Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_34.159795.351ON72872838310.0
KLTH0H14850g5.351ON72672333050.0
SAKL0G08844g5.351ON74672230180.0
TPHA0E011205.351ON73372428480.0
Suva_15.2625.351ON73172428300.0
Kpol_339.125.351ON73372528250.0
YHR072W (ERG7)5.351ON73172428030.0
KAFR0D046705.351ON73172327970.0
KNAG0B045805.351ON72972627930.0
Skud_8.1315.351ON73172527900.0
Smik_8.1485.351ON73172527790.0
KLLA0B10175g5.351ON73172527670.0
TDEL0E027605.351ON73172327490.0
NCAS0H016405.351ON72872527320.0
NDAI0C019705.351ON73172527300.0
TBLA0A031205.351ON74372727200.0
AGR351W5.351ON72972427090.0
CAGL0J10824g5.351ON73371926790.0
Ecym_81825.351ON73272426670.0
ZYRO0D10164g5.351ON73272426290.0
SAKL0F08602g7.240ON47498761.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_34.15979
         (728 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_34.15979 s34 complement(142874..145060) [2187 bp, 728 aa] {...  1480   0.0  
KLTH0H14850g Chr8 (1287375..1289555) [2181 bp, 726 aa] {ON} high...  1277   0.0  
SAKL0G08844g Chr7 complement(757226..759466) [2241 bp, 746 aa] {...  1167   0.0  
TPHA0E01120 Chr5 complement(230336..232537) [2202 bp, 733 aa] {O...  1101   0.0  
Suva_15.262 Chr15 (440969..443164) [2196 bp, 731 aa] {ON} YHR072...  1094   0.0  
Kpol_339.12 s339 (18976..21177) [2202 bp, 733 aa] {ON} (18976..2...  1092   0.0  
YHR072W Chr8 (239098..241293) [2196 bp, 731 aa] {ON}  ERG7Lanost...  1084   0.0  
KAFR0D04670 Chr4 (915691..917886) [2196 bp, 731 aa] {ON} Anc_5.3...  1082   0.0  
KNAG0B04580 Chr2 complement(884911..887100) [2190 bp, 729 aa] {O...  1080   0.0  
Skud_8.131 Chr8 (212610..214805) [2196 bp, 731 aa] {ON} YHR072W ...  1079   0.0  
Smik_8.148 Chr8 (215426..217621) [2196 bp, 731 aa] {ON} YHR072W ...  1075   0.0  
KLLA0B10175g Chr2 (889538..891733) [2196 bp, 731 aa] {ON} highly...  1070   0.0  
TDEL0E02760 Chr5 complement(531650..533845) [2196 bp, 731 aa] {O...  1063   0.0  
NCAS0H01640 Chr8 complement(313901..316087) [2187 bp, 728 aa] {O...  1056   0.0  
NDAI0C01970 Chr3 complement(442137..444332) [2196 bp, 731 aa] {O...  1056   0.0  
TBLA0A03120 Chr1 (742618..744849) [2232 bp, 743 aa] {ON} Anc_5.3...  1052   0.0  
AGR351W Chr7 (1381502..1383691) [2190 bp, 729 aa] {ON} Syntenic ...  1048   0.0  
CAGL0J10824g Chr10 complement(1056204..1058405) [2202 bp, 733 aa...  1036   0.0  
Ecym_8182 Chr8 complement(379402..381600) [2199 bp, 732 aa] {ON}...  1031   0.0  
ZYRO0D10164g Chr4 (854166..856364) [2199 bp, 732 aa] {ON} highly...  1017   0.0  
SAKL0F08602g Chr6 (657898..659322) [1425 bp, 474 aa] {ON} simila...    34   1.5  

>Kwal_34.15979 s34 complement(142874..145060) [2187 bp, 728 aa] {ON}
           YHR072W (ERG7) - 2,3-oxidosqualene-lanosterol cyclase
           [contig 272] FULL
          Length = 728

 Score = 1480 bits (3831), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 712/728 (97%), Positives = 712/728 (97%)

Query: 1   MLYSEELGLPKTDSKRWRLKTDALGSEKWEYLSEIEAKQQPQSAYVKYLLQLPDFEAPKP 60
           MLYSEELGLPKTDSKRWRLKTDALGSEKWEYLSEIEAKQQPQSAYVKYLLQLPDFEAPKP
Sbjct: 1   MLYSEELGLPKTDSKRWRLKTDALGSEKWEYLSEIEAKQQPQSAYVKYLLQLPDFEAPKP 60

Query: 61  AVNKNSAHFTAKDAAFNGAQFFSLLQEDSGIFPCQYKGPMFMTIGYVAALYCAEVPIPTP 120
           AVNKNSAHFTAKDAAFNGAQFFSLLQEDSGIFPCQYKGPMFMTIGYVAALYCAEVPIPTP
Sbjct: 61  AVNKNSAHFTAKDAAFNGAQFFSLLQEDSGIFPCQYKGPMFMTIGYVAALYCAEVPIPTP 120

Query: 121 VKQEIIRYIVNSSHPVDGGWGLHEVDKSTTFGTVINYVILRLLGLKPDNIVCQRARRTLH 180
           VKQEIIRYIVNSSHPVDGGWGLHEVDKSTTFGTVINYVILRLLGLKPDNIVCQRARRTLH
Sbjct: 121 VKQEIIRYIVNSSHPVDGGWGLHEVDKSTTFGTVINYVILRLLGLKPDNIVCQRARRTLH 180

Query: 181 RLGGAVGAPHWGKAWLSILNLYKWEGVNPAPPELWLLPYALPIHPGRWWVHTRAIYQALG 240
           RLGGAVGAPHWGKAWLSILNLYKWEGVNPAPPELWLLPYALPIHPGRWWVHTRAIYQALG
Sbjct: 181 RLGGAVGAPHWGKAWLSILNLYKWEGVNPAPPELWLLPYALPIHPGRWWVHTRAIYQALG 240

Query: 241 YLSAAKYSCPVTPLLEEIRNEIYTQPFESIDFSKQKNNVCGVDLYYPHTRLLNIANASMI 300
           YLSAAKYSCPVTPLLEEIRNEIYTQPFESIDFSKQKNNVCGVDLYYPHTRLLNIANASMI
Sbjct: 241 YLSAAKYSCPVTPLLEEIRNEIYTQPFESIDFSKQKNNVCGVDLYYPHTRLLNIANASMI 300

Query: 301 FYEKYLKPDWFLKYSNRKVYELIKKEIKNTDYLCIAPVSMAFCAIVTLIEEGRDSYEFKR 360
           FYEKYLKPDWFLKYSNRKVYELIKKEIKNTDYLCIAPVSMAFCAIVTLIEEGRDSYEFKR
Sbjct: 301 FYEKYLKPDWFLKYSNRKVYELIKKEIKNTDYLCIAPVSMAFCAIVTLIEEGRDSYEFKR 360

Query: 361 FLERFEDVLFLGPQGMTVMGTNGVQVWDCAFAIQYYFVAGLAELPEFHETIEKAYKFLCR 420
           FLERFEDVLFLGPQGMTVMGTNGVQVWDCAFAIQYYFVAGLAELPEFHETIEKAYKFLCR
Sbjct: 361 FLERFEDVLFLGPQGMTVMGTNGVQVWDCAFAIQYYFVAGLAELPEFHETIEKAYKFLCR 420

Query: 421 SQFDTECEPGSFRDKRIGAWPFSTKTQGYTVSDCTAESVKAIIMVRNSPSFANLRDEISD 480
           SQFDTECEPGSFRDKRIGAWPFSTKTQGYTVSDCTAESVKAIIMVRNSPSFANLRDEISD
Sbjct: 421 SQFDTECEPGSFRDKRIGAWPFSTKTQGYTVSDCTAESVKAIIMVRNSPSFANLRDEISD 480

Query: 481 ERLYKAMDVLLALQNTGSFEYGSFATYEKIKATTKLEKLNPAEVFGNIMVEFPYVECTDS 540
           ERLYKAMDVLLALQNTGSFEYGSFATYEKIKATTKLEKLNPAEVFGNIMVEFPYVECTDS
Sbjct: 481 ERLYKAMDVLLALQNTGSFEYGSFATYEKIKATTKLEKLNPAEVFGNIMVEFPYVECTDS 540

Query: 541 SVLGLTYFSKHYTYRXXXXXXXXXXXXXXXXNAQKPDGSWYGCWGICFTYAGMFALEALH 600
           SVLGLTYFSKHYTYR                NAQKPDGSWYGCWGICFTYAGMFALEALH
Sbjct: 541 SVLGLTYFSKHYTYRQEEIKKAIEIAIQYIKNAQKPDGSWYGCWGICFTYAGMFALEALH 600

Query: 601 TVDETYENSEVVQKGCDFLVSKQRPDGGWSESMKSSELHSYVESANSQAVQTAWALIGLL 660
           TVDETYENSEVVQKGCDFLVSKQRPDGGWSESMKSSELHSYVESANSQAVQTAWALIGLL
Sbjct: 601 TVDETYENSEVVQKGCDFLVSKQRPDGGWSESMKSSELHSYVESANSQAVQTAWALIGLL 660

Query: 661 LAEYPNKEIIDKGINLLKKRQLESGEWKFEEVEGVFNHSCAIEYPSYKFLFPIKALGLYA 720
           LAEYPNKEIIDKGINLLKKRQLESGEWKFEEVEGVFNHSCAIEYPSYKFLFPIKALGLYA
Sbjct: 661 LAEYPNKEIIDKGINLLKKRQLESGEWKFEEVEGVFNHSCAIEYPSYKFLFPIKALGLYA 720

Query: 721 KKYEHLNE 728
           KKYEHLNE
Sbjct: 721 KKYEHLNE 728

>KLTH0H14850g Chr8 (1287375..1289555) [2181 bp, 726 aa] {ON} highly
           similar to uniprot|P38604 Saccharomyces cerevisiae
           YHR072W ERG7 Lanosterol synthase an essential enzyme
           that catalyzes the cyclization of squalene 2 3- epoxide
           a step in ergosterol biosynthesis
          Length = 726

 Score = 1277 bits (3305), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 599/723 (82%), Positives = 651/723 (90%)

Query: 2   LYSEELGLPKTDSKRWRLKTDALGSEKWEYLSEIEAKQQPQSAYVKYLLQLPDFEAPKPA 61
           LY++ELGLP TD   WRL+TD LGSEKWEYLSE EAK  PQS+YVKYLLQ PDFEAP+P 
Sbjct: 3   LYADELGLPTTDKTLWRLRTDELGSEKWEYLSEEEAKADPQSSYVKYLLQNPDFEAPEPL 62

Query: 62  VNKNSAHFTAKDAAFNGAQFFSLLQEDSGIFPCQYKGPMFMTIGYVAALYCAEVPIPTPV 121
            +     FTA DAAFNGAQFFSLLQED+GIFPCQYKGPMF+TIGYVA LYCA +P+P  +
Sbjct: 63  RSSKCDEFTAGDAAFNGAQFFSLLQEDTGIFPCQYKGPMFLTIGYVATLYCARIPVPEHI 122

Query: 122 KQEIIRYIVNSSHPVDGGWGLHEVDKSTTFGTVINYVILRLLGLKPDNIVCQRARRTLHR 181
           K EIIRYIVNS+HPVDGGWGLHEVDKSTTFGT INYVILRLLGL+ D+IVCQRAR+TLHR
Sbjct: 123 KIEIIRYIVNSAHPVDGGWGLHEVDKSTTFGTAINYVILRLLGLEADHIVCQRARKTLHR 182

Query: 182 LGGAVGAPHWGKAWLSILNLYKWEGVNPAPPELWLLPYALPIHPGRWWVHTRAIYQALGY 241
           LGGA+GAPHWGKAWLSILNLY+WEGVNPAPPELWLLPYALPIHPGRWWVHTRA+YQALGY
Sbjct: 183 LGGAIGAPHWGKAWLSILNLYRWEGVNPAPPELWLLPYALPIHPGRWWVHTRAVYQALGY 242

Query: 242 LSAAKYSCPVTPLLEEIRNEIYTQPFESIDFSKQKNNVCGVDLYYPHTRLLNIANASMIF 301
           LSAAKY C +TPLL+EIR EIY +PFESIDFSK KN V GVDLYYPHT+LLNIAN ++  
Sbjct: 243 LSAAKYCCELTPLLQEIRKEIYVKPFESIDFSKHKNTVGGVDLYYPHTKLLNIANVALTL 302

Query: 302 YEKYLKPDWFLKYSNRKVYELIKKEIKNTDYLCIAPVSMAFCAIVTLIEEGRDSYEFKRF 361
           YE YLKP+WFLKYSNRKVYELIKKEIKNTDYLCIAPVSMAFCA+VTLIEEGRDSYEFKRF
Sbjct: 303 YENYLKPNWFLKYSNRKVYELIKKEIKNTDYLCIAPVSMAFCAVVTLIEEGRDSYEFKRF 362

Query: 362 LERFEDVLFLGPQGMTVMGTNGVQVWDCAFAIQYYFVAGLAELPEFHETIEKAYKFLCRS 421
           ++ F++VLF+GPQGMTVMGTNGVQVWDCAFAIQYYFVAGLAELPEF +TIEKAYKFLCRS
Sbjct: 363 VDGFQEVLFMGPQGMTVMGTNGVQVWDCAFAIQYYFVAGLAELPEFRDTIEKAYKFLCRS 422

Query: 422 QFDTECEPGSFRDKRIGAWPFSTKTQGYTVSDCTAESVKAIIMVRNSPSFANLRDEISDE 481
           QFDTECEPGSFRDKR+GAWPFSTKTQGYTVSDCTAE+VKAIIMVRNSP F  LR EISDE
Sbjct: 423 QFDTECEPGSFRDKRVGAWPFSTKTQGYTVSDCTAEAVKAIIMVRNSPKFTYLRGEISDE 482

Query: 482 RLYKAMDVLLALQNTGSFEYGSFATYEKIKATTKLEKLNPAEVFGNIMVEFPYVECTDSS 541
           RLYKA+D+LL LQNTGSFEYGSFATYEKIKATT LEKLNPAEVFGNIMVEFPYVECTDSS
Sbjct: 483 RLYKAVDILLGLQNTGSFEYGSFATYEKIKATTALEKLNPAEVFGNIMVEFPYVECTDSS 542

Query: 542 VLGLTYFSKHYTYRXXXXXXXXXXXXXXXXNAQKPDGSWYGCWGICFTYAGMFALEALHT 601
           VLGLTYF+K+Y YR                  Q PDGSWYGCWG+CFTYAGMFALEAL+T
Sbjct: 543 VLGLTYFAKYYNYRKDEITKAIEIAIQYIKRVQNPDGSWYGCWGVCFTYAGMFALEALYT 602

Query: 602 VDETYENSEVVQKGCDFLVSKQRPDGGWSESMKSSELHSYVESANSQAVQTAWALIGLLL 661
           V E YENSEVV+KGCDF  S+QR DGGWSESMKSSELH+YVE+ NSQ VQTAWALIGLLL
Sbjct: 603 VGENYENSEVVRKGCDFFASRQRSDGGWSESMKSSELHTYVEADNSQVVQTAWALIGLLL 662

Query: 662 AEYPNKEIIDKGINLLKKRQLESGEWKFEEVEGVFNHSCAIEYPSYKFLFPIKALGLYAK 721
           A+YPN+++ID+GI LLKKRQL SGEWKFE+VEGVFNHSCAIEYPSYKFLFPIKALGLY+K
Sbjct: 663 AKYPNRDVIDRGIALLKKRQLPSGEWKFEDVEGVFNHSCAIEYPSYKFLFPIKALGLYSK 722

Query: 722 KYE 724
           +YE
Sbjct: 723 RYE 725

>SAKL0G08844g Chr7 complement(757226..759466) [2241 bp, 746 aa] {ON}
           highly similar to uniprot|P38604 Saccharomyces
           cerevisiae YHR072W ERG7 Lanosterol synthase an essential
           enzyme that catalyzes the cyclization of squalene 2 3-
           epoxide a step in ergosterol biosynthesis
          Length = 746

 Score = 1167 bits (3018), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 546/722 (75%), Positives = 613/722 (84%)

Query: 2   LYSEELGLPKTDSKRWRLKTDALGSEKWEYLSEIEAKQQPQSAYVKYLLQLPDFEAPKPA 61
           LYS++LGLPKTD  RWRL TD LG E WEYLS  +A ++PQS+YVKYLLQLPDF APKP 
Sbjct: 20  LYSDQLGLPKTDPTRWRLHTDELGRETWEYLSTEQAAKEPQSSYVKYLLQLPDFPAPKPE 79

Query: 62  VNKNSAHFTAKDAAFNGAQFFSLLQEDSGIFPCQYKGPMFMTIGYVAALYCAEVPIPTPV 121
                  FTA DAA+NGAQF  LLQE+SGIFPCQYKGPMF+TIGYVA  Y A + IP   
Sbjct: 80  RTSEDPEFTAYDAAYNGAQFLQLLQEESGIFPCQYKGPMFITIGYVATCYAAGIEIPEHE 139

Query: 122 KQEIIRYIVNSSHPVDGGWGLHEVDKSTTFGTVINYVILRLLGLKPDNIVCQRARRTLHR 181
           + EI+RYIVN +HPVDGGWGLH  DKST FGT INYVILRLLGL  D+IVC+RAR TL +
Sbjct: 140 RHEIVRYIVNMAHPVDGGWGLHSEDKSTAFGTSINYVILRLLGLPSDHIVCRRARSTLLK 199

Query: 182 LGGAVGAPHWGKAWLSILNLYKWEGVNPAPPELWLLPYALPIHPGRWWVHTRAIYQALGY 241
           LGGA+GAPHWGK WLSILNLY WEGVNPAPPELWLLPYALPIHPGRWWVHTRA+Y  +GY
Sbjct: 200 LGGAIGAPHWGKIWLSILNLYGWEGVNPAPPELWLLPYALPIHPGRWWVHTRAVYMPVGY 259

Query: 242 LSAAKYSCPVTPLLEEIRNEIYTQPFESIDFSKQKNNVCGVDLYYPHTRLLNIANASMIF 301
           LSA K+ C +TPLL+EIR EIYT+ +++IDFSK +N VCG+DLYYPHT+LL++AN  M+F
Sbjct: 260 LSAKKFCCELTPLLKEIRTEIYTKEYDTIDFSKHRNTVCGIDLYYPHTKLLDVANWGMVF 319

Query: 302 YEKYLKPDWFLKYSNRKVYELIKKEIKNTDYLCIAPVSMAFCAIVTLIEEGRDSYEFKRF 361
           YEKYL+P+WFL Y+N+KVYELIKKEI NTDYLCIAPV+MAFCA+VTLIEEG DS+EF RF
Sbjct: 320 YEKYLRPNWFLNYTNKKVYELIKKEITNTDYLCIAPVNMAFCAVVTLIEEGVDSHEFNRF 379

Query: 362 LERFEDVLFLGPQGMTVMGTNGVQVWDCAFAIQYYFVAGLAELPEFHETIEKAYKFLCRS 421
            +RF+DVLF GPQGMT+MGTNGVQVWDCAFA+QY F+A LAELPEF   I KAYKFLCRS
Sbjct: 380 RDRFKDVLFHGPQGMTLMGTNGVQVWDCAFAVQYLFLAELAELPEFRGIIVKAYKFLCRS 439

Query: 422 QFDTECEPGSFRDKRIGAWPFSTKTQGYTVSDCTAESVKAIIMVRNSPSFANLRDEISDE 481
           QFDTECEPGSFRDKR+G WPFSTKTQGYTVSDCTAE+VKAIIMVRNSP+F   R+EISDE
Sbjct: 440 QFDTECEPGSFRDKRVGGWPFSTKTQGYTVSDCTAEAVKAIIMVRNSPAFVEYRNEISDE 499

Query: 482 RLYKAMDVLLALQNTGSFEYGSFATYEKIKATTKLEKLNPAEVFGNIMVEFPYVECTDSS 541
           RLYKAMD+LL LQN GSFEYGSFA+YEKIKA+T +EKLNPAEVFGNIMVEFPYVECTDSS
Sbjct: 500 RLYKAMDILLNLQNVGSFEYGSFASYEKIKASTLIEKLNPAEVFGNIMVEFPYVECTDSS 559

Query: 542 VLGLTYFSKHYTYRXXXXXXXXXXXXXXXXNAQKPDGSWYGCWGICFTYAGMFALEALHT 601
           VLGLTYF KHY YR                 +Q  +GSWYG WG+CFTYAGMFALEAL+T
Sbjct: 560 VLGLTYFHKHYDYRKDDIAHAIKIAIDYIKRSQAKNGSWYGSWGVCFTYAGMFALEALYT 619

Query: 602 VDETYENSEVVQKGCDFLVSKQRPDGGWSESMKSSELHSYVESANSQAVQTAWALIGLLL 661
           V E YENSEVV+KGCDFLVS+Q  DGGW ES KSSELH+YV S  S  VQTAW++IGLLL
Sbjct: 620 VGENYENSEVVRKGCDFLVSRQMEDGGWGESPKSSELHNYVSSEQSLVVQTAWSVIGLLL 679

Query: 662 AEYPNKEIIDKGINLLKKRQLESGEWKFEEVEGVFNHSCAIEYPSYKFLFPIKALGLYAK 721
           AEYP+K++ID+GI LLK RQL SGEWKFE +EGVFNHSC IEYPSYKFLFPIKALGLYAK
Sbjct: 680 AEYPDKKVIDRGIQLLKSRQLPSGEWKFESIEGVFNHSCMIEYPSYKFLFPIKALGLYAK 739

Query: 722 KY 723
           +Y
Sbjct: 740 RY 741

>TPHA0E01120 Chr5 complement(230336..232537) [2202 bp, 733 aa] {ON}
           Anc_5.351 YHR072W
          Length = 733

 Score = 1101 bits (2848), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 519/724 (71%), Positives = 591/724 (81%), Gaps = 2/724 (0%)

Query: 2   LYSEELGLPKTDSKRWRLKTDALGSEKWEYLSEIEAK-QQPQSAYVKYLLQLPDFEAPKP 60
            YSE++GLPKTD K WRL+TD LG E WEYL E E      QS Y K+LLQ+PDF AP P
Sbjct: 5   FYSEQIGLPKTDPKSWRLRTDELGRESWEYLKEGEVDLNDEQSTYTKWLLQVPDFPAPNP 64

Query: 61  AVNKNSAHFTAKDAAFNGAQFFSLLQE-DSGIFPCQYKGPMFMTIGYVAALYCAEVPIPT 119
           A+N  SA+F A++A  NGA F+ LLQ+  SG+FPCQYKGPMFM IGY+A  Y A + IP 
Sbjct: 65  AINSESANFKAENACHNGASFYKLLQDPTSGMFPCQYKGPMFMAIGYIAVNYIAGIEIPD 124

Query: 120 PVKQEIIRYIVNSSHPVDGGWGLHEVDKSTTFGTVINYVILRLLGLKPDNIVCQRARRTL 179
             + E+IRYIVN+SHPVDGGWGLH VDKST FGT +NYV LRLLGL  D+ VC +AR TL
Sbjct: 125 HERIEMIRYIVNTSHPVDGGWGLHSVDKSTVFGTALNYVNLRLLGLSKDHPVCVKARDTL 184

Query: 180 HRLGGAVGAPHWGKAWLSILNLYKWEGVNPAPPELWLLPYALPIHPGRWWVHTRAIYQAL 239
            RLGGA+GAPHWGK WLS LNLYKWEGVNPAPPE WLLPY+LPIHPGRWWVHTR +Y  +
Sbjct: 185 MRLGGAIGAPHWGKIWLSALNLYKWEGVNPAPPETWLLPYSLPIHPGRWWVHTRGVYIPV 244

Query: 240 GYLSAAKYSCPVTPLLEEIRNEIYTQPFESIDFSKQKNNVCGVDLYYPHTRLLNIANASM 299
            YLS  KY+C +TPLL EIR EIYT+ FESIDFSK +N VCGVDLYYPH++LL++AN  +
Sbjct: 245 SYLSLTKYTCELTPLLAEIRTEIYTKDFESIDFSKHRNTVCGVDLYYPHSKLLDVANDCL 304

Query: 300 IFYEKYLKPDWFLKYSNRKVYELIKKEIKNTDYLCIAPVSMAFCAIVTLIEEGRDSYEFK 359
           +FYE YL+P+W  + S + VYELIKKEI+NTDYLCIAPV+ AFCA+VTLIEEG++S +F+
Sbjct: 305 VFYENYLRPEWVYEKSRKSVYELIKKEIENTDYLCIAPVNQAFCALVTLIEEGKNSKQFE 364

Query: 360 RFLERFEDVLFLGPQGMTVMGTNGVQVWDCAFAIQYYFVAGLAELPEFHETIEKAYKFLC 419
           RF  R +D LF GPQGMTVMGTNG QVWDCAF IQYYFVAGLAE PEF++ I  AYKFLC
Sbjct: 365 RFQYRMKDALFHGPQGMTVMGTNGTQVWDCAFFIQYYFVAGLAEKPEFYDAISAAYKFLC 424

Query: 420 RSQFDTECEPGSFRDKRIGAWPFSTKTQGYTVSDCTAESVKAIIMVRNSPSFANLRDEIS 479
           RSQFDTECEPGSFRDKR+GAW FSTKTQGYTVSDCTAES+KAIIMVRNSP+FA + +E S
Sbjct: 425 RSQFDTECEPGSFRDKRVGAWGFSTKTQGYTVSDCTAESIKAIIMVRNSPTFAKIHNEFS 484

Query: 480 DERLYKAMDVLLALQNTGSFEYGSFATYEKIKATTKLEKLNPAEVFGNIMVEFPYVECTD 539
           DERLYK +D+L++LQN GSFEYGSFATYEKIKA   +E LNPAEVFGNIMVE+PYVECTD
Sbjct: 485 DERLYKGIDILMSLQNLGSFEYGSFATYEKIKAPLFMEALNPAEVFGNIMVEYPYVECTD 544

Query: 540 SSVLGLTYFSKHYTYRXXXXXXXXXXXXXXXXNAQKPDGSWYGCWGICFTYAGMFALEAL 599
           SSVLGLTYF KHY Y+                + Q+ DGSWYGCWGICFTYAGMFA+EAL
Sbjct: 545 SSVLGLTYFHKHYDYKKEEISKRIKLAIDYIKSCQQKDGSWYGCWGICFTYAGMFAMEAL 604

Query: 600 HTVDETYENSEVVQKGCDFLVSKQRPDGGWSESMKSSELHSYVESANSQAVQTAWALIGL 659
            TV E Y+NSEVV+KGCDFLV KQ  DGGWSESMKSSELH+YV S  S  VQTAW LI L
Sbjct: 605 ETVGENYKNSEVVRKGCDFLVKKQMEDGGWSESMKSSELHTYVSSERSLVVQTAWVLIAL 664

Query: 660 LLAEYPNKEIIDKGINLLKKRQLESGEWKFEEVEGVFNHSCAIEYPSYKFLFPIKALGLY 719
           LLA+YP+K++ID+GI LLK RQ  SGEWKFEEVEGVFNHSCAIEY SY+FLFPIKALGLY
Sbjct: 665 LLAKYPHKDVIDRGIQLLKSRQQPSGEWKFEEVEGVFNHSCAIEYQSYRFLFPIKALGLY 724

Query: 720 AKKY 723
            K Y
Sbjct: 725 VKNY 728

>Suva_15.262 Chr15 (440969..443164) [2196 bp, 731 aa] {ON} YHR072W
           (REAL)
          Length = 731

 Score = 1094 bits (2830), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 519/724 (71%), Positives = 586/724 (80%), Gaps = 1/724 (0%)

Query: 2   LYSEELGLPKTDSKRWRLKTDALGSEKWEYLSEIEAKQQPQSAYVKYLLQLPDFEAPKPA 61
            YSE++GLPKTD +RWRL+TD LG E WEYL+  +A   P S + ++LLQ PDF  P PA
Sbjct: 4   FYSEKIGLPKTDPRRWRLRTDKLGRESWEYLTPEQAANDPPSTFTQWLLQDPDFPQPHPA 63

Query: 62  VNKNSAHFTAKDAAFNGAQFFSLLQE-DSGIFPCQYKGPMFMTIGYVAALYCAEVPIPTP 120
            NK+S  F+A DA  NGA FF LLQE DSGIFPCQYKGPMFMTIGYVA  Y A + IP  
Sbjct: 64  KNKHSPDFSAFDACHNGASFFKLLQEPDSGIFPCQYKGPMFMTIGYVAVSYIAGIQIPEH 123

Query: 121 VKQEIIRYIVNSSHPVDGGWGLHEVDKSTTFGTVINYVILRLLGLKPDNIVCQRARRTLH 180
            + E+IRYIVN++HPVDGGWGLH VDKST FGTV+NYVILRLLGL  D+ VC +AR TL 
Sbjct: 124 ERIELIRYIVNTAHPVDGGWGLHSVDKSTVFGTVLNYVILRLLGLSKDHPVCVKARDTLL 183

Query: 181 RLGGAVGAPHWGKAWLSILNLYKWEGVNPAPPELWLLPYALPIHPGRWWVHTRAIYQALG 240
           RLGGA+GAPHWGK WLS LNLYKWEGVNPAPPE WLLPY+LPIHPGRWWVHTR +Y  + 
Sbjct: 184 RLGGAIGAPHWGKVWLSALNLYKWEGVNPAPPETWLLPYSLPIHPGRWWVHTRGVYIPVS 243

Query: 241 YLSAAKYSCPVTPLLEEIRNEIYTQPFESIDFSKQKNNVCGVDLYYPHTRLLNIANASMI 300
           YLS  K+ CP+TPLLEE+R EIYT+PF+ I+FS  +N VCGVDLYYPH+++LNIAN  ++
Sbjct: 244 YLSLVKFVCPMTPLLEELRGEIYTKPFDKINFSNHRNTVCGVDLYYPHSKILNIANNFVV 303

Query: 301 FYEKYLKPDWFLKYSNRKVYELIKKEIKNTDYLCIAPVSMAFCAIVTLIEEGRDSYEFKR 360
           FYEKYL+  +    S RKVY+L+KKEI+NTD LCIAPV+ AFCA+VTLIEEG DS  FK 
Sbjct: 304 FYEKYLRNRFIYSLSKRKVYDLVKKEIENTDSLCIAPVNQAFCALVTLIEEGVDSQAFKD 363

Query: 361 FLERFEDVLFLGPQGMTVMGTNGVQVWDCAFAIQYYFVAGLAELPEFHETIEKAYKFLCR 420
           F  RF+D LF GPQGMT+MGTNGVQ WDCAFAIQY+F AGLAE PEFH+TI  AYKFLCR
Sbjct: 364 FQYRFKDALFHGPQGMTIMGTNGVQTWDCAFAIQYFFTAGLAERPEFHDTIVSAYKFLCR 423

Query: 421 SQFDTECEPGSFRDKRIGAWPFSTKTQGYTVSDCTAESVKAIIMVRNSPSFANLRDEISD 480
           SQFDTEC PGSFRDKR GAW FSTKTQGYTVSDCTAES+KAIIMVRNSP F+++   I++
Sbjct: 424 SQFDTECVPGSFRDKRKGAWGFSTKTQGYTVSDCTAESIKAIIMVRNSPVFSDVHHLITN 483

Query: 481 ERLYKAMDVLLALQNTGSFEYGSFATYEKIKATTKLEKLNPAEVFGNIMVEFPYVECTDS 540
           ERL++ +DVLL LQN GSFEYGSFATYEKIKA   +E LNPAEVFGNIMVE+PYVECTDS
Sbjct: 484 ERLFEGIDVLLNLQNVGSFEYGSFATYEKIKAPLAMENLNPAEVFGNIMVEYPYVECTDS 543

Query: 541 SVLGLTYFSKHYTYRXXXXXXXXXXXXXXXXNAQKPDGSWYGCWGICFTYAGMFALEALH 600
           SVLGLTYF K + Y+                 +Q PDG WYG WGICFTYAGMFALEALH
Sbjct: 544 SVLGLTYFHKFFDYKKEEISTCIRIAIEYIKKSQLPDGGWYGSWGICFTYAGMFALEALH 603

Query: 601 TVDETYENSEVVQKGCDFLVSKQRPDGGWSESMKSSELHSYVESANSQAVQTAWALIGLL 660
           TV ETYENS  V+KGCDFLVSKQ  DGGW ESMKSSELHSYV+S  S  VQTAWALI LL
Sbjct: 604 TVGETYENSSTVRKGCDFLVSKQMEDGGWGESMKSSELHSYVDSEESLVVQTAWALIALL 663

Query: 661 LAEYPNKEIIDKGINLLKKRQLESGEWKFEEVEGVFNHSCAIEYPSYKFLFPIKALGLYA 720
            AEYP +E+ID+GI LLK RQ ESGEWKFE VEGVFNHSCAIEYPSY+FLFPIKALG+Y 
Sbjct: 664 FAEYPRREVIDRGIELLKHRQEESGEWKFEGVEGVFNHSCAIEYPSYRFLFPIKALGMYT 723

Query: 721 KKYE 724
           K YE
Sbjct: 724 KAYE 727

>Kpol_339.12 s339 (18976..21177) [2202 bp, 733 aa] {ON}
           (18976..21177) [2202 nt, 734 aa]
          Length = 733

 Score = 1092 bits (2825), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 516/725 (71%), Positives = 593/725 (81%), Gaps = 3/725 (0%)

Query: 2   LYSEELGLPKTDSKRWRLKTDALGSEKWEYLSEIEAKQQPQSAYVKYLLQLPDFEAPKPA 61
            YSEE+GL KTD K WRL+TD LG E WEYL+  +A + PQS+Y ++LLQ+P+F  P P 
Sbjct: 4   FYSEEIGLEKTDPKLWRLRTDKLGRESWEYLTPEDADKDPQSSYTQWLLQVPEFPTPSPL 63

Query: 62  VNKNSAH--FTAKDAAFNGAQFFSLLQ-EDSGIFPCQYKGPMFMTIGYVAALYCAEVPIP 118
            N ++ +  +TA DA  NGA FF LLQ E+SGIFPCQYKGPMFMTIGY+A  Y A V IP
Sbjct: 64  KNSSNKNENYTAYDACHNGASFFKLLQDENSGIFPCQYKGPMFMTIGYIAVNYIAGVKIP 123

Query: 119 TPVKQEIIRYIVNSSHPVDGGWGLHEVDKSTTFGTVINYVILRLLGLKPDNIVCQRARRT 178
              + E+IRYIVN++HPVDGGWGLH VDKST FGTV+NYV LRLLGL  D+ VC +AR T
Sbjct: 124 DHERIELIRYIVNTAHPVDGGWGLHSVDKSTVFGTVLNYVNLRLLGLSKDHPVCVKARDT 183

Query: 179 LHRLGGAVGAPHWGKAWLSILNLYKWEGVNPAPPELWLLPYALPIHPGRWWVHTRAIYQA 238
           L +LGGA+GAPHWGK WLS LNLYKWEGVNPAPPE WLLPY+L IHPGRWWVHTR +Y  
Sbjct: 184 LIKLGGAIGAPHWGKTWLSTLNLYKWEGVNPAPPETWLLPYSLSIHPGRWWVHTRGVYLP 243

Query: 239 LGYLSAAKYSCPVTPLLEEIRNEIYTQPFESIDFSKQKNNVCGVDLYYPHTRLLNIANAS 298
           + YLS  +YSC +TPLL E+R EIYT+PF+SIDFS+ +N VCGVDLYYPH+++L++AN  
Sbjct: 244 ISYLSLVRYSCELTPLLAELREEIYTKPFDSIDFSRHRNTVCGVDLYYPHSKVLDVANDC 303

Query: 299 MIFYEKYLKPDWFLKYSNRKVYELIKKEIKNTDYLCIAPVSMAFCAIVTLIEEGRDSYEF 358
           ++FYEKYL+P W    S   VY+LIKKEI+NTDYLCIAPV+ AFCA+VTLIEEGRDS  F
Sbjct: 304 IVFYEKYLRPQWVHDKSKETVYDLIKKEIENTDYLCIAPVNQAFCALVTLIEEGRDSQAF 363

Query: 359 KRFLERFEDVLFLGPQGMTVMGTNGVQVWDCAFAIQYYFVAGLAELPEFHETIEKAYKFL 418
           KRF  RF+D LF GPQGMTVMGTNGVQVWDCAFAIQY+FVAGLAE PEF++TI +AY+FL
Sbjct: 364 KRFEFRFKDALFHGPQGMTVMGTNGVQVWDCAFAIQYFFVAGLAEKPEFYDTIVRAYEFL 423

Query: 419 CRSQFDTECEPGSFRDKRIGAWPFSTKTQGYTVSDCTAESVKAIIMVRNSPSFANLRDEI 478
           CRSQFDTEC PGSFRDKR+GAW FSTKTQGYTVSDCTAE++KAIIMVRNS  F  + D+I
Sbjct: 424 CRSQFDTECVPGSFRDKRVGAWGFSTKTQGYTVSDCTAEAIKAIIMVRNSDVFRAVHDKI 483

Query: 479 SDERLYKAMDVLLALQNTGSFEYGSFATYEKIKATTKLEKLNPAEVFGNIMVEFPYVECT 538
           SDERL K +DVL++LQN GSFEYGSFATYEKIKA   +E LNPAEVFGNIMVE+PYVECT
Sbjct: 484 SDERLNKGIDVLMSLQNLGSFEYGSFATYEKIKAPLFMEALNPAEVFGNIMVEYPYVECT 543

Query: 539 DSSVLGLTYFSKHYTYRXXXXXXXXXXXXXXXXNAQKPDGSWYGCWGICFTYAGMFALEA 598
           DSSVLGLT+F KH +YR                + Q+ DGSWYGCWGICFTYAGMFA+EA
Sbjct: 544 DSSVLGLTFFHKHSSYRKEEIANRIKLAIDYIKSCQQEDGSWYGCWGICFTYAGMFAMEA 603

Query: 599 LHTVDETYENSEVVQKGCDFLVSKQRPDGGWSESMKSSELHSYVESANSQAVQTAWALIG 658
           L+TV E Y NSE V+KGCDFLVSKQ  DGGW ESMKSSELHSYV+S  S  VQTAW L+ 
Sbjct: 604 LYTVGENYSNSETVRKGCDFLVSKQMEDGGWGESMKSSELHSYVDSEKSLVVQTAWVLVA 663

Query: 659 LLLAEYPNKEIIDKGINLLKKRQLESGEWKFEEVEGVFNHSCAIEYPSYKFLFPIKALGL 718
           LLLAEYP+K++ID+GI LLK RQL SGEWKFE VEGVFNHSCAIEYPSY+FLFPIKALGL
Sbjct: 664 LLLAEYPDKDVIDRGIQLLKDRQLPSGEWKFESVEGVFNHSCAIEYPSYRFLFPIKALGL 723

Query: 719 YAKKY 723
           Y K Y
Sbjct: 724 YTKAY 728

>YHR072W Chr8 (239098..241293) [2196 bp, 731 aa] {ON}
           ERG7Lanosterol synthase, an essential enzyme that
           catalyzes the cyclization of squalene 2,3-epoxide, a
           step in ergosterol biosynthesis
          Length = 731

 Score = 1084 bits (2803), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 511/724 (70%), Positives = 585/724 (80%), Gaps = 1/724 (0%)

Query: 2   LYSEELGLPKTDSKRWRLKTDALGSEKWEYLSEIEAKQQPQSAYVKYLLQLPDFEAPKPA 61
            YS+ +GLPKTD + WRL+TD LG E WEYL+  +A   P S + ++LLQ P F  P P 
Sbjct: 4   FYSDTIGLPKTDPRLWRLRTDELGRESWEYLTPQQAANDPPSTFTQWLLQDPKFPQPHPE 63

Query: 62  VNKNSAHFTAKDAAFNGAQFFSLLQE-DSGIFPCQYKGPMFMTIGYVAALYCAEVPIPTP 120
            NK+S  F+A DA  NGA FF LLQE DSGIFPCQYKGPMFMTIGYVA  Y A + IP  
Sbjct: 64  RNKHSPDFSAFDACHNGASFFKLLQEPDSGIFPCQYKGPMFMTIGYVAVNYIAGIEIPEH 123

Query: 121 VKQEIIRYIVNSSHPVDGGWGLHEVDKSTTFGTVINYVILRLLGLKPDNIVCQRARRTLH 180
            + E+IRYIVN++HPVDGGWGLH VDKST FGTV+NYVILRLLGL  D+ VC +AR TL 
Sbjct: 124 ERIELIRYIVNTAHPVDGGWGLHSVDKSTVFGTVLNYVILRLLGLPKDHPVCAKARSTLL 183

Query: 181 RLGGAVGAPHWGKAWLSILNLYKWEGVNPAPPELWLLPYALPIHPGRWWVHTRAIYQALG 240
           RLGGA+G+PHWGK WLS LNLYKWEGVNPAPPE WLLPY+LP+HPGRWWVHTR +Y  + 
Sbjct: 184 RLGGAIGSPHWGKIWLSALNLYKWEGVNPAPPETWLLPYSLPMHPGRWWVHTRGVYIPVS 243

Query: 241 YLSAAKYSCPVTPLLEEIRNEIYTQPFESIDFSKQKNNVCGVDLYYPHTRLLNIANASMI 300
           YLS  K+SCP+TPLLEE+RNEIYT+PF+ I+FSK +N VCGVDLYYPH+  LNIAN+ ++
Sbjct: 244 YLSLVKFSCPMTPLLEELRNEIYTKPFDKINFSKNRNTVCGVDLYYPHSTTLNIANSLVV 303

Query: 301 FYEKYLKPDWFLKYSNRKVYELIKKEIKNTDYLCIAPVSMAFCAIVTLIEEGRDSYEFKR 360
           FYEKYL+  +    S +KVY+LIK E++NTD LCIAPV+ AFCA+VTLIEEG DS  F+R
Sbjct: 304 FYEKYLRNRFIYSLSKKKVYDLIKTELQNTDSLCIAPVNQAFCALVTLIEEGVDSEAFQR 363

Query: 361 FLERFEDVLFLGPQGMTVMGTNGVQVWDCAFAIQYYFVAGLAELPEFHETIEKAYKFLCR 420
              RF+D LF GPQGMT+MGTNGVQ WDCAFAIQY+FVAGLAE PEF+ TI  AYKFLC 
Sbjct: 364 LQYRFKDALFHGPQGMTIMGTNGVQTWDCAFAIQYFFVAGLAERPEFYNTIVSAYKFLCH 423

Query: 421 SQFDTECEPGSFRDKRIGAWPFSTKTQGYTVSDCTAESVKAIIMVRNSPSFANLRDEISD 480
           +QFDTEC PGS+RDKR GAW FSTKTQGYTV+DCTAE++KAIIMV+NSP F+ +   IS 
Sbjct: 424 AQFDTECVPGSYRDKRKGAWGFSTKTQGYTVADCTAEAIKAIIMVKNSPVFSEVHHMISS 483

Query: 481 ERLYKAMDVLLALQNTGSFEYGSFATYEKIKATTKLEKLNPAEVFGNIMVEFPYVECTDS 540
           ERL++ +DVLL LQN GSFEYGSFATYEKIKA   +E LNPAEVFGNIMVE+PYVECTDS
Sbjct: 484 ERLFEGIDVLLNLQNIGSFEYGSFATYEKIKAPLAMETLNPAEVFGNIMVEYPYVECTDS 543

Query: 541 SVLGLTYFSKHYTYRXXXXXXXXXXXXXXXXNAQKPDGSWYGCWGICFTYAGMFALEALH 600
           SVLGLTYF K++ YR                 +Q PDGSWYG WGICFTYAGMFALEALH
Sbjct: 544 SVLGLTYFHKYFDYRKEEIRTRIRIAIEFIKKSQLPDGSWYGSWGICFTYAGMFALEALH 603

Query: 601 TVDETYENSEVVQKGCDFLVSKQRPDGGWSESMKSSELHSYVESANSQAVQTAWALIGLL 660
           TV ETYENS  V+KGCDFLVSKQ  DGGW ESMKSSELHSYV+S  S  VQTAWALI LL
Sbjct: 604 TVGETYENSSTVRKGCDFLVSKQMKDGGWGESMKSSELHSYVDSEKSLVVQTAWALIALL 663

Query: 661 LAEYPNKEIIDKGINLLKKRQLESGEWKFEEVEGVFNHSCAIEYPSYKFLFPIKALGLYA 720
            AEYPNKE+ID+GI+LLK RQ ESGEWKFE VEGVFNHSCAIEYPSY+FLFPIKALG+Y+
Sbjct: 664 FAEYPNKEVIDRGIDLLKNRQEESGEWKFESVEGVFNHSCAIEYPSYRFLFPIKALGMYS 723

Query: 721 KKYE 724
           + YE
Sbjct: 724 RAYE 727

>KAFR0D04670 Chr4 (915691..917886) [2196 bp, 731 aa] {ON} Anc_5.351
           YHR072W
          Length = 731

 Score = 1082 bits (2797), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 502/723 (69%), Positives = 584/723 (80%), Gaps = 1/723 (0%)

Query: 2   LYSEELGLPKTDSKRWRLKTDALGSEKWEYLSEIEAKQQPQSAYVKYLLQLPDFEAPKPA 61
            YS+E+GL KTD + WRL+TD LG + W+Y+ +++A+  PQ+ +V++LLQLP F +P P 
Sbjct: 4   FYSDEVGLEKTDPRLWRLRTDDLGRQTWDYIDQLDAESDPQTTFVQWLLQLPGFPSPNPD 63

Query: 62  VNKNSAHFTAKDAAFNGAQFFSLLQE-DSGIFPCQYKGPMFMTIGYVAALYCAEVPIPTP 120
           +      FTAKDA +NGA FF LLQ+ +SGIFPCQYKGPMFMTIGYVA  Y A + IP  
Sbjct: 64  IKNGDDSFTAKDACYNGATFFKLLQDGNSGIFPCQYKGPMFMTIGYVAVNYIAGIEIPEH 123

Query: 121 VKQEIIRYIVNSSHPVDGGWGLHEVDKSTTFGTVINYVILRLLGLKPDNIVCQRARRTLH 180
            K E+IRYIVN++HPVDGGWGLH VDKST FGT INYVILRLLGL   + VC RAR TL 
Sbjct: 124 EKIELIRYIVNTAHPVDGGWGLHSVDKSTAFGTAINYVILRLLGLSKHHTVCVRARDTLL 183

Query: 181 RLGGAVGAPHWGKAWLSILNLYKWEGVNPAPPELWLLPYALPIHPGRWWVHTRAIYQALG 240
           RLGGA+G PHWGK WLS+LNLY WEGVNPAPPE WLLPY LPIHPGRWWVHTR +Y  + 
Sbjct: 184 RLGGAIGVPHWGKIWLSVLNLYSWEGVNPAPPETWLLPYYLPIHPGRWWVHTRGVYLPIS 243

Query: 241 YLSAAKYSCPVTPLLEEIRNEIYTQPFESIDFSKQKNNVCGVDLYYPHTRLLNIANASMI 300
           YLS  +YS   TPLLEEIR EIY +PF+ I+FS+ +N VCGVDLYYPH+ LL+ AN +++
Sbjct: 244 YLSLVRYSTECTPLLEEIRKEIYVKPFDDINFSQHRNTVCGVDLYYPHSTLLDTANKAIV 303

Query: 301 FYEKYLKPDWFLKYSNRKVYELIKKEIKNTDYLCIAPVSMAFCAIVTLIEEGRDSYEFKR 360
            YEK+L+P W  + S + +YELI+KE +NTDYLCIAPV+ AFCA+ TLIEEG +S  F++
Sbjct: 304 LYEKFLRPTWLAEKSRKAIYELIEKEAQNTDYLCIAPVNQAFCALATLIEEGVESKPFRK 363

Query: 361 FLERFEDVLFLGPQGMTVMGTNGVQVWDCAFAIQYYFVAGLAELPEFHETIEKAYKFLCR 420
           + ERF+D LF GPQGMTV GTNGVQ WDCAFAIQY F+AGLAE PEF++ +  A+KFLCR
Sbjct: 364 YQERFKDALFHGPQGMTVTGTNGVQTWDCAFAIQYLFIAGLAEQPEFYDAVSAAFKFLCR 423

Query: 421 SQFDTECEPGSFRDKRIGAWPFSTKTQGYTVSDCTAESVKAIIMVRNSPSFANLRDEISD 480
           SQFDTEC PGSFRDKR+GAW FSTKTQGYTVSDCTAES+KAIIMVRNSP FA + DEI+D
Sbjct: 424 SQFDTECVPGSFRDKRVGAWGFSTKTQGYTVSDCTAESIKAIIMVRNSPVFAKIHDEITD 483

Query: 481 ERLYKAMDVLLALQNTGSFEYGSFATYEKIKATTKLEKLNPAEVFGNIMVEFPYVECTDS 540
           ERL K +D+LL LQN GSFE+GSFATYEKIKA   LEKLNPAEVFGNIMVE+PYVECTDS
Sbjct: 484 ERLCKGIDILLDLQNMGSFEFGSFATYEKIKAPLILEKLNPAEVFGNIMVEYPYVECTDS 543

Query: 541 SVLGLTYFSKHYTYRXXXXXXXXXXXXXXXXNAQKPDGSWYGCWGICFTYAGMFALEALH 600
           SVLGLTYF +HY YR                NAQ+ DGSWYG WGICFTYAGMFA+EAL 
Sbjct: 544 SVLGLTYFHRHYKYRHEEISDRIQLAIRYIKNAQQDDGSWYGSWGICFTYAGMFAMEALQ 603

Query: 601 TVDETYENSEVVQKGCDFLVSKQRPDGGWSESMKSSELHSYVESANSQAVQTAWALIGLL 660
           +V E YENS+ V KGCDFLVSKQ PDGGWSESMKSSELH+YV +  S  VQTAW LI LL
Sbjct: 604 SVGELYENSDAVHKGCDFLVSKQMPDGGWSESMKSSELHTYVSTKESLVVQTAWVLIALL 663

Query: 661 LAEYPNKEIIDKGINLLKKRQLESGEWKFEEVEGVFNHSCAIEYPSYKFLFPIKALGLYA 720
           LA+YP+K++ID+GI+LLK RQ  SGEWKFE VEGVFNHSCAIEYPSY+FLFPIKALGLY 
Sbjct: 664 LAKYPDKQVIDRGISLLKSRQEPSGEWKFESVEGVFNHSCAIEYPSYRFLFPIKALGLYV 723

Query: 721 KKY 723
           K+Y
Sbjct: 724 KEY 726

>KNAG0B04580 Chr2 complement(884911..887100) [2190 bp, 729 aa] {ON}
           Anc_5.351 YHR072W
          Length = 729

 Score = 1080 bits (2793), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 511/726 (70%), Positives = 593/726 (81%), Gaps = 10/726 (1%)

Query: 1   MLYSEELGLPKTDSKRWRLKTDALGSEKWEYLSEIEAKQQPQSAYVKYLLQLPDFE--AP 58
           +LYSE+LGLP+TD KRWRL+TD LG E W+Y+ E + +  PQS++ ++LLQ+ D E  AP
Sbjct: 5   VLYSEQLGLPRTDPKRWRLRTDELGRETWDYIPEDQCEMDPQSSFTQWLLQIRDTETSAP 64

Query: 59  KPAVNKNSAHFTAKDAAFNGAQFFSLLQE-DSGIFPCQYKGPMFMTIGYVAALYCAEVPI 117
           K  V       TA D+  NGA FF  LQ+  SG+FPCQYKGPMFMTIGY+A  Y A + I
Sbjct: 65  KEPV-------TAFDSCINGANFFKSLQDPHSGMFPCQYKGPMFMTIGYIAVNYIAGIEI 117

Query: 118 PTPVKQEIIRYIVNSSHPVDGGWGLHEVDKSTTFGTVINYVILRLLGLKPDNIVCQRARR 177
           P   + EIIRYIVN+SHPVDGGWGLH VDKST FGTV+NYVILRLLGL+ D+ VC +AR 
Sbjct: 118 PKHERLEIIRYIVNTSHPVDGGWGLHSVDKSTVFGTVLNYVILRLLGLQRDHPVCLKARD 177

Query: 178 TLHRLGGAVGAPHWGKAWLSILNLYKWEGVNPAPPELWLLPYALPIHPGRWWVHTRAIYQ 237
           TL RLGGA+GAPHWGK WLS+LNLYKWEGVNPAPPE WLLPY LPIHPG+WWVHTR +Y 
Sbjct: 178 TLLRLGGAIGAPHWGKIWLSVLNLYKWEGVNPAPPETWLLPYELPIHPGKWWVHTRGVYL 237

Query: 238 ALGYLSAAKYSCPVTPLLEEIRNEIYTQPFESIDFSKQKNNVCGVDLYYPHTRLLNIANA 297
            + YLS   YSC +TPLLEEIR EIYT+PF+SIDFSK +N VCGVDLYYPH+++L++AN 
Sbjct: 238 PISYLSLVHYSCELTPLLEEIRGEIYTKPFDSIDFSKHRNTVCGVDLYYPHSKVLDMANN 297

Query: 298 SMIFYEKYLKPDWFLKYSNRKVYELIKKEIKNTDYLCIAPVSMAFCAIVTLIEEGRDSYE 357
           ++IFYEKYL+P W  K S  KVY LI+KEI+NTDYLCIAPV+ AFCA+VTLIEEG DS  
Sbjct: 298 AIIFYEKYLRPAWIYKKSKAKVYSLIQKEIQNTDYLCIAPVNQAFCALVTLIEEGVDSEA 357

Query: 358 FKRFLERFEDVLFLGPQGMTVMGTNGVQVWDCAFAIQYYFVAGLAELPEFHETIEKAYKF 417
           F +F  RF+D LF GPQGMTVMGTNGVQ WDCAFA+QY+FVAGLAE PEF+  I  AY+F
Sbjct: 358 FTKFRTRFKDALFHGPQGMTVMGTNGVQTWDCAFAVQYFFVAGLAERPEFYNFIVAAYRF 417

Query: 418 LCRSQFDTECEPGSFRDKRIGAWPFSTKTQGYTVSDCTAESVKAIIMVRNSPSFANLRDE 477
           L RSQFDTEC PGSFRDKR G+W FSTKTQGYTVSDCTAE++KAIIMV+N+P F+++ DE
Sbjct: 418 LIRSQFDTECVPGSFRDKRKGSWGFSTKTQGYTVSDCTAEAIKAIIMVKNAPQFSDVHDE 477

Query: 478 ISDERLYKAMDVLLALQNTGSFEYGSFATYEKIKATTKLEKLNPAEVFGNIMVEFPYVEC 537
           I D RLY+ +DVLL+LQNTGSFEYGSFATYEKIKA   +EKLNPAEVFGNIM+E+PYVEC
Sbjct: 478 IEDSRLYEGIDVLLSLQNTGSFEYGSFATYEKIKAPLIMEKLNPAEVFGNIMIEYPYVEC 537

Query: 538 TDSSVLGLTYFSKHYTYRXXXXXXXXXXXXXXXXNAQKPDGSWYGCWGICFTYAGMFALE 597
           TDSSVLGLT+F K+Y YR                 AQ+PDGSWYGCWGIC+TYAGMFALE
Sbjct: 538 TDSSVLGLTFFHKYYKYRTEEISERIRIAIEYLKRAQEPDGSWYGCWGICYTYAGMFALE 597

Query: 598 ALHTVDETYENSEVVQKGCDFLVSKQRPDGGWSESMKSSELHSYVESANSQAVQTAWALI 657
           ALH+V+E Y NS +V+KGCDFLVSKQ  DGGW ESMKSSELHSYV +  S  VQTAWA+I
Sbjct: 598 ALHSVEENYANSAIVRKGCDFLVSKQLIDGGWGESMKSSELHSYVSTPESLVVQTAWAVI 657

Query: 658 GLLLAEYPNKEIIDKGINLLKKRQLESGEWKFEEVEGVFNHSCAIEYPSYKFLFPIKALG 717
            LLLAEYP+K++I++GI LL+ RQL SGEWKFE VEGVFNHSCAIEYPSY+FLFPIKALG
Sbjct: 658 ALLLAEYPDKKVIERGIELLRSRQLPSGEWKFESVEGVFNHSCAIEYPSYRFLFPIKALG 717

Query: 718 LYAKKY 723
           LY K Y
Sbjct: 718 LYNKTY 723

>Skud_8.131 Chr8 (212610..214805) [2196 bp, 731 aa] {ON} YHR072W
           (REAL)
          Length = 731

 Score = 1079 bits (2790), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 510/725 (70%), Positives = 583/725 (80%), Gaps = 1/725 (0%)

Query: 2   LYSEELGLPKTDSKRWRLKTDALGSEKWEYLSEIEAKQQPQSAYVKYLLQLPDFEAPKPA 61
            YSE +GLPKTD + WRL+TD LG E WEYL+  +A  +P S + ++LLQ P+F  P+P 
Sbjct: 4   FYSERIGLPKTDPRLWRLRTDELGRESWEYLTPEQAANEPPSTFTQWLLQDPNFSQPQPG 63

Query: 62  VNKNSAHFTAKDAAFNGAQFFSLLQE-DSGIFPCQYKGPMFMTIGYVAALYCAEVPIPTP 120
            NK+S  F+A DA  NGA FF LLQ+  SGIFPCQYKGPMF+TIGYVA  Y A V IP  
Sbjct: 64  RNKHSPDFSAFDACHNGASFFQLLQDPKSGIFPCQYKGPMFLTIGYVAVNYIAGVQIPEH 123

Query: 121 VKQEIIRYIVNSSHPVDGGWGLHEVDKSTTFGTVINYVILRLLGLKPDNIVCQRARRTLH 180
            + EIIRYIVN++HPVDGGWGLH VDKST FGTV+NYVILRLLGL  D+ VC +AR TL 
Sbjct: 124 ERIEIIRYIVNTAHPVDGGWGLHSVDKSTVFGTVLNYVILRLLGLPKDHPVCTKARGTLL 183

Query: 181 RLGGAVGAPHWGKAWLSILNLYKWEGVNPAPPELWLLPYALPIHPGRWWVHTRAIYQALG 240
           RLGGA+G+PHWGK WLS LNLYKWEGVNPAPPE WLLPY+LP+HPGRWWVHTR +Y  + 
Sbjct: 184 RLGGAIGSPHWGKIWLSALNLYKWEGVNPAPPETWLLPYSLPMHPGRWWVHTRGVYIPVS 243

Query: 241 YLSAAKYSCPVTPLLEEIRNEIYTQPFESIDFSKQKNNVCGVDLYYPHTRLLNIANASMI 300
           YLS  K+SCP+TPLLEEIR EIYT+PF+ IDFS  +N VCGVDLYYPH+R L+IAN  ++
Sbjct: 244 YLSLVKFSCPMTPLLEEIRKEIYTKPFDKIDFSNHRNTVCGVDLYYPHSRTLDIANNFVV 303

Query: 301 FYEKYLKPDWFLKYSNRKVYELIKKEIKNTDYLCIAPVSMAFCAIVTLIEEGRDSYEFKR 360
           FYEKYL+  +    S RKVY+LIK EI+NTD LCIAPV+ AFCA+VT IEEG DS  FK+
Sbjct: 304 FYEKYLRNRFIYSLSKRKVYDLIKTEIENTDSLCIAPVNQAFCALVTFIEEGVDSQAFKK 363

Query: 361 FLERFEDVLFLGPQGMTVMGTNGVQVWDCAFAIQYYFVAGLAELPEFHETIEKAYKFLCR 420
           F  RF+D LF GPQGMT+MGTNGVQ WDCAFAIQY+F+AGLAE PEF+ TI  AYKFLCR
Sbjct: 364 FQYRFKDALFHGPQGMTIMGTNGVQTWDCAFAIQYFFIAGLAERPEFYNTIVSAYKFLCR 423

Query: 421 SQFDTECEPGSFRDKRIGAWPFSTKTQGYTVSDCTAESVKAIIMVRNSPSFANLRDEISD 480
           +QFDTEC PGSFR+KR G+W FSTKTQGYTV+DCTAES+KAIIMV+NSP F+ +   I+ 
Sbjct: 424 AQFDTECVPGSFREKRKGSWGFSTKTQGYTVADCTAESIKAIIMVKNSPVFSEVHHLITS 483

Query: 481 ERLYKAMDVLLALQNTGSFEYGSFATYEKIKATTKLEKLNPAEVFGNIMVEFPYVECTDS 540
           ERL++ +DVLL+LQN GSFEYGSFATYEKIKA   +E LNPAEVFGNIMVE+PYVECTDS
Sbjct: 484 ERLFEGIDVLLSLQNVGSFEYGSFATYEKIKAPLAMEILNPAEVFGNIMVEYPYVECTDS 543

Query: 541 SVLGLTYFSKHYTYRXXXXXXXXXXXXXXXXNAQKPDGSWYGCWGICFTYAGMFALEALH 600
           SVLGLTYF K + Y+                 AQ PDGSWYG WGICFTYAGMFA+EALH
Sbjct: 544 SVLGLTYFHKFFDYKKEEIRRRIRIAIEYIKRAQSPDGSWYGSWGICFTYAGMFAMEALH 603

Query: 601 TVDETYENSEVVQKGCDFLVSKQRPDGGWSESMKSSELHSYVESANSQAVQTAWALIGLL 660
           TV E YENS  V+KGCDFLVSKQ  DGGW ESMKSSELHSYV+S  S  VQ+AWALI L 
Sbjct: 604 TVGENYENSSTVRKGCDFLVSKQMKDGGWGESMKSSELHSYVDSGKSLVVQSAWALIALF 663

Query: 661 LAEYPNKEIIDKGINLLKKRQLESGEWKFEEVEGVFNHSCAIEYPSYKFLFPIKALGLYA 720
            AEYPNKE+ID+GI LLK RQ ESGEWKFE VEGVFNHSCAIEYPSY+FLFPIKALG+YA
Sbjct: 664 FAEYPNKEVIDRGIELLKNRQEESGEWKFESVEGVFNHSCAIEYPSYRFLFPIKALGMYA 723

Query: 721 KKYEH 725
           K YE 
Sbjct: 724 KAYEQ 728

>Smik_8.148 Chr8 (215426..217621) [2196 bp, 731 aa] {ON} YHR072W
           (REAL)
          Length = 731

 Score = 1075 bits (2779), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 506/725 (69%), Positives = 585/725 (80%), Gaps = 1/725 (0%)

Query: 2   LYSEELGLPKTDSKRWRLKTDALGSEKWEYLSEIEAKQQPQSAYVKYLLQLPDFEAPKPA 61
            YSE +GLPKTD + WRL+TD +G E WEYL+  +A  +P S + ++LLQ P+F  P+P 
Sbjct: 4   FYSETIGLPKTDPRLWRLRTDEIGRESWEYLTSEQAANEPPSTFTQWLLQDPEFPHPQPE 63

Query: 62  VNKNSAHFTAKDAAFNGAQFFSLLQE-DSGIFPCQYKGPMFMTIGYVAALYCAEVPIPTP 120
            NK+S +F+A DA  NGA FF LLQE DSGIFPCQYKGPMFMTIGYVA  Y A + IP  
Sbjct: 64  RNKHSPNFSAFDACHNGASFFKLLQEPDSGIFPCQYKGPMFMTIGYVAVNYIAGIQIPEH 123

Query: 121 VKQEIIRYIVNSSHPVDGGWGLHEVDKSTTFGTVINYVILRLLGLKPDNIVCQRARRTLH 180
            + EIIRYIVN++HPVDGGWGLH VDKST FGT +NYVILRLLGL  D+ VC ++R TL 
Sbjct: 124 ERIEIIRYIVNTAHPVDGGWGLHSVDKSTVFGTALNYVILRLLGLPKDHPVCVKSRNTLL 183

Query: 181 RLGGAVGAPHWGKAWLSILNLYKWEGVNPAPPELWLLPYALPIHPGRWWVHTRAIYQALG 240
           RLGGA+G+PHWGK WLS LNLY+WEGVNPAPPE WLLPY+LP+HPGRWWVHTRA+Y  + 
Sbjct: 184 RLGGALGSPHWGKIWLSALNLYRWEGVNPAPPETWLLPYSLPMHPGRWWVHTRAVYIPVS 243

Query: 241 YLSAAKYSCPVTPLLEEIRNEIYTQPFESIDFSKQKNNVCGVDLYYPHTRLLNIANASMI 300
           YLS  K++CP+TPLLEE+R EIYT+PF+ I FSK +N VCGVDLYYPH++ LNIAN  ++
Sbjct: 244 YLSLVKFTCPMTPLLEELREEIYTKPFDKIKFSKHRNTVCGVDLYYPHSKTLNIANNFVV 303

Query: 301 FYEKYLKPDWFLKYSNRKVYELIKKEIKNTDYLCIAPVSMAFCAIVTLIEEGRDSYEFKR 360
           FYEKYL+  +    S RKVY+L++KEI+NTD LCIAPV+ AFCA+VTLIEEG DS  FK+
Sbjct: 304 FYEKYLRNRFIYSLSKRKVYDLVRKEIQNTDSLCIAPVNQAFCALVTLIEEGVDSQAFKK 363

Query: 361 FLERFEDVLFLGPQGMTVMGTNGVQVWDCAFAIQYYFVAGLAELPEFHETIEKAYKFLCR 420
           F  RF+D LF GPQGMT+MGTNGVQ WDCAFAIQY F+AGLAE  EF+ TI  AYKFLCR
Sbjct: 364 FQYRFKDALFHGPQGMTIMGTNGVQSWDCAFAIQYLFIAGLAERSEFYNTIVSAYKFLCR 423

Query: 421 SQFDTECEPGSFRDKRIGAWPFSTKTQGYTVSDCTAESVKAIIMVRNSPSFANLRDEISD 480
           +QFDTEC PGSFRDKR GAW FSTKTQGY VSDCTAE++KAIIMV+NSP F  + + IS+
Sbjct: 424 AQFDTECVPGSFRDKRKGAWGFSTKTQGYVVSDCTAEAIKAIIMVKNSPVFTEVHNMISN 483

Query: 481 ERLYKAMDVLLALQNTGSFEYGSFATYEKIKATTKLEKLNPAEVFGNIMVEFPYVECTDS 540
           ERL++ +DVLL LQN GSFEYGSFATYEKIKA   +E LNPAEVFGNIMVE+PYVECTDS
Sbjct: 484 ERLFEGIDVLLNLQNIGSFEYGSFATYEKIKAPLAMETLNPAEVFGNIMVEYPYVECTDS 543

Query: 541 SVLGLTYFSKHYTYRXXXXXXXXXXXXXXXXNAQKPDGSWYGCWGICFTYAGMFALEALH 600
           SVLGLTYF K++ Y+                 +Q P+GSWYG WGICFTYAGMFALEALH
Sbjct: 544 SVLGLTYFHKYFDYKKEEIRARIRIAIEFIKKSQLPNGSWYGSWGICFTYAGMFALEALH 603

Query: 601 TVDETYENSEVVQKGCDFLVSKQRPDGGWSESMKSSELHSYVESANSQAVQTAWALIGLL 660
           TV ETYENS  V+KGCDFLVSKQ  DGGW ESMKSSELHSYV+S  S  VQTAW LI LL
Sbjct: 604 TVGETYENSSTVRKGCDFLVSKQMKDGGWGESMKSSELHSYVDSEKSLVVQTAWVLIALL 663

Query: 661 LAEYPNKEIIDKGINLLKKRQLESGEWKFEEVEGVFNHSCAIEYPSYKFLFPIKALGLYA 720
            AEYP K++ID+GI LLK RQ ESGEWKFE VEGVFNHSCAIEYPSY+FLFPIKALG+Y+
Sbjct: 664 FAEYPGKDVIDRGIELLKNRQEESGEWKFEGVEGVFNHSCAIEYPSYRFLFPIKALGMYS 723

Query: 721 KKYEH 725
           K YE 
Sbjct: 724 KAYEQ 728

>KLLA0B10175g Chr2 (889538..891733) [2196 bp, 731 aa] {ON} highly
           similar to uniprot|P38604 Saccharomyces cerevisiae
           YHR072W ERG7 Lanosterol synthase an essential enzyme
           that catalyzes the cyclization of squalene 2 3- epoxide
           a step in ergosterol biosynthesis
          Length = 731

 Score = 1070 bits (2767), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 501/725 (69%), Positives = 586/725 (80%), Gaps = 1/725 (0%)

Query: 2   LYSEELGLPKTDSKRWRLKTDALGSEKWEYLSEIEAKQQPQSAYVKYLLQLPDFEAPKPA 61
           LYSE +GLP+TD KRWRL TD LG + WEYLSE ++K+ PQS + ++LL+  DF  P P 
Sbjct: 4   LYSETIGLPRTDPKRWRLITDDLGRQTWEYLSENDSKKVPQSTFARWLLKCEDFPEPHPE 63

Query: 62  VNKNSAHFTAKDAAFNGAQFFSLLQE-DSGIFPCQYKGPMFMTIGYVAALYCAEVPIPTP 120
           +N  ++ FTA +AA NGA+FF LLQ+ DSG FPCQYKGPMFMTIGYV  +Y A++ IP  
Sbjct: 64  INSKTSGFTAWNAAHNGAKFFELLQDPDSGTFPCQYKGPMFMTIGYVVTMYIAKIEIPEH 123

Query: 121 VKQEIIRYIVNSSHPVDGGWGLHEVDKSTTFGTVINYVILRLLGLKPDNIVCQRARRTLH 180
            K E+IRY+ N +HPVDGGWGLH VDKST  GTV+NYV++RLLGL  D+ VC RAR TL 
Sbjct: 124 EKAEMIRYVANYAHPVDGGWGLHHVDKSTVLGTVLNYVMMRLLGLPKDHEVCVRARDTLL 183

Query: 181 RLGGAVGAPHWGKAWLSILNLYKWEGVNPAPPELWLLPYALPIHPGRWWVHTRAIYQALG 240
           RLGGA+ +PHW K WLSILNLYKWEGVNPAPPELW+LPY L IHP RWWVHTR IY  + 
Sbjct: 184 RLGGAIASPHWAKIWLSILNLYKWEGVNPAPPELWMLPYGLNIHPARWWVHTRGIYLPVS 243

Query: 241 YLSAAKYSCPVTPLLEEIRNEIYTQPFESIDFSKQKNNVCGVDLYYPHTRLLNIANASMI 300
           YLS+ +YSC + PLLEEIR EIYTQPFE+IDF K +N VCGVDLYYPHT++L+  N  + 
Sbjct: 244 YLSSTQYSCELDPLLEEIRTEIYTQPFETIDFKKHRNTVCGVDLYYPHTKVLDTMNYFIS 303

Query: 301 FYEKYLKPDWFLKYSNRKVYELIKKEIKNTDYLCIAPVSMAFCAIVTLIEEGRDSYEFKR 360
            YE+Y++P+W LK S  +VYEL+KKEI NTDYLCIAPV+ AFCAIVTLIEEG+DS EF R
Sbjct: 304 KYERYVRPNWLLKKSTNRVYELVKKEIANTDYLCIAPVNNAFCAIVTLIEEGKDSEEFGR 363

Query: 361 FLERFEDVLFLGPQGMTVMGTNGVQVWDCAFAIQYYFVAGLAELPEFHETIEKAYKFLCR 420
           FL RF+DVLF GPQG+TVMGTNGVQVWDCAF IQY F+AGLAELPEFHETI +++KFLCR
Sbjct: 364 FLYRFKDVLFHGPQGLTVMGTNGVQVWDCAFYIQYMFMAGLAELPEFHETIVRSFKFLCR 423

Query: 421 SQFDTECEPGSFRDKRIGAWPFSTKTQGYTVSDCTAESVKAIIMVRNSPSFANLRDEISD 480
           SQF  +C  GSFRDKR+GAWPFSTKTQGYTVSDCTAE++KAIIMV NS  + ++      
Sbjct: 424 SQFTEDCVEGSFRDKRLGAWPFSTKTQGYTVSDCTAEAIKAIIMVLNSDKYRDVWGVYDT 483

Query: 481 ERLYKAMDVLLALQNTGSFEYGSFATYEKIKATTKLEKLNPAEVFGNIMVEFPYVECTDS 540
           E+L   +DVLL LQN  SFEYGSFATYEKIKA   +EKLNPAEVFGNIMVEFPYVECTDS
Sbjct: 484 EKLKNGIDVLLGLQNLSSFEYGSFATYEKIKAPLLMEKLNPAEVFGNIMVEFPYVECTDS 543

Query: 541 SVLGLTYFSKHYTYRXXXXXXXXXXXXXXXXNAQKPDGSWYGCWGICFTYAGMFALEALH 600
           SVLGLTYF +++ YR                 +Q+P+GSWYGCWGIC+TYAGMFALEAL+
Sbjct: 544 SVLGLTYFRRYFNYRKKDIDHAIDSAIAYIKKSQQPNGSWYGCWGICYTYAGMFALEALN 603

Query: 601 TVDETYENSEVVQKGCDFLVSKQRPDGGWSESMKSSELHSYVESANSQAVQTAWALIGLL 660
           T+ ETYENSEVV+KGCDF V+KQ PDGGWSE MKSSELH+YV    S  VQTAW LIGL+
Sbjct: 604 TIGETYENSEVVRKGCDFFVTKQLPDGGWSEKMKSSELHTYVSDKESYVVQTAWVLIGLI 663

Query: 661 LAEYPNKEIIDKGINLLKKRQLESGEWKFEEVEGVFNHSCAIEYPSYKFLFPIKALGLYA 720
           LA++P+K +ID+ INLLK+RQ  SGEWK+E VEGVFNHSCAIEYPSY+FLFPIKALGLY 
Sbjct: 664 LAKFPDKSVIDRAINLLKQRQQPSGEWKYEAVEGVFNHSCAIEYPSYRFLFPIKALGLYV 723

Query: 721 KKYEH 725
           K+Y H
Sbjct: 724 KEYGH 728

>TDEL0E02760 Chr5 complement(531650..533845) [2196 bp, 731 aa] {ON}
           Anc_5.351 YHR072W
          Length = 731

 Score = 1063 bits (2749), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 499/723 (69%), Positives = 575/723 (79%), Gaps = 1/723 (0%)

Query: 2   LYSEELGLPKTDSKRWRLKTDALGSEKWEYLSEIEAKQQPQSAYVKYLLQLPDFEAPKPA 61
            YSEELGL +TD   WRL+TD LG E W YL+  +AK   Q  + ++LLQ   F  P P 
Sbjct: 4   FYSEELGLERTDPDLWRLRTDELGRETWVYLTPEQAKNDEQCTFTQWLLQSEKFPKPSPN 63

Query: 62  VNKNSAHFTAKDAAFNGAQFFSLLQE-DSGIFPCQYKGPMFMTIGYVAALYCAEVPIPTP 120
            +  +  F A DA  NGA FF LLQ+  SGIFPCQYKGPMF+TIGYVA  Y +   IP  
Sbjct: 64  RHSGTTDFKAADACENGASFFKLLQDPRSGIFPCQYKGPMFLTIGYVAVHYISGTTIPEH 123

Query: 121 VKQEIIRYIVNSSHPVDGGWGLHEVDKSTTFGTVINYVILRLLGLKPDNIVCQRARRTLH 180
            + EIIRYIVN++HPVDGGWGLH VDKST FGTV+NYVILRLLGL  D+ VC +AR  L 
Sbjct: 124 ERIEIIRYIVNTAHPVDGGWGLHSVDKSTAFGTVVNYVILRLLGLPKDHPVCLKARALLM 183

Query: 181 RLGGAVGAPHWGKAWLSILNLYKWEGVNPAPPELWLLPYALPIHPGRWWVHTRAIYQALG 240
           +LGGA+GAPHWGK WLS+LNLYKWEGVNPAPPE+WLLPYALPIHPGRWWVHTRAIY  + 
Sbjct: 184 KLGGAIGAPHWGKIWLSVLNLYKWEGVNPAPPEMWLLPYALPIHPGRWWVHTRAIYLPVS 243

Query: 241 YLSAAKYSCPVTPLLEEIRNEIYTQPFESIDFSKQKNNVCGVDLYYPHTRLLNIANASMI 300
           YLS  +YSCP+  LL E+R+EIY +PF+SI+FS  +N VCG+DLYYPHT +LN+AN  M+
Sbjct: 244 YLSLIRYSCPLNDLLRELRSEIYVKPFDSINFSSNRNTVCGIDLYYPHTTVLNMANNVMV 303

Query: 301 FYEKYLKPDWFLKYSNRKVYELIKKEIKNTDYLCIAPVSMAFCAIVTLIEEGRDSYEFKR 360
           FYEK+L+P+W  K +  +VY LIKKEI NTDYLCIAPV+ AFCA+VT IEEG++S  FK+
Sbjct: 304 FYEKHLRPNWLGKKAKDRVYGLIKKEIANTDYLCIAPVNQAFCALVTYIEEGKESSAFKK 363

Query: 361 FLERFEDVLFLGPQGMTVMGTNGVQVWDCAFAIQYYFVAGLAELPEFHETIEKAYKFLCR 420
           F +R +D LF GPQGMT+MGTNGVQ WDCAFAIQY+FVAGLAE PE+++TI  AYKFLCR
Sbjct: 364 FEDRLKDALFHGPQGMTIMGTNGVQTWDCAFAIQYFFVAGLAEKPEYYDTICAAYKFLCR 423

Query: 421 SQFDTECEPGSFRDKRIGAWPFSTKTQGYTVSDCTAESVKAIIMVRNSPSFANLRDEISD 480
           +QFDTEC  GSFRDKR+GAWPFSTK QGYTVSDCTAE++KAIIMVRNSP FA++R+EI+D
Sbjct: 424 TQFDTECVEGSFRDKRVGAWPFSTKAQGYTVSDCTAEAIKAIIMVRNSPKFASIRNEITD 483

Query: 481 ERLYKAMDVLLALQNTGSFEYGSFATYEKIKATTKLEKLNPAEVFGNIMVEFPYVECTDS 540
           ERL K +DVLL+LQN  SFEYGSFATYEKIKA   +EKLNPAEVFGNIMVEFPYVECTDS
Sbjct: 484 ERLCKGIDVLLSLQNITSFEYGSFATYEKIKAPLSMEKLNPAEVFGNIMVEFPYVECTDS 543

Query: 541 SVLGLTYFSKHYTYRXXXXXXXXXXXXXXXXNAQKPDGSWYGCWGICFTYAGMFALEALH 600
           SVLGLTYF   Y YR                  Q  DGSWYGCWG+C++YAGMFA+EALH
Sbjct: 544 SVLGLTYFHTFYDYRKEEISKRIKLAIDYIKRDQDEDGSWYGCWGVCYSYAGMFAMEALH 603

Query: 601 TVDETYENSEVVQKGCDFLVSKQRPDGGWSESMKSSELHSYVESANSQAVQTAWALIGLL 660
           +V E Y NSE V+KGCDFLVS+Q  DGGW ESMKSSELHSYV +  S  VQTAW LI LL
Sbjct: 604 SVGENYSNSEYVRKGCDFLVSRQISDGGWGESMKSSELHSYVSTRESLVVQTAWVLIALL 663

Query: 661 LAEYPNKEIIDKGINLLKKRQLESGEWKFEEVEGVFNHSCAIEYPSYKFLFPIKALGLYA 720
           L +YPNK +ID GI LLKKRQLE+GEWKFE +EGVFNHSCAIEYPSY+FLFPIKALGLY 
Sbjct: 664 LGKYPNKSVIDAGIKLLKKRQLETGEWKFEGIEGVFNHSCAIEYPSYRFLFPIKALGLYT 723

Query: 721 KKY 723
             Y
Sbjct: 724 ATY 726

>NCAS0H01640 Chr8 complement(313901..316087) [2187 bp, 728 aa] {ON}
           Anc_5.351 YHR072W
          Length = 728

 Score = 1056 bits (2732), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 501/725 (69%), Positives = 582/725 (80%), Gaps = 5/725 (0%)

Query: 2   LYSEELGLPKTDSKRWRLKTDALGSEKWEYLSEIEAKQQPQSAYVKYLLQLPDFEAPKPA 61
           LYS+ELGL KTD  RWRL+T+ LG   WEY++  +    PQS + K+LLQLPDF AP P 
Sbjct: 5   LYSDELGLQKTDPTRWRLRTNPLGRHTWEYINSEQKTNDPQSTFTKWLLQLPDFPAPTPT 64

Query: 62  VNKNSAHFTAKDAAFNGAQFFSLLQE-DSGIFPCQYKGPMFMTIGYVAALYCAEVPIPTP 120
             +     TA++A ++GA FF LLQ+ +SG FPCQYKGPMFMTIGYVA  Y A + IP  
Sbjct: 65  TEEPR---TAREACYDGASFFRLLQDKESGTFPCQYKGPMFMTIGYVAVNYIAGLEIPNH 121

Query: 121 VKQEIIRYIVNSSHPVDGGWGLHEVDKSTTFGTVINYVILRLLGLKPDNIVCQRARRTLH 180
            + EIIRY+VN++HPVDGGWGLH  DKST FGTVINYVILRLLG+  D+IVC+RAR+TL 
Sbjct: 122 ERIEIIRYLVNTAHPVDGGWGLHSTDKSTVFGTVINYVILRLLGMSKDHIVCRRARKTLL 181

Query: 181 RLGGAVGAPHWGKAWLSILNLYKWEGVNPAPPELWLLPYALPIHPGRWWVHTRAIYQALG 240
            LGGA+GAPHWGK WLS+LNLYKWEGVNPAPPE WLLPY LPIHPGRWWVHTR +Y  + 
Sbjct: 182 SLGGAIGAPHWGKVWLSVLNLYKWEGVNPAPPETWLLPYCLPIHPGRWWVHTRGVYLPIS 241

Query: 241 YLSAAKYSCPVTPLLEEIRNEIYT-QPFESIDFSKQKNNVCGVDLYYPHTRLLNIANASM 299
           YLS   +SC +TPLL+EIR EIYT QPFE+I F++ +NNVCGVDLYYPH+++L++ANA +
Sbjct: 242 YLSLVHFSCELTPLLKEIREEIYTAQPFEAIKFAQNRNNVCGVDLYYPHSQVLDVANACI 301

Query: 300 IFYEKYLKPDWFLKYSNRKVYELIKKEIKNTDYLCIAPVSMAFCAIVTLIEEGRDSYEFK 359
           + YE+YL+P W  K S RKVYELIKKEI NTDYLCIAPV+ AFCA+VTLIEEG DS  F+
Sbjct: 302 VKYEEYLRPTWLKKLSKRKVYELIKKEISNTDYLCIAPVNQAFCALVTLIEEGVDSNAFQ 361

Query: 360 RFLERFEDVLFLGPQGMTVMGTNGVQVWDCAFAIQYYFVAGLAELPEFHETIEKAYKFLC 419
           +F  RF+D LF GPQGMTVMGTNGVQVWDCAFAIQY+FVAGLAE  EF++TI  AY FLC
Sbjct: 362 KFSYRFKDSLFHGPQGMTVMGTNGVQVWDCAFAIQYFFVAGLAEKSEFYDTIASAYAFLC 421

Query: 420 RSQFDTECEPGSFRDKRIGAWPFSTKTQGYTVSDCTAESVKAIIMVRNSPSFANLRDEIS 479
           RSQFDTEC  GSFRDKR+G+W FSTKTQGYTVSDCTAES+KAIIMV+NSP F  +   I+
Sbjct: 422 RSQFDTECVRGSFRDKRVGSWGFSTKTQGYTVSDCTAESIKAIIMVKNSPVFKAIHHLIT 481

Query: 480 DERLYKAMDVLLALQNTGSFEYGSFATYEKIKATTKLEKLNPAEVFGNIMVEFPYVECTD 539
           DE++Y+ +DVLL+LQN GSFEYGSFATYEKIKA   LEKLNPAEVFGNIMVE+PYVECTD
Sbjct: 482 DEKIYQGIDVLLSLQNVGSFEYGSFATYEKIKAPLFLEKLNPAEVFGNIMVEYPYVECTD 541

Query: 540 SSVLGLTYFSKHYTYRXXXXXXXXXXXXXXXXNAQKPDGSWYGCWGICFTYAGMFALEAL 599
           SSVLGLTYF  +Y YR                + Q  DGSWYG WGIC+TYAGMFA+EAL
Sbjct: 542 SSVLGLTYFHNYYNYRGNEISQRIKVAVDYIKHLQASDGSWYGSWGICYTYAGMFAMEAL 601

Query: 600 HTVDETYENSEVVQKGCDFLVSKQRPDGGWSESMKSSELHSYVESANSQAVQTAWALIGL 659
           H+V E Y NS VV+KGCDFLV++Q  DGGW E MKSSELH+YV S  SQ VQTAW +I L
Sbjct: 602 HSVGECYANSIVVKKGCDFLVNRQMTDGGWGEPMKSSELHTYVNSERSQVVQTAWVVIAL 661

Query: 660 LLAEYPNKEIIDKGINLLKKRQLESGEWKFEEVEGVFNHSCAIEYPSYKFLFPIKALGLY 719
           LLA+YP K++I KG+ LLK RQ  SGEWKFE  EGVFNHSCAIEYPSY+ LFPIKALGLY
Sbjct: 662 LLAKYPRKDVIIKGVELLKSRQEPSGEWKFESPEGVFNHSCAIEYPSYRHLFPIKALGLY 721

Query: 720 AKKYE 724
           A+ Y+
Sbjct: 722 AEIYD 726

>NDAI0C01970 Chr3 complement(442137..444332) [2196 bp, 731 aa] {ON}
           Anc_5.351 YHR072W
          Length = 731

 Score = 1056 bits (2730), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 504/725 (69%), Positives = 578/725 (79%), Gaps = 3/725 (0%)

Query: 2   LYSEELGLPKTDSKRWRLKTDALGSEKWEYLSEIEAKQQPQSAYVKYLLQLPDFEAPKPA 61
           LYSEELGL KTD   WRL+T+  G + WEY+++ ++   PQS + K+LLQLPDF  P P 
Sbjct: 5   LYSEELGLEKTDPLLWRLRTNIDGRQSWEYITKDQSPNDPQSNFTKWLLQLPDF--PTPQ 62

Query: 62  VNKNSAHFTAKDAAFNGAQFFSLLQ-EDSGIFPCQYKGPMFMTIGYVAALYCAEVPIPTP 120
              N    +A+     GA+FF LLQ E SG FPCQYKGPMFMTIGYVA  Y A++ IP  
Sbjct: 63  YPDNIKDVSAEAICLKGAKFFRLLQDETSGTFPCQYKGPMFMTIGYVAVNYVADIKIPES 122

Query: 121 VKQEIIRYIVNSSHPVDGGWGLHEVDKSTTFGTVINYVILRLLGLKPDNIVCQRARRTLH 180
            + EIIRYIVN++HPVDGGWGLH  DKST FGTV+NY+ILRLLGL  ++ VC +AR TL 
Sbjct: 123 ERIEIIRYIVNTAHPVDGGWGLHSEDKSTVFGTVLNYIILRLLGLDANHPVCMKARDTLL 182

Query: 181 RLGGAVGAPHWGKAWLSILNLYKWEGVNPAPPELWLLPYALPIHPGRWWVHTRAIYQALG 240
           RLGGA+ APHWGK WLS+LNLYKWEGVNPAPPE WLLPY +PIHPGRWWVHTR +Y  + 
Sbjct: 183 RLGGAISAPHWGKVWLSVLNLYKWEGVNPAPPETWLLPYWMPIHPGRWWVHTRGVYLPIS 242

Query: 241 YLSAAKYSCPVTPLLEEIRNEIYTQPFESIDFSKQKNNVCGVDLYYPHTRLLNIANASMI 300
           YLS   Y C +T LL+EIR+EIY +PF+SIDFSK +N VCGVDLYYPH++ L+ AN+ ++
Sbjct: 243 YLSLVHYQCELTDLLKEIRSEIYVKPFDSIDFSKHRNTVCGVDLYYPHSKTLDFANSLIV 302

Query: 301 FYEKYLKPDWFLKYSNRKVYELIKKEIKNTDYLCIAPVSMAFCAIVTLIEEGRDSYEFKR 360
            YEKYL+P+    YS  KVY+LIKKEI+NTDYLCIAPV+ AFCA+VTL+EEG DS  F+R
Sbjct: 303 PYEKYLRPNALRDYSKHKVYDLIKKEIENTDYLCIAPVNQAFCALVTLLEEGADSKAFER 362

Query: 361 FLERFEDVLFLGPQGMTVMGTNGVQVWDCAFAIQYYFVAGLAELPEFHETIEKAYKFLCR 420
           F  RF+D LFLGPQGMTVMGTNGVQ WDCAFAIQY FVAGLA+ PEF+ TI  AYKFLCR
Sbjct: 363 FQYRFKDALFLGPQGMTVMGTNGVQTWDCAFAIQYLFVAGLAKRPEFYNTISNAYKFLCR 422

Query: 421 SQFDTECEPGSFRDKRIGAWPFSTKTQGYTVSDCTAESVKAIIMVRNSPSFANLRDEISD 480
           SQFDT+C  GSFRDKR GAW FSTKTQGYTVSDCTAES+KAIIMVRNS  F ++ DEISD
Sbjct: 423 SQFDTDCVTGSFRDKRDGAWGFSTKTQGYTVSDCTAESIKAIIMVRNSVIFKDIHDEISD 482

Query: 481 ERLYKAMDVLLALQNTGSFEYGSFATYEKIKATTKLEKLNPAEVFGNIMVEFPYVECTDS 540
           ERLYKA+D+LL LQNTGSFE+GSFATYEKIKA   LE LNPAEVFGNIMVE+PYVECTDS
Sbjct: 483 ERLYKAVDILLDLQNTGSFEFGSFATYEKIKAPLFLEALNPAEVFGNIMVEYPYVECTDS 542

Query: 541 SVLGLTYFSKHYTYRXXXXXXXXXXXXXXXXNAQKPDGSWYGCWGICFTYAGMFALEALH 600
           SVLGLT F KHY YR                  Q+ DGSWYG WGIC+TYAGMFA+EALH
Sbjct: 543 SVLGLTSFHKHYNYRKDEISKRINIAIEYIKKVQEDDGSWYGSWGICYTYAGMFAMEALH 602

Query: 601 TVDETYENSEVVQKGCDFLVSKQRPDGGWSESMKSSELHSYVESANSQAVQTAWALIGLL 660
           +V ETY NS VV+KGCDFLV++Q  DGGW ESMKSSELH+YV +  S  VQTAW ++ LL
Sbjct: 603 SVGETYGNSFVVKKGCDFLVARQLEDGGWGESMKSSELHTYVSTKESLVVQTAWVVLALL 662

Query: 661 LAEYPNKEIIDKGINLLKKRQLESGEWKFEEVEGVFNHSCAIEYPSYKFLFPIKALGLYA 720
           LA+YPNK IIDKGI LLKKRQ  SGEWKFE  EGVFNHSCAIEYPSY+FLFPIKALGLY+
Sbjct: 663 LAQYPNKNIIDKGIALLKKRQQVSGEWKFESPEGVFNHSCAIEYPSYRFLFPIKALGLYS 722

Query: 721 KKYEH 725
           + YEH
Sbjct: 723 QIYEH 727

>TBLA0A03120 Chr1 (742618..744849) [2232 bp, 743 aa] {ON} Anc_5.351
           YHR072W
          Length = 743

 Score = 1052 bits (2720), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 488/727 (67%), Positives = 586/727 (80%), Gaps = 4/727 (0%)

Query: 1   MLYSEELGLPKTDSKRWRLKTDALGSEKWEYLSEIEAKQQPQSAYVKYLLQLPDFEAPKP 60
           +LYS+EL LPKTD +RWRL TD LG E WEYLSE ++K+ PQS +VK+LLQ+PDF  PKP
Sbjct: 13  ILYSDELKLPKTDPRRWRLITDKLGRESWEYLSEEDSKKIPQSTFVKWLLQIPDFPTPKP 72

Query: 61  AVNKNSAHFTAKDAAFNGAQFFSLLQE-DSGIFPCQYKGPMFMTIGYVAALYCAEVPIPT 119
            + +   +FT  DA  NGA FF LLQ+ +SGIFPCQYKGPMF+TIGYVA  Y A + IP 
Sbjct: 73  KIKQGDKNFTTHDALLNGANFFKLLQDPESGIFPCQYKGPMFLTIGYVAVQYIAGIKIPE 132

Query: 120 PVKQEIIRYIVNSSHPVDGGWGLHEVDKSTTFGTVINYVILRLLGLKPDNIVCQRARRTL 179
             + EIIRYIVN++HPVDGGWGLH VDKST FGTV+NYVILRLLGL   + VC +AR+TL
Sbjct: 133 HERLEIIRYIVNTAHPVDGGWGLHSVDKSTVFGTVLNYVILRLLGLPKTHPVCVKARKTL 192

Query: 180 HRLGGAVGAPHWGKAWLSILNLYKWEGVNPAPPELWLLPYALPIHPGRWWVHTRAIYQAL 239
            RLGGA+G+PHWGK WLS+LNLYKWEGVNPAPPE WLLPY+LPIHPGRWWVHTR +Y  +
Sbjct: 193 IRLGGAIGSPHWGKIWLSVLNLYKWEGVNPAPPETWLLPYSLPIHPGRWWVHTRGVYLPV 252

Query: 240 GYLSAAKYSCPVTPLLEEIRNEIYTQPFESIDFSKQKNNVCGVDLYYPHTRLLNIANASM 299
            YL   K++CP TPL+EEIR EIY   +++IDFSK +N VCGVDLYYPH+++L++AN  +
Sbjct: 253 SYLGLTKFACPPTPLIEEIRKEIYATEYDTIDFSKHRNTVCGVDLYYPHSKILDVANNIL 312

Query: 300 IFYEKYLKPDWFLKYSNRKVYELIKKEIKNTDYLCIAPVSMAFCAIVTLIEEGRDSYEFK 359
           +FYEK+++P++    S  KV +LI+KEI NTDYLCIAPV+ AFC++V L+E+G +S EF+
Sbjct: 313 VFYEKWIRPNFIYNKSKEKVLDLIEKEIANTDYLCIAPVNQAFCSLVILVEKGVNSKEFE 372

Query: 360 RFLERFEDVLFLGPQGMTVMGTNGVQVWDCAFAIQYYFVAGLAELPEFHETIEKAYKFLC 419
           R   RF+D LF GPQGMTVMGTNGVQ WDCAFA+QY+F+AGLAE PEF + I ++YKFLC
Sbjct: 373 RCQYRFKDALFHGPQGMTVMGTNGVQTWDCAFAVQYFFMAGLAERPEFKDLIIRSYKFLC 432

Query: 420 RSQFDTECEPGSFRDKRIGAWPFSTKTQGYTVSDCTAESVKAIIMVRNSPSFANLRDEIS 479
           RSQFDTEC PGSFRDKRIG W FSTKTQGYTVSDCTAES+KAIIMVRNSP+F  + DEIS
Sbjct: 433 RSQFDTECVPGSFRDKRIGGWGFSTKTQGYTVSDCTAESIKAIIMVRNSPAFKEVHDEIS 492

Query: 480 DERLYKAMDVLLALQNTGSFEYGSFATYEKIKATTKLEKLNPAEVFGNIMVEFPYVECTD 539
           DERLY+ +++L++LQN G FEYGSFATYEKIKA   +E LNPAEVF NIMVE+PYVECTD
Sbjct: 493 DERLYQGIEILMSLQNLGKFEYGSFATYEKIKAPLSMELLNPAEVFCNIMVEYPYVECTD 552

Query: 540 SSVLGLTYFSKHYTYRXXXXXXXXXXXXXXXXNAQKPDGSWYGCWGICFTYAGMFALEAL 599
           SSVLGLTYF KHY Y+                 AQ  DGSWYG WGICFTYA MFALEAL
Sbjct: 553 SSVLGLTYFHKHYDYKYDEIGKRIRLAIDYIKRAQNNDGSWYGSWGICFTYASMFALEAL 612

Query: 600 HTVDETYENSEVVQKGCDFLVSKQRPDGGWSESMKSSELHSYVESAN---SQAVQTAWAL 656
            T+ E Y NSE V+KGCDF+VSKQ  DGGWSE+MKSSE+H YV+S +   S  VQT+W++
Sbjct: 613 ETIGEDYNNSETVKKGCDFIVSKQNKDGGWSETMKSSEIHYYVDSGDLEGSYVVQTSWSV 672

Query: 657 IGLLLAEYPNKEIIDKGINLLKKRQLESGEWKFEEVEGVFNHSCAIEYPSYKFLFPIKAL 716
           IGL+LA YP+K+++ +GI  +K +QL SGEW+F+ VEGVFNHSC IEYPSY+FLFPIKAL
Sbjct: 673 IGLILANYPDKDVVYRGIEYIKSQQLPSGEWEFQNVEGVFNHSCGIEYPSYRFLFPIKAL 732

Query: 717 GLYAKKY 723
           GLY  +Y
Sbjct: 733 GLYRTRY 739

>AGR351W Chr7 (1381502..1383691) [2190 bp, 729 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHR072W (ERG7)
          Length = 729

 Score = 1048 bits (2709), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 477/724 (65%), Positives = 585/724 (80%), Gaps = 1/724 (0%)

Query: 1   MLYSEELGLPKTDSKRWRLKTDALGSEKWEYLSEIEAKQQPQSAYVKYLLQLPDFEAPKP 60
           MLYS+ELGLP TDS+RWRL  D +G+E+WEY+ E E  + PQ+  V++LL +P F  P+P
Sbjct: 1   MLYSDELGLPTTDSRRWRLFCDEVGAERWEYMDEQETSKVPQTTCVQWLLNVPSFPTPEP 60

Query: 61  AVNKNSAHFTAKDAAFNGAQFFSLLQED-SGIFPCQYKGPMFMTIGYVAALYCAEVPIPT 119
            V+     FTA +AA+NGA+F  LLQ++ SG FPC Y+GPMFMTIGYV A++   V IP 
Sbjct: 61  EVSSKDQGFTAANAAYNGARFLGLLQDEASGTFPCSYRGPMFMTIGYVVAMHVGGVVIPE 120

Query: 120 PVKQEIIRYIVNSSHPVDGGWGLHEVDKSTTFGTVINYVILRLLGLKPDNIVCQRARRTL 179
           P ++E++RY+VN++HPVDGGWGLH  DKST  GT +NYV+LRLLG++ ++IV QRAR+TL
Sbjct: 121 PQRRELVRYVVNTAHPVDGGWGLHSEDKSTVMGTALNYVLLRLLGMEREHIVMQRARKTL 180

Query: 180 HRLGGAVGAPHWGKAWLSILNLYKWEGVNPAPPELWLLPYALPIHPGRWWVHTRAIYQAL 239
            R+GGA+G+P+WGK WLS+LNLYKWEGVNPAPPELWLLPY  P HP RWWVHTRAI+  +
Sbjct: 181 LRMGGAIGSPYWGKVWLSVLNLYKWEGVNPAPPELWLLPYQFPYHPARWWVHTRAIFLPM 240

Query: 240 GYLSAAKYSCPVTPLLEEIRNEIYTQPFESIDFSKQKNNVCGVDLYYPHTRLLNIANASM 299
            YL+  +Y C +TPLLEEIR+EI+T+PFE IDF+  +NNVCG+DLYYPHT +LN  N  +
Sbjct: 241 SYLAGVRYQCALTPLLEEIRSEIFTRPFEEIDFAANRNNVCGIDLYYPHTTVLNTLNKCI 300

Query: 300 IFYEKYLKPDWFLKYSNRKVYELIKKEIKNTDYLCIAPVSMAFCAIVTLIEEGRDSYEFK 359
           + YEKYL+P+W LKYS  ++YELIK EI+NTDYLCIAPV+ A  AIVT IEEG DS EF 
Sbjct: 301 VGYEKYLRPNWLLKYSLNRIYELIKMEIQNTDYLCIAPVNNALNAIVTCIEEGPDSAEFG 360

Query: 360 RFLERFEDVLFLGPQGMTVMGTNGVQVWDCAFAIQYYFVAGLAELPEFHETIEKAYKFLC 419
           RFL+RF++VLFLGPQGM VMGTNGVQVWDCAF IQ  F A L + PEF+E I +AY+FLC
Sbjct: 361 RFLDRFKEVLFLGPQGMLVMGTNGVQVWDCAFYIQSMFAANLQDKPEFYENIVRAYRFLC 420

Query: 420 RSQFDTECEPGSFRDKRIGAWPFSTKTQGYTVSDCTAESVKAIIMVRNSPSFANLRDEIS 479
           RSQ   +C PGS+RD RIGAWPFSTKTQGY VSDCTAE+ K++++VRNSP F  +RDEIS
Sbjct: 421 RSQITDDCVPGSYRDPRIGAWPFSTKTQGYAVSDCTAEAAKSVLLVRNSPVFKEVRDEIS 480

Query: 480 DERLYKAMDVLLALQNTGSFEYGSFATYEKIKATTKLEKLNPAEVFGNIMVEFPYVECTD 539
            E+L KA+D LL LQN GSF+YGSFA+YEKI+A   +E LN AEVF NIMVE PYVECTD
Sbjct: 481 SEKLQKAIDALLGLQNLGSFKYGSFASYEKIRAPLSIESLNSAEVFANIMVEHPYVECTD 540

Query: 540 SSVLGLTYFSKHYTYRXXXXXXXXXXXXXXXXNAQKPDGSWYGCWGICFTYAGMFALEAL 599
           SSVLGL+++ K++ YR                +AQ+ DGSWYGCWGIC+TYAGMFALEAL
Sbjct: 541 SSVLGLSFYRKYHDYRQDEVDHAIKIAVKFIKSAQEKDGSWYGCWGICYTYAGMFALEAL 600

Query: 600 HTVDETYENSEVVQKGCDFLVSKQRPDGGWSESMKSSELHSYVESANSQAVQTAWALIGL 659
           H   E+Y +SEVV+KGC+FLVSKQ PDGGWSE+MKSSELH+YV    S  VQTAWALIGL
Sbjct: 601 HNAGESYADSEVVKKGCEFLVSKQLPDGGWSETMKSSELHTYVSDKRSYVVQTAWALIGL 660

Query: 660 LLAEYPNKEIIDKGINLLKKRQLESGEWKFEEVEGVFNHSCAIEYPSYKFLFPIKALGLY 719
           LLA+YP++++ID+GI LLK+RQL SGEWK+E +EGVFNHSCAIEYPSY+F+FPIKALG+Y
Sbjct: 661 LLADYPDRKVIDRGIQLLKERQLPSGEWKYESIEGVFNHSCAIEYPSYRFVFPIKALGIY 720

Query: 720 AKKY 723
           +KKY
Sbjct: 721 SKKY 724

>CAGL0J10824g Chr10 complement(1056204..1058405) [2202 bp, 733 aa]
           {ON} highly similar to uniprot|P38604 Saccharomyces
           cerevisiae YHR072w ERG7 lanosterol synthase
          Length = 733

 Score = 1036 bits (2679), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 501/719 (69%), Positives = 576/719 (80%), Gaps = 3/719 (0%)

Query: 2   LYSEELGLPKTDSKRWRLKTDALGSEKWEYLSEIEAKQQPQSAYVKYLLQLPDFEAPKPA 61
            YS+ +G+P+TD KRWRL+T  LG E WEY+ + +    PQS +V++LLQ  D E P P+
Sbjct: 4   FYSDTVGIPRTDPKRWRLRTTELGREAWEYIEQDKVDADPQSTFVQWLLQ--DEEFPTPS 61

Query: 62  VNKNSAHFTAKDAAFNGAQFFSLLQED-SGIFPCQYKGPMFMTIGYVAALYCAEVPIPTP 120
             K     +++ A + GA F+ LLQ+  SGIFPCQYKGPMFMTIGYVA  Y A V +P  
Sbjct: 62  PRKEGDDLSSEQACYYGASFYKLLQDQKSGIFPCQYKGPMFMTIGYVAVNYIAGVKLPEH 121

Query: 121 VKQEIIRYIVNSSHPVDGGWGLHEVDKSTTFGTVINYVILRLLGLKPDNIVCQRARRTLH 180
            + E+IRYIVN++HPVDGGWGLH VDKST FGTV+NYV LRLLGL  D+IVC RAR TLH
Sbjct: 122 ERIELIRYIVNTAHPVDGGWGLHSVDKSTVFGTVLNYVCLRLLGLPKDHIVCVRARHTLH 181

Query: 181 RLGGAVGAPHWGKAWLSILNLYKWEGVNPAPPELWLLPYALPIHPGRWWVHTRAIYQALG 240
           RLGGA GAPHWGK WLSILNLYKWEGVNPAPPE WLLPY+LPIHPGRWWVHTRA+Y  + 
Sbjct: 182 RLGGATGAPHWGKIWLSILNLYKWEGVNPAPPETWLLPYSLPIHPGRWWVHTRAVYLPVS 241

Query: 241 YLSAAKYSCPVTPLLEEIRNEIYTQPFESIDFSKQKNNVCGVDLYYPHTRLLNIANASMI 300
           YLS  KYSCP+T LL EIR EIYT+ F+ I+FS+ +N VCGVDLYYPH+++L+ AN  ++
Sbjct: 242 YLSLIKYSCPLTDLLSEIRQEIYTKSFDKINFSQHRNTVCGVDLYYPHSKILDTANDVIV 301

Query: 301 FYEKYLKPDWFLKYSNRKVYELIKKEIKNTDYLCIAPVSMAFCAIVTLIEEGRDSYEFKR 360
           FYEKYL+P      S + VY LIKKEI+NTD LCIAPV+ AFCA+VT +EEG+DS  F+R
Sbjct: 302 FYEKYLRPRLVSMASKKVVYNLIKKEIQNTDSLCIAPVNQAFCALVTYLEEGKDSKAFER 361

Query: 361 FLERFEDVLFLGPQGMTVMGTNGVQVWDCAFAIQYYFVAGLAELPEFHETIEKAYKFLCR 420
           F  RF+D LF GPQGMTVMGTNGVQ WDCAF IQY+FVAGLAE PEF E I  AYKFLCR
Sbjct: 362 FQYRFKDGLFHGPQGMTVMGTNGVQTWDCAFMIQYFFVAGLAEKPEFREMIINAYKFLCR 421

Query: 421 SQFDTECEPGSFRDKRIGAWPFSTKTQGYTVSDCTAESVKAIIMVRNSPSFANLRDEISD 480
           SQFDTEC  GSFRDKR+GAW FSTKTQGYTVSDCTAE++KAIIMVRNSP F+++ DEI+D
Sbjct: 422 SQFDTECVEGSFRDKRVGAWGFSTKTQGYTVSDCTAEAIKAIIMVRNSPVFSSVHDEITD 481

Query: 481 ERLYKAMDVLLALQNTGSFEYGSFATYEKIKATTKLEKLNPAEVFGNIMVEFPYVECTDS 540
           ERL K +DVLL+LQN G FEYGSFATYEKIKA   +EKLNPAEVFGNIMVE+PYVECTDS
Sbjct: 482 ERLCKGIDVLLSLQNIGKFEYGSFATYEKIKAPLSMEKLNPAEVFGNIMVEYPYVECTDS 541

Query: 541 SVLGLTYFSKHYTYRXXXXXXXXXXXXXXXXNAQKPDGSWYGCWGICFTYAGMFALEALH 600
           SVLGLTYF K+Y YR                 AQ+ DG WYGCWGICFTYAGMFA+EALH
Sbjct: 542 SVLGLTYFHKYYDYRKDEISHRIRIAIDYIKQAQQDDGGWYGCWGICFTYAGMFAMEALH 601

Query: 601 TVDETYENSEVVQKGCDFLVSKQRPDGGWSESMKSSELHSYVESANSQAVQTAWALIGLL 660
           +V ETY+NS  V+KGCDFL+SKQ PDGGW ESMKSSELH YV+S  S  VQTAWALI LL
Sbjct: 602 SVGETYDNSLTVRKGCDFLLSKQMPDGGWGESMKSSELHDYVDSPKSLVVQTAWALIALL 661

Query: 661 LAEYPNKEIIDKGINLLKKRQLESGEWKFEEVEGVFNHSCAIEYPSYKFLFPIKALGLY 719
           LA+ PN++ I++GINLLK RQ  SGEWKFE  EGVFNHSCAIEYPSY+FLFPIKALGLY
Sbjct: 662 LAKCPNEDAIERGINLLKSRQQPSGEWKFESAEGVFNHSCAIEYPSYRFLFPIKALGLY 720

>Ecym_8182 Chr8 complement(379402..381600) [2199 bp, 732 aa] {ON}
           similar to Ashbya gossypii AGR351W
          Length = 732

 Score = 1031 bits (2667), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 477/724 (65%), Positives = 572/724 (79%), Gaps = 2/724 (0%)

Query: 2   LYSEELGLPKTDSKRWRLKTDALGSEKWEYLSEIEAKQQPQSAYVKYLLQLPDFEAPKPA 61
           LYS+ LGLP TD  RWRL   +LG   W+Y+SE ++K+ PQ    K+LL   +F  P+P 
Sbjct: 4   LYSDYLGLPSTDPSRWRLNCTSLGETSWKYISEADSKKIPQCNCTKWLLNADNFSTPEPD 63

Query: 62  VNKNSAHFTAKDAAFNGAQFFSLLQ-EDSGIFPCQYKGPMFMTIGYVAALYCAEVPIPTP 120
           V    A+F A +AA+NGA F  LLQ +DSG FP QYKGPMFMTI YV ++Y     IP  
Sbjct: 64  VGNGDANFKAYNAAYNGASFLKLLQNQDSGTFPNQYKGPMFMTICYVGSMYVGRKEIPEC 123

Query: 121 VKQEIIRYIVNSSHPVDGGWGLHEVDKSTTFGTVINYVILRLLGLKPDNIVCQRARRTLH 180
            K EIIRYIVN++HPVDGGWGLH   KST FGTV+NY++LRLLG+  D++VC+RAR TLH
Sbjct: 124 EKIEIIRYIVNTAHPVDGGWGLHTTGKSTVFGTVLNYIVLRLLGMSKDHVVCRRARSTLH 183

Query: 181 RLGGAVGAPHWGKAWLSILNLYKWEGVNPAPPELWLLPYALPIHPGRWWVHTRAIYQALG 240
           RLGGA+GAPHWGK WLSILNLYKWEGVNPAP E W LPY +PIHP RWW+HTRAIY  + 
Sbjct: 184 RLGGAIGAPHWGKIWLSILNLYKWEGVNPAPAEFWTLPYIVPIHPARWWIHTRAIYLPMS 243

Query: 241 YLSAAKYSCPVTPLLEEIRNEIYTQPFESIDFSKQKNNVCGVDLYYPHTRLLNIANASMI 300
           YL    Y+C +TPLL+EIRNEIYT  F+ I FSK +N VC VDLY+PH+ +LN+ N++++
Sbjct: 244 YLCGISYACELTPLLQEIRNEIYTTNFDEIQFSKHRNTVCQVDLYFPHSTILNVINSAIV 303

Query: 301 FYEKYLKPDWFLKYSNRKVYELIKKEIKNTDYLCIAPVSMAFCAIVTLIEEGRDSYEFKR 360
           +Y+ YL+PDW +KYSN+KVYELI+KEI NT+YLC+APVS AFC+IVT IEEG DS EF+R
Sbjct: 304 WYQNYLRPDWLVKYSNKKVYELIRKEIVNTEYLCVAPVSAAFCSIVTCIEEGADSPEFER 363

Query: 361 FLERFEDVLFLGPQGMTVMGTNGVQVWDCAFAIQYYFVAGLAELPEFHETIEKAYKFLCR 420
            +E F   +F GPQGMTVMGTNG QVWDC+F +QY F+A LAELPEF + +  AYKFLCR
Sbjct: 364 LMEAFAGNVFHGPQGMTVMGTNGSQVWDCSFFVQYLFMANLAELPEFQDAVTNAYKFLCR 423

Query: 421 SQFDTECEPGSFRDKRIGAWPFSTKTQGYTVSDCTAESVKAIIMVRNSPSFANLRDEISD 480
           SQF  EC  GS+RDKR+G WPFSTKTQGYTVSDCTAE++KA+IMV+ SP FA + DEIS+
Sbjct: 424 SQFTHECVSGSYRDKRVGGWPFSTKTQGYTVSDCTAEALKAVIMVKRSPVFAAIHDEISE 483

Query: 481 ERLYKAMDVLLALQNTGSFEYGSFATYEKIKATTKLEKLNPAEVFGNIMVEFPYVECTDS 540
           E L KA+DVLL+LQN GS EYGSFATYEKI+A   +EKLNPAEVF NIMVE+PYVECTDS
Sbjct: 484 EALQKAIDVLLSLQNVGSIEYGSFATYEKIRAPLIMEKLNPAEVFENIMVEYPYVECTDS 543

Query: 541 SVLGLTYFSKHYTYRXXXXXXXXXXXXXXXXNAQKPDGSWYGCWGICFTYAGMFALEALH 600
            +LGLTYFS++Y YR                  Q  DGSWYGCWGIC+TYAGMFALEAL+
Sbjct: 544 CILGLTYFSEYYDYRKDDIDHSVKIAADYIKKVQGKDGSWYGCWGICYTYAGMFALEALY 603

Query: 601 TVDETYENSEVVQKGCDFLVSKQRPDGGWSESMKSSELHSYV-ESANSQAVQTAWALIGL 659
           T+ E YENSEVV++GCDFLV KQ  DGGWSES+KS+EL  Y+ +   S  V T+WALIGL
Sbjct: 604 TIGENYENSEVVRRGCDFLVKKQLSDGGWSESIKSAELMCYINDDKGSLVVPTSWALIGL 663

Query: 660 LLAEYPNKEIIDKGINLLKKRQLESGEWKFEEVEGVFNHSCAIEYPSYKFLFPIKALGLY 719
           LLA+YP+KE+ID+GI LLK RQL SGEWKFE++EG+FNHSCAIEYP+Y+FLFPIKALG+Y
Sbjct: 664 LLADYPDKEVIDRGIQLLKSRQLRSGEWKFEQIEGIFNHSCAIEYPTYRFLFPIKALGIY 723

Query: 720 AKKY 723
           AKKY
Sbjct: 724 AKKY 727

>ZYRO0D10164g Chr4 (854166..856364) [2199 bp, 732 aa] {ON} highly
           similar to uniprot|P38604 Saccharomyces cerevisiae
           YHR072W ERG7 Lanosterol synthase an essential enzyme
           that catalyzes the cyclization of squalene 2 3- epoxide
           a step in ergosterol biosynthesis
          Length = 732

 Score = 1017 bits (2629), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 477/724 (65%), Positives = 563/724 (77%), Gaps = 2/724 (0%)

Query: 2   LYSEELGLPKTDSKRWRLKTDALGSEKWEYLSEIEAKQQPQSAYVKYLLQLPDFEAPKPA 61
           LYSEEL L +TD   WRL+ D LG E WEY+S+ +AK  PQS YV++LLQLP F  P P 
Sbjct: 4   LYSEELQLERTDPNLWRLRVDKLGRESWEYISKEDAKNDPQSKYVQWLLQLPSFPKPSPK 63

Query: 62  VNK-NSAHFTAKDAAFNGAQFFSLLQE-DSGIFPCQYKGPMFMTIGYVAALYCAEVPIPT 119
           ++  N+  F A +A  NGA F+ LLQ+ DSGIFPCQYKGPMFMTIGYV   Y A + IP 
Sbjct: 64  IHSGNAKKFNALEACKNGASFYQLLQDPDSGIFPCQYKGPMFMTIGYVVVHYVAGIEIPK 123

Query: 120 PVKQEIIRYIVNSSHPVDGGWGLHEVDKSTTFGTVINYVILRLLGLKPDNIVCQRARRTL 179
           P + E+IRYIVN+SHPVDGGWGLH  DKST FGT INYV LRLLGL  D+ VC +ARRTL
Sbjct: 124 PKRLEMIRYIVNTSHPVDGGWGLHSTDKSTVFGTAINYVNLRLLGLPRDHPVCVKARRTL 183

Query: 180 HRLGGAVGAPHWGKAWLSILNLYKWEGVNPAPPELWLLPYALPIHPGRWWVHTRAIYQAL 239
           H+LGGA+GAPHWGK WLS+LNLYKWEGVNPAPPE WLLPY LPIHPGRWWVHTRAIY  +
Sbjct: 184 HKLGGALGAPHWGKIWLSVLNLYKWEGVNPAPPETWLLPYFLPIHPGRWWVHTRAIYLPV 243

Query: 240 GYLSAAKYSCPVTPLLEEIRNEIYTQPFESIDFSKQKNNVCGVDLYYPHTRLLNIANASM 299
            YLS  +Y CP+TPLL+E+R E+Y +PF SIDF   +N VCGVDLYYPH+++L++ N+ +
Sbjct: 244 SYLSLIRYQCPLTPLLQELREELYVKPFNSIDFGSNRNTVCGVDLYYPHSKVLDLMNSVL 303

Query: 300 IFYEKYLKPDWFLKYSNRKVYELIKKEIKNTDYLCIAPVSMAFCAIVTLIEEGRDSYEFK 359
           +FYEK+L+ +W    +  +VY LIKKEI NTDYLCIAPV+ AFCA+VTLIEEG +S +FK
Sbjct: 304 VFYEKHLRFNWINTMAKNRVYGLIKKEIANTDYLCIAPVNQAFCALVTLIEEGVNSPQFK 363

Query: 360 RFLERFEDVLFLGPQGMTVMGTNGVQVWDCAFAIQYYFVAGLAELPEFHETIEKAYKFLC 419
           RF  RF D LF GPQGMT+MGTNGVQ WDCAF IQ  F AGLAE  +++ET+ +AY+FL 
Sbjct: 364 RFQFRFNDALFHGPQGMTMMGTNGVQTWDCAFTIQSLFTAGLAEKEQYYETVVRAYEFLN 423

Query: 420 RSQFDTECEPGSFRDKRIGAWPFSTKTQGYTVSDCTAESVKAIIMVRNSPSFANLRDEIS 479
           R+QF  EC PGSFRD R GAW FSTKTQGYTVSDCTAES+KAIIMV+ SP +A +   I 
Sbjct: 424 RAQFQDECVPGSFRDLRKGAWGFSTKTQGYTVSDCTAESIKAIIMVKKSPFYAKVHSLID 483

Query: 480 DERLYKAMDVLLALQNTGSFEYGSFATYEKIKATTKLEKLNPAEVFGNIMVEFPYVECTD 539
           DERL +A+DVLL+LQN G FEYGSFATYE IKA   +EKLNPAEVFGNIMVE+PYVECTD
Sbjct: 484 DERLCQAIDVLLSLQNVGPFEYGSFATYEMIKAPLLMEKLNPAEVFGNIMVEYPYVECTD 543

Query: 540 SSVLGLTYFSKHYTYRXXXXXXXXXXXXXXXXNAQKPDGSWYGCWGICFTYAGMFALEAL 599
           S+VLGLT F  +  YR                  Q  DGSWYGCWG+CFTYAGMFALEAL
Sbjct: 544 SAVLGLTSFHDYCDYRRDEISDRINIAVDYIKKCQNEDGSWYGCWGVCFTYAGMFALEAL 603

Query: 600 HTVDETYENSEVVQKGCDFLVSKQRPDGGWSESMKSSELHSYVESANSQAVQTAWALIGL 659
           H+V E Y NS++VQKGCDFLV +Q  DGGW E+MKS ELH+YVES  S  VQT+W +I L
Sbjct: 604 HSVGEDYHNSKIVQKGCDFLVDRQMADGGWGETMKSCELHTYVESQESMVVQTSWVIIAL 663

Query: 660 LLAEYPNKEIIDKGINLLKKRQLESGEWKFEEVEGVFNHSCAIEYPSYKFLFPIKALGLY 719
           LL++YPNK +ID+ +  L+ RQ  SGEWKF+ VEGVFNHSCAIEYP+Y+F+FPIKALGLY
Sbjct: 664 LLSKYPNKSVIDRAVKFLETRQERSGEWKFDGVEGVFNHSCAIEYPNYRFIFPIKALGLY 723

Query: 720 AKKY 723
              +
Sbjct: 724 VNAF 727

>SAKL0F08602g Chr6 (657898..659322) [1425 bp, 474 aa] {ON} similar
           to uniprot|P40186 Saccharomyces cerevisiae YIL050W PCL7
           Pho85p cyclin of the Pho80p subfamily forms a functional
           kinase complex with Pho85p which phosphorylates Mmr1p
           and is regulated by Pho81p involved in glycogen
           metabolism expression is cell-cycle regulated
          Length = 474

 Score = 33.9 bits (76), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 26/98 (26%), Positives = 44/98 (44%), Gaps = 4/98 (4%)

Query: 601 TVDETYENSEVVQKGCDFLVSKQRPDGGWSESMKSSELHSYVESANSQAVQTAWALIGLL 660
           TV +TY N  V+Q+ C     K + DG  +         S    A +Q   +A  L+   
Sbjct: 234 TVSDTYSNCTVMQRSCSSSEDKSK-DGVSTSGQHKESQTSSANGAKTQGKDSAKTLMD-- 290

Query: 661 LAEYPNKEIIDKGINLLKKRQLESGEWKFEEV-EGVFN 697
           +A +PN ++++   +LL K    + + +   V E  FN
Sbjct: 291 IATFPNNKLLNMLTSLLNKIVKSNDQLRNTNVQESAFN 328

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.136    0.426 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 78,372,554
Number of extensions: 3400325
Number of successful extensions: 7721
Number of sequences better than 10.0: 21
Number of HSP's gapped: 7771
Number of HSP's successfully gapped: 21
Length of query: 728
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 611
Effective length of database: 40,065,477
Effective search space: 24480006447
Effective search space used: 24480006447
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 70 (31.6 bits)