Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_34.159775.352ON59759730730.0
KLTH0H14872g5.352ON62362614330.0
SAKL0G08822g5.352ON58262910031e-128
NDAI0C043205.352ON7065868971e-111
KLLA0B10197g5.352ON6215298901e-111
ZYRO0D10186g5.352ON6356528621e-107
TDEL0E027505.352ON5646208331e-103
YDR320C (SWA2)5.352ON6685568161e-99
KNAG0C055005.352ON5855118073e-99
Skud_4.5865.352ON6425367896e-96
Smik_4.5795.352ON6676247916e-96
KAFR0C018505.352ON6465377722e-93
Kpol_339.135.352ON6864637402e-88
CAGL0H07095g5.352ON6615447279e-87
NCAS0F028705.352ON7003447161e-84
Ecym_81815.352ON6615467103e-84
Suva_2.4895.352ON6593226955e-82
AGR352C5.352ON6485606946e-82
TPHA0E011105.352ON6933456828e-80
TBLA0H019705.352ON8403166706e-77
Kwal_55.199355.617ON5931381000.002
TPHA0D028805.617ON585145960.005
TPHA0D038606.328ON12061840.025
Kpol_1028.516.328ON11773820.044
KLTH0E02178g5.617ON593138870.072
Ecym_20906.328ON17269820.10
NDAI0D008106.21ON349150840.13
NCAS0B070102.152ON625130840.14
TBLA0I023106.328ON11671780.15
SAKL0A01672g6.328ON12897780.16
YCR060W (TAH1)6.328ON11173770.18
SAKL0G07084g5.617ON585138820.28
TPHA0I015102.152ON603147810.34
ACR005W6.21ON32769800.35
YOR027W (STI1)5.617ON589130800.44
TPHA0L014208.506ON374189790.51
Suva_12.1141.456ON370142780.66
Kwal_56.244877.313ON37072780.73
Kpol_1018.695.617ON590142780.84
Ecym_44133.481ON510146771.0
CAGL0D05060g3.481ON510200771.0
Suva_8.805.617ON586130771.0
Skud_15.1925.617ON589136761.3
CAGL0K09240g6.328ON14252721.4
KLLA0A07062g5.617ON581133751.7
KAFR0F007202.152ON608116751.7
KAFR0J025706.328ON12171701.8
Smik_2.2958.506ON385100741.8
Skud_2.2828.506ON38565742.1
KLTH0H02068g7.313ON370126732.5
Kpol_513.28.506ON374146732.6
AAR054C6.328ON133110702.7
Kwal_27.118908.506ON334146732.7
KLTH0F14542g3.481ON513192732.8
NCAS0G008105.617ON584142732.9
Suva_4.4058.506ON38598733.0
TBLA0H033808.506ON375148723.0
KNAG0A079003.481ON512142733.1
Kwal_55.211753.481ON511142723.5
YBR155W (CNS1)8.506ON38591723.7
YJR032W (CPR7)1.456ON393142714.7
Skud_3.1356.328ON11877674.9
NCAS0H008306.21ON33867715.0
Kpol_1037.266.21ON34267705.8
AEL224W5.617ON58068706.0
Ecym_52131.229ON41657706.0
CAGL0H08195g5.617ON58366707.1
TDEL0A048405.617ON576133707.2
TDEL0F020303.314ON28638697.2
Smik_15.2055.617ON589130698.1
YLR352W4.185ON807113698.5
NCAS0F034903.481ON512148699.9
AGL268C8.506ON37994689.9
CAGL0L04048g2.152ON587666910.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_34.15977
         (597 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_34.15977 s34 (141005..142798) [1794 bp, 597 aa] {ON} YDR320...  1188   0.0  
KLTH0H14872g Chr8 complement(1289638..1291509) [1872 bp, 623 aa]...   556   0.0  
SAKL0G08822g Chr7 (755393..757141) [1749 bp, 582 aa] {ON} simila...   390   e-128
NDAI0C04320 Chr3 complement(983914..986034) [2121 bp, 706 aa] {O...   350   e-111
KLLA0B10197g Chr2 complement(891842..893707) [1866 bp, 621 aa] {...   347   e-111
ZYRO0D10186g Chr4 complement(856401..858308) [1908 bp, 635 aa] {...   336   e-107
TDEL0E02750 Chr5 (529920..531614) [1695 bp, 564 aa] {ON} Anc_5.3...   325   e-103
YDR320C Chr4 complement(1106095..1108101) [2007 bp, 668 aa] {ON}...   318   1e-99
KNAG0C05500 Chr3 (1069670..1071427) [1758 bp, 585 aa] {ON} Anc_5...   315   3e-99
Skud_4.586 Chr4 complement(1042397..1044325) [1929 bp, 642 aa] {...   308   6e-96
Smik_4.579 Chr4 complement(1032558..1034561) [2004 bp, 667 aa] {...   309   6e-96
KAFR0C01850 Chr3 (369596..371536) [1941 bp, 646 aa] {ON} Anc_5.3...   301   2e-93
Kpol_339.13 s339 complement(21257..23317) [2061 bp, 686 aa] {ON}...   289   2e-88
CAGL0H07095g Chr8 (700262..702247) [1986 bp, 661 aa] {ON} simila...   284   9e-87
NCAS0F02870 Chr6 complement(573068..575170) [2103 bp, 700 aa] {O...   280   1e-84
Ecym_8181 Chr8 (377372..379357) [1986 bp, 661 aa] {ON} similar t...   278   3e-84
Suva_2.489 Chr2 complement(863483..865462) [1980 bp, 659 aa] {ON...   272   5e-82
AGR352C Chr7 complement(1383723..1385669) [1947 bp, 648 aa] {ON}...   271   6e-82
TPHA0E01110 Chr5 (228116..230197) [2082 bp, 693 aa] {ON} Anc_5.3...   267   8e-80
TBLA0H01970 Chr8 (464239..466761) [2523 bp, 840 aa] {ON} Anc_5.3...   262   6e-77
Kwal_55.19935 s55 (182767..184548) [1782 bp, 593 aa] {ON} YOR027...    43   0.002
TPHA0D02880 Chr4 (599288..601045) [1758 bp, 585 aa] {ON} Anc_5.6...    42   0.005
TPHA0D03860 Chr4 (807913..808275) [363 bp, 120 aa] {ON} Anc_6.32...    37   0.025
Kpol_1028.51 s1028 complement(123535..123888) [354 bp, 117 aa] {...    36   0.044
KLTH0E02178g Chr5 (194914..196695) [1782 bp, 593 aa] {ON} highly...    38   0.072
Ecym_2090 Chr2 complement(163340..163858) [519 bp, 172 aa] {ON} ...    36   0.10 
NDAI0D00810 Chr4 complement(181659..182708) [1050 bp, 349 aa] {O...    37   0.13 
NCAS0B07010 Chr2 (1332351..1334228) [1878 bp, 625 aa] {ON} Anc_2...    37   0.14 
TBLA0I02310 Chr9 (528067..528417) [351 bp, 116 aa] {ON} Anc_6.32...    35   0.15 
SAKL0A01672g Chr1 complement(154932..155318) [387 bp, 128 aa] {O...    35   0.16 
YCR060W Chr3 (224399..224734) [336 bp, 111 aa] {ON}  TAH1Compone...    34   0.18 
SAKL0G07084g Chr7 (580004..581761) [1758 bp, 585 aa] {ON} highly...    36   0.28 
TPHA0I01510 Chr9 complement(342661..344472) [1812 bp, 603 aa] {O...    36   0.34 
ACR005W Chr3 (363355..364338) [984 bp, 327 aa] {ON} Syntenic hom...    35   0.35 
YOR027W Chr15 (381053..382822) [1770 bp, 589 aa] {ON}  STI1Hsp90...    35   0.44 
TPHA0L01420 Chr12 (293980..295104) [1125 bp, 374 aa] {ON} Anc_8....    35   0.51 
Suva_12.114 Chr12 (164933..166042) [1110 bp, 370 aa] {ON} YJR032...    35   0.66 
Kwal_56.24487 s56 (1016327..1017439) [1113 bp, 370 aa] {ON} YLR2...    35   0.73 
Kpol_1018.69 s1018 (197149..198921) [1773 bp, 590 aa] {ON} (1971...    35   0.84 
Ecym_4413 Chr4 complement(856330..857862) [1533 bp, 510 aa] {ON}...    34   1.0  
CAGL0D05060g Chr4 complement(486065..487597) [1533 bp, 510 aa] {...    34   1.0  
Suva_8.80 Chr8 (142691..144451) [1761 bp, 586 aa] {ON} YOR027W (...    34   1.0  
Skud_15.192 Chr15 (340847..342616) [1770 bp, 589 aa] {ON} YOR027...    34   1.3  
CAGL0K09240g Chr11 complement(914042..914470) [429 bp, 142 aa] {...    32   1.4  
KLLA0A07062g Chr1 complement(636546..638291) [1746 bp, 581 aa] {...    33   1.7  
KAFR0F00720 Chr6 complement(141181..143007) [1827 bp, 608 aa] {O...    33   1.7  
KAFR0J02570 Chr10 (488372..488737) [366 bp, 121 aa] {ON} Anc_6.3...    32   1.8  
Smik_2.295 Chr2 (535786..536943) [1158 bp, 385 aa] {ON} YBR155W ...    33   1.8  
Skud_2.282 Chr2 (517201..518358) [1158 bp, 385 aa] {ON} YBR155W ...    33   2.1  
KLTH0H02068g Chr8 complement(188834..189946) [1113 bp, 370 aa] {...    33   2.5  
Kpol_513.2 s513 (1962..3086) [1125 bp, 374 aa] {ON} (1962..3086)...    33   2.6  
AAR054C Chr1 complement(440706..441107) [402 bp, 133 aa] {ON} Sy...    32   2.7  
Kwal_27.11890 s27 (990685..991689) [1005 bp, 334 aa] {ON} YBR155...    33   2.7  
KLTH0F14542g Chr6 complement(1191800..1193341) [1542 bp, 513 aa]...    33   2.8  
NCAS0G00810 Chr7 complement(138192..139946) [1755 bp, 584 aa] {O...    33   2.9  
Suva_4.405 Chr4 (719015..720172) [1158 bp, 385 aa] {ON} YBR155W ...    33   3.0  
TBLA0H03380 Chr8 (829314..830441) [1128 bp, 375 aa] {ON} Anc_8.5...    32   3.0  
KNAG0A07900 Chr1 complement(1258164..1259702) [1539 bp, 512 aa] ...    33   3.1  
Kwal_55.21175 s55 complement(716457..717992) [1536 bp, 511 aa] {...    32   3.5  
YBR155W Chr2 (549771..550928) [1158 bp, 385 aa] {ON}  CNS1TPR-co...    32   3.7  
YJR032W Chr10 (491081..492262) [1182 bp, 393 aa] {ON}  CPR7Pepti...    32   4.7  
Skud_3.135 Chr3 (208664..209020) [357 bp, 118 aa] {ON} YCR060W (...    30   4.9  
NCAS0H00830 Chr8 complement(151809..152825) [1017 bp, 338 aa] {O...    32   5.0  
Kpol_1037.26 s1037 complement(59590..60618) [1029 bp, 342 aa] {O...    32   5.8  
AEL224W Chr5 (207712..209454) [1743 bp, 580 aa] {ON} Syntenic ho...    32   6.0  
Ecym_5213 Chr5 complement(455091..456341) [1251 bp, 416 aa] {ON}...    32   6.0  
CAGL0H08195g Chr8 complement(804418..806169) [1752 bp, 583 aa] {...    32   7.1  
TDEL0A04840 Chr1 (851520..853250) [1731 bp, 576 aa] {ON} Anc_5.6...    32   7.2  
TDEL0F02030 Chr6 (370257..371117) [861 bp, 286 aa] {ON} Anc_3.31...    31   7.2  
Smik_15.205 Chr15 (346899..348668) [1770 bp, 589 aa] {ON} YOR027...    31   8.1  
YLR352W Chr12 (831116..833539) [2424 bp, 807 aa] {ON} Putative p...    31   8.5  
NCAS0F03490 Chr6 complement(698757..700295) [1539 bp, 512 aa] {O...    31   9.9  
AGL268C Chr7 complement(205872..207011) [1140 bp, 379 aa] {ON} S...    31   9.9  
CAGL0L04048g Chr12 (476407..478170) [1764 bp, 587 aa] {ON} simil...    31   10.0 

>Kwal_34.15977 s34 (141005..142798) [1794 bp, 597 aa] {ON} YDR320C
           (SWA2) - auxilin-like protein [contig 272] FULL
          Length = 597

 Score = 1188 bits (3073), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 579/597 (96%), Positives = 579/597 (96%)

Query: 1   MSSAFDDLFSTFKGGNQSSQNGIAKAKSPRIETSPGINYSDDSRNGTDLDEIFGFEKQAN 60
           MSSAFDDLFSTFKGGNQSSQNGIAKAKSPRIETSPGINYSDDSRNGTDLDEIFGFEKQAN
Sbjct: 1   MSSAFDDLFSTFKGGNQSSQNGIAKAKSPRIETSPGINYSDDSRNGTDLDEIFGFEKQAN 60

Query: 61  SAPAVXXXXXXXXXXXXXXXXXXQNHMDPEPQPLVDEIKDMEIARLMSLGLSCTKATSYY 120
           SAPAV                  QNHMDPEPQPLVDEIKDMEIARLMSLGLSCTKATSYY
Sbjct: 61  SAPAVKDEFDLAFDAFDAPAKLPQNHMDPEPQPLVDEIKDMEIARLMSLGLSCTKATSYY 120

Query: 121 ERGLLYDDLLERKRQQRTREEAPQKTSDEGRFTQGSEPDLLSVASSWLNRGRTFLDSKLK 180
           ERGLLYDDLLERKRQQRTREEAPQKTSDEGRFTQGSEPDLLSVASSWLNRGRTFLDSKLK
Sbjct: 121 ERGLLYDDLLERKRQQRTREEAPQKTSDEGRFTQGSEPDLLSVASSWLNRGRTFLDSKLK 180

Query: 181 QIQNDNGTQSYSDYISSRMESSAHTGSRLRPTSDIPTNIDRSISFQDLSLADQPNESSVP 240
           QIQNDNGTQSYSDYISSRMESSAHTGSRLRPTSDIPTNIDRSISFQDLSLADQPNESSVP
Sbjct: 181 QIQNDNGTQSYSDYISSRMESSAHTGSRLRPTSDIPTNIDRSISFQDLSLADQPNESSVP 240

Query: 241 AQVSPMNSEILPPLVNIGDDVPVSGPEEASADLLVDFDAPSGHDAVSSPVAASIAMSALE 300
           AQVSPMNSEILPPLVNIGDDVPVSGPEEASADLLVDFDAPSGHDAVSSPVAASIAMSALE
Sbjct: 241 AQVSPMNSEILPPLVNIGDDVPVSGPEEASADLLVDFDAPSGHDAVSSPVAASIAMSALE 300

Query: 301 FHSYQEFKEKGTLSFSAGDYHTAFQNFEKSVNSLPHSHPLRAISLSNMIICRLKLGEYRK 360
           FHSYQEFKEKGTLSFSAGDYHTAFQNFEKSVNSLPHSHPLRAISLSNMIICRLKLGEYRK
Sbjct: 301 FHSYQEFKEKGTLSFSAGDYHTAFQNFEKSVNSLPHSHPLRAISLSNMIICRLKLGEYRK 360

Query: 361 AIEDSSVALKLISCAKLDDVIPASDPPKTFKEIWCKIVGNKAEAYEHIEDYDKALKEYQL 420
           AIEDSSVALKLISCAKLDDVIPASDPPKTFKEIWCKIVGNKAEAYEHIEDYDKALKEYQL
Sbjct: 361 AIEDSSVALKLISCAKLDDVIPASDPPKTFKEIWCKIVGNKAEAYEHIEDYDKALKEYQL 420

Query: 421 LIKRGAASRKVMEGRRRCQKIVEPEKFVQRSKTPLSTSPSVSRKDVAVAATSQVPSEKLE 480
           LIKRGAASRKVMEGRRRCQKIVEPEKFVQRSKTPLSTSPSVSRKDVAVAATSQVPSEKLE
Sbjct: 421 LIKRGAASRKVMEGRRRCQKIVEPEKFVQRSKTPLSTSPSVSRKDVAVAATSQVPSEKLE 480

Query: 481 RVQNINKKEKELERQKFLLHDKVQDRVREWCQNSEDDLRELLSRFHLIVDWVDWKNVSTA 540
           RVQNINKKEKELERQKFLLHDKVQDRVREWCQNSEDDLRELLSRFHLIVDWVDWKNVSTA
Sbjct: 481 RVQNINKKEKELERQKFLLHDKVQDRVREWCQNSEDDLRELLSRFHLIVDWVDWKNVSTA 540

Query: 541 DLVMPKRVKIVYLKAVTKTHPDKIQDSWPLERKMVAENVFVILSKAWELFKEQNKLS 597
           DLVMPKRVKIVYLKAVTKTHPDKIQDSWPLERKMVAENVFVILSKAWELFKEQNKLS
Sbjct: 541 DLVMPKRVKIVYLKAVTKTHPDKIQDSWPLERKMVAENVFVILSKAWELFKEQNKLS 597

>KLTH0H14872g Chr8 complement(1289638..1291509) [1872 bp, 623 aa]
           {ON} weakly similar to uniprot|Q06677 Saccharomyces
           cerevisiae YDR320C SWA2 auxilin-like protein
          Length = 623

 Score =  556 bits (1433), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/626 (48%), Positives = 408/626 (65%), Gaps = 32/626 (5%)

Query: 1   MSSAFDDLFSTFKGGNQSSQNGIAKAKSPRIETSPGINYSDDSRNGTDLDEIFGFEKQAN 60
           MSSAFDDLFS FKGGN+SS N   K +S      P    +       DLD  FG  K +N
Sbjct: 1   MSSAFDDLFSAFKGGNESSSNTKPKGESLAGARLPLTGEASRKDADADLDAFFG-SKTSN 59

Query: 61  SAPAVXXXXXXXXXXXXXXXXXXQ------NHMDPEPQPLVDEIKDMEIARLMSLGLSCT 114
           +                      +      + ++P+PQP+VDE+KDMEIARLMSLGL   
Sbjct: 60  ATSGTARDEFDLAFDMLNGPVASRLAAPDVDLVEPKPQPVVDEVKDMEIARLMSLGLDWD 119

Query: 115 KATSYYERGLLYDDLLERKRQQRTREEAPQKTSDEGRFTQGSEPDLLSVASSWLNRGRTF 174
           KA  YYERG+LY+ +++R++++  R E P +TS +    +  E DL SVAS+WLN+GRTF
Sbjct: 120 KAAEYYERGILYEQVVDRQKRRTARTERPLRTSPQSSQLREEESDLFSVASNWLNKGRTF 179

Query: 175 LDSKLKQIQNDNGTQSYSDYISSRMESSA------HTGSRLRPTSDIPTNIDRSISFQDL 228
           LDSKLKQ+Q +   +S+SDYISSR  S+A       +GS     S        +  F+DL
Sbjct: 180 LDSKLKQVQTEYSDRSFSDYISSRSGSNASPPWLKESGSYHLQVSSDRGKQKVTTQFKDL 239

Query: 229 SLADQPN-----ESSVPAQVSP---MNSEILPPLVNIGDDVPVSGPEEASA---DLLVDF 277
            + ++ +      S VP+  SP   + S   P       D   + P  +     DLL+DF
Sbjct: 240 KIEEETHFGPRANSPVPSTKSPAVSVASASHPVYSETPGDKSEAPPNPSPVQDNDLLIDF 299

Query: 278 DAPSGHDAVSSPVAASIAMSALEFHSYQEFKEKGTLSFSAGDYHTAFQNFEKSVNSLPHS 337
           +AP+   + + P   S  ++ LE HS++EFKEKG  SF  GDYH AFQN+EKS+NSLP +
Sbjct: 300 EAPALKTS-NVPATYSPNLTELERHSFEEFKEKGANSFRTGDYHAAFQNYEKSLNSLPLT 358

Query: 338 HPLRAISLSNMIICRLKLGEYRKAIEDSSVALKLISCAKLDDVIPASDPPKTFKEIWCKI 397
           HPLR +S SN+IICRLK+GEYR+A+ D+S ALKLI    ++  IP  +PPKT+KE W KI
Sbjct: 359 HPLRVVSFSNIIICRLKVGEYREALSDASSALKLIPQGSMNSNIPNLNPPKTYKEFWSKI 418

Query: 398 VGNKAEAYEHIEDYDKALKEYQLLIKRGAASRKVMEGRRRCQKIVEPEK----FVQRSKT 453
           + NKA A+E +E+Y+KAL+ YQ LI+ G  S KV+E RR+CQK +  EK      ++S+T
Sbjct: 419 MNNKAVAFERVENYEKALETYQQLIEAGVTSSKVLEARRQCQKAIALEKKPVSVARKSET 478

Query: 454 PLSTSPSVSRKDVAVAA--TSQVPSEKLERVQNINKKEKELERQKFLLHDKVQDRVREWC 511
            +  + +V++K     A  T + PSEKL RVQ+INKKEK+LE Q+FLLHD+V   ++EWC
Sbjct: 479 SIPKA-AVTKKPSGRPAKVTLENPSEKLARVQDINKKEKDLEAQRFLLHDEVSSLIQEWC 537

Query: 512 QNSEDDLRELLSRFHLIVDWVDWKNVSTADLVMPKRVKIVYLKAVTKTHPDKIQDSWPLE 571
           +  +D+LRELL+RFH IVDWV+WK VSTADLV+PK+ K++YLKAV KTHPDKIQDSWPL+
Sbjct: 538 EGHDDNLRELLARFHTIVDWVNWKEVSTADLVVPKKAKVIYLKAVAKTHPDKIQDSWPLK 597

Query: 572 RKMVAENVFVILSKAWELFKEQNKLS 597
           RKM+AENVF++LSKAWE FKE+N+LS
Sbjct: 598 RKMIAENVFIVLSKAWETFKEKNQLS 623

>SAKL0G08822g Chr7 (755393..757141) [1749 bp, 582 aa] {ON} similar
           to gnl|GLV|KLLA0B10197g Kluyveromyces lactis
           KLLA0B10197g and some similarites with YDR320C
           uniprot|Q06677 Saccharomyces cerevisiae YDR320C SWA2
           auxilin- like protein
          Length = 582

 Score =  390 bits (1003), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 250/629 (39%), Positives = 357/629 (56%), Gaps = 88/629 (13%)

Query: 5   FDDLFSTFKGGNQSSQNG------IAKAKSPRIETSPGINYSDDSRNGTDLDEIFGFEKQ 58
           F DL S+FKG  Q S           K   P I +SP  +    + N  DLD  F     
Sbjct: 6   FADLLSSFKGEKQKSSTTSETVSLFDKHDGPSI-SSPAPSKPLQTIND-DLDAAFDVFNS 63

Query: 59  ANSAPAVXXXXXXXXXXXXXXXXXXQNHMDPEPQPLVDEIKDMEIARLMSLGLSCTKATS 118
           A + PA                         +  P+VDE+KDMEIARLMSLG+S  +A  
Sbjct: 64  ATNTPA------------------------KQGSPVVDEVKDMEIARLMSLGVSLERALQ 99

Query: 119 YYERGLLYDDLLERKRQQRTREEAPQKTSDEGR-----FTQGS------------EPDLL 161
           YYERG+LYDD+L R+ +   + EA ++ +   R     F  GS            + DL 
Sbjct: 100 YYERGILYDDVLRRRHE---KHEAKRQAAAASRDFTKLFDNGSSNILGSDGSDDKQQDLF 156

Query: 162 SVASSWLNRGRTFLDSKLKQIQN-----DNGTQSYSDYISSRMESSAHTGSRLRPTSDIP 216
           S+A+   N+G++F++ +LKQ Q      D   +S++D+ISSR+ES         PT    
Sbjct: 157 SMATGLFNKGKSFMEERLKQRQQHQHQQDPAFRSFADHISSRLES---------PTR--- 204

Query: 217 TNIDRSISFQDLSLADQPNESSVPAQVSPMNSEILPPLVNIGDDVPVSGPEEASADLLVD 276
              +RS  + D  +  +      P       S I   L+   D++ VS P+  +   L+D
Sbjct: 205 AKYERS-QYTDKQVGSERRPEPAPVDEVEEPSVIEGDLLGGFDELSVSSPQHET---LLD 260

Query: 277 FD-APSGHDAVSSPVAASIAMSALEFHSYQEFKEKGTLSFSAGDYHTAFQNFEKSVNSLP 335
           F+ A S     SS     I++SA+E   + EFK KG   F+ G+Y +A   +EKS+N+LP
Sbjct: 261 FEQAVSPPQLRSSSARPPISISAMELSGFGEFKSKGGELFAHGNYSSALLEYEKSLNTLP 320

Query: 336 HSHPLRAISLSNMIICRLKLGEYRKAIEDSSVALKLISCAKLDDVIPASDPPKTFKEIWC 395
             HPLR ISLSN+I  +LKLGE   A+++   AL+LI   +L   IPAS+PPK+++E W 
Sbjct: 321 SGHPLRIISLSNIITTQLKLGESSSALQNIETALRLIGEDELQLTIPASNPPKSYREFWG 380

Query: 396 KIVGNKAEAYEHIEDYDKALKEYQLLIKRGAASRKVMEGRRRCQKIVEPEKFVQRSKTPL 455
           KI   KAEA EH+E+Y  AL+ Y+ LI +G  + KVM+G+RRCQK++ P K       P 
Sbjct: 381 KITMRKAEALEHVENYVSALECYKALIDKGFVTSKVMDGKRRCQKVLSPPK-------PQ 433

Query: 456 STSPSVSRK----DVAVAATSQVP--SEKLERVQNINKKEKELERQKFLLHDKVQDRVRE 509
           S  P V+RK    +V   ++S +P  S+ LE++Q IN++ ++LE +KFLL DKV ++++ 
Sbjct: 434 SGIPPVARKKPSPNVLDTSSSTLPKRSDNLEKIQRINREAEQLENKKFLLRDKVDEQIKS 493

Query: 510 WCQNSEDDLRELLSRFHLIVDWV-DWKNVSTADLVMPKRVKIVYLKAVTKTHPDKIQDSW 568
           W Q  E+DLR+LL+    ++ W  DWK V+T+DLVMPK+VKI YLKA+ KTHPDK+ DS 
Sbjct: 494 WSQGKENDLRQLLADLPKVLTWSNDWKPVTTSDLVMPKKVKITYLKAIAKTHPDKLNDSL 553

Query: 569 PLERKMVAENVFVILSKAWELFKEQNKLS 597
            +E KM+AE++F ILSKAWE FKE+N +S
Sbjct: 554 DVEHKMLAEDIFSILSKAWEAFKEENNIS 582

>NDAI0C04320 Chr3 complement(983914..986034) [2121 bp, 706 aa] {ON}
           Anc_5.352 YDR320C
          Length = 706

 Score =  350 bits (897), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 214/586 (36%), Positives = 325/586 (55%), Gaps = 93/586 (15%)

Query: 88  DPEPQPLVDEIKDMEIARLMSLGLSCTKATSYYERGLLYDDLLERKRQQRTREEAP---- 143
           D E + +VDE+KDME+ARLMSLGLS  +A  YY++G+LY+D++ ++R+++ ++++P    
Sbjct: 138 DYEEEIIVDEVKDMEVARLMSLGLSIDQANKYYDKGILYEDIIRKQREKKLKQQSPRNKN 197

Query: 144 --------QKTSD-------EGRF--TQGSEPDLLSVASSWLNRGRTFLDSKLKQIQNDN 186
                   QK SD         RF  +Q +  +L S+A+  L +G+  +D      + +N
Sbjct: 198 NAQDKNNTQKYSDLFDNTYANKRFNESQNNTGNLFSMATDILYKGKELVDQLTAYPEENN 257

Query: 187 GTQSYSDYI----------SSRMESSA--------HTGSRLRPTSDIPTNIDR-SISFQD 227
               Y + I           SR  +SA        H  S     S  P+ ++R S+ ++D
Sbjct: 258 RLYKYREPIDNEENPFLQEGSRSPASARSPSLSGSHVASASAKPSSKPSYVERNSLKYED 317

Query: 228 --LSLADQPNESSVPAQVSPMNSEILPPLVNIGDDVPVSGPEEASADLLVDFDAPSGHDA 285
              +L D  +         P  ++ +PP  +I  D      E  + + L+DFD   G   
Sbjct: 318 NNTTLIDDFDYKLTINSKEPSMAKNIPP--SITPDTT----ETNNNNALLDFD---GLST 368

Query: 286 VSSP---------------------------VAASIAMSALEFHSYQEFKEKGTLSFSAG 318
           V++P                             A++ +S +E   + EFK +G+  F  G
Sbjct: 369 VTAPGSSNISVNKKNTSSSSATSPSPSPASITIATVPISHIELSGHIEFKTRGSELFKNG 428

Query: 319 DYHTAFQNFEKSVNSLPHSHPLRAISLSNMIICRLKLGEYRKAIEDSSVALKLISCAKL- 377
           DY +A Q +EKS+N+LP  HPLR IS SN+I  +LK+GEY K+IED  +AL L    K+ 
Sbjct: 429 DYVSALQEYEKSLNTLPQYHPLRIISYSNIIATQLKIGEYSKSIEDCKIALSLFPKGKVT 488

Query: 378 ---DDVIPASDPPKTFKEIWCKIVGNKAEAYEHIEDYDKALKEYQLLIKRGAASRKVMEG 434
              + +IP S P ++FK+IW K++  +AE+YEH+E+Y  AL  YQ LI+ G  + K+M+G
Sbjct: 489 SAWNQIIPDSTPQRSFKDIWSKLIMRQAESYEHLENYKLALDSYQKLIENGFTNSKIMDG 548

Query: 435 RRRCQKIVEPEKFVQRSKTPLSTSPSVSR---KDVAVAATSQVPSEKLERVQNINKKEKE 491
           +RRCQKI+ P    Q SK+P  T  S+ +   KD   A+        ++R+Q+ N K +E
Sbjct: 549 KRRCQKILNPPPPPQTSKSPTPTPVSILKHKEKDTTTAS--------VQRLQDENAKSRE 600

Query: 492 LERQKFLLHDKVQDRVREWCQNSEDDLRELLSRFHLIVDWVDWKNVSTADLVMPKRVKIV 551
           +E QK  L+DKV+ ++  W  + + D+R LLS    ++ W DW ++S ADLVMPK+VKI 
Sbjct: 601 IENQKVALYDKVESKINAWKLDKDTDIRHLLSNLSTVLTWCDWPSISQADLVMPKKVKIT 660

Query: 552 YLKAVTKTHPDKIQDSWPLERKMVAENVFVILSKAWELFKEQNKLS 597
           YLKA+TKTHPDKI +S  LE KM+AENVF ILS AW+ FK  N ++
Sbjct: 661 YLKAITKTHPDKIPESLDLENKMIAENVFSILSLAWDKFKLDNNMN 706

>KLLA0B10197g Chr2 complement(891842..893707) [1866 bp, 621 aa] {ON}
           similar to uniprot|Q06677 Saccharomyces cerevisiae
           YDR320C SWA2 auxilin-like protein
          Length = 621

 Score =  347 bits (890), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 223/529 (42%), Positives = 308/529 (58%), Gaps = 56/529 (10%)

Query: 89  PEPQPLVDEIKDMEIARLMSLGLSCTKATSYYERGLLYDDLLE-RKRQQRTREEAPQKTS 147
           PEPQPLVDE+KDMEIARLMSLGLS  KA  YY++G++Y++L+E +K+++++R       +
Sbjct: 128 PEPQPLVDEVKDMEIARLMSLGLSFDKAVHYYDKGIMYEELIESQKKRKQSRSNV---NN 184

Query: 148 DEGRF------TQGSEPDLLSVASSWLNRGRTFLDSKLK---QIQNDNGTQ--SYSDYIS 196
           D G+       ++ S P  +SVAS+  N G+ F++ KLK   Q Q  N +Q   +SD I 
Sbjct: 185 DFGQQQLRKQESRDSSPAFISVASNLFNMGKEFIEDKLKPTLQPQYANSSQRSQFSDDIP 244

Query: 197 SRMESSAHTGSRLRPTSDIPTNIDRSISFQDLSLADQPNESSVPA--QVSPMNSEILPPL 254
            R +   +T    RP          S+ FQ    + QP+   +P+  Q+S  N+   PP 
Sbjct: 245 LRRD---YTRPHSRP---------HSMQFQSERTSPQPS-PELPSIHQLSINNASSAPPP 291

Query: 255 VNIGDDVPVSGPEEASADLLVDFDAPSGHDAVSSPVAASIAMSALEFHSYQEFKEKGTLS 314
           V++ +    S     + + LVDF A     A  +  +    +S  E  S+ EFK  G   
Sbjct: 292 VSVENQDTASV---INQETLVDFGA-----APQTSASPQHRISDFELTSFNEFKNNGVKY 343

Query: 315 FSAGDYHTAFQNFEKSVNSLPHSHPLRAISLSNMIICRLKLGEYRKAIEDSSVALKLISC 374
           FS+GDYH A   FEKS N+LP  HPLR ISLSN++ C+LKLGE  KA+E   +AL L   
Sbjct: 344 FSSGDYHNALLEFEKSFNTLPFKHPLRIISLSNIVSCQLKLGENSKALESVKLALDLSDL 403

Query: 375 A-KLDDVIPASDPPKTFKEIWCKIVGNKAEAYEHIEDYDKALKEYQLLIKRGAASRKVME 433
           A    D+I  S P +TFK++  KI    AE  EH+E+Y+KAL  Y  LI  G   +KVM+
Sbjct: 404 APNASDIIEHSVPERTFKQMINKIQLKHAEIQEHLENYEKALSLYANLISNGITEQKVMD 463

Query: 434 GRRRCQKIVEPEKF------VQRSKTPLSTSPSVSRKDVAVAATSQVPSEKLERVQNINK 487
           G+RRC+KIV PEKF      +     P+ +  S+S   VAV            RV+  NK
Sbjct: 464 GKRRCEKIVNPEKFKPAKEKISSPTIPVRSKTSISADTVAV-----------NRVKEENK 512

Query: 488 KEKELERQKFLLHDKVQDRVREWCQNSEDDLRELLSRFHLIVDWVDWKNVSTADLVMPKR 547
           K++E E ++  L DKV +++ EW +N+E+DLR LL+    ++ W  WK VS  DLVM K+
Sbjct: 513 KQEEEEEERLRLRDKVDEKISEWTKNNENDLRYLLANLEPLLWWASWKEVSPQDLVMTKK 572

Query: 548 VKIVYLKAVTKTHPDKIQDSWPLERKMVAENVFVILSKAWELFKEQNKL 596
           VKI YLKA+ KTHPDKI     LE  M+AENV+ IL+KAWE FK QN +
Sbjct: 573 VKICYLKAIAKTHPDKIPADASLETIMIAENVYTILNKAWEYFKSQNNI 621

>ZYRO0D10186g Chr4 complement(856401..858308) [1908 bp, 635 aa] {ON}
           similar to uniprot|Q06677 Saccharomyces cerevisiae
           YDR320C SWA2 auxilin-like protein
          Length = 635

 Score =  336 bits (862), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 217/652 (33%), Positives = 336/652 (51%), Gaps = 72/652 (11%)

Query: 1   MSSAFDDLFSTFKGGNQSSQNGIAKAKSPRI------ETSPGI-----------NYSDDS 43
           M   F DL + FKGG    QN   K  + +       ETS  +           NY  D 
Sbjct: 1   MGDPFADLLTQFKGGESKPQNQGNKPLAAQYSENNTRETSSSLSLQPEPVTTASNYKIDD 60

Query: 44  RNGTDLDEIFGFEKQANSAPAVXXXXXXXXXXXXXXXXXXQNHMDPE---------PQPL 94
               D +++FG +   N+  +                      + PE         P+ L
Sbjct: 61  ----DFEQLFGIKSNTNTNNSDVNNRPNTTNQNEFDSAIDLLQITPEKQRQSAEREPEQL 116

Query: 95  VDEIKDMEIARLMSLGLSCTKATSYYERGLLYDDLLERKRQQRT--RE------------ 140
           VDE++DME+A+LMSLG S   A + YE+G+LYDD++E +++++   RE            
Sbjct: 117 VDEVRDMEVAKLMSLGYSIDGANTSYEQGMLYDDVIEERKKKKLHRRELQRLMAETNWER 176

Query: 141 EAPQKTSDEGRFTQGSEPDLLSVASSWLNRGRTFLDSKLKQIQNDNGTQSY-SDYISSRM 199
           E P+  +DE   +  +  DL S+AS   N+G+  +D        +N    Y S+ +  R 
Sbjct: 177 ETPETNNDE---SGKNNVDLFSIASGIFNKGKKIVDHLSLFPDEENDLLPYRSERLKQRQ 233

Query: 200 ESSAHTGSRLR--PTSDIPTNIDRSISFQDLSLADQPNESSVPAQVSPMNSEILPPL-VN 256
                   R R  PT +  T     + ++      QP   ++ AQ   +  +    L + 
Sbjct: 234 TFEPELPRRPRKDPTPNPRTQGTPQVEYESTLQYQQP---TIQAQEGDLLGDFQDKLSLR 290

Query: 257 IGDDVPVSGPEEASADLLVDFDAPSGHDAVSS-------PVAASIAMSALEFHSYQEFKE 309
              +   S  +  S + L+DFDAPS +   +S        V  ++ ++ +E   Y EFK+
Sbjct: 291 SQGNKSTSASQSPSNETLLDFDAPSANSTSASVSVSRQGSVVPTVPITEIELSGYNEFKD 350

Query: 310 KGTLSFSAGDYHTAFQNFEKSVNSLPHSHPLRAISLSNMIICRLKLGEYRKAIEDSSVAL 369
           +    F  GDY  A Q +EKS N+LPH HPLR IS SN++  +LK G+Y++++  +S+AL
Sbjct: 351 RAGELFKTGDYVAALQEYEKSANTLPHGHPLRIISYSNLMASQLKTGQYKESLHVASMAL 410

Query: 370 KLI--SCAKLDDVIPASDPPKTFKEIWCKIVGNKAEAYEHIEDYDKALKEYQLLIKRGAA 427
           KL      +   +I  S+P KT++++W KIV  +AEA+EH E++ +A   YQ LI++   
Sbjct: 411 KLFPEDTTQWTQLIQNSEPSKTYRDMWPKIVQRRAEAFEHSENFQEAFNAYQSLIEKNFC 470

Query: 428 SRKVMEGRRRCQKIVEPEK--FVQRSKTPLSTSPSVSRKDVAVAATSQVPSEKLERVQNI 485
           + K+M+G+RRCQK++ PEK   VQ+      +              S    + L++V+  
Sbjct: 471 TNKIMDGKRRCQKVLNPEKPKVVQKKPASSKSPSPSPNH-------SDKKYKNLQKVKED 523

Query: 486 NKKEKELERQKFLLHDKVQDRVREWCQNSEDDLRELLSRFHLIVDWVDWKNVSTADLVMP 545
           N+K+ E + Q+  L+D+V D+++ W     +D+R LLS    ++ WVDWK VS ADLVMP
Sbjct: 524 NRKQAEEDTQRHALYDRVYDQIKLWESGKANDIRHLLSNLQTVLTWVDWKPVSPADLVMP 583

Query: 546 KRVKIVYLKAVTKTHPDKIQDSWPLERKMVAENVFVILSKAWELFKEQNKLS 597
           K+VKI YL+AV KTHPDKI DS PL++KM+AE+VF  LS AWE FK +N ++
Sbjct: 584 KKVKITYLRAVAKTHPDKISDSLPLDKKMIAESVFSSLSSAWEKFKSENDIN 635

>TDEL0E02750 Chr5 (529920..531614) [1695 bp, 564 aa] {ON} Anc_5.352
           YDR320C
          Length = 564

 Score =  325 bits (833), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 219/620 (35%), Positives = 329/620 (53%), Gaps = 79/620 (12%)

Query: 1   MSSAFDDLFSTFKGGNQSSQNGIAKAKSPRI--ETSPG---INYSDDSRNGTDLDEIFGF 55
           MS  F DL S+F+ G   S   ++K  +P +  E  PG   IN  DD      LDE+FG 
Sbjct: 1   MSDPFADLLSSFRSGGSDS---VSKEATPEVKQEKLPGRNQINVHDD------LDELFGL 51

Query: 56  EKQANSA--PAVXXXXXXXXXXXXXXXXXXQNHMDPEPQPLVDEIKDMEIARLMSLGLSC 113
           +K+  +     V                  +  ++  P+ +VDE+KDME+A+LMSL L  
Sbjct: 52  KKRDETVVKNQVVGDSFDAAFEAFDRPQKVEKSLEESPEMVVDEVKDMEVAKLMSLNLDI 111

Query: 114 TKATSYYERGLLYDDLLERKRQQR--------TREEAPQKTSDEGRFTQGSEPDLLSVAS 165
            +AT YYERG+LY+ L  ++R+Q          R++  Q+ + E +F  GS     S+AS
Sbjct: 112 DQATDYYERGVLYEQLSRQRREQELIRRREQMLRQQQQQQQTPEEKFDSGS---FFSLAS 168

Query: 166 SWLNRGRTFLD--SKLKQIQNDNGTQSYSDYISSRMESSAHTGSRLRPTSDIPTNIDRSI 223
             L +GR F+D  S   Q Q+             R+       +R+R   D+P    +S+
Sbjct: 169 GILEKGRQFVDQFSGFPQEQD-------------RL-------TRVRVEQDLPVERPKSV 208

Query: 224 SFQDLSLADQPNESSVPAQVSPMNSEILPPLV-NIGDDVPVSGPEEASADLLVDFDAPSG 282
                           P  V      +L      I  + P   P       L+DFD  + 
Sbjct: 209 E---------------PPTVEVEEGNLLGEFQEKINLEEPKRSPTPPPQATLLDFDNGTP 253

Query: 283 HDAVSSPVAASIAMSALEFHSYQEFKEKGTLSFSAGDYHTAFQNFEKSVNSLPHSHPLRA 342
            + + +     + +S LE   Y+E+K++GT  F AGDY +A Q +EKS+NSLP +H LR 
Sbjct: 254 PERIKT--ITPVPISHLEISGYKEYKDRGTEFFKAGDYVSASQEYEKSLNSLPQNHALRI 311

Query: 343 ISLSNMIICRLKLGEYRKAIEDSSVALKLISCAK--LDDVIPASDPPKTFKEIWCKIVGN 400
           ++ SN+     K+GEY++ + D   AL++        D+ I  S P +TFKE+W KIV  
Sbjct: 312 VAYSNLTAALFKVGEYKRCLSDIESALEMFPKDPNLWDEPIQDSQPIRTFKEMWPKIVTR 371

Query: 401 KAEAYEHIEDYDKALKEYQLLIKRGAASRKVMEGRRRCQKIVEPEKFVQRSKTPLSTSPS 460
           +AEA+EHIE+Y++AL++YQ LI++   + K+M G+RRCQK++ P +       P +TSP+
Sbjct: 372 RAEAFEHIENYERALQDYQSLIEKNNFNDKIMGGKRRCQKVLNPTE-------PKATSPN 424

Query: 461 VSRKDVA-VAATSQVPSE--KLERVQNINKKEKELERQKFLLHDKVQDRVREWCQNSEDD 517
            S   V  V+  ++ P     +ERV+  N++ +  E +K  L+D V  ++  W     DD
Sbjct: 425 RSPTPVPKVSEDTKQPKTYANVERVKQENQRNELQEAEKAALYDTVFQQIESWKAGKGDD 484

Query: 518 LRELLSRFHLIVDWVDWKNVSTADLVMPKRVKIVYLKAVTKTHPDKIQDSWPLERKMVAE 577
           +R LL+    ++ W DWK VST+DLVMPK+VKI Y+KAV KTHPDKI  S  LE++M+AE
Sbjct: 485 IRHLLANLSTVLTWCDWKPVSTSDLVMPKKVKITYMKAVAKTHPDKIPSSLELEKRMIAE 544

Query: 578 NVFVILSKAWELFKEQNKLS 597
           +VF  LS AWE FK  N ++
Sbjct: 545 DVFSSLSVAWEKFKLANDIN 564

>YDR320C Chr4 complement(1106095..1108101) [2007 bp, 668 aa] {ON}
           SWA2Auxilin-like protein involved in vesicular
           transport; clathrin-binding protein required for
           uncoating of clathrin-coated vesicles
          Length = 668

 Score =  318 bits (816), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 205/556 (36%), Positives = 311/556 (55%), Gaps = 57/556 (10%)

Query: 84  QNHMDPEPQPLVDEIKDMEIARLMSLGLSCTKATSYYERGLLYDDLLE-RKRQQRTREEA 142
           ++H+      LVDE+KDMEIARLMSLGLS  +AT +YE  + Y+  LE  K +Q+ R + 
Sbjct: 128 EDHLYNGDDALVDEVKDMEIARLMSLGLSIEEATEFYENDVTYERYLEILKSKQKERNDL 187

Query: 143 PQKTSDEGRFTQGS---------EPDLLSVASSWLNRGRTFLDSKLKQIQNDNGTQSYSD 193
             +  + G   + S           +L S+A+ + N+G+  +D             S+  
Sbjct: 188 AIRKKESGIKMEKSGLSNIVGTDSNNLFSMATDFFNKGKKLVDQ----------WTSFPP 237

Query: 194 YISSRMESSAHTGSRLRPTSDIPTNID--RSISFQD------LSLADQPNES-------- 237
             + R+ + + T  ++    D+P   D    I F+D      L  AD P++         
Sbjct: 238 EANDRLNNYSKTHDKVE-DYDLPQVNDSPNRILFEDNEVVENLPPADNPDQDLLTDFETK 296

Query: 238 -SVPAQVSPMNSEILPPLVNIGDDVPVSGPEEASADLLVDF------DAPSGHDAV---- 286
             +  + +P  S    P   I  +      E    D L+DF      ++ S  D+     
Sbjct: 297 IDITKRTAPDVSHSSSPTSGILIEENSRRNEPLIEDSLLDFSEGNLTNSKSNEDSTLFNE 356

Query: 287 SSPVAASIAMSALEFHSYQEFKEKGTLSFSAGDYHTAFQNFEKSVNSLPHSHPLRAISLS 346
           +S   ++I +S +E   Y EFK KGT  F  GDY  + Q +EKS+N+LP +HPLR I+LS
Sbjct: 357 NSNTDSTIPISDIELSGYNEFKAKGTSLFKNGDYINSLQEYEKSLNTLPLNHPLRIIALS 416

Query: 347 NMIICRLKLGEYRKAIEDSSVALKLI--SCAKLDDVIPASDPPKTFKEIWCKIVGNKAEA 404
           N+I  +LK+GEY K+IE+SS+AL+L   S AK  + I  SDP ++F +IW KI+  +AE+
Sbjct: 417 NIIASQLKIGEYSKSIENSSMALELFPSSKAKWKNKISNSDPERSFNDIWPKIMIRRAES 476

Query: 405 YEHIEDYDKALKEYQLLIKRGAASRKVMEGRRRCQKIVEP---EKFVQRSKTPLSTSPSV 461
           +EH+E + KAL+ YQ LIK+     K+M+G+RRCQ  + P   +K +   K   +TSP+ 
Sbjct: 477 FEHLESFKKALETYQELIKKNFFDDKIMQGKRRCQDFINPPPVKKSMPVKKKTTTTSPAT 536

Query: 462 SRKDVAVAATSQVPSEKLERVQNINKKEKELERQKFLLHDKVQDRVREWCQNSEDDLREL 521
            ++++  A++S  P   ++    I  K++ELE  K  L+DKV +++  W    +DD+R L
Sbjct: 537 KKQNL-TASSSNSPIS-VDSTSEI--KKRELENAKLALYDKVFEKISSWKDGKDDDIRHL 592

Query: 522 LSRFHLIVDWVDWKNVSTADLVMPKRVKIVYLKAVTKTHPDKIQDSWPLERKMVAENVFV 581
           L+    ++ W +WK+VS  DLVMPKRVKI Y+KAV KTHPDKI +S  LE KM+AEN+F 
Sbjct: 593 LANLSSLLTWCNWKDVSMQDLVMPKRVKITYMKAVAKTHPDKIPESLSLENKMIAENIFS 652

Query: 582 ILSKAWELFKEQNKLS 597
            LS AW+ FK QN ++
Sbjct: 653 TLSIAWDKFKLQNDIN 668

>KNAG0C05500 Chr3 (1069670..1071427) [1758 bp, 585 aa] {ON}
           Anc_5.352 YDR320C
          Length = 585

 Score =  315 bits (807), Expect = 3e-99,   Method: Compositional matrix adjust.
 Identities = 193/511 (37%), Positives = 281/511 (54%), Gaps = 36/511 (7%)

Query: 94  LVDEIKDMEIARLMSLGLSCTKATSYYERGLLYDDLLERKRQQRTREEAPQKTSDE-GRF 152
           +VDE++DME+A++MSLG    KA  +Y+ G+LYD+L+ER+ ++  R    + +  E    
Sbjct: 104 VVDEVRDMEVAKIMSLGFGIDKAVEFYDSGVLYDELVERRDRRHIRHTHTRHSVREVTEV 163

Query: 153 TQGSEPDLLSVASSWLNRGRTFLDSKLKQIQNDNGTQSYSDYISSRMESSAHTGSRLRPT 212
            + +     S A   LN+G+ F+D  L    ++ G +  + Y     ++ AH G      
Sbjct: 164 PKHTGNSFFSAAVGLLNKGKDFVD-HLTAYPDEEGDR-LARYRQEHADA-AHFGDF---- 216

Query: 213 SDIPTNIDRSISFQDLSLADQPNESSVPAQVSPMNSEILPPLVNIGDDVPVSGPEEASAD 272
               T  +R    QDL + D  ++ S+  + +P       PL           P+E   D
Sbjct: 217 ----TPGERE---QDLLIDDFESKVSITDKHNP-------PLAQT--------PDETLLD 254

Query: 273 LLVDFDAPSG---HDAVSSPVAASIA-MSALEFHSYQEFKEKGTLSFSAGDYHTAFQNFE 328
              D  + SG   H   S  +   I  +S +E   Y EF+ KGT  F  GDY  A   +E
Sbjct: 255 FGEDDSSKSGSRTHVNNSPSIELPIVPISTMELSGYNEFRAKGTELFKKGDYSAAVLEYE 314

Query: 329 KSVNSLPHSHPLRAISLSNMIICRLKLGEYRKAIEDSSVALKLI--SCAKLDDVIPASDP 386
           KS+N+LP  HPLR I++SNM++  LK+GEY K ++ + +AL+LI    +    VI  S+P
Sbjct: 315 KSLNTLPEKHPLRIIAMSNMMLPYLKIGEYTKCLKLAPLALELIPEDRSTWRSVIQQSEP 374

Query: 387 PKTFKEIWCKIVGNKAEAYEHIEDYDKALKEYQLLIKRGAASRKVMEGRRRCQKIVEPEK 446
            +T+++IW K+V   AEA EH E+Y  A   YQLL+  G  + KVM+G+RRCQK++ P  
Sbjct: 375 KRTYRDIWSKLVMRLAEAQEHAENYTGAFDNYQLLVANGITNEKVMDGKRRCQKVLNPPS 434

Query: 447 FVQRSKTPLSTSPSVSRKDVAVAATSQVPSEKLERVQNINKKEKELERQKFLLHDKVQDR 506
            V+R  TP  T   V+       ATS+   E  ERV+  N K ++ E  K   +D V+ +
Sbjct: 435 KVERKGTPTPTPQVVTPARTPDPATSKTVYENAERVKRANAKSEQEEAAKMEFYDVVETK 494

Query: 507 VREWCQNSEDDLRELLSRFHLIVDWVDWKNVSTADLVMPKRVKIVYLKAVTKTHPDKIQD 566
           V  W  + E D+R LLS    IV WV+W +VS ADLVMPKRVKI YLKA+ K HPDKI  
Sbjct: 495 VNNWKGDKEGDIRYLLSHLTEIVTWVEWNSVSQADLVMPKRVKITYLKAIAKIHPDKIPA 554

Query: 567 SWPLERKMVAENVFVILSKAWELFKEQNKLS 597
             PLE +M+A+ VF +L+ AWE FK  N ++
Sbjct: 555 DLPLEYRMIADTVFSVLNNAWEKFKLDNNIN 585

>Skud_4.586 Chr4 complement(1042397..1044325) [1929 bp, 642 aa] {ON}
           YDR320C (REAL)
          Length = 642

 Score =  308 bits (789), Expect = 6e-96,   Method: Compositional matrix adjust.
 Identities = 201/536 (37%), Positives = 299/536 (55%), Gaps = 64/536 (11%)

Query: 97  EIKDMEIARLMSLGLSCTKATSYYERGLLYDDLLE--RKRQQRTREEAPQKTSDE----- 149
           E+KDMEIARLMSLGLS  KAT +Y   + Y+  LE  + +Q++ R+   ++ S++     
Sbjct: 136 EVKDMEIARLMSLGLSVQKATEFYNDDITYERYLEILKSKQKKHRDRIAREKSNDIKIKK 195

Query: 150 -GRF--TQGSEPDLLSVASSWLNRGRTFLD--SKLKQIQND------NGTQSYSDYISSR 198
            G F  T     +LLS+A+ + N+G+  +D  +     +N+      N     +DY  S 
Sbjct: 196 PGLFNNTDSDNNNLLSIATDFFNKGKELMDQWTSFPPEENNRLKSHLNLEDESNDYDLSL 255

Query: 199 MESSAHTGSRLRPTSDIPTNIDRSISFQDLSLADQPNESSVPAQVSPMNSEILPPLVNIG 258
            E+  ++G       D+ T+ +  I   D++     N +S P+          P      
Sbjct: 256 EENPCNSGGD-NLDEDLLTDFEAKI---DITKRASKNVASSPS----------PSF---- 297

Query: 259 DDVPV---SGPEEASAD-LLVDF--------DAPSGHDAV--SSPVAASIAMSALEFHSY 304
            D+P+   SG +E+S D  L+DF        D+   +     SS   + + +S +E   Y
Sbjct: 298 -DIPIDEDSGKKESSMDDSLLDFSPENFTKSDSTENNTLFGESSNAVSVVPISDIELSGY 356

Query: 305 QEFKEKGTLSFSAGDYHTAFQNFEKSVNSLPHSHPLRAISLSNMIICRLKLGEYRKAIED 364
            EFK KG   F  GDY  + Q +EK++NSLP +HPLR I LSN+I  +LK+GEY K+I +
Sbjct: 357 SEFKAKGATLFKNGDYVNSLQEYEKALNSLPSNHPLRIIGLSNIIASQLKVGEYSKSIVN 416

Query: 365 SSVALKLISCAK--LDDVIPASDPPKTFKEIWCKIVGNKAEAYEHIEDYDKALKEYQLLI 422
           S +AL L   AK   ++ I  SDP ++F +IW KI+  +AE++EH+E +  AL+ YQ LI
Sbjct: 417 SDLALALFPPAKASWNNKISNSDPQRSFNDIWPKIMIRRAESFEHLESFKNALETYQELI 476

Query: 423 KRGAASRKVMEGRRRCQKIVEPEKFVQRSKTPLS-TSPSVSRKDVAVAATSQVPSEKLER 481
            R     K+M+G+RRCQ  + P   + R  TP+  T+P++ +        S  P +   +
Sbjct: 477 SRNFFDDKIMQGKRRCQNFISPP--LVRKSTPVKKTTPTLKK---PAPDPSPAPIDIPSK 531

Query: 482 VQNINKKEKELERQKFLLHDKVQDRVREWCQNSEDDLRELLSRFHLIVDWVDWKNVSTAD 541
           V     KE+ELE  K  L+DKV  ++  W    EDD+R LLS    ++ W +WK+VS  D
Sbjct: 532 V-----KEQELENAKLALYDKVFGKIGTWKGGKEDDIRHLLSNLSQLLTWCNWKDVSMQD 586

Query: 542 LVMPKRVKIVYLKAVTKTHPDKIQDSWPLERKMVAENVFVILSKAWELFKEQNKLS 597
           LVMPK+VKI Y+KAV KTHPDKI +S  LE KM+AEN+F  LS AW+ FK+QN ++
Sbjct: 587 LVMPKKVKIAYMKAVAKTHPDKIPESLSLENKMIAENIFSTLSIAWDKFKQQNDIN 642

>Smik_4.579 Chr4 complement(1032558..1034561) [2004 bp, 667 aa] {ON}
           YDR320C (REAL)
          Length = 667

 Score =  309 bits (791), Expect = 6e-96,   Method: Compositional matrix adjust.
 Identities = 216/624 (34%), Positives = 330/624 (52%), Gaps = 77/624 (12%)

Query: 19  SQNGIAKAKSPRIETSPGINYSDDSRNGTDLDEIFGFEKQANSAPAVXXXXXXXXXXXXX 78
           S N    A S      P +++ DD     D +E+FG     N   A              
Sbjct: 76  SSNNTISANSTNSSPRPPLDHIDD-----DFNELFG-----NGTTAATDTLQKVNDDYCR 125

Query: 79  XXXXXQNHMDPEPQPLVDEIKDMEIARLMSLGLSCTKATSYYERGLLYDDLL------ER 132
                +++ D   + LVDE+KDMEIARLMSLGLS  KAT +Y   + Y+  L      ++
Sbjct: 126 NNEGRKSNGD---EALVDEVKDMEIARLMSLGLSIEKATKFYNDDITYERYLKVLKSNQK 182

Query: 133 KRQQRTREEAPQKTS---DEGRFTQGSEPD-LLSVASSWLNRGRTFLDS-------KLKQ 181
           K + RT  E+P   +    E     GSE + L S+A+++ N+G+  +D        +  +
Sbjct: 183 KSKDRTARESPGDVNFERSELSNNFGSENNNLFSIATNFFNKGKELVDQWTSFPPEENDR 242

Query: 182 IQNDNGTQSYSDYISSRMESSAHTG-------------SRLRPTSDIPTNIDRSISFQDL 228
           + N    ++ S+   S +E+  + G             S      D+ T+ +  I     
Sbjct: 243 LNNHPNLRNKSEDYDSPLENDPYNGFSIEDDKSEKGLLSENNLDEDLLTDFETKIEITKR 302

Query: 229 SLAD---QPNESS-VPAQVSPMNSEILPPLV--NIGD----DVPVSGPEEASADLLVDFD 278
           +++D    P+ SS +  + +P+  E   PLV  N+ D    +V  S   E++        
Sbjct: 303 TVSDVDPSPSPSSGILIEENPLRKE---PLVENNLLDFSEGNVTKSNSSESN-------- 351

Query: 279 APSGHDAVSSPVAASIAMSALEFHSYQEFKEKGTLSFSAGDYHTAFQNFEKSVNSLPHSH 338
             S  +   +P +A I +S +E   Y EFK KG+  F  GDY  + Q +EKS+NSLP +H
Sbjct: 352 --SLFNGNRNPNSA-IPISDIELSGYNEFKAKGSNFFKNGDYVNSLQEYEKSLNSLPSNH 408

Query: 339 PLRAISLSNMIICRLKLGEYRKAIEDSSVALKLISCAKLD--DVIPASDPPKTFKEIWCK 396
           PLR I+LSN+I  +LK+GEY K+IE+SS+AL L    K +  ++I  SDP ++F +IW K
Sbjct: 409 PLRIIALSNIIASQLKVGEYSKSIENSSMALALFPPTKANWSNMISDSDPQRSFNDIWPK 468

Query: 397 IVGNKAEAYEHIEDYDKALKEYQLLIKRGAASRKVMEGRRRCQKIVEP---EKFVQRSKT 453
           I+  +AE++EH+E +  AL+ YQ LI +     K+M+G+RRCQ  + P   +KF    K 
Sbjct: 469 IMIRRAESFEHLESFSNALETYQELINKNFFDEKIMQGKRRCQNFINPPPVKKFSPVKKA 528

Query: 454 PLSTSPSVSRKDVAVAATSQVPSEKLERVQNINKKEKELERQKFLLHDKVQDRVREWCQN 513
             + SP+      + ++TS    +   ++     K++ELE  K  L+DKV +R+  W  +
Sbjct: 529 TSTQSPTEKSTPTSSSSTSSNSPDTTSKI-----KKQELENAKLALYDKVFERISSWKND 583

Query: 514 SEDDLRELLSRFHLIVDWVDWKNVSTADLVMPKRVKIVYLKAVTKTHPDKIQDSWPLERK 573
             DD+R LL+    ++ W +WK++   DLVMPKRVKI Y+KAV KTHPDKI +S  LE K
Sbjct: 584 KGDDIRHLLANLSGLLTWCNWKDIPMQDLVMPKRVKITYMKAVAKTHPDKIPESLSLENK 643

Query: 574 MVAENVFVILSKAWELFKEQNKLS 597
           M+AENVF  LS AW+ FK+QN ++
Sbjct: 644 MIAENVFSSLSIAWDKFKQQNDIN 667

>KAFR0C01850 Chr3 (369596..371536) [1941 bp, 646 aa] {ON} Anc_5.352
           YDR320C
          Length = 646

 Score =  301 bits (772), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 195/537 (36%), Positives = 289/537 (53%), Gaps = 47/537 (8%)

Query: 94  LVDEIKDMEIARLMSLGLSCTKATSYYERGLLYDDLL---ERKRQ-QRTREEAPQKTSDE 149
           +VDE+KDMEIA+LMSLGLS  KA SYY +G+ YD LL   ER+R   R   + P    + 
Sbjct: 124 VVDEVKDMEIAQLMSLGLSIEKANSYYSKGISYDTLLKKLERRRYGSRKGRDTPTFGGNT 183

Query: 150 GR--------FTQGSEPDLLSVASSWLNRGRTFLDSKLKQIQNDNGTQSYSDYISSRMES 201
            +        F      +L S+AS   N+G+ F+D      +  +    Y D IS   E 
Sbjct: 184 NKDDKAYAKLFDSSENTNLFSMASGLFNKGKEFIDQMTAYPEETDRLSRYRD-IS---EI 239

Query: 202 SAHTGSRLRPTSDIPTNIDRSISFQDLSLADQPNESSVPAQVSPMNSEILPPLVNIGDDV 261
           S+    R  P      ++DR    QD      P       Q SP  S  L  L N  +++
Sbjct: 240 SSMKPLRKSPGIVDGFDMDRISQHQDTDKGKAPTREV--QQESPPPSHDL--LDNFQNNL 295

Query: 262 PVSGPEE--ASADLLVDFDAPSG-----------------HDAVSSPVAASIAMSALEFH 302
            +   +E  +   +L+D D                      + + +     I +S++E  
Sbjct: 296 KLDDNKEELSKESVLLDIDNDDSTLLKSKSLTSDSLLFQDENVLENSNIPKIPISSIELS 355

Query: 303 SYQEFKEKGTLSFSAGDYHTAFQNFEKSVNSLPHSHPLRAISLSNMIICRLKLGEYRKAI 362
            Y E+  +G+  F  GDY +A + +EKS+N+LP SHPLR I+ SN+    LK+GEY   +
Sbjct: 356 GYNEYNSRGSSFFKNGDYISALEEYEKSLNTLPQSHPLRIIAYSNITAAELKIGEYSNLV 415

Query: 363 EDSSVALKLISCAKL--DDVIPASDPPKTFKEIWCKIVGNKAEAYEHIEDYDKALKEYQL 420
           + +  ALKL     L  + +I  S+P K++K+IW K+V  KAEA EH+E+++ A K+Y  
Sbjct: 416 KKADKALKLFPKENLKWNLIIQDSEPHKSYKDIWSKLVLRKAEALEHLENFELAYKQYHS 475

Query: 421 LIKRGAASRKVMEGRRRCQKIVEPEKFVQRSKTPLSTSPSVSRKDVAVAATSQVPSEKLE 480
           LI+    S K+M+G+RRCQK++ PE   +  + P S+ P+      AV   S    E +E
Sbjct: 476 LIENNVFSDKIMDGKRRCQKVLNPEIAKKTQQKPSSSKPA------AVPTPSTQKYESVE 529

Query: 481 RVQNINKKEKELERQKFLLHDKVQDRVREWCQNSEDDLRELLSRFHLIVDWVDWKNVSTA 540
           R++  N++E+E E +K  L+D V+ ++  W  N  +D+R LL+    I+ W +WK +S  
Sbjct: 530 RIKEQNRQEEENEAEKLKLYDIVEAKINAWKSNKPEDIRHLLANLPTILTWTEWKPISVN 589

Query: 541 DLVMPKRVKIVYLKAVTKTHPDKIQDSWPLERKMVAENVFVILSKAWELFKEQNKLS 597
           DLVMPK+VK+ YLKA+ KTHPDKI  S  LE KM+AEN F  LS AW+ FKE+N ++
Sbjct: 590 DLVMPKKVKVTYLKAIAKTHPDKISSSLNLESKMIAENAFSTLSVAWDKFKEENNMN 646

>Kpol_339.13 s339 complement(21257..23317) [2061 bp, 686 aa] {ON}
           complement(21257..23317) [2061 nt, 687 aa]
          Length = 686

 Score =  289 bits (740), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 172/463 (37%), Positives = 264/463 (57%), Gaps = 41/463 (8%)

Query: 146 TSDEGRFTQGSEPDLLSVASSWLNRGRTFLDSKLKQIQNDNGTQSYSDYISSRMESSAHT 205
           TSDE  F Q S  D   +ASS             K    D+ T++Y D  +S    +   
Sbjct: 254 TSDENPFNQQSRYD---IASS-------------KTTSTDSQTRNYHDKKTSINNKAHER 297

Query: 206 GSRLRPTSDIPTNIDR-SISFQDLSLADQ------PNESSVPAQVSPMNSEILPPLVNIG 258
            ++  P ++ P N+D  +  F  + L+ +       N     ++ +     I  P+VN+ 
Sbjct: 298 IAKETPINNQPANLDLLNDDFISIKLSSENVSTNLTNLEQAKSKQATSKQAISKPIVNVA 357

Query: 259 DDVPVSGPEEASADLLVDFDAPSGHDAVSSPVAA--SIAMSALEFHSYQEFKEKGTLSFS 316
                      + + L+DFD+P+   AV SP A+   + +S +E   Y+EFKE+GT +F 
Sbjct: 358 ---------PKANNTLLDFDSPTT--AVHSPAASLPKVPISEIELLGYKEFKERGTENFK 406

Query: 317 AGDYHTAFQNFEKSVNSLPHSHPLRAISLSNMIICRLKLGEYRKAIEDSSVALKLISC-- 374
            GDY TA + ++KS+N+LP  HPLR I+ SN++    K GEYRK+IE S+ AL+      
Sbjct: 407 TGDYVTALEAYQKSLNTLPIKHPLRIIASSNILASMSKTGEYRKSIEISTSALEQFPGDQ 466

Query: 375 AKLDDVIPASDPPKTFKEIWCKIVGNKAEAYEHIEDYDKALKEYQLLIKRGAASRKVMEG 434
            + ++ I  S+P +T+K+IW KIV  +AEA+EHIE Y+ AL+ YQ +I++   + KVM G
Sbjct: 467 KQWNEFIQDSEPQRTYKDIWPKIVLKRAEAFEHIESYENALETYQQMIEKNFFNDKVMSG 526

Query: 435 RRRCQKIVEPEKFVQRSKTPLSTSPSVSRKDVAVAATSQVPSEKLERVQNINKKEKELER 494
           +RRCQ ++ P   V+ +K+  S  P  +       +      E +E+++  NK E E+E 
Sbjct: 527 KRRCQHVINP---VKPTKSNSSALPRQTNTKPKKESNQNKAYENVEKLKQKNKLEAEIES 583

Query: 495 QKFLLHDKVQDRVREWCQNSEDDLRELLSRFHLIVDWVDWKNVSTADLVMPKRVKIVYLK 554
           Q+  L+D V+ ++ +W  N +DD+R LLS   LI+ W +W  V  +DLVMPK+VKI Y+K
Sbjct: 584 QRLALYDSVEAQINKWKANKDDDIRHLLSNLQLILTWGNWNPVPPSDLVMPKKVKITYMK 643

Query: 555 AVTKTHPDKIQDSWPLERKMVAENVFVILSKAWELFKEQNKLS 597
           AV +THPDKI     LE+KM+AEN+F +LSKAWE FK+ N ++
Sbjct: 644 AVARTHPDKIPSDLELEKKMIAENIFSVLSKAWEKFKKDNNMN 686

 Score = 61.6 bits (148), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 48/71 (67%), Gaps = 3/71 (4%)

Query: 89  PEPQPLV-DEIKDMEIARLMSLGLSCTKATSYYERGLLYDDLLERKRQQRTREEAPQKTS 147
           PE Q +V DE+KDMEIA+LMSLGL   +AT++Y+ G+LY+ L+ + R   +R  A  + +
Sbjct: 126 PEVQDIVVDEVKDMEIAKLMSLGLDIDEATTHYDNGILYETLVSKIRTSNSRITA--QRN 183

Query: 148 DEGRFTQGSEP 158
           D GR    +EP
Sbjct: 184 DSGRNDIRAEP 194

>CAGL0H07095g Chr8 (700262..702247) [1986 bp, 661 aa] {ON} similar
           to uniprot|Q06677 Saccharomyces cerevisiae YDR320c SWA2
          Length = 661

 Score =  284 bits (727), Expect = 9e-87,   Method: Compositional matrix adjust.
 Identities = 190/544 (34%), Positives = 301/544 (55%), Gaps = 52/544 (9%)

Query: 94  LVDEIKDMEIARLMSLGLSCTKATSYYERGLLYDDLLERKRQQRTREEAPQKTSDEGRFT 153
           ++DE++DME+A+LMSLGL+  KA+SYYERG+ ++D+L RKR+Q+      Q+++ + +  
Sbjct: 130 VIDEVRDMELAKLMSLGLNIDKASSYYERGITFEDVL-RKRKQKASNGYQQRSNIDRKQG 188

Query: 154 QGSEPDLL--------SVASSWLNRGRTFLD--SKLKQIQND--NGTQSYSDYISSRM-- 199
            G   ++         S+ S  LN+G+  ++  S   + +N+  N  + Y +Y  S    
Sbjct: 189 GGEIRNIFDTRGSGSESLFSGILNKGKELVNQLSTYTEEENERMNKFKGYEEYSMSETYL 248

Query: 200 --ESSAHTGSRLRPTSD-IPTNIDRSISFQDLSLADQPNES-SVPAQVSPMNSEILPPLV 255
             E+S   G   R + + IP    R    +  S   + N+  +  A   P N +    L+
Sbjct: 249 EKENSMDPGVFSRSSQEKIPQRAARPSHEKSNSSRSKINKRMTTEAPHKPFNDDDQSSLI 308

Query: 256 NIGDDVPVSG-PEEASADLLVDFDAPSGHDAVSSPVAAS----------IAMSALEFHSY 304
              D    S  P E +   L+DFD     +  SSPV  +          I +S +E   Y
Sbjct: 309 ESKDSSRESSMPGEGT---LLDFD---NDNHASSPVVNTSNQNTVSITQIPISHIEISGY 362

Query: 305 QEFKEKGTLSFSAGDYHTAFQNFEKSVNSLPHSHPLRAISLSNMIICRLKLGEYRKAIED 364
            EFK +GT  F  GDY +A + +EKS+N+LP  HPLR I+ SN+I  R+K+G++ +++ D
Sbjct: 363 NEFKARGTDYFKNGDYASAVEEYEKSLNTLPMKHPLRIIAYSNIIASRIKIGQHSQSVVD 422

Query: 365 SSVALKLISCAK--LDDVIPASDPPKTFKEIWCKIVGNKAEAYEHIEDYDKALKEYQLLI 422
           +  A+KL+   K      I  SDP +++ +IW KI+  +AE+YE IE Y  AL  YQ L+
Sbjct: 423 AQEAMKLLPEEKSLWTAAIQNSDPVRSYNDIWPKIILRQAESYEAIEKYKLALDAYQTLL 482

Query: 423 KRGAASRKVMEGRRRCQKIV---------EPEKFVQRSKTPLSTSPSVSRKDVAVAATSQ 473
           ++   S KV+ G+RRCQ  +          P K    +  P   +P+V+R+   V   S 
Sbjct: 483 EKNLFSEKVIAGKRRCQHALGLDSKPKSNPPSKSATPAPAP-RRAPTVNRQTEVVNKKS- 540

Query: 474 VPSEKLERVQNINKKEKELERQKFLLHDKVQDRVREWCQNSEDDLRELLSRFHLIVDWVD 533
           V +EKL++    N++  +LE QK  L+DKV+  +  W    +DD+R LLS    ++ W  
Sbjct: 541 VNAEKLKKE---NERLAKLEDQKVALYDKVEGIINSWKNGKQDDIRYLLSNLQAVITWTQ 597

Query: 534 WKNVSTADLVMPKRVKIVYLKAVTKTHPDKIQDSWPLERKMVAENVFVILSKAWELFKEQ 593
           WK V +++LV+P++VKI Y+KAV K HPDK+  S  LE++M+AE+VF  LS +WE FK+ 
Sbjct: 598 WKPVQSSELVLPRKVKITYMKAVAKLHPDKLPSSLTLEQQMIAESVFSTLSDSWENFKKS 657

Query: 594 NKLS 597
           N ++
Sbjct: 658 NDIN 661

>NCAS0F02870 Chr6 complement(573068..575170) [2103 bp, 700 aa] {ON}
           Anc_5.352 YDR320C
          Length = 700

 Score =  280 bits (716), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 149/344 (43%), Positives = 215/344 (62%), Gaps = 22/344 (6%)

Query: 274 LVDFDAPSGHDAVSSPVAAS--------------IAMSALEFHSYQEFKEKGTLSFSAGD 319
           L+DFD  S  +A ++P                  I +S +E   Y EF+ +GT  F  GD
Sbjct: 359 LLDFDDDSSFNASNTPFVNGNNNINNNVNSSLPVIPISHIELSGYAEFRNRGTQYFKNGD 418

Query: 320 YHTAFQNFEKSVNSLPHSHPLRAISLSNMIICRLKLGEYRKAIEDSSVALKLI--SCAKL 377
           Y ++FQ +EKS+N+LP +HPLR I+ SN+I   LK+GEY K++++SS AL++     A+ 
Sbjct: 419 YVSSFQEYEKSLNTLPVNHPLRIIAYSNIIASELKIGEYSKSLKNSSSALEMFPDDTAQW 478

Query: 378 DDVIPASDPPKTFKEIWCKIVGNKAEAYEHIEDYDKALKEYQLLIKRGAASRKVMEGRRR 437
             VI  SDP +T+K+IW K+   +AEA EHIE +  AL  YQ LI++G A+ K+M+G+RR
Sbjct: 479 TAVIQDSDPQRTYKDIWPKVKLRQAEALEHIESFKAALSSYQELIEKGFANDKIMDGKRR 538

Query: 438 CQKIVEPEKFVQRSKTPLST---SPS-VSRKDVAVAATSQVPSEKLERVQNINKKEKELE 493
           CQK++ P          +ST   SPS V RK  A + +     E +ER++  N   +E+E
Sbjct: 539 CQKVLNPTPPPVVKTPRISTPKQSPSPVPRK--ATSNSKDAVYESVERLKKENATSQEVE 596

Query: 494 RQKFLLHDKVQDRVREWCQNSEDDLRELLSRFHLIVDWVDWKNVSTADLVMPKRVKIVYL 553
           +QK  L+DKV  +V  W    + D+R LL+   +++ W DWK V+ +DLVMPK+VKI Y+
Sbjct: 597 KQKLALYDKVFAKVETWKNRKDTDIRHLLANLSIVLTWCDWKPVAASDLVMPKKVKITYM 656

Query: 554 KAVTKTHPDKIQDSWPLERKMVAENVFVILSKAWELFKEQNKLS 597
           KAV KTHPDK+ +S  LE KM+AENVF +LS AW+ FK +N +S
Sbjct: 657 KAVAKTHPDKVPESLELENKMIAENVFSVLSVAWDKFKIENNMS 700

>Ecym_8181 Chr8 (377372..379357) [1986 bp, 661 aa] {ON} similar to
           Ashbya gossypii AGR352C
          Length = 661

 Score =  278 bits (710), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 183/546 (33%), Positives = 286/546 (52%), Gaps = 52/546 (9%)

Query: 93  PLVDEIKDMEIARLMSLGLSCTKATSYYERGLLYDDLLE-----RKRQQRTREEAPQKT- 146
           PL++ +  ME   + + G+S   A S Y++GL Y D  E     +K QQR    A Q++ 
Sbjct: 127 PLLEGVHGMESEPINARGISTEDANSCYDQGLFYIDAQEVLQNGKKFQQRNGFTAGQRSD 186

Query: 147 SDEGR-FT---QGSEPDLLSVASSWLNRGRTFLDSKLKQIQNDNGTQ-----SYSDYISS 197
           SD  R FT      E +L+S AS+   +GR  +++K+ +   + G +      +  + S 
Sbjct: 187 SDNDRVFTFRKDNEEENLISFASNLFTKGRDLVENKINKTFENIGNRRSTPFEFKLFSSE 246

Query: 198 RMESSAHTGSRLRPTSDIPTNIDR-SISFQDLSL---------------ADQPNESSVPA 241
              S +HT       S   +N D  S  F  LS+               AD  + + +  
Sbjct: 247 NTNSRSHTNKYEPELSRDSSNSDYISKKFDGLSVDEDKGNPCLNKEENYADLLSHAFLDT 306

Query: 242 QVSPMNSEILPPLVNIGDDVPVSGPEEASADLLVDFDAPSGHDAVSSPVAASIAMSALEF 301
             +     I     N+     +   E+     L+DFD        S   +  + +S +E 
Sbjct: 307 GDTEAKDRIWGQSQNVHSQESLYSAEDGK---LIDFDTEEAPPPASKVSSHYVPISQIEM 363

Query: 302 HSYQEFKEKGTLSFSAGDYHTAFQNFEKSVNSLPHSHPLRAISLSNMIICRLKLGEYRKA 361
             YQEF   G   F  GDYH A Q + KS+N+LP  HPLR ++ SN+I  +LK+GE+ ++
Sbjct: 364 SGYQEFNINGKQYFRNGDYHNAHQQYIKSLNTLPVGHPLRIVAYSNIITTQLKIGEHTES 423

Query: 362 IEDSSVALKLISCAKLDDVIPASDPPKTFKEIWCKIVGNKAEAYEHIEDYDKALKEYQLL 421
           +++   A  L+  + LD +I  ++PPKT+KE W KI+  KAE  E++E YD+AL  Y+ L
Sbjct: 424 LKNIEKACDLLDGSSLDGIIQGTNPPKTYKEFWNKIISKKAEVLEYLEHYDEALAVYRCL 483

Query: 422 IKRGAASRKVMEGRRRCQK----IVEPEKF------VQRSKTPLSTSPSVSRKDVAVAAT 471
           I +G   +K++EG+ RCQK      EP         VQ+ K P S + S+  +       
Sbjct: 484 ISKGVFDKKIIEGKTRCQKHSKITSEPATEDSALAPVQKDKVPKSNNSSIPER------- 536

Query: 472 SQVPSEKLERVQNINKKEKELERQKFLLHDKVQDRVREWCQNSEDDLRELLSRFHLIVDW 531
            ++ S+K E +    ++ KELE+QKF LHDKV  +++ W    E DLR LLSR  L++ W
Sbjct: 537 -RIRSQKAEELIKKRQEMKELEKQKFRLHDKVHSKIQSWIDGKETDLRHLLSRLSLVLTW 595

Query: 532 VDWKNVSTADLVMPKRVKIVYLKAVTKTHPDKIQDSWPLERKMVAENVFVILSKAWELFK 591
            +W ++   DLV+PK+VKI+Y+KA++K HPDK+  +  LE KM+AE++F +L  AW +FK
Sbjct: 596 TNWNHIGANDLVIPKKVKIIYMKAISKVHPDKVPSTLDLESKMLAEDIFSVLGNAWNVFK 655

Query: 592 EQNKLS 597
             N ++
Sbjct: 656 LNNDIN 661

>Suva_2.489 Chr2 complement(863483..865462) [1980 bp, 659 aa] {ON}
           YDR320C (REAL)
          Length = 659

 Score =  272 bits (695), Expect = 5e-82,   Method: Compositional matrix adjust.
 Identities = 144/322 (44%), Positives = 199/322 (61%), Gaps = 13/322 (4%)

Query: 279 APSGHDAVSSPVAASIAMSALEFHSYQEFKEKGTLSFSAGDYHTAFQNFEKSVNSLPHSH 338
           A S  D  ++PVA    +S +E   Y EFK KGT  F  GDY  + Q +EKS+NSLP  H
Sbjct: 348 AISREDGNTNPVAP---ISDIELSGYNEFKAKGTSLFKNGDYVNSLQEYEKSLNSLPLKH 404

Query: 339 PLRAISLSNMIICRLKLGEYRKAIEDSSVALKLISCAK--LDDVIPASDPPKTFKEIWCK 396
           PLR I+LSN+I  +LK+GEY K+IE+S  AL L    K   +D I  SDP +++ +IW K
Sbjct: 405 PLRIIALSNIIASQLKIGEYSKSIENSDTALALFPANKSSWNDKISKSDPQRSYNDIWPK 464

Query: 397 IVGNKAEAYEHIEDYDKALKEYQLLIKRGAASRKVMEGRRRCQKIVEPEKFVQRSKTPLS 456
           I+  +AE++EH+E +  AL+ YQ L+ R     K+M+G+RRCQ  V P     R  +P+ 
Sbjct: 465 IMIRRAESFEHLESFKNALETYQELVTRNFFDDKIMQGKRRCQDFVNPAP--ARKPSPVK 522

Query: 457 -TSPSVSRKDVAVAATSQVPSEKLERVQNINKKEKELERQKFLLHDKVQDRVREWCQNSE 515
            T+P+ +      +  S  P +   RV     KE+ELE  K  L+D V D++  W    +
Sbjct: 523 KTTPTPAPMKKPTSTPSPAPVDNASRV-----KEQELENAKLALYDNVSDKIGCWKCGKD 577

Query: 516 DDLRELLSRFHLIVDWVDWKNVSTADLVMPKRVKIVYLKAVTKTHPDKIQDSWPLERKMV 575
           DD+R LL+    ++ W +WK+VS  +LVMPK+VKI Y+KAV KTHPDKI  S  LE KM+
Sbjct: 578 DDIRHLLANLSGLLTWCNWKDVSVQELVMPKKVKITYMKAVAKTHPDKIPKSLSLENKMI 637

Query: 576 AENVFVILSKAWELFKEQNKLS 597
           AENVF  LS AW+ FK+QN ++
Sbjct: 638 AENVFTTLSFAWDKFKQQNDIN 659

>AGR352C Chr7 complement(1383723..1385669) [1947 bp, 648 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR320C
           (SWA2)
          Length = 648

 Score =  271 bits (694), Expect = 6e-82,   Method: Compositional matrix adjust.
 Identities = 188/560 (33%), Positives = 285/560 (50%), Gaps = 86/560 (15%)

Query: 94  LVDEIKDMEIARLMSLGLSCTKATSYYERGLLYDDLLERK------RQQR---------- 137
           + DE +D E+A+LMSLGL    A  YY RG  Y+ L  R+      R  R          
Sbjct: 119 IADEEQDFELAKLMSLGLDIGAANDYYHRGGRYEQLRMRRAESDGTRMHRGSNLGRNSDF 178

Query: 138 TREEAPQKTSDEGR---FTQGSEPD--------------------LLSVASSWLNRGRTF 174
            R     + SD GR   F +GS+                      L+S AS+  NRGR F
Sbjct: 179 CRSRDFGRGSDLGRSGDFERGSDLGRAESSETPQWSSLRSGHSNRLVSAASNLFNRGRDF 238

Query: 175 LDSKL----------KQIQND------NGTQSYSDYISSRMESSAHTGSRLRPTSDIPTN 218
           ++ +L          +   +D      N TQ  SDY  ++    AH    L  T      
Sbjct: 239 IEDQLATHARTSASSRSTLSDSNERFSNHTQE-SDYSVNQTNDQAH----LIHTQPTAAE 293

Query: 219 IDRSISFQDLSLADQPNESSVP-AQVSPMNSEILPPLVNIGDDVPVSGPEEASADLLVDF 277
           +D    F D  +    +   VP  Q + + SE    L+    D    GP +++A L    
Sbjct: 294 VDLLEGFADTEVVQHQSTLEVPRMQAAGVKSE--ESLI----DFSSEGPSKSAAQLNY-- 345

Query: 278 DAPSGHDAVSSPVAASIAMSALEFHSYQEFKEKGTLSFSAGDYHTAFQNFEKSVNSLPHS 337
                           ++++ LE   Y +F +    S+  GDYH AFQ++ KS+N+LP +
Sbjct: 346 ----------------VSITPLELSGYYDFNKTAAESYKKGDYHAAFQDYLKSLNTLPLA 389

Query: 338 HPLRAISLSNMIICRLKLGEYRKAIEDSSVALKLISCAKLDDVIPASDPPKTFKEIWCKI 397
           HPLR I+LSN+I  +LK+GE+ +++++ + A++L+     D  I  + PP+T+KE W KI
Sbjct: 390 HPLRIIALSNIITTQLKIGEHTESMKNINSAVELLQDVPFDAQIQDTSPPRTYKEFWQKI 449

Query: 398 VGNKAEAYEHIEDYDKALKEYQLLIKRGAASRKVMEGRRRCQKIVEPEKFVQRSKTPLST 457
           +  KAE  E  ++Y+ AL  YQ LI RG   + ++ G+ RCQK    +K    S  P +T
Sbjct: 450 LAKKAEVLESQDNYEAALSVYQQLISRGYTPKLILNGKARCQKACNSQK-GNVSSNPTAT 508

Query: 458 SPSVSRKDVAVAATSQVPSEKLERVQNINKKEKELERQKFLLHDKVQDRVREWCQNSEDD 517
           +    +      AT++  +E+++R++  N   ++ E ++F LHDKV+ R+R W      D
Sbjct: 509 TQGDRKNPRKQTATAKGKTEEVKRLKAQNHAIEKQENERFGLHDKVESRIRTWTAGKSTD 568

Query: 518 LRELLSRFHLIVDWVDWKNVSTADLVMPKRVKIVYLKAVTKTHPDKIQDSWPLERKMVAE 577
           LR LL     ++ W++   +  +DLVMPKRVK+ YLKAV+KTHPDK+  +  LE KMVAE
Sbjct: 569 LRHLLLGLPALLPWLNSDQMIASDLVMPKRVKLSYLKAVSKTHPDKLPQTLELEEKMVAE 628

Query: 578 NVFVILSKAWELFKEQNKLS 597
           +VF+ L+KAW +FKE+N LS
Sbjct: 629 HVFITLTKAWGVFKEENSLS 648

>TPHA0E01110 Chr5 (228116..230197) [2082 bp, 693 aa] {ON} Anc_5.352
           YDR320C
          Length = 693

 Score =  267 bits (682), Expect = 8e-80,   Method: Compositional matrix adjust.
 Identities = 144/345 (41%), Positives = 207/345 (60%), Gaps = 18/345 (5%)

Query: 267 EEASADLLVDFDAPSGHDAVSSPVAASIAMSA-----------LEFHSYQEFKEKGTLSF 315
           E    + L+DF    G++ +SSP   SI+ S            +E   Y EFK++GT  F
Sbjct: 353 ERIQDNTLLDF----GNEDLSSPANVSISSSGQECIPVISINQIELSGYNEFKDRGTEYF 408

Query: 316 SAGDYHTAFQNFEKSVNSLPHSHPLRAISLSNMIICRLKLGEYRKAIEDSSVALKLI-SC 374
             GDY +A + +EKS+NSL   HPLR I+ SN++   LK G+Y   I  S+ AL L    
Sbjct: 409 KKGDYVSATEQYEKSLNSLSKLHPLRIIASSNLLASLLKTGDYTSMITISTSALDLFPKE 468

Query: 375 AKL-DDVIPASDPPKTFKEIWCKIVGNKAEAYEHIEDYDKALKEYQLLIKRGAASRKVME 433
           +KL D+VI  S+P KT+KEIW K+V  +AEA+E IE+Y +A   YQLLI+    + K+M 
Sbjct: 469 SKLWDNVIQNSEPSKTYKEIWSKLVARRAEAFEFIENYQQAYDSYQLLIENNIFNEKIMA 528

Query: 434 GRRRCQKIVEPEKFVQRSKTPLSTSPSV-SRKDVAVAATSQVPSEKLERVQNINKKEKEL 492
           G+ RCQK++ PE   +  K  ++T+    + +   +  T    S  L+++Q  NK+ ++ 
Sbjct: 529 GKLRCQKVLNPETHNKPLKKLVATTAETKTSQTKNIVNTQSTSSGNLKKIQEQNKRTEKY 588

Query: 493 ERQKFLLHDKVQDRVREWCQNSEDDLRELLSRFHLIVDWVDWKNVSTADLVMPKRVKIVY 552
           E +K  L+D V+ +V  W    +DD+R LLSR   I+ W  W  V+++DLVMPK+VKI Y
Sbjct: 589 EEEKEALYDVVEQKVNAWIAGKDDDIRHLLSRLQRIITWTQWNEVASSDLVMPKKVKITY 648

Query: 553 LKAVTKTHPDKIQDSWPLERKMVAENVFVILSKAWELFKEQNKLS 597
           LKAV KTHPDK+  +   E +M+AEN+F ILSK WE FK  N +S
Sbjct: 649 LKAVAKTHPDKLPSNLDTESRMLAENIFSILSKNWEKFKVDNNIS 693

>TBLA0H01970 Chr8 (464239..466761) [2523 bp, 840 aa] {ON} Anc_5.352
           YDR320C
          Length = 840

 Score =  262 bits (670), Expect = 6e-77,   Method: Compositional matrix adjust.
 Identities = 137/316 (43%), Positives = 202/316 (63%), Gaps = 4/316 (1%)

Query: 284 DAVSSPVAASIAMSALEFHSYQEFKEKGTLSFSAGDYHTAFQNFEKSVNSLPHSHPLRAI 343
           D V++     + +S +E   Y EF+  GT  F  GDY +A   ++KS+N+LP  HPLR I
Sbjct: 526 DLVNTLPIVKVPISTIELSGYTEFRANGTEFFKKGDYDSALSEYKKSLNTLPQKHPLRLI 585

Query: 344 SLSNMIICRLKLGEYRKAIEDSSVALKLI--SCAKLDDVIPASDPPKTFKEIWCKIVGNK 401
           S SN++  +LK+GEY ++++D  VAL+L   +  +    I  SDP KT+KEIW KIV  K
Sbjct: 586 SYSNILAAQLKVGEYSQSVKDCDVALELFPKNDKQWTQFIQDSDPQKTYKEIWPKIVLRK 645

Query: 402 AEAYEHIEDYDKALKEYQLLIKRGAASRKVMEGRRRCQKIVEPEKFVQRSKTPLSTSPSV 461
           AEA EH+E Y  A   YQLL+ +   + K+M G+RRCQK++ PE    + K+  +TS   
Sbjct: 646 AEACEHMEKYQIAYDSYQLLLHKNVFNDKIMAGKRRCQKVLNPE--TPKLKSSANTSRIS 703

Query: 462 SRKDVAVAATSQVPSEKLERVQNINKKEKELERQKFLLHDKVQDRVREWCQNSEDDLREL 521
           S K    + +S   ++ +ER++   KKE+E E ++  L D V  ++++W  N EDD+R L
Sbjct: 704 SAKQSTASTSSINVNKNVERLKETRKKEREEEEERLRLLDSVNAKIQKWTNNKEDDIRYL 763

Query: 522 LSRFHLIVDWVDWKNVSTADLVMPKRVKIVYLKAVTKTHPDKIQDSWPLERKMVAENVFV 581
           LS  H+++ W +WK ++ +DLVMPK+VK+ Y+KAV KTHPDKI     +E KM+AE++F 
Sbjct: 764 LSNVHIVLTWSNWKAINASDLVMPKKVKVNYMKAVAKTHPDKISKDLSIENKMIAESIFS 823

Query: 582 ILSKAWELFKEQNKLS 597
           ILS AWE FK  NK++
Sbjct: 824 ILSVAWEKFKTANKMN 839

 Score = 69.3 bits (168), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 57/97 (58%), Gaps = 12/97 (12%)

Query: 92  QPLVDEIKDMEIARLMSLGLSCTKATSYYERGLLYDDLLERKRQQRTREEAPQKTS-DEG 150
           Q +VDE+KDMEIA+LMSLGLS  KA  YY +G L DD+L + + Q+ + ++   T  D+ 
Sbjct: 214 QSVVDEVKDMEIAKLMSLGLSIDKAHMYYNKGYLSDDVLRKMQAQKHKRQSNYSTKYDDT 273

Query: 151 RF--------TQGSEPD---LLSVASSWLNRGRTFLD 176
           +            S P    L S+AS +LN+G+  +D
Sbjct: 274 KIRNSLDKLNNSASPPGNNVLFSIASDFLNKGKGIVD 310

>Kwal_55.19935 s55 (182767..184548) [1782 bp, 593 aa] {ON} YOR027W
           (STI1) - Heat shock protein also induced by canavanine
           and entry into stationary phase [contig 159] FULL
          Length = 593

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 34/138 (24%), Positives = 61/138 (44%), Gaps = 22/138 (15%)

Query: 303 SYQEFKEKGTLSFSAGDYHTAFQNFEKSVNSLPHSHPLRAISLSNMIICRLKLGEYRKAI 362
           S +EFK++G  +F A D+  A + F K++ S   S     +  SN   C   L ++++A+
Sbjct: 2   SAEEFKKQGNAAFVAKDFEKAAELFSKAIES---SETPNHVLYSNRSACYTSLKKFKEAL 58

Query: 363 EDSSVALKLISCAKLDDVIPASDPPKTFKEIWCKIVGNKAEAYEHIEDYDKALKEYQLLI 422
           ED+        C K++               W K       A   + + D A KEY+  +
Sbjct: 59  EDAE------ECVKINPT-------------WSKGYNRVGAAQYGLGNLDDAEKEYKKAL 99

Query: 423 KRGAASRKVMEGRRRCQK 440
           +  ++++   EG  + QK
Sbjct: 100 EIDSSNKAAQEGLEQVQK 117

>TPHA0D02880 Chr4 (599288..601045) [1758 bp, 585 aa] {ON} Anc_5.617
           YOR027W
          Length = 585

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 35/145 (24%), Positives = 62/145 (42%), Gaps = 24/145 (16%)

Query: 303 SYQEFKEKGTLSFSAGDYHTAFQNFEKSVNSLPH-SHPLRAISLSNMIICRLKLGEYRKA 361
           S  E+K++G  +FSA +Y  A   F K++   P  +H L     SN   C   L ++  A
Sbjct: 4   SADEYKQQGNTAFSAKEYEKAVDLFSKAIEVSPEPNHVL----YSNRSACYTSLKKFTDA 59

Query: 362 IEDSSVALKLISCAKLDDVIPASDPPKTFKEIWCKIVGNKAEAYEHIEDYDKALKEYQLL 421
           + D++       C K++               W K       A+  + D D+A K Y+  
Sbjct: 60  LNDAN------ECTKINPT-------------WSKGYNRVGAAHYGLGDLDEAEKSYKKA 100

Query: 422 IKRGAASRKVMEGRRRCQKIVEPEK 446
           ++  A+++   EG  + ++  E  K
Sbjct: 101 LELDASNKVAQEGLEQVKRTQEARK 125

>TPHA0D03860 Chr4 (807913..808275) [363 bp, 120 aa] {ON} Anc_6.328
           YCR060W
          Length = 120

 Score = 37.0 bits (84), Expect = 0.025,   Method: Composition-based stats.
 Identities = 19/61 (31%), Positives = 34/61 (55%), Gaps = 4/61 (6%)

Query: 303 SYQEFKEKGTLSFSAGDYHTAFQNFEKSVNSLPHSHPLRAISLSNMIICRLKLGEYRKAI 362
           S++++KE+G  +F  G Y  A + ++K V+  P +     I  SN  +  +KLG Y + +
Sbjct: 2   SFEQYKEEGNRNFKEGSYKVAAELYQKCVDIEPEN----PIGYSNKAMALIKLGRYTEVV 57

Query: 363 E 363
           E
Sbjct: 58  E 58

>Kpol_1028.51 s1028 complement(123535..123888) [354 bp, 117 aa] {ON}
           complement(123535..123888) [354 nt, 118 aa]
          Length = 117

 Score = 36.2 bits (82), Expect = 0.044,   Method: Composition-based stats.
 Identities = 21/73 (28%), Positives = 37/73 (50%), Gaps = 4/73 (5%)

Query: 303 SYQEFKEKGTLSFSAGDYHTAFQNFEKSVNSLPHSHPLRAISLSNMIICRLKLGEYRKAI 362
           S++E+K  G   F  G+Y  A + ++K +   P +     I  SN  +  +KL +Y +A+
Sbjct: 2   SFEEYKTTGNTYFKDGNYLKAVEYYKKCIEVEPEN----PIGYSNSAMSLIKLTKYTEAL 57

Query: 363 EDSSVALKLISCA 375
           E     LK ++ A
Sbjct: 58  ESCGTGLKYVNDA 70

>KLTH0E02178g Chr5 (194914..196695) [1782 bp, 593 aa] {ON} highly
           similar to uniprot|P15705 Saccharomyces cerevisiae
           YOR027W STI1 Heat shock protein also induced by
           canavanine and entry into stationary phase
          Length = 593

 Score = 38.1 bits (87), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 33/138 (23%), Positives = 61/138 (44%), Gaps = 22/138 (15%)

Query: 303 SYQEFKEKGTLSFSAGDYHTAFQNFEKSVNSLPHSHPLRAISLSNMIICRLKLGEYRKAI 362
           S +EFK++G  +F A DY  A + F K++ +   S     +  SN   C   L ++ +A+
Sbjct: 2   SAEEFKKQGNAAFVAKDYEKASELFTKAIEA---SEAPNHVLYSNRSACFTSLKKFNEAL 58

Query: 363 EDSSVALKLISCAKLDDVIPASDPPKTFKEIWCKIVGNKAEAYEHIEDYDKALKEYQLLI 422
            D++       C K++   PA          W K       AY  +   D+A + Y+  +
Sbjct: 59  NDAN------ECVKIN---PA----------WSKGYNRVGAAYFGLGKLDEAEQGYKKAL 99

Query: 423 KRGAASRKVMEGRRRCQK 440
           +   +++   +G  + QK
Sbjct: 100 EIDTSNKAAQDGLEQVQK 117

>Ecym_2090 Chr2 complement(163340..163858) [519 bp, 172 aa] {ON}
           similar to Ashbya gossypii AAR054C
          Length = 172

 Score = 36.2 bits (82), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 35/69 (50%), Gaps = 4/69 (5%)

Query: 305 QEFKEKGTLSFSAGDYHTAFQNFEKSVNSLPHSHPLRAISLSNMIICRLKLGEYRKAIED 364
           ++ K KG   F  GDY TA   +EK+  +L  S+P   I  SNM    +KL  +++A+  
Sbjct: 42  EDLKVKGNTFFKNGDYETAILYYEKAC-ALDSSNP---IYFSNMATALIKLERWQEAVNA 97

Query: 365 SSVALKLIS 373
               L  +S
Sbjct: 98  CDKGLNKVS 106

>NDAI0D00810 Chr4 complement(181659..182708) [1050 bp, 349 aa] {ON}
           Anc_6.21 YOR007C
          Length = 349

 Score = 37.0 bits (84), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 36/150 (24%), Positives = 70/150 (46%), Gaps = 25/150 (16%)

Query: 307 FKEKGTLSFSAGDYHTAFQNFEKSVNSLPHSHPLRAISLSNMIICRLKLGEYRKAIEDSS 366
           FK +G  + +  D+H A + + +++  LP      AI  +N       L E+ +AI+D+ 
Sbjct: 104 FKLEGNKAMAMKDFHLAVEKYTEAIKILP----TNAIYYANRAAAHSSLKEFEEAIKDAE 159

Query: 367 VALKLISCAKLDDVIPASDPPKTFKEIWCKIVGNKAEAYEHIEDYDKALKEYQ--LLIKR 424
            A+K+             DP  ++ + + ++    A A   +  +++AL+ Y+  L I+ 
Sbjct: 160 SAIKI-------------DP--SYSKGYSRL----AFAKYGLGKHEEALESYKKVLDIEG 200

Query: 425 GAASRKVMEGRRRCQKIVEPEKFVQRSKTP 454
             A+  +       +K VE    V++SKTP
Sbjct: 201 DNATAGMKRDYETAKKRVEESMNVEKSKTP 230

>NCAS0B07010 Chr2 (1332351..1334228) [1878 bp, 625 aa] {ON}
           Anc_2.152
          Length = 625

 Score = 37.0 bits (84), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 37/130 (28%), Positives = 55/130 (42%), Gaps = 28/130 (21%)

Query: 306 EFKEKGTLSFSAGDYHTA--FQNFEKSVNSLPHSHPLRAISLSNMIICRLKLGEYRKAIE 363
           + K+KG   F A DY  A  + N    +N  P       I  SN+  C + LG+  K IE
Sbjct: 124 QLKDKGNKYFKAKDYTNAIKYYNLALDLNKDP-------IFYSNISACYVSLGQLDKVIE 176

Query: 364 DSSVALKLISCAKLDDVIPASDPPKTFKEIWCKIVGNKAEAYEHIEDYDKALKEYQLLIK 423
            S+ AL+L             +P       + K +  +A A E +E+Y  AL +  +L  
Sbjct: 177 SSTKALEL-------------NPN------YSKALLRRASANESLENYSDALFDLSVLSL 217

Query: 424 RGAASRKVME 433
            G  S   +E
Sbjct: 218 NGDYSGASIE 227

>TBLA0I02310 Chr9 (528067..528417) [351 bp, 116 aa] {ON} Anc_6.328
           YCR060W
          Length = 116

 Score = 34.7 bits (78), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 36/71 (50%), Gaps = 4/71 (5%)

Query: 303 SYQEFKEKGTLSFSAGDYHTAFQNFEKSVNSLPHSHPLRAISLSNMIICRLKLGEYRKAI 362
           +++E K KG +SF  G Y  A   + + + S+  S+P   I  SN  +  LK   + +AI
Sbjct: 2   NFEELKAKGNISFKNGSYSEAISWYNRCI-SIDPSNP---IGYSNKAMALLKADRFDEAI 57

Query: 363 EDSSVALKLIS 373
                 L+LIS
Sbjct: 58  TTCEKGLQLIS 68

>SAKL0A01672g Chr1 complement(154932..155318) [387 bp, 128 aa] {ON}
           similar to uniprot|P25638 Saccharomyces cerevisiae
           YCR060W TAH1 HSP90
          Length = 128

 Score = 34.7 bits (78), Expect = 0.16,   Method: Composition-based stats.
 Identities = 29/97 (29%), Positives = 49/97 (50%), Gaps = 5/97 (5%)

Query: 304 YQEFKEKGTLSFSAGDYHTAFQNFEKSVNSLPHSHPLRAISLSNMIICRLKLGEYRKAIE 363
           +   K KG + F   DY TA   ++K++ + P S+P   I  SN  +  +KL ++ +A++
Sbjct: 4   FDTLKAKGNVFFKKCDYETAVLYYQKAITADP-SNP---IGYSNNAMGLIKLEKWSEAVD 59

Query: 364 DSSVALKLISCAKLDDVIPASDPPKTFKEIWCKIVGN 400
             +  LK+I C + D         +  KEI  K +GN
Sbjct: 60  ACNKGLKMI-CPENDKDGKIVQKLEWRKEIALKNIGN 95

>YCR060W Chr3 (224399..224734) [336 bp, 111 aa] {ON}  TAH1Component
           of the conserved R2TP complex (Rvb1-Rvb2-Tah1-Pih1);
           contains a single TPR domain with at least two TPR
           motifs; R2TP complex interacts with Hsp90 (Hsp82p and
           Hsc82p) to mediate assembly large protein complexes such
           as box C/D snoRNPs and RNA polymerase II
          Length = 111

 Score = 34.3 bits (77), Expect = 0.18,   Method: Composition-based stats.
 Identities = 20/73 (27%), Positives = 37/73 (50%), Gaps = 4/73 (5%)

Query: 304 YQEFKEKGTLSFSAGDYHTAFQNFEKSVNSLPHSHPLRAISLSNMIICRLKLGEYRKAIE 363
           +++ KE+G   F  G Y  A   +++ + + P +     +  SN  +  +KLGEY +AI+
Sbjct: 4   FEKQKEQGNSLFKQGLYREAVHCYDQLITAQPQN----PVGYSNKAMALIKLGEYTQAIQ 59

Query: 364 DSSVALKLISCAK 376
                L+  S A+
Sbjct: 60  MCQQGLRYTSTAE 72

>SAKL0G07084g Chr7 (580004..581761) [1758 bp, 585 aa] {ON} highly
           similar to uniprot|P15705 Saccharomyces cerevisiae
           YOR027W STI1 Heat shock protein also induced by
           canavanine and entry into stationary phase
          Length = 585

 Score = 36.2 bits (82), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 31/138 (22%), Positives = 59/138 (42%), Gaps = 22/138 (15%)

Query: 303 SYQEFKEKGTLSFSAGDYHTAFQNFEKSVNSLPHSHPLRAISLSNMIICRLKLGEYRKAI 362
           S  E+K++G  +F+A D+  A + F K++     S     +  SN   C     ++ KA+
Sbjct: 2   SADEYKQQGNAAFAAKDFEKAIELFTKAIEV---SEKPNHVLYSNRSACYTSTKQFNKAL 58

Query: 363 EDSSVALKLISCAKLDDVIPASDPPKTFKEIWCKIVGNKAEAYEHIEDYDKALKEYQLLI 422
           ED+        C  ++   PA          W K       A+  + D D+A + Y+  +
Sbjct: 59  EDAK------QCVNIN---PA----------WSKGYNRVGAAHFGLGDLDEAEQGYKKAL 99

Query: 423 KRGAASRKVMEGRRRCQK 440
           +  +A++   +G  +  K
Sbjct: 100 ELDSANKAAQDGLEQVHK 117

>TPHA0I01510 Chr9 complement(342661..344472) [1812 bp, 603 aa] {ON}
           Anc_2.152 YHR117W
          Length = 603

 Score = 35.8 bits (81), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 36/147 (24%), Positives = 59/147 (40%), Gaps = 37/147 (25%)

Query: 281 SGHDAVSSPVAASIAMSALEFHSYQEFKEKGTLSFSAGDYHTA--FQNFEKSVNSLPHSH 338
           SG D+ S  +    AM+          K+KG   F   D+  A  + N+  ++   P   
Sbjct: 91  SGKDSFSDELKEKYAMA---------LKDKGNDYFKKQDFENALKYYNYALTLKQDP--- 138

Query: 339 PLRAISLSNMIICRLKLGEYRKAIEDSSVALKLISCAKLDDVIPASDPPKTFKEIWCKIV 398
               +  SN+  C + LG+  K +E S+ ALKL                   K  + K +
Sbjct: 139 ----VFYSNISACYVSLGQLEKVVESSTEALKL-------------------KHDYSKAL 175

Query: 399 GNKAEAYEHIEDYDKALKEYQLLIKRG 425
             +A AYE + +Y  A+ +  +L   G
Sbjct: 176 LRRASAYESLANYVDAMVDLSVLSLNG 202

>ACR005W Chr3 (363355..364338) [984 bp, 327 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR007C (SGT2)
          Length = 327

 Score = 35.4 bits (80), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 34/69 (49%), Gaps = 4/69 (5%)

Query: 305 QEFKEKGTLSFSAGDYHTAFQNFEKSVNSLPHSHPLRAISLSNMIICRLKLGEYRKAIED 364
           +  K +G  + +A DY TA Q +  ++  LP      A+  +N       L +Y KA+ED
Sbjct: 91  EALKLEGNRAMAAKDYETAIQKYTAAIEVLPTD----AVYYANRAAAYSSLQQYEKAVED 146

Query: 365 SSVALKLIS 373
           +  A K+ S
Sbjct: 147 AEKATKVDS 155

>YOR027W Chr15 (381053..382822) [1770 bp, 589 aa] {ON}  STI1Hsp90
           cochaperone, interacts with the Ssa group of the
           cytosolic Hsp70 chaperones and activates Ssa1p ATPase
           activity; interacts with Hsp90 chaperones and inhibits
           their ATPase activity; homolog of mammalian Hop
          Length = 589

 Score = 35.4 bits (80), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 32/130 (24%), Positives = 58/130 (44%), Gaps = 24/130 (18%)

Query: 306 EFKEKGTLSFSAGDYHTAFQNFEKSVN-SLPHSHPLRAISLSNMIICRLKLGEYRKAIED 364
           E+K++G  +F+A DY  A + F K++  S   +H L     SN   C   L ++  A+ D
Sbjct: 7   EYKQQGNAAFTAKDYDKAIELFTKAIEVSETPNHVL----YSNRSACYTSLKKFSDALND 62

Query: 365 SSVALKLISCAKLDDVIPASDPPKTFKEIWCKIVGNKAEAYEHIEDYDKALKEYQLLIKR 424
           ++       C K++   P+          W K       A+  + D D+A   Y+  ++ 
Sbjct: 63  AN------ECVKIN---PS----------WSKGYNRLGAAHLGLGDLDEAESNYKKALEL 103

Query: 425 GAASRKVMEG 434
            A+++   EG
Sbjct: 104 DASNKAAKEG 113

>TPHA0L01420 Chr12 (293980..295104) [1125 bp, 374 aa] {ON} Anc_8.506
           YBR155W
          Length = 374

 Score = 35.0 bits (79), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 40/189 (21%), Positives = 71/189 (37%), Gaps = 36/189 (19%)

Query: 237 SSVPAQVSPMNSEILPP-LVNIGDDVPVSGPEEAS--ADLLVDFDAPSGHDAVSSPVAAS 293
           S +P  V  +N  ILPP L    D       EE +     +   D   G+        ++
Sbjct: 2   SKLPKYVPGVNDPILPPQLSEFKDKTTDEVLEELNRMPFFMTKLDDSDGNGG------SN 55

Query: 294 IAMSALEFHSYQ--------EFKEKGTLSFSAGDYHTAFQNFEKSVNSLPHSHPLRAISL 345
           + + AL+  +Y+         FK++G  ++    Y  A   +E+ +    ++  +  +  
Sbjct: 56  VTLDALKALAYEGEPHEIAENFKKQGNEAYKLKQYRNARVLYERGIEVNCNNDKINELLF 115

Query: 346 SNMIICRLKLGEYRKAIEDSSVALKLISCAKLDDVIPASDPPKTFKEIWCKIVGNKAEAY 405
            N   C L++  YR  I D   AL                   +F  +  K     A+A+
Sbjct: 116 VNKAACELEMKNYRSCINDCKKAL-------------------SFNPLNVKCYFRMAKAF 156

Query: 406 EHIEDYDKA 414
             IE YD++
Sbjct: 157 SAIEKYDES 165

>Suva_12.114 Chr12 (164933..166042) [1110 bp, 370 aa] {ON} YJR032W
           (REAL)
          Length = 370

 Score = 34.7 bits (78), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 36/142 (25%), Positives = 56/142 (39%), Gaps = 30/142 (21%)

Query: 308 KEKGTLSFSAGDYHTAFQNFEKSVNSLPHSHP--------------LRAISLSNMIICRL 353
           KE GTL F   DY  AF  + KS+N +    P              L+     N+ +   
Sbjct: 244 KESGTLLFKKKDYENAFFKYRKSLNYINEYMPEPDLDKEKNEQFTDLKMKVYLNLSLALF 303

Query: 354 KLGEYRKAIEDSSVALKLISCAKLDDVIPASDPPKTFKEIWCKIVGNKAEAYEHIEDYDK 413
            L  Y  AI  ++  L++       D +P  D  K +          +  +Y   +  D+
Sbjct: 304 NLERYDSAITYATYLLEM-------DNVPNKDRAKAYYR--------RGNSYLRKKRLDE 348

Query: 414 ALKEYQLLIKRGAASRKVMEGR 435
           AL++Y+ L K      KV+E R
Sbjct: 349 ALRDYR-LCKEMNPDDKVIEQR 369

>Kwal_56.24487 s56 (1016327..1017439) [1113 bp, 370 aa] {ON} YLR216C
           (CPR6) - cyclophilin related to the mammalian CyP-40
           [contig 161] FULL
          Length = 370

 Score = 34.7 bits (78), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 32/72 (44%), Gaps = 13/72 (18%)

Query: 308 KEKGTLSFSAGDYHTAFQNFEKSVNSLPHSHP-------------LRAISLSNMIICRLK 354
           KE GT  F   +Y TA   +EK+ + L    P             LR   L N+ +C LK
Sbjct: 222 KEIGTAQFKVKNYTTALAKYEKASSMLKQYQPQDLPEDDIKKIDQLRLSILLNVALCALK 281

Query: 355 LGEYRKAIEDSS 366
             +Y+K +  ++
Sbjct: 282 TTDYQKVLASTT 293

>Kpol_1018.69 s1018 (197149..198921) [1773 bp, 590 aa] {ON}
           (197149..198921) [1773 nt, 591 aa]
          Length = 590

 Score = 34.7 bits (78), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 34/142 (23%), Positives = 61/142 (42%), Gaps = 24/142 (16%)

Query: 303 SYQEFKEKGTLSFSAGDYHTAFQNFEKSVN-SLPHSHPLRAISLSNMIICRLKLGEYRKA 361
           S  E+K++G  +F A DY  A   F K+++ S   +H L     SN   C   L ++  A
Sbjct: 4   SADEYKQQGNAAFVAKDYDKAIDLFSKAIDVSEQPNHVL----YSNRSACYTSLKKFVNA 59

Query: 362 IEDSSVALKLISCAKLDDVIPASDPPKTFKEIWCKIVGNKAEAYEHIEDYDKALKEYQLL 421
           ++D+        C K++   P+          W K       A+  + D D+A   Y+  
Sbjct: 60  LKDAE------ECVKIN---PS----------WSKGYNRVGAAHFGMGDLDEAEAGYKKA 100

Query: 422 IKRGAASRKVMEGRRRCQKIVE 443
           ++  A+++   EG  +  +  E
Sbjct: 101 LELDASNKAAQEGLEQVHRTQE 122

>Ecym_4413 Chr4 complement(856330..857862) [1533 bp, 510 aa] {ON}
           similar to Ashbya gossypii AAR083C
          Length = 510

 Score = 34.3 bits (77), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 31/146 (21%), Positives = 66/146 (45%), Gaps = 31/146 (21%)

Query: 306 EFKEKGTLSFSAGDYHTAFQNFEKSVNSLPHSHPLRAISLSNMIICRLKLGEYRKAIEDS 365
           E+K++G    ++ DY  A + + K++         ++I  SN  +  LKL  ++ A+EDS
Sbjct: 11  EYKDQGNKFVASKDYGQAIEAYTKAI----ELDGCQSIFFSNRALANLKLDRFQSALEDS 66

Query: 366 SVALKLISCAKLDDVIPASDPPKTFKEIWCKIVGNKAEAYEHIEDYDKALKEYQLLIK-- 423
           S A++L S                      K    +  AY  ++D+  A ++ +++++  
Sbjct: 67  SKAIELDSSN-------------------VKGYHRRGMAYAGLQDFISAKRDLEVVLRVK 107

Query: 424 --RGAASRKVMEGRRRCQKIVEPEKF 447
                A R ++     C++++  E+F
Sbjct: 108 PGEATAKRTLLA----CERMIRRERF 129

>CAGL0D05060g Chr4 complement(486065..487597) [1533 bp, 510 aa] {ON}
           highly similar to uniprot|P53043 Saccharomyces
           cerevisiae YGR123c PPT1 protein ser/thr phosphatase
          Length = 510

 Score = 34.3 bits (77), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 43/200 (21%), Positives = 85/200 (42%), Gaps = 37/200 (18%)

Query: 296 MSALEFHSYQEFKEKGTLSFSAGDYHTAFQNFEKSVNSLPHSHPLRAISLSNMIICRLKL 355
           M A +     E+K +G       DY  A + ++K++         +++  SN  +C LKL
Sbjct: 1   MGATDADKALEYKNEGNACVKVQDYAKAIEKYDKAI----ELDDTQSVYFSNRALCHLKL 56

Query: 356 GEYRKAIEDSSVALKLISCAKLDDVIPASDPPKTFKEIWCKIVGNKAEAYEHIEDYDKAL 415
             ++ A +D   AL L             DP         K    +  A   + ++ KA 
Sbjct: 57  DNFQCASQDCDKALAL-------------DPKNV------KAYHRRGLACVGLLEFKKAR 97

Query: 416 KEYQLLIK---RGAASRKVMEGRRRCQKIVEPEKFVQR-------SKTPLSTSPSVSRKD 465
            +  +++K     AA+++ ++    C+K++  E+F +        SK  L ++ ++S  D
Sbjct: 98  ADLTVVLKAKPSDAAAKRALD---ICEKVIREERFRKAIGGGDSDSKPKLCSTLNLSSFD 154

Query: 466 V-AVAATSQVPSEKLERVQN 484
             +  A    PS + E+++N
Sbjct: 155 ANSDLAKYDGPSLEFEQLKN 174

>Suva_8.80 Chr8 (142691..144451) [1761 bp, 586 aa] {ON} YOR027W
           (REAL)
          Length = 586

 Score = 34.3 bits (77), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 32/130 (24%), Positives = 56/130 (43%), Gaps = 24/130 (18%)

Query: 306 EFKEKGTLSFSAGDYHTAFQNFEKSVN-SLPHSHPLRAISLSNMIICRLKLGEYRKAIED 364
           E+K++G  +F+A DY  A   F K++  S   +H L     SN   C   L ++  A+ D
Sbjct: 7   EYKQQGNAAFTAKDYGKAIDLFTKAIEVSEAPNHVL----YSNRSACYTSLKKFTDALND 62

Query: 365 SSVALKLISCAKLDDVIPASDPPKTFKEIWCKIVGNKAEAYEHIEDYDKALKEYQLLIKR 424
           ++       C K++   P+          W K       A+  + D D A   Y+  ++ 
Sbjct: 63  AT------ECVKIN---PS----------WSKGYNRLGAAHLGLGDLDDAESNYKKALEL 103

Query: 425 GAASRKVMEG 434
            AA++   +G
Sbjct: 104 DAANKAAKDG 113

>Skud_15.192 Chr15 (340847..342616) [1770 bp, 589 aa] {ON} YOR027W
           (REAL)
          Length = 589

 Score = 33.9 bits (76), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 31/136 (22%), Positives = 60/136 (44%), Gaps = 24/136 (17%)

Query: 306 EFKEKGTLSFSAGDYHTAFQNFEKSVN-SLPHSHPLRAISLSNMIICRLKLGEYRKAIED 364
           E+K++G  +F+A +Y  A + F K++  S   SH L     SN   C   L ++  A+ D
Sbjct: 7   EYKQQGNAAFTAKNYDGAIELFTKAIEVSETPSHVL----FSNRSACYTSLKKFSDALND 62

Query: 365 SSVALKLISCAKLDDVIPASDPPKTFKEIWCKIVGNKAEAYEHIEDYDKALKEYQLLIKR 424
           ++       C K++   P+          W K       A+  + D D+A  +Y+  ++ 
Sbjct: 63  AN------ECVKIN---PS----------WSKGYNRLGAAHLGLGDLDEAESDYKKALEL 103

Query: 425 GAASRKVMEGRRRCQK 440
            A ++   +G  +  +
Sbjct: 104 DANNKAAKDGLEQVHR 119

>CAGL0K09240g Chr11 complement(914042..914470) [429 bp, 142 aa] {ON}
           weakly similar to uniprot|P25638 Saccharomyces
           cerevisiae YCR060w
          Length = 142

 Score = 32.3 bits (72), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 26/52 (50%), Gaps = 4/52 (7%)

Query: 303 SYQEFKEKGTLSFSAGDYHTAFQNFEKSVNSLPHSHPLRAISLSNMIICRLK 354
           S+Q FK+ G   F  G+Y  A + + K ++      P  A+  SN+ +  LK
Sbjct: 34  SFQHFKDIGNEHFKKGEYDLAIEQYRKCIS----LEPTNAVGYSNLAMAYLK 81

>KLLA0A07062g Chr1 complement(636546..638291) [1746 bp, 581 aa] {ON}
           highly similar to uniprot|P15705 Saccharomyces
           cerevisiae YOR027W STI1 Heat shock protein also induced
           by canavanine and entry into stationary phase
          Length = 581

 Score = 33.5 bits (75), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 31/133 (23%), Positives = 61/133 (45%), Gaps = 24/133 (18%)

Query: 303 SYQEFKEKGTLSFSAGDYHTAFQNFEKSVN-SLPHSHPLRAISLSNMIICRLKLGEYRKA 361
           S  +FK++G  +F++ DY  A + F K++  S   +H L     SN   C     ++ KA
Sbjct: 2   SADQFKQEGNQAFASKDYAKAIELFTKAIEVSEQPNHVL----FSNRSACYASNKDFVKA 57

Query: 362 IEDSSVALKLISCAKLDDVIPASDPPKTFKEIWCKIVGNKAEAYEHIEDYDKALKEYQLL 421
           ++D++       C K++   P+          W K       A+  + D D+A + Y+  
Sbjct: 58  LDDAN------ECVKIN---PS----------WAKGYNRLGAAHYGLGDLDEAEQSYKKA 98

Query: 422 IKRGAASRKVMEG 434
           ++  +A++   +G
Sbjct: 99  LELDSANKAAQDG 111

>KAFR0F00720 Chr6 complement(141181..143007) [1827 bp, 608 aa] {ON}
           Anc_2.152 YHR117W
          Length = 608

 Score = 33.5 bits (75), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 31/116 (26%), Positives = 50/116 (43%), Gaps = 24/116 (20%)

Query: 306 EFKEKGTLSFSAGDYHTAFQNFEKSVNSLPHSHPLRAISLSNMIICRLKLGEYRKAIEDS 365
           E K+KG   F   DY  A + ++ ++  +    P   +  SNM  C + L E  K IE S
Sbjct: 110 ELKDKGNEYFKEKDYENALKFYDFAL--ILKKDP---VFYSNMSACYVSLNELDKVIEMS 164

Query: 366 SVALKLISCAKLDDVIPASDPPKTFKEIWCKIVGNKAEAYEHIEDYDKALKEYQLL 421
           + AL+L                   K  + K +  +A A E +E+Y  A+ +  +L
Sbjct: 165 TKALEL-------------------KPDYSKALLRRATANEQLENYSDAMFDLSVL 201

>KAFR0J02570 Chr10 (488372..488737) [366 bp, 121 aa] {ON} Anc_6.328
           YCR060W
          Length = 121

 Score = 31.6 bits (70), Expect = 1.8,   Method: Composition-based stats.
 Identities = 19/71 (26%), Positives = 35/71 (49%), Gaps = 4/71 (5%)

Query: 303 SYQEFKEKGTLSFSAGDYHTAFQNFEKSVNSLPHSHPLRAISLSNMIICRLKLGEYRKAI 362
           S+  FK +G   F  G+Y +A +++EK +      +P   I  SN  +  +K  + ++A+
Sbjct: 2   SFDHFKTEGNQYFKEGNYASAIKSYEKCI----EINPENPIGYSNKAMALIKANKNQEAV 57

Query: 363 EDSSVALKLIS 373
                 LK +S
Sbjct: 58  RTCQDGLKRVS 68

>Smik_2.295 Chr2 (535786..536943) [1158 bp, 385 aa] {ON} YBR155W
           (REAL)
          Length = 385

 Score = 33.1 bits (74), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 27/100 (27%), Positives = 41/100 (41%), Gaps = 9/100 (9%)

Query: 284 DAVSSPVAASIAMSALEF----HSYQE-FKEKGTLSFSAGDYHTAFQNFEKSVNSLPHSH 338
           D V        A+ AL +    H   E FK++G   + A  +  A + + K +       
Sbjct: 58  DGVGGENVELEALKALAYEGEPHEIAENFKKQGNELYKAKRFKDARELYTKGIAVECEDK 117

Query: 339 PLRAISLSNMIICRLKLGEYRKAIEDSSVALKL----ISC 374
            +     +N   C L+L  YR+ IED S AL +    I C
Sbjct: 118 SINESLFANRAACELELKNYRRCIEDCSKALTINPKNIKC 157

>Skud_2.282 Chr2 (517201..518358) [1158 bp, 385 aa] {ON} YBR155W
           (REAL)
          Length = 385

 Score = 33.1 bits (74), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 31/65 (47%)

Query: 307 FKEKGTLSFSAGDYHTAFQNFEKSVNSLPHSHPLRAISLSNMIICRLKLGEYRKAIEDSS 366
           FK++G   + A  +  A + + K +N       +     +N   C L+L  YR+ IED S
Sbjct: 86  FKKQGNELYKAKRFKDARELYIKGLNVECEDKFINESLFANKAACELELKNYRRCIEDCS 145

Query: 367 VALKL 371
            AL +
Sbjct: 146 KALSI 150

>KLTH0H02068g Chr8 complement(188834..189946) [1113 bp, 370 aa] {ON}
           similar to uniprot|P53691 Saccharomyces cerevisiae
           YLR216C CPR6 Peptidyl-prolyl cis-trans isomerase
           (cyclophilin) catalyzes the cis-trans isomerization of
           peptide bonds N-terminal to proline residues binds to
           Hsp82p and contributes to chaperone activity
          Length = 370

 Score = 32.7 bits (73), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 30/126 (23%), Positives = 53/126 (42%), Gaps = 28/126 (22%)

Query: 308 KEKGTLSFSAGDYHTAFQNFEKSVNSLPHSHP-------------LRAISLSNMIICRLK 354
           K+ GT  F A  +  A   +EKS + L    P             LR     N+ +C +K
Sbjct: 222 KDIGTSLFKAQKFQPALTKYEKSSSMLKQYFPQDLPAEDISRVDQLRISIFLNIALCAIK 281

Query: 355 LGEYRKAIEDSSVALKLISCAKLDDVIPASDPPKTFKEIWCKIVGNKAEAYEHIEDYDKA 414
            G+Y+KA+  ++   +++  A  DD   A            K +  +  AY H++D + A
Sbjct: 282 TGDYQKALTSTT---EVVHDAAADDKSKA------------KALYRRGLAYYHLKDPEMA 326

Query: 415 LKEYQL 420
           + + + 
Sbjct: 327 ITDLEF 332

>Kpol_513.2 s513 (1962..3086) [1125 bp, 374 aa] {ON} (1962..3086)
           [1125 nt, 375 aa]
          Length = 374

 Score = 32.7 bits (73), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 33/146 (22%), Positives = 59/146 (40%), Gaps = 17/146 (11%)

Query: 237 SSVPAQVSPMNSEILPP-LVNIGDDVPVSGPEEAS--ADLLVDFDAPSGHDAVSSPVAAS 293
           S++P  V+  N  ILPP L +  D       EE +     +   D   G         ++
Sbjct: 2   STLPKYVAGPNDPILPPQLSDFKDKTTDEVFEELNRMPFFMTKLDDTDGDGG------SN 55

Query: 294 IAMSALEFHSYQ--------EFKEKGTLSFSAGDYHTAFQNFEKSVNSLPHSHPLRAISL 345
           + + AL+  +Y+         FK +G   +    +  A + + K+++       +     
Sbjct: 56  VTLDALKALAYEGEPHEIAGNFKNQGNDLYKVKRFRDARELYNKAIDVKCDDDKINESLY 115

Query: 346 SNMIICRLKLGEYRKAIEDSSVALKL 371
           +N   C L+L  YR+ I D  +AL L
Sbjct: 116 ANRAACELELKNYRRCINDCKMALSL 141

>AAR054C Chr1 complement(440706..441107) [402 bp, 133 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YCR060W
          Length = 133

 Score = 31.6 bits (70), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 28/110 (25%), Positives = 51/110 (46%), Gaps = 15/110 (13%)

Query: 307 FKEKGTLSFSAGDYHTAFQNFEKSVNSLPHSHPLRAISLSNMIICRLKLGEYRKAIEDSS 366
            + KG   +S G+Y TA   ++ +  + P S+P   + L+NM +  LKL  +  A+    
Sbjct: 11  LRSKGNDLYSKGEYETAVLYYKNASLAEP-SNP---VHLANMSMALLKLERWEDALSACD 66

Query: 367 VALKLISCAKLDDVIPASDPPKTFKEIWCKIVGNKAEAYEHIEDYDKALK 416
            AL+++              P T  +I  K+   K  A+EH+   ++ +K
Sbjct: 67  RALEIM-----------KKGPVTDDKILQKVQWRKKLAHEHLAGTERDIK 105

>Kwal_27.11890 s27 (990685..991689) [1005 bp, 334 aa] {ON} YBR155W
           (CNS1) - component of Hsp90p chaperone machinery [contig
           27] FULL
          Length = 334

 Score = 32.7 bits (73), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 31/146 (21%), Positives = 57/146 (39%), Gaps = 11/146 (7%)

Query: 233 QPNESSVPAQVSPMNSEILPPLVNIGDDVPVSGPEEASADLLVDFDAPSGHDAVSSPVAA 292
           +P E ++P Q+S   ++    ++   + +P    +      L D D   G + V      
Sbjct: 14  RPGEPALPPQLSEFQNKNTDQVLEELNRMPFFMRK------LDDTDGDGGEN-VGLEALK 66

Query: 293 SIAMSALEFHSYQEFKEKGTLSFSAGDYHTAFQNFEKSVNSLPHSHPLRAISLSNMIICR 352
           ++A         + FK +G   +    Y  A + + K +     S+ +     SN   C 
Sbjct: 67  ALAYDGEPHEVAENFKNQGNELYKVKRYKDAREIYNKGIEIKCDSNKINESLFSNRAACE 126

Query: 353 LKLGEYRKAIEDSSVALKL----ISC 374
           L+L  YR+ + D   AL+     I C
Sbjct: 127 LELKNYRRCVNDCRQALQFNPTNIKC 152

>KLTH0F14542g Chr6 complement(1191800..1193341) [1542 bp, 513 aa]
           {ON} highly similar to uniprot|P53043 Saccharomyces
           cerevisiae YGR123C
          Length = 513

 Score = 32.7 bits (73), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 41/192 (21%), Positives = 78/192 (40%), Gaps = 31/192 (16%)

Query: 306 EFKEKGTLSFSAGDYHTAFQNFEKSVNSLPHSHPLRAISLSNMIICRLKLGEYRKAIEDS 365
           EFK +G        Y  A + + K++         ++I  SN    RLKL  +  A+ED 
Sbjct: 14  EFKNQGNAFIKEKKYPEAVEYYSKAI----ELDDTQSIFFSNRAFSRLKLDNFLTALEDC 69

Query: 366 SVALKLISCAKLDDVIPASDPPKTFKEIWCKIVGNKAEAYEHIEDYDKALKEYQLLIKRG 425
           + +++L               PK  K I       +  +Y  + ++ KA K+ + +++  
Sbjct: 70  NKSIEL--------------DPKNIKAIH-----RRGLSYVGLLEFSKARKDLKTILQVK 110

Query: 426 AASRKVMEGRRRCQKIVEPEKF-------VQRSKTPLSTSPSVSRKDVAVAATSQVPSEK 478
              +  ++    C++ +  E+F        + SK  +  S  +S  D   A        +
Sbjct: 111 PNEQSALKALEVCERFIREERFKKAISGDGEESKVNVCASLQLSSFD-GNADLLNYKGME 169

Query: 479 LERVQNINKKEK 490
           LE VQ  N+K++
Sbjct: 170 LEIVQLTNEKQE 181

>NCAS0G00810 Chr7 complement(138192..139946) [1755 bp, 584 aa] {ON}
           Anc_5.617
          Length = 584

 Score = 32.7 bits (73), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 31/142 (21%), Positives = 60/142 (42%), Gaps = 24/142 (16%)

Query: 306 EFKEKGTLSFSAGDYHTAFQNFEKSVN-SLPHSHPLRAISLSNMIICRLKLGEYRKAIED 364
           E K+KG  +F++ D+  A + F +++  S   +H L     SN   C   L ++++A+ D
Sbjct: 6   ELKQKGNAAFASKDFTGAIEYFTEAIAASTTPNHVL----YSNRSACYTSLKQFQEALND 61

Query: 365 SSVALKLISCAKLDDVIPASDPPKTFKEIWCKIVGNKAEAYEHIEDYDKALKEYQLLIKR 424
           +        C K++        P      W K       A+  + D D A   Y+  ++ 
Sbjct: 62  AQ------QCVKIN--------PD-----WSKGYNRMGAAHLGLGDLDDAESNYKKALEL 102

Query: 425 GAASRKVMEGRRRCQKIVEPEK 446
            + ++   EG  +  ++ E  K
Sbjct: 103 DSNNKAASEGLEQVHRVQESRK 124

>Suva_4.405 Chr4 (719015..720172) [1158 bp, 385 aa] {ON} YBR155W
           (REAL)
          Length = 385

 Score = 32.7 bits (73), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 23/98 (23%), Positives = 39/98 (39%), Gaps = 4/98 (4%)

Query: 281 SGHDAVSSPVAASIAMSALEFHSYQEFKEKGTLSFSAGDYHTAFQNFEKSVNSLPHSHPL 340
           +G + V      ++A         + FK++G   + A  +  A + + K V        +
Sbjct: 60  AGGENVELEALKALAYEGEPHEIAENFKKQGNELYKAKRFKDARELYTKGVAVECEDKSI 119

Query: 341 RAISLSNMIICRLKLGEYRKAIEDSSVALKL----ISC 374
                +N   C L+L  YRK +ED   AL +    I C
Sbjct: 120 NESLFANRAACELELKNYRKCVEDCGKALTINPKNIKC 157

>TBLA0H03380 Chr8 (829314..830441) [1128 bp, 375 aa] {ON} Anc_8.506
           YBR155W
          Length = 375

 Score = 32.3 bits (72), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 33/148 (22%), Positives = 56/148 (37%), Gaps = 17/148 (11%)

Query: 234 PNESSVPAQVSPMNSEILPPLVNIGDDVPVSGPEEASADLLVDFDAPSGHDAVSSPVAAS 293
           PN+  +P Q+S    +    +    + +P           +   D   G   V+  + A 
Sbjct: 11  PNDPELPPQLSEFKDKSADEIFEELNRMPF---------FMTQLDETDGEGGVNDNLEAL 61

Query: 294 IAMSALEFHSYQ---EFKEKGTLSFSAGDYHTAFQNFEKSVNSLPHSHPLRAISLSNMII 350
            A+ A E   ++    FK +G   +    Y  A + + K ++       +     +N   
Sbjct: 62  KAL-AYEGEPHEIAGNFKNRGNEFYKLKQYRDAREVYTKGIDVKCDDDKINESLYANRAA 120

Query: 351 CRLKLGEYRKAIEDSSVAL----KLISC 374
           C L+L  +RK IED   AL    K I C
Sbjct: 121 CELELKNFRKCIEDCKKALSFNVKNIKC 148

>KNAG0A07900 Chr1 complement(1258164..1259702) [1539 bp, 512 aa]
           {ON} Anc_3.481 YGR123C
          Length = 512

 Score = 32.7 bits (73), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 30/142 (21%), Positives = 57/142 (40%), Gaps = 23/142 (16%)

Query: 306 EFKEKGTLSFSAGDYHTAFQNFEKSVNSLPHSHPLRAISLSNMIICRLKLGEYRKAIEDS 365
           +FK++G +   + DY  A + + K++     S    +I  SN  +  LKL  ++ A+ D 
Sbjct: 14  KFKDEGNVYIKSQDYQKAIELYTKAIELDSTS----SIFYSNRALAHLKLDNFQSALHDC 69

Query: 366 SVALKLISCAKLDDVIPASDPPKTFKEIWCKIVGNKAEAYEHIEDYDKALKEYQLLIKRG 425
           + A+KL +                      K    +  AY  + ++ KA  +  +L+K  
Sbjct: 70  NDAIKLDNNN-------------------IKAYHRRGLAYVGLLEFRKAKNDLTILLKYK 110

Query: 426 AASRKVMEGRRRCQKIVEPEKF 447
                   G   C+  +  E+F
Sbjct: 111 PNDATAKRGLEMCESFIREERF 132

>Kwal_55.21175 s55 complement(716457..717992) [1536 bp, 511 aa] {ON}
           YGR123C (PPT1) - serine/threonine phosphatase [contig
           295] FULL
          Length = 511

 Score = 32.3 bits (72), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 31/142 (21%), Positives = 57/142 (40%), Gaps = 23/142 (16%)

Query: 306 EFKEKGTLSFSAGDYHTAFQNFEKSVNSLPHSHPLRAISLSNMIICRLKLGEYRKAIEDS 365
           EFK +G        Y  A + + K++         ++I  SN    RL+L  +  A ED 
Sbjct: 12  EFKNQGNAYVKEKKYQEAVEYYSKAI----ELDDTQSIYFSNRAFSRLRLDNFLTAQEDC 67

Query: 366 SVALKLISCAKLDDVIPASDPPKTFKEIWCKIVGNKAEAYEHIEDYDKALKEYQLLIKRG 425
             A+ L               PK  K I       +  +Y  + ++ KA K+ +++++  
Sbjct: 68  DKAIAL--------------DPKNIKAIH-----RRGLSYVGLLEFFKARKDLRVVLQVK 108

Query: 426 AASRKVMEGRRRCQKIVEPEKF 447
              +  ++    C+K +  EKF
Sbjct: 109 PNEQSALKALEVCEKFIREEKF 130

>YBR155W Chr2 (549771..550928) [1158 bp, 385 aa] {ON}
           CNS1TPR-containing co-chaperone; binds both Hsp82p
           (Hsp90) and Ssa1p (Hsp70) and stimulates the ATPase
           activity of SSA1, ts mutants reduce Hsp82p function
           while over expression suppresses the phenotypes of an
           HSP82 ts allele and a cpr7 deletion
          Length = 385

 Score = 32.3 bits (72), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 21/91 (23%), Positives = 38/91 (41%)

Query: 281 SGHDAVSSPVAASIAMSALEFHSYQEFKEKGTLSFSAGDYHTAFQNFEKSVNSLPHSHPL 340
           +G + V      ++A         + FK++G   + A  +  A + + K +        +
Sbjct: 60  AGGENVELEALKALAYEGEPHEIAENFKKQGNELYKAKRFKDARELYSKGLAVECEDKSI 119

Query: 341 RAISLSNMIICRLKLGEYRKAIEDSSVALKL 371
                +N   C L+L  YR+ IED S AL +
Sbjct: 120 NESLYANRAACELELKNYRRCIEDCSKALTI 150

>YJR032W Chr10 (491081..492262) [1182 bp, 393 aa] {ON}
           CPR7Peptidyl-prolyl cis-trans isomerase (cyclophilin),
           catalyzes the cis-trans isomerization of peptide bonds
           N-terminal to proline residues; binds to Hsp82p and
           contributes to chaperone activity
          Length = 393

 Score = 32.0 bits (71), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 35/142 (24%), Positives = 58/142 (40%), Gaps = 30/142 (21%)

Query: 308 KEKGTLSFSAGDYHTAFQNFEKSVNSLPHSHP---------LRAISLS-----NMIICRL 353
           KE GTL F   DY  AF  + KS+N +    P         ++ I+L      N+ +   
Sbjct: 244 KESGTLLFKKKDYSNAFFKYRKSLNYINEYMPEPDVDKERNIQFINLKMKIYLNLSLVLF 303

Query: 354 KLGEYRKAIEDSSVALKLISCAKLDDVIPASDPPKTFKEIWCKIVGNKAEAYEHIEDYDK 413
            L  Y  AI  ++  L++       D +P  D  K +          +  +Y   +  D+
Sbjct: 304 NLERYDDAIMYATYLLEM-------DNVPNRDQAKAYYR--------RGNSYLKKKRLDE 348

Query: 414 ALKEYQLLIKRGAASRKVMEGR 435
           AL++Y +  K      +V+E R
Sbjct: 349 ALQDY-IFCKEKNPDDEVIEQR 369

>Skud_3.135 Chr3 (208664..209020) [357 bp, 118 aa] {ON} YCR060W
           (REAL)
          Length = 118

 Score = 30.4 bits (67), Expect = 4.9,   Method: Composition-based stats.
 Identities = 19/77 (24%), Positives = 38/77 (49%), Gaps = 4/77 (5%)

Query: 303 SYQEFKEKGTLSFSAGDYHTAFQNFEKSVNSLPHSHPLRAISLSNMIICRLKLGEYRKAI 362
           S+++ K++G   F  G Y  A  ++++ + + P +     +  SN  +  +KLGE+ +AI
Sbjct: 7   SFEKDKQQGNALFKQGLYLEAVDSYDRLIAAQPQN----PVGYSNKAMALIKLGEHAQAI 62

Query: 363 EDSSVALKLISCAKLDD 379
           +     L+  S     D
Sbjct: 63  QACQQGLQHASTTTTPD 79

>NCAS0H00830 Chr8 complement(151809..152825) [1017 bp, 338 aa] {ON}
           Anc_6.21 YOR007C
          Length = 338

 Score = 32.0 bits (71), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 17/67 (25%), Positives = 35/67 (52%), Gaps = 4/67 (5%)

Query: 305 QEFKEKGTLSFSAGDYHTAFQNFEKSVNSLPHSHPLRAISLSNMIICRLKLGEYRKAIED 364
           + FK +G  + +A DY  A + + +++ +LP +     I  +N       + EY  AI+D
Sbjct: 100 ESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPTN----VIYYANRAAAYSSVKEYDNAIKD 155

Query: 365 SSVALKL 371
           +  A+++
Sbjct: 156 AEKAIEI 162

>Kpol_1037.26 s1037 complement(59590..60618) [1029 bp, 342 aa] {ON}
           complement(59590..60618) [1029 nt, 343 aa]
          Length = 342

 Score = 31.6 bits (70), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 16/67 (23%), Positives = 36/67 (53%), Gaps = 4/67 (5%)

Query: 305 QEFKEKGTLSFSAGDYHTAFQNFEKSVNSLPHSHPLRAISLSNMIICRLKLGEYRKAIED 364
           +  K +G  + +  DY  A + + +++ +LP +    A+  +N       L +Y +A+ED
Sbjct: 101 EALKLEGNKAMAGKDYELAIKKYTEAIATLPTN----AVYFANRAAAYSSLKKYDEAVED 156

Query: 365 SSVALKL 371
           ++ A+K+
Sbjct: 157 ANSAIKI 163

>AEL224W Chr5 (207712..209454) [1743 bp, 580 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR027W (STI1)
          Length = 580

 Score = 31.6 bits (70), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 18/68 (26%), Positives = 38/68 (55%), Gaps = 5/68 (7%)

Query: 305 QEFKEKGTLSFSAGDYHTAFQNFEKSVN-SLPHSHPLRAISLSNMIICRLKLGEYRKAIE 363
           +E+K++G  +F+A D+  A + F K++  S   +H L     SN   C   + ++R+A+ 
Sbjct: 5   EEYKKEGNSAFAAKDFEKAIELFGKAIEVSEQPNHVL----YSNRSACYASMRKFREALA 60

Query: 364 DSSVALKL 371
           D+   +++
Sbjct: 61  DAQECVRI 68

>Ecym_5213 Chr5 complement(455091..456341) [1251 bp, 416 aa] {ON}
           similar to Ashbya gossypii AFL214C
          Length = 416

 Score = 31.6 bits (70), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 30/57 (52%), Gaps = 2/57 (3%)

Query: 364 DSSVALKLISCAKLDDVIPASDPPKTFKEIWCKIVGNKAEAYE-HIEDYDKALKEYQ 419
           DSS  ++ + C  L  VI A     +F   + +  G +  +YE H   Y++ALKE+Q
Sbjct: 96  DSSYIMQRLKCGPLSRVIEAGTGSGSFSHAFARSAG-RVFSYEFHEVRYEQALKEFQ 151

>CAGL0H08195g Chr8 complement(804418..806169) [1752 bp, 583 aa] {ON}
           highly similar to uniprot|P15705 Saccharomyces
           cerevisiae YOR027w STI1
          Length = 583

 Score = 31.6 bits (70), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 18/66 (27%), Positives = 32/66 (48%), Gaps = 3/66 (4%)

Query: 306 EFKEKGTLSFSAGDYHTAFQNFEKSVNSLPHSHPLRAISLSNMIICRLKLGEYRKAIEDS 365
           E+K++G  +F A DY  A   F K++     S     +  SN   C   L ++ +A+ D+
Sbjct: 6   EYKQQGNAAFVAKDYEKAIDLFSKAIEV---SETPNHVFYSNRSACYASLKKFPEALNDA 62

Query: 366 SVALKL 371
              +K+
Sbjct: 63  EECVKI 68

>TDEL0A04840 Chr1 (851520..853250) [1731 bp, 576 aa] {ON} Anc_5.617
           YOR027W
          Length = 576

 Score = 31.6 bits (70), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 32/133 (24%), Positives = 57/133 (42%), Gaps = 24/133 (18%)

Query: 303 SYQEFKEKGTLSFSAGDYHTAFQNFEKSVN-SLPHSHPLRAISLSNMIICRLKLGEYRKA 361
           S  E+K++G  +F A DY  A + F K+++ S   +H L     SN   C   L ++ + 
Sbjct: 3   SADEYKQQGNAAFVAKDYEKAAELFGKAIDVSEQPNHVL----YSNRSACYTSLKKFAEG 58

Query: 362 IEDSSVALKLISCAKLDDVIPASDPPKTFKEIWCKIVGNKAEAYEHIEDYDKALKEYQLL 421
           ++D+        C K++   P           W K       A   + + + A K YQ  
Sbjct: 59  LKDAE------ECVKIN---PG----------WSKGYNRVGAAQFGLNNLEDAEKSYQKA 99

Query: 422 IKRGAASRKVMEG 434
           ++  +A++   EG
Sbjct: 100 LELDSANKAAKEG 112

>TDEL0F02030 Chr6 (370257..371117) [861 bp, 286 aa] {ON} Anc_3.314
           YBL029W
          Length = 286

 Score = 31.2 bits (69), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 22/38 (57%), Gaps = 2/38 (5%)

Query: 225 FQDLSLADQPNESSVPAQVSPMNSEILPPLVN--IGDD 260
           F DL++ DQ  + SV   +SP+ +  +PP  N   GDD
Sbjct: 25  FDDLAIFDQEEKESVVETISPILTVAIPPFANTEFGDD 62

>Smik_15.205 Chr15 (346899..348668) [1770 bp, 589 aa] {ON} YOR027W
           (REAL)
          Length = 589

 Score = 31.2 bits (69), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 29/130 (22%), Positives = 56/130 (43%), Gaps = 24/130 (18%)

Query: 306 EFKEKGTLSFSAGDYHTAFQNFEKSVN-SLPHSHPLRAISLSNMIICRLKLGEYRKAIED 364
           E+K++G  +F+A DY  A + F K++  S   +H L     SN   C   L ++  A+ D
Sbjct: 7   EYKQQGNSAFTAKDYDKAIELFTKAIEVSKTPNHVL----YSNRSACYASLKKFSDALND 62

Query: 365 SSVALKLISCAKLDDVIPASDPPKTFKEIWCKIVGNKAEAYEHIEDYDKALKEYQLLIKR 424
           +   +         ++ P+          W K       A+  + D D+A   Y+  ++ 
Sbjct: 63  AKECI---------NINPS----------WSKGYNRLGAAHLGLGDLDEAENNYKKALEL 103

Query: 425 GAASRKVMEG 434
            A+++   +G
Sbjct: 104 DASNKAAKDG 113

>YLR352W Chr12 (831116..833539) [2424 bp, 807 aa] {ON} Putative
           protein of unknown function with similarity to F-box
           proteins; interacts with Skp1p and Cdc53p; YLR352W is
           not an essential gene
          Length = 807

 Score = 31.2 bits (69), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 30/113 (26%), Positives = 52/113 (46%), Gaps = 13/113 (11%)

Query: 466 VAVAATSQVPSEKLERVQNINKKEKELERQ---KFLLHDKVQDRVREWCQNSEDDLRELL 522
           + VA   ++ S  L R   +NK  K L  +   +FL+  K   R    C+N +DDL + +
Sbjct: 101 IEVADFQELTSIGLGRSSEMNKMIKNLTNETLLEFLMLTKANLREFLACENIQDDLDDNI 160

Query: 523 SRFHL----IVDWVDWKNVSTADLVMPKRVKIVYLKAVTKTHPDKIQDSWPLE 571
            ++ L    ++  VD+   S             ++KA+ K +P+K  D + LE
Sbjct: 161 IKYILSPGKVLSVVDFCGCSGTTFTES------FIKALDKYYPNKSIDQYRLE 207

>NCAS0F03490 Chr6 complement(698757..700295) [1539 bp, 512 aa] {ON}
           Anc_3.142 YDL047W
          Length = 512

 Score = 31.2 bits (69), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 29/148 (19%), Positives = 60/148 (40%), Gaps = 22/148 (14%)

Query: 303 SYQEFKEKGTLSFSAGDYHTAFQNFEKSVNSLPHS---HPLRAISLSNMIICRLKLGEYR 359
           ++ + KE+     + G+ +   QN+ K++     +    P ++I  SN  + +LKL  ++
Sbjct: 4   AFADAKEQAVAFKNEGNTYIKEQNYMKAIELYSQAIELDPTQSIFFSNRALAQLKLDNFQ 63

Query: 360 KAIEDSSVALKLISCAKLDDVIPASDPPKTFKEIWCKIVGNKAEAYEHIEDYDKALKEYQ 419
             + D  VAL+L             DP         K    +  ++  +    KA  + Q
Sbjct: 64  SCMNDCDVALRL-------------DPKNI------KAYHRRGLSHLGLLQCKKARNDLQ 104

Query: 420 LLIKRGAASRKVMEGRRRCQKIVEPEKF 447
           +++K              C+K++  E+F
Sbjct: 105 VVLKAKPTDATAKRALAMCEKVIREERF 132

>AGL268C Chr7 complement(205872..207011) [1140 bp, 379 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR155W
           (CNS1)
          Length = 379

 Score = 30.8 bits (68), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 24/94 (25%), Positives = 37/94 (39%), Gaps = 1/94 (1%)

Query: 278 DAPSGHDAVSSPVAASIAMSALEFHSYQEFKEKGTLSFSAGDYHTAFQNFEKSVNSLPHS 337
           DA SG + V      ++A         + FK +G   +    +  A   + K +      
Sbjct: 52  DAASGEN-VELEALKALAYDGEPHEVAENFKNQGNDLYKVKRFRDARVMYNKGIEVKCDD 110

Query: 338 HPLRAISLSNMIICRLKLGEYRKAIEDSSVALKL 371
             +  + L N   C L+L  YR+ I D   ALKL
Sbjct: 111 AGISELLLLNRAACELELKNYRRCINDCREALKL 144

>CAGL0L04048g Chr12 (476407..478170) [1764 bp, 587 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121c TOM70
           or uniprot|P38825 Saccharomyces cerevisiae YHR117w TOM7
          Length = 587

 Score = 31.2 bits (69), Expect = 10.0,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 31/66 (46%), Gaps = 5/66 (7%)

Query: 306 EFKEKGTLSFSAGDYHTAFQNFEKSVNSLPHSHPLRAISLSNMIICRLKLGEYRKAIEDS 365
           E K++G   F   DY  A  N+ K    L +      +  SNM  C + L   ++AIE  
Sbjct: 88  ELKKRGNAYFKVKDYENAI-NYYKFALQLKND----PVFYSNMAACYISLEHNKEAIEAC 142

Query: 366 SVALKL 371
           S AL+L
Sbjct: 143 SKALEL 148

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.313    0.129    0.366 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 62,638,449
Number of extensions: 2745624
Number of successful extensions: 9471
Number of sequences better than 10.0: 181
Number of HSP's gapped: 9841
Number of HSP's successfully gapped: 197
Length of query: 597
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 482
Effective length of database: 40,294,809
Effective search space: 19422097938
Effective search space used: 19422097938
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 69 (31.2 bits)