

Query: 328 EKFGRFRLVLQSILIQQTDTRQLYTAVRQSNNDPTVAHVNDDWLLYDDKFSMNNLQILAL 387
           +  G FRLVLQSILIQ   T++++TAVRQSNN PT+A + DDWLLYD +FSM+NLQIL L
Sbjct: 462 DTLGYFRLVLQSILIQDPQTKEVFTAVRQSNNKPTIADITDDWLLYDAEFSMHNLQILTL 521

Query: 388 HDVLEINKFFPKVLFYSLIVVTDEVAIDAQEYYPSA 423
            D++ I K +PK+LFY+++V+ D   I  +  Y  A
Sbjct: 522 QDIMTIKKDYPKILFYTMVVINDRSEIACEFPYNGA 557

 Score = 58.9 bits (141), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 40/122 (32%), Positives = 57/122 (46%), Gaps = 16/122 (13%)

Query: 499 DGEVFQLYSATRTNSNKSTAHRSIRTIKSIGDWAFHHDXXXXXXXXXXX-------FLED 551
           D   F L  A RT SN +T HRSIRT+ SIGDW+   D                    + 
Sbjct: 605 DSLTFDLCQAERTKSNMTTTHRSIRTVNSIGDWSISRDTTGIATRAATNTSGQYDDHYQA 664

Query: 552 PRLDDEGNLMKIKSKSSVKSG------LTKTFTLGS---LSTVERSKSVPLPSILKTLSN 602
            + D+      I+ +     G      +++  T GS   L +VER+KS+PLP++LKT S 
Sbjct: 665 LKFDESSKERLIQGRKDGSGGKYSKHQISRVNTNGSSMPLDSVERTKSLPLPTLLKTASG 724

Query: 603 FD 604
            +
Sbjct: 725 IE 726

>KLLA0A01782g Chr1 complement(157216..158802) [1587 bp, 528 aa] {ON}
           some similarities with uniprot|Q04233 Saccharomyces
           cerevisiae YML006C GIS4 CAAX box containing protein of
           unknown function proposed to be involved in the RAS/cAMP
           signaling pathway
          Length = 528

 Score =  160 bits (404), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 84/142 (59%), Positives = 102/142 (71%), Gaps = 5/142 (3%)

Query: 1   MPENSVKVDDYFGNDENGLWSWYLCNLRHGNFEELNNNQLKSALLRRFLNEQLMSETVPF 60
           MP  SV+V DY+ ND NGLWSWYL NLR+G FEEL  N+LK  LL+RFL +Q  + T P 
Sbjct: 1   MP-TSVQVKDYYENDYNGLWSWYLSNLRNGEFEELTGNELKHGLLKRFLRDQFQA-TGPL 58

Query: 61  NKKLLLVSIPDAIHENTNLLENFLRDYFHL-DDLQYIQIRKLTQEKCYNHENHYLICDNL 119
           NKKLLLVSIPD IH++  +LE FL +YFHL DD   I I KLT+   Y HENHYLI D L
Sbjct: 59  NKKLLLVSIPDEIHQDIKVLEEFLSEYFHLKDDHTNIVIDKLTRGTVYKHENHYLIQDKL 118

Query: 120 SNFNDKSFLEFGIKRVGACNGN 141
           +NFND+ FLE  +K+  + +GN
Sbjct: 119 TNFNDEWFLE--MKKDVSISGN 138

 Score =  123 bits (309), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 90/282 (31%), Positives = 123/282 (43%), Gaps = 63/282 (22%)

Query: 328 EKFGRFRLVLQSILIQQTDTRQLYTAVRQSNNDPTVAHVNDDWLLYDDKFSMNNLQILAL 387
           + FG FRLVLQSILI   +T Q++T +RQS ND + A +NDDWLLYD  F++ NLQ+L+L
Sbjct: 284 DNFGTFRLVLQSILITNKETEQIFTGIRQSENDRSNADINDDWLLYDTDFNLGNLQMLSL 343

Query: 388 HDVLEINKFFPKVLFYSLIVVTDEVAIDAQEYYPSASHQSPERTVSTSLLSENTLKLQXX 447
           +D+L+ +KF PK+LFYS+I V D V              + E ++   +   NTL     
Sbjct: 344 YDILDFSKFLPKILFYSMIHVKDSV------------DDNTELSLQHLITVNNTL----- 386

Query: 448 XXXXXXXXXXXXXMGVNSSSLTPFYATAQGSPXXXXXXXXXXXXXXXGKTDDGEVFQLYS 507
                           N +  +P       S                    D  V  LYS
Sbjct: 387 ---------------TNGNMYSPHEVDDSMSELSSDNSIECYTGNSNDSIADEPVIGLYS 431

Query: 508 ATRTNSNKSTAHRSIRTIKSIGDWAFHHDXXXXXXXXXXXFLEDPRLDDEGNLMKIKSKS 567
                +  +  HRSIRT++SIG WA +              +     D  GN M      
Sbjct: 432 PA---TAATAGHRSIRTVESIGAWALNRSNTKKSMETVQNTVS---RDSRGNFMN----- 480

Query: 568 SVKSGLTKTFTLGSLSTVERSKSVPLPSILKTL-SNFDEEAL 608
                              R KS P+P +L+TL SN DEEA+
Sbjct: 481 -------------------RIKSQPMPVLLQTLNSNIDEEAI 503

>NCAS0H02550 Chr8 (506755..508986) [2232 bp, 743 aa] {ON} Anc_5.526
           YML006C
          Length = 743

 Score =  162 bits (411), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 78/154 (50%), Positives = 100/154 (64%), Gaps = 25/154 (16%)

Query: 3   ENSVKVDDYFGNDENGLWSWYLCNLRHGNFEELNNNQLKSALLRRFLNEQLMS------- 55
           + SV+V DYF ND+NGLWSWYL N+R G+FEE+  NQLK  LL+RFLN    S       
Sbjct: 2   QKSVRVTDYFDNDDNGLWSWYLTNIRLGDFEEVTGNQLKYTLLKRFLNSHFYSNSDVTAT 61

Query: 56  ------------------ETVPFNKKLLLVSIPDAIHENTNLLENFLRDYFHLDDLQYIQ 97
                             +  P  +K+LLVSIPD +H + ++LE FLRDYFHL+ L+ IQ
Sbjct: 62  ESPQQHNNNNNTNNNNTQQLKPNFRKILLVSIPDKVHRDLSILETFLRDYFHLEHLEGIQ 121

Query: 98  IRKLTQEKCYNHENHYLICDNLSNFNDKSFLEFG 131
           I++LTQ KCYNHENHYL+ D ++NF+D  FLEF 
Sbjct: 122 IQRLTQSKCYNHENHYLLTDTINNFDDPVFLEFA 155

 Score =  148 bits (373), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 101/290 (34%), Positives = 141/290 (48%), Gaps = 32/290 (11%)

Query: 331 GRFRLVLQSILIQQTDTRQLYTAVRQSNNDPTVAHVNDDWLLYDDKFSMNNLQILALHDV 390
           G FRLVLQSILIQ   T+++YTA+RQSNN+PT+A + DDWLLYD +FSM+NLQIL L D+
Sbjct: 434 GHFRLVLQSILIQHPVTKEIYTAIRQSNNEPTIADIMDDWLLYDSQFSMDNLQILTLQDL 493

Query: 391 LEINKFFPKVLFYSLIVVTDEVAIDAQEYYPSASHQSPERTVSTSLLSENTLKLQXXXXX 450
           L+ N+ FPK+LFYS+++VTD      Q      S   P+  ++TS LS N L+       
Sbjct: 494 LDTNRSFPKILFYSMVIVTD---AHHQPIQGPTSTAGPD--LTTSYLS-NKLESIAGDET 547

Query: 451 XXXXXXXXXXMGVNSSSLTP--FYATAQGSPXXXXXXXXXXXXXXXGKTDDGEVFQLYSA 508
                     M  +     P  F+                      G        ++Y  
Sbjct: 548 NQRFENRYYPMADDQVEDQPQQFFPQEDDHDDDNMYDTDDSLMEEAGP-------EMYLP 600

Query: 509 TRTNSNKSTAHRSIRTIKSIGDWAFHHDXXXXXXXXXX--------------XFLEDPRL 554
           TR  +N +TAHRSIRT+ SIG+WAF+ +                            D + 
Sbjct: 601 TRMETNNTTAHRSIRTVNSIGEWAFNRNNTNGSSSKSAIGREDEDGDEEEETNHHNDGQT 660

Query: 555 DDEGNLMKIKSKSSVKSGLTKTFTLG---SLSTVERSKSVPLPSILKTLS 601
            D  +    K+      G  K    G   ++  VER+KS PLP++LK++S
Sbjct: 661 HDNNHHHNKKTGKKGSYGGAKNKRSGNIEAMKAVERTKSTPLPTLLKSIS 710

>KAFR0C05390 Chr3 (1080797..1082164) [1368 bp, 455 aa] {ON}
           Anc_5.526 YML006C
          Length = 455

 Score =  158 bits (399), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 91/186 (48%), Positives = 124/186 (66%), Gaps = 15/186 (8%)

Query: 1   MPENSVKVDDYFGNDENGLWSWYLCNLRHGNFEELNNNQLKSALLRRFLNEQL-MSETVP 59
           MP NSV++ DYF NDENGLWSWYL NLR GNFEEL NN+LK +LL+RFL  Q+ +++ + 
Sbjct: 1   MP-NSVQIHDYFDNDENGLWSWYLTNLRSGNFEELINNKLKDSLLKRFLRNQVDINDQI- 58

Query: 60  FNKKLLLVSIPDAIHENTNLLENFLRDYFHLDDLQYIQIRKLTQEKCYNHENHYLICDNL 119
             KK+LL+SIPD I  + N+LE FL DYFHL+DL  I+I KLT+   YNHENHYL+ D++
Sbjct: 59  --KKILLISIPDHIFSDINVLEIFLSDYFHLNDLSNIKIIKLTKFNVYNHENHYLLIDSV 116

Query: 120 SNFNDKSFLEFGIKRVGACNGNELSGETSNNQYSIISGETSTDVTKSSLEIPLSPEFIRD 179
           +NF D++FL +          N      ++N++ I S  T T  +    +IPL+P    D
Sbjct: 117 NNFKDETFLNY---------VNPQPSTNASNKF-IPSIRTGTSASIPENDIPLAPIRNID 166

Query: 180 SKVTQE 185
           S ++ E
Sbjct: 167 SSISIE 172

 Score = 81.6 bits (200), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 45/85 (52%), Positives = 58/85 (68%), Gaps = 1/85 (1%)

Query: 328 EKFGRFRLVLQSILIQQTDTRQLYTAVRQSNNDPTVAHVNDDWLLYDDKFSMNNLQILAL 387
           E  G +RLVLQS+LI   +   L T VRQSNN    A++NDDW+LYD+KFSM NL IL+L
Sbjct: 261 EAIGHYRLVLQSMLICNKENLDLQTGVRQSNNLINYANINDDWMLYDEKFSMRNLNILSL 320

Query: 388 HDVLEI-NKFFPKVLFYSLIVVTDE 411
            D+  I N    K+LFYS+I V ++
Sbjct: 321 KDLSIIGNVDSIKILFYSMIDVNNQ 345

>TBLA0D01660 Chr4 complement(409692..412292) [2601 bp, 866 aa] {ON}
           Anc_5.526 YML006C
          Length = 866

 Score =  142 bits (357), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 69/129 (53%), Positives = 88/129 (68%), Gaps = 6/129 (4%)

Query: 6   VKVDDYFGNDENGLWSWYLCNLRHGNFEELNNNQLKSALLRRFLNEQLMSETVPFNK--- 62
           V+V+DY+ ND NGLWSWYL N+R+G FEEL  N LK  LL+RFL E    +    ++   
Sbjct: 9   VQVNDYYDNDNNGLWSWYLSNIRNGMFEELTENILKITLLKRFLKENFQQDINSTSQHST 68

Query: 63  ---KLLLVSIPDAIHENTNLLENFLRDYFHLDDLQYIQIRKLTQEKCYNHENHYLICDNL 119
              K+L  SIPD IH++  +LEN L+DYF LD+L  IQI KLTQ +CYNHENHY++ D L
Sbjct: 69  NCTKILFTSIPDNIHQDLPILENLLKDYFDLDNLDNIQILKLTQNRCYNHENHYILKDIL 128

Query: 120 SNFNDKSFL 128
            NF + SF 
Sbjct: 129 DNFGNTSFF 137

 Score =  112 bits (279), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 72/210 (34%), Positives = 105/210 (50%), Gaps = 11/210 (5%)

Query: 328 EKFGRFRLVLQSILIQQTDTRQLYTAVRQSNNDPTVAHVNDDWLLYDDKFSMNNLQILAL 387
           +  G FRLVLQ ILI      + YTA+RQS+++  VA + DDWLLYD KFSM+NL+IL L
Sbjct: 507 DSLGHFRLVLQCILIYHPHAEKTYTAIRQSDSNRDVADIQDDWLLYDLKFSMDNLEILTL 566

Query: 388 HDVLEINKFFPKVLFYSLIVVTDEVAIDAQEYYPSASHQSPERTVSTSLLSENTLKLQXX 447
            ++L+ N+ +PK+LFY+L      VAI+    Y   +    E    T+ L    L  +  
Sbjct: 567 QELLDFNRDYPKILFYTL------VAINDNSSYIRTNKNISEINELTNNLK--NLNCKPS 618

Query: 448 XXXXXXXXXXXXXMGVNSSSLTPFYATAQGSPXXXXXX--XXXXXXXXXGKTDDGEVFQL 505
                           N++ +   +     S                  G+ +  E  ++
Sbjct: 619 GDDRNKKDNQKINTEFNTTRIHSNHLIDHSSSEDIPRQLYTTLSSDEEYGEIEYPEGLEM 678

Query: 506 YSATRTNSNKST-AHRSIRTIKSIGDWAFH 534
           Y  ++  SN +T AHRSIRT+ SIG+WAFH
Sbjct: 679 YEPSKIKSNTTTIAHRSIRTVNSIGEWAFH 708

>ZYRO0D12540g Chr4 (1059795..1061441) [1647 bp, 548 aa] {ON} some
           similarities with uniprot|Q04233 Saccharomyces
           cerevisiae YML006C GIS4 CAAX box containing protein of
           unknown function proposed to be involved in the RAS/cAMP
           signaling pathway
          Length = 548

 Score =  136 bits (342), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 71/149 (47%), Positives = 98/149 (65%), Gaps = 11/149 (7%)

Query: 5   SVKVDDYFGNDENGLWSWYLCNLRHGNFEELNNNQLKSALLRRFLN---EQLMSETVPFN 61
           SV+V DYF ND+NGLWSWYL N+R+G+FEEL  NQLK +L +RFL    E  ++E    +
Sbjct: 4   SVRVGDYFSNDDNGLWSWYLTNIRNGDFEELTRNQLKHSLFKRFLRTYLEPTLNERK--D 61

Query: 62  KKLLLVSIPDAIHENTNLLENFLRDYFHLDDLQYIQIRKLTQEKCYNHENHYLICDNLSN 121
            K+L+VSIP+ +  +  LLE FL DY +LD++   +I KLT  + YNHENHY++ D  +N
Sbjct: 62  TKVLIVSIPEDVRRDITLLEYFLGDYLNLDNM---EITKLTTSRIYNHENHYVVMDKENN 118

Query: 122 FNDKSFLEFG---IKRVGACNGNELSGET 147
           F + +FL F    I+      G EL+G T
Sbjct: 119 FKNSNFLHFASTNIQTGKGFTGGELAGTT 147

 Score =  110 bits (275), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 60/115 (52%), Positives = 78/115 (67%), Gaps = 6/115 (5%)

Query: 328 EKFGRFRLVLQSILIQQTDTRQLYTAVRQSNNDPTVAHVNDDWLLYDDKFSMNNLQILAL 387
           + FG FRLVLQS+L     + +++TA+RQSNN PT A V+DDWLLYD +FSM+NLQ+L L
Sbjct: 306 DSFGHFRLVLQSVLFINPTSNEIFTAIRQSNNKPTKADVDDDWLLYDSQFSMHNLQMLTL 365

Query: 388 HDVLEINKFFPKVLFYSLIVVTDEVAI-DAQEYYPSASHQSPERTVSTSLLSENT 441
            D+ E+NK  PKVLFYSL+ V D  ++ DA     + S+     T STSL S  T
Sbjct: 366 QDLSELNKGCPKVLFYSLVEVVDTPSLEDADTECATISN-----TASTSLSSAPT 415

 Score = 40.4 bits (93), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 29/98 (29%), Positives = 43/98 (43%), Gaps = 22/98 (22%)

Query: 510 RTNSNKST-AHRSIRTIKSIGDWAFHHDXXXXXXXXXXXFLEDPRLDDEGNLMKIKSKSS 568
           + N+N ST  HRSI T  S  DW                      ++   ++ K  S + 
Sbjct: 442 KGNTNSSTLGHRSIVTTNSAADW------------------RRQSVESNASIRKYDSTAE 483

Query: 569 VKSGLTKTFTLGSLSTVERSKSVPLPSILKTLSNFDEE 606
              GL  T  +G    +ER++S PLP+ LKT+S  D +
Sbjct: 484 TYKGLNATHAVG---IMERTRSTPLPTALKTISGSDRQ 518

>Ecym_4061 Chr4 (133342..135333) [1992 bp, 663 aa] {ON} similar to
           Ashbya gossypii ADR198C
          Length = 663

 Score =  117 bits (293), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 74/165 (44%), Positives = 92/165 (55%), Gaps = 25/165 (15%)

Query: 256 MSLRS-EDVSSYDGEELA-------HIXXXXXXXXXXXXXXXN----ISELSSVDHSLNS 303
           +S+RS E   SYDGE LA       HI               N     SELSS   + NS
Sbjct: 265 VSIRSSESYQSYDGEVLARTLTREEHIQGSCCPTEHRHEELYNEGDSTSELSS---ACNS 321

Query: 304 LSYDSECTPGXXXXXXXXXXXXXXEKFGRFRLVLQSILIQQTDTRQLYTAVRQSNNDPTV 363
           +S D    P                  G FR+VLQSILI  T   QL TAVRQSNND TV
Sbjct: 322 VSSDCSIFPSISISGDE----------GDFRIVLQSILIYNTTLDQLLTAVRQSNNDTTV 371

Query: 364 AHVNDDWLLYDDKFSMNNLQILALHDVLEINKFFPKVLFYSLIVV 408
           A +NDDWLLYD++FSMNN+Q+++L D+ E+N  FPK+LFYS++ +
Sbjct: 372 ADINDDWLLYDERFSMNNIQMVSLIDIFEMNGVFPKILFYSVVAI 416

 Score = 81.6 bits (200), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 51/119 (42%), Positives = 72/119 (60%), Gaps = 7/119 (5%)

Query: 1   MPENSVKVDDYFGNDENGLWSWYLCNLRHGNFEELNNNQLKSALLRRFLNEQLMSETVPF 60
           M ENS  + D    D NGLWSWYL NLR G FEEL+++ +K  L++R + E     T+  
Sbjct: 1   MVENSGCLLD----DCNGLWSWYLHNLRCGEFEELSSDIVKCRLMKRLVKE-YSGGTMSA 55

Query: 61  NKKLLLVSIPDAIHENTNLLENFLRDYF-HLDDLQYIQIRKLTQEK-CYNHENHYLICD 117
           + ++LLVS+PD I +  ++LE FLR     + +++   I KLT  K   N E+HYLI D
Sbjct: 56  SNRVLLVSVPDDIRQGASILEEFLRSSLPGMREVRDGNITKLTGRKDLLNGEDHYLIND 114

 Score = 32.7 bits (73), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 31/53 (58%), Gaps = 5/53 (9%)

Query: 555 DDEGNLMKIK---SKSSVKSGLTKTFTLGSLSTVERSK--SVPLPSILKTLSN 602
           DD  ++ + K   SK+  K+GLTK  +LGSLS   R +  S  LP +L T+ N
Sbjct: 564 DDNEDMFRSKYIISKNPSKNGLTKISSLGSLSLAHRERMFSCSLPGMLHTVFN 616

>Kpol_1023.99 s1023 complement(232194..233849) [1656 bp, 551 aa]
           {ON} complement(232194..233849) [1656 nt, 552 aa]
          Length = 551

 Score =  105 bits (261), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 49/92 (53%), Positives = 70/92 (76%), Gaps = 1/92 (1%)

Query: 328 EKFGRFRLVLQSILIQQTDTRQLYTAVRQSNNDPTVAHVNDDWLLYDDKFSMNNLQILAL 387
           + +  F+LVLQSILI  +D+ +L TA+RQSNN+   A ++DDWLLYD KFSM NLQIL+L
Sbjct: 255 DPYANFQLVLQSILIYNSDSDELITAIRQSNNEQDSADIDDDWLLYDSKFSMTNLQILSL 314

Query: 388 HDVLEINKFFPKVLFYSLIVVTDEVAIDAQEY 419
           +++L INK +PK+LFYSL+ + + V ++   Y
Sbjct: 315 NELLHINKDYPKILFYSLVSIPN-VTVNISNY 345

 Score = 39.7 bits (91), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 31/102 (30%), Positives = 51/102 (50%), Gaps = 12/102 (11%)

Query: 19  LWSWYLCNLRHGNFEELNNNQLKSALLRRFLNEQLMSETVPFNKKLLLVSIPDAIHENTN 78
           +W+WYLC++R+G+FEE+  N+    LL+  L + + +     NK   L+SI         
Sbjct: 15  VWTWYLCHVRNGSFEEILGNEDYYKLLKNNLVDDVFN-IDKGNKIFKLISI-------NY 66

Query: 79  LLENFLRDYFHLDDLQYIQIRKLTQEKCYNHENHYLICDNLS 120
           L  N L DY++      ++   L   K  + E HYL+ +  S
Sbjct: 67  LNNNILLDYYN----NIVKKTLLLLNKSNSIELHYLVINGTS 104

>ADR198C Chr4 complement(1046482..1048131) [1650 bp, 549 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YML006C
           (GIS4)
          Length = 549

 Score = 87.0 bits (214), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 47/120 (39%), Positives = 73/120 (60%), Gaps = 5/120 (4%)

Query: 330 FGRFRLVLQSILIQQTDTRQLYTAVRQSNNDPTVAHVNDDWLLYDDKFSMNNLQILALHD 389
           F +FR+VLQSIL+   +  ++ TAVRQ NN+P +A+ +DD LLYD+K S+   +IL+L D
Sbjct: 246 FSKFRVVLQSILVYDCEKDRINTAVRQYNNNPNIANCSDDCLLYDNKISLITFRILSLVD 305

Query: 390 VLEINKFFPKVLFYSLI-VVTDEVAIDAQEYYPSASHQSPE----RTVSTSLLSENTLKL 444
           ++E+N+  PK+LFYS+  +        A        H  P+     + S S LS ++L+L
Sbjct: 306 LMELNRAHPKMLFYSVAEIFNSSPRCSAAGCCAQVHHSQPQLLQRNSFSASTLSRHSLRL 365

 Score = 56.2 bits (134), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 44/71 (61%), Gaps = 1/71 (1%)

Query: 15 DENGLWSWYLCNLRHGNFEELNNNQLKSALLRRFLNEQLMSETVPFNKKLLLVSIPDAIH 74
          D +GLWSWYL NLR G FE+L  ++ + + L+ FL +   + +    ++L L+S P ++ 
Sbjct: 4  DYHGLWSWYLGNLRKGRFEQLVGDEARYSQLKAFLRD-CFAHSTGQERRLQLLSFPASVP 62

Query: 75 ENTNLLENFLR 85
           +  +LE F+R
Sbjct: 63 CDYKILEEFIR 73

>NDAI0H01590 Chr8 (385963..387078) [1116 bp, 371 aa] {ON} 
          Length = 371

 Score = 82.0 bits (201), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 39/80 (48%), Positives = 56/80 (70%)

Query: 330 FGRFRLVLQSILIQQTDTRQLYTAVRQSNNDPTVAHVNDDWLLYDDKFSMNNLQILALHD 389
           +G+ R VLQSI+ +   T +L TA+RQS+ D  VA  +D+WLLYD  FS+NNL+I  L D
Sbjct: 292 YGQIRFVLQSIVFKSVRTAELLTAIRQSSADRIVATSSDEWLLYDSDFSLNNLEISTLQD 351

Query: 390 VLEINKFFPKVLFYSLIVVT 409
           +L  N   P++LFY++ VV+
Sbjct: 352 ILYPNYENPRILFYTMSVVS 371

 Score = 68.2 bits (165), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 44/124 (35%), Positives = 66/124 (53%), Gaps = 6/124 (4%)

Query: 1   MPENSVKVDDYFGNDENGLWSWYLCNLRHGNFEELNNNQLKSALLRRFLNEQLMSETVPF 60
           M E+++K DD      N + SWYL NLR G FE +  ++ K+  L   L+ QL       
Sbjct: 1   MSEDNIKKDD------NEVLSWYLRNLREGRFENIIEDRAKNYHLNTILDRQLFDNKQYG 54

Query: 61  NKKLLLVSIPDAIHENTNLLENFLRDYFHLDDLQYIQIRKLTQEKCYNHENHYLICDNLS 120
               +LVS   +I E  ++ + FL   F  + LQYI++ +L   K  N E HY + D+L+
Sbjct: 55  ATNKILVSTLTSIDEIVSIKDIFLGQLFDHERLQYIEVEELKSLKGDNKETHYFLTDHLN 114

Query: 121 NFND 124
           +FND
Sbjct: 115 SFND 118

>NCAS0F01080 Chr6 (214243..215382) [1140 bp, 379 aa] {ON} Anc_5.526
           YML006C
          Length = 379

 Score = 79.3 bits (194), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 56/81 (69%)

Query: 329 KFGRFRLVLQSILIQQTDTRQLYTAVRQSNNDPTVAHVNDDWLLYDDKFSMNNLQILALH 388
           K G+ R VL S+LIQ   +++ +TA+RQ ++DP  A++ D+WLLYD KFS++NL++  L 
Sbjct: 298 KSGQLRFVLHSLLIQNAQSKETFTAIRQRSSDPNTANILDEWLLYDSKFSLDNLEMGTLQ 357

Query: 389 DVLEINKFFPKVLFYSLIVVT 409
           D+L  NK    +L Y  I+++
Sbjct: 358 DILLSNKGNSMLLLYKTILIS 378

 Score = 73.6 bits (179), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 38/118 (32%), Positives = 64/118 (54%), Gaps = 2/118 (1%)

Query: 12  FGNDENGLWSWYLCNLRHGNFEELNNNQLKSALLRRFLNEQLMSETVPFNKKLLLVSIPD 71
           + +D + +WSWYL NL+ GNFE L N  ++   L  +   Q  S       K +L+S+P 
Sbjct: 9   YPDDIDDMWSWYLSNLQSGNFEALVNGSVRQQHLEAYFKSQFTSGNE--GSKKILLSVPS 66

Query: 72  AIHENTNLLENFLRDYFHLDDLQYIQIRKLTQEKCYNHENHYLICDNLSNFNDKSFLE 129
            + +  ++   FL   F+ + LQYI + + ++      + HYL+ D LS FN+ +F+E
Sbjct: 67  MLCQEVSIKRLFLGSIFNEERLQYINVMEFSKSPKQTEKKHYLLTDALSGFNEAAFIE 124

>TPHA0K00540 Chr11 complement(107389..109416) [2028 bp, 675 aa] {ON}
           Anc_5.526 YML006C
          Length = 675

 Score = 79.7 bits (195), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 71/108 (65%), Gaps = 8/108 (7%)

Query: 330 FGRFRLVLQSILIQQTDTRQLYTAVRQSNNDPTVAHVNDDWLLYDDKFSMNNLQILALHD 389
           +G F+LVLQS+++   ++ + +TAVRQSN+    A  +D+WLLYD KFSM+NL+I+ L+ 
Sbjct: 336 YGEFKLVLQSMILINFESGESFTAVRQSNSLIHEATEDDEWLLYDSKFSMDNLEIVTLNY 395

Query: 390 VLEINKFFPKVLFYSLIVVTDEVAIDAQEYYPSASHQSPERTVSTSLL 437
           +++I   F K+ FYS++++  E        YP A   + ++ ++ +L+
Sbjct: 396 LMDIYADFVKIFFYSMVIINLE--------YPQAITFATDKHINNNLI 435

 Score = 44.3 bits (103), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 31/118 (26%), Positives = 57/118 (48%), Gaps = 16/118 (13%)

Query: 18  GLWSWYLCNLRHGNFEELNN---------NQLKSALLRRFLNEQLMSETVPF-NKKLLLV 67
            LW+WYL  +R+G FEEL           N+++  L     N ++  E     +  +L +
Sbjct: 14  SLWTWYLNCIRNGEFEELLKEEDKYRSILNKIRETLQTHARNIEMEEEDANISDGNILFL 73

Query: 68  SIPDAIHENTNLLENFLRDYFHLDDLQYIQIRKLTQEKC------YNHENHYLICDNL 119
           S+   + ++  ++++FL D F   DL  I IR++            +HE +Y++ D+L
Sbjct: 74  SLHYTLDKDKEIIDDFLVDNFPNVDLSNIVIREICNNNINSEHFKKDHETYYMVIDSL 131

>KNAG0C03240 Chr3 complement(634593..635567) [975 bp, 324 aa] {ON}
          
          Length = 324

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 32/57 (56%), Gaps = 1/57 (1%)

Query: 15 DENGLWSWYLCNLRHGNFEELNNNQLKSALLRRFLNEQLMS-ETVPFNKKLLLVSIP 70
          + N  W WY+ NL  GNFEELN+N +K   L  FL       +T    ++LLLV+ P
Sbjct: 16 ESNNFWFWYIDNLVAGNFEELNDNLIKRNQLCSFLAHYFGGKQTTKLQRRLLLVTSP 72

 Score = 37.0 bits (84), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 31/53 (58%), Gaps = 8/53 (15%)

Query: 339 SILIQQTDTRQLYTAVRQSNNDPTVAHVNDDWLLYDDKFSMNNLQILALHDVL 391
           S+L +   + +L+ AVRQ  +D        DW++YD  FS+NNL+   L D+L
Sbjct: 263 SLLGKDDASGKLWHAVRQLQDD--------DWVIYDADFSLNNLENCKLEDIL 307

>TBLA0G00940 Chr7 complement(228909..231257) [2349 bp, 782 aa] {ON} 
          Length = 782

 Score = 38.5 bits (88), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 23/85 (27%), Positives = 42/85 (49%), Gaps = 10/85 (11%)

Query: 334 RLVLQSILIQQTDTRQ--LYTAVRQSNNDPTVAHVNDDWLLYDDKFSMNNLQILALHDVL 391
           R+ L  I++++        +TA+++ N       +   WL++D  F     Q+++   +L
Sbjct: 564 RMNLNCIILKKIGNTNGDFFTAIKEYN------ELYSKWLIFDSTFQTEKSQLVSFDKLL 617

Query: 392 EINKFFPKVLFYSL--IVVTDEVAI 414
           EI K F K+ FYS    VV +E + 
Sbjct: 618 EIAKSFSKIFFYSYNNTVVKNETSF 642

>NDAI0A08310 Chr1 complement(1902537..1906688) [4152 bp, 1383 aa] {ON}
            Anc_7.154 YER008C
          Length = 1383

 Score = 33.9 bits (76), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 27/82 (32%), Positives = 41/82 (50%), Gaps = 11/82 (13%)

Query: 19   LWSWYLCNLRHGNFEEL-----NNNQLKSALLRRFLNEQLMSETVP---FNKKLL--LVS 68
            LW   L  L H   EE+     NN Q ++ LLR + N Q   + VP    + KLL  LV 
Sbjct: 920  LWEKMLFQLNHPE-EEIGKVSSNNQQGEARLLRSWKNYQETKKLVPVEPLSSKLLSGLVD 978

Query: 69   IPDAIHENTNLLENFLRDYFHL 90
              + + +N  + +NF+  +FH+
Sbjct: 979  ALEILEQNCIIYQNFIDKFFHI 1000

>KLTH0C07150g Chr3 complement(618784..620010) [1227 bp, 408 aa] {ON}
           similar to uniprot|P34220 Saccharomyces cerevisiae
           YBL055C Hypothetical ORF
          Length = 408

 Score = 33.5 bits (75), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 19/71 (26%), Positives = 36/71 (50%), Gaps = 1/71 (1%)

Query: 334 RLVLQSILIQQTDTRQLYTAVRQSNNDPTVAHVNDDWLLYDD-KFSMNNLQILALHDVLE 392
           RL +      ++  RQLYT +R +  DP    + +  L YD   +S   +Q+L   + L+
Sbjct: 114 RLDVADAAFTKSKLRQLYTLMRDNARDPKFRAIGEIGLDYDRFYYSSQEMQLLFFEEQLK 173

Query: 393 INKFFPKVLFY 403
           ++  FP++  +
Sbjct: 174 LSCLFPEMPLF 184

>Skud_13.84 Chr13 (149982..151112) [1131 bp, 376 aa] {ON} YML060W
           (REAL)
          Length = 376

 Score = 32.0 bits (71), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 14/50 (28%), Positives = 28/50 (56%)

Query: 133 KRVGACNGNELSGETSNNQYSIISGETSTDVTKSSLEIPLSPEFIRDSKV 182
           K VGA +G+  SGE    ++SI+         + +L++ L+   I+++K+
Sbjct: 326 KEVGATSGSTTSGEVKKRKWSIVKEVEQIATKQMALKVELAKVHIKEAKI 375

>TDEL0A06260 Chr1 (1096512..1098353) [1842 bp, 613 aa] {ON}
           Anc_8.681 YPL158C
          Length = 613

 Score = 31.6 bits (70), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 24/47 (51%)

Query: 107 YNHENHYLICDNLSNFNDKSFLEFGIKRVGACNGNELSGETSNNQYS 153
           Y+  NH+L+ DN+   ND +  +       A N N  SG +SN  YS
Sbjct: 37  YHLNNHHLLNDNVGKCNDDAASQILSDYTSASNTNTQSGHSSNGYYS 83

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.131    0.370 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 59,409,352
Number of extensions: 2447200
Number of successful extensions: 6035
Number of sequences better than 10.0: 44
Number of HSP's gapped: 6211
Number of HSP's successfully gapped: 84
Length of query: 635
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 519
Effective length of database: 40,180,143
Effective search space: 20853494217
Effective search space used: 20853494217
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 69 (31.2 bits)