Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_34.159895.348ON50650626220.0
KLTH0H14784g5.348ON51449212931e-174
SAKL0G08910g5.348ON5055167341e-90
Ecym_81855.348ON4713444222e-45
Suva_2.4865.348ON4153853972e-42
Skud_4.5835.348ON4153723902e-41
TDEL0E027905.348ON4112643814e-40
AGR348W5.348ON5423393822e-39
Smik_4.5765.348ON4153883728e-39
YDR317W (HIM1)5.348ON4143773561e-36
ZYRO0F00550g5.348ON4152833421e-34
Kpol_1051.45.348ON4264353377e-34
CAGL0H07161g5.348ON4242642785e-26
TPHA0D020605.348ON4962582569e-23
KAFR0C018805.348ON3451562154e-18
KLLA0B10120g5.348ON3482581986e-16
TBLA0A031005.348ON3721561543e-10
KLTH0H00264g7.148ON222124980.001
YER004W (FMP52)7.148ON23182880.022
Ecym_44797.148ON224120880.023
ZYRO0D09548g7.148ON225147870.031
Suva_5.917.148ON22980860.039
TBLA0A105007.148ON237200850.049
TBLA0F033107.148ON161129780.21
Smik_5.1187.148ON23180770.46
Skud_5.1037.148ON22780770.52
NCAS0E02080singletonON22595731.6
Kwal_47.188627.148ON22475722.3
Kpol_312.97.148ON22175712.4
KLTH0F01826g1.60ON66350732.9
SAKL0D02992g3.275ON58851714.0
TPHA0L007607.148ON22677677.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_34.15989
         (506 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_34.15989 s34 complement(147085..148605) [1521 bp, 506 aa] {...  1014   0.0  
KLTH0H14784g Chr8 (1283834..1285378) [1545 bp, 514 aa] {ON} weak...   502   e-174
SAKL0G08910g Chr7 complement(761626..763143) [1518 bp, 505 aa] {...   287   1e-90
Ecym_8185 Chr8 complement(383906..385321) [1416 bp, 471 aa] {ON}...   167   2e-45
Suva_2.486 Chr2 (859579..860826) [1248 bp, 415 aa] {ON} YDR317W ...   157   2e-42
Skud_4.583 Chr4 (1038472..1039719) [1248 bp, 415 aa] {ON} YDR317...   154   2e-41
TDEL0E02790 Chr5 complement(536193..537428) [1236 bp, 411 aa] {O...   151   4e-40
AGR348W Chr7 (1377726..1379354) [1629 bp, 542 aa] {ON} Syntenic ...   151   2e-39
Smik_4.576 Chr4 (1028647..1029894) [1248 bp, 415 aa] {ON} YDR317...   147   8e-39
YDR317W Chr4 (1102184..1103428) [1245 bp, 414 aa] {ON}  HIM1Prot...   141   1e-36
ZYRO0F00550g Chr6 complement(51742..52989) [1248 bp, 415 aa] {ON...   136   1e-34
Kpol_1051.4 s1051 (8692..9972) [1281 bp, 426 aa] {ON} (8692..997...   134   7e-34
CAGL0H07161g Chr8 complement(704823..706097) [1275 bp, 424 aa] {...   111   5e-26
TPHA0D02060 Chr4 (424797..426287) [1491 bp, 496 aa] {ON} Anc_5.3...   103   9e-23
KAFR0C01880 Chr3 complement(374180..375217) [1038 bp, 345 aa] {O...    87   4e-18
KLLA0B10120g Chr2 (886187..887233) [1047 bp, 348 aa] {ON} some s...    81   6e-16
TBLA0A03100 Chr1 (739771..740889) [1119 bp, 372 aa] {ON} Anc_5.3...    64   3e-10
KLTH0H00264g Chr8 complement(23047..23715) [669 bp, 222 aa] {ON}...    42   0.001
YER004W Chr5 (159580..160275) [696 bp, 231 aa] {ON}  FMP52Protei...    39   0.022
Ecym_4479 Chr4 complement(973594..974268) [675 bp, 224 aa] {ON} ...    39   0.023
ZYRO0D09548g Chr4 (812531..813208) [678 bp, 225 aa] {ON} similar...    38   0.031
Suva_5.91 Chr5 (135337..136023) [687 bp, 229 aa] {ON} YER004W (R...    38   0.039
TBLA0A10500 Chr1 (2585576..2586289) [714 bp, 237 aa] {ON} Anc_7....    37   0.049
TBLA0F03310 Chr6 complement(814437..814922) [486 bp, 161 aa] {ON...    35   0.21 
Smik_5.118 Chr5 (163900..164595) [696 bp, 231 aa] {ON} YER004W (...    34   0.46 
Skud_5.103 Chr5 (156788..157471) [684 bp, 227 aa] {ON} YER004W (...    34   0.52 
NCAS0E02080 Chr5 complement(399088..399765) [678 bp, 225 aa] {ON}      33   1.6  
Kwal_47.18862 s47 complement(1003035..1003709) [675 bp, 224 aa] ...    32   2.3  
Kpol_312.9 s312 (21577..22242) [666 bp, 221 aa] {ON} (21577..222...    32   2.4  
KLTH0F01826g Chr6 (142334..144325) [1992 bp, 663 aa] {ON} simila...    33   2.9  
SAKL0D02992g Chr4 (247577..249343) [1767 bp, 588 aa] {ON} highly...    32   4.0  
TPHA0L00760 Chr12 (143784..144464) [681 bp, 226 aa] {ON} Anc_7.1...    30   7.9  

>Kwal_34.15989 s34 complement(147085..148605) [1521 bp, 506 aa] {ON}
           YDR317W - Hypothetical ORF [contig 272] FULL
          Length = 506

 Score = 1014 bits (2622), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 492/506 (97%), Positives = 492/506 (97%)

Query: 1   MADENEEKRAPCKSVVKHRFRDRSGSIFKPRREVTDQQQRAIRHDQILISPQQRSLVQIA 60
           MADENEEKRAPCKSVVKHRFRDRSGSIFKPRREVTDQQQRAIRHDQILISPQQRSLVQIA
Sbjct: 1   MADENEEKRAPCKSVVKHRFRDRSGSIFKPRREVTDQQQRAIRHDQILISPQQRSLVQIA 60

Query: 61  RNADSEVLNVPSNRTVDSXXXXXXXXXXXXXXAANLAQPWVYLNATNDLQRKISSLFPFS 120
           RNADSEVLNVPSNRTVDS              AANLAQPWVYLNATNDLQRKISSLFPFS
Sbjct: 61  RNADSEVLNVPSNRTVDSTLIFGITGLTGGLIAANLAQPWVYLNATNDLQRKISSLFPFS 120

Query: 121 DQLEKHHHFMRRTRSPLCNLLTKEKSVEVTKNLFCFTRRSVTLEQICLDGLDASWEHSID 180
           DQLEKHHHFMRRTRSPLCNLLTKEKSVEVTKNLFCFTRRSVTLEQICLDGLDASWEHSID
Sbjct: 121 DQLEKHHHFMRRTRSPLCNLLTKEKSVEVTKNLFCFTRRSVTLEQICLDGLDASWEHSID 180

Query: 181 YKGSKMVCSKENLSCEEPFVKRGTTTFFQDASDAPAVTLTIQLQKFTYHLNYDNSRDVHG 240
           YKGSKMVCSKENLSCEEPFVKRGTTTFFQDASDAPAVTLTIQLQKFTYHLNYDNSRDVHG
Sbjct: 181 YKGSKMVCSKENLSCEEPFVKRGTTTFFQDASDAPAVTLTIQLQKFTYHLNYDNSRDVHG 240

Query: 241 ETCRHTLMIQLRVNIILIVEEDSQKWPMLLTRIFGKHASKRPLIVKDTEEPILWTAPPLT 300
           ETCRHTLMIQLRVNIILIVEEDSQKWPMLLTRIFGKHASKRPLIVKDTEEPILWTAPPLT
Sbjct: 241 ETCRHTLMIQLRVNIILIVEEDSQKWPMLLTRIFGKHASKRPLIVKDTEEPILWTAPPLT 300

Query: 301 QINTMVSSLGSKSFEKKKPKISRHFADYELNMLLAHAFCKDKTRGLEKKIVIITSFNNLF 360
           QINTMVSSLGSKSFEKKKPKISRHFADYELNMLLAHAFCKDKTRGLEKKIVIITSFNNLF
Sbjct: 301 QINTMVSSLGSKSFEKKKPKISRHFADYELNMLLAHAFCKDKTRGLEKKIVIITSFNNLF 360

Query: 361 LSSTSDYFQSKLMLEQDLVTKVQALDKLVLLRPGPLVGNHTHQLQSPSIIDKPSFIPTAM 420
           LSSTSDYFQSKLMLEQDLVTKVQALDKLVLLRPGPLVGNHTHQLQSPSIIDKPSFIPTAM
Sbjct: 361 LSSTSDYFQSKLMLEQDLVTKVQALDKLVLLRPGPLVGNHTHQLQSPSIIDKPSFIPTAM 420

Query: 421 FKVLKFKKNCIERKLQLLREISQVGIRTKLSELMARLAYQRSCSPLLGHVVPAYKVAFVA 480
           FKVLKFKKNCIERKLQLLREISQVGIRTKLSELMARLAYQRSCSPLLGHVVPAYKVAFVA
Sbjct: 421 FKVLKFKKNCIERKLQLLREISQVGIRTKLSELMARLAYQRSCSPLLGHVVPAYKVAFVA 480

Query: 481 SIRAVFSPDSASFVELIKSDEIEKMA 506
           SIRAVFSPDSASFVELIKSDEIEKMA
Sbjct: 481 SIRAVFSPDSASFVELIKSDEIEKMA 506

>KLTH0H14784g Chr8 (1283834..1285378) [1545 bp, 514 aa] {ON} weakly
           similar to uniprot|Q06674 Saccharomyces cerevisiae
           YDR317W Hypothetical ORF
          Length = 514

 Score =  502 bits (1293), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 243/492 (49%), Positives = 332/492 (67%), Gaps = 3/492 (0%)

Query: 18  HRFRDRSGSIFKPRREVTDQQQRAIRHDQILISPQQRSLVQIARNADSEVLNVPSNRTVD 77
            R + +SGSIFKPR+E    +Q AIRHDQILI P+Q S V+   +    ++++ + R  D
Sbjct: 22  QRLKGKSGSIFKPRQETPIHRQNAIRHDQILIWPRQPSPVRSTDDLADGMVSLSTQRVTD 81

Query: 78  SXXXXXXXXXXXXXXAANLAQPWVYLNATNDLQRKISSLFPFS-DQLEKHHHFMRRTRSP 136
           +               ANLAQPW+YLNATNDLQ K+ SL+P   ++  KH+ F+++ +SP
Sbjct: 82  NVLILGATGLTGSLILANLAQPWIYLNATNDLQSKVDSLYPADLERFTKHNIFVKKPKSP 141

Query: 137 LCNLLTKEKSVEVTKNLFCFTRRSVTLEQICLDGLDASWEHSIDYKGSKMVCSKENLSCE 196
           LCN+L + KS+EVTKNL+C  RR + +E + LDGLDASWEH++  KG  ++C K  +S +
Sbjct: 142 LCNILVRRKSIEVTKNLYCLARRPIAVEGMPLDGLDASWEHTVRCKGFDLICGKGGISRD 201

Query: 197 EPFVKRGTTTFFQDASDAPAVTLTIQLQKFTYHLNYDNSRDVHGETCRHTLMIQLRVNII 256
               +           + P   + +QLQ F++ L Y+NSRD HG+TC H LM++L +N+I
Sbjct: 202 CTLERNAAMYELASTHNCPGREIILQLQSFSFKLVYENSRDPHGDTCGHALMVKLNINVI 261

Query: 257 LIVEEDSQKWPMLLTRIFGKHASKRPLI--VKDTEEPILWTAPPLTQINTMVSSLGSKSF 314
            +++ DSQ+WP LLT +FG+   KR LI   +  E    W  P L  + T+VS+LGS   
Sbjct: 262 CVIDTDSQRWPALLTDVFGEQPMKRGLIPQGQGLEGISHWEFPSLGDVGTLVSALGSTRH 321

Query: 315 EKKKPKISRHFADYELNMLLAHAFCKDKTRGLEKKIVIITSFNNLFLSSTSDYFQSKLML 374
           +++K  I RH+ DYELN+ LA  FC+ K RG  KKIV++TSFN+  LS+ S+YFQ+KL L
Sbjct: 322 QERKSSIPRHYVDYELNLTLAQEFCQRKARGTRKKIVVVTSFNSSLLSTVSNYFQTKLKL 381

Query: 375 EQDLVTKVQALDKLVLLRPGPLVGNHTHQLQSPSIIDKPSFIPTAMFKVLKFKKNCIERK 434
           EQDL TKV  +D LVLLRPGPLVGNHT   Q+P   +K +F+P A+F +L  KK C +RK
Sbjct: 382 EQDLYTKVHGMDNLVLLRPGPLVGNHTPHAQTPPATNKFTFLPAALFHILVLKKRCFDRK 441

Query: 435 LQLLREISQVGIRTKLSELMARLAYQRSCSPLLGHVVPAYKVAFVASIRAVFSPDSASFV 494
           ++LLR++ +VG+R KLSEL ARLAYQ  C  L+  V  A+KVAF A+ RA++SPDSASFV
Sbjct: 442 VRLLRDLMKVGLRAKLSELGARLAYQHPCLQLVSSVNAAHKVAFFAASRAIYSPDSASFV 501

Query: 495 ELIKSDEIEKMA 506
           ELIKSDEIEKMA
Sbjct: 502 ELIKSDEIEKMA 513

>SAKL0G08910g Chr7 complement(761626..763143) [1518 bp, 505 aa] {ON}
           weakly similar to uniprot|Q06674 Saccharomyces
           cerevisiae YDR317W Hypothetical ORF
          Length = 505

 Score =  287 bits (734), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 195/516 (37%), Positives = 282/516 (54%), Gaps = 46/516 (8%)

Query: 13  KSVVKHRFRDRSGSIFKPRREVTDQQQRAIRHDQILISPQQRSLVQIARNADSEVLNVPS 72
           K ++K R R++   +FK   + +D    A    Q L+      L  I        L  P 
Sbjct: 14  KQLLKERIREKRSMLFKNAPDASD---VAANDHQHLVEKSPPELPDIEFEQQCGSLTTP- 69

Query: 73  NRTVDSXXXXXXXXXXXXXXAANLAQPWVYLNATNDLQRKISSLFPFSD-QLEKHHHFMR 131
           N   DS                +LA+PW+YL  TND+Q KI  +F   D   E +   ++
Sbjct: 70  NLLTDSYLLLGTTGLTGGIILNSLAEPWLYLGTTNDVQDKIQMMFEAGDLSSESNPPNVK 129

Query: 132 RTRSPLCNLLTKEKSVEVTKNLFCFTRRSVTLE-QICLDGLDASWEHSIDYKGSKMVCSK 190
           RT      +L  EKS+E+TKNLFCF R+   LE     + ++  WE+SIDYKG+K    K
Sbjct: 130 RT---FGQILRGEKSIEITKNLFCFNRKLALLEIPSTPEYINDYWEYSIDYKGTKYHSKK 186

Query: 191 ENLSCEEPFVKRGTTTFFQDASDAPAVTLTIQLQKFTYHLNYDNSRDVHGETCR---HTL 247
            N+S   P +K G        S+  ++T   QLQ+F Y   +    D   +  R    TL
Sbjct: 187 NNISFGVPTLKFGKLV----NSNENSITNQCQLQQFDYKFEFQR-EDPSMQNLRTRAQTL 241

Query: 248 MIQLRVNIILIVEEDSQKWPMLLTRIFGKHASKRPLIVKDTEEPILWTAPPLTQINTMVS 307
           +I L++N+I I+E +S+ WP+LL   FG   +   L V+  + P     P L+++NT+VS
Sbjct: 242 IISLKINVIQILEPNSKLWPLLLHSTFGDTDTNVALHVQG-QVPTPMIFPSLSKVNTLVS 300

Query: 308 SLGSKSFEKKKPKISRHFADYELNMLLAHAFCKDKTR-GLEKKIVIITSFNNLFLSSTSD 366
           +LGS +FE+KK  +SR F DY+LN  +A  F  + +  G++KK+V+ITSFNN  LSSTS 
Sbjct: 301 ALGSTTFEQKKSHVSRDFVDYDLNFKMAEEFTTNSSEHGIKKKVVVITSFNNFALSSTSP 360

Query: 367 YFQSKLMLEQDLVTKVQALDKLVLLRPGPLVGNHTHQLQSPSIIDKPSFIP-------TA 419
           YF +KL LEQDL T++  LD+LV+LRPGPL+G+HT           P FIP         
Sbjct: 361 YFHTKLKLEQDLATRIPELDELVILRPGPLIGSHT-----------PEFIPGDPPKSTNG 409

Query: 420 MFKVLK----FKKNCIERKLQLLREISQVGIRTKLSELMARLAYQRSCSPLLGHVVPAYK 475
           + K L     +KK C + K   L+ ++QVG++TK++E+ ARL Y+ SCS + G+ VP  K
Sbjct: 410 LLKPLSTVCYYKKACYDHKRHFLQSVTQVGLKTKMTEVFARLIYRSSCSWMFGYSVPVAK 469

Query: 476 VAFVASIRAV----FSPDSASF-VELIKSDEIEKMA 506
           VA VA+IR +      P+S    V+LIKSDE++ M 
Sbjct: 470 VAVVAAIRTIQKIQNDPESGGIRVQLIKSDELDVMV 505

>Ecym_8185 Chr8 complement(383906..385321) [1416 bp, 471 aa] {ON}
           similar to Ashbya gossypii AGR348W
          Length = 471

 Score =  167 bits (422), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 109/344 (31%), Positives = 177/344 (51%), Gaps = 43/344 (12%)

Query: 147 VEVTKNLFCFTRRSVTLEQICLDGLDASWEHSIDYKGSKMVCSKENLSCEEPFVKRGTTT 206
           +++TKN++CF RR  T++   +  L  +W   ++Y G   +  K +L  ++   + G   
Sbjct: 131 LKLTKNIWCFNRRLKTVD-FSISKLPPTWTAVVNYGGEPHIIRKYDLKIKQHITEIGKLD 189

Query: 207 FFQDASDAPAVTLTIQLQKFTYHLNY--DNSRDVHGETCRHTLMIQLRVNIILIVEEDSQ 264
                       L  Q  +F + L    D  ++V              VN+  I++ DS+
Sbjct: 190 -----------GLEFQWDQFDWELKLPTDEVKNV-------------TVNVFQIIQNDSK 225

Query: 265 KWPMLLTRIFGKHASKRPLIVKDTEEPILWTAPPLTQINTMVSSLGSKSFEKKKPKISRH 324
           KW    + +F    +++PL   D  E  L   P + Q+ T++S+LGS S+E +K K  R 
Sbjct: 226 KWDKTFSELF--TGNRKPL--NDRIEVYL---PSIDQVETLISTLGSSSWESRKMKTPRS 278

Query: 325 FADYELNMLLAHAFCKDKTRGLEKKIVIITSFNNLFLSSTSDYFQSKLMLEQDLVTKVQA 384
           F DY LNM +A  F  D+ + L K +VI+TSFNNL L   S YF++K  LE DL   V  
Sbjct: 279 FVDYTLNMDMAKVFAPDQKKSLIKHMVIVTSFNNLALGVLSPYFRTKQKLENDLTYDVPG 338

Query: 385 LDKLVLLRPGPLVGNHTHQLQSPSIIDKPSFIPTA---MFKVLKFKKNCIERKLQLLREI 441
           L  L +LRPGPL+G H  Q     II  P  +P     ++K   +K++ ++ KL  L ++
Sbjct: 339 LTHLTILRPGPLIGQHGKQ-----IILAPQ-LPVGSGVLYKCYAWKRSLLKAKLHWLSQV 392

Query: 442 SQVGIRTKLSELMARLAYQRSCSPLLGHVVPAYKVAFVASIRAV 485
             VG   K++EL+A+  Y    + ++G+ +P+ KVA +A+  A+
Sbjct: 393 KDVGPSKKVTELIAKATYHLPGNWIVGYSIPSSKVARIAAKEAM 436

>Suva_2.486 Chr2 (859579..860826) [1248 bp, 415 aa] {ON} YDR317W
           (REAL)
          Length = 415

 Score =  157 bits (397), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 117/385 (30%), Positives = 190/385 (49%), Gaps = 46/385 (11%)

Query: 145 KSVEVTKNLFCFTRRSVTLEQICLDGLDASWEHSIDYKGSKM-------------VCSKE 191
           ++V + K++FC  R+SVT ++  +  +D     SI +KG +               C+  
Sbjct: 54  ENVVLNKHIFCINRKSVTEQKSFIKTIDYVNMKSIIWKGGRYYLRSRGENETKRETCN-S 112

Query: 192 NLSCEEPFVKRGTTTFFQDASDAPAVTLTIQLQKFTYHLNYDNSRDVHGETCRHTLMIQL 251
           N  C + F + G      D       +     ++F+Y L+Y   +D        +  I+ 
Sbjct: 113 NTFCYDDF-EEGIIRNSMDKDKKGTFSFAYNRKQFSYALHYACGKD-------ESFGIKY 164

Query: 252 RVNIILIVEEDSQKWPMLLTRIFGKHASKRPLIVKDTEEPILWTAPPLTQINTMVSSLGS 311
              +  +V   S  WP LL  +F          V   +     + P L  I TMV +LGS
Sbjct: 165 NFIVTQLVIPQSTSWPKLLPEVFSGTQKLERFDVDSRDYVSDKSLPALNSIGTMVCALGS 224

Query: 312 KSFEKKKPKISRHFADYELNMLLAHAFCKDKTRGLEKKIVIITSFNNLFLSSTSDYFQSK 371
            +   +K ++   F DY L+  LA  F    T   +KK+V+ITSFNN FLS T +YF+ K
Sbjct: 225 SAARVRKSQVPNSFVDYHLSFNLAQEF----TNTTDKKLVVITSFNNDFLSRTFEYFRIK 280

Query: 372 LMLEQDLVTKV-QALDKLVLLRPGPLVGNHTHQL-------QSPSIIDKPSFIPTAMFKV 423
             LE DL   +   L +L++LRPGP+ G H + +       Q+P++ ++  + P     +
Sbjct: 281 AKLENDLEEALPNKLKELIILRPGPMCGQHGNPVHVEMDIQQNPTLSERFFYYPRY---I 337

Query: 424 LKFKKNCIERKLQLLREISQVGIRTKLSELMARLAYQRSCSPLLGHVVPAYKVAFVASIR 483
           LK+K+ CI        E+ +VG+RT+LSE++A   Y+   S LLG+ VP  KV++VAS+ 
Sbjct: 338 LKYKQQCIS-------EVRKVGLRTRLSEVIASSIYRMPGSALLGYSVPVSKVSYVASLM 390

Query: 484 AVF--SPDSASFVELIKSDEIEKMA 506
           A+   S ++   VE+I S +I+ +A
Sbjct: 391 AIEKKSKEAGPKVEVINSYQIDMIA 415

>Skud_4.583 Chr4 (1038472..1039719) [1248 bp, 415 aa] {ON} YDR317W
           (REAL)
          Length = 415

 Score =  154 bits (390), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 114/372 (30%), Positives = 185/372 (49%), Gaps = 18/372 (4%)

Query: 144 EKSVEVTKNLFCFTRRSVTLEQICLDGLDASWEHSIDYKGSKMVCSKENLSCEEPFVKRG 203
           ++ V + K++FC  RR+VT ++  L  +D     SI +KG +    +   + +       
Sbjct: 53  KEDVVLNKHVFCINRRNVTEQKSFLKTIDYVNMKSITWKGGRYYL-RSRTANDNGRETSS 111

Query: 204 TTTFFQDASDAPAV-TLTIQLQKFTYHLNYDN---SRDVHGETCR--HTLMIQLRVNIIL 257
           T TFF D  +   +     + QK  +   Y+    S  +H   CR   +  I+    +  
Sbjct: 112 TDTFFYDNFEEGFIRGAAYEGQKGNFSFAYNQKQFSYSLH-YACRKEESFGIKYNFTVTQ 170

Query: 258 IVEEDSQKWPMLLTRIFGKHASKRPLIVKDTEEPILWTAPPLTQINTMVSSLGSKSFEKK 317
           ++   S+ WP LL+RIF K        + +       + P L  I TMV +LGS S   +
Sbjct: 171 LIIPPSESWPRLLSRIFSKEQKLEKFDIDNKTYVADKSLPSLRDIGTMVCTLGSTSARVR 230

Query: 318 KPKISRHFADYELNMLLAHAFCKDKTRGLEKKIVIITSFNNLFLSSTSDYFQSKLMLEQD 377
           + ++   F DY L   LA  F         K++V++TSFNN  L  T +YF+ K  LE D
Sbjct: 231 RTQVPNSFVDYHLVFSLAQEFANTTN----KRLVVVTSFNNDLLMRTFEYFRIKAKLEND 286

Query: 378 LVTKV-QALDKLVLLRPGPLVGNHTHQLQSPSIIDKPSFIPTAMFKVLKFKKNCIERKLQ 436
           L   +   L +LV+LRPGP+ G H   +     + +    PT   ++L + +  ++ K Q
Sbjct: 287 LEEALPNKLKELVILRPGPMCGQHGDPVNVKLDVQEN---PTFSERILYYPRYVLKYKKQ 343

Query: 437 LLREISQVGIRTKLSELMARLAYQRSCSPLLGHVVPAYKVAFVASIRAV--FSPDSASFV 494
            + E  +VG+RTKLSEL+A   Y+   S LLG+ VP  KV++V S++A+   S ++   V
Sbjct: 344 YISEARKVGLRTKLSELIASSIYRMPGSALLGYSVPVSKVSYVTSLKAIEKRSKEAGPKV 403

Query: 495 ELIKSDEIEKMA 506
           E+I S +I+ +A
Sbjct: 404 EMINSYQIDMIA 415

>TDEL0E02790 Chr5 complement(536193..537428) [1236 bp, 411 aa] {ON}
           Anc_5.348 YDR317W
          Length = 411

 Score =  151 bits (381), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 100/264 (37%), Positives = 149/264 (56%), Gaps = 18/264 (6%)

Query: 247 LMIQLRVNIILIVEEDSQKWPMLLTRIFGKHASKRPLIVKDTEEPILWTAPPLTQINTMV 306
           L+I     I+ I   DS KW  LL  IF    + R     D     L   PPL +I TM+
Sbjct: 160 LLITFNFVILQIACPDSSKWCELLPDIFSGCVALRSEAEPDGTTNKL---PPLDEIPTMI 216

Query: 307 SSLGSKSFEKKKPKISRHFADYELNMLLAHAFCKDKTRGLEKKIVIITSFNNLFLSSTSD 366
            +LG+ S   ++ K  RH+ DYEL   LA +F  +   G  K++VI+T+FNN+ +     
Sbjct: 217 CTLGAGS---RQSKAKRHYVDYELTFKLAQSF--NNCEG--KRLVIVTTFNNILIRHLLP 269

Query: 367 YFQSKLMLEQDLVTKVQA-LDKLVLLRPGPLVGNHTHQLQSPSIIDKPSFIPTAMFK-VL 424
           YF++K  LE DL  K++  L KLV+LRPGPLVG H   L     I       T M K +L
Sbjct: 270 YFRTKSKLENDLQHKLKPRLGKLVVLRPGPLVGEHGRPLTKSLTIGHS----TNMLKQIL 325

Query: 425 KFKKNCIERKLQLLREISQVGIRTKLSELMARLAYQRSCSPLLGHVVPAYKVAFVASIRA 484
            +K+ C + KL L +E  ++G RT+ SEL+AR  Y++  S +LG+ +PA K A+VA+ +A
Sbjct: 326 YYKEYCFQCKLALFKEFRRIGFRTRASELIARTMYRKPGSWMLGYCIPATKAAYVAASKA 385

Query: 485 V--FSPDSASFVELIKSDEIEKMA 506
               S +++  VE+I S++++ +A
Sbjct: 386 TDEASDEASDPVEIITSEQMDHIA 409

>AGR348W Chr7 (1377726..1379354) [1629 bp, 542 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR317W
          Length = 542

 Score =  151 bits (382), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 99/339 (29%), Positives = 171/339 (50%), Gaps = 41/339 (12%)

Query: 151 KNLFCFTRRSVTLEQICLDGLDASWEHSIDYKGSKMVCSKENLSCEEPFVKRGTTTFFQD 210
           +  +CF+R+   +E I +  L  +W   ++++G K V  K ++               + 
Sbjct: 205 RTFWCFSRKFQDVE-IDISNLPKTWTAIVEFEGEKHVIRKNDVR------------LIRH 251

Query: 211 ASDAPAVTLTIQLQKFTYHLNYD---NSRDVHGETCRHTLMIQLRVNIILIVEEDSQKWP 267
            S+   +   + L+      N+D    + +V   T          +N++ +V+ DS++WP
Sbjct: 252 LSECGGM---LGLKCHWDQYNWDVVLTTGEVRNAT----------INVVQVVQPDSRRWP 298

Query: 268 MLLTRIFGKHASKRPLIVKDTEEPILWTAPPLTQINTMVSSLGSKSFEKKKPKISRHFAD 327
            L  ++F          V+          P +T+I T++S+LGS S+E +K K  R F D
Sbjct: 299 DLFNKMFTGG-------VRTFNAYSEIYMPAVTEIETLISTLGSTSWEARKSKAPRAFVD 351

Query: 328 YELNMLLAHAFCKDKTRGLEKKIVIITSFNNLFLSSTSDYFQSKLMLEQDLVTKVQALDK 387
           Y LNM +A  F  D  +G  K +VI+TSFN+L L   S YF++K  LE DL   V  L  
Sbjct: 352 YTLNMQMAKTFAPDPKKGTVKHMVIVTSFNHLALGMVSQYFRTKQRLENDLTYDVPGLTH 411

Query: 388 LVLLRPGPLVGNHTHQ-LQSPSIIDKPSFIPTAMFKVLKFKKNCIERKLQLLREISQVGI 446
           L +LRPGPL+G H  + + SP+  D  +     + +   +KKN +  +   L ++ +VG 
Sbjct: 412 LTILRPGPLLGEHGSKPVISPTNPDTGNM----LTRCYTYKKNVMRTQFNWLAQVKEVGP 467

Query: 447 RTKLSELMARLAYQRSCSPLLGHVVPAYKVAFVASIRAV 485
            TK++EL+A+  Y    + ++G+ +PA +VA +A+  A+
Sbjct: 468 TTKVTELVAKATYHLPGNWIVGYSIPAGRVAQIAAQEAL 506

>Smik_4.576 Chr4 (1028647..1029894) [1248 bp, 415 aa] {ON} YDR317W
           (REAL)
          Length = 415

 Score =  147 bits (372), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 118/388 (30%), Positives = 192/388 (49%), Gaps = 39/388 (10%)

Query: 139 NLLTKEKS-VEVTKNLFCFTRRSVTLEQICLDGLDASWEHSIDYK------------GSK 185
           N LT+ K  V + K++FC  RRS+T E+  +  +D     SI +K             +K
Sbjct: 47  NSLTEIKGDVVLNKHVFCINRRSITEEKSFMKSIDYINMKSITWKRGRYYLRSRNENETK 106

Query: 186 MVCSKENLSC----EEPFVKRGTTTFFQDASDAPAVTLTIQLQKFTYHLNYDNSRDVHGE 241
            + S  +  C    EE F+K+ T     D +      +    ++F+Y L Y + +     
Sbjct: 107 KIPSNPDTFCYDAFEEGFIKKTT-----DENGKDNFCIPYNQKRFSYALYYASGK----- 156

Query: 242 TCRHTLMIQLRVNIILIVEEDSQKWPMLLTRIFGKHASKRPLIVKDTEEPILWTAPPLTQ 301
             +    I  +  +  ++   S+ W  LL+ IF            +       + P L  
Sbjct: 157 --KEGFEIIYKFTVTQLIIPRSENWSRLLSYIFSGTQKLEKFDANNKTYVAGKSLPNLRD 214

Query: 302 INTMVSSLGSKSFEKKKPKISRHFADYELNMLLAHAFCKDKTRGLEKKIVIITSFNNLFL 361
           I+TMV +LGS S   ++ ++   F DY L   LA  F    T   +K++VIITSFNN FL
Sbjct: 215 ISTMVCTLGSTSARVRRTQVPNSFVDYSLPFSLAQEF----TNTTDKRLVIITSFNNKFL 270

Query: 362 SSTSDYFQSKLMLEQDLVTKVQALDK-LVLLRPGPLVGNHTHQLQSPSIIDKPSFIPTAM 420
           S+T +YF+ K  LE DL   +    K L++LRPGP+ G H + ++    + +     T  
Sbjct: 271 STTFEYFRIKAKLENDLEEVLPNKPKELIILRPGPMCGQHGNSIKVELDVQEN---LTFS 327

Query: 421 FKVLKFKKNCIERKLQLLREISQVGIRTKLSELMARLAYQRSCSPLLGHVVPAYKVAFVA 480
            K+L + +  +  K Q + E+ ++G+RTKLSEL+A   Y+   S LLG+ VP  KV++VA
Sbjct: 328 DKILYYPRYLLMYKKQYISEVRKIGLRTKLSELIASSTYRMPGSALLGYSVPVSKVSYVA 387

Query: 481 SIRAV--FSPDSASFVELIKSDEIEKMA 506
           S+ A+   S ++   +E+I S +I+ +A
Sbjct: 388 SLMAIERKSKEAGPKMEVINSYQIDMIA 415

>YDR317W Chr4 (1102184..1103428) [1245 bp, 414 aa] {ON}  HIM1Protein
           of unknown function involved in DNA repair
          Length = 414

 Score =  141 bits (356), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 111/377 (29%), Positives = 181/377 (48%), Gaps = 39/377 (10%)

Query: 146 SVEVTKNLFCFTRRSVTLEQICLDGLDASWEHSIDYKGSKM------------VCSKENL 193
           +V + K++FC  RR +  E+  +  +D     S+ ++G +             V S  N 
Sbjct: 55  NVVLNKHVFCVNRRCINEEKSFMKTIDYINMRSVTWQGGRYYLRSRKEKDTEKVPSSPNT 114

Query: 194 SC----EEPFVKRGTTTFFQDASDAPAVTLTIQLQKFTYHLNYDNSRDVHGETCRHTLMI 249
            C    EE F+K       +D       +     ++F+Y L+Y   ++   E   +  + 
Sbjct: 115 FCYDNFEEGFIKNTPEERGKDG-----YSFVYNQKQFSYTLHYACGKEKGIEIICNFTVT 169

Query: 250 QLRVNIILIVEEDSQKWPMLLTRIFGKHASKRPLIVKDTEEPILWTAPPLTQINTMVSSL 309
           QL +         S+ WP LL RIF          + +       + P L  I+TMV SL
Sbjct: 170 QLII-------PRSETWPKLLPRIFSGTQKLEKFDIDNKNYVPGRSLPSLCDISTMVCSL 222

Query: 310 GSKSFEKKKPKISRHFADYELNMLLAHAFCKDKTRGLEKKIVIITSFNNLFLSSTSDYFQ 369
           GS S   ++ ++   FADY L   LA  F    T    K++V+ T+FNN FLS T +YF+
Sbjct: 223 GSTSARVRRTQVPSSFADYYLPFNLAQEF----TNTTNKRLVVTTAFNNDFLSKTFEYFR 278

Query: 370 SKLMLEQDLVTKV-QALDKLVLLRPGPLVGNHTHQLQSPSIIDKPSFIPTAMFKVLKFKK 428
            K  LE DL   +   L +LV+LRPGP+ G H + +      +  +F+     K+  +  
Sbjct: 279 IKAKLENDLDEALPNKLKELVILRPGPMCGQHGNPINVELGKENSTFLE----KIFYYPH 334

Query: 429 NCIERKLQLLREISQVGIRTKLSELMARLAYQRSCSPLLGHVVPAYKVAFVASIRAVF-- 486
             +  K + + E  ++G+RTKLSE++A   Y+   S LLG+ VP  KV++VAS+ A+   
Sbjct: 335 YLLVYKKKYISEARRIGLRTKLSEIIASSIYRMPGSALLGYAVPVSKVSYVASLMAIERK 394

Query: 487 SPDSASFVELIKSDEIE 503
           S ++   +E+I S +I+
Sbjct: 395 SKEAGPKLEVISSYQID 411

>ZYRO0F00550g Chr6 complement(51742..52989) [1248 bp, 415 aa] {ON}
           similar to uniprot|Q06674 Saccharomyces cerevisiae
           YDR317W Hypothetical ORF
          Length = 415

 Score =  136 bits (342), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 96/283 (33%), Positives = 146/283 (51%), Gaps = 30/283 (10%)

Query: 203 GTTTFFQDAS-------DAPAVTLTIQLQKFTYHLNYDNSRDVHGETCRHTLMIQLRVNI 255
           G   F +D +       D  +VTL  +  + +Y L Y  S+D+        L+I     I
Sbjct: 124 GNNVFEEDGTIQLTKTVDNRSVTLRFRQTRKSYQLEYI-SKDLKN------LLITFHFTI 176

Query: 256 ILIVEEDSQKWPMLLTRIFGKHASKRPLIVKDTEEPILWTAPPLTQINTMVSSLGSKSFE 315
           + +V EDS +W  LL  IF       P     T   +    P L Q+ TM+ +LG  S  
Sbjct: 177 VQLVFEDSTRWADLLPSIFSGEVELVPEESNHTSPRL----PHLDQVKTMICTLGPNSSS 232

Query: 316 KKKPKISRHFADYELNMLLAHAF--CKDKTRGLEKKIVIITSFNNLFLSSTSDYFQSKLM 373
            K     R+F +Y+L   +   F  C+DK      ++VI+TSFNN  +S    YF++K  
Sbjct: 233 TKHSHYDRYFVEYQLTFQIVQNFASCEDK------RLVIMTSFNNSLVSHIFPYFKAKYQ 286

Query: 374 LEQDLVTKVQ-ALDKLVLLRPGPLVGNHTHQLQSPSIIDKPSFIPTAMFKVLKFKKNCIE 432
           LE DL  KV  AL +LV+LRPGP+VGNH + L    +  +  + P+   ++  +K+ C E
Sbjct: 287 LENDLQNKVAPALAQLVVLRPGPIVGNHVN-LNDRDL--RLRYSPSLCEQLKHYKEWCWE 343

Query: 433 RKLQLLREISQVGIRTKLSELMARLAYQRSCSPLLGHVVPAYK 475
            K   ++EI ++G +TK SEL+A+  Y++  S +LG+ VPA K
Sbjct: 344 YKKSFVKEIRKIGFKTKASELVAKAMYRKPGSSVLGYCVPASK 386

>Kpol_1051.4 s1051 (8692..9972) [1281 bp, 426 aa] {ON} (8692..9972)
           [1281 nt, 427 aa]
          Length = 426

 Score =  134 bits (337), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 119/435 (27%), Positives = 206/435 (47%), Gaps = 80/435 (18%)

Query: 102 YLNATNDLQRKISSLFPFSD-QLEKHHHFMRRTRSPLCNLLTKEKSVEVTKNLFCFTRRS 160
           YL  +N++++K++   P SD ++  +H  M               ++++ KN+FC  RRS
Sbjct: 42  YLLNSNEIKQKLN---PRSDIEIPSNHQKMN--------------TIKIVKNIFCINRRS 84

Query: 161 VTLEQICLDGLDA---------SWEHSID-----------YKGSKMVCSKENLSCEEPFV 200
            TL+    D L++           E+ +D           Y  +++   K N  CE PF 
Sbjct: 85  QTLDLFNKDALESVKVGRIKFKDLEYRLDKTPGETSYESSYLTNEIESGKINFDCEHPF- 143

Query: 201 KRGTTTFFQDASDAPAVTLTIQLQKFTYHLNYDNSRDVHGETCRHTLMIQLRVNIILIVE 260
                        +P   L+ +LQK    L Y            + L IQ  +++  I+ 
Sbjct: 144 -------------SP---LSFELQKKRAQLTYKAKEG-------NMLQIQFEISVYHIII 180

Query: 261 EDSQKWPMLLTRIFGKHASKRPLIVKDTEEPILWTA-PPLTQINTMVSSLGSKSFEKKKP 319
             S +WP LL RIF          V+D E  IL T  P L  I TM+SSLG    ++   
Sbjct: 181 PTSNQWPTLLPRIFNPATVIEK--VEDKENSILPTGLPDLKNIPTMISSLGLNHRQQITR 238

Query: 320 KISRHFADYELNMLLAHAFCKDKTRGLEKKIVIITSFNNLFLSSTSDYFQSKLMLEQDLV 379
           + S    D++L + L   F  +      KK+V+IT+FNN  +S    YF  K  +E+ L 
Sbjct: 239 EKSYRAIDFDLTLKLTQTFANNNN----KKLVVITTFNNKVVSKMFRYFHFKFKIEEALQ 294

Query: 380 TKVQA-LDKLVLLRPGPLVGNHTHQLQSPS---IIDKPSFIPTAMFKVLKFKKNCIERKL 435
            ++   L +LV+LRPGP+VG       +P    I+ K       + + +  KK  ++ KL
Sbjct: 295 NELNPKLSQLVILRPGPIVGVPMTDAINPEFNPILKKSD---NLVEQSILLKKYLLDYKL 351

Query: 436 QLLREISQVGIRTKLSELMARLAYQRSCSPLLGHVVPAYKVAFVASIRAVFSPDSASF-- 493
             L++    GI  +L++++A+  Y++  + +LG+ +PA KVA VA+++A+    ++++  
Sbjct: 352 ATLKKYRSTGIAPRLTDILAKTMYRKPGTSVLGYCIPATKVAKVAALKAIEPTIASTYSK 411

Query: 494 --VELIKSDEIEKMA 506
             V++I S +I+++ 
Sbjct: 412 PDVQIITSRQIDELV 426

>CAGL0H07161g Chr8 complement(704823..706097) [1275 bp, 424 aa] {ON}
           similar to uniprot|Q06674 Saccharomyces cerevisiae
           YDR317w
          Length = 424

 Score =  111 bits (278), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 82/264 (31%), Positives = 134/264 (50%), Gaps = 20/264 (7%)

Query: 224 QKFTYHLNYDNSRDVHGETCRHTLMIQLRVNIILIVEEDSQKWPMLLTRIFGKHASKRPL 283
           +++ Y+L Y ++         + L +    N I ++ ++S  WP ++  IF         
Sbjct: 157 KEYMYYLEYMSAEG-------NLLKLNFIFNHIQLIIKNSFSWPSVIPIIFSDEVEA--- 206

Query: 284 IVKDTEEPILWTAPPLTQINTMVSSLGSKSFEKKKPKISRHFADYELNMLLAHAFCKDKT 343
           I    + P+    P L+ I TM+S++G+ +   K    + +  DY+LN+ L  AF     
Sbjct: 207 ISFREKMPLKRYFPLLSDIKTMISTIGTTTNRNKISNTTYNDIDYQLNVDLVKAFSNTD- 265

Query: 344 RGLEKKIVIITSFNNLFLSSTSDYFQSKLMLEQDLVTKVQA-LDKLVLLRPGPLVGNHTH 402
              +K ++I+TSFNN  +S+ S YF+ K+ LE  L   +   L  L +LRPGPLVG H+ 
Sbjct: 266 ---DKSVIIVTSFNNTIISTVSPYFKIKMKLESTLANAITPPLKTLTILRPGPLVGRHSD 322

Query: 403 QLQSPSIIDKPSFIPTAMF-KVLKFKKNCIERKLQLLREISQVGIRTKLSELMARLAYQR 461
              +   I K S    ++F + L  KK  ++     + +I   G+  K SE++AR  Y+ 
Sbjct: 323 IYPTNDSILKNS----SLFERALLHKKAFLQNMECFVDDIRTGGMSIKASEIVARTFYRI 378

Query: 462 SCSPLLGHVVPAYKVAFVASIRAV 485
             S LLG+ +PA KVA+  SI AV
Sbjct: 379 PGSKLLGYCIPAQKVAYAISIAAV 402

>TPHA0D02060 Chr4 (424797..426287) [1491 bp, 496 aa] {ON} Anc_5.348
           YDR317W
          Length = 496

 Score =  103 bits (256), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 77/258 (29%), Positives = 128/258 (49%), Gaps = 13/258 (5%)

Query: 232 YDNSRDVHGETCRHTLMIQLRVNIILIVEEDSQKWPMLLTRIFGKHASKRPLIVKDTEEP 291
           YD+S  +   +    L I   + +  +   DS  WP LL  +F  +    P   K   E 
Sbjct: 222 YDSSL-IFASSSGDILKINFDLKLYHLSAVDSTIWPSLLPVLFDSNTKLVP--NKGLIEN 278

Query: 292 ILWTA---PPLTQINTMVSSLGSKSFEKKKPKISRHFADYELNMLLAHAFCKDKTRGLEK 348
           I  T    P L+++  M++SLGS+S   K         DY+LN+ L ++F        +K
Sbjct: 279 IDLTNEKLPLLSEVKVMLNSLGSRSHSPKNETFKN--IDYKLNLSLINSFNNTS----DK 332

Query: 349 KIVIITSFNNLFLSSTSDYFQSKLMLEQDLVTKV-QALDKLVLLRPGPLVGNHTHQLQSP 407
           K++IITS N    +  S Y   K++LE+DL T +   +++LV+LRPGPLVG        P
Sbjct: 333 KVIIITSVNKKIYTFFSRYLNYKMVLEEDLKTNLDNKINELVILRPGPLVGTPMTTKLIP 392

Query: 408 SIIDKPSFIPTAMFKVLKFKKNCIERKLQLLREISQVGIRTKLSELMARLAYQRSCSPLL 467
            +        +++ +++ +K+   + K+ LLR I   G     + ++A+  Y+R  + LL
Sbjct: 393 GLTAHLKRNDSSLKQLINYKRFAFDYKVALLRRIKYTGFEPTCTNILAKTFYRRPGTSLL 452

Query: 468 GHVVPAYKVAFVASIRAV 485
           G+ +PA KVA V   + +
Sbjct: 453 GYTIPASKVAEVMVFKGL 470

>KAFR0C01880 Chr3 complement(374180..375217) [1038 bp, 345 aa] {ON}
           Anc_5.348 YDR317W
          Length = 345

 Score = 87.4 bits (215), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 58/156 (37%), Positives = 88/156 (56%), Gaps = 6/156 (3%)

Query: 247 LMIQLRVNIILIVEEDSQKWPMLLTRIF-GKHASKRPLIVKDTEEPILWTAPPLTQINTM 305
           L +   V  + IV  +S+KWP LL  +F G++  K     KD   P L+    +  I+T+
Sbjct: 144 LNVTYNVFHVQIVYNESEKWPDLLPILFTGENEIKIARKRKDRLFPELFKLANINDISTV 203

Query: 306 VSSLGSKSFEKKKPKISRHFADYELNMLLAHAFCKDKTRGLEKKIVIITSFNNLFLSSTS 365
           V +LG+ S   KK  ++ +  DY+L   L  AF    T    KK++I+TSFNN  +S+  
Sbjct: 204 VCTLGASSATAKKQNMTVNKIDYDLTYNLIRAF----TTTENKKVIIVTSFNNALISNIF 259

Query: 366 DYFQSKLMLEQDLVTKVQ-ALDKLVLLRPGPLVGNH 400
            YF++KL LE DL T ++  + +L +LRPGP+ G H
Sbjct: 260 PYFRTKLRLENDLKTTLEPPIKELYILRPGPIKGKH 295

>KLLA0B10120g Chr2 (886187..887233) [1047 bp, 348 aa] {ON} some
           similarities with uniprot|Q06674 Saccharomyces
           cerevisiae YDR317W
          Length = 348

 Score = 80.9 bits (198), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 70/258 (27%), Positives = 118/258 (45%), Gaps = 43/258 (16%)

Query: 233 DNSRDVHGETCRHTLM-IQLRVNIILIVEEDSQKWPMLLTRIFGKHASKRPLIVKDTEEP 291
           ++S  +   T  H L+ I + V +  I E DS KW  ++            + + D    
Sbjct: 83  ESSNTISYSTTIHDLISICVNVEVTTIKEPDSTKWAQMI---------PHHIFINDPSAD 133

Query: 292 ILWTAPPLTQINTMVSSLGSKSFEKKKPKISRHFADYELNMLLAHAFCKDKTRGLEKKI- 350
           +           +++S LGS S   K+  ++R + D  LN+ +  A   +    L +K+ 
Sbjct: 134 L-----------SVISCLGSTSARSKRTGVARDWVDKILNLDILKAILNNDI--LSQKLS 180

Query: 351 --VIITSFNNLFLSSTSDYFQSKLMLEQDLVTKVQAL-----DKLVLLRPGPLVGNH--T 401
             +I+TSFNN  +S    YF++K    Q+L T  Q L       +V+LRPGPL+G H  T
Sbjct: 181 QYIIMTSFNNFAISRMFPYFKAK----QELETNTQFLLQNHRASIVILRPGPLIGKHGST 236

Query: 402 HQLQSPSIIDKPSFIPTAMFKVLKFKKNCIERKLQLLREISQVGIRTKLSELMARLAYQR 461
                P + D+       +  +L++KK      ++ + E   VGI T+ SEL+A+ +Y  
Sbjct: 237 SSFTVPELDDR------LLHSILRYKKAIFHHYVRRMNEWKDVGIATRTSELVAQFSYNM 290

Query: 462 SCSPLLGHVVPAYKVAFV 479
             +  +G+ V     A V
Sbjct: 291 PGAFFVGYPVKVLDCAHV 308

>TBLA0A03100 Chr1 (739771..740889) [1119 bp, 372 aa] {ON} Anc_5.348
           YDR317W
          Length = 372

 Score = 63.9 bits (154), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 52/156 (33%), Positives = 73/156 (46%), Gaps = 18/156 (11%)

Query: 253 VNIILIVEEDSQKWPMLLTRIF-------GKHASKRPLIVKDTEEPILWTAPPLTQINTM 305
           +NI   V   S  W  +L  IF        K       I + T E      P L  I  M
Sbjct: 193 INIYQFVLPKSDTWLEVLPNIFKPTTILHSKINCTWNYIDQFTNEKSNIVLPKLEDIQVM 252

Query: 306 VSSLGSKSFEKKKPKISRHFADYELNMLLAHAFCKDKTRGLEKKIVIITSFNNLFLSSTS 365
           + +LG+     +K        D++L   L++ F    +  L KK+VI+T+FNN  LS T 
Sbjct: 253 ICTLGTNLLCDQKK------IDFDLTFQLSNWF----SNRLGKKLVIVTAFNNSLLSKTF 302

Query: 366 DYFQSKLMLEQDLVTKVQ-ALDKLVLLRPGPLVGNH 400
           +YF  K  LE+ L   +   L +LV+LRPGPL+G H
Sbjct: 303 NYFNVKNQLEKSLKYDLDFPLGELVILRPGPLLGTH 338

>KLTH0H00264g Chr8 complement(23047..23715) [669 bp, 222 aa] {ON}
           similar to uniprot|P40008 Saccharomyces cerevisiae
           YER004W FMP52 The authentic non-tagged protein was
           localized to the mitochondria
          Length = 222

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/124 (25%), Positives = 62/124 (50%), Gaps = 18/124 (14%)

Query: 281 RPLIVKDTEEPILWTAPPLTQINTMVSSLGSKSFEKKKPKISRHFADYELNMLLAHAFCK 340
           R LI++D+     W+A      + + S L +   E  K    +   D+++N+ LA +   
Sbjct: 48  RSLILEDSSN---WSAAVPENYDILFSGLATTRGEAGKENFYK--VDHDMNLQLARS--- 99

Query: 341 DKTRGLEKKIVIITSF---NNLFLSSTSDYFQSKLMLEQDLVTKVQALDKLVLLRPGPLV 397
            K +G    +V+ ++    N++F      Y ++K  LE+D++      ++ ++LRPGPL+
Sbjct: 100 AKEKGYSTYVVVSSTGADENSMFY-----YMKTKGELERDILA--LGFERTIILRPGPLL 152

Query: 398 GNHT 401
           G  T
Sbjct: 153 GERT 156

>YER004W Chr5 (159580..160275) [696 bp, 231 aa] {ON}  FMP52Protein
           of unknown function, localized to the mitochondrial
           outer membrane; induced by treatment with
           8-methoxypsoralen and UVA irradiation
          Length = 231

 Score = 38.5 bits (88), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 45/82 (54%), Gaps = 11/82 (13%)

Query: 327 DYELNMLLAHAFCKDKTRGLEKKIVIITSFNNLFLSSTSDYFQSKLMLEQDLVTKVQALD 386
           D++LN+ LA A    K +G E   +++ S       S   Y + K  +E+D++    ALD
Sbjct: 90  DHDLNLQLAQA---AKEKGCE--TIVLVSSAGAHPDSRFGYMKMKGEIERDVI----ALD 140

Query: 387 --KLVLLRPGPLVGNHTHQLQS 406
              +++LRPGPL+G  T+  QS
Sbjct: 141 FKHIIILRPGPLLGERTNSKQS 162

>Ecym_4479 Chr4 complement(973594..974268) [675 bp, 224 aa] {ON}
           similar to Ashbya gossypii ADR005W
          Length = 224

 Score = 38.5 bits (88), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 62/120 (51%), Gaps = 11/120 (9%)

Query: 279 SKRPLIVKDTEEPILWTAPPLTQINTMVSSLGSKSFEKKKPKISRHFADYELNMLLAHAF 338
           S + +I +DTE    W       IN + S+LG+        + +++  D+ LN+ +A A 
Sbjct: 44  SVKSIINEDTET---WIDSIPDGINVLFSALGTTKAAAGSIE-NQYKIDHGLNLAVAKAA 99

Query: 339 CKDKTRGLEKKIVIITSFNNLFLSSTSDYFQSKLMLEQDLVTKVQALDKLVLLRPGPLVG 398
              K +G  K +V+++S     + S   YF+ K  LE+D++      ++ +LLRPG L+G
Sbjct: 100 ---KEKGC-KTLVLVSSLG-ASIESRLPYFKMKGELERDVLA--LGFERTILLRPGVLLG 152

>ZYRO0D09548g Chr4 (812531..813208) [678 bp, 225 aa] {ON} similar to
           uniprot|P40008 Saccharomyces cerevisiae YER004W FMP52
           The authentic non-tagged protein was localized to the
           mitochondria
          Length = 225

 Score = 38.1 bits (87), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 38/147 (25%), Positives = 62/147 (42%), Gaps = 39/147 (26%)

Query: 254 NIILIVEEDSQKWPMLLTRIFGKHASKRPLIVKDTEEPILWTAPPLTQINTMVSSLGSKS 313
           N+  IVE DS KW  L                            P T +    S+ G+  
Sbjct: 43  NVKQIVETDSSKWAQLF---------------------------PETGVKFYFSAFGTT- 74

Query: 314 FEKKKPKISRHF--ADYELNMLLAHAFCKDKTRGLEKKIVIITSFNNLFLSSTSDYFQSK 371
             +     + +F   D++LN+ LA A    KT+G    +++ +   N   +S   YF+ K
Sbjct: 75  --RAAAGSAENFYKIDHDLNVELAKA---AKTKGCTTMVLVSSVGANE--NSMLPYFKDK 127

Query: 372 LMLEQDLVTKVQALDKLVLLRPGPLVG 398
             +E+D++      D  ++LRPGPL+G
Sbjct: 128 GEIERDIL--ALDFDHTIILRPGPLLG 152

>Suva_5.91 Chr5 (135337..136023) [687 bp, 229 aa] {ON} YER004W
           (REAL)
          Length = 229

 Score = 37.7 bits (86), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 42/80 (52%), Gaps = 7/80 (8%)

Query: 327 DYELNMLLAHAFCKDKTRGLEKKIVIITSFNNLFLSSTSDYFQSKLMLEQDLVTKVQALD 386
           D++LNM LA A    K RG +   +++ S     + S   Y + K  +E+D++       
Sbjct: 90  DHDLNMQLARA---AKDRGCD--TIVLVSSAGAHVDSRFGYMKMKGEIERDIIA--LNFK 142

Query: 387 KLVLLRPGPLVGNHTHQLQS 406
             ++LRPGPL+G  T+  Q+
Sbjct: 143 HTIILRPGPLLGKRTNSKQN 162

>TBLA0A10500 Chr1 (2585576..2586289) [714 bp, 237 aa] {ON} Anc_7.148
           YER004W
          Length = 237

 Score = 37.4 bits (85), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 47/200 (23%), Positives = 86/200 (43%), Gaps = 37/200 (18%)

Query: 269 LLTRIFGKHASKRPLIVKDTEEPIL------WTAP-PLTQINTMVSSLGSKSFEKKKPKI 321
           L+ ++F    ++RP+    T + I+      W +  P  +I+ +++ L +        + 
Sbjct: 29  LINKVF--TITRRPIESDKTAQQIVEKDNSKWISHFPTDKIDILMTGLATTKKAAGGAQ- 85

Query: 322 SRHFADYELNMLLAHAFCKDKTRGLEKKIVIITSFNNLFLSSTSDYFQSKLMLEQDLVTK 381
            +++ D++LN+  A    K K  G    +V+ ++      S+ S +F  K+  E +   K
Sbjct: 86  QQYYIDHDLNIDFAK---KAKENGCSTFVVVSSAG----ASADSRFFYLKMKGEIERDLK 138

Query: 382 VQALDKLVLLRPGPLVGNHTHQLQSPSIIDKPSFIPTAMFKVLKFKKNCIER-KLQLL-- 438
               D L++LRPGPL+G     L+             + F  L    N + R +LQ L  
Sbjct: 139 AIDFDHLIILRPGPLLGERQENLKG---------FGNSTFTTL---GNWVYRSRLQALVG 186

Query: 439 -----REISQVGIRTKLSEL 453
                 E+ QVG+   L  L
Sbjct: 187 HPVFGDEVGQVGVHLALKAL 206

>TBLA0F03310 Chr6 complement(814437..814922) [486 bp, 161 aa] {ON}
           Anc_7.148 YER004W possible pseudogene; truncated at 5'
           end
          Length = 161

 Score = 34.7 bits (78), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 33/129 (25%), Positives = 55/129 (42%), Gaps = 21/129 (16%)

Query: 327 DYELNMLLAHAFCKDKTRGLEKKIVIITSFNNLFLSSTSDYFQSKLMLEQDLVTKVQALD 386
           D+ LN+ LA    K K  G    +++ +S  N    S   Y + K  +E+DL  +    D
Sbjct: 21  DHNLNIHLAK---KAKENGCSTFVLVSSSLANA--DSRFTYLKMKGEIERDL--EAIGFD 73

Query: 387 KLVLLRPGPLVGNHTHQLQSPSIIDKPSFIPTAMFKVL-----KFKKNCIERKLQLLREI 441
            L++LRPG L+G   +  +             +MF  L     + +  C+ +      E+
Sbjct: 74  HLIILRPGKLLGERQNDFKG---------FANSMFTALGNSIYRSRLQCVLQYPVFGNEV 124

Query: 442 SQVGIRTKL 450
            QVG+   L
Sbjct: 125 GQVGVYLAL 133

>Smik_5.118 Chr5 (163900..164595) [696 bp, 231 aa] {ON} YER004W
           (REAL)
          Length = 231

 Score = 34.3 bits (77), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 26/80 (32%), Positives = 41/80 (51%), Gaps = 7/80 (8%)

Query: 327 DYELNMLLAHAFCKDKTRGLEKKIVIITSFNNLFLSSTSDYFQSKLMLEQDLVTKVQALD 386
           D++LN+ LA A  KDK  G E   +++ S       S   Y + K  +E+D++       
Sbjct: 90  DHDLNLQLARA-AKDK--GCE--TIVLVSSAGAHADSRFGYMKMKGEIERDVIA--LNFK 142

Query: 387 KLVLLRPGPLVGNHTHQLQS 406
             ++LRPGPL+G   +  QS
Sbjct: 143 HTIILRPGPLLGERENSKQS 162

>Skud_5.103 Chr5 (156788..157471) [684 bp, 227 aa] {ON} YER004W
           (REAL)
          Length = 227

 Score = 34.3 bits (77), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 40/80 (50%), Gaps = 7/80 (8%)

Query: 327 DYELNMLLAHAFCKDKTRGLEKKIVIITSFNNLFLSSTSDYFQSKLMLEQDLVTKVQALD 386
           D++LN+ LA A    K +G E   +++ S       S   Y + K  +E+D++       
Sbjct: 90  DHDLNLQLARA---AKEKGCE--TIVLVSSAGAHPDSRFGYMKMKGEIERDVIA--LNFK 142

Query: 387 KLVLLRPGPLVGNHTHQLQS 406
             ++LRPGPL+G  T   QS
Sbjct: 143 HTIILRPGPLLGERTKSKQS 162

>NCAS0E02080 Chr5 complement(399088..399765) [678 bp, 225 aa] {ON} 
          Length = 225

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 43/95 (45%), Gaps = 7/95 (7%)

Query: 327 DYELNMLLAHAFCKDKTRGLEKKIVIITSFNNLFLSSTSDYFQSKLMLEQDLVTKVQALD 386
           D++LN+ LA A    K +G     +++ S +   L S   Y + K  +E+D+V      D
Sbjct: 87  DHDLNLELAKAA---KAKGCS--TIVVVSSDRASLDSRFSYMRMKGEIERDIV--ALDFD 139

Query: 387 KLVLLRPGPLVGNHTHQLQSPSIIDKPSFIPTAMF 421
             ++LRPG L+G    Q    S       +   MF
Sbjct: 140 HTIILRPGILLGERDPQTAHKSFTHDAMRMIGGMF 174

>Kwal_47.18862 s47 complement(1003035..1003709) [675 bp, 224 aa]
           {ON} YER004W - Hypothetical ORF [contig 189] FULL
          Length = 224

 Score = 32.3 bits (72), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 39/75 (52%), Gaps = 7/75 (9%)

Query: 324 HFADYELNMLLAHAFCKDKTRGLEKKIVIITSFNNLFLSSTSDYFQSKLMLEQDLVTKVQ 383
           ++ D++LN+ LA    K K  G   K  ++ S       S   YF++K  +E+D++    
Sbjct: 87  YWVDHDLNLQLAQ---KAKENGC--KTFVLVSSAGASEKSPFFYFKTKAEIERDIL--AL 139

Query: 384 ALDKLVLLRPGPLVG 398
             +K ++LRPG L G
Sbjct: 140 NFEKTIILRPGALFG 154

>Kpol_312.9 s312 (21577..22242) [666 bp, 221 aa] {ON} (21577..22242)
           [666 nt, 222 aa]
          Length = 221

 Score = 32.0 bits (71), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 39/75 (52%), Gaps = 7/75 (9%)

Query: 327 DYELNMLLAHAFCKDKTRGLEKKIVIITSFNNLFLSSTSDYFQSKLMLEQDLVTKVQALD 386
           DY+LN+ LA A    K +G    +++ ++  N    S   Y + K  +E+D++      D
Sbjct: 86  DYDLNIELAKA---AKEKGCSTLVLVSSAGANE--HSWIAYLKMKGEIERDMIK--LGFD 138

Query: 387 KLVLLRPGPLVGNHT 401
             ++LRPG ++G  T
Sbjct: 139 HTIILRPGAILGERT 153

>KLTH0F01826g Chr6 (142334..144325) [1992 bp, 663 aa] {ON} similar
           to uniprot|P09959 Saccharomyces cerevisiae YLR182W SWI6
           Transcription cofactor forms complexes with DNA-binding
           proteins Swi4p and Mbp1p to regulate transcription at
           the G1/S transition involved in meiotic gene expression
           localization regulated by phosphorylation potential
           Cdc28p substrate
          Length = 663

 Score = 32.7 bits (73), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 29/50 (58%), Gaps = 5/50 (10%)

Query: 211 ASDAPAVTLTIQLQKFTYHLNYDNSRDVHGETCRHTLMIQLRVNIILIVE 260
           A DA  +  T+ L+ F  H+   N+RD++G+TC   L I  R+  + IVE
Sbjct: 330 AGDADIIMTTVDLKWFISHVL--NARDINGDTC---LNIASRLGNVSIVE 374

>SAKL0D02992g Chr4 (247577..249343) [1767 bp, 588 aa] {ON} highly
           similar to uniprot|P15180 Saccharomyces cerevisiae
           YDR037W KRS1 Lysyl-tRNA synthetase also identified as a
           negative regulator of general control of amino acid
           biosynthesis
          Length = 588

 Score = 32.0 bits (71), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 26/51 (50%), Gaps = 5/51 (9%)

Query: 95  NLAQPWVYLNATNDLQRKISSLFPFSDQLEKHHHFMRRTRSPLCNLLTKEK 145
           N A+PW  +N   +L+++ +  FP  DQL         T   L N+LT+ K
Sbjct: 390 NFARPWKRINMIEELEKRFNVKFPAGDQLH-----TAETGEFLKNILTENK 435

>TPHA0L00760 Chr12 (143784..144464) [681 bp, 226 aa] {ON} Anc_7.148
           YER004W
          Length = 226

 Score = 30.4 bits (67), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 26/77 (33%), Positives = 41/77 (53%), Gaps = 7/77 (9%)

Query: 327 DYELNMLLAHAFCKDKTRGLEKKIVIITSFNNLFLSSTSDYFQSKLMLEQDLVTKVQALD 386
           D++LN+ L     K K  G +  ++I +S  N    S + Y + K  +E+D VTK+   D
Sbjct: 90  DHDLNLQLLE---KAKENGCKTVVLISSSGANEH--SWAGYLKMKGEIERD-VTKL-GFD 142

Query: 387 KLVLLRPGPLVGNHTHQ 403
             ++LRPG L+G    Q
Sbjct: 143 HTIILRPGVLLGERDSQ 159

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.133    0.385 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 49,114,110
Number of extensions: 1996619
Number of successful extensions: 4962
Number of sequences better than 10.0: 37
Number of HSP's gapped: 5049
Number of HSP's successfully gapped: 37
Length of query: 506
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 392
Effective length of database: 40,409,475
Effective search space: 15840514200
Effective search space used: 15840514200
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 68 (30.8 bits)