Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_47.186425.527ON30930915860.0
KLTH0G03762g5.527ON70930912511e-168
SAKL0G04928g5.527ON8923278561e-107
ADR194C5.527ON6373157547e-95
TDEL0A039105.527ON7493367461e-92
Ecym_40655.527ON7213237399e-92
Suva_2.5995.527ON8273167441e-91
Skud_4.6965.527ON8113147352e-90
ZYRO0D12562g5.527ON8183437143e-87
YDR422C (SIP1)5.527ON8153147012e-85
Smik_4.6975.527ON8173216872e-83
NCAS0F010905.527ON7873386844e-83
CAGL0F03047g5.527ON7443396684e-81
NDAI0H016005.527ON8423236664e-80
TBLA0D016505.527ON10163176411e-75
KNAG0C032305.527ON5613285451e-64
Kpol_1004.215.527ON7553365164e-59
KAFR0E033005.527ON4663054814e-56
Kpol_1023.985.527ON6673324354e-48
TPHA0K005305.527ON6463183231e-32
Ecym_12103.517ON4503022052e-17
Suva_5.1233.517ON4232872053e-17
Skud_5.1363.517ON4182882027e-17
KNAG0B036905.527ON326651502e-10
CAGL0K09350g3.517ON4322881513e-10
KNAG0E015903.517ON423871485e-10
KNAG0B006003.517ON389531451e-09
TBLA0I032703.517ON433421442e-09
Kpol_195.23.517ON435421423e-09
TDEL0D058503.517ON404421414e-09
ZYRO0E08404g3.517ON348551397e-09
KLLA0B00583g3.517ON486411407e-09
Kwal_47.190403.517ON429421398e-09
KAFR0I023803.517ON409421389e-09
TPHA0A058103.517ON424411371e-08
CAGL0A03696g3.517ON415451371e-08
Smik_5.1503.517ON417421362e-08
NCAS0E006203.517ON500401362e-08
NDAI0I028903.517ON582421353e-08
SAKL0F02002g3.517ON503411343e-08
YER027C (GAL83)3.517ON417421334e-08
Skud_7.603.517ON441721318e-08
YGL208W (SIP2)3.517ON415711309e-08
NDAI0B060103.517ON503401301e-07
NCAS0F037303.517ON432401301e-07
AER361C3.517ON475421291e-07
KAFR0F041403.517ON348721272e-07
Suva_7.533.517ON414721254e-07
Smik_7.553.517ON415401238e-07
KLTH0G01848g3.517ON416401221e-06
KNAG0F013302.81ON62642740.87
Suva_13.220singletonOFF7536652.1
KAFR0J027703.546ON51058702.8
Klac_YGOB_Anc_7.647.64ON119083694.2
TBLA0C054902.147ON958107685.2
Klac_YGOB_Anc_7.168singletonOFF50746676.6
Klac_YGOB_Anc_7.168b7.168ON77946676.7
CAGL0J08349g1.66ON100362677.6
Kwal_23.50708.74ON31682659.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_47.18642
         (309 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_47.18642 s47 (908641..909570) [930 bp, 309 aa] {ON} YDR422C...   615   0.0  
KLTH0G03762g Chr7 complement(297935..300064) [2130 bp, 709 aa] {...   486   e-168
SAKL0G04928g Chr7 complement(405798..408476) [2679 bp, 892 aa] {...   334   e-107
ADR194C Chr4 complement(1039625..1041538) [1914 bp, 637 aa] {ON}...   295   7e-95
TDEL0A03910 Chr1 complement(701073..703322) [2250 bp, 749 aa] {O...   291   1e-92
Ecym_4065 Chr4 (144003..146168) [2166 bp, 721 aa] {ON} similar t...   289   9e-92
Suva_2.599 Chr2 complement(1068063..1070546) [2484 bp, 827 aa] {...   291   1e-91
Skud_4.696 Chr4 complement(1236293..1238728) [2436 bp, 811 aa] {...   287   2e-90
ZYRO0D12562g Chr4 complement(1061702..1064158) [2457 bp, 818 aa]...   279   3e-87
YDR422C Chr4 complement(1315326..1317773) [2448 bp, 815 aa] {ON}...   274   2e-85
Smik_4.697 Chr4 complement(1236081..1238534) [2454 bp, 817 aa] {...   269   2e-83
NCAS0F01090 Chr6 complement(215542..217905) [2364 bp, 787 aa] {O...   268   4e-83
CAGL0F03047g Chr6 complement(298906..301140) [2235 bp, 744 aa] {...   261   4e-81
NDAI0H01600 Chr8 complement(387297..389825) [2529 bp, 842 aa] {O...   261   4e-80
TBLA0D01650 Chr4 (406397..409447) [3051 bp, 1016 aa] {ON} Anc_5....   251   1e-75
KNAG0C03230 Chr3 (632659..634344) [1686 bp, 561 aa] {ON} Anc_5.5...   214   1e-64
Kpol_1004.21 s1004 complement(41725..43992) [2268 bp, 755 aa] {O...   203   4e-59
KAFR0E03300 Chr5 (654349..655749) [1401 bp, 466 aa] {ON} Anc_5.5...   189   4e-56
Kpol_1023.98 s1023 (229891..231894) [2004 bp, 667 aa] {ON} (2298...   172   4e-48
TPHA0K00530 Chr11 (105141..107081) [1941 bp, 646 aa] {ON} Anc_5....   129   1e-32
Ecym_1210 Chr1 (423627..424979) [1353 bp, 450 aa] {ON} similar t...    84   2e-17
Suva_5.123 Chr5 complement(184865..186136) [1272 bp, 423 aa] {ON...    84   3e-17
Skud_5.136 Chr5 complement(206871..208127) [1257 bp, 418 aa] {ON...    82   7e-17
KNAG0B03690 Chr2 (708946..709926) [981 bp, 326 aa] {ON} Anc_5.52...    62   2e-10
CAGL0K09350g Chr11 complement(922651..923949) [1299 bp, 432 aa] ...    63   3e-10
KNAG0E01590 Chr5 complement(317054..318325) [1272 bp, 423 aa] {O...    62   5e-10
KNAG0B00600 Chr2 (97910..99079) [1170 bp, 389 aa] {ON} Anc_3.517...    60   1e-09
TBLA0I03270 Chr9 complement(793849..795150) [1302 bp, 433 aa] {O...    60   2e-09
Kpol_195.2 s195 complement(4330..5637) [1308 bp, 435 aa] {ON} co...    59   3e-09
TDEL0D05850 Chr4 complement(1062927..1064141) [1215 bp, 404 aa] ...    59   4e-09
ZYRO0E08404g Chr5 complement(672301..673347) [1047 bp, 348 aa] {...    58   7e-09
KLLA0B00583g Chr2 complement(44819..46279) [1461 bp, 486 aa] {ON...    59   7e-09
Kwal_47.19040 s47 complement(1073036..1074325) [1290 bp, 429 aa]...    58   8e-09
KAFR0I02380 Chr9 (482219..483448) [1230 bp, 409 aa] {ON} Anc_3.5...    58   9e-09
TPHA0A05810 Chr1 complement(1317530..1318804) [1275 bp, 424 aa] ...    57   1e-08
CAGL0A03696g Chr1 (377255..378502) [1248 bp, 415 aa] {ON} simila...    57   1e-08
Smik_5.150 Chr5 complement(213879..215132) [1254 bp, 417 aa] {ON...    57   2e-08
NCAS0E00620 Chr5 (106661..108163) [1503 bp, 500 aa] {ON} Anc_3.517     57   2e-08
NDAI0I02890 Chr9 complement(682274..684022) [1749 bp, 582 aa] {O...    57   3e-08
SAKL0F02002g Chr6 (167591..169102) [1512 bp, 503 aa] {ON} simila...    56   3e-08
YER027C Chr5 complement(208979..210232) [1254 bp, 417 aa] {ON}  ...    56   4e-08
Skud_7.60 Chr7 (102699..104024) [1326 bp, 441 aa] {ON} YGL208W (...    55   8e-08
YGL208W Chr7 (97338..98585) [1248 bp, 415 aa] {ON}  SIP2One of t...    55   9e-08
NDAI0B06010 Chr2 complement(1460221..1461732) [1512 bp, 503 aa] ...    55   1e-07
NCAS0F03730 Chr6 complement(750798..752096) [1299 bp, 432 aa] {O...    55   1e-07
AER361C Chr5 complement(1307677..1309104) [1428 bp, 475 aa] {ON}...    54   1e-07
KAFR0F04140 Chr6 complement(814903..815949) [1047 bp, 348 aa] {O...    54   2e-07
Suva_7.53 Chr7 (93895..95139) [1245 bp, 414 aa] {ON} YGL208W (REAL)    53   4e-07
Smik_7.55 Chr7 (92235..93482) [1248 bp, 415 aa] {ON} YGL208W (REAL)    52   8e-07
KLTH0G01848g Chr7 (136780..138030) [1251 bp, 416 aa] {ON} simila...    52   1e-06
KNAG0F01330 Chr6 complement(239604..241484) [1881 bp, 626 aa] {O...    33   0.87 
Suva_13.220 Chr13 (356656..356880) [225 bp, 75 aa] {OFF}  YAR027...    30   2.1  
KAFR0J02770 Chr10 complement(526999..528531) [1533 bp, 510 aa] {...    32   2.8  
Klac_YGOB_Anc_7.64 Chr6 (231920..235492) [3573 bp, 1190 aa] {ON}...    31   4.2  
TBLA0C05490 Chr3 complement(1325823..1328699) [2877 bp, 958 aa] ...    31   5.2  
Klac_YGOB_Anc_7.168 Chr2 (1011211..1012734) [1524 bp, 507 aa] {O...    30   6.6  
Klac_YGOB_Anc_7.168b Chr2 (1011211..1012701,1012704..1013552) [2...    30   6.7  
CAGL0J08349g Chr10 complement(829222..832233) [3012 bp, 1003 aa]...    30   7.6  
Kwal_23.5070 s23 complement(996522..997472) [951 bp, 316 aa] {ON...    30   9.8  

>Kwal_47.18642 s47 (908641..909570) [930 bp, 309 aa] {ON} YDR422C
           (SIP1) - SNF1 protein kinase substrate [contig 191]
           PARTIAL
          Length = 309

 Score =  615 bits (1586), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/309 (96%), Positives = 297/309 (96%)

Query: 1   MVFDMESNCWIAPDLYLPAGVYKFQFLINGELRHSEFLPTATDSFGNCVNWFEVVAGHKV 60
           MVFDMESNCWIAPDLYLPAGVYKFQFLINGELRHSEFLPTATDSFGNCVNWFEVVAGHKV
Sbjct: 1   MVFDMESNCWIAPDLYLPAGVYKFQFLINGELRHSEFLPTATDSFGNCVNWFEVVAGHKV 60

Query: 61  IEPSRDVISNDFTENQVAISANDPSASPRPPILXXXXXXXXXXXXAKHIERSGTPYSDYT 120
           IEPSRDVISNDFTENQVAISANDPSASPRPPIL            AKHIERSGTPYSDYT
Sbjct: 61  IEPSRDVISNDFTENQVAISANDPSASPRPPILSGSSSFSNWKNSAKHIERSGTPYSDYT 120

Query: 121 GLCSRTDLAKPELRHKNTSSYDLLAPVPRPVYEYSNEIPELFKANFEGSSTPPPYQESVP 180
           GLCSRTDLAKPELRHKNTSSYDLLAPVPRPVYEYSNEIPELFKANFEGSSTPPPYQESVP
Sbjct: 121 GLCSRTDLAKPELRHKNTSSYDLLAPVPRPVYEYSNEIPELFKANFEGSSTPPPYQESVP 180

Query: 181 SQNPVKNQPSFLHRVQDCNQDVLFADLQKNGEIDSQAAEEAFLQQYPTPDLPVYLDSSFL 240
           SQNPVKNQPSFLHRVQDCNQDVLFADLQKNGEIDSQAAEEAFLQQYPTPDLPVYLDSSFL
Sbjct: 181 SQNPVKNQPSFLHRVQDCNQDVLFADLQKNGEIDSQAAEEAFLQQYPTPDLPVYLDSSFL 240

Query: 241 NAVFRGFQEKNDTKSKLNHIVPHVNLNHLLTSSIRDEIISVGCTTRYEGKFITQIIYTPC 300
           NAVFRGFQEKNDTKSKLNHIVPHVNLNHLLTSSIRDEIISVGCTTRYEGKFITQIIYTPC
Sbjct: 241 NAVFRGFQEKNDTKSKLNHIVPHVNLNHLLTSSIRDEIISVGCTTRYEGKFITQIIYTPC 300

Query: 301 YYGNKEKSG 309
           YYGNKEKSG
Sbjct: 301 YYGNKEKSG 309

>KLTH0G03762g Chr7 complement(297935..300064) [2130 bp, 709 aa] {ON}
           similar to uniprot|P32578 Saccharomyces cerevisiae
           YDR422C SIP1 Alternate beta-subunit of the Snf1p kinase
           complex may confer substrate specificity vacuolar
           protein containing KIS (Kinase-Interacting Sequence) and
           ASC (Association with Snf1 kinase Complex) domains
           involved in protein interactions
          Length = 709

 Score =  486 bits (1251), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 229/309 (74%), Positives = 262/309 (84%), Gaps = 6/309 (1%)

Query: 1   MVFDMESNCWIAPDLYLPAGVYKFQFLINGELRHSEFLPTATDSFGNCVNWFEVVAGHKV 60
           MVFDME NCW A DLYLP+GVYKFQFLINGELRHS++LPTATDSFGNCVNWFEVV GH  
Sbjct: 401 MVFDMERNCWTAHDLYLPSGVYKFQFLINGELRHSDYLPTATDSFGNCVNWFEVVEGHDS 460

Query: 61  IEPSRDVISND---FTENQVAISANDPSASPRPPILXXXXXXXXXXXXAKHIERSGTPYS 117
           IEPSRDVIS++    +++Q+A+    P    RP +             ++H+ERSGTP+S
Sbjct: 461 IEPSRDVISSEDVKLSKDQIAVEQPAPE---RPALGSDGSSSSNWKGSSRHVERSGTPFS 517

Query: 118 DYTGLCSRTDLAKPELRHKNTSSYDLLAPVPRPVYEYSNEIPELFKANFEGSSTPPPYQE 177
           DYTGLCSR++L KPELRH NTSSYDLLAPVPRP YEY++EIPELFKANF+GS  PPPY+E
Sbjct: 518 DYTGLCSRSELTKPELRHNNTSSYDLLAPVPRPKYEYTDEIPELFKANFDGSLVPPPYEE 577

Query: 178 SVPSQNPVKNQPSFLHRVQDCNQDVLFADLQKNGEIDSQAAEEAFLQQYPTPDLPVYLDS 237
              +++  +  PSFLHRVQDCNQDVLFADLQ+NG+IDSQAAEEAFLQQYPTPDLPVYLDS
Sbjct: 578 RELTKDGSQKPPSFLHRVQDCNQDVLFADLQQNGQIDSQAAEEAFLQQYPTPDLPVYLDS 637

Query: 238 SFLNAVFRGFQEKNDTKSKLNHIVPHVNLNHLLTSSIRDEIISVGCTTRYEGKFITQIIY 297
           SFLNAVF GFQ+K D+K+++NHIVPHVNLNHLLTSSIRDEIISVGCTTRYEGKFITQIIY
Sbjct: 638 SFLNAVFSGFQDKTDSKTRVNHIVPHVNLNHLLTSSIRDEIISVGCTTRYEGKFITQIIY 697

Query: 298 TPCYYGNKE 306
           TPCYY NK+
Sbjct: 698 TPCYYSNKD 706

>SAKL0G04928g Chr7 complement(405798..408476) [2679 bp, 892 aa] {ON}
           some similarities with uniprot|P32578 Saccharomyces
           cerevisiae YDR422C SIP1 Alternate beta-subunit of the
           Snf1p kinase complex may confer substrate specificity
           vacuolar protein containing KIS (Kinase-Interacting
           Sequence) and ASC (Association with Snf1 kinase Complex)
           domains involved in protein interactions
          Length = 892

 Score =  334 bits (856), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 175/327 (53%), Positives = 217/327 (66%), Gaps = 24/327 (7%)

Query: 1   MVFDMESNCWIAPDLYLPAGVYKFQFLINGELRHSEFLPTATDSFGNCVNWFEVVAGHKV 60
           M ++     W  P+L LP GVYK QFLINGELRHS FLPTATDSFGN VNWFEV+ G+  
Sbjct: 565 MEYETTEKSWFVPNLKLPPGVYKLQFLINGELRHSNFLPTATDSFGNFVNWFEVLPGYYE 624

Query: 61  IEPSRDVISNDFT-ENQVAISANDP----------SASPRPPILXXXXXXXXXXXXAKHI 109
           IEP RDV  +     + + +S  +           +  PRPP+L            +K+I
Sbjct: 625 IEPLRDVPVDSMNYGSDLGVSMKESVNGGSDFTITAPIPRPPLL--SQATSSSYRSSKYI 682

Query: 110 ERSGTPYSDYTGLCSRTDLAKPELRHKNTSSYDLLAPVPRPVYEYSNEIPELFKANFEGS 169
           ERS TPYSDYTG+ SR++ A+P L  K +SSYD+ AP+P   YEYS +IPELFK N E  
Sbjct: 683 ERSTTPYSDYTGILSRSNSARPLLNQKKSSSYDVFAPLPPKKYEYSTDIPELFKVNDEED 742

Query: 170 ------STPPPYQESVPSQNPVKNQPSFLHRVQDCNQDVLFADLQKNGEIDSQAAEEAFL 223
                   PP Y   +  +     QPSF  RVQDCNQD LF+DLQ++  ID+QAAEE FL
Sbjct: 743 HDHDIPEDPPSYSSLL--KGSEAEQPSFHCRVQDCNQDRLFSDLQQHDRIDAQAAEEFFL 800

Query: 224 QQYPTPDLPVYLDSSFLNAVFRGFQEKN---DTKSKLNHIVPHVNLNHLLTSSIRDEIIS 280
           Q+YP PDLP+YL+SS+LN VF   Q+ N   +TK+ +N ++PHVNLNHLLTSSIR+EIIS
Sbjct: 801 QKYPVPDLPIYLNSSYLNKVFNQLQKDNNAGETKAVVNPVIPHVNLNHLLTSSIREEIIS 860

Query: 281 VGCTTRYEGKFITQIIYTPCYYGNKEK 307
           VGCTTRYEGKFIT ++Y PCYY N  +
Sbjct: 861 VGCTTRYEGKFITHVVYAPCYYENTNR 887

>ADR194C Chr4 complement(1039625..1041538) [1914 bp, 637 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR422C
           (SIP1)
          Length = 637

 Score =  295 bits (754), Expect = 7e-95,   Method: Compositional matrix adjust.
 Identities = 162/315 (51%), Positives = 199/315 (63%), Gaps = 30/315 (9%)

Query: 1   MVFDMESNCWIAPDLYLPAGVYKFQFLINGELRHSEFLPTATDSFGNCVNWFEVVAGHKV 60
           MVF  +   W+APDL LP G+YK QFLING LRHS FLPTATDS  N VNWFEVV  +  
Sbjct: 345 MVFSKDEQFWVAPDLRLPPGIYKLQFLINGALRHSNFLPTATDSHSNIVNWFEVVPWYDR 404

Query: 61  IEPSRDVISNDFTENQVAISANDPS----ASPRPPILXXXXXXXXXXXXAKHIERSGTPY 116
            EP RD         +VA+    P     A+ RPP+L            A+ +ERS TP 
Sbjct: 405 AEPYRDP-----APEEVAMPPESPQLTAPAAGRPPLLKRGTSSSSR---ARVVERSNTPI 456

Query: 117 SDYTGLCSRTDLAKPELRHKNTSSYDLLAPVPRPVYEYSNEIPELFKANFEGSSTPPPYQ 176
           SDYTG+ SR+  A+P L H  +++   L+P+PR V +YS EIPELFK   EG    PP  
Sbjct: 457 SDYTGI-SRSGSARPLLAHHKSANSIELSPIPRCVLQYSTEIPELFKP--EGC---PPDP 510

Query: 177 ESVPSQNPVKNQPSFLHRVQDCNQDVLFADLQKNGEIDSQAAEEAFLQQYPTPDLPVYLD 236
            + P         SF   +QDCNQD LF  LQ++ ++ +Q AEE  +++YP PDLPVYL+
Sbjct: 511 NTAPG--------SFNENIQDCNQDELFRFLQEDWKMSAQEAEEVLVEKYPVPDLPVYLN 562

Query: 237 SSFLNAVFRGFQEKNDT----KSKLNHIVPHVNLNHLLTSSIRDEIISVGCTTRYEGKFI 292
           SS+LN +F   Q  + T    +S   HI+PHVNLNHLLTSSIRDEIISVGCTTRYEGKFI
Sbjct: 563 SSYLNEIFTKLQRSSVTGDVKRSSFTHIIPHVNLNHLLTSSIRDEIISVGCTTRYEGKFI 622

Query: 293 TQIIYTPCYYGNKEK 307
           TQI+Y PCYY +  K
Sbjct: 623 TQIMYAPCYYESSRK 637

>TDEL0A03910 Chr1 complement(701073..703322) [2250 bp, 749 aa] {ON}
           Anc_5.527 YDR422C
          Length = 749

 Score =  291 bits (746), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 166/336 (49%), Positives = 209/336 (62%), Gaps = 36/336 (10%)

Query: 1   MVFDMESNCWIAPDLYLPAGVYKFQFLINGELRHSEFLPTATDSFGNCVNWFEVVAGHKV 60
           M +D + N +  P+L LP G+YKFQF+INGE+RHS  LP+ATDS GN VNWFEV+ G++ 
Sbjct: 418 MKYDEKENNFYVPNLSLPPGIYKFQFVINGEIRHSNLLPSATDSVGNIVNWFEVIPGYES 477

Query: 61  IEPSRDVISNDFTENQ-VAISANDPSASP-------------------RPPILXXXXXXX 100
           +EP R+ I  D+ EN  +    +D S S                    RPP+        
Sbjct: 478 VEPFRNEI--DYHENMGIDPPQSDSSTSTGKHHDESPGKVPLVQPVPGRPPL-----AAR 530

Query: 101 XXXXXAKHIERSGTPYSDYTGLCSRTDLA--KPELRHKNTSSYDLLAPVPRPVYEYSNEI 158
                +   ERSGTPYSDYTG+ SR + A  K  L H+  SS DL+  +    YEYSNEI
Sbjct: 531 HTSSYSNKQERSGTPYSDYTGV-SRCNSAVRKSPLIHQTLSSIDLVTALQPKKYEYSNEI 589

Query: 159 PELFKA-NFEGSSTPPPYQESVPSQNPVK--NQPSFLHRVQDCNQDVLFADLQKNGEIDS 215
           PELFKA N  G S    +    P        +QPSFL  V DCNQD LF  LQ+ G +D+
Sbjct: 590 PELFKAGNVLGQSDENQFPTPPPPPMNPPSYDQPSFLENVVDCNQDNLFVSLQQGGLLDA 649

Query: 216 QAAEEAFLQQYPTPDLPVYLDSSFLNAVFRGFQEKND---TKSKLNHIVPHVNLNHLLTS 272
           + AE+ FL++Y  PDLPVYL+S++LN +F  FQ+ N      S LNHI+PHVNLNHLLTS
Sbjct: 650 ETAEQLFLEKYTVPDLPVYLNSTYLNKIFNEFQKHNSLGSNSSGLNHIIPHVNLNHLLTS 709

Query: 273 SIRDEIISVGCTTRYEGKFITQIIYTPCYYGNKEKS 308
           SIRDE+ISVGCTTRYEGKFITQ++Y PCYY +  K+
Sbjct: 710 SIRDEMISVGCTTRYEGKFITQVVYAPCYYASGPKA 745

>Ecym_4065 Chr4 (144003..146168) [2166 bp, 721 aa] {ON} similar to
           Ashbya gossypii ADR194C
          Length = 721

 Score =  289 bits (739), Expect = 9e-92,   Method: Compositional matrix adjust.
 Identities = 152/323 (47%), Positives = 200/323 (61%), Gaps = 20/323 (6%)

Query: 1   MVFDMESNCWIAPDLYLPAGVYKFQFLINGELRHSEFLPTATDSFGNCVNWFEVVAGHKV 60
           MV+  +  CW A DL LPAG+YK  F ING++RHS +LPTATDS  N VNWFEVV G+  
Sbjct: 402 MVYLEQEQCWAAEDLKLPAGIYKLMFFINGQVRHSNYLPTATDSLSNIVNWFEVVPGYDQ 461

Query: 61  IEPSRDVISND-------FTENQVAISANDPS-ASPRPPILXXXXXXXXXXXXAKHIERS 112
           IEP RD            + E  + ++   PS A+ RPP++            A+ IER+
Sbjct: 462 IEPYRDAAIERSPNELAAYNETSLLLTNETPSPANIRPPLINRGTSSSSR---ARVIERT 518

Query: 113 GTPYSDYTGLCSRTDLAKPEL-RHKNTSSYDLLAPVPRPVYEYSNEIPELFKANFEGSST 171
            TP SDYTG+ +R   + P + RHK+ +S D+     +P   YS+++PELFK     +  
Sbjct: 519 NTPISDYTGVLARNSCSNPAIYRHKSNNSTDVDILPKQPTLIYSSDVPELFKVGNASTGG 578

Query: 172 PPPYQESVPSQNPVK---NQPSFLHRVQDCNQDVLFADLQKNGEIDSQAAEEAFLQQYPT 228
                +    QNP K   + P+F+  VQDCNQD LF  LQ+   +++Q AEE FL++Y  
Sbjct: 579 SQQGSDKNKLQNPSKYLQDSPNFMKNVQDCNQDELFHYLQEKWNMNAQEAEEVFLEKYSV 638

Query: 229 PDLPVYLDSSFLNAVFRGFQEKNDT-----KSKLNHIVPHVNLNHLLTSSIRDEIISVGC 283
           PDLP+YL+S+ LN +F   Q+ +       +  L HI+PHVNLNHLLTS+IRDEIISVGC
Sbjct: 639 PDLPIYLNSTSLNEIFNKLQQNSAMGDLPKRKSLTHIIPHVNLNHLLTSNIRDEIISVGC 698

Query: 284 TTRYEGKFITQIIYTPCYYGNKE 306
           TTRYEGKFITQI+Y PCYY N E
Sbjct: 699 TTRYEGKFITQIMYAPCYYENYE 721

>Suva_2.599 Chr2 complement(1068063..1070546) [2484 bp, 827 aa] {ON}
           YDR422C (REAL)
          Length = 827

 Score =  291 bits (744), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 160/316 (50%), Positives = 198/316 (62%), Gaps = 19/316 (6%)

Query: 1   MVFDMESNCWIAPDLYLPAGVYKFQFLINGELRHSEFLPTATDSFGNCVNWFEVVAGHKV 60
           M++D     W  P+L+LP G+Y+ QF ING L HS FLPTATDS G  VNWFEV+ G+  
Sbjct: 522 MIYDAVHKEWFVPELFLPPGIYRLQFSINGILTHSNFLPTATDSEGKFVNWFEVLPGYHT 581

Query: 61  IEPSRDVISNDFTENQVAISANDPSASPRP-PILXXXXXXXXXXXXAKHIERSGTPYSDY 119
           IEP RD      TE+QV  S  D  A  RP P              AK +ER  TP+SDY
Sbjct: 582 IEPFRDEAD---TESQVG-STIDVEAPIRPEPKRLSSSSRKSSYYSAKGVERPSTPFSDY 637

Query: 120 TGLCSRTDLA--KPELRHKNTSSYDLLAPVPRPVYEYSNEIPELFKANFEGSSTPPPYQE 177
            GL SR++ A  +        SS DL+A +   + EYSNEIP LF     G+ +  P QE
Sbjct: 638 RGL-SRSNSANLRDSFVRLKASSLDLMAQIKPEILEYSNEIPSLFTI---GNGSATPIQE 693

Query: 178 SVPSQNPVKNQPSFLHRVQDCNQDVLFADLQKNGEIDSQAAEEAFLQQYPTPDLPVYLDS 237
            +PSQ+     PSF H+V DCNQD LFA LQ+ G ID++ AE  FL +YP PDLP+YL+S
Sbjct: 694 DLPSQD----LPSFTHKVVDCNQDDLFATLQQGGNIDAETAEIVFLSRYPIPDLPIYLNS 749

Query: 238 SFLNAVFRGFQEKNDTKSK----LNHIVPHVNLNHLLTSSIRDEIISVGCTTRYEGKFIT 293
           S+LN +       +++  K    +NHI+PHVNLNHLLTSSIRDEIISV CTTRYEGKFIT
Sbjct: 750 SYLNKILNQGNPNSESGDKDEGAINHIIPHVNLNHLLTSSIRDEIISVACTTRYEGKFIT 809

Query: 294 QIIYTPCYYGNKEKSG 309
           Q+IY PCYY  ++  G
Sbjct: 810 QVIYAPCYYKTQKAHG 825

>Skud_4.696 Chr4 complement(1236293..1238728) [2436 bp, 811 aa] {ON}
           YDR422C (REAL)
          Length = 811

 Score =  287 bits (735), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 154/314 (49%), Positives = 189/314 (60%), Gaps = 13/314 (4%)

Query: 1   MVFDMESNCWIAPDLYLPAGVYKFQFLINGELRHSEFLPTATDSFGNCVNWFEVVAGHKV 60
           M++D     W  PDL+LPAG+Y+ QF ING L HS FLPTATDS GN VNWFEV+ G+  
Sbjct: 504 MIYDSVHREWFVPDLFLPAGIYRLQFSINGLLTHSNFLPTATDSEGNFVNWFEVLPGYHT 563

Query: 61  IEPSRDVISNDFTENQVAISANDPSASPRPPILXXXXXXXXXXXXAKHIERSGTPYSDYT 120
           IEP RD    DF       S  D  A  RP               AK  ER GTP+SDY 
Sbjct: 564 IEPFRDEADMDFQMR----STLDEEAPIRPEPKRLSSSRKSSYYSAKDGERPGTPFSDYR 619

Query: 121 GLC-SRTDLAKPELRHKNTSSYDLLAPVPRPVYEYSNEIPELFKANFEGSSTPPPYQESV 179
           GL  S +   +        SS DL+A +     EYSNEIP LF      ++T   + E +
Sbjct: 620 GLSRSNSVFLRGSFVRLKASSLDLMAEIKPEKLEYSNEIPNLFNIGEASTTTSKDHFERL 679

Query: 180 PSQNPVKNQPSFLHRVQDCNQDVLFADLQKNGEIDSQAAEEAFLQQYPTPDLPVYLDSSF 239
             Q+    +PSF H+V DCNQD LFA LQ+ G ID++ AE  FL +YP PDLP+YL+SS+
Sbjct: 680 SPQD----RPSFTHKVVDCNQDDLFATLQQGGNIDAETAEAVFLSRYPIPDLPIYLNSSY 735

Query: 240 LNAVFRGFQEKND----TKSKLNHIVPHVNLNHLLTSSIRDEIISVGCTTRYEGKFITQI 295
           LN +       ++     +  +NHI+PHVNLNHLLTSSIRDEIISV CTTRYEGKFITQ+
Sbjct: 736 LNRILNQSNPNSEFHDGDEGGINHIIPHVNLNHLLTSSIRDEIISVACTTRYEGKFITQV 795

Query: 296 IYTPCYYGNKEKSG 309
           IY PCYY  ++  G
Sbjct: 796 IYAPCYYKTQKAGG 809

>ZYRO0D12562g Chr4 complement(1061702..1064158) [2457 bp, 818 aa]
           {ON} some similarities with uniprot|P32578 Saccharomyces
           cerevisiae YDR422C SIP1 Alternate beta-subunit of the
           Snf1p kinase complex may confer substrate specificity
           vacuolar protein containing KIS (Kinase-Interacting
           Sequence) and ASC (Association with Snf1 kinase Complex)
           domains involved in protein interactions
          Length = 818

 Score =  279 bits (714), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 156/343 (45%), Positives = 198/343 (57%), Gaps = 51/343 (14%)

Query: 1   MVFDMESNCWIAPDLYLPAGVYKFQFLINGELRHSEFLPTATDSFGNCVNWFEVVAGHKV 60
           M ++ E+  W+ PDL LP GVY+ QFLINGEL HS +LPTATDS GN VNWFEV+ G++ 
Sbjct: 483 MRYEEETKEWVVPDLVLPVGVYRLQFLINGELTHSNYLPTATDSVGNFVNWFEVIPGYEK 542

Query: 61  IEPSRDVIS----------------------NDFTENQVAISANDPSASPRPPILXXXXX 98
           +EP RD +                       N  +E  V +       + RPP+      
Sbjct: 543 VEPYRDEVELDSGQPLNAGNNGIAGSVLSLENQGSEGTVLMEPVPGKVNVRPPL------ 596

Query: 99  XXXXXXXAKHIERSGTPYSDYTGLCSRTDLAKPELRHKNTSSYDLLAPVPRPVYEYSNEI 158
                  +  + RS TPYSDYTG+   +   +    +  TSS DL   +    Y+YSNEI
Sbjct: 597 -ASMHHSSNRVIRSNTPYSDYTGISRSSSALRKSPINCTTSSLDLHTALQPKKYKYSNEI 655

Query: 159 PELFK------ANFE------GSSTPPPYQ--ESVPSQNPVKNQPSFLHRVQDCNQDVLF 204
           PELFK      AN E      G   PP Y      PS N       F ++V DCNQD LF
Sbjct: 656 PELFKTAPITKANDENEDFTFGHMEPPTYDWARGHPSSNA-----GFGNQVVDCNQDELF 710

Query: 205 ADLQKNGEIDSQAAEEAFLQQYPTPDLPVYLDSSFLNAVFRGFQEKN---DTKSKLNHIV 261
            +LQ+ G +D++ AE+ FL++YP PDLP+YL+S +LN +   FQ+ N        +NHI+
Sbjct: 711 TELQQGGLLDAETAEQLFLEKYPVPDLPIYLNSYYLNRIISEFQKNNYPGGGSGGINHII 770

Query: 262 PHVNLNHLLTSSIRDEIISVGCTTRYEGKFITQIIYTPCYYGN 304
           PHVNLNHLLTSSIRDE+ISVGCTTRYEGKFITQ+IY PCYY N
Sbjct: 771 PHVNLNHLLTSSIRDEMISVGCTTRYEGKFITQVIYAPCYYEN 813

>YDR422C Chr4 complement(1315326..1317773) [2448 bp, 815 aa] {ON}
           SIP1Alternate beta-subunit of the Snf1p kinase complex,
           may confer substrate specificity; vacuolar protein
           containing KIS (Kinase-Interacting Sequence) and ASC
           (Association with Snf1 kinase Complex) domains involved
           in protein interactions
          Length = 815

 Score =  274 bits (701), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 153/314 (48%), Positives = 193/314 (61%), Gaps = 18/314 (5%)

Query: 1   MVFDMESNCWIAPDLYLPAGVYKFQFLINGELRHSEFLPTATDSFGNCVNWFEVVAGHKV 60
           MV+D     W  PDL+LPAG+Y+ QF ING L HS FLPTATDS GN VNWFEV+ G+  
Sbjct: 507 MVYDDVHKEWFVPDLFLPAGIYRLQFSINGILTHSNFLPTATDSEGNFVNWFEVLPGYHT 566

Query: 61  IEPSRDVISNDFTENQVAISANDPSASPRPPILXX--XXXXXXXXXXAKHIERSGTPYSD 118
           IEP R+    D   +QV  + ++    P+ P L              AK +ER  TP+SD
Sbjct: 567 IEPFRNEADID---SQVEPTLDE--ELPKRPELKRFPSSSRKSSYYSAKGVERPSTPFSD 621

Query: 119 YTGLC--SRTDLAKPELRHKNTSSYDLLAPVPRPVYEYSNEIPELFKANFEGSSTPPPYQ 176
           Y GL   S  ++    +R K  SS DL+A V      YSNEIP LF      + +     
Sbjct: 622 YRGLSRSSSINMRDSFVRLK-ASSLDLMAEVKPERLVYSNEIPNLFNIGDGSTISVKGDS 680

Query: 177 ESVPSQNPVKNQPSFLHRVQDCNQDVLFADLQKNGEIDSQAAEEAFLQQYPTPDLPVYLD 236
           + V  Q P    PSF HRV DCNQD LFA LQ+ G ID++ AE  FL +YP PDLP+YL+
Sbjct: 681 DDVHPQEP----PSFTHRVVDCNQDDLFATLQQGGNIDAETAEAVFLSRYPVPDLPIYLN 736

Query: 237 SSFLNAVFRGFQEKNDTKSK----LNHIVPHVNLNHLLTSSIRDEIISVGCTTRYEGKFI 292
           SS+LN +     + +++  +    +NHI+PHVNLNHLLTSSIRDEIISV CTTRYEGKFI
Sbjct: 737 SSYLNRILNQSNQNSESHERDEGAINHIIPHVNLNHLLTSSIRDEIISVACTTRYEGKFI 796

Query: 293 TQIIYTPCYYGNKE 306
           TQ++Y PCYY  ++
Sbjct: 797 TQVVYAPCYYKTQK 810

>Smik_4.697 Chr4 complement(1236081..1238534) [2454 bp, 817 aa] {ON}
           YDR422C (REAL)
          Length = 817

 Score =  269 bits (687), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 152/321 (47%), Positives = 190/321 (59%), Gaps = 26/321 (8%)

Query: 1   MVFDMESNCWIAPDLYLPAGVYKFQFLINGELRHSEFLPTATDSFGNCVNWFEVVAGHKV 60
           MV+D     W  PDL+LP G+Y+ QF ING L HS +LPTATDS GN VNWFEV+ G+  
Sbjct: 507 MVYDNVHKEWFFPDLFLPPGIYRLQFSINGLLTHSNYLPTATDSEGNFVNWFEVLPGYHT 566

Query: 61  IEPSRDVISNDFTENQVAISAN-DPSASPRPPI-----LXXXXXXXXXXXXAKHIERSGT 114
           IEP R         N+  + +  +P      PI                  AK +ER  T
Sbjct: 567 IEPFR---------NEADLGSQVEPVLEEESPIRPELKRFSSSSRKSSYYSAKGVERPST 617

Query: 115 PYSDYTGLC--SRTDLAKPELRHKNTSSYDLLAPVPRPVYEYSNEIPELFKANFEGSSTP 172
           P+SDY GL   S  ++    +R K  SS DL+A +     EYSNEIP LF  N     T 
Sbjct: 618 PFSDYRGLSRSSSVNMRDSFVRLK-ASSLDLMAEIKPEKLEYSNEIPNLF--NIADGGTT 674

Query: 173 PPYQESVPSQNPVKNQPSFLHRVQDCNQDVLFADLQKNGEIDSQAAEEAFLQQYPTPDLP 232
              +ES  S    + QPSF ++V DCNQD LFA LQ+ G ID++ AE  FL +YP PDLP
Sbjct: 675 SVIRESRDSS--PQEQPSFTYKVVDCNQDDLFATLQQGGNIDAETAETVFLSRYPIPDLP 732

Query: 233 VYLDSSFLNAVFR----GFQEKNDTKSKLNHIVPHVNLNHLLTSSIRDEIISVGCTTRYE 288
           +YL+SS+LN +        +  +  +  +NHI+PHVNLNHLLTSSIRDEIISV CTTRYE
Sbjct: 733 IYLNSSYLNKILNQSNPNSEPHDRDEGAINHIIPHVNLNHLLTSSIRDEIISVACTTRYE 792

Query: 289 GKFITQIIYTPCYYGNKEKSG 309
           GKFITQ+IY PCYY  ++  G
Sbjct: 793 GKFITQVIYAPCYYKTQKARG 813

>NCAS0F01090 Chr6 complement(215542..217905) [2364 bp, 787 aa] {ON}
           Anc_5.527 YDR422C
          Length = 787

 Score =  268 bits (684), Expect = 4e-83,   Method: Compositional matrix adjust.
 Identities = 155/338 (45%), Positives = 197/338 (58%), Gaps = 55/338 (16%)

Query: 1   MVFDMESNCWIAPDLYLPAGVYKFQFLINGELRHSEFLPTATDSFGNCVNWFEVVAGHKV 60
           M+F+     W  P+L LP G+Y+ +F ING+L HS FLPTATDS GN VNWFEV+ G+  
Sbjct: 469 MLFNPMIKEWYVPNLLLPPGIYRLKFSINGDLTHSNFLPTATDSMGNIVNWFEVLPGYDT 528

Query: 61  IEPSRD-VISNDFTEN--QVAISANDPSASPRPPILXXXXXXXXXXXXAKHIERSGTPYS 117
           +EP RD +I   F  N  Q  +  N+P+                    A     S TPYS
Sbjct: 529 VEPYRDEIIETTFHTNGSQGTLRDNNPTT--------IRSRRSSSFVSANGDLASMTPYS 580

Query: 118 DYTGLCSRTDLAKPELRHKNTS--------SYDLLAPVPRPVYEYSNEIPELFKAN---- 165
           DYTG+ SR++ A   L  K TS          DL  P+     EYSNEIPELFK +    
Sbjct: 581 DYTGI-SRSNSA---LNSKRTSLVSLRGVGKLDLFTPMEPKKIEYSNEIPELFKISNSIE 636

Query: 166 --------FEGSSTPPPYQESVPSQNPVKNQPSFLHRVQDCNQDVLFADLQKNGEIDSQA 217
                   +  + T  P++E           PSF +RV DCNQD LF+DLQKNG ID++ 
Sbjct: 637 DEDDDEGDYGHNETLSPFEE-----------PSFTNRVVDCNQDKLFSDLQKNGNIDAET 685

Query: 218 AEEAFLQQYPTPDLPVYLDSSFLNAVFRGFQEKND---------TKSKLNHIVPHVNLNH 268
           AE  FL +Y  PDLP+YL+SS+LN +F  FQ++++         +   + HI+PHVNLNH
Sbjct: 686 AEMLFLNKYQVPDLPIYLNSSYLNKIFLQFQKQHNDPTPSANTASTIGITHIIPHVNLNH 745

Query: 269 LLTSSIRDEIISVGCTTRYEGKFITQIIYTPCYYGNKE 306
           LLTSSIRDEIISV CTTRY+GKFITQ++Y PC YGN E
Sbjct: 746 LLTSSIRDEIISVACTTRYQGKFITQVMYAPCNYGNPE 783

>CAGL0F03047g Chr6 complement(298906..301140) [2235 bp, 744 aa] {ON}
           similar to uniprot|P32578 Saccharomyces cerevisiae
           YDR422c SIP1 multicopy suppressor of SNF1
          Length = 744

 Score =  261 bits (668), Expect = 4e-81,   Method: Compositional matrix adjust.
 Identities = 151/339 (44%), Positives = 196/339 (57%), Gaps = 48/339 (14%)

Query: 1   MVFDMESNCWIAPDLYLPAGVYKFQFLINGELRHSEFLPTATDSFGNCVNWFEVVAGHKV 60
           + +D  +N W  PDLYLP G+Y+ QFL+NG L HS+FLPTATD  GN +NWFEV+ G+  
Sbjct: 406 LSYDSHNNEWYVPDLYLPQGIYRLQFLVNGNLVHSDFLPTATDDQGNIMNWFEVLRGYDR 465

Query: 61  IEPSRDV--ISNDFTE-----------NQVAISANDPSASPR-----------PPILXXX 96
           IEP RD   I +D+T            N    S+++ + S R           P      
Sbjct: 466 IEPYRDESEIQSDYTSSVDTTLEGMENNGFQGSSDNSTTSMRNNNPVALNLQAPAPSKAQ 525

Query: 97  XXXXXXXXXAKHIERSGTPYSDYTGLCSRTDL---AKPELRHKNTSSYDL--LAPVPRPV 151
                    AK  E+S T +SDYTG+ SRT+    A   + + NT   DL    P+   V
Sbjct: 526 ASRNSSYYSAKSFEKSITQFSDYTGV-SRTNSMVSAVSPINNANTRDNDLEFFPPIKPKV 584

Query: 152 YEYSNEIPELFKANFEGSSTPPPYQESVPSQNPVKN-------QPSFLHRVQDCNQDVLF 204
           YEYSN IP LF+ + +         E V   N  +N       +PSF +RV DCNQD LF
Sbjct: 585 YEYSNNIPALFRISCD--------MEDVDDDNGTENNPRAFYDRPSFTNRVVDCNQDALF 636

Query: 205 ADLQKNGEIDSQAAEEAFLQQYPTPDLPVYLDSSFLNAVFRGFQE---KNDTKSKLNHIV 261
            DLQK G++D++ AE  FL++Y  PDLPVYL+S++LN +F  F +    +   S +NHI+
Sbjct: 637 GDLQKGGKMDAEEAENLFLKKYQVPDLPVYLNSTYLNKIFHEFHQVAGPSTQDSSINHII 696

Query: 262 PHVNLNHLLTSSIRDEIISVGCTTRYEGKFITQIIYTPC 300
           PHVNL HLLTSSIRD I+SV CTTRY GKFITQ+IY PC
Sbjct: 697 PHVNLKHLLTSSIRDGIVSVACTTRYAGKFITQVIYAPC 735

>NDAI0H01600 Chr8 complement(387297..389825) [2529 bp, 842 aa] {ON}
           Anc_5.527 YDR422C
          Length = 842

 Score =  261 bits (666), Expect = 4e-80,   Method: Compositional matrix adjust.
 Identities = 144/323 (44%), Positives = 193/323 (59%), Gaps = 29/323 (8%)

Query: 1   MVFDMESNCWIAPDLYLPAGVYKFQFLINGELRHSEFLPTATDSFGNCVNWFEVVAGHKV 60
           MVF+     W  P+L LP G+Y+ +F IN ++ HS FLPTATDS GN VNWFEV+ G+  
Sbjct: 527 MVFNPMIKEWYMPNLTLPPGIYRLKFSINNDITHSNFLPTATDSMGNIVNWFEVLPGYDA 586

Query: 61  IEPSRD-VISNDF--TENQVAISANDPSASPRPPILXXXXXXXXXXXXAKHIERSGTPYS 117
           +EP RD +I   F    +Q  +S +D        +             AK    S TPYS
Sbjct: 587 VEPYRDEIIETTFHTAPSQGTLSVHD--------LTMIRSRRSSSFVSAKSDLSSFTPYS 638

Query: 118 DYTGLCSRTDLAKPELRH------KNTSSYDLLAPVPRPVYEYSNEIPELFK-ANFEGSS 170
           DY G+   +       +       + T+  DL  P+      YS EIPELFK AN E ++
Sbjct: 639 DYAGISRSSSSVGTATKKASLVSLRGTNKLDLFTPIEPKKIAYSKEIPELFKIANSEDTN 698

Query: 171 TPPPYQESVPSQNPVKNQPSFLHRVQDCNQDVLFADLQKNGEIDSQAAEEAFLQQYPTPD 230
                +      +P + +PSF H+V DCNQD LFADLQ++G ID++ AE  FL +YP PD
Sbjct: 699 ---KMEIDDDGSSPFE-RPSFTHKVIDCNQDKLFADLQRDGNIDAETAEALFLNRYPIPD 754

Query: 231 LPVYLDSSFLNAVFRGFQEKND-------TKSKLNHIVPHVNLNHLLTSSIRDEIISVGC 283
           LP+YL+S++LN +F  FQ++++       +   L HI+PHVNLNHLLTSSIRDEIISV C
Sbjct: 755 LPIYLNSTYLNKIFTQFQKQHNDPTLPASSSIGLTHIIPHVNLNHLLTSSIRDEIISVAC 814

Query: 284 TTRYEGKFITQIIYTPCYYGNKE 306
           TTRY+GKFITQ++Y PC Y ++E
Sbjct: 815 TTRYQGKFITQVMYAPCNYSSQE 837

>TBLA0D01650 Chr4 (406397..409447) [3051 bp, 1016 aa] {ON} Anc_5.527
            YDR422C
          Length = 1016

 Score =  251 bits (641), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 132/317 (41%), Positives = 190/317 (59%), Gaps = 23/317 (7%)

Query: 1    MVFDMESNCWIAPDLYLPAGVYKFQFLINGELRHSEFLPTATDSFGNCVNWFEVVAGHKV 60
            +V++ +   WI P+L LP G+Y+ QFL+N +L+HS+FLPTATD FGN VNWFEV++G+  
Sbjct: 709  LVYNKDEKAWILPNLMLPPGIYQVQFLVNSDLKHSDFLPTATDDFGNIVNWFEVLSGYDF 768

Query: 61   IEPSRDVISNDFTENQVAISANDPSASPRPPILXXXXXXXXXXXXAKHIERSGTPYSDYT 120
            IEP RD         +   SA++   +    I+            A +  +  TP S+YT
Sbjct: 769  IEPFRD---------ENISSADNSDGTLMQNIIPEKLKTISMTKMAGNGSKGSTPRSNYT 819

Query: 121  GLCSRTDLAKPELRHKNTS-SYDLLAPVPRPVYEYSNEIPELFKANFEGSSTPPPYQESV 179
            G+     L+         S + +L  P+     EYS EIPE+FK   E +++  P Q   
Sbjct: 820  GVSRSNSLSASSSSSVWKSVNVNLFTPLEPNKVEYSTEIPEIFKNTTENNTSNAPMQ--- 876

Query: 180  PSQNPVKNQPSFLHRVQDCNQDVLFADLQKNGEIDSQAAEEAFLQQYPTPDLPVYLDSSF 239
               +P + +P  LH V DC+Q+ LF DL  +G +D++ AE+ FL +YP P+LP+YL+S +
Sbjct: 877  --YHPERKRPGLLHNVVDCSQEELFGDLLADGLMDTETAEQMFLDKYPVPELPIYLNSKY 934

Query: 240  LNAVFRGFQEKNDT-------KSKLNHIVPHVNLNHLLTSSIRDEIISVGCTTRYEGKFI 292
            +  +     + + +        + LNHI+PHVNL HLLTSSIR+E+ISV CTTRYEGKF+
Sbjct: 935  MTQIVGEINQPSGSGPPSSLNNNDLNHIIPHVNLQHLLTSSIREEMISVACTTRYEGKFL 994

Query: 293  TQIIYTPCYYGNKEKSG 309
            TQI+YTPC+Y N  KSG
Sbjct: 995  TQILYTPCFYENL-KSG 1010

>KNAG0C03230 Chr3 (632659..634344) [1686 bp, 561 aa] {ON} Anc_5.527
           YDR422C
          Length = 561

 Score =  214 bits (545), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 127/328 (38%), Positives = 175/328 (53%), Gaps = 65/328 (19%)

Query: 3   FDMESNCWIAPDLYLPAGVYKFQFLINGELRHSEFLPTATDSFGNCVNWFEVVAGHKVIE 62
           +D +   W  PDLYLP G+Y+ +FLING L HS FLPTATD+ G  VNWFEV+ G++ IE
Sbjct: 268 YDAKKKDWFVPDLYLPPGIYRLKFLINGMLLHSNFLPTATDAAGTIVNWFEVLPGYETIE 327

Query: 63  PSRDVISNDFTENQVAISANDPSASPRPPILXXXXXXXXXXXXAKHIERSGTPYSDYTGL 122
           P RD         +  I  +D S   +P                    +S T  +DY G+
Sbjct: 328 PYRD---------ESMIGQDDESIDSQP-------------------YKSTTDVTDYAGI 359

Query: 123 ---------CSRTDLAKPEL--------------RHKNTSSYDLLAPVPRPVYEYSNEIP 159
                     S+++L  P L                  T+  + +  +P P YEYS EIP
Sbjct: 360 SRSSSVVSKHSKSNLRLPNLHITSLNKESSASVNEANETNEGNDIQLLPEPKYEYSTEIP 419

Query: 160 ELFKANFEGSSTPPPYQE-----SVPSQNPVKNQPSFLHRVQDCNQDVLFADLQKNGEID 214
           ELF+ +   +      +E      + +  P       L RV + NQD LFA +QK G++ 
Sbjct: 420 ELFQFDDVNTRKTNDIKEVRKESKLETLYPNGKFDFTLARVVNSNQDALFASIQKIGKMT 479

Query: 215 SQAAEEAFLQQYPTPDLPVYLDSSFLNAVFRGFQEKNDTKSKLNHIVPHVNLNHLLTSSI 274
           ++ AEE FL ++   DLP+YL+S++LN  F G         ++NHI+PHVNL HLLT+SI
Sbjct: 480 TEEAEEYFLTKFKVSDLPIYLNSTYLNKNFSG---------EVNHIIPHVNLRHLLTTSI 530

Query: 275 RDEIISVGCTTRYEGKFITQIIYTPCYY 302
           +++II VGCTTRY GKFITQ+IY PC Y
Sbjct: 531 KEDIICVGCTTRYAGKFITQVIYAPCSY 558

>Kpol_1004.21 s1004 complement(41725..43992) [2268 bp, 755 aa] {ON}
           complement(41725..43992) [2268 nt, 756 aa]
          Length = 755

 Score =  203 bits (516), Expect = 4e-59,   Method: Compositional matrix adjust.
 Identities = 124/336 (36%), Positives = 183/336 (54%), Gaps = 48/336 (14%)

Query: 1   MVFDMESNCWIAPDLYLPAGVYKFQFLINGELRHSEFLPTATDSFGNCVNWFEVVAGHKV 60
           MV+  +++ W+   L+LP G+YK QF +NG LRHS++LPTATD+ GN VNWFEV  G++ 
Sbjct: 438 MVYYPDTSEWVTKYLFLPPGIYKLQFNVNGSLRHSDYLPTATDNLGNIVNWFEVPRGYES 497

Query: 61  IEPSRDVISNDFTENQVAISANDPSASPRPPILXXXXXXXXXXXXAKHIERSGTPYSDYT 120
           IEP RD   ND+ +N+++         P P  L            + H  R  TPYSD+ 
Sbjct: 498 IEPFRD---NDYVKNEISGGI----LQPIPNTLGIPSVSSQLSSFSFHASRPTTPYSDFA 550

Query: 121 GLCSRTDLAKPELRHKN----TSSYDL--LAPVPRPVYEYSNEIPELFKA---------- 164
           G+   + L    LR K+    ++++DL     VP P Y+Y+ EIPE++KA          
Sbjct: 551 GINRSSPLP---LREKSPDVKSTNFDLEFSTAVPEPKYDYTTEIPEIYKAVDLDLTTAKA 607

Query: 165 -----NFEGSSTPPPYQESVPSQNPVKNQPSFLHRVQDCNQDVLFADLQKN--GEIDSQA 217
                + E  + PP Y  +  +        S  + V  C+Q  LF  L KN    +++  
Sbjct: 608 TETTTDDEDITKPPLYLGTGGN--------SIFNDVIGCSQRDLFEKLSKNTGKGLNTDE 659

Query: 218 AEEAFLQQYPTPDLPVYLDSSFLNAVF---RGFQEKNDTKSK----LNHIVPHVNLNHLL 270
            E+ FL +YP  DLP+YL++ ++N      R     +D   +    +NHIVPHVN+ HLL
Sbjct: 660 LEKIFLAKYPITDLPIYLNTDYMNKALEQHRNIVGVDDVMQEEINVVNHIVPHVNIKHLL 719

Query: 271 TSSIRDEIISVGCTTRYEGKFITQIIYTPCYYGNKE 306
           T +I+D +I+V CT RY GKFITQ++Y+PC   N +
Sbjct: 720 THNIQDSVIAVACTVRYGGKFITQVVYSPCSVENDD 755

>KAFR0E03300 Chr5 (654349..655749) [1401 bp, 466 aa] {ON} Anc_5.527
           YDR422C
          Length = 466

 Score =  189 bits (481), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 114/305 (37%), Positives = 165/305 (54%), Gaps = 54/305 (17%)

Query: 1   MVFDMESNCWIAPDLYLPAGVYKFQFLINGELRHSEFLPTATDSFGNCVNWFEVVAGHKV 60
           +++D+ +N W  P+L+LP G+YK QFLING L HS +LPTAT++ GN VNWFEV+ G+K 
Sbjct: 205 LLYDIVTNEWYLPNLFLPPGIYKLQFLINGNLIHSNYLPTATNANGNIVNWFEVICGYKT 264

Query: 61  IEPSRD---VISNDFTENQVAISANDPSASPRPPILXXXXXXXXXXXXAKHIERSGTPYS 117
           IEP RD   +I  + +    +IS+N                                  +
Sbjct: 265 IEPYRDEERIIHREKSTANESISSN--------------------------------SLT 292

Query: 118 DYTGLCSRTDLAKPELRHKNTSSYDLLAPVPRPVYEYSNEIPELFKANFEGSSTPPPYQE 177
           DY G+   + +   +    ++S       +     +Y+NEIPE+FK +   +S       
Sbjct: 293 DYAGISRSSSIVSNKSSLISSSLKLTNLNLNDDEIKYTNEIPEIFKFDSTANSN------ 346

Query: 178 SVPSQNPVKNQP--SFLHRVQDCNQDVLFADLQKNGEIDSQAAEEAFLQQYPTPDLPVYL 235
                  V NQ     L +V D NQD +FA LQK   +++  AE  FL ++   DLP+YL
Sbjct: 347 -------VNNQAFDMSLSKVIDLNQDHVFASLQKIARMNTDEAENYFLNRFKIHDLPIYL 399

Query: 236 DSSFLNAVFRGFQEKNDTKSKLNHIVPHVNLNHLLTSSIRDEIISVGCTTRYEGKFITQI 295
           +S+FLN +F     +++     N+ VPHVNLNHLLT+SI+D+ + V CTTRY GKFITQI
Sbjct: 400 NSNFLNKIFI----RDNNNETTNNTVPHVNLNHLLTTSIKDDTLCVACTTRYVGKFITQI 455

Query: 296 IYTPC 300
           +Y P 
Sbjct: 456 MYAPS 460

>Kpol_1023.98 s1023 (229891..231894) [2004 bp, 667 aa] {ON}
           (229891..231894) [2004 nt, 668 aa]
          Length = 667

 Score =  172 bits (435), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 110/332 (33%), Positives = 165/332 (49%), Gaps = 52/332 (15%)

Query: 1   MVFDMESNCWIAPDLYLPAGVYKFQFLING-ELRHSEFLPTATDSFGNCVNWFEVVAGHK 59
           M +D   N W+ PDL+LP G Y+ +FLI+  + R+S +LP   D  G  +N  E++ G+K
Sbjct: 355 MTYDKNENNWVLPDLFLPPGKYRLRFLIDHHDFRYSNYLPVTEDELGTIINEIEILPGYK 414

Query: 60  VIEP---------SRDVISNDFTENQVAISANDPSASPRPPILXXXXXXXXXXXXAKHIE 110
            +EP           ++I+++ + N      ++P   P  P L            ++  E
Sbjct: 415 SVEPFEHNNHIMIQENIINSELSLNNSRQLQSEP---PSYPELEENFSSPIESIISED-E 470

Query: 111 RSGTPYSDYTGL------CSRTDLAKPELRHKNTSSYDLLAPVPRPVYEYSNEIPELFKA 164
                YS   G        S+T L+              + P    V  Y+NEIP+LFK 
Sbjct: 471 LDNDQYSKVYGKRNNSIGQSKTSLS--------------IKPCISEV-TYTNEIPQLFKI 515

Query: 165 NFEGSSTPPPYQESVPSQNPVKNQPSFLHRVQDCNQDVLFADLQKNGEIDSQAAEEAFLQ 224
                     Y+     + P   +P   +RV DCNQD+LFA  Q+NG +D + AE+ FL+
Sbjct: 516 TDNNCIVNENYERYGFVEPPSYGEPGLENRVIDCNQDILFATFQQNGAVDVELAEQLFLE 575

Query: 225 QYPTPDLPVYLDSSFLNAVFRGFQEKNDTKSKLNHI-------------VPHVNLNHLLT 271
           +YP PDLPV+LDS F   +F    + ND+   LN +             +PHVNLNH+LT
Sbjct: 576 KYPVPDLPVFLDSHFSEKLF----DNNDSSKNLNDMNGEDIQIKNNGQDIPHVNLNHVLT 631

Query: 272 SSIRDEIISVGCTTRYEGKFITQIIYTPCYYG 303
           + I + +ISV CTTRY+ KF+T I+Y+P  + 
Sbjct: 632 NKISNGMISVACTTRYKRKFVTHILYSPSTHS 663

>TPHA0K00530 Chr11 (105141..107081) [1941 bp, 646 aa] {ON} Anc_5.527
           YDR422C
          Length = 646

 Score =  129 bits (323), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 96/318 (30%), Positives = 144/318 (45%), Gaps = 49/318 (15%)

Query: 1   MVFDMESNCWIAPDLYLPAGVYKFQFLIN-GELRHSEFLPTATDSFGNCVNWFEVVAGHK 59
           + +D  ++ W   DL+LPAG Y+F FLIN  ++ HS  + T  D FG  VN+FEV    +
Sbjct: 357 LKYDSLTHEWKISDLFLPAGYYEFSFLINETDVHHSLHICTKMDRFGKRVNYFEVPKYVR 416

Query: 60  VIEPSRDVISNDFTENQVAISANDPSASPRPPILXXXXXXXXXXXXAKHIERSGTPYSDY 119
             EP +                           L             +HIE S T  S++
Sbjct: 417 TFEPLQ---------------------------LSSALYTVTQADDRRHIECSKTS-SEF 448

Query: 120 TGLCSRTDLAKPELRHKNTSSYDLLAPVPRPVYEYSNEIPELFKANFEGSSTPPPYQESV 179
             L    D+ +        S  +          +Y+N+IPELFK + +         E  
Sbjct: 449 LNLLDNYDI-RTRYNANFYSHNESGTGNNFNNNKYTNQIPELFKFSEKNIRELSTETEIT 507

Query: 180 PSQNPVKNQPSFLHRVQDCNQDVLFADLQKNGEIDSQAAEEAFLQQYPTPDLPVYLDSSF 239
             + P   +PSF + + DC+Q+ LF  LQ+NG +DS  AE+  LQ+YP  +LP++ ++  
Sbjct: 508 FLEPPSYGEPSFYNNIVDCSQEKLFLSLQQNGAVDSYVAEQVILQRYPVSELPIFFENIS 567

Query: 240 LNAVFRGFQEKNDTKSKLN-HIV----------------PHVNLNHLLTSSIRDEIISVG 282
           +  +       N  KS  N H +                PHV LNHL+T  I   ++SV 
Sbjct: 568 MEKL--ASHNNNLNKSHTNKHWLEGLTPNESDNITPKEPPHVILNHLVTQKISRNVVSVA 625

Query: 283 CTTRYEGKFITQIIYTPC 300
            TTRY+ K+ITQI+Y+P 
Sbjct: 626 VTTRYKQKYITQILYSPI 643

>Ecym_1210 Chr1 (423627..424979) [1353 bp, 450 aa] {ON} similar to
           Ashbya gossypii AER361C
          Length = 450

 Score = 83.6 bits (205), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 82/302 (27%), Positives = 123/302 (40%), Gaps = 83/302 (27%)

Query: 15  LYLPAGVYKFQFLINGELRHSEFLPTATDSFGNCVNWFEVVAG--HKVIEPSRDVISNDF 72
           L LP G ++F+F+++ ELR S+FLPTATD  GN VN+ E+VA    +  +P+ D+    +
Sbjct: 217 LQLPPGTHRFRFIVDNELRFSDFLPTATDQMGNFVNYMEIVASPPSQEQQPASDL---QY 273

Query: 73  TENQVAISANDPSASPRPPILXXXXXXXXXXXXAKHIERSGTPYSDYT--------GLCS 124
             ++  IS                          KH+E      SD          G+ S
Sbjct: 274 VSDEGPIS--------------------------KHVENIREGRSDAASAAVDEERGMSS 307

Query: 125 RTDLA-----KPELRHKNTSSYDLLAPVPRPVYEYSNEIPELFKANFEGSSTPPPYQESV 179
           R+ LA      P+      + +   +    PVYE++ +IP +F                 
Sbjct: 308 RSKLALQIEDDPDDMGDGYTRFREESK-EIPVYEFTQDIPAVF----------------- 349

Query: 180 PSQNPVKNQPSFLHRVQDCNQDVLFADLQKNGEIDSQAAEEAFLQQYPTPDLPVYLDSSF 239
                    PS +       Q  L  D QKN + +        L     P LP +L+   
Sbjct: 350 -------TDPSVM------GQYYLTLDQQKNNQQN--------LAWLTPPQLPPHLEHVI 388

Query: 240 LNAVFRGFQEKNDTKSKLNHIVPHVNLNHLLTSSIRDEIISVGCTTRYEGKFITQIIYTP 299
           LN   +     ++  S    I  HV LNHL TSSI+   + V    RY+ K+ TQI+Y P
Sbjct: 389 LNHYNKSADGASENTSGALPIPNHVVLNHLATSSIKHNTLCVASIVRYKSKYATQILYAP 448

Query: 300 CY 301
            +
Sbjct: 449 LH 450

>Suva_5.123 Chr5 complement(184865..186136) [1272 bp, 423 aa] {ON}
           YER027C (REAL)
          Length = 423

 Score = 83.6 bits (205), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 82/287 (28%), Positives = 117/287 (40%), Gaps = 72/287 (25%)

Query: 15  LYLPAGVYKFQFLINGELRHSEFLPTATDSFGNCVNWFEVVAGHKVI-EPSRDVISNDFT 73
           L LP G ++F+F+++ ELR S++LPTATD  GN VN+ EV A      EP +    N   
Sbjct: 207 LQLPPGTHRFRFIVDNELRFSDYLPTATDQMGNFVNYMEVTAPPDWSNEPQQQASDNKSN 266

Query: 74  ENQVAISANDPSASPRPPILXXXXXXXXXXXXAKHIERSGTPYSDYTGLCSRTDLAKPEL 133
                  A+D  ++ RP               A  IE+                  +P+ 
Sbjct: 267 H------ADDSQSAKRP--------MSARSRIALEIEK------------------EPDD 294

Query: 134 RHKNTSSYDLLAPVPRPVYEYSNEIPELFKANFEGSSTPPPYQESVPSQNPVKNQPSFLH 193
                + +   AP P+P  EY+ +IP +F        T P   E                
Sbjct: 295 MGDGYTRFHDEAP-PKPDLEYTQDIPAVF--------TDPNVME---------------- 329

Query: 194 RVQDCNQDVLFADLQKNGEIDSQAAEEAFLQQYPTPDLPVYLDSSFLNAVFRGFQEKNDT 253
                 Q  L  D Q+N          A+L     P LP +L++  LN       + N+ 
Sbjct: 330 ------QYYLTLDQQQNNH-----QNMAWLT---PPQLPPHLENVILNNYSNAQTDNNEN 375

Query: 254 KSKLNHIVPHVNLNHLLTSSIRDEIISVGCTTRYEGKFITQIIYTPC 300
            S    I  HV LNHL TSSI+   + V    RY+ K++TQI+YTP 
Sbjct: 376 TSGALPIPNHVILNHLATSSIKHNTLCVASIVRYKQKYVTQILYTPL 422

>Skud_5.136 Chr5 complement(206871..208127) [1257 bp, 418 aa] {ON}
           YER027C (REAL)
          Length = 418

 Score = 82.4 bits (202), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 86/288 (29%), Positives = 118/288 (40%), Gaps = 77/288 (26%)

Query: 15  LYLPAGVYKFQFLINGELRHSEFLPTATDSFGNCVNWFEVVAGHKVI-EPSRDVISNDFT 73
           L LP G ++F+F+++ ELR S++LPTATD  GN VN+ EV A      EP + V  N   
Sbjct: 205 LQLPPGTHRFRFIVDNELRFSDYLPTATDQMGNFVNYMEVSAPPDWTNEPQQQVTDNK-- 262

Query: 74  ENQVAISANDPSASPRPPILXXXXXXXXXXXXAKHIERSGTPYSD-YTGLCSRTDLAKPE 132
               A  A+D  ++ RP               A  IE+      D YT            
Sbjct: 263 ----AYHADDNQSTKRP--------MSARSRIALEIEKEPDDMGDGYTRF---------- 300

Query: 133 LRHKNTSSYDLLAPVPRPVYEYSNEIPELFKANFEGSSTPPPYQESVPSQNPVKNQPSFL 192
             H  T S        +P  EY+ +IP +F        T P   E               
Sbjct: 301 --HDETPS--------KPNLEYTQDIPAVF--------TDPNVME--------------- 327

Query: 193 HRVQDCNQDVLFADLQKNGEIDSQAAEEAFLQQYPTPDLPVYLDSSFLNAVFRGFQEKND 252
                  Q  L  D Q+N   +      A+L     P LP +L++  LN+       + D
Sbjct: 328 -------QYYLTLDQQQNNHQNM-----AWLT---PPQLPPHLENVILNSYSNA---QTD 369

Query: 253 TKSKLNHIVPHVNLNHLLTSSIRDEIISVGCTTRYEGKFITQIIYTPC 300
             S    I  HV LNHL TSSI+   + V    RY+ K++TQI+YTP 
Sbjct: 370 NTSGALPIPNHVILNHLATSSIKHNTLCVASIVRYKQKYVTQILYTPL 417

>KNAG0B03690 Chr2 (708946..709926) [981 bp, 326 aa] {ON} Anc_5.527
           YDR422C
          Length = 326

 Score = 62.4 bits (150), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 43/65 (66%), Gaps = 1/65 (1%)

Query: 1   MVFDMESNCWIAPDLYLPAGVYKFQFLINGEL-RHSEFLPTATDSFGNCVNWFEVVAGHK 59
           + F+ +S+ W+APDLYLP G YKF+F+IN     HSE+LP  T   G   N+F V+   +
Sbjct: 114 LQFEGDSSEWVAPDLYLPPGEYKFRFVINDTCSMHSEYLPILTVGDGIAYNYFVVIENDE 173

Query: 60  VIEPS 64
           V+EP+
Sbjct: 174 VVEPA 178

 Score = 32.0 bits (71), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 34/150 (22%), Positives = 57/150 (38%), Gaps = 26/150 (17%)

Query: 153 EYSNEIPELFKANFEGSSTPPPYQESVPSQNPVKNQPSFLHRVQDCNQDVLFADLQKNGE 212
           EY+NEI  LF+           Y +S    +  + +P         NQ   F    +  +
Sbjct: 196 EYTNEILPLFEG----------YCDSQQIDHTAQYKPK-----THMNQKTFFYYAFQEQD 240

Query: 213 IDSQAAEEAFLQQYPTPDLPVYLDSSFLNAVFRGFQEKNDTKSKLNHIVPHVNLNHLLTS 272
             S   +  F ++Y  P +P Y  S  +           D   K+   +   NLN  +  
Sbjct: 241 AASGDYDAQFCERYTVPIIPPYFYSIDITP--------QDNTLKVPLPIQLANLNRTIFP 292

Query: 273 S---IRDEIISVGCTTRYEGKFITQIIYTP 299
           S   I ++ + +GC   Y GK++  + Y P
Sbjct: 293 SPEDICNDYLCIGCVISYRGKYMAHLFYRP 322

>CAGL0K09350g Chr11 complement(922651..923949) [1299 bp, 432 aa]
           {ON} similar to uniprot|P34164 Saccharomyces cerevisiae
           YGL208w SIP2 or uniprot|Q04739 Saccharomyces cerevisiae
           YER027c GAL83
          Length = 432

 Score = 62.8 bits (151), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 73/288 (25%), Positives = 109/288 (37%), Gaps = 70/288 (24%)

Query: 15  LYLPAGVYKFQFLINGELRHSEFLPTATDSFGNCVNWFEVVAGHKVIEPSRDVISNDFTE 74
           L L  G ++F+F+++ +LR S+ LPTATD  GN VN+ EV A  K    S         +
Sbjct: 213 LQLAPGTHRFRFIVDNQLRFSDNLPTATDQMGNFVNYLEVSAVPKSDSTSSRTGKERKDK 272

Query: 75  NQVAISANDPSASPRPPILXXXXXXXXXXXXAKHIERSGTPYSD-YTGLCSRTDLAKPEL 133
           N+ ++S      S   P+             A  IE+    + D YT             
Sbjct: 273 NKKSVSKVSKDRSTVGPL-------SARSCIALEIEKEPDDFGDGYT------------- 312

Query: 134 RHKNTSSYDLLAPVPRPVYEYSNEIPELFKANFEGSSTPPPYQESVPSQNPVKNQPSFLH 193
                  Y    P   P YE+S+EIP +F              +S+  Q  ++ Q     
Sbjct: 313 ------RYHEELP-QEPKYEFSSEIPAIF------------VDQSIIEQLTMERQ----- 348

Query: 194 RVQDCNQDVLFADLQKNGEIDSQAAEEAFLQQYPTP-DLPVYLDSSFLNAVFRGFQEKND 252
           R +  N   L                        TP  LP  L++  LN       +  +
Sbjct: 349 RKKSNNMSWL------------------------TPPQLPPQLENVILNKFGEPLSQSTE 384

Query: 253 TKSKLNHIVPHVNLNHLLTSSIRDEIISVGCTTRYEGKFITQIIYTPC 300
             +    I  H  LNHL+T+SI+   + V    RY  K+++QI Y P 
Sbjct: 385 NNAGALPIPNHSVLNHLVTTSIKHNTLCVATNNRYRQKYVSQIYYVPL 432

>KNAG0E01590 Chr5 complement(317054..318325) [1272 bp, 423 aa] {ON}
           Anc_3.517 YER027C
          Length = 423

 Score = 61.6 bits (148), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 32/87 (36%), Positives = 52/87 (59%), Gaps = 9/87 (10%)

Query: 15  LYLPAGVYKFQFLINGELRHSEFLPTATDSFGNCVNWFEVV---AGHKVIEPSRDVISND 71
           L LP G +KF+F+++ ELR S++LPTATD  GN VN+ EVV   A  ++ +   ++    
Sbjct: 192 LQLPPGTHKFRFIVDNELRFSDYLPTATDQMGNFVNYLEVVAPPAAPQLGQTQNEINDQQ 251

Query: 72  FTENQVAISAND------PSASPRPPI 92
           + + Q+ + A D      PSA+ + P+
Sbjct: 252 WNDEQMGLPAQDRDTATYPSATRKTPM 278

 Score = 52.4 bits (124), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 43/88 (48%)

Query: 213 IDSQAAEEAFLQQYPTPDLPVYLDSSFLNAVFRGFQEKNDTKSKLNHIVPHVNLNHLLTS 272
           +D Q      +     P LP +L++  LN+      E N+  S    I  HV LNHL TS
Sbjct: 335 LDQQQNNHQNMAWLTPPQLPPHLENVILNSYSSLQGESNENNSGALPIPNHVILNHLATS 394

Query: 273 SIRDEIISVGCTTRYEGKFITQIIYTPC 300
           SI+   + V    RY+ K+ TQI+Y P 
Sbjct: 395 SIKHNTLCVASIVRYKQKYATQILYAPL 422

>KNAG0B00600 Chr2 (97910..99079) [1170 bp, 389 aa] {ON} Anc_3.517
           YER027C
          Length = 389

 Score = 60.5 bits (145), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 37/53 (69%)

Query: 15  LYLPAGVYKFQFLINGELRHSEFLPTATDSFGNCVNWFEVVAGHKVIEPSRDV 67
           L LP G +KF+F+++ ELR S+FLPTATD  GN VN+ EV    + +E  +D+
Sbjct: 193 LKLPVGTHKFRFVVDNELRFSDFLPTATDQTGNFVNYIEVKPSEETLELEKDI 245

 Score = 52.8 bits (125), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 43/73 (58%), Gaps = 8/73 (10%)

Query: 229 PDLPVYLDSSFLNAVFRGFQEKNDTKSKLNHIVP--HVNLNHLLTSSIRDEIISVGCTTR 286
           P+LP  L+   LN       +  DT +    +    +V LNHLLTSSI++ ++ +GC+ R
Sbjct: 321 PELPSQLERCILN------NKNEDTDNGPCELTTPNYVTLNHLLTSSIKNNMLCLGCSVR 374

Query: 287 YEGKFITQIIYTP 299
           Y  K++TQ+ YTP
Sbjct: 375 YRQKYVTQVYYTP 387

>TBLA0I03270 Chr9 complement(793849..795150) [1302 bp, 433 aa] {ON}
           Anc_3.517 YER027C
          Length = 433

 Score = 60.1 bits (144), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 25/42 (59%), Positives = 33/42 (78%)

Query: 15  LYLPAGVYKFQFLINGELRHSEFLPTATDSFGNCVNWFEVVA 56
           L LP G ++F+F+++ ELR S+FLPTATD  GN VN+ EVVA
Sbjct: 202 LQLPPGTHRFRFIVDNELRFSDFLPTATDQMGNFVNYLEVVA 243

 Score = 54.3 bits (129), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 45/88 (51%), Gaps = 1/88 (1%)

Query: 213 IDSQAAEEAFLQQYPTPDLPVYLDSSFLNAVFRGFQEKNDTKSKLNHIVPHVNLNHLLTS 272
           +D Q      +     P LP +L++  LN+ + G    N+  S    I  HV LNHL TS
Sbjct: 346 LDQQQNNHQNMAWLTPPQLPPHLENVILNS-YSGSGSDNENTSGALPIPNHVVLNHLATS 404

Query: 273 SIRDEIISVGCTTRYEGKFITQIIYTPC 300
           SI+   + V    RY+ K++TQI+Y P 
Sbjct: 405 SIKHNTLCVASIVRYKSKYVTQILYAPL 432

>Kpol_195.2 s195 complement(4330..5637) [1308 bp, 435 aa] {ON}
           complement(4330..5637) [1308 nt, 436 aa]
          Length = 435

 Score = 59.3 bits (142), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 25/42 (59%), Positives = 32/42 (76%)

Query: 15  LYLPAGVYKFQFLINGELRHSEFLPTATDSFGNCVNWFEVVA 56
           L LP G +KF+F+++ ELR S+FLPTATD  GN VN+ E VA
Sbjct: 178 LQLPPGTHKFRFIVDNELRFSDFLPTATDQMGNFVNYLEAVA 219

 Score = 52.4 bits (124), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 42/88 (47%)

Query: 213 IDSQAAEEAFLQQYPTPDLPVYLDSSFLNAVFRGFQEKNDTKSKLNHIVPHVNLNHLLTS 272
           +D Q      L     P LP +L++  LN+      E     S    I  HV LNHL TS
Sbjct: 347 LDQQQNNHQNLSWLTPPQLPPHLENVILNSYSSNSPETGQNNSGSLPIPNHVVLNHLATS 406

Query: 273 SIRDEIISVGCTTRYEGKFITQIIYTPC 300
           SI+   + V    RY+ K++TQI+Y P 
Sbjct: 407 SIKHNTLCVASIVRYKRKYVTQILYAPL 434

>TDEL0D05850 Chr4 complement(1062927..1064141) [1215 bp, 404 aa]
           {ON} Anc_3.517 YER027C
          Length = 404

 Score = 58.9 bits (141), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 23/42 (54%), Positives = 33/42 (78%)

Query: 15  LYLPAGVYKFQFLINGELRHSEFLPTATDSFGNCVNWFEVVA 56
           L LP G ++F+F+++ ELR S++LPTATD  GN VN+ EV+A
Sbjct: 187 LQLPVGTHRFRFIVDNELRFSDYLPTATDQMGNFVNYLEVIA 228

 Score = 52.4 bits (124), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 30/88 (34%), Positives = 44/88 (50%)

Query: 213 IDSQAAEEAFLQQYPTPDLPVYLDSSFLNAVFRGFQEKNDTKSKLNHIVPHVNLNHLLTS 272
           +D Q      +     P LP +L++  LN+      + N+  S    I  HV LNHL TS
Sbjct: 316 LDQQQNNHQNMAWLTPPQLPPHLENVPLNSYTNSQNDSNENNSGALPIPNHVVLNHLATS 375

Query: 273 SIRDEIISVGCTTRYEGKFITQIIYTPC 300
           SI+   + V    RY+ K++TQI+Y P 
Sbjct: 376 SIKHNTLCVASIVRYKRKYVTQILYAPL 403

>ZYRO0E08404g Chr5 complement(672301..673347) [1047 bp, 348 aa] {ON}
           some similarities with uniprot|Q04739 Saccharomyces
           cerevisiae YER027C GAL83 One of three possible beta-
           subunits of the Snf1 kinase complex allows nuclear
           localization of the Snf1 kinase complex in the presence
           of a nonfermentable carbon source contains
           glycogen-binding domain and some similarities with
           YGL208W uniprot|P34164 Saccharomyces cerevisiae YGL208W
           SIP2 Member of a family of proteins including Sip1p and
           Gal83p that interact with Snf1p and Snf4p and are
           involved in the response to glucose starvation component
           of Snf1 protein complex involved in response to glucose
           starvation
          Length = 348

 Score = 58.2 bits (139), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 37/55 (67%)

Query: 15  LYLPAGVYKFQFLINGELRHSEFLPTATDSFGNCVNWFEVVAGHKVIEPSRDVIS 69
           L LP G ++F+F+++ ELR S++LPTATD  GN VN+ E+  G K    +R  I+
Sbjct: 155 LQLPIGTHRFRFIVDNELRFSDYLPTATDQMGNFVNYLEIGRGQKDTLSARSRIA 209

 Score = 49.7 bits (117), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 32/90 (35%), Positives = 45/90 (50%), Gaps = 3/90 (3%)

Query: 213 IDSQAAEEAFLQQYPTPDLPVYLDSSFLNAVFRGFQ--EKNDTKSKLNHIVPHVNLNHLL 270
           +D Q      +     P LP +L+   LN+ + G Q    N+  S    I  HV LNHL 
Sbjct: 259 LDQQQHNHQNMAWLTPPTLPPHLEDVPLNS-YNGIQGDSNNENNSGALPIPNHVVLNHLA 317

Query: 271 TSSIRDEIISVGCTTRYEGKFITQIIYTPC 300
           TSSI+   + V    RY+ K++TQI+Y P 
Sbjct: 318 TSSIKHNTLCVASIVRYKRKYVTQILYAPL 347

>KLLA0B00583g Chr2 complement(44819..46279) [1461 bp, 486 aa] {ON}
           uniprot|Q00995 Kluyveromyces lactis FOG1 protein
          Length = 486

 Score = 58.5 bits (140), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 32/41 (78%)

Query: 15  LYLPAGVYKFQFLINGELRHSEFLPTATDSFGNCVNWFEVV 55
           L LP G ++F+F+++ ELR S+FLPTATD  GN VN+ E+V
Sbjct: 241 LQLPPGTHRFRFIVDNELRFSDFLPTATDQMGNFVNYLEIV 281

 Score = 48.1 bits (113), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 27/72 (37%), Positives = 38/72 (52%)

Query: 229 PDLPVYLDSSFLNAVFRGFQEKNDTKSKLNHIVPHVNLNHLLTSSIRDEIISVGCTTRYE 288
           P LP  L++  LN   +  +  ++  S    I  HV LNHL TSSI+   + V    RY+
Sbjct: 414 PQLPPQLENVILNNYNKNAEPGSENNSGALPIPNHVVLNHLATSSIKHNTLCVASIVRYK 473

Query: 289 GKFITQIIYTPC 300
            K+ TQI+Y P 
Sbjct: 474 RKYATQILYAPL 485

>Kwal_47.19040 s47 complement(1073036..1074325) [1290 bp, 429 aa]
           {ON} YER027C (GAL83) - glucose repression protein, a
           component of the Snf1 complex [contig 188] FULL
          Length = 429

 Score = 58.2 bits (139), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 23/42 (54%), Positives = 33/42 (78%)

Query: 15  LYLPAGVYKFQFLINGELRHSEFLPTATDSFGNCVNWFEVVA 56
           L LP G ++F+F+++ ELR S+FLPTATD  GN VN+ E+V+
Sbjct: 168 LQLPPGTHRFRFIVDNELRFSDFLPTATDQMGNFVNYLEIVS 209

 Score = 50.1 bits (118), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 32/92 (34%), Positives = 47/92 (51%), Gaps = 5/92 (5%)

Query: 213 IDSQAAEEAFLQQYPTPDLPVYLDSSFLNAVFRGFQEKNDTKSKLNH----IVPHVNLNH 268
           +D Q   +  +     P LP +L++  LN  +    E  D+ S+ N     I  HV LNH
Sbjct: 338 LDQQQNNQQSMAWLTPPQLPPHLENVILNN-YSSQSEPGDSGSENNSGALPIPNHVVLNH 396

Query: 269 LLTSSIRDEIISVGCTTRYEGKFITQIIYTPC 300
           L TSSI+   + V    RY+ K+ TQI+Y+P 
Sbjct: 397 LATSSIKHSTLCVASIVRYKRKYATQILYSPL 428

>KAFR0I02380 Chr9 (482219..483448) [1230 bp, 409 aa] {ON} Anc_3.517
           YER027C
          Length = 409

 Score = 57.8 bits (138), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 23/42 (54%), Positives = 33/42 (78%)

Query: 15  LYLPAGVYKFQFLINGELRHSEFLPTATDSFGNCVNWFEVVA 56
           L LP G ++F+F+++ ELR S++LPTATD  GN VN+ EV+A
Sbjct: 178 LQLPPGTHRFRFIVDNELRFSDYLPTATDQMGNFVNYLEVIA 219

 Score = 54.3 bits (129), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 43/88 (48%)

Query: 213 IDSQAAEEAFLQQYPTPDLPVYLDSSFLNAVFRGFQEKNDTKSKLNHIVPHVNLNHLLTS 272
           +D Q      +     P LP +L++  LN+      E N+  S    I  HV LNHL TS
Sbjct: 321 LDQQQNNHQNMAWLTPPQLPPHLENVILNSYSNSQGESNENTSGALPIPNHVILNHLATS 380

Query: 273 SIRDEIISVGCTTRYEGKFITQIIYTPC 300
           SI+   + V    RY  K++TQI+Y P 
Sbjct: 381 SIKHNTLCVASIVRYRQKYVTQILYAPL 408

>TPHA0A05810 Chr1 complement(1317530..1318804) [1275 bp, 424 aa]
           {ON} Anc_3.517 YER027C
          Length = 424

 Score = 57.4 bits (137), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 24/41 (58%), Positives = 31/41 (75%)

Query: 15  LYLPAGVYKFQFLINGELRHSEFLPTATDSFGNCVNWFEVV 55
           L LP G +KF+F+++ ELR S+FLPTATD  GN VN+ E V
Sbjct: 183 LQLPPGTHKFRFIVDNELRFSDFLPTATDQMGNFVNYLEAV 223

 Score = 43.1 bits (100), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 29/88 (32%), Positives = 42/88 (47%)

Query: 213 IDSQAAEEAFLQQYPTPDLPVYLDSSFLNAVFRGFQEKNDTKSKLNHIVPHVNLNHLLTS 272
           +D Q      L     P LP +L++  LN       + +   S    I  HV L+HL TS
Sbjct: 336 LDQQQNNHQNLAWLTPPQLPPHLENVILNNYSSSSSDNSQNTSGSLPIPNHVVLHHLATS 395

Query: 273 SIRDEIISVGCTTRYEGKFITQIIYTPC 300
           SI+   + V    RY+ K++TQI+Y P 
Sbjct: 396 SIKHNTLCVASIVRYKRKYVTQILYAPL 423

>CAGL0A03696g Chr1 (377255..378502) [1248 bp, 415 aa] {ON} similar
           to uniprot|Q04739 Saccharomyces cerevisiae YER027c GAL83
           glucose repression protein
          Length = 415

 Score = 57.4 bits (137), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 25/45 (55%), Positives = 34/45 (75%), Gaps = 2/45 (4%)

Query: 15  LYLPAGVYKFQFLINGELRHSEFLPTATDSFGNCVNWFEV--VAG 57
           L LP G ++F+F+++ ELR S+FLPTATD  GN VN+ E+  VAG
Sbjct: 202 LQLPPGTHRFRFIVDNELRFSDFLPTATDQMGNFVNYLEIAPVAG 246

 Score = 55.5 bits (132), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 44/88 (50%)

Query: 213 IDSQAAEEAFLQQYPTPDLPVYLDSSFLNAVFRGFQEKNDTKSKLNHIVPHVNLNHLLTS 272
           +D Q      +     P LP +L++  LN+      E N+  S    I  HV LNHL TS
Sbjct: 327 LDQQKNNHQNMAWLTPPQLPPHLENVILNSYSNAQGESNENNSGALPIPNHVILNHLATS 386

Query: 273 SIRDEIISVGCTTRYEGKFITQIIYTPC 300
           SI+   + V    RY+ K++TQI+Y P 
Sbjct: 387 SIKHNTLCVASIVRYKRKYVTQILYAPL 414

>Smik_5.150 Chr5 complement(213879..215132) [1254 bp, 417 aa] {ON}
           YER027C (REAL)
          Length = 417

 Score = 57.0 bits (136), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 23/42 (54%), Positives = 32/42 (76%)

Query: 15  LYLPAGVYKFQFLINGELRHSEFLPTATDSFGNCVNWFEVVA 56
           L LP G ++F+F+++ ELR S++LPTATD  GN VN+ EV A
Sbjct: 204 LQLPPGTHRFRFIVDNELRFSDYLPTATDQMGNFVNYMEVTA 245

 Score = 52.0 bits (123), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 44/88 (50%), Gaps = 3/88 (3%)

Query: 213 IDSQAAEEAFLQQYPTPDLPVYLDSSFLNAVFRGFQEKNDTKSKLNHIVPHVNLNHLLTS 272
           +D Q      +     P LP +L++  LN+       + D  S    I  HV LNHL TS
Sbjct: 332 LDQQQNNHQNMAWLTPPQLPPHLENVILNSYSNA---QTDNTSGALPIPNHVILNHLATS 388

Query: 273 SIRDEIISVGCTTRYEGKFITQIIYTPC 300
           SI+   + V    RY+ K++TQI+YTP 
Sbjct: 389 SIKHNTLCVASIVRYKQKYVTQILYTPL 416

>NCAS0E00620 Chr5 (106661..108163) [1503 bp, 500 aa] {ON} Anc_3.517
          Length = 500

 Score = 57.0 bits (136), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 23/40 (57%), Positives = 32/40 (80%)

Query: 15  LYLPAGVYKFQFLINGELRHSEFLPTATDSFGNCVNWFEV 54
           L LPAG ++F+F+++ EL+ S+FLPTATD  GN VN+ EV
Sbjct: 271 LQLPAGTHRFRFIVDNELKFSDFLPTATDQTGNFVNYLEV 310

 Score = 48.9 bits (115), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 42/78 (53%), Gaps = 3/78 (3%)

Query: 223 LQQYPTPDLPVYLDSSFLNAVFRGFQEKNDTKSKLNHIVPHVNLNHLLTSSIRDEIISVG 282
           LQ    P LP +L++  LN+        N+  S    I  HV LNHL+T+SI+   + V 
Sbjct: 425 LQWLTPPQLPPHLENIILNS---SQDTSNENTSGALPIPNHVVLNHLVTTSIKHNTLCVA 481

Query: 283 CTTRYEGKFITQIIYTPC 300
              RY+ K++TQI+Y P 
Sbjct: 482 SIIRYKHKYVTQILYAPL 499

>NDAI0I02890 Chr9 complement(682274..684022) [1749 bp, 582 aa] {ON}
           Anc_3.517 YER027C
          Length = 582

 Score = 56.6 bits (135), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 23/42 (54%), Positives = 32/42 (76%)

Query: 15  LYLPAGVYKFQFLINGELRHSEFLPTATDSFGNCVNWFEVVA 56
           L LP G ++F+F+++ ELR S++LPTATD  GN VN+ EV A
Sbjct: 280 LQLPEGTHRFRFIVDNELRFSDYLPTATDQTGNFVNYLEVKA 321

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 26/38 (68%)

Query: 263 HVNLNHLLTSSIRDEIISVGCTTRYEGKFITQIIYTPC 300
           HV LNHL+T+SI+   + V    RY+ K+ TQI+YTP 
Sbjct: 544 HVVLNHLVTTSIKHNTLCVASIIRYKHKYATQILYTPL 581

>SAKL0F02002g Chr6 (167591..169102) [1512 bp, 503 aa] {ON} similar
           to gnl|GLV|CAGL0A03696g Candida glabrata CAGL0A03696g
           and similar to YER027C uniprot|Q04739 Saccharomyces
           cerevisiae YER027C GAL83 One of three possible
           beta-subunits of the Snf1 kinase complex allows nuclear
           localization of the Snf1 kinase complex in the presence
           of a nonfermentable carbon source contains
           glycogen-binding domain and similar to YGL208W
           uniprot|P34164 Saccharomyces cerevisiae YGL208W SIP2
           Member of a family of proteins including Sip1p and
           Gal83p that interact with Snf1p and Snf4p and are
           involved in the response to glucose starvation component
           of Snf1 protein complex involved in response to glucose
           starvation
          Length = 503

 Score = 56.2 bits (134), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 22/41 (53%), Positives = 32/41 (78%)

Query: 15  LYLPAGVYKFQFLINGELRHSEFLPTATDSFGNCVNWFEVV 55
           L LP G ++F+F+++ ELR S++LPTATD  GN VN+ E+V
Sbjct: 253 LQLPPGTHRFRFIVDNELRFSDYLPTATDQMGNFVNYMEIV 293

 Score = 46.6 bits (109), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 27/76 (35%), Positives = 39/76 (51%), Gaps = 4/76 (5%)

Query: 229 PDLPVYLDSSFLNAVFRGFQEKNDTKSKLNH----IVPHVNLNHLLTSSIRDEIISVGCT 284
           P LP +L++  LN       +  ++  + N     I  HV LNHL TSSI+   + V   
Sbjct: 427 PQLPPHLENVILNNYSANSAQAEESGGENNSGALPIPNHVVLNHLATSSIKHNTLCVASI 486

Query: 285 TRYEGKFITQIIYTPC 300
            RY+ K+ TQI+Y P 
Sbjct: 487 VRYKSKYATQILYAPL 502

>YER027C Chr5 complement(208979..210232) [1254 bp, 417 aa] {ON}
           GAL83One of three possible beta-subunits of the Snf1
           kinase complex, allows nuclear localization of the Snf1
           kinase complex in the presence of a nonfermentable
           carbon source; contains glycogen-binding domain
          Length = 417

 Score = 55.8 bits (133), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 23/42 (54%), Positives = 32/42 (76%)

Query: 15  LYLPAGVYKFQFLINGELRHSEFLPTATDSFGNCVNWFEVVA 56
           L LP G ++F+F+++ ELR S++LPTATD  GN VN+ EV A
Sbjct: 204 LQLPPGTHRFRFIVDNELRFSDYLPTATDQMGNFVNYMEVSA 245

 Score = 52.0 bits (123), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 44/88 (50%), Gaps = 3/88 (3%)

Query: 213 IDSQAAEEAFLQQYPTPDLPVYLDSSFLNAVFRGFQEKNDTKSKLNHIVPHVNLNHLLTS 272
           +D Q      +     P LP +L++  LN+       + D  S    I  HV LNHL TS
Sbjct: 332 LDQQQNNHQNMAWLTPPQLPPHLENVILNSYSNA---QTDNTSGALPIPNHVILNHLATS 388

Query: 273 SIRDEIISVGCTTRYEGKFITQIIYTPC 300
           SI+   + V    RY+ K++TQI+YTP 
Sbjct: 389 SIKHNTLCVASIVRYKQKYVTQILYTPL 416

>Skud_7.60 Chr7 (102699..104024) [1326 bp, 441 aa] {ON} YGL208W
           (REAL)
          Length = 441

 Score = 55.1 bits (131), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 41/72 (56%)

Query: 229 PDLPVYLDSSFLNAVFRGFQEKNDTKSKLNHIVPHVNLNHLLTSSIRDEIISVGCTTRYE 288
           P LP  L++  LN  +    + N+  S    I  HV LNHL+TSSI+   + V    RY+
Sbjct: 367 PQLPPQLENVILNKYYATQDQFNENNSGALPIPNHVVLNHLVTSSIKHNTLCVASIVRYK 426

Query: 289 GKFITQIIYTPC 300
            K++TQI+YTP 
Sbjct: 427 QKYVTQILYTPI 438

 Score = 53.9 bits (128), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 36/61 (59%)

Query: 1   MVFDMESNCWIAPDLYLPAGVYKFQFLINGELRHSEFLPTATDSFGNCVNWFEVVAGHKV 60
           ++ D   N      L L  G ++F+F+++ ELR S+FLPTATD  GN VN+ EV    K 
Sbjct: 218 LIPDANKNGLFHVKLRLLPGTHRFRFIVDNELRVSDFLPTATDQMGNFVNYIEVRQPQKK 277

Query: 61  I 61
           +
Sbjct: 278 L 278

>YGL208W Chr7 (97338..98585) [1248 bp, 415 aa] {ON}  SIP2One of
           three beta subunits of the Snf1 serine/threonine protein
           kinase complex involved in the response to glucose
           starvation; null mutants exhibit accelerated aging;
           N-myristoylprotein localized to the cytoplasm and the
           plasma membrane
          Length = 415

 Score = 54.7 bits (130), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 41/71 (57%)

Query: 229 PDLPVYLDSSFLNAVFRGFQEKNDTKSKLNHIVPHVNLNHLLTSSIRDEIISVGCTTRYE 288
           P LP  L++  LN  +    + N+  S    I  HV LNHL+TSSI+   + V    RY+
Sbjct: 341 PQLPPQLENVILNKYYATQDQFNENNSGALPIPNHVVLNHLVTSSIKHNTLCVASIVRYK 400

Query: 289 GKFITQIIYTP 299
            K++TQI+YTP
Sbjct: 401 QKYVTQILYTP 411

 Score = 53.9 bits (128), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 36/54 (66%)

Query: 1   MVFDMESNCWIAPDLYLPAGVYKFQFLINGELRHSEFLPTATDSFGNCVNWFEV 54
           ++ D ++N      L L  G ++F+F+++ ELR S+FLPTATD  GN VN+ EV
Sbjct: 192 LIPDSDNNGSFHVKLRLLPGTHRFRFIVDNELRVSDFLPTATDQMGNFVNYIEV 245

>NDAI0B06010 Chr2 complement(1460221..1461732) [1512 bp, 503 aa]
           {ON} Anc_3.517 YER027C
          Length = 503

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 21/40 (52%), Positives = 31/40 (77%)

Query: 15  LYLPAGVYKFQFLINGELRHSEFLPTATDSFGNCVNWFEV 54
           L LP G ++F+F+++ ELR S++LPTATD  GN VN+ E+
Sbjct: 251 LQLPPGTHRFRFIVDNELRFSDYLPTATDQMGNFVNYLEI 290

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 25/38 (65%)

Query: 263 HVNLNHLLTSSIRDEIISVGCTTRYEGKFITQIIYTPC 300
           HV LNHL TSSI+   + V    RY+ K++TQI+Y P 
Sbjct: 465 HVILNHLATSSIKHNTLCVASIVRYKRKYVTQILYAPL 502

>NCAS0F03730 Chr6 complement(750798..752096) [1299 bp, 432 aa] {ON}
           Anc_3.517 YER027C
          Length = 432

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 21/40 (52%), Positives = 31/40 (77%)

Query: 15  LYLPAGVYKFQFLINGELRHSEFLPTATDSFGNCVNWFEV 54
           L LP G ++F+F+++ ELR S++LPTATD  GN VN+ E+
Sbjct: 207 LQLPPGTHRFRFIVDNELRFSDYLPTATDQMGNFVNYLEI 246

 Score = 52.8 bits (125), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 30/88 (34%), Positives = 43/88 (48%)

Query: 213 IDSQAAEEAFLQQYPTPDLPVYLDSSFLNAVFRGFQEKNDTKSKLNHIVPHVNLNHLLTS 272
           +D Q      +     P LP +L++  LN+        N+  S    I  HV LNHL TS
Sbjct: 344 LDQQQNNHQNMAWLTPPQLPPHLENVILNSYSNSQGTNNENNSGALPIPNHVILNHLATS 403

Query: 273 SIRDEIISVGCTTRYEGKFITQIIYTPC 300
           SI+   + V    RY+ K++TQI+Y P 
Sbjct: 404 SIKHNTLCVASIVRYKRKYVTQILYAPL 431

>AER361C Chr5 complement(1307677..1309104) [1428 bp, 475 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER027C
           (GAL83) and YGL208W (SIP2)
          Length = 475

 Score = 54.3 bits (129), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 22/42 (52%), Positives = 32/42 (76%)

Query: 15  LYLPAGVYKFQFLINGELRHSEFLPTATDSFGNCVNWFEVVA 56
           L LP G ++F+F+++ ELR S+FL TATD  GN VN+ E+V+
Sbjct: 236 LQLPPGTHRFRFIVDNELRFSDFLLTATDQMGNFVNYLEIVS 277

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 37/122 (30%), Positives = 57/122 (46%), Gaps = 11/122 (9%)

Query: 185 VKNQPSFLHRVQDCNQDV--LFADLQKNGE----IDSQAAEEAFLQQYPTPDLPVYLDSS 238
           +K +P++     +  QD+  +F D    G+    +D Q   +  L     P LP +L+  
Sbjct: 358 IKTKPAY-----EFTQDIPAVFTDPSVMGQYYLTLDQQQHNQQNLAWLTPPQLPPHLEHV 412

Query: 239 FLNAVFRGFQEKNDTKSKLNHIVPHVNLNHLLTSSIRDEIISVGCTTRYEGKFITQIIYT 298
            LN   +     ++  S    I  HV LNHL TSSI+   + V    RY+ K+ TQI+Y 
Sbjct: 413 ILNHYNKSADGVSENTSGALPIPNHVVLNHLATSSIKHNTLCVASIVRYKQKYATQILYA 472

Query: 299 PC 300
           P 
Sbjct: 473 PL 474

>KAFR0F04140 Chr6 complement(814903..815949) [1047 bp, 348 aa] {ON}
           Anc_3.517 YER027C
          Length = 348

 Score = 53.5 bits (127), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 42/72 (58%), Gaps = 1/72 (1%)

Query: 229 PDLPVYLDSSFLNAVFRGFQEKNDTKSKLNHIVPHVNLNHLLTSSIRDEIISVGCTTRYE 288
           P +P + D   LN      Q  +D+ +    I  HV LNHL+ +S++  ++++  TTRY+
Sbjct: 277 PQIPPHFDVVILNDQ-NSLQHTDDSNAGFLPIPNHVVLNHLIVNSVKSNMLAISTTTRYK 335

Query: 289 GKFITQIIYTPC 300
            KFITQ+ Y+P 
Sbjct: 336 EKFITQVCYSPI 347

 Score = 52.4 bits (124), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 22/45 (48%), Positives = 32/45 (71%)

Query: 10  WIAPDLYLPAGVYKFQFLINGELRHSEFLPTATDSFGNCVNWFEV 54
           W    L LP G ++F+F+++ ELR S+ +P+ATDS GN VN+ EV
Sbjct: 143 WARVRLKLPPGNHRFRFVVDNELRFSDDVPSATDSMGNLVNYIEV 187

>Suva_7.53 Chr7 (93895..95139) [1245 bp, 414 aa] {ON} YGL208W (REAL)
          Length = 414

 Score = 52.8 bits (125), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 40/72 (55%)

Query: 229 PDLPVYLDSSFLNAVFRGFQEKNDTKSKLNHIVPHVNLNHLLTSSIRDEIISVGCTTRYE 288
           P LP  L++  LN       + N+  S    I  HV LNHL+TSSI+   + V    RY+
Sbjct: 340 PQLPPQLENVILNKYCTTQDQVNENNSGALPIPNHVVLNHLITSSIKHNTLCVSSIVRYK 399

Query: 289 GKFITQIIYTPC 300
            K++TQI+YTP 
Sbjct: 400 QKYVTQILYTPI 411

 Score = 52.0 bits (123), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 30/40 (75%)

Query: 15  LYLPAGVYKFQFLINGELRHSEFLPTATDSFGNCVNWFEV 54
           L L  G ++F+F+++ ELR S+FLPTATD  GN VN+ EV
Sbjct: 205 LRLLPGTHRFRFVVDNELRVSDFLPTATDQMGNFVNYIEV 244

>Smik_7.55 Chr7 (92235..93482) [1248 bp, 415 aa] {ON} YGL208W (REAL)
          Length = 415

 Score = 52.0 bits (123), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 30/40 (75%)

Query: 15  LYLPAGVYKFQFLINGELRHSEFLPTATDSFGNCVNWFEV 54
           L L  G ++F+F+++ ELR S+FLPTATD  GN VN+ EV
Sbjct: 206 LRLLPGTHRFRFVVDNELRVSDFLPTATDQMGNFVNYIEV 245

 Score = 46.6 bits (109), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 24/62 (38%), Positives = 34/62 (54%)

Query: 239 FLNAVFRGFQEKNDTKSKLNHIVPHVNLNHLLTSSIRDEIISVGCTTRYEGKFITQIIYT 298
            LN  +    + N+  S    I  HV LNHL+TSSI+   + V    RY+ K++TQI+Y 
Sbjct: 351 ILNKYYMTQDQFNENNSGALPIPNHVVLNHLITSSIKHNTLCVASIVRYKQKYVTQILYA 410

Query: 299 PC 300
           P 
Sbjct: 411 PI 412

>KLTH0G01848g Chr7 (136780..138030) [1251 bp, 416 aa] {ON} similar
           to uniprot|P34164 Saccharomyces cerevisiae YGL208W SIP2
           Member of a family of proteins including Sip1p and
           Gal83p that interact with Snf1p and Snf4p and are
           involved in the response to glucose starvation component
           of Snf1 protein complex involved in response to glucose
           starvation and similar to YER027C uniprot|Q04739
           Saccharomyces cerevisiae YER027C GAL83 One of three
           possible beta-subunits of the Snf1 kinase complex allows
           nuclear localization of the Snf1 kinase complex in the
           presence of a nonfermentable carbon source contains
           glycogen-binding domain
          Length = 416

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 30/40 (75%)

Query: 15  LYLPAGVYKFQFLINGELRHSEFLPTATDSFGNCVNWFEV 54
           L LP G ++F+F+++ ELR S++L TATD  GN VN+ E+
Sbjct: 168 LQLPPGTHRFRFIVDNELRFSDYLATATDQMGNFVNYLEI 207

 Score = 46.6 bits (109), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 30/92 (32%), Positives = 46/92 (50%), Gaps = 5/92 (5%)

Query: 213 IDSQAAEEAFLQQYPTPDLPVYLDSSFLNAVFRGFQEKNDTKSKLNH----IVPHVNLNH 268
           +D Q   +  +     P LP +L++  LN  +    +   + S+ N     I  HV LNH
Sbjct: 325 LDQQQNNQQSMAWLTPPQLPPHLENVILNN-YSNSSDPGGSGSENNSGALPIPNHVVLNH 383

Query: 269 LLTSSIRDEIISVGCTTRYEGKFITQIIYTPC 300
           L TSSI+   + V    RY+ K+ TQI+Y+P 
Sbjct: 384 LATSSIKHNTLCVASIVRYKRKYATQILYSPL 415

>KNAG0F01330 Chr6 complement(239604..241484) [1881 bp, 626 aa]
          {ON} Anc_2.81 YHR146W
          Length = 626

 Score = 33.1 bits (74), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 24/42 (57%), Gaps = 3/42 (7%)

Query: 20 GVYKFQFLINGELRHSEFLPTATDSFGNCVNWFEVVAGHKVI 61
          G + F+F+++GE   S+     TD FGN  N+ E   GH +I
Sbjct: 52 GRFVFKFVVDGEWAVSQDYKIETDEFGNQNNYIE---GHDMI 90

>Suva_13.220 Chr13 (356656..356880) [225 bp, 75 aa] {OFF}  YAR027W
           (HSP)
          Length = 75

 Score = 29.6 bits (65), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 15/36 (41%), Positives = 20/36 (55%), Gaps = 1/36 (2%)

Query: 198 CNQDVLFAD-LQKNGEIDSQAAEEAFLQQYPTPDLP 232
           CN D +  +   K  EI  QA  E + +QYP PD+P
Sbjct: 40  CNVDPILEEYFIKAAEIQKQAVREYWRKQYPDPDVP 75

>KAFR0J02770 Chr10 complement(526999..528531) [1533 bp, 510 aa] {ON}
           Anc_3.546 YFR039C
          Length = 510

 Score = 31.6 bits (70), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 16/58 (27%), Positives = 27/58 (46%), Gaps = 5/58 (8%)

Query: 187 NQPSFLHRVQDCNQDVLFADLQKNGEIDSQAAEEAFLQQYPTPDLPVYLDSSFLNAVF 244
           N   +L ++    QD+         EIDS+  E+ +  +  T +LPVY+D   +   F
Sbjct: 295 NSDDYLQKIAKAIQDI-----DCKIEIDSKTGEKRYFDKTGTTELPVYIDRQLMRDYF 347

>Klac_YGOB_Anc_7.64 Chr6 (231920..235492) [3573 bp, 1190 aa] {ON}
           ANNOTATED BY YGOB -
          Length = 1190

 Score = 31.2 bits (69), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 41/83 (49%), Gaps = 2/83 (2%)

Query: 200 QDVLFADLQKNGEIDSQAAEEAFLQQYPTPDLPVYLDSSFLNAVFRGFQEKN--DTKSKL 257
           +++L  +  K  E+D    E+  L + P P+ P +  S+ L+  F  + EK    ++SKL
Sbjct: 524 EEILAKNYVKAVEVDDYHEEDTTLFKIPHPNGPEFNCSTLLSKPFMHYFEKGVLKSQSKL 583

Query: 258 NHIVPHVNLNHLLTSSIRDEIIS 280
            H    +N +     S R+ I+S
Sbjct: 584 AHDALQINASGAYWMSARERIMS 606

>TBLA0C05490 Chr3 complement(1325823..1328699) [2877 bp, 958 aa]
           {ON} Anc_2.147 YHR120W
          Length = 958

 Score = 30.8 bits (68), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 28/107 (26%), Positives = 48/107 (44%), Gaps = 9/107 (8%)

Query: 157 EIPELFKANFEGSSTPPPYQESVPSQNPVK--NQPSFLHRVQDCNQDV--LFADLQKNGE 212
           +I +LF+   + S      +E +     +K  NQ + L +  DCNQ    L  ++ +N  
Sbjct: 450 DIQDLFRIIQKFSFGQGGAEELIQVAQSLKSSNQIAMLLKDCDCNQMTRKLLDEIIENLI 509

Query: 213 IDSQAAEEAFLQQYPTPDLPVYLDSSFLNAVFRGFQEKNDTKSKLNH 259
            D+   EE      PT D+P ++D +   A      E  D  +K+N+
Sbjct: 510 FDNLLIEEILKGILPTVDIPTFVDENINTA-----SENTDNNNKINY 551

>Klac_YGOB_Anc_7.168 Chr2 (1011211..1012734) [1524 bp, 507 aa] {OFF}
           ANNOTATED BY YGOB -
          Length = 507

 Score = 30.4 bits (67), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 24/46 (52%)

Query: 16  YLPAGVYKFQFLINGELRHSEFLPTATDSFGNCVNWFEVVAGHKVI 61
           YL  G+ K  +++N  L  +E LP AT   G+   +F V   + +I
Sbjct: 155 YLEKGLVKKIYIVNKYLVEAELLPEATQHLGSGNGFFSVPTANPII 200

>Klac_YGOB_Anc_7.168b Chr2 (1011211..1012701,1012704..1013552) [2340
           bp, 779 aa] {ON} ANNOTATED BY YGOB -
          Length = 779

 Score = 30.4 bits (67), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 24/46 (52%)

Query: 16  YLPAGVYKFQFLINGELRHSEFLPTATDSFGNCVNWFEVVAGHKVI 61
           YL  G+ K  +++N  L  +E LP AT   G+   +F V   + +I
Sbjct: 155 YLEKGLVKKIYIVNKYLVEAELLPEATQHLGSGNGFFSVPTANPII 200

>CAGL0J08349g Chr10 complement(829222..832233) [3012 bp, 1003 aa]
           {ON} similar to uniprot|P53836 Saccharomyces cerevisiae
           YNL278w CAF120 and similar to uniprot|Q06315
           Saccharomyces cerevisiae YLR187w
          Length = 1003

 Score = 30.4 bits (67), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 33/62 (53%), Gaps = 2/62 (3%)

Query: 118 DYTGLCSRTDLAKPELRHKNTSSYDLLAPVPRPVYEYSNEIPE-LFKANFEGSSTPPPYQ 176
           +Y  L  R + A P  R +N +S D ++ + R + E+  E P+ + K NF GSS   P Q
Sbjct: 604 NYNKLDRRFNDANPRQRGENDASSDEISEMARSINEFGFEHPQKVMKGNF-GSSGTLPIQ 662

Query: 177 ES 178
           + 
Sbjct: 663 DG 664

>Kwal_23.5070 s23 complement(996522..997472) [951 bp, 316 aa] {ON}
           YPL015C (HST2) - similar to Sir2p [contig 7] FULL
          Length = 316

 Score = 29.6 bits (65), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 31/82 (37%), Gaps = 7/82 (8%)

Query: 120 TGLCSRTDLAKPELRHKNTSSYDLLAPVPRPVYEYSNEIPELFKANFEGSSTPPPYQESV 179
            G    T    P+ R   T  YD LA +  P  E   +I E F+ N      P P+    
Sbjct: 28  VGAGISTSCGIPDFRSPGTGLYDNLAKLNLPFAEAVFDI-EFFQEN------PRPFYALA 80

Query: 180 PSQNPVKNQPSFLHRVQDCNQD 201
               P   QPS  HR+    QD
Sbjct: 81  KELYPGNYQPSSFHRLMRVFQD 102

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.134    0.406 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 36,187,912
Number of extensions: 1675604
Number of successful extensions: 4852
Number of sequences better than 10.0: 73
Number of HSP's gapped: 4959
Number of HSP's successfully gapped: 107
Length of query: 309
Length of database: 53,481,399
Length adjustment: 109
Effective length of query: 200
Effective length of database: 40,982,805
Effective search space: 8196561000
Effective search space used: 8196561000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 65 (29.6 bits)