Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_34.159865.349ON23123112191e-172
KLTH0H14806g5.349ON3462317532e-99
SAKL0G08888g5.349ON3792414413e-52
KAFR0C018705.349ON3412444132e-48
Smik_4.5775.349ON3682404143e-48
Skud_4.5845.349ON3682404125e-48
Suva_2.4875.349ON3682124073e-47
TPHA0D020705.349ON3732514004e-46
YDR318W (MCM21)5.349ON3682403961e-45
ZYRO0D10120g5.349ON3292333871e-44
Kpol_1051.55.349ON3702473857e-44
TDEL0E027805.349ON3472383759e-43
KNAG0C055205.349ON3852413753e-42
CAGL0H07139g5.349ON3582133481e-38
TBLA0H019805.349ON3592443462e-38
Ecym_81845.349ON2482383374e-38
AGR349W5.349ON2422383313e-37
NCAS0F028505.349ON2811662514e-25
KLLA0B10142g5.349ON2931971912e-16
NDAI0I015505.349ON2761531892e-16
KAFR0K006307.72ON1334129730.86
NDAI0J030104.375ON165555730.91
TDEL0F050808.384ON83495711.5
Suva_8.1632.169ON43764682.9
ZYRO0B06160g3.107ON95749683.7
Kpol_1040.97.69ON50552656.2
TPHA0F011802.264ON795123649.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_34.15986
         (231 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_34.15986 s34 complement(145905..146600) [696 bp, 231 aa] {O...   474   e-172
KLTH0H14806g Chr8 (1285442..1285493,1285556..1286544) [1041 bp, ...   294   2e-99
SAKL0G08888g Chr7 complement(760335..761422,761488..761539) [114...   174   3e-52
KAFR0C01870 Chr3 complement(372621..373594,373748..373799) [1026...   163   2e-48
Smik_4.577 Chr4 (1030208..1030259,1030337..1030526,1030557..1031...   164   3e-48
Skud_4.584 Chr4 (1040035..1040086,1040162..1040345,1040376..1041...   163   5e-48
Suva_2.487 Chr2 (861131..861182,861257..861446,861477..862341) [...   161   3e-47
TPHA0D02070 Chr4 (426798..427919) [1122 bp, 373 aa] {ON} Anc_5.3...   158   4e-46
YDR318W Chr4 (1103758..1103809,1103893..1104947) [1107 bp, 368 a...   157   1e-45
ZYRO0D10120g Chr4 (852141..852192,852258..853195) [990 bp, 329 a...   153   1e-44
Kpol_1051.5 s1051 (10484..11596) [1113 bp, 370 aa] {ON} (10484.....   152   7e-44
TDEL0E02780 Chr5 complement(534940..535931,535996..536047) [1044...   149   9e-43
KNAG0C05520 Chr3 complement(1072299..1073456) [1158 bp, 385 aa] ...   149   3e-42
CAGL0H07139g Chr8 complement(703350..704426) [1077 bp, 358 aa] {...   138   1e-38
TBLA0H01980 Chr8 complement(466993..468020,468148..468199) [1080...   137   2e-38
Ecym_8184 Chr8 complement(382634..383380) [747 bp, 248 aa] {ON} ...   134   4e-38
AGR349W Chr7 (1379849..1380577) [729 bp, 242 aa] {ON} Syntenic h...   132   3e-37
NCAS0F02850 Chr6 (571260..572105) [846 bp, 281 aa] {ON} Anc_5.34...   101   4e-25
KLLA0B10142g Chr2 (887476..887527,887649..888478) [882 bp, 293 a...    78   2e-16
NDAI0I01550 Chr9 (368193..369023) [831 bp, 276 aa] {ON} Anc_5.34...    77   2e-16
KAFR0K00630 Chr11 complement(135570..139574) [4005 bp, 1334 aa] ...    33   0.86 
NDAI0J03010 Chr10 (748394..753361) [4968 bp, 1655 aa] {ON} Anc_4...    33   0.91 
TDEL0F05080 Chr6 complement(955954..958458) [2505 bp, 834 aa] {O...    32   1.5  
Suva_8.163 Chr8 (286737..288050) [1314 bp, 437 aa] {ON} YOR110W ...    31   2.9  
ZYRO0B06160g Chr2 complement(493345..496218) [2874 bp, 957 aa] {...    31   3.7  
Kpol_1040.9 s1040 (27948..29465) [1518 bp, 505 aa] {ON} (27948.....    30   6.2  
TPHA0F01180 Chr6 (267674..270061) [2388 bp, 795 aa] {ON} Anc_2.2...    29   9.8  

>Kwal_34.15986 s34 complement(145905..146600) [696 bp, 231 aa] {ON}
           YDR318W (MCM21) - involved in minichromosome maintenance
           [contig 272] FULL
          Length = 231

 Score =  474 bits (1219), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 231/231 (100%), Positives = 231/231 (100%)

Query: 1   MFDSTVADLFNTDILTSPSKRKKVVNSRKHQELIKKLDIENLYRTIGLSTFPVVDPSDVE 60
           MFDSTVADLFNTDILTSPSKRKKVVNSRKHQELIKKLDIENLYRTIGLSTFPVVDPSDVE
Sbjct: 1   MFDSTVADLFNTDILTSPSKRKKVVNSRKHQELIKKLDIENLYRTIGLSTFPVVDPSDVE 60

Query: 61  QDEDGETIFRRSMIGLRLEIFNELDKTFEPPHYVLFKQNLKTGHWNIFRHTIPSYVGVER 120
           QDEDGETIFRRSMIGLRLEIFNELDKTFEPPHYVLFKQNLKTGHWNIFRHTIPSYVGVER
Sbjct: 61  QDEDGETIFRRSMIGLRLEIFNELDKTFEPPHYVLFKQNLKTGHWNIFRHTIPSYVGVER 120

Query: 121 LFEQTKTINPLADIGKIYTFGKKVYTSLLSISTKQQTFKSLAESGIVSQLVIDPSCTSAS 180
           LFEQTKTINPLADIGKIYTFGKKVYTSLLSISTKQQTFKSLAESGIVSQLVIDPSCTSAS
Sbjct: 121 LFEQTKTINPLADIGKIYTFGKKVYTSLLSISTKQQTFKSLAESGIVSQLVIDPSCTSAS 180

Query: 181 FQMMQGSVSVKLKLSETDITACSSIPRSSQKWTATILGPVQSLPRRLQTLV 231
           FQMMQGSVSVKLKLSETDITACSSIPRSSQKWTATILGPVQSLPRRLQTLV
Sbjct: 181 FQMMQGSVSVKLKLSETDITACSSIPRSSQKWTATILGPVQSLPRRLQTLV 231

>KLTH0H14806g Chr8 (1285442..1285493,1285556..1286544) [1041 bp, 346
           aa] {ON} similar to uniprot|Q06675 Saccharomyces
           cerevisiae YDR318W MCM21 Protein involved in
           minichromosome maintenance component of the COMA complex
           that bridges kinetochore subunits that are in contact
           with centromeric DNA and the subunits bound to
           microtubules
          Length = 346

 Score =  294 bits (753), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 136/231 (58%), Positives = 174/231 (75%)

Query: 1   MFDSTVADLFNTDILTSPSKRKKVVNSRKHQELIKKLDIENLYRTIGLSTFPVVDPSDVE 60
            FDS VADL  TDILTSPSKRK+   SR H+EL++K+ IEN+YR +G+STFPVVDPSD+E
Sbjct: 115 FFDSAVADLIETDILTSPSKRKRAAQSRAHEELVQKVQIENIYRMLGISTFPVVDPSDLE 174

Query: 61  QDEDGETIFRRSMIGLRLEIFNELDKTFEPPHYVLFKQNLKTGHWNIFRHTIPSYVGVER 120
             E+ E   +R M+GLRLE+FNEL+++FEPP+Y+LFKQN K  +WNIFRHT+PSYVGVE+
Sbjct: 175 GTEEDEINIKRKMLGLRLELFNELERSFEPPYYILFKQNPKNSYWNIFRHTVPSYVGVEQ 234

Query: 121 LFEQTKTINPLADIGKIYTFGKKVYTSLLSISTKQQTFKSLAESGIVSQLVIDPSCTSAS 180
           +F+Q ++   LA+  +IYTF KKVY SLLSIS K Q F+   +   +SQL IDPSCTS S
Sbjct: 235 MFQQVRSNGLLANQSEIYTFAKKVYKSLLSISVKTQIFRRTEKKEAISQLEIDPSCTSVS 294

Query: 181 FQMMQGSVSVKLKLSETDITACSSIPRSSQKWTATILGPVQSLPRRLQTLV 231
           F + +    VKLKL  TD+ ACS IP  +  W A +LGPV SLP R+++LV
Sbjct: 295 FHIEKLGCFVKLKLDATDVIACSCIPHENVSWNAQMLGPVVSLPDRIESLV 345

>SAKL0G08888g Chr7 complement(760335..761422,761488..761539) [1140
           bp, 379 aa] {ON} similar to uniprot|Q06675 Saccharomyces
           cerevisiae YDR318W MCM21 Protein involved in
           minichromosome maintenance component of the COMA complex
           that bridges kinetochore subunits that are in contact
           with centromeric DNA and the subunits bound to
           microtubules
          Length = 379

 Score =  174 bits (441), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 102/241 (42%), Positives = 147/241 (60%), Gaps = 13/241 (5%)

Query: 1   MFDSTVADLFNTDILTSPSKRK----KVVNSRKHQELIKKLDIENLYRTIGLSTFPVVDP 56
           MFDS +ADL +T+ILTSPSKRK    KV N++  Q LI  + +EN+YR  G++ FPVVDP
Sbjct: 132 MFDSDIADLIDTEILTSPSKRKEKLSKVHNNK--QNLIDYVRLENVYRMTGITVFPVVDP 189

Query: 57  SDVE-QDEDGETIFRRSMIGLRLEIFNELDKTFEPPHYVLFKQNLKTGHWNIFRHTIPSY 115
           SD++   E  E    R M+G+RLE+FNE+  TFE P+YVL K++ K   W+IF+HTIP+Y
Sbjct: 190 SDLKVNKETKEYEILREMMGVRLEVFNEVLSTFEKPYYVLLKKSSKRDSWDIFKHTIPNY 249

Query: 116 VGVERLFEQTKTINPLADIGKIYTFGKKVYTSLLSISTKQQTFKSLA-ESGIVSQLVIDP 174
           + ++ LFE+T     + D    Y F KKVY  LL  S K Q F+ LA E   +SQ+  D 
Sbjct: 250 IDIQLLFEKTNG-GIITDYSGTYLFAKKVYQLLLQTSLKAQVFEVLAREDSRISQIESDL 308

Query: 175 SCTSASFQMMQGSVSVK--LKLSETDITACSSIPRSS--QKWTATILGPVQSLPRRLQTL 230
           +    SF++   ++S K  L++   ++   S    S   ++W   +LGPV   PR+L  +
Sbjct: 309 AVNVVSFKVSFKNLSFKTVLQMDWNNVHGASIKLNSEHVRRWENYLLGPVDEFPRKLAQV 368

Query: 231 V 231
           +
Sbjct: 369 I 369

>KAFR0C01870 Chr3 complement(372621..373594,373748..373799) [1026
           bp, 341 aa] {ON} Anc_5.349 YDR318W
          Length = 341

 Score =  163 bits (413), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 88/244 (36%), Positives = 142/244 (58%), Gaps = 17/244 (6%)

Query: 1   MFDSTVADLFNTDILTSPSKRKKVVNSRKH--------QELIKKLDIENLYRTIGLSTFP 52
           +FD +V D+ +T+IL+SPSKR++ +N              L  ++ +EN++R  G++ FP
Sbjct: 100 LFDKSVGDILDTEILSSPSKRRQRLNGDDRSSIGNLPLDNLHDQIMVENIFRLFGITFFP 159

Query: 53  VVDPSDVEQD-EDGETIFRRSMIGLRLEIFNELDKTFEPPHYVLFKQNLKTGHWNIFRHT 111
           VVDPSD++ + E  E    R M+G+RL+IF+EL K ++ P Y+L K+ +K+  W+IF+HT
Sbjct: 160 VVDPSDLQMNIETQEMDTMREMLGIRLDIFDELSKKYDKPMYILLKKKIKSDTWDIFKHT 219

Query: 112 IPSYVGVERLFEQTKTINPLADIGKIYTFGKKVYTSLLSISTKQQTFKSLAESGIVSQLV 171
           IPSY+GVE++FE+      ++    IY F K++Y  LL  S ++   K   E G++S L 
Sbjct: 220 IPSYIGVEKIFEEVSAGLAIS-YEDIYLFSKEIYLQLLKESARKGKLKKFEEKGLISNLR 278

Query: 172 IDPSCTSASFQMMQGSVSVKLKLSETDITACSSI-----PRSSQKWTATILGPVQSLPRR 226
           I  S T  SF +  G+  ++L L +  I +CS +          KW     GP++ L  +
Sbjct: 279 ISLSSTKVSFSI--GTFEIELYLQDNIIISCSFVKGIRDASVRSKWEVLFNGPLEDLEYK 336

Query: 227 LQTL 230
           L+ L
Sbjct: 337 LRQL 340

>Smik_4.577 Chr4
           (1030208..1030259,1030337..1030526,1030557..1031421)
           [1107 bp, 368 aa] {ON} YDR318W (REAL)
          Length = 368

 Score =  164 bits (414), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 89/240 (37%), Positives = 137/240 (57%), Gaps = 16/240 (6%)

Query: 1   MFDSTVADLFNTDILTSPSKRKKV-----VNSRKHQELIKKLDIENLYRTIGLSTFPVVD 55
           MFD  VADL +TDILTSPSKRK+      +NS    +L   + +EN+YR  G++ FP+VD
Sbjct: 123 MFDPEVADLLDTDILTSPSKRKRKLKIEDINSIDKGKLEDSIVVENVYRIFGITFFPLVD 182

Query: 56  PSDVEQDEDGETIF-RRSMIGLRLEIFNELDKTFEPPHYVLFKQNLKTGHWNIFRHTIPS 114
           P D++  +D + IF  R M+G+RLE+F+E    FE PHY+L K+ +K+  W +F+HT+PS
Sbjct: 183 PIDLKIKDDSDEIFVDREMLGIRLEVFSERTSKFEKPHYILLKKRIKSNSWFLFKHTVPS 242

Query: 115 YVGVERLFEQTKTINPLADIGKIYTFGKKVYTSLLSISTKQQTFKSLAESGIVSQLVIDP 174
           ++ V+ +F+ T     +      Y F K+V+  L+ I  +QQ FK L    I+  L +D 
Sbjct: 243 FIDVQGIFDDTNG-GLVVSYDDAYLFAKRVFLQLVEIQKRQQIFKDLEAKKIIHDLNLDL 301

Query: 175 SCTSASFQMMQGSVSVKLKLSETDITACSSIP-------RSSQKWTATILGPVQSLPRRL 227
             + ASF      V V+L + + +I +CS +         +  KW   +LG +  L  +L
Sbjct: 302 ESSMASF--FVKDVKVELFVKQNEIVSCSILDDIHDFSHNNKNKWEIALLGSLDDLELKL 359

>Skud_4.584 Chr4
           (1040035..1040086,1040162..1040345,1040376..1041246)
           [1107 bp, 368 aa] {ON} YDR318W (REAL)
          Length = 368

 Score =  163 bits (412), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 87/240 (36%), Positives = 138/240 (57%), Gaps = 16/240 (6%)

Query: 1   MFDSTVADLFNTDILTSPSKRKKV-----VNSRKHQELIKKLDIENLYRTIGLSTFPVVD 55
           MFDS VADL +TDILTSPSKRK+      +++    +L   + +EN+YR  G++ FP+VD
Sbjct: 123 MFDSAVADLLDTDILTSPSKRKRKLKIADIDTSDRNDLEDSIIMENVYRMFGITFFPLVD 182

Query: 56  PSDVE-QDEDGETIFRRSMIGLRLEIFNELDKTFEPPHYVLFKQNLKTGHWNIFRHTIPS 114
           P+D++ +D   E    R M+G+RLE+F+E    FE PHY+L K+ +K+  W +F+HTIPS
Sbjct: 183 PADLKIKDVSDEIFVDREMLGIRLEVFSERKSKFEKPHYILLKKRIKSNSWFLFKHTIPS 242

Query: 115 YVGVERLFEQTKTINPLADIGKIYTFGKKVYTSLLSISTKQQTFKSLAESGIVSQLVIDP 174
           ++ V+ +F +T     +     +Y F K+V+  L+ I  +QQ FK L    I+  L +D 
Sbjct: 243 FIDVQGIFNETNG-GLVISHDNVYLFAKRVFLQLVEIQKRQQKFKDLEAKKIIHDLDLDL 301

Query: 175 SCTSASFQMMQGSVSVKLKLSETDITACSSIP-------RSSQKWTATILGPVQSLPRRL 227
             +  SF      V V+L + + +I +CS +        ++  KW   +LG +  L  +L
Sbjct: 302 QSSMVSF--FVKDVKVELFVKQNEIVSCSILDEIHDFSRKNKSKWEIVLLGSLDDLELKL 359

>Suva_2.487 Chr2 (861131..861182,861257..861446,861477..862341)
           [1107 bp, 368 aa] {ON} YDR318W (REAL)
          Length = 368

 Score =  161 bits (407), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 86/212 (40%), Positives = 126/212 (59%), Gaps = 15/212 (7%)

Query: 1   MFDSTVADLFNTDILTSPSKRKK-----VVNSRKHQELIKKLDIENLYRTIGLSTFPVVD 55
           MFDS VADL +T+ILTSPSKRK+      +N+     L   + +EN+YR  G++ FP+VD
Sbjct: 123 MFDSDVADLLDTEILTSPSKRKRKLNLEEINTSDKSMLEDSIILENIYRMFGITFFPLVD 182

Query: 56  PSDVE-QDEDGETIFRRSMIGLRLEIFNELDKTFEPPHYVLFKQNLKTGHWNIFRHTIPS 114
           P D++ +D   E +  R M+G+RLE+FNE    FE PHY+L K+ +K+  W +F+HTIPS
Sbjct: 183 PIDLKMKDSSDEIVVDREMLGIRLEVFNERTSKFEKPHYILLKKRIKSNSWFLFKHTIPS 242

Query: 115 YVGVERLFEQTK---TINPLADIGKIYTFGKKVYTSLLSISTKQQTFKSLAESGIVSQLV 171
           Y+ V+ +F  T     I+P       Y F K+V+  L+ I  +QQ+FK L    I+  L 
Sbjct: 243 YIDVQAIFNDTNGGLVISP----DDAYLFAKRVFVQLVEIQKRQQSFKDLEAKKIIHNLD 298

Query: 172 IDPSCTSASFQMMQGSVSVKLKLSETDITACS 203
           +D   +  SF      V V+L L + +I +CS
Sbjct: 299 LDLQSSMVSF--FVKDVKVELFLKQNEIVSCS 328

>TPHA0D02070 Chr4 (426798..427919) [1122 bp, 373 aa] {ON} Anc_5.349
           YDR318W
          Length = 373

 Score =  158 bits (400), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 87/251 (34%), Positives = 141/251 (56%), Gaps = 22/251 (8%)

Query: 1   MFDSTVADLFNTDILTSPSKRKKVV---------------NSRKHQELIKKLDIENLYRT 45
           +F S +++  NTDILTSPSKRKKV+               N   ++EL +K+  EN +R 
Sbjct: 121 IFASELSENINTDILTSPSKRKKVIEGIEITGNDANMGYKNPNLNEELERKIIKENTFRL 180

Query: 46  IGLSTFPVVDPSDVEQDE-DGETIFRRSMIGLRLEIFNELDKTFEPPHYVLFKQNLKTGH 104
            G+S FPVVDP D+  D+ + E   +R MIG+RLE+F++    FE PHY+L K+  K+ +
Sbjct: 181 FGISYFPVVDPCDLVHDKSNNEVNNKREMIGIRLEVFDDTLGVFEKPHYILLKKKTKSNN 240

Query: 105 WNIFRHTIPSYVGVERLFEQTKTINPLADIGKIYTFGKKVYTSLLSISTKQQTFKSLAES 164
           W +F++TIP+Y+ +  +F++      L     IY F K+VY  LL I  +++    L E+
Sbjct: 241 WGLFKYTIPNYIDIYLIFQRINN-GILLTYEDIYIFAKQVYIQLLLIQNRKKNLMQLQEA 299

Query: 165 GIVSQLVIDPSCTSASFQMMQGSVSVKLKLSETDITACSSIP-----RSSQKWTATILGP 219
            IVS ++ID +       ++  +  + L L +  +T+ S         S ++W  T+LGP
Sbjct: 300 NIVSDILIDLNLKLIKMNIINTTTKLTLYLEKDKVTSVSIYSETLDIHSQKRWKLTLLGP 359

Query: 220 VQSLPRRLQTL 230
           V  + R+++ L
Sbjct: 360 VSGISRKIRYL 370

>YDR318W Chr4 (1103758..1103809,1103893..1104947) [1107 bp, 368 aa]
           {ON}  MCM21Protein involved in minichromosome
           maintenance; component of the COMA complex (Ctf19p,
           Okp1p, Mcm21p, Ame1p) that bridges kinetochore subunits
           that are in contact with centromeric DNA and the
           subunits bound to microtubules
          Length = 368

 Score =  157 bits (396), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 86/240 (35%), Positives = 135/240 (56%), Gaps = 16/240 (6%)

Query: 1   MFDSTVADLFNTDILTSPSKRKKV-----VNSRKHQELIKKLDIENLYRTIGLSTFPVVD 55
           MFD  VADL +TDILTSPSKRK+      +++    EL   + +EN+YR  G++ FP+VD
Sbjct: 123 MFDPGVADLLDTDILTSPSKRKRKLKIDDISTSDRSELEDYIVLENVYRMFGITFFPLVD 182

Query: 56  PSDVE-QDEDGETIFRRSMIGLRLEIFNELDKTFEPPHYVLFKQNLKTGHWNIFRHTIPS 114
           P D++ +D  GE    R M+G+RLE+F+E    FE PHYVL K+ +K+  W +F+HTIPS
Sbjct: 183 PIDLKIKDASGEIFVDREMLGIRLEVFSERTSQFEKPHYVLLKKRIKSNSWFLFKHTIPS 242

Query: 115 YVGVERLFEQTKTINPLADIGKIYTFGKKVYTSLLSISTKQQTFKSLAESGIVSQLVIDP 174
           ++ V+ +F+ T     +      Y F K+V+  L+ +  ++Q FK L    I+  L +D 
Sbjct: 243 FIDVQGIFDDTNG-GLVISHDDAYLFAKRVFLQLVEVQKRRQIFKDLEAKKIIHDLDLDL 301

Query: 175 SCTSASFQMMQGSVSVKLKLSETDITACSSIP-------RSSQKWTATILGPVQSLPRRL 227
             +  SF      + V+L + + +I +CS +         +  KW   +LG +  L  +L
Sbjct: 302 ESSMVSF--FVKDIKVELFVKQNEIVSCSILDDIHDFSQNNKSKWEIALLGSLDDLELKL 359

>ZYRO0D10120g Chr4 (852141..852192,852258..853195) [990 bp, 329 aa]
           {ON} similar to uniprot|Q06675 Saccharomyces cerevisiae
           YDR318W MCM21 Protein involved in minichromosome
           maintenance component of the COMA complex that bridges
           kinetochore subunits that are in contact with
           centromeric DNA and the subunits bound to microtubules
          Length = 329

 Score =  153 bits (387), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 87/233 (37%), Positives = 135/233 (57%), Gaps = 12/233 (5%)

Query: 1   MFDSTVADLF-NTDILTSPSKRKKVVNSRKHQELIKKLDIENLYRTIGLSTFPVVDPSDV 59
           MFD ++ADL  +T   TSP KR+  + + K  E   ++ IEN YR  G++ FP+VDPSD+
Sbjct: 105 MFDKSIADLLGDTSSSTSPGKRRSKLQNFKGLE--SQVSIENAYRLFGITFFPLVDPSDI 162

Query: 60  E-QDEDGETIFRRSMIGLRLEIFNELDKTFEPPHYVLFKQNLKTGHWNIFRHTIPSYVGV 118
             Q  D      R M+G+RLE+FNE  + FE PHY+L KQNLK   W++F+HTIP+++ +
Sbjct: 163 NFQRND----INRKMLGIRLEVFNEGLRQFEKPHYILLKQNLKLNSWSLFKHTIPAFIDL 218

Query: 119 ERLFEQTKTINPLADIGKIYTFGKKVYTSLLSISTKQQTFKSLAESGIVSQLVIDPSCTS 178
           E +F++      +    ++Y F K+VY  LL +S + Q  + L +  ++S L ID    +
Sbjct: 219 ESIFQKIDN-GIITTYDQVYLFAKQVYIQLLCVSQRVQIIEELQDIRLISNLEIDLQIAA 277

Query: 179 ASFQMMQGSVSVKLKLSETDITACSSIPRSSQKWTATILGPVQSLPRRLQTLV 231
            SF  +QG   V+L L +  + +C +      K    +LGPV+ L  +L  L+
Sbjct: 278 VSFD-IQGMKRVRLFLQDDQVISCDTFDDDELKM--LLLGPVKELKLKLGRLL 327

>Kpol_1051.5 s1051 (10484..11596) [1113 bp, 370 aa] {ON}
           (10484..11596) [1113 nt, 371 aa]
          Length = 370

 Score =  152 bits (385), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 89/247 (36%), Positives = 138/247 (55%), Gaps = 20/247 (8%)

Query: 1   MFDSTVADLFNTDILTSPSKRK-KVVN---------SRKHQELIKKLDIENLYRTIGLST 50
           MF+S ++D+ NTDILTSPSKRK K+ N           K + L KK+ IENL+R  G++ 
Sbjct: 122 MFNSGISDMINTDILTSPSKRKLKLGNIDDDSETSKGNKQKNLNKKIRIENLFRLFGITF 181

Query: 51  FPVVDPSDVEQDEDGETI-FRRSMIGLRLEIFNELDKTFEPPHYVLFKQNLKTGHWNIFR 109
           FP+VDP+D++ +++ +T+  +R M+G+RLEI+NE + TFE PHY+L K+ LK   W IF+
Sbjct: 182 FPLVDPTDLKMNKELKTMEIKREMLGIRLEIYNEHNSTFEKPHYILLKKKLKIDSWMIFK 241

Query: 110 HTIPSYVGVE-RLFEQTKTINPLADIGKIYTFGKKVYTSLLSISTKQQTFKSLAESGIVS 168
           HTIPSY+ +E + F     +  L    +I  F K+VY  L+  + ++Q  + L E   + 
Sbjct: 242 HTIPSYIDIESKWFGINNGM--LNTYDEINVFAKEVYIELIHGNIREQKIQKLTELEYIR 299

Query: 169 QLVIDPSCTSASFQMMQGSVSVKLKLSETDITACS-----SIPRSSQKWTATILGPVQSL 223
               D + +     ++     ++L L    I +C        P    KW   +LG +  L
Sbjct: 300 DCQTDVNSSRVILTLI-DQYEIELFLKNETIVSCKIPTDRMEPMLKNKWQIILLGTIDEL 358

Query: 224 PRRLQTL 230
           P +L  L
Sbjct: 359 PNKLSQL 365

>TDEL0E02780 Chr5 complement(534940..535931,535996..536047) [1044
           bp, 347 aa] {ON} Anc_5.349 YDR318W
          Length = 347

 Score =  149 bits (375), Expect = 9e-43,   Method: Compositional matrix adjust.
 Identities = 81/238 (34%), Positives = 131/238 (55%), Gaps = 11/238 (4%)

Query: 1   MFDSTVADLFNTDILTSPSKRKKVVNSRKHQELIKKLDI--ENLYRTIGLSTFPVVDPSD 58
           MFD ++A   +T+ILTSPSK ++ +   K+ E   +  +  EN+YR  G++ FPVVDP+D
Sbjct: 110 MFDESIAQFIDTNILTSPSKARRRMKDTKYDEDAPRNQVLLENVYRMFGITYFPVVDPTD 169

Query: 59  VE-QDEDGETIFRRSMIGLRLEIFNELDKTFEPPHYVLFKQNLKTGHWNIFRHTIPSYVG 117
           ++   E  +T   R MIG+RLE+FNE    FE P+Y+L K+ +K+  W +F+HT+P ++ 
Sbjct: 170 LKVNKETNKTEINREMIGIRLEVFNESIARFEKPYYILLKKKIKSDSWLLFKHTVPIFID 229

Query: 118 VERLFEQTKTINPLADIGKIYTFGKKVYTSLLSISTKQQTFKSLAESGIVSQLVIDPSCT 177
           V  LF +T     +     IY F K VY  L+ ++ + Q  + L  SG++  L +D    
Sbjct: 230 VHALFNKTNG-GAIISHENIYLFAKTVYRQLIELTARMQNLEDLMSSGVIDNLDLDLEAA 288

Query: 178 SASFQMMQGSVSVKLKLSETDITACSSIPRS-----SQKWTATILGPVQSLPRRLQTL 230
           + SF   +  V  +L L +  I +CS +  +       +     LGP+  L  +L+ L
Sbjct: 289 AVSFS--KNEVQFRLMLHKDQIVSCSLVGEALDGNVKPQLETIFLGPLHELEIKLKHL 344

>KNAG0C05520 Chr3 complement(1072299..1073456) [1158 bp, 385 aa]
           {ON} Anc_5.349 YDR318W
          Length = 385

 Score =  149 bits (375), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 91/241 (37%), Positives = 131/241 (54%), Gaps = 16/241 (6%)

Query: 1   MFDSTVADLFNTDILTSPSKRKKVVNSRKH----QELIKKLDIENLYRTIGLSTFPVVDP 56
           MFD +V DL +TDIL+SPSKRK+  N  +H      L +K+ +EN YR  G++ FPVVDP
Sbjct: 144 MFDQSVGDLLDTDILSSPSKRKR--NPAQHGADTSRLHEKILLENAYRLFGITYFPVVDP 201

Query: 57  SDVEQD-EDGETIFRRSMIGLRLEIFNELDKTFEPPHYVLFKQNLKTGHWNIFRHTIPSY 115
           +D++ + E  + +  R M+G+R ++FN+ D  FE P YVL K+NLK   W IF+HTIP  
Sbjct: 202 ADLQLNAETQKMVITREMLGVRFDVFNDQDSKFEKPFYVLLKKNLKAKVWEIFKHTIPGN 261

Query: 116 VGVERLFEQTKTINPLADIGKIYTFGKKVYTSLLSISTKQQTFKSLAESGIVSQLVIDPS 175
           + V  LF  T T         IY F K+VY  L+  S + + F SL E G++  L  D  
Sbjct: 262 IDVHSLF-HTITGGLATSNNDIYLFSKEVYVRLVQSSLRLKHFNSLQERGLIEDLRGDLR 320

Query: 176 CTSASFQMMQGS---VSVKLKLSETDITAC---SSIPRSSQKWTATILGPVQSLPRRLQT 229
            T+ SF  M G    + VKL +   ++ +            K    + GP+  L  +L+ 
Sbjct: 321 STNVSF--MTGPRFMIDVKLTIQNNEVVSVYVKKGKEEVKSKLAMFLTGPIDDLEGKLKQ 378

Query: 230 L 230
           L
Sbjct: 379 L 379

>CAGL0H07139g Chr8 complement(703350..704426) [1077 bp, 358 aa] {ON}
           some similarities with uniprot|Q06675 Saccharomyces
           cerevisiae YDR318w MCM21
          Length = 358

 Score =  138 bits (348), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 77/213 (36%), Positives = 123/213 (57%), Gaps = 17/213 (7%)

Query: 1   MFDSTVADLFNTDILTSPSKRKKVV---NSRKHQELIKK-LDIENLYRTIGLSTFPVVDP 56
           +FD +V D+ +TDIL SPSKRK+ +   N     ++ K+ +  EN+YR  G+S FP+VDP
Sbjct: 119 LFDESVRDVIDTDILISPSKRKQKIQQLNPNSTGKVSKEPIQYENIYRLFGISYFPLVDP 178

Query: 57  SDVEQDEDGE-TIFRRSMIGLRLEIFNELDKTFEPPHYVLFKQNLKTGHWNIFRHTIPSY 115
           SD+  D   E  I  R M+G+R +IFNE  K+FE PHY+L K++ K+  W +F++T+P+Y
Sbjct: 179 SDLIFDSKTEKMIVTRDMLGIRFDIFNESSKSFEKPHYILLKKSAKSDDWKLFKYTVPNY 238

Query: 116 VGVERLFEQTKTINPLADIGKIYTFGKKVYTSLLSISTKQQTFKSLAESGIVSQLVIDPS 175
           + VE +F +  T   +     +Y F K +Y  L+ I  + + F  L + GI+  L +D  
Sbjct: 239 IDVEGIFAEV-TGGLIRTYDDVYLFAKCIYLLLVEIVIRSELFLQLEKDGIIDDLDMDLQ 297

Query: 176 -----CTSASFQMMQGSVSVKLKLSETDITACS 203
                CT      +QG+  ++  + +  I AC+
Sbjct: 298 SLVIKCT------LQGTTKIEFHIHQYSIIACT 324

>TBLA0H01980 Chr8 complement(466993..468020,468148..468199) [1080
           bp, 359 aa] {ON} Anc_5.349 YDR318W
          Length = 359

 Score =  137 bits (346), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 85/244 (34%), Positives = 138/244 (56%), Gaps = 18/244 (7%)

Query: 1   MFDSTVADLFNTDILTSPSKRKKVVNSRK---H-QELIKKLDI-ENLYRTIGLSTFPVVD 55
           +FD  ++ L + ++++ PS+R+K +   +   H +E++K   I E +YR +G++ FPVVD
Sbjct: 109 LFDDEISRLLSPEVVSLPSQRRKRMKLERPNLHIREILKNFVILEIVYRMVGITFFPVVD 168

Query: 56  PSDVE-QDEDGETIFRRSMIGLRLEIFNELDKTFEPPHYVLFKQNLKTGHWNIFRHTIPS 114
           P+D+E  D       RR M+G+RLEI+N+L  +FE PHY+L KQ+ K+  W+IF++TIP+
Sbjct: 169 PTDLEFLDTKKLLSIRREMLGIRLEIYNDLISSFEKPHYILLKQSEKSKIWSIFKYTIPN 228

Query: 115 YVGVERLFEQTKTINPLADIGKIYTFGKKVYTSLLSISTKQQTFKSLAESGIVSQLVIDP 174
           Y+ +  LF +        D   I+ F K VY++L SIS K Q FK L    +   L ID 
Sbjct: 229 YIDIHSLFLKINNGIITTD-SDIFLFAKDVYSALSSISKKIQYFKKLENLKVFENLNIDL 287

Query: 175 SCTSASFQMMQGSVSVKLKLSETDITAC------SSIPRSS----QKWTATILGPVQSLP 224
                SF + +   ++++ L E DI  C      S I + +    +KW     GP++ L 
Sbjct: 288 IGIQISF-LFKSIYNIRISLKEWDIITCTIESTESYINKETRTFYRKWEIQFQGPIKKLV 346

Query: 225 RRLQ 228
            +L+
Sbjct: 347 SKLE 350

>Ecym_8184 Chr8 complement(382634..383380) [747 bp, 248 aa] {ON}
           similar to Ashbya gossypii AGR349W
          Length = 248

 Score =  134 bits (337), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 77/238 (32%), Positives = 131/238 (55%), Gaps = 10/238 (4%)

Query: 1   MFDSTVADLFNTDILTSPSKRKKVVNS-----RKHQELIKKLDIENLYRTIGLSTFPVVD 55
           MFD T+A  F+T+I+ SPSKR K++ S     R   EL K ++IEN YR  G++ FP+VD
Sbjct: 9   MFDPTIASFFDTEIVRSPSKRNKLMKSSATSIRPDNELEKFVEIENCYRMSGITFFPLVD 68

Query: 56  PSDVEQDEDGE-TIFRRSMIGLRLEIFNELDKTFEPPHYVLFKQNLKTGH-WNIFRHTIP 113
           P  +  +   + T     ++G+RLE+FNE    +EPP+Y++ K+  K    W++++HTIP
Sbjct: 69  PGKLASNTHHDSTSLVAELLGIRLEVFNETTLKYEPPYYIILKRRPKANQIWDLYKHTIP 128

Query: 114 SYVGVERLFEQTKTINPLADIGKIYTFGKKVYTSLLSISTKQQTFKSLAESGIVSQLVID 173
             + +E+++  T     ++   ++Y F KK Y  LL+I  + Q   +L +  +   + +D
Sbjct: 129 KVIDIEQIWSTTGH-GIISMDKEVYIFAKKCYMELLAIHYRLQFICNL-DPQLFENIKVD 186

Query: 174 PSCTSASFQMM-QGSVSVKLKLSETDITACSSIPRSSQKWTATILGPVQSLPRRLQTL 230
                 SFQ+  +  ++V  +L +  I  C        +W+  ILGP+  LP ++  L
Sbjct: 187 SYAVMLSFQLTGEEIITVVAQLRDRSIIDCDIDIERHNEWSKIILGPLVDLPDKILIL 244

>AGR349W Chr7 (1379849..1380577) [729 bp, 242 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR318W (MCM21)
          Length = 242

 Score =  132 bits (331), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 74/238 (31%), Positives = 131/238 (55%), Gaps = 11/238 (4%)

Query: 1   MFDSTVADLFNTDILTSPSKRKKVVNSR----KHQELIKKLDIENLYRTIGLSTFPVVDP 56
           MFD  +A   +T++L SPSKR K++++R    K +EL   +++EN YR  G++ FP+VDP
Sbjct: 1   MFDPALAPFLDTELLRSPSKRGKILSTRPEQSKQRELRNFIEVENCYRMCGITFFPLVDP 60

Query: 57  SDVE-QDEDGETIFRRSMIGLRLEIFNELDKTFEPPHYVLFKQNLKTG-HWNIFRHTIPS 114
             +  QD+D E I    M+G+RLE+FNE  + F+ P+YVL +++ K    W +F+HT+P 
Sbjct: 61  GRLGGQDKDNEGIVN-EMLGIRLEVFNENTRRFDYPYYVLLRRDAKVATRWQLFKHTLPK 119

Query: 115 YVGVERLFEQTKTINPLADIGKIYTFGKKVYTSLLSISTKQQTFKSLAESGIVSQLVIDP 174
            +  ER++  T      +D   +Y F KK Y  L+ +  + Q F +  +  +   +  D 
Sbjct: 120 MLDAERIWSTTLNGAICSD-SDVYLFAKKCYARLIDMHFRLQ-FIARLDPYLFENIRTDS 177

Query: 175 SCTSASFQMMQGS--VSVKLKLSETDITACSSIPRSSQKWTATILGPVQSLPRRLQTL 230
                SF +  G+  ++V + L   ++ +C    +   +W   ++G +  LP +++ L
Sbjct: 178 YAAMLSFLISGGAQPLAVTVLLEGREVRSCQLDQQQHDEWAHVLVGALADLPNKVRVL 235

>NCAS0F02850 Chr6 (571260..572105) [846 bp, 281 aa] {ON} Anc_5.349
           YDR318W
          Length = 281

 Score =  101 bits (251), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 61/166 (36%), Positives = 95/166 (57%), Gaps = 28/166 (16%)

Query: 1   MFDSTVADLFNTDILTSPSKRKKVV-NSRKHQELIKKLD-----IENLYRTIGLSTFPVV 54
           MFD++VAD+ NT++L+SPSKR+ ++ N +   E  K L      +EN++R +G+S F  V
Sbjct: 128 MFDTSVADVLNTEMLSSPSKRRLILKNGQDEMEENKHLQKEYRLLENVFRIVGISFFDAV 187

Query: 55  DPSDVEQDEDGETIFRRSMIGLRLEIFNELDKTFEPPHYVLFK---QNLKTGHWNIFRHT 111
           DP+D+E D          MIG+RL+ FN+  K +    Y++ K   +N + G W I +HT
Sbjct: 188 DPNDLESD----------MIGIRLDPFNQPSKVY----YIILKKEAKNNREGLWTIIKHT 233

Query: 112 IPSYVGVERLFEQTK-----TINPLADIGKIYTFGKKVYTSLLSIS 152
           IP Y+ V   F ++K     T+  + +   IY   K+VY  LL +S
Sbjct: 234 IPKYINVTNTFGESKRETWRTMIKIENHDDIYLLAKEVYVKLLLLS 279

>KLLA0B10142g Chr2 (887476..887527,887649..888478) [882 bp, 293 aa]
           {ON} similar to uniprot|Q06675 Saccharomyces cerevisiae
           YDR318W MCM21 Protein involved in minichromosome
           maintenance component of the COMA complex that bridges
           kinetochore subunits that are in contact with
           centromeric DNA and the subunits bound to microtubules
          Length = 293

 Score = 78.2 bits (191), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 51/197 (25%), Positives = 97/197 (49%), Gaps = 23/197 (11%)

Query: 40  ENLYRTIGLSTFPVVDPSDVEQDEDGETIFRRSMIGLRLEIFNELDKTFEPPHYVLFKQN 99
           EN  R IG+S FPV +  ++E             +G+RLE+F+EL   ++PP YV+ K +
Sbjct: 114 ENSVRLIGVSLFPV-NYDNIE------------FMGIRLELFDELSLKYDPPFYVILKPS 160

Query: 100 LKT-GHWNIFRHTIPSYVGVERLFEQTKTINPLADIGKIYTFGKKVYTSLLSISTKQQTF 158
           +K  G W +F+H +P Y+ + + ++        +D   I  F    Y  LL + ++ Q F
Sbjct: 161 VKRLGIWELFKHNLPKYINIHQHWQLITKDTDTSD-SNIMKFANLCYKDLLKVHSRVQFF 219

Query: 159 KSLAESGI----VSQLVIDPSCTSASFQMMQGSVSVKLKLSETDITACSSIPRSSQKWTA 214
           + L  + +     S L ID    + SF++    + +K+   + +I  C+     + +   
Sbjct: 220 RKLEGNYVNDKQYSLLHIDNMGLNVSFRLGADIIKIKVDDGDDEIIDCT----FNGEKNI 275

Query: 215 TILGPVQSLPRRLQTLV 231
           ++LG +  +  R Q+++
Sbjct: 276 SLLGSIYGITNRFQSII 292

>NDAI0I01550 Chr9 (368193..369023) [831 bp, 276 aa] {ON} Anc_5.349
           YDR318W
          Length = 276

 Score = 77.4 bits (189), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 47/153 (30%), Positives = 85/153 (55%), Gaps = 11/153 (7%)

Query: 1   MFDSTVADLFNTDILTSPSKRKKVVNSRKHQELIKKLD-IENLYRTIGLSTFPVVDPSDV 59
           MFD++VAD+  TDIL+SPSKR      R+   L + L  +E+ Y+ +G++   + DP+D+
Sbjct: 129 MFDTSVADVLGTDILSSPSKRIIETKERQSDNLQRTLILLEDFYKKLGVNFLQLFDPNDL 188

Query: 60  EQDEDGETI-FRRSMIGLRLEIFNELDKTFEPPHYVLFKQNLKTGHWNIFRHTIPSYVGV 118
           E +E  E +  +  M+G+R E+ +         +Y+L K+   + +W  ++H++P+ + V
Sbjct: 189 EMNEKMEALQMKGDMLGVRFELPS---SEGAQKYYLLLKKETASDYWIPYKHSLPNIIDV 245

Query: 119 ERLFEQTKTINPLADIGK-IYTFGKKVYTSLLS 150
              F     +N  A+  + IY   K +Y  LL+
Sbjct: 246 NEYF-----VNVAAESHEDIYLIAKDIYLQLLT 273

>KAFR0K00630 Chr11 complement(135570..139574) [4005 bp, 1334 aa] {ON}
            Anc_7.72 YAL026C
          Length = 1334

 Score = 32.7 bits (73), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 35/129 (27%), Positives = 53/129 (41%), Gaps = 18/129 (13%)

Query: 106  NIFRHTIPSYVGVERLFEQTKTINPLADIGKIYTFGKKVYTSLL-------SISTKQQT- 157
            N F H+I  YVGV   +     +N   ++   +T+G  VYT+ +       ++ T Q T 
Sbjct: 1079 NGFYHSIIIYVGVVFFYRYGSALNMNGEVADHWTWGTTVYTTSILVVLGKAALVTNQWTK 1138

Query: 158  FKSLAESG-IVSQLVIDPSCTSASFQMMQGSVSVKLKLSETDITACSSIPRSSQKWTATI 216
            F  +A  G  V  LV  P         + GS+   + +S       S    S   W   I
Sbjct: 1139 FTLVAIPGSFVFWLVFFP---------IYGSIFPYVNISREYFGVVSHTYGSGVFWLTLI 1189

Query: 217  LGPVQSLPR 225
            + PV +L R
Sbjct: 1190 VLPVLALLR 1198

>NDAI0J03010 Chr10 (748394..753361) [4968 bp, 1655 aa] {ON}
           Anc_4.375 YJR140C
          Length = 1655

 Score = 32.7 bits (73), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 32/55 (58%), Gaps = 5/55 (9%)

Query: 61  QDEDGETIFRRSMIGLRLEIFNELDKTFEPPHYVLFKQN-LKTGHWNIFRHTIPS 114
           Q E+   I++ ++  L+L+ F E D TF+     LF+++ LK   W  +RHT P+
Sbjct: 26  QIEESFEIYQTALSQLKLKQFEEADLTFQK----LFEKDVLKPDKWGFYRHTSPT 76

>TDEL0F05080 Chr6 complement(955954..958458) [2505 bp, 834 aa] {ON}
           Anc_8.384 YLR166C
          Length = 834

 Score = 32.0 bits (71), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 48/95 (50%), Gaps = 10/95 (10%)

Query: 119 ERLFEQTKTINPLADIGKIYTFGKKVYTSLLSISTKQQTFKSLAESGIVSQLVIDPSC-- 176
           ++L   T+ ++PL +  +I    KK Y   + + T+   F S+ +S  +  L I P+   
Sbjct: 118 DQLTNVTQVVSPLGEKMEIAIRRKKAYIKSVELITQYNAFYSIGKSSYLETLRISPNWQK 177

Query: 177 -TSASFQMMQGSVSVKLKLSETDITACSSIPRSSQ 210
            T A+  MM+  +++ LK+        SSIPR+ +
Sbjct: 178 KTQAAI-MMKNLLALALKVE------TSSIPRTGE 205

>Suva_8.163 Chr8 (286737..288050) [1314 bp, 437 aa] {ON} YOR110W
           (REAL)
          Length = 437

 Score = 30.8 bits (68), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 18/64 (28%), Positives = 33/64 (51%), Gaps = 3/64 (4%)

Query: 160 SLAESGIVSQLVIDPSCTSASFQMMQGSVSVKLKLSETDITACSSIPRSSQKWTATILGP 219
           SL E+G    ++   SC+   +++++ S  +   +   D TA S IP  ++KW  T+ G 
Sbjct: 189 SLDENG---NIIRSGSCSLDKYEVLRKSYDITEDVDNQDQTALSYIPFGNRKWVLTMNGN 245

Query: 220 VQSL 223
            + L
Sbjct: 246 TEFL 249

>ZYRO0B06160g Chr2 complement(493345..496218) [2874 bp, 957 aa] {ON}
           highly similar to uniprot|P25847 Saccharomyces
           cerevisiae YOL090W MSH2 Protein that forms heterodimers
           with Msh3p and Msh6p that bind to DNA mismatches to
           initiate the mismatch repair process contains a Walker
           ATP- binding motif required for repair activity
           Msh2p-Msh6p binds to and hydrolyzes ATP
          Length = 957

 Score = 30.8 bits (68), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 26/49 (53%), Gaps = 7/49 (14%)

Query: 96  FKQNLKTGHWNIFRHTIPSYVGVERLFEQTKTINPLADIGKIYTFGKKV 144
            +Q L+T H       +PS + V R+ ++      L D+ KIY FGKK+
Sbjct: 380 LRQILQTDH-------LPSVLDVRRITKKLNRNGNLEDVLKIYQFGKKI 421

>Kpol_1040.9 s1040 (27948..29465) [1518 bp, 505 aa] {ON}
           (27948..29465) [1518 nt, 506 aa]
          Length = 505

 Score = 29.6 bits (65), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 28/52 (53%), Gaps = 1/52 (1%)

Query: 50  TFPVVDPSDVEQDEDGETIFRRSMIGLRLEIFNELDKTFEPPHYVLFKQNLK 101
           T P++  SD ++D D ETI  R+   L L+  N + K +E P  +    N+K
Sbjct: 39  TIPIITVSDGDEDCDAETIVLRTQSELSLKNLNNI-KNYEIPTKINSSPNMK 89

>TPHA0F01180 Chr6 (267674..270061) [2388 bp, 795 aa] {ON} Anc_2.264
           YIL107C
          Length = 795

 Score = 29.3 bits (64), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 30/123 (24%), Positives = 50/123 (40%), Gaps = 14/123 (11%)

Query: 5   TVADLFNTDILTSPSKRKKVVNSRKHQELIKKLDI------ENLYRTIGLSTFPVVDP-- 56
           T++   N D+  + S      NS+KH  ++   D       + LY+T      P+ D   
Sbjct: 31  TLSKTSNNDVSPTNSTSNSAPNSKKHVRILTNKDSLLDDKEQGLYKTTSFLKRPLSDTPV 90

Query: 57  -----SDVEQDEDGETIFRRSMIGLRLEIFNELDKTFEPPHYVLFKQNLKTGHWNIFRHT 111
                S     ED   + R S   + L   N+++   EP    L K NL TG+ ++   +
Sbjct: 91  GSVWNSPGTSREDTPNVSRESS-AMNLLKLNKINSNTEPSIKALLKSNLITGNLHLQHGS 149

Query: 112 IPS 114
            P+
Sbjct: 150 TPN 152

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.133    0.376 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 23,329,230
Number of extensions: 970320
Number of successful extensions: 3573
Number of sequences better than 10.0: 42
Number of HSP's gapped: 3599
Number of HSP's successfully gapped: 42
Length of query: 231
Length of database: 53,481,399
Length adjustment: 106
Effective length of query: 125
Effective length of database: 41,326,803
Effective search space: 5165850375
Effective search space used: 5165850375
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 64 (29.3 bits)