Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_34.15946na 1ON27927913230.0
KLTH0H15048gna 1ON2963057272e-95
AFR531Wna 1ON2742845236e-65
SAKL0B05434gna 1ON3441064541e-53
Ecym_1475na 1ON3491034271e-49
ZYRO0D13992g5.586ON5871103383e-35
TDEL0A045305.586ON4841123302e-34
KAFR0A067205.586ON2351103143e-34
Kpol_1023.635.586ON5561093252e-33
KNAG0C060305.586ON3141093142e-33
NCAS0H028905.586ON5321093223e-33
Kwal_47.183375.586ON5361093215e-33
Ecym_14045.586ON5621093209e-33
SAKL0G06292g5.586ON5171093171e-32
AFR461C5.586ON5441093154e-32
NDAI0C006905.586ON6501113164e-32
KNAG0B033505.586ON6001093155e-32
NCAS0A079005.586ON3671093075e-32
KLTH0G05104g5.586ON5381093136e-32
TBLA0E028205.586ON3121093037e-32
Skud_8.555.586ON5351093111e-31
KLLA0F10109g5.586ON6231093131e-31
Smik_8.635.586ON5421093102e-31
Suva_8.625.586ON5451093083e-31
YHR006W (STP2)5.586ON5411093041e-30
TPHA0K002105.586ON4811093003e-30
YDR463W (STP1)5.586ON5191092933e-29
Smik_4.7425.586ON5281092924e-29
NDAI0H011105.586ON4541092852e-28
Skud_4.7395.586ON5141092836e-28
CAGL0K06413g5.586ON3591092771e-27
Suva_2.6395.586ON5161092802e-27
KAFR0C057105.586ON4421112721e-26
CAGL0E04312g5.586ON6881092724e-26
Kwal_26.93004.222ON3041231915e-16
TPHA0B009304.222ON347991775e-14
AFR588W4.222ON319941757e-14
Kpol_337.64.222ON4001001769e-14
SAKL0H26224gsingletonON227711702e-13
KNAG0B059404.222ON377941742e-13
NDAI0J020604.222ON489581742e-13
CAGL0H04873g4.222ON451621742e-13
SAKL0H03894g4.222ON358971722e-13
KLTH0D13618g4.222ON414941714e-13
Ecym_27684.222ON431941705e-13
YLR375W (STP3)4.222ON343941652e-12
Smik_12.4624.222ON341941652e-12
Skud_12.4604.222ON344941652e-12
NCAS0J013004.222ON435991653e-12
Suva_10.4914.222ON344941643e-12
KAFR0A061204.222ON3421331625e-12
KLLA0F07073g4.222ON5581381636e-12
ZYRO0B07436g4.222ON3431031617e-12
TDEL0E015204.222ON399941618e-12
CAGL0K04697g4.222ON515631618e-12
TBLA0A082004.222ON350581582e-11
TBLA0I027704.222ON613581582e-11
NCAS0A023604.222ON478581531e-10
Suva_4.2014.222ON503581521e-10
Skud_4.2064.222ON486581521e-10
NDAI0D045104.222ON560581503e-10
Smik_4.1904.222ON489581475e-10
YDL048C (STP4)4.222ON490581476e-10
Kpol_472.34.222ON3111401271e-07
TPHA0B023904.222ON3461451075e-05
Kpol_1065.153.281ON22060984e-04
KNAG0J008703.281ON28084950.001
AGL071C2.533ON39661960.001
KLLA0E18547g2.533ON43163960.002
Ecym_72552.533ON54461950.002
TBLA0I014802.533ON51364930.004
KAFR0A010903.281ON24963890.008
KNAG0H011803.281ON25466890.008
Skud_13.2262.533ON47564890.010
Suva_13.2462.533ON41964890.011
TPHA0M011803.281ON35065880.012
Smik_13.2492.533ON47364880.013
SAKL0A09482g2.533ON38859880.013
TBLA0H006608.425ON131177890.013
SAKL0D03146g3.281ON15762850.014
YMR070W (MOT3)2.533ON49064870.019
NCAS0I015603.281ON26659850.023
Kpol_1052.83.298ON38674850.027
ZYRO0B02002g2.533ON29488840.034
NDAI0K018602.533ON73061850.037
CAGL0K04631g4.214ON101358840.054
KNAG0G012808.144ON47259830.067
Ecym_21596.256ON46079820.073
KLLA0B07909g4.214ON92260820.086
TDEL0A030702.533ON23964800.086
Smik_4.2813.281ON23164800.094
KNAG0D041904.214ON101060820.096
NCAS0A021604.189ON412103810.100
SAKL0G18062g4.351ON123860820.10
Kwal_27.109253.281ON26461800.10
NCAS0F037403.518ON28896800.11
TPHA0C021608.425ON137561810.11
KAFR0B068104.351ON115560810.12
KAFR0C004903.281ON22459790.13
KNAG0E016003.518ON33892800.13
CAGL0K03003g2.533ON64760800.14
Smik_16.4507.543ON43233800.14
TPHA0G035102.533ON38761800.14
KLLA0F18524g3.281ON35761800.14
Suva_2.2003.281ON23261780.15
KAFR0A018602.533ON49066800.15
SAKL0A03476g6.256ON32268790.16
ZYRO0C13508g3.281ON18959770.17
TBLA0G022302.533ON21659780.17
YDR043C (NRG1)3.281ON23161780.17
Skud_4.2973.281ON23161780.18
Skud_16.4907.543ON40733790.18
Kpol_1023.1004.351ON91659790.19
KLTH0D06842g2.533ON50661790.20
Ecym_26543.281ON25760780.20
TPHA0C041902.533ON41761780.21
NDAI0A074703.281ON26359770.22
KLTH0C07172g3.281ON26561770.22
CAGL0K12078g3.281ON46363780.26
TBLA0I019703.281ON28852770.26
Kpol_1018.332.533ON58958780.26
Kpol_1002.256.256ON29493770.26
KLTH0C04884g3.298ON34278770.29
Kpol_529.138.425ON141061780.30
ZYRO0B07568g4.214ON61660770.30
Kpol_1052.183.281ON35761770.31
SAKL0H04070g4.214ON89971780.32
NDAI0I009906.256ON409106770.33
TDEL0D034303.281ON17559750.34
NCAS0A023104.214ON87960770.35
CAGL0M00594g4.351ON102078770.35
NDAI0D042404.214ON116997770.37
SAKL0D06776g1.326ON76760770.39
NDAI0C048608.425ON135061770.40
KNAG0D022208.130ON120654770.40
TPHA0B003804.351ON131055760.46
TDEL0D058603.518ON33058750.46
CAGL0M13189g2.598ON54159760.46
KLLA0C16005g6.256ON33175750.47
AFR580C4.214ON83860760.47
KAFR0E042704.351ON125577760.49
NDAI0D032404.351ON136260760.49
Kwal_26.80112.531ON19058740.50
Kwal_47.172418.144ON40360750.52
Ecym_27604.214ON93878750.60
NCAS0A048002.533ON51164750.61
TPHA0A039103.298ON35168740.62
KNAG0C058102.533ON55464750.64
KAFR0B021608.144ON45359740.66
Kwal_23.54007.543ON42933740.70
TBLA0I032803.518ON33088740.70
NDAI0C005602.598ON97259750.71
Ecym_62951.326ON66360740.71
Smik_13.584.351ON125360750.72
YML081W (TDA9)4.351ON125160740.79
Kwal_26.80212.533ON50760740.80
KLTH0D18062g4.351ON112861740.82
Skud_13.614.351ON125360740.82
ZYRO0A09416g8.425ON134661740.83
KNAG0F017106.256ON41364740.83
AGR031W3.281ON14059710.83
Kwal_47.166214.351ON117880740.90
KAFR0C003403.298ON39475730.92
TPHA0A039803.281ON31462730.92
Kpol_1001.14.351ON134155740.95
NCAS0A062504.351ON134160740.95
TDEL0B046708.144ON31259730.96
TPHA0C017608.486ON17160711.0
YER130C8.144ON44359731.1
CAGL0M01870g3.298ON31568721.1
NCAS0B028408.425ON115261731.1
KNAG0I020702.162ON57264731.1
TBLA0B061604.351ON138460731.1
Suva_5.2518.144ON44959721.1
Skud_5.2488.144ON44259721.2
Smik_6.4356.256ON38655721.3
Skud_16.486.256ON39855721.3
CAGL0L07480g3.281ON31459711.4
YMR037C (MSN2)2.598ON70459721.4
Skud_13.1932.598ON70459721.4
CAGL0K02145g8.144ON31759711.4
AER159C4.351ON119160721.4
KNAG0A070402.533ON35261711.4
NCAS0F009002.533ON52561721.4
TBLA0E047704.351ON165560721.5
KLTH0E06688g8.144ON39759711.5
Suva_2.3838.425ON131960721.5
YDR216W (ADR1)8.425ON132360721.5
Smik_4.4638.425ON132460721.5
Skud_4.4788.425ON132376721.6
YPL230W (USV1)6.256ON39155711.6
Suva_16.766.256ON39255711.6
Smik_5.2768.144ON44259711.6
CAGL0L03916g2.162ON64233721.6
Smik_5.1513.518ON38858711.6
YPR186C (PZF1)7.543ON42933711.6
Smik_13.2072.598ON70359721.6
KNAG0D009006.256ON32255711.7
NCAS0G012706.256ON27497701.8
NDAI0D040904.189ON45640711.8
ADL051Wna 2ON17335691.9
NDAI0A075403.298ON37077711.9
NDAI0B060203.518ON42658711.9
TBLA0I027004.214ON73758711.9
NDAI0B042902.162ON106455711.9
KLLA0B04477g4.351ON133261712.0
ZYRO0G19140g8.144ON55760712.0
KAFR0F039404.189ON45240702.0
Suva_5.1243.518ON40658702.1
Kpol_543.294.189ON45168702.2
KLLA0C17072g8.144ON47460702.2
NDAI0A056503.281ON33061702.2
KLLA0A02629g4.189ON55940702.3
Kpol_1050.116singletonON32962692.5
NDAI0H014002.533ON54160702.6
Suva_12.2184.351ON127090702.7
KNAG0J022503.296ON29667692.7
CAGL0K04257g4.189ON547105702.7
NCAS0D02520singletonON24356692.7
CAGL0H04213g4.351ON132153702.7
KLLA0F13046g8.425ON137961702.8
Kwal_14.14574.189ON51533692.9
ZYRO0B14894g4.351ON111961702.9
Klac_YGOB_Anc_3.5183.518ON23961683.2
Ecym_84038.144ON57359693.2
KLLA0F26961g2.598ON69459693.3
Skud_10.3514.351ON132771693.3
AGL246W8.486ON22759683.4
NCAS0B069602.162ON83964693.8
TPHA0C025802.598ON36559683.9
ZYRO0G20526g1.326ON849104683.9
KNAG0D040204.189ON48640684.1
KAFR0G030504.214ON74960684.2
Skud_2.1893.281ON22057674.2
TPHA0J006704.189ON66078684.3
YBR066C (NRG2)3.281ON22057674.3
KNAG0H034802.162ON79664684.5
SAKL0H24816g8.144ON41059684.5
KNAG0B067104.351ON105358684.7
KLTH0G17336g4.189ON48533674.9
Smik_2.1993.281ON22057665.1
Suva_4.3053.281ON22057665.4
Skud_7.3644.214ON81060675.4
TPHA0H018506.256ON36146675.7
Suva_7.3494.214ON81260675.9
ZYRO0F01012g2.598ON58459676.0
CAGL0E04884g8.425ON148961676.3
TDEL0B069102.598ON43759666.3
KAFR0B002807.543ON41663666.5
KAFR0J003402.533ON21862656.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_34.15946
         (279 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_34.15946 s34 complement(130149..130988) [840 bp, 279 aa] {O...   514   0.0  
KLTH0H15048g Chr8 (1303474..1304364) [891 bp, 296 aa] {ON} some ...   284   2e-95
AFR531W Chr6 (1389929..1390753) [825 bp, 274 aa] {ON} Unclear if...   206   6e-65
SAKL0B05434g Chr2 (467863..468897) [1035 bp, 344 aa] {ON} some s...   179   1e-53
Ecym_1475 Chr1 (978578..979627) [1050 bp, 349 aa] {ON} similar t...   169   1e-49
ZYRO0D13992g Chr4 (1178918..1180681) [1764 bp, 587 aa] {ON} simi...   134   3e-35
TDEL0A04530 Chr1 (805574..807028) [1455 bp, 484 aa] {ON} Anc_5.5...   131   2e-34
KAFR0A06720 Chr1 (1361355..1362062) [708 bp, 235 aa] {ON} Anc_5....   125   3e-34
Kpol_1023.63 s1023 complement(144388..146058) [1671 bp, 556 aa] ...   129   2e-33
KNAG0C06030 Chr3 (1176811..1177755) [945 bp, 314 aa] {ON} Anc_5....   125   2e-33
NCAS0H02890 Chr8 complement(564830..566428) [1599 bp, 532 aa] {O...   128   3e-33
Kwal_47.18337 s47 complement(787992..789602) [1611 bp, 536 aa] {...   128   5e-33
Ecym_1404 Chr1 complement(840220..841908) [1689 bp, 562 aa] {ON}...   127   9e-33
SAKL0G06292g Chr7 (522850..524403) [1554 bp, 517 aa] {ON} unipro...   126   1e-32
AFR461C Chr6 complement(1270007..1271641) [1635 bp, 544 aa] {ON}...   125   4e-32
NDAI0C00690 Chr3 complement(134897..136849) [1953 bp, 650 aa] {O...   126   4e-32
KNAG0B03350 Chr2 complement(647618..649420) [1803 bp, 600 aa] {O...   125   5e-32
NCAS0A07900 Chr1 complement(1570244..1571347) [1104 bp, 367 aa] ...   122   5e-32
KLTH0G05104g Chr7 (412304..413920) [1617 bp, 538 aa] {ON} simila...   125   6e-32
TBLA0E02820 Chr5 complement(699189..700127) [939 bp, 312 aa] {ON...   121   7e-32
Skud_8.55 Chr8 (100188..101795) [1608 bp, 535 aa] {ON} YHR006W (...   124   1e-31
KLLA0F10109g Chr6 complement(939195..941066) [1872 bp, 623 aa] {...   125   1e-31
Smik_8.63 Chr8 (97366..98994) [1629 bp, 542 aa] {ON} YHR006W (REAL)   124   2e-31
Suva_8.62 Chr8 (113740..115377) [1638 bp, 545 aa] {ON} YHR006W (...   123   3e-31
YHR006W Chr8 (117814..119439) [1626 bp, 541 aa] {ON}  STP2Transc...   121   1e-30
TPHA0K00210 Chr11 complement(34961..36406) [1446 bp, 481 aa] {ON...   120   3e-30
YDR463W Chr4 (1386816..1388375) [1560 bp, 519 aa] {ON}  STP1Tran...   117   3e-29
Smik_4.742 Chr4 (1308041..1309627) [1587 bp, 528 aa] {ON} YDR463...   117   4e-29
NDAI0H01110 Chr8 (247915..249279) [1365 bp, 454 aa] {ON} Anc_5.586    114   2e-28
Skud_4.739 Chr4 (1306825..1308369) [1545 bp, 514 aa] {ON} YDR463...   113   6e-28
CAGL0K06413g Chr11 (628640..629719) [1080 bp, 359 aa] {ON} some ...   111   1e-27
Suva_2.639 Chr2 (1139039..1140589) [1551 bp, 516 aa] {ON} YDR463...   112   2e-27
KAFR0C05710 Chr3 (1136694..1138022) [1329 bp, 442 aa] {ON} Anc_5...   109   1e-26
CAGL0E04312g Chr5 (412800..414866) [2067 bp, 688 aa] {ON} some s...   109   4e-26
Kwal_26.9300 s26 (1156241..1157155) [915 bp, 304 aa] {ON} YLR375...    78   5e-16
TPHA0B00930 Chr2 complement(212983..214026) [1044 bp, 347 aa] {O...    73   5e-14
AFR588W Chr6 (1496952..1497911) [960 bp, 319 aa] {ON} Syntenic h...    72   7e-14
Kpol_337.6 s337 (17510..18712) [1203 bp, 400 aa] {ON} (17510..18...    72   9e-14
SAKL0H26224g Chr8 (2308056..2308739) [684 bp, 227 aa] {ON} some ...    70   2e-13
KNAG0B05940 Chr2 (1165682..1166815) [1134 bp, 377 aa] {ON} Anc_4...    72   2e-13
NDAI0J02060 Chr10 (505150..506619) [1470 bp, 489 aa] {ON} Anc_4....    72   2e-13
CAGL0H04873g Chr8 complement(465069..466424) [1356 bp, 451 aa] {...    72   2e-13
SAKL0H03894g Chr8 complement(357602..358678) [1077 bp, 358 aa] {...    71   2e-13
KLTH0D13618g Chr4 (1112089..1113333) [1245 bp, 414 aa] {ON} simi...    70   4e-13
Ecym_2768 Chr2 (1495608..1496903) [1296 bp, 431 aa] {ON} similar...    70   5e-13
YLR375W Chr12 (871697..872728) [1032 bp, 343 aa] {ON}  STP3Zinc-...    68   2e-12
Smik_12.462 Chr12 (810413..811438) [1026 bp, 341 aa] {ON} YLR375...    68   2e-12
Skud_12.460 Chr12 (811208..812242) [1035 bp, 344 aa] {ON} YLR375...    68   2e-12
NCAS0J01300 Chr10 (225659..226966) [1308 bp, 435 aa] {ON} Anc_4....    68   3e-12
Suva_10.491 Chr10 (836816..837094,837128..837883) [1035 bp, 344 ...    68   3e-12
KAFR0A06120 Chr1 complement(1238549..1239577) [1029 bp, 342 aa] ...    67   5e-12
KLLA0F07073g Chr6 (675221..676897) [1677 bp, 558 aa] {ON} some s...    67   6e-12
ZYRO0B07436g Chr2 complement(581225..582256) [1032 bp, 343 aa] {...    67   7e-12
TDEL0E01520 Chr5 complement(297717..298916) [1200 bp, 399 aa] {O...    67   8e-12
CAGL0K04697g Chr11 (459195..460742) [1548 bp, 515 aa] {ON} some ...    67   8e-12
TBLA0A08200 Chr1 complement(2024809..2025861) [1053 bp, 350 aa] ...    65   2e-11
TBLA0I02770 Chr9 (650889..652730) [1842 bp, 613 aa] {ON} Anc_4.2...    65   2e-11
NCAS0A02360 Chr1 (448263..449699) [1437 bp, 478 aa] {ON} Anc_4.222     64   1e-10
Suva_4.201 Chr4 complement(354498..356009) [1512 bp, 503 aa] {ON...    63   1e-10
Skud_4.206 Chr4 complement(361956..363416) [1461 bp, 486 aa] {ON...    63   1e-10
NDAI0D04510 Chr4 complement(1057468..1059150) [1683 bp, 560 aa] ...    62   3e-10
Smik_4.190 Chr4 complement(347829..349298) [1470 bp, 489 aa] {ON...    61   5e-10
YDL048C Chr4 complement(366739..368211) [1473 bp, 490 aa] {ON}  ...    61   6e-10
Kpol_472.3 s472 complement(4365..5300) [936 bp, 311 aa] {ON} com...    54   1e-07
TPHA0B02390 Chr2 complement(547109..548149) [1041 bp, 346 aa] {O...    46   5e-05
Kpol_1065.15 s1065 (43237..43899) [663 bp, 220 aa] {ON} (43237.....    42   4e-04
KNAG0J00870 Chr10 complement(148421..149263) [843 bp, 280 aa] {O...    41   0.001
AGL071C Chr7 complement(574723..575913) [1191 bp, 396 aa] {ON} S...    42   0.001
KLLA0E18547g Chr5 complement(1648263..1649558) [1296 bp, 431 aa]...    42   0.002
Ecym_7255 Chr7 complement(537346..538980) [1635 bp, 544 aa] {ON}...    41   0.002
TBLA0I01480 Chr9 (321045..322586) [1542 bp, 513 aa] {ON} Anc_2.5...    40   0.004
KAFR0A01090 Chr1 complement(209790..210539) [750 bp, 249 aa] {ON...    39   0.008
KNAG0H01180 Chr8 (200503..201267) [765 bp, 254 aa] {ON} Anc_3.28...    39   0.008
Skud_13.226 Chr13 (383462..383482,383520..384161,384207..384971)...    39   0.010
Suva_13.246 Chr13 (390482..391741) [1260 bp, 419 aa] {ON} YMR070...    39   0.011
TPHA0M01180 Chr13 complement(237368..238420) [1053 bp, 350 aa] {...    39   0.012
Smik_13.249 Chr13 (393264..393311,393345..394718) [1422 bp, 473 ...    39   0.013
SAKL0A09482g Chr1 (831930..833096) [1167 bp, 388 aa] {ON} some s...    39   0.013
TBLA0H00660 Chr8 complement(139075..143010) [3936 bp, 1311 aa] {...    39   0.013
SAKL0D03146g Chr4 complement(256292..256765) [474 bp, 157 aa] {O...    37   0.014
YMR070W Chr13 (409154..410626) [1473 bp, 490 aa] {ON}  MOT3Trans...    38   0.019
NCAS0I01560 Chr9 (291561..292361) [801 bp, 266 aa] {ON} Anc_3.281      37   0.023
Kpol_1052.8 s1052 complement(23868..25028) [1161 bp, 386 aa] {ON...    37   0.027
ZYRO0B02002g Chr2 (162068..162952) [885 bp, 294 aa] {ON} some si...    37   0.034
NDAI0K01860 Chr11 complement(417678..419870) [2193 bp, 730 aa] {...    37   0.037
CAGL0K04631g Chr11 complement(441550..444591) [3042 bp, 1013 aa]...    37   0.054
KNAG0G01280 Chr7 complement(286134..287552) [1419 bp, 472 aa] {O...    37   0.067
Ecym_2159 Chr2 (304191..305573) [1383 bp, 460 aa] {ON} similar t...    36   0.073
KLLA0B07909g Chr2 (697885..700653) [2769 bp, 922 aa] {ON} some s...    36   0.086
TDEL0A03070 Chr1 (549360..550079) [720 bp, 239 aa] {ON} Anc_2.53...    35   0.086
Smik_4.281 Chr4 complement(509413..510108) [696 bp, 231 aa] {ON}...    35   0.094
KNAG0D04190 Chr4 complement(754846..757878) [3033 bp, 1010 aa] {...    36   0.096
NCAS0A02160 Chr1 complement(406753..407991) [1239 bp, 412 aa] {O...    36   0.100
SAKL0G18062g Chr7 complement(1562943..1566659) [3717 bp, 1238 aa...    36   0.10 
Kwal_27.10925 s27 complement(559077..559871) [795 bp, 264 aa] {O...    35   0.10 
NCAS0F03740 Chr6 complement(752361..753227) [867 bp, 288 aa] {ON...    35   0.11 
TPHA0C02160 Chr3 complement(486620..490747) [4128 bp, 1375 aa] {...    36   0.11 
KAFR0B06810 Chr2 complement(1416866..1420333) [3468 bp, 1155 aa]...    36   0.12 
KAFR0C00490 Chr3 complement(97556..98230) [675 bp, 224 aa] {ON} ...    35   0.13 
KNAG0E01600 Chr5 complement(319141..320157) [1017 bp, 338 aa] {O...    35   0.13 
CAGL0K03003g Chr11 (277585..279528) [1944 bp, 647 aa] {ON} weakl...    35   0.14 
Smik_16.450 Chr16 complement(772259..773557) [1299 bp, 432 aa] {...    35   0.14 
TPHA0G03510 Chr7 (750272..751435) [1164 bp, 387 aa] {ON} Anc_2.5...    35   0.14 
KLLA0F18524g Chr6 complement(1701498..1702571) [1074 bp, 357 aa]...    35   0.14 
Suva_2.200 Chr2 complement(341892..342590) [699 bp, 232 aa] {ON}...    35   0.15 
KAFR0A01860 Chr1 (387980..389452) [1473 bp, 490 aa] {ON} Anc_2.5...    35   0.15 
SAKL0A03476g Chr1 (319246..320214) [969 bp, 322 aa] {ON} some si...    35   0.16 
ZYRO0C13508g Chr3 complement(1068164..1068733) [570 bp, 189 aa] ...    34   0.17 
TBLA0G02230 Chr7 (580915..581565) [651 bp, 216 aa] {ON} Anc_2.53...    35   0.17 
YDR043C Chr4 complement(542674..543369) [696 bp, 231 aa] {ON}  N...    35   0.17 
Skud_4.297 Chr4 complement(519166..519861) [696 bp, 231 aa] {ON}...    35   0.18 
Skud_16.490 Chr16 complement(852079..853302) [1224 bp, 407 aa] {...    35   0.18 
Kpol_1023.100 s1023 (235260..238010) [2751 bp, 916 aa] {ON} (235...    35   0.19 
KLTH0D06842g Chr4 (597659..599179) [1521 bp, 506 aa] {ON} some s...    35   0.20 
Ecym_2654 Chr2 (1266751..1267524) [774 bp, 257 aa] {ON} similar ...    35   0.20 
TPHA0C04190 Chr3 (901757..903010) [1254 bp, 417 aa] {ON} Anc_2.5...    35   0.21 
NDAI0A07470 Chr1 complement(1702035..1702826) [792 bp, 263 aa] {...    34   0.22 
KLTH0C07172g Chr3 complement(620315..621112) [798 bp, 265 aa] {O...    34   0.22 
CAGL0K12078g Chr11 complement(1169818..1171209) [1392 bp, 463 aa...    35   0.26 
TBLA0I01970 Chr9 complement(446033..446899) [867 bp, 288 aa] {ON...    34   0.26 
Kpol_1018.33 s1018 complement(96025..97794) [1770 bp, 589 aa] {O...    35   0.26 
Kpol_1002.25 s1002 (79397..80281) [885 bp, 294 aa] {ON} (79397.....    34   0.26 
KLTH0C04884g Chr3 complement(422344..423372) [1029 bp, 342 aa] {...    34   0.29 
Kpol_529.13 s529 complement(28325..32557) [4233 bp, 1410 aa] {ON...    35   0.30 
ZYRO0B07568g Chr2 (595114..596964) [1851 bp, 616 aa] {ON} some s...    34   0.30 
Kpol_1052.18 s1052 (58087..59160) [1074 bp, 357 aa] {ON} (58087....    34   0.31 
SAKL0H04070g Chr8 (379179..381878) [2700 bp, 899 aa] {ON} some s...    35   0.32 
NDAI0I00990 Chr9 complement(236716..237945) [1230 bp, 409 aa] {O...    34   0.33 
TDEL0D03430 Chr4 (635293..635820) [528 bp, 175 aa] {ON} Anc_3.28...    33   0.34 
NCAS0A02310 Chr1 complement(433632..436271) [2640 bp, 879 aa] {O...    34   0.35 
CAGL0M00594g Chr13 (70659..73721) [3063 bp, 1020 aa] {ON} simila...    34   0.35 
NDAI0D04240 Chr4 complement(993054..996563) [3510 bp, 1169 aa] {...    34   0.37 
SAKL0D06776g Chr4 (561887..564190) [2304 bp, 767 aa] {ON} weakly...    34   0.39 
NDAI0C04860 Chr3 (1123119..1127171) [4053 bp, 1350 aa] {ON} Anc_...    34   0.40 
KNAG0D02220 Chr4 (378969..382589) [3621 bp, 1206 aa] {ON} Anc_8....    34   0.40 
TPHA0B00380 Chr2 (78891..82823) [3933 bp, 1310 aa] {ON} Anc_4.35...    34   0.46 
TDEL0D05860 Chr4 complement(1064492..1065484) [993 bp, 330 aa] {...    33   0.46 
CAGL0M13189g Chr13 complement(1295843..1297468) [1626 bp, 541 aa...    34   0.46 
KLLA0C16005g Chr3 (1397274..1398269) [996 bp, 331 aa] {ON} some ...    33   0.47 
AFR580C Chr6 complement(1478501..1481017) [2517 bp, 838 aa] {ON}...    34   0.47 
KAFR0E04270 Chr5 complement(859635..863402) [3768 bp, 1255 aa] {...    34   0.49 
NDAI0D03240 Chr4 complement(769306..773394) [4089 bp, 1362 aa] {...    34   0.49 
Kwal_26.8011 s26 complement(611115..611687) [573 bp, 190 aa] {ON...    33   0.50 
Kwal_47.17241 s47 (312857..314068) [1212 bp, 403 aa] {ON} YER130...    33   0.52 
Ecym_2760 Chr2 complement(1473533..1476349) [2817 bp, 938 aa] {O...    33   0.60 
NCAS0A04800 Chr1 complement(959067..960602) [1536 bp, 511 aa] {O...    33   0.61 
TPHA0A03910 Chr1 complement(862763..863818) [1056 bp, 351 aa] {O...    33   0.62 
KNAG0C05810 Chr3 complement(1127391..1129055) [1665 bp, 554 aa] ...    33   0.64 
KAFR0B02160 Chr2 complement(422203..423564) [1362 bp, 453 aa] {O...    33   0.66 
Kwal_23.5400 s23 complement(1143487..1144776) [1290 bp, 429 aa] ...    33   0.70 
TBLA0I03280 Chr9 complement(796048..797040) [993 bp, 330 aa] {ON...    33   0.70 
NDAI0C00560 Chr3 (104390..107308) [2919 bp, 972 aa] {ON} Anc_2.598     33   0.71 
Ecym_6295 Chr6 complement(553427..555418) [1992 bp, 663 aa] {ON}...    33   0.71 
Smik_13.58 Chr13 (102509..106270) [3762 bp, 1253 aa] {ON} YML081...    33   0.72 
YML081W Chr13 (104777..108532) [3756 bp, 1251 aa] {ON}  TDA9DNA-...    33   0.79 
Kwal_26.8021 s26 (613992..615515) [1524 bp, 507 aa] {ON} YMR070W...    33   0.80 
KLTH0D18062g Chr4 (1493355..1496741) [3387 bp, 1128 aa] {ON} sim...    33   0.82 
Skud_13.61 Chr13 (104114..107875) [3762 bp, 1253 aa] {ON} YML081...    33   0.82 
ZYRO0A09416g Chr1 (756859..760899) [4041 bp, 1346 aa] {ON} simil...    33   0.83 
KNAG0F01710 Chr6 (320407..321648) [1242 bp, 413 aa] {ON} Anc_6.2...    33   0.83 
AGR031W Chr7 (769920..770342) [423 bp, 140 aa] {ON} Syntenic hom...    32   0.83 
Kwal_47.16621 s47 complement(32712..36248) [3537 bp, 1178 aa] {O...    33   0.90 
KAFR0C00340 Chr3 complement(65838..67022) [1185 bp, 394 aa] {ON}...    33   0.92 
TPHA0A03980 Chr1 (885841..886785) [945 bp, 314 aa] {ON} Anc_3.28...    33   0.92 
Kpol_1001.1 s1001 (3077..7102) [4026 bp, 1341 aa] {ON} (3077..71...    33   0.95 
NCAS0A06250 Chr1 complement(1234566..1238591) [4026 bp, 1341 aa]...    33   0.95 
TDEL0B04670 Chr2 (830511..831449) [939 bp, 312 aa] {ON} Anc_8.14...    33   0.96 
TPHA0C01760 Chr3 (402424..402939) [516 bp, 171 aa] {ON} Anc_8.48...    32   1.0  
YER130C Chr5 complement(421115..422446) [1332 bp, 443 aa] {ON} P...    33   1.1  
CAGL0M01870g Chr13 complement(219813..220760) [948 bp, 315 aa] {...    32   1.1  
NCAS0B02840 Chr2 complement(483481..486939) [3459 bp, 1152 aa] {...    33   1.1  
KNAG0I02070 Chr9 (402292..404010) [1719 bp, 572 aa] {ON} Anc_2.1...    33   1.1  
TBLA0B06160 Chr2 (1454045..1458199) [4155 bp, 1384 aa] {ON} Anc_...    33   1.1  
Suva_5.251 Chr5 complement(396841..398190) [1350 bp, 449 aa] {ON...    32   1.1  
Skud_5.248 Chr5 (399138..400466) [1329 bp, 442 aa] {ON} YER130C ...    32   1.2  
Smik_6.435 Chr6 complement(707873..709033) [1161 bp, 386 aa] {ON...    32   1.3  
Skud_16.48 Chr16 (88821..90017) [1197 bp, 398 aa] {ON} YPL230W (...    32   1.3  
CAGL0L07480g Chr12 complement(824237..825181) [945 bp, 314 aa] {...    32   1.4  
YMR037C Chr13 complement(344403..346517) [2115 bp, 704 aa] {ON} ...    32   1.4  
Skud_13.193 Chr13 complement(330998..333112) [2115 bp, 704 aa] {...    32   1.4  
CAGL0K02145g Chr11 (190884..191837) [954 bp, 317 aa] {ON} some s...    32   1.4  
AER159C Chr5 complement(935544..939119) [3576 bp, 1191 aa] {ON} ...    32   1.4  
KNAG0A07040 Chr1 (1102385..1103443) [1059 bp, 352 aa] {ON} Anc_2...    32   1.4  
NCAS0F00900 Chr6 complement(179873..181450) [1578 bp, 525 aa] {O...    32   1.4  
TBLA0E04770 Chr5 complement(1228439..1233406) [4968 bp, 1655 aa]...    32   1.5  
KLTH0E06688g Chr5 (614548..615741) [1194 bp, 397 aa] {ON} weakly...    32   1.5  
Suva_2.383 Chr2 (674568..678527) [3960 bp, 1319 aa] {ON} YDR216W...    32   1.5  
YDR216W Chr4 (895035..899006) [3972 bp, 1323 aa] {ON}  ADR1Carbo...    32   1.5  
Smik_4.463 Chr4 (838900..842874) [3975 bp, 1324 aa] {ON} YDR216W...    32   1.5  
Skud_4.478 Chr4 (849367..853338) [3972 bp, 1323 aa] {ON} YDR216W...    32   1.6  
YPL230W Chr16 (115312..116487) [1176 bp, 391 aa] {ON}  USV1Putat...    32   1.6  
Suva_16.76 Chr16 (124796..125974) [1179 bp, 392 aa] {ON} YPL230W...    32   1.6  
Smik_5.276 Chr5 complement(429983..431311) [1329 bp, 442 aa] {ON...    32   1.6  
CAGL0L03916g Chr12 complement(450952..452880) [1929 bp, 642 aa] ...    32   1.6  
Smik_5.151 Chr5 complement(215590..216756) [1167 bp, 388 aa] {ON...    32   1.6  
YPR186C Chr16 complement(909733..911022) [1290 bp, 429 aa] {ON} ...    32   1.6  
Smik_13.207 Chr13 complement(338510..340621) [2112 bp, 703 aa] {...    32   1.6  
KNAG0D00900 Chr4 (144302..145270) [969 bp, 322 aa] {ON} Anc_6.25...    32   1.7  
NCAS0G01270 Chr7 (228699..229523) [825 bp, 274 aa] {ON} Anc_6.256      32   1.8  
NDAI0D04090 Chr4 complement(959363..960733) [1371 bp, 456 aa] {O...    32   1.8  
ADL051W Chr4 (595493..596014) [522 bp, 173 aa] {ON} NOHBY404; No...    31   1.9  
NDAI0A07540 Chr1 (1730558..1731670) [1113 bp, 370 aa] {ON} Anc_3...    32   1.9  
NDAI0B06020 Chr2 complement(1462374..1463654) [1281 bp, 426 aa] ...    32   1.9  
TBLA0I02700 Chr9 complement(630467..632680) [2214 bp, 737 aa] {O...    32   1.9  
NDAI0B04290 Chr2 (1077647..1080841) [3195 bp, 1064 aa] {ON} Anc_...    32   1.9  
KLLA0B04477g Chr2 (400019..404017) [3999 bp, 1332 aa] {ON} simil...    32   2.0  
ZYRO0G19140g Chr7 complement(1587180..1588853) [1674 bp, 557 aa]...    32   2.0  
KAFR0F03940 Chr6 complement(769153..770511) [1359 bp, 452 aa] {O...    32   2.0  
Suva_5.124 Chr5 complement(186591..187811) [1221 bp, 406 aa] {ON...    32   2.1  
Kpol_543.29 s543 complement(59228..60583) [1356 bp, 451 aa] {ON}...    32   2.2  
KLLA0C17072g Chr3 (1494101..1495525) [1425 bp, 474 aa] {ON} weak...    32   2.2  
NDAI0A05650 Chr1 (1275925..1276917) [993 bp, 330 aa] {ON} Anc_3....    32   2.2  
KLLA0A02629g Chr1 complement(233822..235501) [1680 bp, 559 aa] {...    32   2.3  
Kpol_1050.116 s1050 complement(264361..265350) [990 bp, 329 aa] ...    31   2.5  
NDAI0H01400 Chr8 complement(340037..341662) [1626 bp, 541 aa] {O...    32   2.6  
Suva_12.218 Chr12 complement(338418..342230) [3813 bp, 1270 aa] ...    32   2.7  
KNAG0J02250 Chr10 (421560..422450) [891 bp, 296 aa] {ON}               31   2.7  
CAGL0K04257g Chr11 complement(392116..393759) [1644 bp, 547 aa] ...    32   2.7  
NCAS0D02520 Chr4 (478610..479341) [732 bp, 243 aa] {ON}                31   2.7  
CAGL0H04213g Chr8 (398544..402509) [3966 bp, 1321 aa] {ON} simil...    32   2.7  
KLLA0F13046g Chr6 (1201353..1205492) [4140 bp, 1379 aa] {ON} wea...    32   2.8  
Kwal_14.1457 s14 complement(331338..332885) [1548 bp, 515 aa] {O...    31   2.9  
ZYRO0B14894g Chr2 complement(1212853..1216212) [3360 bp, 1119 aa...    32   2.9  
Klac_YGOB_Anc_3.518 Chr2 complement(46736..47455) [720 bp, 239 a...    31   3.2  
Ecym_8403 Chr8 complement(832403..834124) [1722 bp, 573 aa] {ON}...    31   3.2  
KLLA0F26961g Chr6 (2486804..2488888) [2085 bp, 694 aa] {ON} weak...    31   3.3  
Skud_10.351 Chr10 complement(617553..621332,621389..621469,62146...    31   3.3  
AGL246W Chr7 (240857..241540) [684 bp, 227 aa] {ON} Syntenic hom...    31   3.4  
NCAS0B06960 Chr2 (1324315..1326834) [2520 bp, 839 aa] {ON} Anc_2...    31   3.8  
TPHA0C02580 Chr3 (572294..573391) [1098 bp, 365 aa] {ON} Anc_2.5...    31   3.9  
ZYRO0G20526g Chr7 (1691182..1693731) [2550 bp, 849 aa] {ON} weak...    31   3.9  
KNAG0D04020 Chr4 complement(726098..727558) [1461 bp, 486 aa] {O...    31   4.1  
KAFR0G03050 Chr7 complement(633014..635263) [2250 bp, 749 aa] {O...    31   4.2  
Skud_2.189 Chr2 complement(338427..339089) [663 bp, 220 aa] {ON}...    30   4.2  
TPHA0J00670 Chr10 complement(148901..150883) [1983 bp, 660 aa] {...    31   4.3  
YBR066C Chr2 complement(370037..370699) [663 bp, 220 aa] {ON}  N...    30   4.3  
KNAG0H03480 Chr8 (648636..651026) [2391 bp, 796 aa] {ON} Anc_2.1...    31   4.5  
SAKL0H24816g Chr8 complement(2158299..2159531) [1233 bp, 410 aa]...    31   4.5  
KNAG0B06710 Chr2 complement(1325084..1328245) [3162 bp, 1053 aa]...    31   4.7  
KLTH0G17336g Chr7 (1500141..1501598) [1458 bp, 485 aa] {ON} some...    30   4.9  
Smik_2.199 Chr2 complement(351916..352578) [663 bp, 220 aa] {ON}...    30   5.1  
Suva_4.305 Chr4 complement(536954..537616) [663 bp, 220 aa] {ON}...    30   5.4  
Skud_7.364 Chr7 complement(609656..612088) [2433 bp, 810 aa] {ON...    30   5.4  
TPHA0H01850 Chr8 complement(425548..426633) [1086 bp, 361 aa] {O...    30   5.7  
Suva_7.349 Chr7 complement(598667..601105) [2439 bp, 812 aa] {ON...    30   5.9  
ZYRO0F01012g Chr6 (78166..79920) [1755 bp, 584 aa] {ON} similar ...    30   6.0  
CAGL0E04884g Chr5 complement(469532..474001) [4470 bp, 1489 aa] ...    30   6.3  
TDEL0B06910 Chr2 complement(1222435..1223748) [1314 bp, 437 aa] ...    30   6.3  
KAFR0B00280 Chr2 (65006..66256) [1251 bp, 416 aa] {ON} Anc_7.543...    30   6.5  
KAFR0J00340 Chr10 complement(58635..59291) [657 bp, 218 aa] {ON}       30   6.6  
TDEL0E01590 Chr5 (312468..314780) [2313 bp, 770 aa] {ON} Anc_4.2...    30   6.6  
Suva_16.518 Chr16 complement(892114..893397) [1284 bp, 427 aa] {...    30   6.9  
TBLA0H02830 Chr8 complement(659893..662133) [2241 bp, 746 aa] {O...    30   7.2  
SAKL0F16170g Chr6 complement(1310627..1311940) [1314 bp, 437 aa]...    30   7.2  
NDAI0B01930 Chr2 (468399..469709) [1311 bp, 436 aa] {ON} Anc_8.144     30   7.3  
ACL057W Chr3 (264934..266496) [1563 bp, 520 aa] {ON} Syntenic ho...    30   7.4  
Skud_5.137 Chr5 complement(208578..209762) [1185 bp, 394 aa] {ON...    30   7.4  
Smik_6.150 Chr6 complement(248356..250776) [2421 bp, 806 aa] {ON...    30   7.6  
KAFR0I02370 Chr9 (480591..481766) [1176 bp, 391 aa] {ON} Anc_3.5...    30   8.0  
Smik_11.186 Chr11 (309525..311450) [1926 bp, 641 aa] {ON} YKL062...    30   8.1  
KAFR0B06360 Chr2 (1315900..1317783) [1884 bp, 627 aa] {ON} Anc_8...    30   8.1  
Kpol_1031.42 s1031 complement(101434..102513) [1080 bp, 359 aa] ...    30   8.3  
TDEL0F05500 Chr6 (1024045..1027668) [3624 bp, 1207 aa] {ON} Anc_...    30   8.4  
KNAG0E02610 Chr5 complement(517056..519296) [2241 bp, 746 aa] {O...    30   8.5  
YKL062W Chr11 (323228..325120) [1893 bp, 630 aa] {ON}  MSN4Trans...    30   8.5  
Kwal_27.10467 s27 complement(354071..354979) [909 bp, 302 aa] {O...    30   8.6  
ZYRO0E08426g Chr5 complement(673465..673980) [516 bp, 171 aa] {O...    29   8.6  
KLTH0D08734g Chr4 complement(730214..732247) [2034 bp, 677 aa] {...    30   8.8  
KNAG0M00350 Chr13 (51209..54439) [3231 bp, 1076 aa] {ON} Anc_4.3...    30   8.8  
Kpol_1050.19 s1050 complement(48007..48672) [666 bp, 221 aa] {ON...    29   8.9  
Skud_11.167 Chr11 (302970..304856) [1887 bp, 628 aa] {ON} YKL062...    30   9.1  
Kpol_472.10 s472 (31069..33561) [2493 bp, 830 aa] {ON} (31069..3...    30   9.4  
KAFR0C02980 Chr3 (595202..595879) [678 bp, 225 aa] {ON} Anc_8.14...    29   9.4  
TPHA0F01810 Chr6 (416859..418136) [1278 bp, 425 aa] {ON} Anc_2.1...    30   9.5  
KNAG0A02260 Chr1 (205510..206118) [609 bp, 202 aa] {ON} Anc_8.48...    29   9.8  
YGR067C Chr7 complement(622372..624786) [2415 bp, 804 aa] {ON} P...    30   9.8  
TPHA0G00270 Chr7 (43982..45400) [1419 bp, 472 aa] {ON} Anc_7.543...    30   10.0 

>Kwal_34.15946 s34 complement(130149..130988) [840 bp, 279 aa] {ON}
           YDR463W (STP1) - Nuclear-localized protein containing
           zinc finger motifs [contig 272] FULL
          Length = 279

 Score =  514 bits (1323), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 247/279 (88%), Positives = 247/279 (88%)

Query: 1   MGYIQFDRVDVPEDNVVSLGLLNKQLERQRGSVEMGEIGAEMGVTCDEIDSKPVHTRLCA 60
           MGYIQFDRVDVPEDNVVSLGLLNKQLERQRGSVEMGEIGAEMGVTCDEIDSKPVHTRLCA
Sbjct: 1   MGYIQFDRVDVPEDNVVSLGLLNKQLERQRGSVEMGEIGAEMGVTCDEIDSKPVHTRLCA 60

Query: 61  TSASIAQMWESLLGFEHYSEVPNAGQPSLDEETCGLRFDTVPSVESFXXXXXXXXXXXXX 120
           TSASIAQMWESLLGFEHYSEVPNAGQPSLDEETCGLRFDTVPSVESF             
Sbjct: 61  TSASIAQMWESLLGFEHYSEVPNAGQPSLDEETCGLRFDTVPSVESFCTDADLAASASST 120

Query: 121 XXYSVVDDLDHVHQPGNGTRPPACLETQPSSFGDXXXXXXXXXXXXXXXXXMFQCAFCPS 180
             YSVVDDLDHVHQPGNGTRPPACLETQPSSFGD                 MFQCAFCPS
Sbjct: 121 CSYSVVDDLDHVHQPGNGTRPPACLETQPSSFGDTPSAINTPAAAAAASTAMFQCAFCPS 180

Query: 181 NFKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHASGEFSRKDTYKTHLKSIHFVYPVGVA 240
           NFKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHASGEFSRKDTYKTHLKSIHFVYPVGVA
Sbjct: 181 NFKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHASGEFSRKDTYKTHLKSIHFVYPVGVA 240

Query: 241 KSQRSRSTGRCAACYQEFRNNNEWLTQHVESRSCSGLHK 279
           KSQRSRSTGRCAACYQEFRNNNEWLTQHVESRSCSGLHK
Sbjct: 241 KSQRSRSTGRCAACYQEFRNNNEWLTQHVESRSCSGLHK 279

>KLTH0H15048g Chr8 (1303474..1304364) [891 bp, 296 aa] {ON} some
           similarities with uniprot|P38704 Saccharomyces
           cerevisiae YHR006W STP2 Transcription factor activated
           by proteolytic processing in response to signals from
           the SPS sensor system for external amino acids activates
           transcription of amino acid permease genes
          Length = 296

 Score =  284 bits (727), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 159/305 (52%), Positives = 179/305 (58%), Gaps = 49/305 (16%)

Query: 1   MGYIQFDRVDVPEDNVVSLGLLNKQ--------------------------LERQRGSVE 34
           MGYIQFD+VDVPEDNVVSLGLL++Q                            R+ G   
Sbjct: 1   MGYIQFDKVDVPEDNVVSLGLLSRQLQKQQLGQLGELAGLGDEYASEYASGFGREYGGEY 60

Query: 35  MGEIGAEMGVTCDEIDSKPVHTRLCATSASIAQMWESLLGFEHYSEVPNAGQPSLDEETC 94
            GE G E      E   K VHT L ATSASIAQ W +LLGF+HY    + G+PSLDEETC
Sbjct: 61  SGEYGHEYR---GEYARKSVHTTLSATSASIAQTWHALLGFDHYDSASD-GKPSLDEETC 116

Query: 95  GLRFDTVPSVESFXXXXXXXXXXXXXXXYSVVDDLDHVHQPGNGTRPPACLETQPSSFGD 154
           G+RFDTVP+  +                  V        + G+    PA L         
Sbjct: 117 GVRFDTVPAAIAAASMASSSSSSCTERSALVPASPASSTECGSAGAKPAAL--------- 167

Query: 155 XXXXXXXXXXXXXXXXXMFQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHA 214
                             FQCAFCPS+FKVKGYLTRHMKKHLVTKDF+CPFWS DCRCHA
Sbjct: 168 ----------SGAAMQQPFQCAFCPSSFKVKGYLTRHMKKHLVTKDFQCPFWSEDCRCHA 217

Query: 215 SGEFSRKDTYKTHLKSIHFVYPVGVAKSQRSRSTGRCAACYQEFRNNNEWLTQHVESRSC 274
           SGEFSRKDTYKTHLKS+HFVYPVGVAKSQR +S GRCAACY EF +N EWL +HVE+R C
Sbjct: 218 SGEFSRKDTYKTHLKSVHFVYPVGVAKSQRGQSKGRCAACYHEFASNAEWLLRHVETRQC 277

Query: 275 SGLHK 279
             L K
Sbjct: 278 EALVK 282

>AFR531W Chr6 (1389929..1390753) [825 bp, 274 aa] {ON} Unclear if
           syntenic homolog of Saccharomyces cerevisiae YHR006W
           (STP2)
          Length = 274

 Score =  206 bits (523), Expect = 6e-65,   Method: Compositional matrix adjust.
 Identities = 117/284 (41%), Positives = 158/284 (55%), Gaps = 35/284 (12%)

Query: 1   MGYIQFDRVDVPEDNVVSLGLLNKQLERQRGSVEMGEIGAEMGVTCDEIDSKPVHTRLCA 60
           MGYIQF  V +PEDNVVSLG+L+K L+RQ+     G+ G +  +         +  +   
Sbjct: 1   MGYIQFHGVYLPEDNVVSLGVLSKHLQRQQEFT--GQPGRQHNLQ--------IGGQGKD 50

Query: 61  TSASIAQMWESLLGFEHYSEVPNAGQPSLDEETCGLRFDTVPSVESFXXXXXXXXXXXXX 120
             A++AQ+W+ L+G        N G P+   E   LR   VP++                
Sbjct: 51  EEANMAQLWDVLMG--------NDGLPA-GAEVQPLRAAEVPTLRCSPEPSSLEEDMQGQ 101

Query: 121 XXYSVVDDLDHVH---------QPGNGTRPPACLETQPSSFGDXXXXXXXXXXXXXXXXX 171
             Y    DL  VH           G+ +  P   ET      D                 
Sbjct: 102 FQYK---DLISVHLSPCTQDEQASGDSSDAPQISETPV----DVAVEAPAQSPTFARDSA 154

Query: 172 MFQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHASGEFSRKDTYKTHLKSI 231
           +++C++CPSNFKV+GYLTRH+KKH+  KDFRCP+WS DCRCH+SGEFSRKDT++THLKSI
Sbjct: 155 VYRCSYCPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDCRCHSSGEFSRKDTFRTHLKSI 214

Query: 232 HFVYPVGVAKSQRSRSTGRCAACYQEFRNNNEWLTQHVESRSCS 275
           HFVYPVG  K+QR+ S GRCAACY++F NN +WL  H+++  C+
Sbjct: 215 HFVYPVGTTKAQRNNSVGRCAACYEQFNNNKDWLKYHIDAGRCT 258

>SAKL0B05434g Chr2 (467863..468897) [1035 bp, 344 aa] {ON} some
           similarities with uniprot|P38704 Saccharomyces
           cerevisiae YHR006W STP2 Transcription factor activated
           by proteolytic processing in response to signals from
           the SPS sensor system for external amino acids activates
           transcription of amino acid permease genes
          Length = 344

 Score =  179 bits (454), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 77/106 (72%), Positives = 89/106 (83%)

Query: 172 MFQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHASGEFSRKDTYKTHLKSI 231
           +FQC  CPSNFKVKGYLTRH+KKHL  KD+ CP+WS DC+CH +GEFSRKDT+KTHLKSI
Sbjct: 231 IFQCPHCPSNFKVKGYLTRHLKKHLPNKDYHCPYWSPDCKCHTTGEFSRKDTFKTHLKSI 290

Query: 232 HFVYPVGVAKSQRSRSTGRCAACYQEFRNNNEWLTQHVESRSCSGL 277
           HFVYPVGV KSQRS S GRCAAC+QEF +N  WL +H+E+  C GL
Sbjct: 291 HFVYPVGVVKSQRSYSKGRCAACFQEFESNVVWLNEHIETGICRGL 336

 Score = 56.6 bits (135), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 44/158 (27%), Positives = 68/158 (43%), Gaps = 54/158 (34%)

Query: 1   MGYIQFDRVDVPEDNVVSLGLLNKQLERQRGSVE-------------------------- 34
           MGYIQFD+V++P+DN+VSLGLLNKQL++ +   E                          
Sbjct: 1   MGYIQFDKVNIPQDNLVSLGLLNKQLQKLKDEREQALQVENDNDKSSSVSGQGISSTNFN 60

Query: 35  MGEIGAEM----------GVT------CDEIDSKPVHTR-LCATSASIAQMWESLLGFE- 76
           +G +   +          GV+       +E ++ P HT  L       ++ W   +  + 
Sbjct: 61  LGSLDEFLQDEKFGFLLQGVSPSKEHGIEETNNSPGHTTDLEKNDTDASEFWNLFMSGQT 120

Query: 77  ----------HYSEVPNAGQPSLDEETCGLRFDTVPSV 104
                       S   +  +PSLDEE CGLRF+T+ + 
Sbjct: 121 DSVSSSILTSSLSNQSSIFEPSLDEEICGLRFNTMTTT 158

>Ecym_1475 Chr1 (978578..979627) [1050 bp, 349 aa] {ON} similar to
           Ashbya gossypii AFR531W
          Length = 349

 Score =  169 bits (427), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 67/103 (65%), Positives = 87/103 (84%)

Query: 172 MFQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHASGEFSRKDTYKTHLKSI 231
           +++C +CPS+FKV+GYLTRH+KKH+  K FRCP+WS DCRCH SGEFSRKDT++THLKSI
Sbjct: 233 IYKCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCRCHPSGEFSRKDTFRTHLKSI 292

Query: 232 HFVYPVGVAKSQRSRSTGRCAACYQEFRNNNEWLTQHVESRSC 274
           HFVYPVG  K+QR+ S GRCAACY+ F +N +WL  H+++ +C
Sbjct: 293 HFVYPVGTTKAQRANSAGRCAACYEHFNSNKDWLKYHIDADNC 335

 Score = 53.1 bits (126), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 24/43 (55%), Positives = 31/43 (72%)

Query: 1  MGYIQFDRVDVPEDNVVSLGLLNKQLERQRGSVEMGEIGAEMG 43
          MGYIQF  V VP+ NVVSLGLLN+QL+RQR  +   ++  E+ 
Sbjct: 1  MGYIQFHPVGVPQGNVVSLGLLNEQLQRQRAILPDTDLSNEIS 43

>ZYRO0D13992g Chr4 (1178918..1180681) [1764 bp, 587 aa] {ON} similar
           to uniprot|Q00947 Saccharomyces cerevisiae YDR463W STP1
           and uniprot|P38704 Saccharomyces cerevisiae YHR006W STP2
           Transcription factor
          Length = 587

 Score =  134 bits (338), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 56/110 (50%), Positives = 77/110 (70%), Gaps = 4/110 (3%)

Query: 172 MFQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFW----SVDCRCHASGEFSRKDTYKTH 227
           +F C +C + FK++GYLTRH+KKH + K + CPF+      + RCH SG FSR+DTYKTH
Sbjct: 203 LFVCHYCDAKFKIRGYLTRHIKKHAIQKAYHCPFFMGEAPPELRCHNSGGFSRRDTYKTH 262

Query: 228 LKSIHFVYPVGVAKSQRSRSTGRCAACYQEFRNNNEWLTQHVESRSCSGL 277
           L++ HF+YP GV  S+R++S G C  C Q F N ++W+ QH+ES  C GL
Sbjct: 263 LRTRHFIYPKGVKPSERNKSAGNCGQCGQSFENTDKWVEQHIESGECRGL 312

>TDEL0A04530 Chr1 (805574..807028) [1455 bp, 484 aa] {ON} Anc_5.586
           YHR006W
          Length = 484

 Score =  131 bits (330), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 55/112 (49%), Positives = 77/112 (68%), Gaps = 4/112 (3%)

Query: 172 MFQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSV----DCRCHASGEFSRKDTYKTH 227
           +F C +C + F+++GYLTRH+KKH + K + CPF+S     D RCH SG FSR+DTYKTH
Sbjct: 137 VFVCHYCDAKFRIRGYLTRHIKKHAIQKAYHCPFFSAEAPQDMRCHNSGGFSRRDTYKTH 196

Query: 228 LKSIHFVYPVGVAKSQRSRSTGRCAACYQEFRNNNEWLTQHVESRSCSGLHK 279
           L++ HF YP GV    R++S+G C+ C Q F N ++W+ QH+E+  C  L K
Sbjct: 197 LRARHFTYPKGVKPQDRTKSSGHCSQCEQFFENTDQWVEQHIETGECKALPK 248

>KAFR0A06720 Chr1 (1361355..1362062) [708 bp, 235 aa] {ON} Anc_5.586
           YHR006W
          Length = 235

 Score =  125 bits (314), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 53/110 (48%), Positives = 80/110 (72%), Gaps = 4/110 (3%)

Query: 172 MFQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWS----VDCRCHASGEFSRKDTYKTH 227
           M+ C +C ++F+++GYLTRH+KKH + K + CPF++     + +CH SG FSR+DTYKTH
Sbjct: 34  MYVCHYCDASFRIRGYLTRHIKKHSIEKAYHCPFYNEHQPSELKCHNSGGFSRRDTYKTH 93

Query: 228 LKSIHFVYPVGVAKSQRSRSTGRCAACYQEFRNNNEWLTQHVESRSCSGL 277
           LKS H +YP GV +++R++STG CA C + F+N + W+  H+ES  C+ L
Sbjct: 94  LKSRHILYPKGVKQNERNKSTGHCAQCGEFFQNLDHWVETHIESGECTAL 143

>Kpol_1023.63 s1023 complement(144388..146058) [1671 bp, 556 aa]
           {ON} complement(144388..146058) [1671 nt, 557 aa]
          Length = 556

 Score =  129 bits (325), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 56/109 (51%), Positives = 76/109 (69%), Gaps = 4/109 (3%)

Query: 173 FQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSV----DCRCHASGEFSRKDTYKTHL 228
           F C +C ++F+++GYLTRH+KKH + K + CPF++     D RCH SG FSR+DTYKTHL
Sbjct: 180 FVCHYCDASFRIRGYLTRHIKKHAIQKAYCCPFYNKSSPPDIRCHTSGGFSRRDTYKTHL 239

Query: 229 KSIHFVYPVGVAKSQRSRSTGRCAACYQEFRNNNEWLTQHVESRSCSGL 277
           K  HF+YP GV    RS+S+G CA C + F N   W+ QH+E+ +C GL
Sbjct: 240 KVRHFMYPDGVKPQDRSKSSGHCAQCGEFFENTENWVEQHIETGNCKGL 288

>KNAG0C06030 Chr3 (1176811..1177755) [945 bp, 314 aa] {ON} Anc_5.586
           YHR006W
          Length = 314

 Score =  125 bits (314), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 57/109 (52%), Positives = 75/109 (68%), Gaps = 4/109 (3%)

Query: 173 FQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSV----DCRCHASGEFSRKDTYKTHL 228
           F C +C + F+++GYLTRH+KKH + K FRCPF+      D +CH SG FSR+DTYKTHL
Sbjct: 61  FVCHYCDARFRMRGYLTRHIKKHAIEKAFRCPFFQRGQPRDLQCHPSGGFSRRDTYKTHL 120

Query: 229 KSIHFVYPVGVAKSQRSRSTGRCAACYQEFRNNNEWLTQHVESRSCSGL 277
           K  H +YP GV  S R+RS G C AC +   + +EW+ QH+ES +C GL
Sbjct: 121 KVKHVLYPPGVRPSDRNRSGGHCTACGEYTESLHEWVEQHIESGACQGL 169

>NCAS0H02890 Chr8 complement(564830..566428) [1599 bp, 532 aa] {ON}
           Anc_5.586
          Length = 532

 Score =  128 bits (322), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 54/109 (49%), Positives = 75/109 (68%), Gaps = 4/109 (3%)

Query: 173 FQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDC----RCHASGEFSRKDTYKTHL 228
           F C +C + F+++GYLTRH+KKH V K + CPF++ D     RCH +G FSR+DTYKTHL
Sbjct: 183 FICHYCDAKFRIRGYLTRHIKKHAVEKAYHCPFFNSDILSESRCHNTGGFSRRDTYKTHL 242

Query: 229 KSIHFVYPVGVAKSQRSRSTGRCAACYQEFRNNNEWLTQHVESRSCSGL 277
           K+ HFVYP G+    R++S+G C+ C Q F   ++W+  H+ES  C GL
Sbjct: 243 KARHFVYPKGMKPQDRAKSSGHCSQCGQSFTTADDWIKNHIESGDCHGL 291

>Kwal_47.18337 s47 complement(787992..789602) [1611 bp, 536 aa] {ON}
           YDR463W (STP1) - Nuclear-localized protein containing
           zinc finger motifs [contig 196] FULL
          Length = 536

 Score =  128 bits (321), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 55/109 (50%), Positives = 76/109 (69%), Gaps = 4/109 (3%)

Query: 173 FQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDC----RCHASGEFSRKDTYKTHL 228
           F C +C + F ++GYLTRH+KKH V K + CPF++ D     RCH +G FSR+DTYKTHL
Sbjct: 157 FVCHYCNAEFYIRGYLTRHIKKHAVEKAYYCPFFNADAPKDARCHTTGGFSRRDTYKTHL 216

Query: 229 KSIHFVYPVGVAKSQRSRSTGRCAACYQEFRNNNEWLTQHVESRSCSGL 277
           +S HFV P GV   ++++S+GRCA C + F N ++W+  HVE+  C GL
Sbjct: 217 RSRHFVCPKGVRSQEKAKSSGRCAHCNEHFENTDDWIKGHVEAGECKGL 265

>Ecym_1404 Chr1 complement(840220..841908) [1689 bp, 562 aa] {ON}
           similar to Ashbya gossypii AFR461C
          Length = 562

 Score =  127 bits (320), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 54/109 (49%), Positives = 77/109 (70%), Gaps = 4/109 (3%)

Query: 173 FQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWS----VDCRCHASGEFSRKDTYKTHL 228
           + C +C + F+++GYLTRH+KKH V K + CPF++     + RCH +G FSR+DTYKTHL
Sbjct: 163 YVCHYCDAEFRIRGYLTRHIKKHAVEKAYHCPFFNGCSPPETRCHTTGGFSRRDTYKTHL 222

Query: 229 KSIHFVYPVGVAKSQRSRSTGRCAACYQEFRNNNEWLTQHVESRSCSGL 277
           +S HF+YP GV    R+RS G CA C + F N ++W+ +H+ES  C+GL
Sbjct: 223 RSRHFIYPEGVKTQDRNRSPGHCAHCGKWFENTSKWIEKHIESGYCTGL 271

>SAKL0G06292g Chr7 (522850..524403) [1554 bp, 517 aa] {ON}
           uniprot|Q875P4 Saccharomyces kluyveri STP1
          Length = 517

 Score =  126 bits (317), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 51/109 (46%), Positives = 77/109 (70%), Gaps = 4/109 (3%)

Query: 173 FQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSV----DCRCHASGEFSRKDTYKTHL 228
           + C +C + F+++GYLTRH+KKH V K + CPF++     + RCH +G FSR+DTYKTHL
Sbjct: 162 YVCHYCDAEFRIRGYLTRHIKKHAVEKAYHCPFFNSKLPPESRCHTTGGFSRRDTYKTHL 221

Query: 229 KSIHFVYPVGVAKSQRSRSTGRCAACYQEFRNNNEWLTQHVESRSCSGL 277
           KS HF+YP G+   +R++S+G C+ C + F N  +W+  H+E+  C+GL
Sbjct: 222 KSRHFIYPKGIKTQERNKSSGNCSHCGEWFENTEKWIENHIETGDCTGL 270

>AFR461C Chr6 complement(1270007..1271641) [1635 bp, 544 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR463W
           (STP1)
          Length = 544

 Score =  125 bits (315), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 54/109 (49%), Positives = 75/109 (68%), Gaps = 4/109 (3%)

Query: 173 FQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSV----DCRCHASGEFSRKDTYKTHL 228
           F C +C + F+++GYLTRH+KKH V K + CPF++     + RCH +G FSR+DTYKTHL
Sbjct: 152 FVCHYCDAEFRIRGYLTRHIKKHAVEKAYHCPFFNSHVPPETRCHTTGGFSRRDTYKTHL 211

Query: 229 KSIHFVYPVGVAKSQRSRSTGRCAACYQEFRNNNEWLTQHVESRSCSGL 277
           +S HF+YP GV    R +S G CA C + F N + W+ +H+ES  C+GL
Sbjct: 212 RSRHFIYPEGVKTQDRGKSCGHCAHCGKWFENTSTWIEKHIESGYCTGL 260

>NDAI0C00690 Chr3 complement(134897..136849) [1953 bp, 650 aa] {ON} 
          Length = 650

 Score =  126 bits (316), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 53/111 (47%), Positives = 78/111 (70%), Gaps = 4/111 (3%)

Query: 173 FQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDC----RCHASGEFSRKDTYKTHL 228
           F C +C + F+++GYLTRH+KKH + K + CPF++ D     RCH SG FSR+DTYKTHL
Sbjct: 273 FVCHYCDAKFRIRGYLTRHIKKHAIEKAYHCPFFNNDALPELRCHNSGGFSRRDTYKTHL 332

Query: 229 KSIHFVYPVGVAKSQRSRSTGRCAACYQEFRNNNEWLTQHVESRSCSGLHK 279
           K+ HF+YP GV    R++S+G C+ C + F + + W+++H+ES +C  L K
Sbjct: 333 KARHFIYPKGVKPQDRNKSSGHCSQCGEFFNSTDIWISKHLESGNCKALPK 383

>KNAG0B03350 Chr2 complement(647618..649420) [1803 bp, 600 aa] {ON}
           Anc_5.586 YHR006W
          Length = 600

 Score =  125 bits (315), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 53/109 (48%), Positives = 75/109 (68%), Gaps = 4/109 (3%)

Query: 173 FQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSV----DCRCHASGEFSRKDTYKTHL 228
           + C +C + FK++GYLTRH+KKH + K + CPF++     + +CH +G FSR+DTYKTHL
Sbjct: 199 YICHYCDATFKIRGYLTRHIKKHAIDKAYHCPFFNATLGTELKCHNTGGFSRRDTYKTHL 258

Query: 229 KSIHFVYPVGVAKSQRSRSTGRCAACYQEFRNNNEWLTQHVESRSCSGL 277
           K+ HFVYP GV  S RS+S G CA C   F + ++W+ +H+E   CS L
Sbjct: 259 KTRHFVYPNGVKPSDRSKSNGTCAHCGDYFESADKWIKEHIEGGQCSSL 307

>NCAS0A07900 Chr1 complement(1570244..1571347) [1104 bp, 367 aa]
           {ON} Anc_5.586
          Length = 367

 Score =  122 bits (307), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 54/109 (49%), Positives = 74/109 (67%), Gaps = 4/109 (3%)

Query: 173 FQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVD----CRCHASGEFSRKDTYKTHL 228
           + C +C + F++KGYLTRH+KKH V K + CPF+S +     RCH SG FSR+DTYKTHL
Sbjct: 96  YVCHYCQAKFRIKGYLTRHIKKHAVEKAYHCPFFSTESPPELRCHNSGGFSRRDTYKTHL 155

Query: 229 KSIHFVYPVGVAKSQRSRSTGRCAACYQEFRNNNEWLTQHVESRSCSGL 277
           K+ H ++P G+   +R++S G CA C + F N   W+  H+ES  CSGL
Sbjct: 156 KARHILFPKGIRPHERNKSKGHCAQCGEFFTNFENWVELHIESGDCSGL 204

>KLTH0G05104g Chr7 (412304..413920) [1617 bp, 538 aa] {ON} similar
           to uniprot|Q00947 Saccharomyces cerevisiae YDR463W STP1
           and uniprot|P38704 Saccharomyces cerevisiae YHR006W STP2
           Transcription factor
          Length = 538

 Score =  125 bits (313), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 52/109 (47%), Positives = 76/109 (69%), Gaps = 4/109 (3%)

Query: 173 FQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDC----RCHASGEFSRKDTYKTHL 228
           F C +C + F ++GYLTRH+KKH V K + CP+++ D     RCH +G FSR+DTYKTHL
Sbjct: 159 FVCHYCNAKFYIRGYLTRHIKKHAVEKAYYCPYFNADAPKDQRCHTTGGFSRRDTYKTHL 218

Query: 229 KSIHFVYPVGVAKSQRSRSTGRCAACYQEFRNNNEWLTQHVESRSCSGL 277
           +S HF+ P GV   ++++S+GRCA C ++F   ++W+  HVE+  C GL
Sbjct: 219 RSRHFICPKGVRSQEKAKSSGRCAHCNEQFDKTDDWIKSHVEAGECKGL 267

>TBLA0E02820 Chr5 complement(699189..700127) [939 bp, 312 aa] {ON}
           Anc_5.586 YHR006W
          Length = 312

 Score =  121 bits (303), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 50/109 (45%), Positives = 75/109 (68%), Gaps = 4/109 (3%)

Query: 173 FQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWS----VDCRCHASGEFSRKDTYKTHL 228
           + C +C ++F++  YLTRH+KKH + K F+CPF++     D RCH SG FSRKDT+K HL
Sbjct: 13  YICHYCDASFRLMSYLTRHIKKHAIEKAFKCPFYNEKLPADLRCHVSGGFSRKDTFKMHL 72

Query: 229 KSIHFVYPVGVAKSQRSRSTGRCAACYQEFRNNNEWLTQHVESRSCSGL 277
           K  HF+YP G+ +++RS+ +G CA C + F N+N+W+  H+ +  C  L
Sbjct: 73  KCRHFIYPKGIKQNERSKYSGNCAQCGEFFHNSNDWMDNHISTGQCKSL 121

>Skud_8.55 Chr8 (100188..101795) [1608 bp, 535 aa] {ON} YHR006W
           (REAL)
          Length = 535

 Score =  124 bits (311), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 54/109 (49%), Positives = 73/109 (66%), Gaps = 4/109 (3%)

Query: 173 FQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFW----SVDCRCHASGEFSRKDTYKTHL 228
           + C +C + F+++GYLTRH+KKH   K + CPF+    S + RCH SG FSR+DTYKTHL
Sbjct: 205 YVCHYCDARFRIRGYLTRHIKKHAKRKAYHCPFFDDSISQELRCHTSGGFSRRDTYKTHL 264

Query: 229 KSIHFVYPVGVAKSQRSRSTGRCAACYQEFRNNNEWLTQHVESRSCSGL 277
           KS HF YP GV    R++S+G CA C + F  +  W+  H+E+ SC GL
Sbjct: 265 KSRHFNYPEGVKPQDRNKSSGACAQCGEHFSTSESWVENHIEAGSCKGL 313

>KLLA0F10109g Chr6 complement(939195..941066) [1872 bp, 623 aa] {ON}
           weakly similar to uniprot|Q00947 Saccharomyces
           cerevisiae YDR463W STP1 Transcription factor activated
           by proteolytic processing in response to signals from
           the SPS sensor system for external amino acids activates
           transcription of amino acid permease genes and may have
           a role in tRNA processing
          Length = 623

 Score =  125 bits (313), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 51/109 (46%), Positives = 71/109 (65%), Gaps = 4/109 (3%)

Query: 173 FQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSV----DCRCHASGEFSRKDTYKTHL 228
           F C +C + FK++GYLTRH+KKH + K + CPFW      + RCH++G FSR+D+YKTHL
Sbjct: 242 FVCHYCDAEFKMRGYLTRHIKKHAIEKAYHCPFWDASLPSEKRCHSTGGFSRRDSYKTHL 301

Query: 229 KSIHFVYPVGVAKSQRSRSTGRCAACYQEFRNNNEWLTQHVESRSCSGL 277
           +S HF+YP  V    R  S G C  C + F + NEW+  H+E+R C  +
Sbjct: 302 RSRHFIYPDNVKNVDRVNSHGHCGRCKKHFDSTNEWIEHHIENRECEAI 350

>Smik_8.63 Chr8 (97366..98994) [1629 bp, 542 aa] {ON} YHR006W (REAL)
          Length = 542

 Score =  124 bits (310), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 54/109 (49%), Positives = 73/109 (66%), Gaps = 4/109 (3%)

Query: 173 FQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFW----SVDCRCHASGEFSRKDTYKTHL 228
           + C +C + F+++GYLTRH+KKH   K + CPF+    S + RCH SG FSR+DTYKTHL
Sbjct: 204 YICHYCDARFRIRGYLTRHIKKHAKRKAYHCPFFDNSISQELRCHTSGGFSRRDTYKTHL 263

Query: 229 KSIHFVYPVGVAKSQRSRSTGRCAACYQEFRNNNEWLTQHVESRSCSGL 277
           KS HF YP GV    R++S+G CA C + F  +  W+  H+E+ SC GL
Sbjct: 264 KSRHFTYPEGVKPQDRNKSSGACAQCGEYFHTSESWVENHIEAGSCKGL 312

>Suva_8.62 Chr8 (113740..115377) [1638 bp, 545 aa] {ON} YHR006W
           (REAL)
          Length = 545

 Score =  123 bits (308), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 54/109 (49%), Positives = 74/109 (67%), Gaps = 4/109 (3%)

Query: 173 FQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFW----SVDCRCHASGEFSRKDTYKTHL 228
           + C +C S F+++GYLTRH+KKH   K + CPF+    S + RCH SG FSR+DTYKTHL
Sbjct: 204 YICHYCDSRFRIRGYLTRHIKKHAKRKAYHCPFFDGSISQELRCHNSGGFSRRDTYKTHL 263

Query: 229 KSIHFVYPVGVAKSQRSRSTGRCAACYQEFRNNNEWLTQHVESRSCSGL 277
           KS HF YP G+    R++S+G CA C + F ++  W+  H+E+ SC GL
Sbjct: 264 KSRHFNYPEGIKPQYRNKSSGACAQCGEYFSSSESWVENHIEAGSCKGL 312

>YHR006W Chr8 (117814..119439) [1626 bp, 541 aa] {ON}
           STP2Transcription factor, activated by proteolytic
           processing in response to signals from the SPS sensor
           system for external amino acids; activates transcription
           of amino acid permease genes
          Length = 541

 Score =  121 bits (304), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 53/109 (48%), Positives = 71/109 (65%), Gaps = 4/109 (3%)

Query: 173 FQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFW----SVDCRCHASGEFSRKDTYKTHL 228
           + C +C + F+++GYLTRH+KKH   K + CPF+    S + RCH SG FSR+DTYKTHL
Sbjct: 204 YICHYCDARFRIRGYLTRHIKKHAKRKAYHCPFFDNSISQELRCHTSGGFSRRDTYKTHL 263

Query: 229 KSIHFVYPVGVAKSQRSRSTGRCAACYQEFRNNNEWLTQHVESRSCSGL 277
           KS HF YP GV    R++S G C  C + F  +  W+  H+E+ SC GL
Sbjct: 264 KSRHFTYPEGVKPQDRNKSPGVCTQCGEHFSTSESWVENHIEAGSCKGL 312

>TPHA0K00210 Chr11 complement(34961..36406) [1446 bp, 481 aa] {ON}
           Anc_5.586 YHR006W
          Length = 481

 Score =  120 bits (300), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 51/109 (46%), Positives = 71/109 (65%), Gaps = 4/109 (3%)

Query: 173 FQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFW----SVDCRCHASGEFSRKDTYKTHL 228
           F C +C + F+++GYLTRH+KKH + K F CPF+    S   +CH +G FSR+DTYK HL
Sbjct: 99  FVCHYCDAVFRIRGYLTRHIKKHAIQKAFHCPFYNDSASSKLKCHTTGGFSRRDTYKAHL 158

Query: 229 KSIHFVYPVGVAKSQRSRSTGRCAACYQEFRNNNEWLTQHVESRSCSGL 277
           K  HF+YP GV    R +S+G C+ C + F+    W+  H+ES +C GL
Sbjct: 159 KIRHFMYPTGVKPRDRHKSSGYCSQCGEFFKTTERWVETHIESGNCKGL 207

>YDR463W Chr4 (1386816..1388375) [1560 bp, 519 aa] {ON}
           STP1Transcription factor, undergoes proteolytic
           processing by SPS (Ssy1p-Ptr3p-Ssy5p)-sensor component
           Ssy5p in response to extracellular amino acids;
           activates transcription of amino acid permease genes and
           may have a role in tRNA processing
          Length = 519

 Score =  117 bits (293), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 51/109 (46%), Positives = 71/109 (65%), Gaps = 4/109 (3%)

Query: 173 FQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSV----DCRCHASGEFSRKDTYKTHL 228
           F C +C + F+++GYLTRH+KKH + K + CPF++     D RCH SG FSR+DTYKTHL
Sbjct: 160 FICHYCDATFRIRGYLTRHIKKHAIEKAYHCPFFNSATPPDLRCHNSGGFSRRDTYKTHL 219

Query: 229 KSIHFVYPVGVAKSQRSRSTGRCAACYQEFRNNNEWLTQHVESRSCSGL 277
           K+ H +YP GV    R++S+G CA C + F     ++  H+ES  C  L
Sbjct: 220 KARHVLYPKGVKPQDRNKSSGHCAQCGEYFSTIENFVENHIESGDCKAL 268

>Smik_4.742 Chr4 (1308041..1309627) [1587 bp, 528 aa] {ON} YDR463W
           (REAL)
          Length = 528

 Score =  117 bits (292), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 51/109 (46%), Positives = 71/109 (65%), Gaps = 4/109 (3%)

Query: 173 FQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWS----VDCRCHASGEFSRKDTYKTHL 228
           F C +C + F+++GYLTRH+KKH + K + CPF++     D RCH SG FSR+DTYKTHL
Sbjct: 160 FICHYCDATFRIRGYLTRHIKKHAIEKAYHCPFFNNATPPDLRCHNSGGFSRRDTYKTHL 219

Query: 229 KSIHFVYPVGVAKSQRSRSTGRCAACYQEFRNNNEWLTQHVESRSCSGL 277
           K+ H +YP GV    R++S+G CA C + F     ++  H+ES  C  L
Sbjct: 220 KARHVLYPKGVRPQDRNKSSGHCAQCGEYFSTIENFVESHIESGDCKAL 268

>NDAI0H01110 Chr8 (247915..249279) [1365 bp, 454 aa] {ON} Anc_5.586
          Length = 454

 Score =  114 bits (285), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 52/109 (47%), Positives = 68/109 (62%), Gaps = 4/109 (3%)

Query: 173 FQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDC----RCHASGEFSRKDTYKTHL 228
           + C  C + F++KGYLTRH+KKH   K + CPF++ D     RCH SG FSR+DTYKTHL
Sbjct: 100 YVCHHCNAQFRIKGYLTRHLKKHATEKAYTCPFFNTDSPPELRCHNSGGFSRRDTYKTHL 159

Query: 229 KSIHFVYPVGVAKSQRSRSTGRCAACYQEFRNNNEWLTQHVESRSCSGL 277
           KS H ++P GV    R++S G CA C   F +   W+  H+ES  C  L
Sbjct: 160 KSRHILFPKGVRPQDRNKSVGHCAQCGDFFDSCENWVETHIESGKCKAL 208

>Skud_4.739 Chr4 (1306825..1308369) [1545 bp, 514 aa] {ON} YDR463W
           (REAL)
          Length = 514

 Score =  113 bits (283), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 50/109 (45%), Positives = 70/109 (64%), Gaps = 4/109 (3%)

Query: 173 FQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWS----VDCRCHASGEFSRKDTYKTHL 228
           F C +C + F+++GYLTRH+KKH + K + CPF++     D RCH SG FSR+DTYKTHL
Sbjct: 160 FICHYCDATFRIRGYLTRHIKKHAIEKAYHCPFFNGATPPDLRCHNSGGFSRRDTYKTHL 219

Query: 229 KSIHFVYPVGVAKSQRSRSTGRCAACYQEFRNNNEWLTQHVESRSCSGL 277
           K+ H +Y  GV    R++S+G CA C + F     ++  H+ES  C  L
Sbjct: 220 KARHVLYSKGVKPQDRNKSSGHCAQCGEYFSTIENFVESHIESGDCKAL 268

>CAGL0K06413g Chr11 (628640..629719) [1080 bp, 359 aa] {ON} some
           similarities with uniprot|Q00947 Saccharomyces
           cerevisiae YDR463w STP1
          Length = 359

 Score =  111 bits (277), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 49/109 (44%), Positives = 71/109 (65%), Gaps = 4/109 (3%)

Query: 173 FQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSV----DCRCHASGEFSRKDTYKTHL 228
           F C +C + FK++GYLTRH+KKH + K + CP+++     D RCH +G FSR+DTYK H+
Sbjct: 41  FVCHYCDARFKIRGYLTRHIKKHALQKAYYCPYYNEKAPPDLRCHNNGGFSRRDTYKAHM 100

Query: 229 KSIHFVYPVGVAKSQRSRSTGRCAACYQEFRNNNEWLTQHVESRSCSGL 277
           K+ H +YP GV   +R +S+G C+ C +   N   W+  HVES  C+ L
Sbjct: 101 KTRHIMYPSGVKSQERFKSSGHCSHCGEYSPNVEFWVEDHVESGQCTAL 149

>Suva_2.639 Chr2 (1139039..1140589) [1551 bp, 516 aa] {ON} YDR463W
           (REAL)
          Length = 516

 Score =  112 bits (280), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 50/109 (45%), Positives = 70/109 (64%), Gaps = 4/109 (3%)

Query: 173 FQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSV----DCRCHASGEFSRKDTYKTHL 228
           F C +C + F+++GYLTRH+KKH + K + CPF++     D RCH SG FSR+DTYKTHL
Sbjct: 160 FICHYCDATFRIRGYLTRHIKKHAIRKAYHCPFFNCATPPDLRCHNSGGFSRRDTYKTHL 219

Query: 229 KSIHFVYPVGVAKSQRSRSTGRCAACYQEFRNNNEWLTQHVESRSCSGL 277
           K+ H +Y  GV    R++S+G CA C + F     ++  H+ES  C  L
Sbjct: 220 KARHVLYSKGVKPQDRNKSSGHCAQCGEYFPVIENFVENHIESGDCKAL 268

>KAFR0C05710 Chr3 (1136694..1138022) [1329 bp, 442 aa] {ON}
           Anc_5.586 YHR006W
          Length = 442

 Score =  109 bits (272), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 46/111 (41%), Positives = 68/111 (61%), Gaps = 4/111 (3%)

Query: 173 FQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDC----RCHASGEFSRKDTYKTHL 228
           F C +C + FK++GYLTRH++KH + K F+CP+++       RCH++G FSR+DT+K HL
Sbjct: 122 FICHYCDAKFKIRGYLTRHIRKHAIEKAFKCPYFNATLPKTLRCHSTGGFSRRDTFKIHL 181

Query: 229 KSIHFVYPVGVAKSQRSRSTGRCAACYQEFRNNNEWLTQHVESRSCSGLHK 279
           KS HF++P  V    ++ S G C  C   F +   W+  HV  R C  + K
Sbjct: 182 KSRHFIFPNDVKVPNKTHSGGNCKHCQGSFSDIETWINDHVGLRRCRAIQK 232

>CAGL0E04312g Chr5 (412800..414866) [2067 bp, 688 aa] {ON} some
           similarities with uniprot|P38704 Saccharomyces
           cerevisiae YHR006w SPT2 or uniprot|Q00947 Saccharomyces
           cerevisiae YDR463w STP1
          Length = 688

 Score =  109 bits (272), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 48/109 (44%), Positives = 68/109 (62%), Gaps = 4/109 (3%)

Query: 173 FQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWS----VDCRCHASGEFSRKDTYKTHL 228
           F C +C + F+++GYLTRH+KKH + K + CPF++       RCH SG FSR+DTYKTH+
Sbjct: 198 FVCHYCDAKFRIRGYLTRHIKKHAIEKAYHCPFYNGQEVPSKRCHNSGGFSRRDTYKTHM 257

Query: 229 KSIHFVYPVGVAKSQRSRSTGRCAACYQEFRNNNEWLTQHVESRSCSGL 277
           K+ H +YP GV  + R+ S+G CA C         ++  H+ES  C  L
Sbjct: 258 KARHLIYPEGVNFASRNESSGHCAKCGGFIAKAATYVEDHIESGQCPAL 306

>Kwal_26.9300 s26 (1156241..1157155) [915 bp, 304 aa] {ON} YLR375W
           (STP3) - Involved in pre-tRNA splicing [contig 72] FULL
          Length = 304

 Score = 78.2 bits (191), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 46/123 (37%), Positives = 58/123 (47%), Gaps = 27/123 (21%)

Query: 174 QCAFCPSNFKVKGYLTRHMKKHLVTKD------------FRCPFWS----VDCR------ 211
           +C  C   F     L RH K+H   +D            FRCP+ S     D R      
Sbjct: 174 KCPVCGRGFTRHNDLLRHRKRHWKDEDNSCSSYNPNQGTFRCPYKSRIAYPDSRSKGLAS 233

Query: 212 -----CHASGEFSRKDTYKTHLKSIHFVYPVGVAKSQRSRSTGRCAACYQEFRNNNEWLT 266
                CHA+G+FSR DT+K HL+++HF YP G  K  R    G+C  C QEF + N WL 
Sbjct: 234 LGTTSCHATGKFSRCDTFKNHLRALHFEYPPGTRKKDRGHVPGKCKHCGQEFASVNTWLN 293

Query: 267 QHV 269
            HV
Sbjct: 294 THV 296

>TPHA0B00930 Chr2 complement(212983..214026) [1044 bp, 347 aa] {ON}
           Anc_4.222 YDL048C
          Length = 347

 Score = 72.8 bits (177), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 40/99 (40%), Positives = 50/99 (50%), Gaps = 20/99 (20%)

Query: 195 HLVTKDFRCPFWSVDCR-------------------CHASGEFSRKDTYKTHLKSIHFVY 235
           H +   FRCPF S   +                   CH +G FSR DTYK HLK++HF Y
Sbjct: 245 HSIKGSFRCPFNSTLIKLDMELYSYKSMDLNFDTSNCHQTGIFSRCDTYKNHLKALHFEY 304

Query: 236 PVGVAKSQRSRSTGRCAACYQEFRNNNEWLTQHVESRSC 274
           P G  K  RS   GRC  C ++F N N WL  HV +++C
Sbjct: 305 PPGTKKVNRSAVAGRCRHCGKKFPNVNYWLKNHV-TKTC 342

>AFR588W Chr6 (1496952..1497911) [960 bp, 319 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR375W (STP3) and
           YDL048C (STP4)
          Length = 319

 Score = 72.0 bits (175), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 49/94 (52%), Gaps = 19/94 (20%)

Query: 195 HLVTKDFRCPFWSVDCR-------------------CHASGEFSRKDTYKTHLKSIHFVY 235
           H++   ++CPF S   +                   CH +G FSR DTYK HLK++HF Y
Sbjct: 217 HMIQGTYKCPFNSTLIKLDMEIYPTKGRRLAFETSNCHITGVFSRCDTYKNHLKALHFEY 276

Query: 236 PVGVAKSQRSRSTGRCAACYQEFRNNNEWLTQHV 269
           P G  K +R++  GRC  C  +F N + WL +HV
Sbjct: 277 PPGTKKRERAKIHGRCKHCGMKFDNVDMWLNEHV 310

>Kpol_337.6 s337 (17510..18712) [1203 bp, 400 aa] {ON}
           (17510..18712) [1203 nt, 401 aa]
          Length = 400

 Score = 72.4 bits (176), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 38/100 (38%), Positives = 49/100 (49%), Gaps = 21/100 (21%)

Query: 195 HLVTKDFRCPFWSV--------------------DCRCHASGEFSRKDTYKTHLKSIHFV 234
           H +   F+CP+ S                        CHA+G FSR DTYK HLK++HF 
Sbjct: 297 HNIKGTFKCPYNSTLIKLDMDIYPHKKGTPLKFESSNCHATGVFSRCDTYKNHLKALHFE 356

Query: 235 YPVGVAKSQRSRSTGRCAACYQEFRNNNEWLTQHVESRSC 274
           YP G  K+ RS   G+C  C + F N + WL  H+E R C
Sbjct: 357 YPPGTKKANRSIVPGKCKHCGKNFPNVDVWLKTHIE-RDC 395

>SAKL0H26224g Chr8 (2308056..2308739) [684 bp, 227 aa] {ON} some
           similarities with uniprot|Q7LH06 Saccharomyces
           cerevisiae YDL048C STP4 Protein involved in pre-tRNA
           splicing and in uptake of branched-chain amino acids
          Length = 227

 Score = 70.1 bits (170), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 31/71 (43%), Positives = 43/71 (60%), Gaps = 2/71 (2%)

Query: 204 PFWSVDCRCHASGEFSRKDTYKTHLKSIHFVYPVGVAKSQRSRSTGRCAACYQEFRNNNE 263
           P ++ DC  H +G F+R DTYK HLK++HF YP G++K  R  S G C  C+  F + + 
Sbjct: 149 PMYATDC--HKTGLFTRVDTYKYHLKALHFEYPDGISKQDREFSPGHCKHCHAHFPSVHA 206

Query: 264 WLTQHVESRSC 274
           WL  H+ S  C
Sbjct: 207 WLQDHILSHKC 217

>KNAG0B05940 Chr2 (1165682..1166815) [1134 bp, 377 aa] {ON}
           Anc_4.222 YDL048C
          Length = 377

 Score = 71.6 bits (174), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 48/94 (51%), Gaps = 19/94 (20%)

Query: 195 HLVTKDFRCPFWSV-------------------DCRCHASGEFSRKDTYKTHLKSIHFVY 235
           H +   F+CPF S                       CH++G FSR DT+K HLK++HF Y
Sbjct: 275 HRIKGTFKCPFNSTLIQLDMEMYPFKSRPLLFETSNCHSTGVFSRCDTFKNHLKALHFEY 334

Query: 236 PVGVAKSQRSRSTGRCAACYQEFRNNNEWLTQHV 269
           P G  K +R+   GRC  C  +F N + WLT+HV
Sbjct: 335 PPGTKKKERTVVPGRCRNCGVKFPNVDTWLTEHV 368

>NDAI0J02060 Chr10 (505150..506619) [1470 bp, 489 aa] {ON} Anc_4.222
          Length = 489

 Score = 71.6 bits (174), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 42/58 (72%)

Query: 212 CHASGEFSRKDTYKTHLKSIHFVYPVGVAKSQRSRSTGRCAACYQEFRNNNEWLTQHV 269
           CH SG FSR+DT+K HLK++HF+YP G  K++R++  G C  C  +F N + WL++HV
Sbjct: 423 CHKSGIFSRRDTFKNHLKALHFLYPPGTKKNERNKVPGTCKHCGMKFDNVDIWLSEHV 480

>CAGL0H04873g Chr8 complement(465069..466424) [1356 bp, 451 aa] {ON}
           some similarities with uniprot|Q05937 Saccharomyces
           cerevisiae YLR375w STP3 or uniprot|Q07351 Saccharomyces
           cerevisiae YDL048c STP4
          Length = 451

 Score = 71.6 bits (174), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 29/62 (46%), Positives = 42/62 (67%)

Query: 208 VDCRCHASGEFSRKDTYKTHLKSIHFVYPVGVAKSQRSRSTGRCAACYQEFRNNNEWLTQ 267
           +  +CH +G FSR DT+K HLK++HF YP G  +S+RS  +G+C  C   F N +EW+ +
Sbjct: 381 ITTQCHKTGVFSRCDTFKNHLKALHFEYPQGTRRSERSFVSGKCKHCNMSFANVDEWINE 440

Query: 268 HV 269
           HV
Sbjct: 441 HV 442

>SAKL0H03894g Chr8 complement(357602..358678) [1077 bp, 358 aa] {ON}
           similar to uniprot|Q7LH06 Saccharomyces cerevisiae
           YDL048C STP4 Protein involved in pre-tRNA splicing and
           in uptake of branched-chain amino acids
          Length = 358

 Score = 70.9 bits (172), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 54/97 (55%), Gaps = 8/97 (8%)

Query: 173 FQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHASGEFSRKDTYKTHLKSIH 232
           F+C F  +  K+   L  + KK  +      PF + +C  HA+G FSR DT+K HLK++H
Sbjct: 261 FKCPFNSNLIKLDMELYPYKKKDSL------PFETSNC--HATGIFSRCDTFKNHLKALH 312

Query: 233 FVYPVGVAKSQRSRSTGRCAACYQEFRNNNEWLTQHV 269
           F YP G  K  R    GRC  C ++F N + WL +HV
Sbjct: 313 FEYPPGTKKKDRGSVHGRCKHCGEKFANVDIWLNEHV 349

>KLTH0D13618g Chr4 (1112089..1113333) [1245 bp, 414 aa] {ON} similar
           to uniprot|Q7LH06 Saccharomyces cerevisiae YDL048C STP4
           Protein involved in pre-tRNA splicing and in uptake of
           branched-chain amino acids
          Length = 414

 Score = 70.5 bits (171), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 44/94 (46%), Gaps = 19/94 (20%)

Query: 195 HLVTKDFRCPFWSV-------------------DCRCHASGEFSRKDTYKTHLKSIHFVY 235
           H +   F CP+ S                       CH +G FSR DT+K HLK++HF Y
Sbjct: 312 HRIKGTFHCPYKSALIALDMDAYPGKRRELAFETSECHQTGVFSRCDTFKNHLKALHFEY 371

Query: 236 PVGVAKSQRSRSTGRCAACYQEFRNNNEWLTQHV 269
           P G  K  RS   GRC  C + F N  EWL+ HV
Sbjct: 372 PPGTKKKDRSSVPGRCKQCGRHFANVGEWLSSHV 405

>Ecym_2768 Chr2 (1495608..1496903) [1296 bp, 431 aa] {ON} similar to
           Ashbya gossypii AFR588W
          Length = 431

 Score = 70.1 bits (170), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 48/94 (51%), Gaps = 19/94 (20%)

Query: 195 HLVTKDFRCPFWSVDCR-------------------CHASGEFSRKDTYKTHLKSIHFVY 235
           H++   ++CPF S   +                   CH +G FSR DTYK HLK++HF Y
Sbjct: 329 HMIQGTYKCPFNSALIKLDMEIYPTKDRQLLFETSNCHITGVFSRCDTYKNHLKALHFEY 388

Query: 236 PVGVAKSQRSRSTGRCAACYQEFRNNNEWLTQHV 269
           P G  K +R+   GRC  C  +F N + WL +H+
Sbjct: 389 PPGTKKRERANIHGRCKHCGMKFDNVDVWLNEHI 422

>YLR375W Chr12 (871697..872728) [1032 bp, 343 aa] {ON}
           STP3Zinc-finger protein of unknown function, possibly
           involved in pre-tRNA splicing and in uptake of
           branched-chain amino acids
          Length = 343

 Score = 68.2 bits (165), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 45/94 (47%), Gaps = 19/94 (20%)

Query: 195 HLVTKDFRCPFWSV-------------------DCRCHASGEFSRKDTYKTHLKSIHFVY 235
           H +   F+CPF S                       CH +G FSR DT+K HLK++HF Y
Sbjct: 241 HQIKGTFKCPFNSTLIQLDMDMYPYKLKPLNFETSNCHQTGVFSRCDTFKNHLKALHFEY 300

Query: 236 PVGVAKSQRSRSTGRCAACYQEFRNNNEWLTQHV 269
           P G  K  R+   GRC  C  +F N + WL +HV
Sbjct: 301 PPGTKKKDRNVVPGRCKHCGLKFENVDVWLNEHV 334

>Smik_12.462 Chr12 (810413..811438) [1026 bp, 341 aa] {ON} YLR375W
           (REAL)
          Length = 341

 Score = 68.2 bits (165), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 45/94 (47%), Gaps = 19/94 (20%)

Query: 195 HLVTKDFRCPFWSV-------------------DCRCHASGEFSRKDTYKTHLKSIHFVY 235
           H +   F+CPF S                       CH +G FSR DT+K HLK++HF Y
Sbjct: 239 HQIKGTFKCPFNSTLIQLDMDMYPYKLKPLNFETSNCHQTGVFSRCDTFKNHLKALHFEY 298

Query: 236 PVGVAKSQRSRSTGRCAACYQEFRNNNEWLTQHV 269
           P G  K  R+   GRC  C  +F N + WL +HV
Sbjct: 299 PPGTKKKDRNVVPGRCKHCGLKFENVDVWLNEHV 332

>Skud_12.460 Chr12 (811208..812242) [1035 bp, 344 aa] {ON} YLR375W
           (REAL)
          Length = 344

 Score = 68.2 bits (165), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 45/94 (47%), Gaps = 19/94 (20%)

Query: 195 HLVTKDFRCPFWSV-------------------DCRCHASGEFSRKDTYKTHLKSIHFVY 235
           H +   F+CPF S                       CH +G FSR DT+K HLK++HF Y
Sbjct: 242 HQIKGTFKCPFNSTLIQLDMDMYPYKLKPLNFETSNCHQTGVFSRCDTFKNHLKALHFEY 301

Query: 236 PVGVAKSQRSRSTGRCAACYQEFRNNNEWLTQHV 269
           P G  K  R+   GRC  C  +F N + WL +HV
Sbjct: 302 PPGTKKKDRNVVPGRCKHCGLKFENVDVWLNEHV 335

>NCAS0J01300 Chr10 (225659..226966) [1308 bp, 435 aa] {ON} Anc_4.222
          Length = 435

 Score = 68.2 bits (165), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 35/99 (35%), Positives = 48/99 (48%), Gaps = 20/99 (20%)

Query: 191 HMKK-HLVTKDFRCPFWSV-------------------DCRCHASGEFSRKDTYKTHLKS 230
           H+K  H ++  ++CP+ S                       CH SG FSR DT+K HLK+
Sbjct: 328 HLKSLHQLSGAYKCPYNSTLIQLDMEMYPFKKQLINFETLNCHPSGIFSRGDTFKNHLKA 387

Query: 231 IHFVYPVGVAKSQRSRSTGRCAACYQEFRNNNEWLTQHV 269
           +HF YP G  K++R+   G C  C + F N   WL  HV
Sbjct: 388 LHFQYPAGTKKTERNSVPGNCKHCGKHFANVEVWLHDHV 426

>Suva_10.491 Chr10 (836816..837094,837128..837883) [1035 bp, 344 aa]
           {ON} YLR375W (REAL)
          Length = 344

 Score = 67.8 bits (164), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 45/94 (47%), Gaps = 19/94 (20%)

Query: 195 HLVTKDFRCPFWSV-------------------DCRCHASGEFSRKDTYKTHLKSIHFVY 235
           H +   F+CPF S                       CH +G FSR DT+K HLK++HF Y
Sbjct: 242 HQIKGTFKCPFNSTLIQLDMDMYPYKFKPLNFETSNCHQTGVFSRCDTFKNHLKALHFEY 301

Query: 236 PVGVAKSQRSRSTGRCAACYQEFRNNNEWLTQHV 269
           P G  K  R+   GRC  C  +F N + WL +HV
Sbjct: 302 PPGTKKKDRNIVPGRCKHCGLKFENVDVWLNEHV 335

>KAFR0A06120 Chr1 complement(1238549..1239577) [1029 bp, 342 aa]
           {ON} Anc_4.222 YDL048C
          Length = 342

 Score = 67.0 bits (162), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 41/133 (30%), Positives = 54/133 (40%), Gaps = 37/133 (27%)

Query: 174 QCAFCPSNFKVKGYLTRHMKKHL------------------VTKDFRCPFWSV------- 208
           +C  C   F     L RH K+H                   +   F+CP+ S        
Sbjct: 201 RCPVCERGFARNNDLIRHKKRHWKDEINVAGEHDQLKSLHQIKGTFKCPYNSTLIQLDME 260

Query: 209 ------------DCRCHASGEFSRKDTYKTHLKSIHFVYPVGVAKSQRSRSTGRCAACYQ 256
                          CH +G FSR DT+K HLK++HF YP G  K  R+  +GRC  C  
Sbjct: 261 IYPFKSKSLNFETSNCHQTGIFSRCDTFKNHLKALHFEYPPGTKKKDRNVVSGRCKHCGL 320

Query: 257 EFRNNNEWLTQHV 269
           +F N   WL+ HV
Sbjct: 321 KFDNVEVWLSDHV 333

>KLLA0F07073g Chr6 (675221..676897) [1677 bp, 558 aa] {ON} some
           similarities with uniprot|Q7LH06 Saccharomyces
           cerevisiae YDL048C STP4 Protein involved in pre-tRNA
           splicing and in uptake of branched-chain amino acids
          Length = 558

 Score = 67.4 bits (163), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 44/138 (31%), Positives = 57/138 (41%), Gaps = 41/138 (29%)

Query: 173 FQCAFCPSNFKVKGYLTRHMKKH-----------LVTK---------DFRCPFWS----V 208
           F+C  C   F     L RH K H            V K          ++CPF S    +
Sbjct: 411 FKCEVCSRGFARSNDLIRHKKLHWKDDLNQESMDFVEKLKCLHELKGTYKCPFNSNLINL 470

Query: 209 DCR-----------------CHASGEFSRKDTYKTHLKSIHFVYPVGVAKSQRSRSTGRC 251
           D +                 CH++G FSR DT+K HLK++HF YP G  K  R+   G C
Sbjct: 471 DLKLKGSDMKTADLPFETSNCHSTGVFSRCDTFKNHLKALHFEYPPGTKKKDRANVAGHC 530

Query: 252 AACYQEFRNNNEWLTQHV 269
             C Q+F +   WL  HV
Sbjct: 531 KHCGQKFESIETWLKDHV 548

>ZYRO0B07436g Chr2 complement(581225..582256) [1032 bp, 343 aa] {ON}
           similar to uniprot|Q7LH06 Saccharomyces cerevisiae
           YDL048C STP4 Protein involved in pre-tRNA splicing and
           in uptake of branched-chain amino acids
          Length = 343

 Score = 66.6 bits (161), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 37/103 (35%), Positives = 49/103 (47%), Gaps = 20/103 (19%)

Query: 195 HLVTKDFRCPFWSV-------------------DCRCHASGEFSRKDTYKTHLKSIHFVY 235
           H +   F+CPF S                       CH +G FSR DT+K HLK++HF Y
Sbjct: 241 HQIKGTFKCPFNSSLIQLDMEIYPYKSKPLNFETSNCHQTGVFSRCDTFKNHLKALHFEY 300

Query: 236 PVGVAKSQRSRSTGRCAACYQEFRNNNEWLTQHVESRSCSGLH 278
           P G  K  RS   GRC  C   F N + WL +H+  ++C  L+
Sbjct: 301 PPGTKKRDRSVVPGRCKHCGLRFANVDLWLNEHI-GKTCGYLY 342

>TDEL0E01520 Chr5 complement(297717..298916) [1200 bp, 399 aa] {ON}
           Anc_4.222 YDL048C
          Length = 399

 Score = 66.6 bits (161), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 45/94 (47%), Gaps = 19/94 (20%)

Query: 195 HLVTKDFRCPFWSV-------------------DCRCHASGEFSRKDTYKTHLKSIHFVY 235
           H +   F+CPF +                       CH +G FSR DT+K HLK++HF Y
Sbjct: 297 HQIKGTFKCPFNAALIQLDMEIYPYKSKPLNFETSSCHQTGVFSRCDTFKNHLKALHFEY 356

Query: 236 PVGVAKSQRSRSTGRCAACYQEFRNNNEWLTQHV 269
           P G  K  R+   GRC  C  +F N + WL +HV
Sbjct: 357 PPGTKKRDRTVVAGRCKHCGIKFANVDTWLNEHV 390

>CAGL0K04697g Chr11 (459195..460742) [1548 bp, 515 aa] {ON} some
           similarities with uniprot|Q07351 Saccharomyces
           cerevisiae YDL048c STP4 or uniprot|Q05937 Saccharomyces
           cerevisiae YLR375w STP3
          Length = 515

 Score = 66.6 bits (161), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 41/63 (65%), Gaps = 1/63 (1%)

Query: 212 CHASGEFSRKDTYKTHLKSIHFVYPVGVAKSQRSRSTGRCAACYQEFRNNNEWLTQHVES 271
           CH +G FSR DT+K HLK++HF YP    + QRS+  G+C  C  +F N + WL QHV  
Sbjct: 448 CHPTGVFSRCDTFKNHLKALHFEYPQKTKREQRSQVPGKCKHCGMKFPNVDIWLNQHV-G 506

Query: 272 RSC 274
           +SC
Sbjct: 507 KSC 509

>TBLA0A08200 Chr1 complement(2024809..2025861) [1053 bp, 350 aa]
           {ON} Anc_4.222 YDL048C
          Length = 350

 Score = 65.5 bits (158), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 37/58 (63%)

Query: 212 CHASGEFSRKDTYKTHLKSIHFVYPVGVAKSQRSRSTGRCAACYQEFRNNNEWLTQHV 269
           CH +G FSR DT+K HLK++HF YP G  K  R   +GRC  C  +F+N + WL  HV
Sbjct: 284 CHQTGVFSRCDTFKNHLKALHFEYPPGTKKKDRLLVSGRCKHCGLKFKNVDVWLKTHV 341

>TBLA0I02770 Chr9 (650889..652730) [1842 bp, 613 aa] {ON} Anc_4.222
           YDL048C
          Length = 613

 Score = 65.5 bits (158), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 37/58 (63%)

Query: 212 CHASGEFSRKDTYKTHLKSIHFVYPVGVAKSQRSRSTGRCAACYQEFRNNNEWLTQHV 269
           CH +G FSR DT+K HLK++HF YP G  +  R  S+G+C  C Q F N + WL  HV
Sbjct: 547 CHQTGVFSRCDTFKNHLKALHFEYPQGTKRKDRLFSSGKCKHCGQNFPNVDVWLNYHV 604

>NCAS0A02360 Chr1 (448263..449699) [1437 bp, 478 aa] {ON} Anc_4.222
          Length = 478

 Score = 63.5 bits (153), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 35/58 (60%)

Query: 212 CHASGEFSRKDTYKTHLKSIHFVYPVGVAKSQRSRSTGRCAACYQEFRNNNEWLTQHV 269
           CH +G FSR DTYK HLK++HF YP    K  R+   G C  C  +F N + WL +HV
Sbjct: 412 CHQTGVFSRCDTYKNHLKALHFEYPPKTKKEDRAVMPGNCKHCGMKFENVDVWLNKHV 469

>Suva_4.201 Chr4 complement(354498..356009) [1512 bp, 503 aa] {ON}
           YDL048C (REAL)
          Length = 503

 Score = 63.2 bits (152), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 36/58 (62%)

Query: 212 CHASGEFSRKDTYKTHLKSIHFVYPVGVAKSQRSRSTGRCAACYQEFRNNNEWLTQHV 269
           CH +G FSR DT+K HLK++HF YP    K  RS   G+C  C  +F N + WL +HV
Sbjct: 437 CHQTGVFSRCDTFKNHLKALHFEYPPKTKKEDRSIVPGKCKHCGLQFPNVDVWLNKHV 494

>Skud_4.206 Chr4 complement(361956..363416) [1461 bp, 486 aa] {ON}
           YDL048C (REAL)
          Length = 486

 Score = 63.2 bits (152), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 36/58 (62%)

Query: 212 CHASGEFSRKDTYKTHLKSIHFVYPVGVAKSQRSRSTGRCAACYQEFRNNNEWLTQHV 269
           CH +G FSR DT+K HLK++HF YP    K  RS   G+C  C  +F N + WL +HV
Sbjct: 420 CHQTGVFSRCDTFKNHLKALHFEYPPKTKKEDRSIVPGKCKHCGLQFPNVDVWLNKHV 477

>NDAI0D04510 Chr4 complement(1057468..1059150) [1683 bp, 560 aa]
           {ON} Anc_4.222
          Length = 560

 Score = 62.4 bits (150), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 34/58 (58%)

Query: 212 CHASGEFSRKDTYKTHLKSIHFVYPVGVAKSQRSRSTGRCAACYQEFRNNNEWLTQHV 269
           CH +G FSR DTYK HLK++HF YP    K  R    GRC  C   F N + WL +HV
Sbjct: 494 CHQTGVFSRCDTYKNHLKALHFEYPPRTRKEDRGVVPGRCKHCGMGFVNVDVWLNKHV 551

>Smik_4.190 Chr4 complement(347829..349298) [1470 bp, 489 aa] {ON}
           YDL048C (REAL)
          Length = 489

 Score = 61.2 bits (147), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 27/58 (46%), Positives = 35/58 (60%)

Query: 212 CHASGEFSRKDTYKTHLKSIHFVYPVGVAKSQRSRSTGRCAACYQEFRNNNEWLTQHV 269
           CH +G FSR DT+K HLK++HF YP    K  R    G+C  C  +F N + WL +HV
Sbjct: 423 CHQTGVFSRCDTFKNHLKALHFEYPPKTKKEDRGIVPGKCKHCGLQFPNVDVWLNKHV 480

>YDL048C Chr4 complement(366739..368211) [1473 bp, 490 aa] {ON}
           STP4Protein containing a Kruppel-type zinc-finger
           domain; has similarity to Stp1p, Stp2p, and Stp3p;
           predicted to be a transcription factor
          Length = 490

 Score = 61.2 bits (147), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 27/58 (46%), Positives = 35/58 (60%)

Query: 212 CHASGEFSRKDTYKTHLKSIHFVYPVGVAKSQRSRSTGRCAACYQEFRNNNEWLTQHV 269
           CH +G FSR DT+K HLK++HF YP    K  R    G+C  C  +F N + WL +HV
Sbjct: 424 CHQTGVFSRCDTFKNHLKALHFEYPPKTKKEDRGVVPGKCKHCGLQFPNVDVWLNKHV 481

>Kpol_472.3 s472 complement(4365..5300) [936 bp, 311 aa] {ON}
           complement(4365..5300) [936 nt, 312 aa]
          Length = 311

 Score = 53.5 bits (127), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 40/140 (28%), Positives = 55/140 (39%), Gaps = 43/140 (30%)

Query: 173 FQCAFCPSNFKVKGYLTRHMKKH-----LVTKD------------------FRCPF---- 205
           F+C  C   F       RH K+H     L  KD                  FRCP+    
Sbjct: 163 FKCPSCNKGFSRNFDFLRHQKEHVQKDLLTAKDPLMSEHDRLVALHNTGDIFRCPYNEKL 222

Query: 206 WSVDC---------------RCHASGEFSRKDTYKTHLKSIHFVYP-VGVAKSQRSRSTG 249
            ++D                 CH++G F RKDT + HL++ HF Y  + + K +   S G
Sbjct: 223 INIDLELYKHKFQPKTAYVKNCHSTGLFLRKDTLRNHLRAHHFNYADLTLPKRKSITSPG 282

Query: 250 RCAACYQEFRNNNEWLTQHV 269
            C AC + F N   W  +HV
Sbjct: 283 NCGACGKWFENTTTWTDEHV 302

>TPHA0B02390 Chr2 complement(547109..548149) [1041 bp, 346 aa] {ON} 
          Length = 346

 Score = 45.8 bits (107), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 36/145 (24%), Positives = 53/145 (36%), Gaps = 48/145 (33%)

Query: 173 FQCAFCPSNFKVKGYLTRHMKKHL----------------------------VTKDFRCP 204
           F C  CP +F       RH K+H+                            +   FRCP
Sbjct: 193 FHCDICPKSFSRNFDFLRHKKEHVQKALIQDVNSQDAYSDLTNKSKLTQLHNIGNVFRCP 252

Query: 205 F-------------------WSVDCRCHASGEFSRKDTYKTHLKSIHFVYPVG-VAKSQR 244
           +                    S    CH +G F RKDT + HL+S HF Y    ++  ++
Sbjct: 253 YNEKVIDLDLSLHKYKVKPASSQVANCHHNGMFFRKDTLRNHLRSHHFDYDKKELSVKEK 312

Query: 245 SRSTGRCAACYQEFRNNNEWLTQHV 269
           + ++GRC  C +   N   W  +HV
Sbjct: 313 ACASGRCRFCNEWHENAKIWADEHV 337

>Kpol_1065.15 s1065 (43237..43899) [663 bp, 220 aa] {ON}
           (43237..43899) [663 nt, 221 aa]
          Length = 220

 Score = 42.4 bits (98), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 29/60 (48%), Gaps = 10/60 (16%)

Query: 173 FQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHASGEFSRKDT----YKTHL 228
           F+C  C   F   G+LTRH + H   K+  CPF   + R      FSR D     YKTHL
Sbjct: 161 FECKTCGRKFTTSGHLTRHNRIHTGEKNHVCPFEGCNLR------FSRNDNSLQHYKTHL 214

>KNAG0J00870 Chr10 complement(148421..149263) [843 bp, 280 aa] {ON}
           Anc_3.281 YBR066C
          Length = 280

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 30/84 (35%), Positives = 36/84 (42%), Gaps = 21/84 (25%)

Query: 173 FQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHASGEFSRKDT----YKTHL 228
           FQC  C   F   G+L+RH K H   K++ CP  S   R      FSR D     Y+THL
Sbjct: 212 FQCKTCSMAFTTSGHLSRHNKIHTGEKNYVCPHESCGQR------FSRHDNCIQHYRTHL 265

Query: 229 KSIHFVYPVGVAKSQRSRSTGRCA 252
           K           K QR    G+ A
Sbjct: 266 K-----------KKQRQAKKGKVA 278

>AGL071C Chr7 complement(574723..575913) [1191 bp, 396 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR070W
           (MOT3)
          Length = 396

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 29/61 (47%), Gaps = 8/61 (13%)

Query: 172 MFQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHASGEFSRKDTYKTHLKSI 231
           + +C FC   FK K +L RH+  H   K + CP+      CH+     RKD    HLK  
Sbjct: 184 IHKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPW------CHS--RHKRKDNLSQHLKLK 235

Query: 232 H 232
           H
Sbjct: 236 H 236

>KLLA0E18547g Chr5 complement(1648263..1649558) [1296 bp, 431 aa]
           {ON} some similarities with uniprot|P54785 Saccharomyces
           cerevisiae YMR070W MOT3 Nuclear transcription factor
           with two Cys2-His2 zinc fingers involved in repression
           of a subset of hypoxic genes by Rox1p repression of
           several DAN/TIR genes during aerobic growth and
           repression of ergosterol biosynthetic genes
          Length = 431

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 27/63 (42%), Gaps = 8/63 (12%)

Query: 173 FQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHASGEFSRKDTYKTHLKSIH 232
           +QC  C   F+ K +L RH+  H   K F CP W        S    RKD    HLK  H
Sbjct: 306 YQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCP-W-------CSSTHKRKDNLLQHLKLKH 357

Query: 233 FVY 235
             Y
Sbjct: 358 TQY 360

>Ecym_7255 Chr7 complement(537346..538980) [1635 bp, 544 aa] {ON}
           similar to Ashbya gossypii AGL071C
          Length = 544

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 29/61 (47%), Gaps = 8/61 (13%)

Query: 172 MFQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHASGEFSRKDTYKTHLKSI 231
           + +C FC   FK K +L RH+  H   K + CP+      CH+     RKD    HLK  
Sbjct: 285 IHKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPW------CHS--RHKRKDNLSQHLKLK 336

Query: 232 H 232
           H
Sbjct: 337 H 337

>TBLA0I01480 Chr9 (321045..322586) [1542 bp, 513 aa] {ON} Anc_2.533
           YMR070W
          Length = 513

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 31/64 (48%), Gaps = 8/64 (12%)

Query: 172 MFQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHASGEFSRKDTYKTHLKSI 231
           +FQC  C  +FK K +L RH+  H   ++F CP       C  S +  RKD    HLK  
Sbjct: 339 IFQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCP-------CCLS-KHKRKDNLIQHLKLK 390

Query: 232 HFVY 235
           H  Y
Sbjct: 391 HLDY 394

>KAFR0A01090 Chr1 complement(209790..210539) [750 bp, 249 aa] {ON}
           Anc_3.281 YBR066C
          Length = 249

 Score = 38.9 bits (89), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 29/63 (46%), Gaps = 10/63 (15%)

Query: 173 FQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHASGEFSRKDT----YKTHL 228
           + C  C   F   G+L RH + H   K+  CPF     R      FSR+D     Y+TH 
Sbjct: 172 YICKTCSKGFTTSGHLARHNRIHTGEKNHECPFEGCQQR------FSRQDNCLQHYRTHF 225

Query: 229 KSI 231
           KSI
Sbjct: 226 KSI 228

>KNAG0H01180 Chr8 (200503..201267) [765 bp, 254 aa] {ON} Anc_3.281
           YBR066C
          Length = 254

 Score = 38.9 bits (89), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 29/66 (43%), Gaps = 10/66 (15%)

Query: 173 FQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHASGEFSRKDT----YKTHL 228
           + C  C   F   G+L RH + H   K+  CPF     R      FSR+D     Y+TH 
Sbjct: 185 YLCTTCTKGFTTSGHLARHKRIHTGEKNHLCPFEGCKQR------FSRQDNCLQHYRTHF 238

Query: 229 KSIHFV 234
           K+  F 
Sbjct: 239 KNFTFT 244

>Skud_13.226 Chr13 (383462..383482,383520..384161,384207..384971)
           [1428 bp, 475 aa] {ON} YMR070W (REAL)
          Length = 475

 Score = 38.9 bits (89), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 30/64 (46%), Gaps = 8/64 (12%)

Query: 172 MFQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHASGEFSRKDTYKTHLKSI 231
           + QC FC  +FK K +L RH+  H   + F CP W +  +        RKD    H+K  
Sbjct: 327 IHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCP-WCLSRQ-------KRKDNLLQHMKLK 378

Query: 232 HFVY 235
           H  Y
Sbjct: 379 HTNY 382

>Suva_13.246 Chr13 (390482..391741) [1260 bp, 419 aa] {ON} YMR070W
           (REAL)
          Length = 419

 Score = 38.9 bits (89), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 30/64 (46%), Gaps = 8/64 (12%)

Query: 172 MFQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHASGEFSRKDTYKTHLKSI 231
           + QC FC  +FK K +L RH+  H   + F CP W +  +        RKD    H+K  
Sbjct: 326 IHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCP-WCLSRQ-------KRKDNLLQHMKLK 377

Query: 232 HFVY 235
           H  Y
Sbjct: 378 HTNY 381

>TPHA0M01180 Chr13 complement(237368..238420) [1053 bp, 350 aa] {ON}
           Anc_3.281 YBR066C
          Length = 350

 Score = 38.5 bits (88), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 24/65 (36%), Positives = 28/65 (43%), Gaps = 20/65 (30%)

Query: 174 QCAFCPSNFKVKGYLTRHMKKHLVTKDFRCP-----FWSVDCRCHASGEFSRKDT----Y 224
           QC  C   F   G+LTRH K H   K+ +CP      W           FSR D     Y
Sbjct: 269 QCKICMKKFTTAGHLTRHHKIHTGEKNHKCPHRGCNLW-----------FSRNDNSLQHY 317

Query: 225 KTHLK 229
           +THLK
Sbjct: 318 QTHLK 322

>Smik_13.249 Chr13 (393264..393311,393345..394718) [1422 bp, 473 aa]
           {ON} YMR070W (REAL)
          Length = 473

 Score = 38.5 bits (88), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 30/64 (46%), Gaps = 8/64 (12%)

Query: 172 MFQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHASGEFSRKDTYKTHLKSI 231
           + QC FC  +FK K +L RH+  H   + F CP W +  +        RKD    H+K  
Sbjct: 337 IHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCP-WCLSRQ-------KRKDNLLQHMKLK 388

Query: 232 HFVY 235
           H  Y
Sbjct: 389 HTNY 392

>SAKL0A09482g Chr1 (831930..833096) [1167 bp, 388 aa] {ON} some
           similarities with uniprot|P54785 Saccharomyces
           cerevisiae YMR070W MOT3 Nuclear transcription factor
           with two Cys2-His2 zinc fingers involved in repression
           of a subset of hypoxic genes by Rox1p repression of
           several DAN/TIR genes during aerobic growth and
           repression of ergosterol biosynthetic genes
          Length = 388

 Score = 38.5 bits (88), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 27/59 (45%), Gaps = 8/59 (13%)

Query: 174 QCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHASGEFSRKDTYKTHLKSIH 232
           QC  C  +FK K +L RH+  H   K F CP+    C+        RKD    H+K  H
Sbjct: 259 QCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPW----CQS----RHKRKDNLLQHMKLKH 309

>TBLA0H00660 Chr8 complement(139075..143010) [3936 bp, 1311 aa] {ON}
           Anc_8.425 YDR216W
          Length = 1311

 Score = 38.9 bits (89), Expect = 0.013,   Method: Composition-based stats.
 Identities = 24/77 (31%), Positives = 35/77 (45%), Gaps = 11/77 (14%)

Query: 172 MFQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHASGEFSRKDTYKTHLKSI 231
           +F C FC   F  + +LTRH + H   K F C        C  +  F+R+D    H + I
Sbjct: 151 LFLCDFCKRAFARQEHLTRHKRSHTNEKPFLCNL------CFKN--FTRRDLLIRHAQKI 202

Query: 232 HFVYPVGVAKSQRSRST 248
           H      + +S + RST
Sbjct: 203 H---GGDIGQSYKRRST 216

>SAKL0D03146g Chr4 complement(256292..256765) [474 bp, 157 aa] {ON}
           similar to uniprot|Q750L1 Ashbya gossypii AGR031W
           AGR031Wp and some similarites with YDR043C
           uniprot|Q03125 Saccharomyces cerevisiae YDR043C NRG1
           Transcriptional repressor that recruits the Cyc8p-Tup1p
           complex to promoters mediates glucose repression and
           negatively regulates a variety of processes including
           filamentous growth and alkaline pH response
          Length = 157

 Score = 37.4 bits (85), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 28/62 (45%), Gaps = 10/62 (16%)

Query: 173 FQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHASGEFSRKDT----YKTHL 228
           + C  C   F   G+L RH + H   K+  CPF     R      FSR D     Y+THL
Sbjct: 100 YVCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQR------FSRHDNCVQHYRTHL 153

Query: 229 KS 230
           K+
Sbjct: 154 KT 155

>YMR070W Chr13 (409154..410626) [1473 bp, 490 aa] {ON}
           MOT3Transcriptional repressor and activator with two
           C2-H2 zinc fingers; involved in repression of a subset
           of hypoxic genes by Rox1p, repression of several DAN/TIR
           genes during aerobic growth, and repression of
           ergosterol biosynthetic genes in response to
           hyperosmotic stress; contributes to recruitment of the
           Tup1p-Cyc8p general repressor to promoters; involved in
           positive transcriptional regulation of CWP2 and other
           genes; can form the [MOT3+] prion
          Length = 490

 Score = 38.1 bits (87), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 30/64 (46%), Gaps = 8/64 (12%)

Query: 172 MFQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHASGEFSRKDTYKTHLKSI 231
           + QC FC  +FK K +L RH+  H   + F CP W +  +        RKD    H+K  
Sbjct: 345 IHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCP-WCLSRQ-------KRKDNLLQHMKLK 396

Query: 232 HFVY 235
           H  Y
Sbjct: 397 HTNY 400

>NCAS0I01560 Chr9 (291561..292361) [801 bp, 266 aa] {ON} Anc_3.281
          Length = 266

 Score = 37.4 bits (85), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 29/59 (49%), Gaps = 10/59 (16%)

Query: 175 CAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHASGEFSRKDT----YKTHLK 229
           C  C + F   G+L+RH + H   K+  CPF   + +      FSR D     Y+THLK
Sbjct: 212 CKICSTGFTTSGHLSRHNRIHTGEKNHSCPFEGCNQK------FSRHDNCLQHYRTHLK 264

>Kpol_1052.8 s1052 complement(23868..25028) [1161 bp, 386 aa] {ON}
           complement(23868..25028) [1161 nt, 387 aa]
          Length = 386

 Score = 37.4 bits (85), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 32/74 (43%), Gaps = 4/74 (5%)

Query: 173 FQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHASGEFSRKDTYKTHLK--S 230
           + C+ C   FK    L+ HM  H   K F CPF +     +A     R   YK H K  S
Sbjct: 305 YHCSICGKKFKRPSSLSTHMNIHTGNKPFTCPFTNCTKSFNAKSNMLRH--YKLHFKLSS 362

Query: 231 IHFVYPVGVAKSQR 244
            +++ P G   S +
Sbjct: 363 GNYILPNGKITSTK 376

>ZYRO0B02002g Chr2 (162068..162952) [885 bp, 294 aa] {ON} some
           similarities with uniprot|P54785 Saccharomyces
           cerevisiae YMR070W MOT3 Nuclear transcription factor
           with two Cys2-His2 zinc fingers involved in repression
           of a subset of hypoxic genes by Rox1p repression of
           several DAN/TIR genes during aerobic growth and
           repression of ergosterol biosynthetic genes
          Length = 294

 Score = 37.0 bits (84), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 27/88 (30%), Positives = 39/88 (44%), Gaps = 15/88 (17%)

Query: 175 CAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHASGEFSRKDTYKTHLKSIHFV 234
           C  C  +FK K +L RH+  H   + F CP W +        +  RKD    H+K  H  
Sbjct: 194 CPMCDKSFKRKSWLRRHLLSHSPERHFGCP-WCLS-------KHKRKDNLLQHMKLKHTE 245

Query: 235 YPVGVAKSQRSRSTGRCAACYQEFRNNN 262
           Y   V +  R+++ G       E RN+N
Sbjct: 246 Y---VLEKLRNQNVG----IDGEVRNDN 266

>NDAI0K01860 Chr11 complement(417678..419870) [2193 bp, 730 aa] {ON}
           Anc_2.533
          Length = 730

 Score = 37.4 bits (85), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 30/61 (49%), Gaps = 8/61 (13%)

Query: 172 MFQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHASGEFSRKDTYKTHLKSI 231
           +FQC++C  +FK   +L RH+  H   + + CP W +        +  RKD    HLK  
Sbjct: 559 VFQCSYCVKSFKRFSWLKRHLLAHSPERHYSCP-WCL-------SKHKRKDNLLQHLKLK 610

Query: 232 H 232
           H
Sbjct: 611 H 611

>CAGL0K04631g Chr11 complement(441550..444591) [3042 bp, 1013 aa]
           {ON} some similarities with uniprot|P53243 Saccharomyces
           cerevisiae YGR067c
          Length = 1013

 Score = 37.0 bits (84), Expect = 0.054,   Method: Composition-based stats.
 Identities = 17/58 (29%), Positives = 26/58 (44%), Gaps = 8/58 (13%)

Query: 175 CAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHASGEFSRKDTYKTHLKSIH 232
           C+FC   F    + TRH + H   K F C           S  F R+D  + H++++H
Sbjct: 14  CSFCNKAFSRSEHKTRHERSHAGVKPFECQV--------CSHSFVRRDLLQRHIRTVH 63

>KNAG0G01280 Chr7 complement(286134..287552) [1419 bp, 472 aa] {ON}
           Anc_8.144 YER130C
          Length = 472

 Score = 36.6 bits (83), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 28/59 (47%), Gaps = 9/59 (15%)

Query: 173 FQCAFCPSNFKVKGYLTRH-MKKHLVTKDFRCPFWSVDCRCHASGEFSRKDTYKTHLKS 230
           F C +CP  FK + +L RH +  H+  K F CP    +        FSR D    H+K+
Sbjct: 400 FGCKYCPRKFKRQEHLKRHILSLHVGEKRFGCPICGKN--------FSRSDNLNQHIKT 450

>Ecym_2159 Chr2 (304191..305573) [1383 bp, 460 aa] {ON} similar to
           Ashbya gossypii AFL136W
          Length = 460

 Score = 36.2 bits (82), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 40/79 (50%), Gaps = 12/79 (15%)

Query: 173 FQC---AFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHASGEFSRKDTYKTHLK 229
           F+C     C  +F    +L RH++KH   K F+C    V  R      FSR D  K H +
Sbjct: 20  FKCTGYGSCDMSFTRAEHLARHIRKHTGEKPFQC---EVCNRF-----FSRIDNLKQHRE 71

Query: 230 SIHFVYPVGVAKSQR-SRS 247
           S+H++  +   +S+R SRS
Sbjct: 72  SVHWIPTISTTRSKRQSRS 90

>KLLA0B07909g Chr2 (697885..700653) [2769 bp, 922 aa] {ON} some
           similarities with uniprot|P53243 Saccharomyces
           cerevisiae YGR067C
          Length = 922

 Score = 36.2 bits (82), Expect = 0.086,   Method: Composition-based stats.
 Identities = 16/60 (26%), Positives = 27/60 (45%), Gaps = 8/60 (13%)

Query: 173 FQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHASGEFSRKDTYKTHLKSIH 232
           + C+FC   F    +  RH + H  +K F C           S  F R+D  + H++++H
Sbjct: 8   YICSFCAKPFSRSEHKARHERSHTGSKPFSCSI--------CSHSFVRRDLLQRHIRTVH 59

>TDEL0A03070 Chr1 (549360..550079) [720 bp, 239 aa] {ON} Anc_2.533
           YMR070W
          Length = 239

 Score = 35.4 bits (80), Expect = 0.086,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 29/64 (45%), Gaps = 8/64 (12%)

Query: 172 MFQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHASGEFSRKDTYKTHLKSI 231
           + +C  C  +FK K +L RH+  H   + F CP W +        +  RKD    H+K  
Sbjct: 133 VHKCHLCNKSFKRKSWLQRHLLSHSPARHFSCP-WCL-------SKHKRKDNLLQHMKLK 184

Query: 232 HFVY 235
           H  Y
Sbjct: 185 HTDY 188

>Smik_4.281 Chr4 complement(509413..510108) [696 bp, 231 aa] {ON}
           YDR043C (REAL)
          Length = 231

 Score = 35.4 bits (80), Expect = 0.094,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 28/64 (43%), Gaps = 10/64 (15%)

Query: 173 FQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHASGEFSRKDT----YKTHL 228
           + C  C   F   G+L RH + H   K+  CP+     R      FSR D     Y+THL
Sbjct: 174 YICKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQR------FSRHDNCLQHYRTHL 227

Query: 229 KSIH 232
           K  H
Sbjct: 228 KKEH 231

>KNAG0D04190 Chr4 complement(754846..757878) [3033 bp, 1010 aa] {ON}
           Anc_4.214 YGR067C
          Length = 1010

 Score = 36.2 bits (82), Expect = 0.096,   Method: Composition-based stats.
 Identities = 18/60 (30%), Positives = 30/60 (50%), Gaps = 8/60 (13%)

Query: 173 FQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHASGEFSRKDTYKTHLKSIH 232
           + C++C   F    + TRH + H   K F+C      C+ H    F R+D  + H+K++H
Sbjct: 8   YICSYCAKAFSRSEHRTRHERSHTGYKPFQCKI----CQ-HC---FVRRDLVQRHIKTVH 59

>NCAS0A02160 Chr1 complement(406753..407991) [1239 bp, 412 aa] {ON}
           Anc_4.189
          Length = 412

 Score = 35.8 bits (81), Expect = 0.100,   Method: Compositional matrix adjust.
 Identities = 26/103 (25%), Positives = 46/103 (44%), Gaps = 11/103 (10%)

Query: 174 QCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHASGEFSRKDTYKTHLKSIHF 233
           +CA CP  F+       H+ ++ + ++F+CPF +  C  H  G F R+   + H  + H 
Sbjct: 271 RCAHCPRRFRTLYEYAAHLDEYSIVREFKCPFKT--CPWHILG-FPRRSDLRRHCANQHK 327

Query: 234 VYPVGVAKSQRSRSTGRCAA-------CYQEFRNNNEWLTQHV 269
               G  K++ +   G           C ++F N N+   +HV
Sbjct: 328 ENLTGQLKNKLNLKDGAYETKNCPNKYCPKKF-NRNDAFARHV 369

>SAKL0G18062g Chr7 complement(1562943..1566659) [3717 bp, 1238 aa]
           {ON} similar to uniprot|Q04545 Saccharomyces cerevisiae
           YML081W Hypothetical ORF
          Length = 1238

 Score = 36.2 bits (82), Expect = 0.10,   Method: Composition-based stats.
 Identities = 19/60 (31%), Positives = 26/60 (43%), Gaps = 8/60 (13%)

Query: 173 FQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHASGEFSRKDTYKTHLKSIH 232
           F C  C   F  + +L RH + H   K F C F     RC     F+R+D    H + +H
Sbjct: 73  FLCPICTRGFARQEHLKRHQRSHTNEKPFLCAFCG---RC-----FARRDLVLRHQQKLH 124

>Kwal_27.10925 s27 complement(559077..559871) [795 bp, 264 aa] {ON}
           YDR043C (NRG1) - transcriptional repressor which can
           bind to UAS-1 in the STA1 promoter and which can
           interact with Ssn6p [contig 33] FULL
          Length = 264

 Score = 35.4 bits (80), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 26/61 (42%), Gaps = 10/61 (16%)

Query: 173 FQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHASGEFSRKDT----YKTHL 228
           + C  C   F   G+L RH + H   K+  CP      R      FSR D     YKTHL
Sbjct: 201 YVCKICVKGFTTSGHLARHNRIHTGEKNHVCPHEGCGQR------FSRHDNCVQHYKTHL 254

Query: 229 K 229
           +
Sbjct: 255 R 255

>NCAS0F03740 Chr6 complement(752361..753227) [867 bp, 288 aa] {ON}
           Anc_3.518
          Length = 288

 Score = 35.4 bits (80), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 30/96 (31%), Positives = 39/96 (40%), Gaps = 14/96 (14%)

Query: 173 FQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHASGEFSRKDTYKTHLKSIH 232
           F+C  C   F    +  RH++ H   K   C F       H    FSR D  K H++ IH
Sbjct: 17  FRCPICSRGFHRLEHKKRHVRTHTGEKPHPCTF------AHCGKSFSRGDELKRHIR-IH 69

Query: 233 FVYPVGVAKSQRSRSTGRCAACYQEFRNNNEWLTQH 268
              P     S+R R   + AA  Q+  NN   L  H
Sbjct: 70  LGLP-----SRRIR--KKAAAKPQDIENNIPQLNIH 98

>TPHA0C02160 Chr3 complement(486620..490747) [4128 bp, 1375 aa] {ON}
           Anc_8.425 YDR216W
          Length = 1375

 Score = 35.8 bits (81), Expect = 0.11,   Method: Composition-based stats.
 Identities = 19/61 (31%), Positives = 28/61 (45%), Gaps = 8/61 (13%)

Query: 172 MFQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHASGEFSRKDTYKTHLKSI 231
           +F C+ C   F  + +LTRH + H   K + C        C    +FSR+D    H + I
Sbjct: 43  LFVCSICTRAFARQEHLTRHERSHTKEKPYCCGL------CQR--KFSRRDLLLRHAQKI 94

Query: 232 H 232
           H
Sbjct: 95  H 95

>KAFR0B06810 Chr2 complement(1416866..1420333) [3468 bp, 1155 aa]
           {ON} Anc_4.351 YJR127C
          Length = 1155

 Score = 35.8 bits (81), Expect = 0.12,   Method: Composition-based stats.
 Identities = 19/60 (31%), Positives = 26/60 (43%), Gaps = 8/60 (13%)

Query: 173 FQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHASGEFSRKDTYKTHLKSIH 232
           F C+ C   F  + +L RH + H   K F C F     RC     F+R+D    H   +H
Sbjct: 54  FLCSICTRGFVRQEHLKRHQRAHTSEKPFLCTFCG---RC-----FARRDLVLRHQHKLH 105

>KAFR0C00490 Chr3 complement(97556..98230) [675 bp, 224 aa] {ON}
           Anc_3.281 YBR066C
          Length = 224

 Score = 35.0 bits (79), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 27/59 (45%), Gaps = 10/59 (16%)

Query: 175 CAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHASGEFSRKDT----YKTHLK 229
           C  C   F   G+L+RH K H   K + CPF     R      FSR D     +KTHL+
Sbjct: 160 CKVCTMAFTTSGHLSRHNKIHTGEKKYVCPFEGCGQR------FSRHDNCVQHHKTHLR 212

>KNAG0E01600 Chr5 complement(319141..320157) [1017 bp, 338 aa] {ON}
           Anc_3.518 YGL209W
          Length = 338

 Score = 35.4 bits (80), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 39/92 (42%), Gaps = 9/92 (9%)

Query: 173 FQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHASGEFSRKDTYKTHLKSIH 232
           F+C  C   F    +  RH++ H   K ++C F   DC       FSR D  K H K IH
Sbjct: 17  FKCPLCQRGFHRLEHKKRHVRTHTGEKPYKCSF--PDC----PKSFSRTDELKRHSK-IH 69

Query: 233 --FVYPVGVAKSQRSRSTGRCAACYQEFRNNN 262
             F+    + + ++ RST       +  R  N
Sbjct: 70  GNFLSTATIKRLEKKRSTAPKQVTRKAGRPTN 101

>CAGL0K03003g Chr11 (277585..279528) [1944 bp, 647 aa] {ON} weakly
           similar to uniprot|P54785 Saccharomyces cerevisiae
           YMR070w MOT3
          Length = 647

 Score = 35.4 bits (80), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 28/60 (46%), Gaps = 8/60 (13%)

Query: 174 QCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHASGEFSRKDTYKTHLKSIHF 233
           +C  CP  FK K +L RH+  H   + F CP+      C++     R+D    H+K  H 
Sbjct: 535 RCHLCPKLFKRKSWLKRHLLSHSQQRHFLCPW------CNS--RHKRRDNLLQHMKLKHV 586

>Smik_16.450 Chr16 complement(772259..773557) [1299 bp, 432 aa] {ON}
           YPR186C (REAL)
          Length = 432

 Score = 35.4 bits (80), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 20/33 (60%)

Query: 173 FQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPF 205
           FQC  CP +F  K +L RH+  H  TK F+C +
Sbjct: 83  FQCDKCPKSFVKKSHLERHLYSHSDTKPFQCSY 115

 Score = 31.2 bits (69), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 26/61 (42%), Gaps = 8/61 (13%)

Query: 173 FQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHASGEFSRKDTYKTHLKSIH 232
           FQC++C      +  L RH   H  TK F CP    D R      F +    + H+ S+H
Sbjct: 111 FQCSYCGKGVTTRQQLKRHEVTH--TKSFICPEEGCDLR------FYKHPQLRAHILSVH 162

Query: 233 F 233
            
Sbjct: 163 L 163

>TPHA0G03510 Chr7 (750272..751435) [1164 bp, 387 aa] {ON} Anc_2.533
           YMR070W
          Length = 387

 Score = 35.4 bits (80), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 28/61 (45%), Gaps = 8/61 (13%)

Query: 172 MFQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHASGEFSRKDTYKTHLKSI 231
           +F+C  C   FK K +L RH+  H   + + CP W +        +  RKD    H+K  
Sbjct: 253 IFRCNVCGKYFKRKSWLKRHLLSHSSNRQYSCP-WCL-------SKHKRKDNLLQHMKLK 304

Query: 232 H 232
           H
Sbjct: 305 H 305

>KLLA0F18524g Chr6 complement(1701498..1702571) [1074 bp, 357 aa]
           {ON} some similarities with uniprot|Q03125 Saccharomyces
           cerevisiae YDR043C NRG1 Transcriptional repressor that
           recruits the Cyc8p-Tup1p complex to promoters
          Length = 357

 Score = 35.4 bits (80), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 27/61 (44%), Gaps = 7/61 (11%)

Query: 173 FQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHASGEFSRKDTYKTHLKSIH 232
           + C  C   F   G+L RH + H   K  +C F   + R      FSR D Y  H ++ H
Sbjct: 284 YICKICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQR------FSRHDNYIQHYRT-H 336

Query: 233 F 233
           F
Sbjct: 337 F 337

>Suva_2.200 Chr2 complement(341892..342590) [699 bp, 232 aa] {ON}
           YDR043C (REAL)
          Length = 232

 Score = 34.7 bits (78), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 27/61 (44%), Gaps = 10/61 (16%)

Query: 173 FQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHASGEFSRKDT----YKTHL 228
           + C  C   F   G+L RH + H   K+  CP+     R      FSR D     Y+THL
Sbjct: 175 YICKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQR------FSRHDNCLQHYRTHL 228

Query: 229 K 229
           K
Sbjct: 229 K 229

>KAFR0A01860 Chr1 (387980..389452) [1473 bp, 490 aa] {ON} Anc_2.533
           YMR070W
          Length = 490

 Score = 35.4 bits (80), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 28/66 (42%), Gaps = 8/66 (12%)

Query: 172 MFQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHASGEFSRKDTYKTHLKSI 231
           +  C  C  +F+ K +L RH+  H   + F CP W +           RKD    H+K  
Sbjct: 352 IHSCHLCEKSFRRKSWLKRHLLSHSTERQFLCP-WCL-------SRHKRKDNLLQHMKLK 403

Query: 232 HFVYPV 237
           H  Y V
Sbjct: 404 HSNYLV 409

>SAKL0A03476g Chr1 (319246..320214) [969 bp, 322 aa] {ON} some
           similarities with uniprot|Q12132 Saccharomyces
           cerevisiae YPL230W USV1 Up in StarVation
          Length = 322

 Score = 35.0 bits (79), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 32/68 (47%), Gaps = 11/68 (16%)

Query: 172 MFQCAF---CPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHASGEFSRKDTYKTHL 228
           +F+C     C   F    +L RH++KH   K F+C        CH    FSR D  K H 
Sbjct: 21  VFRCTGYGDCHMTFTRAEHLARHIRKHTGEKPFQCDI------CHRF--FSRVDNLKQHK 72

Query: 229 KSIHFVYP 236
           +S+H + P
Sbjct: 73  ESVHSIIP 80

>ZYRO0C13508g Chr3 complement(1068164..1068733) [570 bp, 189 aa]
           {ON} weakly similar to uniprot|P38082 Saccharomyces
           cerevisiae YBR066C
          Length = 189

 Score = 34.3 bits (77), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 26/59 (44%), Gaps = 10/59 (16%)

Query: 175 CAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHASGEFSRKDT----YKTHLK 229
           C  C   F   G+L RH + H   K+  CP+   D       +FSR D     Y+ H+K
Sbjct: 112 CRICYKGFTTSGHLARHNRIHTGEKNHECPYEGCD------QKFSRHDNCIQHYRAHVK 164

>TBLA0G02230 Chr7 (580915..581565) [651 bp, 216 aa] {ON} Anc_2.533
           YMR070W
          Length = 216

 Score = 34.7 bits (78), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 25/59 (42%), Gaps = 8/59 (13%)

Query: 174 QCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHASGEFSRKDTYKTHLKSIH 232
           +C  C   FK K +L RHM  H   + + CP W +           RKD    H+K  H
Sbjct: 114 KCPQCEKRFKRKSWLKRHMLSHSEERQYSCP-WCI-------SRHKRKDNLLQHMKLKH 164

>YDR043C Chr4 complement(542674..543369) [696 bp, 231 aa] {ON}
           NRG1Transcriptional repressor that recruits the
           Cyc8p-Tup1p complex to promoters; mediates glucose
           repression and negatively regulates a variety of
           processes including filamentous growth and alkaline pH
           response
          Length = 231

 Score = 34.7 bits (78), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 27/61 (44%), Gaps = 10/61 (16%)

Query: 173 FQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHASGEFSRKDT----YKTHL 228
           + C  C   F   G+L RH + H   K+  CP+     R      FSR D     Y+THL
Sbjct: 174 YICKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQR------FSRHDNCLQHYRTHL 227

Query: 229 K 229
           K
Sbjct: 228 K 228

>Skud_4.297 Chr4 complement(519166..519861) [696 bp, 231 aa] {ON}
           YDR043C (REAL)
          Length = 231

 Score = 34.7 bits (78), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 27/61 (44%), Gaps = 10/61 (16%)

Query: 173 FQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHASGEFSRKDT----YKTHL 228
           + C  C   F   G+L RH + H   K+  CP+     R      FSR D     Y+THL
Sbjct: 174 YICKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQR------FSRHDNCLQHYRTHL 227

Query: 229 K 229
           K
Sbjct: 228 K 228

>Skud_16.490 Chr16 complement(852079..853302) [1224 bp, 407 aa] {ON}
           YPR186C (REAL)
          Length = 407

 Score = 35.0 bits (79), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 20/33 (60%)

Query: 173 FQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPF 205
           FQC  CP +F  K +L RH+  H  TK F+C +
Sbjct: 80  FQCDKCPKSFVKKSHLERHLYSHSDTKPFQCSY 112

>Kpol_1023.100 s1023 (235260..238010) [2751 bp, 916 aa] {ON}
           (235260..238010) [2751 nt, 917 aa]
          Length = 916

 Score = 35.0 bits (79), Expect = 0.19,   Method: Composition-based stats.
 Identities = 19/59 (32%), Positives = 25/59 (42%), Gaps = 8/59 (13%)

Query: 175 CAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHASGEFSRKDTYKTHLKSIHF 233
           C  C   F  + +L RH + H   K F C F     RC     F+R+D    H   +HF
Sbjct: 43  CPTCSRGFVRREHLKRHQRAHTKEKPFVCVFCG---RC-----FARRDLIIRHQNKLHF 93

>KLTH0D06842g Chr4 (597659..599179) [1521 bp, 506 aa] {ON} some
           similarities with uniprot|P54785 Saccharomyces
           cerevisiae YMR070W MOT3 Nuclear transcription factor
           with two Cys2-His2 zinc fingers involved in repression
           of a subset of hypoxic genes by Rox1p repression of
           several DAN/TIR genes during aerobic growth and
           repression of ergosterol biosynthetic genes
          Length = 506

 Score = 35.0 bits (79), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 17/61 (27%), Positives = 30/61 (49%), Gaps = 8/61 (13%)

Query: 172 MFQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHASGEFSRKDTYKTHLKSI 231
           +++C+ C  +FK K +  RH+  H   K + CP+    C+        R+D    H+K+ 
Sbjct: 387 LYRCSMCEKSFKRKSWHQRHLLSHSSFKPYNCPW----CQS----RHKRRDNLFQHMKTK 438

Query: 232 H 232
           H
Sbjct: 439 H 439

>Ecym_2654 Chr2 (1266751..1267524) [774 bp, 257 aa] {ON} similar to
           Ashbya gossypii AGR031W
          Length = 257

 Score = 34.7 bits (78), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 27/60 (45%), Gaps = 10/60 (16%)

Query: 174 QCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHASGEFSRKDT----YKTHLK 229
           +C  C   F   G+L RH + H   K+ RC F     R      FSR D     Y+THLK
Sbjct: 194 RCQTCDKGFTTSGHLARHNRIHTGEKNHRCHFPGCGQR------FSRHDNCLQHYRTHLK 247

>TPHA0C04190 Chr3 (901757..903010) [1254 bp, 417 aa] {ON} Anc_2.533
           YMR070W
          Length = 417

 Score = 34.7 bits (78), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 27/61 (44%), Gaps = 8/61 (13%)

Query: 172 MFQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHASGEFSRKDTYKTHLKSI 231
            ++C  C   FK   +L RH   H   K+F C  W        SG++ RKD    H++  
Sbjct: 323 FYECKVCHKTFKRNSWLKRHFFSHSKLKNFSCN-W-------CSGKYKRKDNLVQHIRKK 374

Query: 232 H 232
           H
Sbjct: 375 H 375

>NDAI0A07470 Chr1 complement(1702035..1702826) [792 bp, 263 aa] {ON}
           
          Length = 263

 Score = 34.3 bits (77), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 28/59 (47%), Gaps = 10/59 (16%)

Query: 175 CAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHASGEFSRKDT----YKTHLK 229
           C  C   F   G+L+RH + H   K+  CP+   +       +FSR D     Y+THLK
Sbjct: 208 CKTCSMGFTTSGHLSRHNRIHTGEKNHSCPYKGCN------QKFSRHDNCLQHYRTHLK 260

>KLTH0C07172g Chr3 complement(620315..621112) [798 bp, 265 aa] {ON}
           some similarities with uniprot|Q03125 Saccharomyces
           cerevisiae YDR043C NRG1 Transcriptional repressor that
           recruits the Cyc8p-Tup1p complex to promoters mediates
           glucose repression and negatively regulates a variety of
           processes including filamentous growth and alkaline pH
           response
          Length = 265

 Score = 34.3 bits (77), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 26/61 (42%), Gaps = 10/61 (16%)

Query: 173 FQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHASGEFSRKDT----YKTHL 228
           + C  C   F   G+L RH + H   K+  CP      R      FSR D     YKTHL
Sbjct: 202 YVCKTCVKGFTTSGHLARHNRIHTGEKNHVCPHPGCGQR------FSRHDNCVQHYKTHL 255

Query: 229 K 229
           +
Sbjct: 256 R 256

>CAGL0K12078g Chr11 complement(1169818..1171209) [1392 bp, 463 aa]
           {ON} weakly similar to uniprot|Q03125 Saccharomyces
           cerevisiae YDR043c NRG1
          Length = 463

 Score = 34.7 bits (78), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 27/63 (42%), Gaps = 10/63 (15%)

Query: 173 FQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHASGEFSRKDT----YKTHL 228
           + C  C   F   G+L RH + H   K   CP+     R      F+R D     YKTHL
Sbjct: 402 YLCKVCGKGFTTSGHLARHNRIHTGEKRHVCPYEGCGQR------FNRHDNCLQHYKTHL 455

Query: 229 KSI 231
           K +
Sbjct: 456 KRL 458

>TBLA0I01970 Chr9 complement(446033..446899) [867 bp, 288 aa] {ON}
           Anc_3.281 YBR066C
          Length = 288

 Score = 34.3 bits (77), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 24/52 (46%), Gaps = 10/52 (19%)

Query: 182 FKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHASGEFSRKDT----YKTHLK 229
               G+L RH + H   K+ RCP    + R      FSR D     YKTHLK
Sbjct: 235 LTTSGHLARHYRIHTGEKNHRCPLEGCNQR------FSRHDNCIQHYKTHLK 280

>Kpol_1018.33 s1018 complement(96025..97794) [1770 bp, 589 aa] {ON}
           complement(96025..97794) [1770 nt, 590 aa]
          Length = 589

 Score = 34.7 bits (78), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 26/58 (44%), Gaps = 8/58 (13%)

Query: 175 CAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHASGEFSRKDTYKTHLKSIH 232
           C  C   FK K +L RH+  H   ++F CP W +        +  RKD    H+K  H
Sbjct: 479 CHICGKQFKRKSWLQRHLLSHSSERNFDCP-WCL-------SKHKRKDNLLQHMKLKH 528

>Kpol_1002.25 s1002 (79397..80281) [885 bp, 294 aa] {ON}
           (79397..80281) [885 nt, 295 aa]
          Length = 294

 Score = 34.3 bits (77), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 26/93 (27%), Positives = 41/93 (44%), Gaps = 13/93 (13%)

Query: 178 CPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHASGEF-SRKDTYKTHLKSIHFVYP 236
           C   F     L RH +KH   K F+C         H   +F SR D  K H++S+H ++P
Sbjct: 33  CSMEFTRSENLVRHRRKHTGEKPFQC---------HVCLKFFSRIDNLKQHIESVHGIHP 83

Query: 237 VGVAKSQRSRSTGRCAACYQEFRNNNEWLTQHV 269
             V   +R++ +   ++  Q   N N  +  H 
Sbjct: 84  AIV---KRTKISAVNSSNAQTMVNPNGTIISHT 113

>KLTH0C04884g Chr3 complement(422344..423372) [1029 bp, 342 aa] {ON}
           conserved hypothetical protein
          Length = 342

 Score = 34.3 bits (77), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 32/78 (41%), Gaps = 2/78 (2%)

Query: 173 FQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHASGEFSRKDTYKTHLKSIH 232
           + CA C   F     L  H   H   K F CPF + D + +A    +R   YK H K+  
Sbjct: 238 YVCASCGKCFNRPSSLATHNNTHTGDKPFTCPFENCDKQFNARSNMTRH--YKLHFKTEG 295

Query: 233 FVYPVGVAKSQRSRSTGR 250
             Y +   +  R+R   R
Sbjct: 296 GTYLLPNGEVTRARPPMR 313

>Kpol_529.13 s529 complement(28325..32557) [4233 bp, 1410 aa] {ON}
           complement(28325..32557) [4233 nt, 1411 aa]
          Length = 1410

 Score = 34.7 bits (78), Expect = 0.30,   Method: Composition-based stats.
 Identities = 19/61 (31%), Positives = 27/61 (44%), Gaps = 8/61 (13%)

Query: 172 MFQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHASGEFSRKDTYKTHLKSI 231
           +F C+ C   F  + +LTRH + H   K + C        C    +FSR+D    H   I
Sbjct: 117 LFVCSICTRAFARQEHLTRHERSHTKEKPYCCGI------CQR--KFSRRDLLLRHAHKI 168

Query: 232 H 232
           H
Sbjct: 169 H 169

>ZYRO0B07568g Chr2 (595114..596964) [1851 bp, 616 aa] {ON} some
           similarities with uniprot|P53243 Saccharomyces
           cerevisiae YGR067C hypothetical ORF
          Length = 616

 Score = 34.3 bits (77), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 29/60 (48%), Gaps = 8/60 (13%)

Query: 173 FQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHASGEFSRKDTYKTHLKSIH 232
           + C+FC   F    +  RH + H   K F C      CR HA   F R+D  + H++++H
Sbjct: 8   YVCSFCSKAFSRSEHRARHERSHTGMKPFECKV----CR-HA---FVRRDLLQRHIRTVH 59

>Kpol_1052.18 s1052 (58087..59160) [1074 bp, 357 aa] {ON}
           (58087..59160) [1074 nt, 358 aa]
          Length = 357

 Score = 34.3 bits (77), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 27/61 (44%), Gaps = 10/61 (16%)

Query: 173 FQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHASGEFSRKDT----YKTHL 228
           + C  C       G+L RH + H   K+  CP+   + R      FSR D     Y+THL
Sbjct: 301 YICRVCSKGLTTSGHLARHYRIHTGEKNHFCPYEGCNQR------FSRHDNCIQHYRTHL 354

Query: 229 K 229
           K
Sbjct: 355 K 355

>SAKL0H04070g Chr8 (379179..381878) [2700 bp, 899 aa] {ON} some
           similarities with uniprot|P53243 Saccharomyces
           cerevisiae YGR067C hypothetical ORF
          Length = 899

 Score = 34.7 bits (78), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 18/71 (25%), Positives = 31/71 (43%), Gaps = 8/71 (11%)

Query: 173 FQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHASGEFSRKDTYKTHLKSIH 232
           + C+FC   F    + TRH + H   K F C           +  F R+D  + H++++H
Sbjct: 8   YICSFCAKAFSRSEHRTRHERSHTGVKPFTCTV--------CAHSFVRRDLLQRHIRTVH 59

Query: 233 FVYPVGVAKSQ 243
             + +   K Q
Sbjct: 60  RTFLLQCTKEQ 70

>NDAI0I00990 Chr9 complement(236716..237945) [1230 bp, 409 aa] {ON}
           Anc_6.256
          Length = 409

 Score = 34.3 bits (77), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 29/106 (27%), Positives = 48/106 (45%), Gaps = 14/106 (13%)

Query: 172 MFQCAF---CPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHASGEFSRKDTYKTHL 228
           +FQC     C   F  + +L RH++KH   K F+C    +  R      FSR D  K H 
Sbjct: 14  LFQCTGYKECSMVFTREEHLARHIRKHTGEKPFQC---DICLRF-----FSRVDNLKQHR 65

Query: 229 KSIHF--VYPVGVAKSQRSRSTGRCAACYQEFRNNNEWLTQHVESR 272
           +++H     P+ + K+  +  T  C       +NN+++ T    +R
Sbjct: 66  ETVHLEGATPLNINKALTTTPT-LCLNGSINQKNNDKYKTIQDNTR 110

>TDEL0D03430 Chr4 (635293..635820) [528 bp, 175 aa] {ON} Anc_3.281
           YBR066C
          Length = 175

 Score = 33.5 bits (75), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 26/59 (44%), Gaps = 10/59 (16%)

Query: 175 CAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHASGEFSRKDT----YKTHLK 229
           C  C   F   G+L RH + H   K+  CP    + R      FSR D     Y+THL+
Sbjct: 121 CKVCSKGFTTSGHLARHNRIHTGEKNHFCPLEGCNQR------FSRHDNCIQHYRTHLR 173

>NCAS0A02310 Chr1 complement(433632..436271) [2640 bp, 879 aa] {ON}
           Anc_4.214
          Length = 879

 Score = 34.3 bits (77), Expect = 0.35,   Method: Composition-based stats.
 Identities = 18/60 (30%), Positives = 26/60 (43%), Gaps = 8/60 (13%)

Query: 173 FQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHASGEFSRKDTYKTHLKSIH 232
           F C+FC   F    +  RH + H   K ++C    V   C     F R D    H+K++H
Sbjct: 15  FICSFCAKGFSRAEHKIRHERSHTGLKPYKC---KVCTHC-----FVRSDLALRHIKTVH 66

>CAGL0M00594g Chr13 (70659..73721) [3063 bp, 1020 aa] {ON} similar
           to uniprot|P46974 Saccharomyces cerevisiae YJR127c ZMS1
           or uniprot|Q04545 Saccharomyces cerevisiae YML081w
          Length = 1020

 Score = 34.3 bits (77), Expect = 0.35,   Method: Composition-based stats.
 Identities = 23/78 (29%), Positives = 31/78 (39%), Gaps = 12/78 (15%)

Query: 173 FQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHASGEFSRKDTYKTHLKSIH 232
           F C  C   F  + +L RH   H   K F C       +C     F+RKD    HL+ +H
Sbjct: 27  FLCPICSRGFVRQEHLKRHQNSHTHEKPFLCLICG---KC-----FARKDLVLRHLQKLH 78

Query: 233 FVYPVGVAKSQRSRSTGR 250
             Y       Q  ++ GR
Sbjct: 79  RDYKT----EQLDKTIGR 92

>NDAI0D04240 Chr4 complement(993054..996563) [3510 bp, 1169 aa] {ON}
           Anc_4.214
          Length = 1169

 Score = 34.3 bits (77), Expect = 0.37,   Method: Composition-based stats.
 Identities = 24/97 (24%), Positives = 35/97 (36%), Gaps = 11/97 (11%)

Query: 136 GNGTRPPACLETQPSSFGDXXXXXXXXXXXXXXXXXMFQCAFCPSNFKVKGYLTRHMKKH 195
           G+   PP  L++ P+                      F C+FC   F    +  RH + H
Sbjct: 53  GSDNHPPQPLDSSPNC---SSSNKNISPPKTGIFSKRFICSFCAKAFSRSEHKIRHERSH 109

Query: 196 LVTKDFRCPFWSVDCRCHASGEFSRKDTYKTHLKSIH 232
              K ++C        C  S  F R D    HLK++H
Sbjct: 110 TGFKPYKCLL------CDHS--FVRSDLTIRHLKTVH 138

>SAKL0D06776g Chr4 (561887..564190) [2304 bp, 767 aa] {ON} weakly
           similar to uniprot|P47043 Saccharomyces cerevisiae
           YJL056C ZAP1 Zinc-regulated transcription factor binds
           to zinc-responsive promoter elements to induce
           transcription of certain genes in the presence of zinc
           regulates its own transcription contains seven zinc-
           finger domains
          Length = 767

 Score = 34.3 bits (77), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 32/60 (53%), Gaps = 10/60 (16%)

Query: 173 FQCAF--CPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHASGEFSRKDTYKTHLKS 230
           +QC++  C  +F  +  L RH+K H   K F+CP        H + +FS +D  + H+++
Sbjct: 628 YQCSWDTCSKSFTQRQKLLRHLKVHSGYKPFKCP--------HCTKKFSTEDILQQHIRT 679

>NDAI0C04860 Chr3 (1123119..1127171) [4053 bp, 1350 aa] {ON}
           Anc_8.425
          Length = 1350

 Score = 34.3 bits (77), Expect = 0.40,   Method: Composition-based stats.
 Identities = 16/61 (26%), Positives = 26/61 (42%), Gaps = 8/61 (13%)

Query: 172 MFQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHASGEFSRKDTYKTHLKSI 231
           +F C  C   F  + +L RH + H   K + C           S +F+R+D    H + +
Sbjct: 115 LFVCEICTRAFARQEHLVRHERSHTKEKPYNCGI--------CSKKFTRRDLLIRHAQKV 166

Query: 232 H 232
           H
Sbjct: 167 H 167

>KNAG0D02220 Chr4 (378969..382589) [3621 bp, 1206 aa] {ON} Anc_8.130
           YPR022C
          Length = 1206

 Score = 34.3 bits (77), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 26/54 (48%), Gaps = 4/54 (7%)

Query: 178 CPSNFKVKGYLTRHMKKHLVTKDFRCP--FWSVDCRCHASGEFSRKDTYKTHLK 229
           C   F  + +L RH   H   + FRCP  F + D RC+ +  F RKD    H K
Sbjct: 77  CNKTFSRQEHLARHKLNHWPKEIFRCPYVFPNTDIRCNKT--FVRKDLLGRHAK 128

>TPHA0B00380 Chr2 (78891..82823) [3933 bp, 1310 aa] {ON} Anc_4.351
           YJR127C
          Length = 1310

 Score = 33.9 bits (76), Expect = 0.46,   Method: Composition-based stats.
 Identities = 18/55 (32%), Positives = 23/55 (41%), Gaps = 3/55 (5%)

Query: 173 FQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHASGEFSRKDTYKTH 227
           F C+ C   F  + +L RH   H   K F C F     RC A  +   +  YK H
Sbjct: 34  FLCSICTRGFVRQEHLKRHKISHTNEKPFLCIFCG---RCFARKDLVLRHQYKLH 85

>TDEL0D05860 Chr4 complement(1064492..1065484) [993 bp, 330 aa] {ON}
           Anc_3.518 YGL209W
          Length = 330

 Score = 33.5 bits (75), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 27/58 (46%), Gaps = 6/58 (10%)

Query: 173 FQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHASGEFSRKDTYKTHLKS 230
           F+C  C   F    +  RH++ H   K  RC F S    C  S  FSR D  K HL++
Sbjct: 17  FKCELCSRGFHRLEHKKRHIRTHTGEKPHRCTFGS----CGKS--FSRSDELKRHLRT 68

>CAGL0M13189g Chr13 complement(1295843..1297468) [1626 bp, 541 aa]
           {ON} weakly similar to uniprot|P33749 Saccharomyces
           cerevisiae YKL062w MSN4 transcriptional activator
          Length = 541

 Score = 33.9 bits (76), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 28/59 (47%), Gaps = 9/59 (15%)

Query: 173 FQCAFCPSNFKVKGYLTRHMKK-HLVTKDFRCPFWSVDCRCHASGEFSRKDTYKTHLKS 230
           FQCA C   F+   +L RH++  H   + F C F      C    +FSR D    HLK+
Sbjct: 484 FQCADCDKAFRRSEHLKRHVRSVHSTERPFPCMF------CE--KKFSRSDNLSQHLKT 534

>KLLA0C16005g Chr3 (1397274..1398269) [996 bp, 331 aa] {ON} some
           similarities with uniprot|Q12132 Saccharomyces
           cerevisiae YPL230W USV1 Up in StarVation
          Length = 331

 Score = 33.5 bits (75), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 37/75 (49%), Gaps = 11/75 (14%)

Query: 178 CPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHASGE-FSRKDTYKTHLKSIHFVYP 236
           C   F  + +L RH++KH   + F         +CH     FSR D  K H++S+H V  
Sbjct: 28  CRMEFTRQEHLARHIRKHTGEQPF---------QCHLCLRFFSRLDNLKQHVESVHSVS- 77

Query: 237 VGVAKSQRSRSTGRC 251
           +  ++ + S+ST  C
Sbjct: 78  MATSQLKNSKSTAPC 92

>AFR580C Chr6 complement(1478501..1481017) [2517 bp, 838 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR067C
          Length = 838

 Score = 33.9 bits (76), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 29/60 (48%), Gaps = 8/60 (13%)

Query: 173 FQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHASGEFSRKDTYKTHLKSIH 232
           + C+FC   F    + TRH + H   K F C        C+ S  F R+D  + H++++H
Sbjct: 8   YICSFCAQAFSRSEHKTRHERSHTGVKPFSCKV------CNHS--FVRRDLLQRHIRTVH 59

>KAFR0E04270 Chr5 complement(859635..863402) [3768 bp, 1255 aa] {ON}
           Anc_4.351 YJR127C
          Length = 1255

 Score = 33.9 bits (76), Expect = 0.49,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 33/77 (42%), Gaps = 10/77 (12%)

Query: 173 FQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDC-RCHASGEFSRKDTYKTHLKSI 231
           F C  C   F  + +L RH + H   + F C    V C RC     F+RKD    H + +
Sbjct: 49  FLCPTCTRGFVRQEHLKRHQRSHTRERPFLC----VLCGRC-----FARKDLVLRHQQKL 99

Query: 232 HFVYPVGVAKSQRSRST 248
           H       A ++  +S+
Sbjct: 100 HATIVSNTASNRSDKSS 116

>NDAI0D03240 Chr4 complement(769306..773394) [4089 bp, 1362 aa] {ON}
           Anc_4.351
          Length = 1362

 Score = 33.9 bits (76), Expect = 0.49,   Method: Composition-based stats.
 Identities = 19/60 (31%), Positives = 26/60 (43%), Gaps = 8/60 (13%)

Query: 173 FQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHASGEFSRKDTYKTHLKSIH 232
           F C+ C   F  + +L RH + H   K F C F     RC     F+R+D    H   +H
Sbjct: 71  FVCSTCTRGFVRQEHLKRHQRSHTNEKPFLCVFCG---RC-----FARRDLVLRHQHKLH 122

>Kwal_26.8011 s26 complement(611115..611687) [573 bp, 190 aa] {ON}
           YPR013C - Hypothetical ORF [contig 55] FULL
          Length = 190

 Score = 33.1 bits (74), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 25/58 (43%), Gaps = 6/58 (10%)

Query: 173 FQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHASGEFSRKDTYKTHLKS 230
           +QC  C   F     L  H+  H  ++ FRCPF S       S  F+ K     HLK+
Sbjct: 128 YQCQLCLKIFSRSSALQAHLLTHTGSRPFRCPFASC------SKTFNVKSNMVRHLKT 179

>Kwal_47.17241 s47 (312857..314068) [1212 bp, 403 aa] {ON} YER130C -
           Hypothetical ORF [contig 211] FULL
          Length = 403

 Score = 33.5 bits (75), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 29/60 (48%), Gaps = 11/60 (18%)

Query: 173 FQCAFCPSNFKVKGYLTRHMKK-HLVTKDFRCPFWSVDCRCHASG-EFSRKDTYKTHLKS 230
           F C FC   FK + +L RH++  H+  K F          CH  G +FSR D    H+K+
Sbjct: 346 FACDFCDRRFKRQEHLKRHVRSLHMGEKPF---------DCHICGKKFSRSDNLNQHIKT 396

>Ecym_2760 Chr2 complement(1473533..1476349) [2817 bp, 938 aa] {ON}
           similar to Ashbya gossypii AFR580C
          Length = 938

 Score = 33.5 bits (75), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 20/78 (25%), Positives = 31/78 (39%), Gaps = 8/78 (10%)

Query: 173 FQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHASGEFSRKDTYKTHLKSIH 232
           + C FC   F    + TRH + H   K F C           S  F R+D  + H++++H
Sbjct: 8   YICCFCARAFSRSEHRTRHERSHTGVKPFSCKV--------CSHSFVRRDLLQRHIRTVH 59

Query: 233 FVYPVGVAKSQRSRSTGR 250
               + +   Q     GR
Sbjct: 60  RSMLLELQLKQVKLGEGR 77

>NCAS0A04800 Chr1 complement(959067..960602) [1536 bp, 511 aa] {ON}
           Anc_2.533
          Length = 511

 Score = 33.5 bits (75), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 18/64 (28%), Positives = 29/64 (45%), Gaps = 8/64 (12%)

Query: 172 MFQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHASGEFSRKDTYKTHLKSI 231
           ++QC  C  +F+   +L RH+  H   + + CP      +C    +  RKD    HLK  
Sbjct: 386 VYQCHMCVKSFRRHSWLKRHLLAHSSQRHYSCP------KC--VSKHKRKDNLLQHLKLK 437

Query: 232 HFVY 235
           H  +
Sbjct: 438 HTAF 441

>TPHA0A03910 Chr1 complement(862763..863818) [1056 bp, 351 aa] {ON} 
          Length = 351

 Score = 33.1 bits (74), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 27/68 (39%), Gaps = 4/68 (5%)

Query: 173 FQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHASGEFSRKDTYKTHLK--S 230
           + C  C   FK    L  HM  H   K +RCP  S     +A     R   YK H K  +
Sbjct: 270 YDCNICGKKFKRPSSLNTHMNIHTGQKPYRCPHISCSKAFNAKSNMLRH--YKLHFKLNT 327

Query: 231 IHFVYPVG 238
             ++ P G
Sbjct: 328 GQYILPNG 335

>KNAG0C05810 Chr3 complement(1127391..1129055) [1665 bp, 554 aa]
           {ON} Anc_2.533 YMR070W
          Length = 554

 Score = 33.5 bits (75), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 18/64 (28%), Positives = 28/64 (43%), Gaps = 8/64 (12%)

Query: 172 MFQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHASGEFSRKDTYKTHLKSI 231
           + +C  C  +FK + +L RH+  H   + + CP W +           RKD    H+K  
Sbjct: 435 IHKCHLCEKSFKRRSWLKRHLLSHSAERHYLCP-WCLS-------RHKRKDNLLQHMKLK 486

Query: 232 HFVY 235
           H  Y
Sbjct: 487 HSNY 490

>KAFR0B02160 Chr2 complement(422203..423564) [1362 bp, 453 aa] {ON}
           Anc_8.144 YER130C
          Length = 453

 Score = 33.1 bits (74), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 28/59 (47%), Gaps = 9/59 (15%)

Query: 173 FQCAFCPSNFKVKGYLTRHMKK-HLVTKDFRCPFWSVDCRCHASGEFSRKDTYKTHLKS 230
           F C +C   FK + +L RH++  H+  K F C      C  H    FSR D    H+K+
Sbjct: 398 FSCEYCDRRFKRQEHLKRHIRSLHICEKPFHCHI----CDKH----FSRSDNLNQHIKT 448

>Kwal_23.5400 s23 complement(1143487..1144776) [1290 bp, 429 aa]
           {ON} YPR186C (PZF1) - Transcription factor IIIA (TFIIIA)
           with putative Zn-fingers [contig 8] FULL
          Length = 429

 Score = 33.1 bits (74), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 17/33 (51%)

Query: 173 FQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPF 205
           FQC  C   F  K +L RHM  H   K F+C +
Sbjct: 81  FQCTVCARQFSRKTHLERHMFSHSEDKPFKCSY 113

>TBLA0I03280 Chr9 complement(796048..797040) [993 bp, 330 aa] {ON}
           Anc_3.518 YGL209W
          Length = 330

 Score = 33.1 bits (74), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 34/88 (38%), Gaps = 10/88 (11%)

Query: 173 FQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHASGEFSRKDTYKTHLK--- 229
           F+C  C   F    +  RH++ H   K   CP       C+ S  FSR D  K H+K   
Sbjct: 16  FKCPMCHRGFYRAEHKKRHIRTHTGEKPHLCPILG----CNKS--FSRTDELKRHMKVHP 69

Query: 230 -SIHFVYPVGVAKSQRSRSTGRCAACYQ 256
            S H ++         S ST    +  Q
Sbjct: 70  ASTHNLHSTSTTSLNISNSTMSMTSLLQ 97

>NDAI0C00560 Chr3 (104390..107308) [2919 bp, 972 aa] {ON} Anc_2.598
          Length = 972

 Score = 33.5 bits (75), Expect = 0.71,   Method: Composition-based stats.
 Identities = 18/59 (30%), Positives = 26/59 (44%), Gaps = 9/59 (15%)

Query: 173 FQCAFCPSNFKVKGYLTRHMKK-HLVTKDFRCPFWSVDCRCHASGEFSRKDTYKTHLKS 230
           F+C+ C   F+   +L RH +  H   + F C F         +  FSR D    HLK+
Sbjct: 915 FKCSDCEKAFRRSEHLKRHFRSVHSAERPFGCMF--------CTKRFSRSDNLSQHLKT 965

>Ecym_6295 Chr6 complement(553427..555418) [1992 bp, 663 aa] {ON}
           similar to Ashbya gossypii AEL174W
          Length = 663

 Score = 33.1 bits (74), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 29/60 (48%), Gaps = 10/60 (16%)

Query: 173 FQCAF--CPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHASGEFSRKDTYKTHLKS 230
           +QC +  C  +F  +  L RH+K H   K F+CP        H S  FS +D    H+++
Sbjct: 516 YQCRWDGCTKHFAQRQKLLRHIKVHTGYKPFKCP--------HCSKTFSTEDILSQHIRT 567

>Smik_13.58 Chr13 (102509..106270) [3762 bp, 1253 aa] {ON} YML081W
           (REAL)
          Length = 1253

 Score = 33.5 bits (75), Expect = 0.72,   Method: Composition-based stats.
 Identities = 19/60 (31%), Positives = 25/60 (41%), Gaps = 8/60 (13%)

Query: 173 FQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHASGEFSRKDTYKTHLKSIH 232
           F C  C   F  + +L RH + H   K F C F     RC     F+R+D    H   +H
Sbjct: 61  FLCHICTRGFVRQEHLKRHQRAHTNEKPFLCVFCG---RC-----FARRDLVLRHQHKLH 112

>YML081W Chr13 (104777..108532) [3756 bp, 1251 aa] {ON}
           TDA9DNA-binding protein, putative transcription factor;
           green fluorescent protein (GFP)-fusion protein localizes
           to the nucleus; null mutant is sensitive to expression
           of the top1-T722A allele; not an essential gene
          Length = 1251

 Score = 33.1 bits (74), Expect = 0.79,   Method: Composition-based stats.
 Identities = 19/60 (31%), Positives = 25/60 (41%), Gaps = 8/60 (13%)

Query: 173 FQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHASGEFSRKDTYKTHLKSIH 232
           F C  C   F  + +L RH + H   K F C F     RC     F+R+D    H   +H
Sbjct: 61  FLCHICTRGFVRQEHLKRHQRAHTNEKPFLCVFCG---RC-----FARRDLVLRHQHKLH 112

>Kwal_26.8021 s26 (613992..615515) [1524 bp, 507 aa] {ON} YMR070W
           (MOT3) - 2 Cys2-His2 zinc fingers at c-terminus,
           glutamine and asparagine rich [contig 55] FULL
          Length = 507

 Score = 33.1 bits (74), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 16/60 (26%), Positives = 29/60 (48%), Gaps = 8/60 (13%)

Query: 173 FQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHASGEFSRKDTYKTHLKSIH 232
           ++C+ C  +FK + +  RH+  H   K + CP+    C+        R+D    H+K+ H
Sbjct: 389 YRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPW----CQS----RHKRRDNLFQHMKTKH 440

>KLTH0D18062g Chr4 (1493355..1496741) [3387 bp, 1128 aa] {ON}
           similar to uniprot|Q04545 Saccharomyces cerevisiae
           YML081W Hypothetical ORF
          Length = 1128

 Score = 33.1 bits (74), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 28/61 (45%), Gaps = 10/61 (16%)

Query: 173 FQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDC-RCHASGEFSRKDTYKTHLKSI 231
           F C+ C   F  + +L RH + H   K F C F    C RC     F+R+D    H + +
Sbjct: 32  FLCSICTRGFARQEHLKRHQRAHTNEKPFLCAF----CGRC-----FARRDLVLRHQQKL 82

Query: 232 H 232
           H
Sbjct: 83  H 83

>Skud_13.61 Chr13 (104114..107875) [3762 bp, 1253 aa] {ON} YML081W
           (REAL)
          Length = 1253

 Score = 33.1 bits (74), Expect = 0.82,   Method: Composition-based stats.
 Identities = 19/60 (31%), Positives = 25/60 (41%), Gaps = 8/60 (13%)

Query: 173 FQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHASGEFSRKDTYKTHLKSIH 232
           F C  C   F  + +L RH + H   K F C F     RC     F+R+D    H   +H
Sbjct: 61  FLCHICTRGFVRQEHLKRHQRAHTNEKPFLCVFCG---RC-----FARRDLVLRHQHKLH 112

>ZYRO0A09416g Chr1 (756859..760899) [4041 bp, 1346 aa] {ON} similar
           to uniprot|P07248 Saccharomyces cerevisiae YDR216W ADR1
           Positive transcriptional regulator controls the
           expression of ADH2 peroxisomal protein genes and genes
           required for ethanol glycerol and fatty acid utilization
          Length = 1346

 Score = 33.1 bits (74), Expect = 0.83,   Method: Composition-based stats.
 Identities = 18/61 (29%), Positives = 26/61 (42%), Gaps = 8/61 (13%)

Query: 172 MFQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHASGEFSRKDTYKTHLKSI 231
           +F C  C   F  + +LTRH + H   K + C           + +FSR+D    H   I
Sbjct: 85  LFVCQVCTRAFARQEHLTRHERSHTKEKPYCCGI--------CNRKFSRRDLLLRHAHKI 136

Query: 232 H 232
           H
Sbjct: 137 H 137

>KNAG0F01710 Chr6 (320407..321648) [1242 bp, 413 aa] {ON} Anc_6.256
           YPL230W
          Length = 413

 Score = 33.1 bits (74), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 30/64 (46%), Gaps = 11/64 (17%)

Query: 172 MFQCAF---CPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHASGEFSRKDTYKTHL 228
           MF+C     C   F    +L RH++KH   K F+C      C  H    FSR D  K H 
Sbjct: 42  MFKCQGFEDCHMAFTRAEHLARHIRKHTGEKPFQC----YICLKH----FSRVDNLKQHR 93

Query: 229 KSIH 232
           +S+H
Sbjct: 94  ESVH 97

>AGR031W Chr7 (769920..770342) [423 bp, 140 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR043C (NRG1) and
           YBR066C (NRG2)
          Length = 140

 Score = 32.0 bits (71), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 25/59 (42%), Gaps = 10/59 (16%)

Query: 175 CAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHASGEFSRKDT----YKTHLK 229
           C  C   F   G+L RH + H   K+  C F     R      FSR D     Y+THLK
Sbjct: 82  CQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQR------FSRHDNCLQHYRTHLK 134

>Kwal_47.16621 s47 complement(32712..36248) [3537 bp, 1178 aa] {ON}
           YML081W - Hypothetical ORF [contig 376] FULL
          Length = 1178

 Score = 33.1 bits (74), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 36/80 (45%), Gaps = 14/80 (17%)

Query: 173 FQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDC-RCHASGEFSRKDTYKTHLKSI 231
           F C+ C   F  + +L RH + H   K F C F    C RC     F+R+D    H + +
Sbjct: 78  FLCSICTRGFARQEHLKRHQRAHTNEKPFLCAF----CGRC-----FARRDLVLRHQQKL 128

Query: 232 HFVY----PVGVAKSQRSRS 247
           H       P  VA ++ S+S
Sbjct: 129 HSTLADSGPEEVAVNRDSKS 148

>KAFR0C00340 Chr3 complement(65838..67022) [1185 bp, 394 aa] {ON}
           Anc_3.298
          Length = 394

 Score = 32.7 bits (73), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 31/75 (41%), Gaps = 4/75 (5%)

Query: 175 CAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHASGEFSRKDTYKTHLK--SIH 232
           C  C   FK    L+ HM  H   K ++CPF +     +A     R   YK H K  S  
Sbjct: 280 CKVCSKRFKRPSSLSTHMNIHTGYKPYQCPFSNCQKSFNAKSNMLRH--YKLHFKLSSGV 337

Query: 233 FVYPVGVAKSQRSRS 247
           +V P G    Q+  S
Sbjct: 338 YVLPSGEITLQKPTS 352

>TPHA0A03980 Chr1 (885841..886785) [945 bp, 314 aa] {ON} Anc_3.281
           YBR066C
          Length = 314

 Score = 32.7 bits (73), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 27/62 (43%), Gaps = 10/62 (16%)

Query: 173 FQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHASGEFSRKDT----YKTHL 228
           + C  C       G+L RH + H   K++ C     D +      FSR D     YKTHL
Sbjct: 256 YICKVCSKGLTTSGHLARHYRIHTGEKNYSCLHEGCDQK------FSRHDNCKQHYKTHL 309

Query: 229 KS 230
           K+
Sbjct: 310 KN 311

>Kpol_1001.1 s1001 (3077..7102) [4026 bp, 1341 aa] {ON} (3077..7102)
           [4026 nt, 1342 aa]
          Length = 1341

 Score = 33.1 bits (74), Expect = 0.95,   Method: Composition-based stats.
 Identities = 18/55 (32%), Positives = 22/55 (40%), Gaps = 3/55 (5%)

Query: 173 FQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHASGEFSRKDTYKTH 227
           F C+ C   F    +L RH   H   K F C F     RC A  +   +  YK H
Sbjct: 36  FLCSICTRGFVRHEHLKRHKISHTNEKPFLCIFCG---RCFARKDLVLRHQYKLH 87

>NCAS0A06250 Chr1 complement(1234566..1238591) [4026 bp, 1341 aa]
           {ON} Anc_4.351
          Length = 1341

 Score = 33.1 bits (74), Expect = 0.95,   Method: Composition-based stats.
 Identities = 19/60 (31%), Positives = 25/60 (41%), Gaps = 8/60 (13%)

Query: 173 FQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHASGEFSRKDTYKTHLKSIH 232
           F C  C   F  + +L RH + H   K F C F     RC     F+R+D    H   +H
Sbjct: 72  FLCPTCTRGFVRQEHLKRHQRSHTNEKPFLCVFCG---RC-----FARRDLVLRHQHKLH 123

>TDEL0B04670 Chr2 (830511..831449) [939 bp, 312 aa] {ON} Anc_8.144
           YER130C
          Length = 312

 Score = 32.7 bits (73), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 27/59 (45%), Gaps = 9/59 (15%)

Query: 173 FQCAFCPSNFKVKGYLTRHMKK-HLVTKDFRCPFWSVDCRCHASGEFSRKDTYKTHLKS 230
           F C FC   FK + +L RH++  H+  K F C             +FSR D    H+K+
Sbjct: 258 FGCEFCDRRFKRQEHLKRHVRSLHMCEKPFNCHI--------CDKKFSRSDNLNQHIKT 308

>TPHA0C01760 Chr3 (402424..402939) [516 bp, 171 aa] {ON} Anc_8.486
           YDR253C
          Length = 171

 Score = 32.0 bits (71), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 25/60 (41%), Gaps = 8/60 (13%)

Query: 172 MFQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHASGEFSRKDTYKTHLKSI 231
           M  CA C   FK    L RH K HL       P  S  C     G F+RKD  K H  ++
Sbjct: 93  MVICAKCGITFKRVSELKRHEKSHL-------PILSNICSQCGKG-FARKDALKRHYNTL 144

>YER130C Chr5 complement(421115..422446) [1332 bp, 443 aa] {ON}
           Protein of unknown function; transcription is regulated
           by Haa1p, Sok2p and Zap1p transcriptional activators;
           computational analysis suggests a role as a
           transcription factor; C. albicans homolog (MNL1) plays a
           role in adaptation to stress
          Length = 443

 Score = 32.7 bits (73), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 29/59 (49%), Gaps = 9/59 (15%)

Query: 173 FQCAFCPSNFKVKGYLTRHMKK-HLVTKDFRCPFWSVDCRCHASGEFSRKDTYKTHLKS 230
           F C FC   FK + +L RH++  H+  K F C        C+ +  FSR D    H+K+
Sbjct: 389 FGCEFCDRRFKRQEHLKRHVRSLHMCEKPFTCHI------CNKN--FSRSDNLNQHVKT 439

>CAGL0M01870g Chr13 complement(219813..220760) [948 bp, 315 aa] {ON}
           some similarities with uniprot|Q12145 Saccharomyces
           cerevisiae YPR013c or uniprot|Q12531 Saccharomyces
           cerevisiae YPR015c
          Length = 315

 Score = 32.3 bits (72), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 28/68 (41%), Gaps = 4/68 (5%)

Query: 173 FQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHASGEFSRKDTYKTHLKSIH 232
           F C  C   FK    L+ HM  H   K + CPF +     +A     R   YK H K  +
Sbjct: 173 FICKVCLKKFKRPSSLSTHMNIHTGEKPYPCPFDNCTKSFNAKSNMLRH--YKLHFKLSN 230

Query: 233 --FVYPVG 238
             ++ P G
Sbjct: 231 GAYILPTG 238

>NCAS0B02840 Chr2 complement(483481..486939) [3459 bp, 1152 aa] {ON}
           Anc_8.425
          Length = 1152

 Score = 32.7 bits (73), Expect = 1.1,   Method: Composition-based stats.
 Identities = 15/61 (24%), Positives = 27/61 (44%), Gaps = 8/61 (13%)

Query: 172 MFQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHASGEFSRKDTYKTHLKSI 231
           +F C  C   F  + +L RH + H   K ++C           + +F+R+D    H + +
Sbjct: 77  LFVCDVCSRAFARQEHLDRHARSHTNEKPYQCGI--------CTKKFTRRDLLLRHAQKV 128

Query: 232 H 232
           H
Sbjct: 129 H 129

>KNAG0I02070 Chr9 (402292..404010) [1719 bp, 572 aa] {ON} Anc_2.162
           YOR113W
          Length = 572

 Score = 32.7 bits (73), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 26/64 (40%), Gaps = 8/64 (12%)

Query: 173 FQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHASGEFSRKDTYKTHLKSIH 232
           ++C +C   F   G L  H++ H   K F C F S          FSRK     HL +  
Sbjct: 416 YKCTWCGKGFTQGGNLKTHVRLHTGEKPFSCEFCSK--------RFSRKGNLTAHLVTHE 467

Query: 233 FVYP 236
            V P
Sbjct: 468 KVRP 471

 Score = 30.8 bits (68), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 15/31 (48%)

Query: 173 FQCAFCPSNFKVKGYLTRHMKKHLVTKDFRC 203
           F C FC   F  KG LT H+  H   + F C
Sbjct: 444 FSCEFCSKRFSRKGNLTAHLVTHEKVRPFVC 474

>TBLA0B06160 Chr2 (1454045..1458199) [4155 bp, 1384 aa] {ON}
           Anc_4.351 YJR127C
          Length = 1384

 Score = 32.7 bits (73), Expect = 1.1,   Method: Composition-based stats.
 Identities = 18/60 (30%), Positives = 26/60 (43%), Gaps = 8/60 (13%)

Query: 173 FQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHASGEFSRKDTYKTHLKSIH 232
           + C  C   F  + +L RH + H   K F C F     RC     F+R+D    H + +H
Sbjct: 105 YICQTCTRGFVRQEHLKRHQRSHTNEKPFLCVFCG---RC-----FARRDLILRHQRRLH 156

>Suva_5.251 Chr5 complement(396841..398190) [1350 bp, 449 aa] {ON}
           YER130C (REAL)
          Length = 449

 Score = 32.3 bits (72), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 29/59 (49%), Gaps = 9/59 (15%)

Query: 173 FQCAFCPSNFKVKGYLTRHMKK-HLVTKDFRCPFWSVDCRCHASGEFSRKDTYKTHLKS 230
           F C FC   FK + +L RH++  H+  K F C        C+ +  FSR D    H+K+
Sbjct: 395 FGCEFCDRRFKRQEHLKRHVRSLHMCEKPFTCHI------CNKN--FSRSDNLNQHVKT 445

>Skud_5.248 Chr5 (399138..400466) [1329 bp, 442 aa] {ON} YER130C
           (REAL)
          Length = 442

 Score = 32.3 bits (72), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 29/59 (49%), Gaps = 9/59 (15%)

Query: 173 FQCAFCPSNFKVKGYLTRHMKK-HLVTKDFRCPFWSVDCRCHASGEFSRKDTYKTHLKS 230
           F C FC   FK + +L RH++  H+  K F C        C+ +  FSR D    H+K+
Sbjct: 388 FGCEFCDRRFKRQEHLKRHVRSLHMCEKPFTCHI------CNKN--FSRSDNLNQHVKT 438

>Smik_6.435 Chr6 complement(707873..709033) [1161 bp, 386 aa] {ON}
           YPL230W (REAL)
          Length = 386

 Score = 32.3 bits (72), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 27/55 (49%), Gaps = 8/55 (14%)

Query: 178 CPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHASGEFSRKDTYKTHLKSIH 232
           C  +F    +L RH++KH   K F+CP     C       FSR D  K H +S+H
Sbjct: 49  CAMSFTRAEHLARHIRKHTGEKPFQCPA----CLKF----FSRVDNLKQHRESVH 95

>Skud_16.48 Chr16 (88821..90017) [1197 bp, 398 aa] {ON} YPL230W
           (REAL)
          Length = 398

 Score = 32.3 bits (72), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 27/55 (49%), Gaps = 8/55 (14%)

Query: 178 CPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHASGEFSRKDTYKTHLKSIH 232
           C  +F    +L RH++KH   K F+CP     C       FSR D  K H +S+H
Sbjct: 49  CAMSFTRAEHLARHIRKHTGEKPFQCP----ACLKF----FSRVDNLKQHRESVH 95

>CAGL0L07480g Chr12 complement(824237..825181) [945 bp, 314 aa] {ON}
           some similarities with uniprot|P38082 Saccharomyces
           cerevisiae YBR066c NRG2 or uniprot|Q03125 Saccharomyces
           cerevisiae YDR043c NRG1
          Length = 314

 Score = 32.0 bits (71), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 27/59 (45%), Gaps = 10/59 (16%)

Query: 175 CAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHASGEFSRKDT----YKTHLK 229
           C  C + F   G+L+RH K H   K   CP       C+ S  FSR D     Y+TH K
Sbjct: 254 CQICLTGFTTSGHLSRHAKIHTGEKSHVCPHEG----CNQS--FSRHDNCLQHYRTHSK 306

>YMR037C Chr13 complement(344403..346517) [2115 bp, 704 aa] {ON}
           MSN2Transcriptional activator related to Msn4p;
           activated in stress conditions, which results in
           translocation from the cytoplasm to the nucleus; binds
           DNA at stress response elements of responsive genes,
           inducing gene expression
          Length = 704

 Score = 32.3 bits (72), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 29/59 (49%), Gaps = 9/59 (15%)

Query: 173 FQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHA-SGEFSRKDTYKTHLKS 230
           F C  CP +FK   +L RH++   V  + R PF      CH    +FSR D    H+K+
Sbjct: 647 FHCHICPKSFKRSEHLKRHVRS--VHSNER-PFA-----CHICDKKFSRSDNLSQHIKT 697

>Skud_13.193 Chr13 complement(330998..333112) [2115 bp, 704 aa] {ON}
           YMR037C (REAL)
          Length = 704

 Score = 32.3 bits (72), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 29/59 (49%), Gaps = 9/59 (15%)

Query: 173 FQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHA-SGEFSRKDTYKTHLKS 230
           F C  CP +FK   +L RH++   V  + R PF      CH    +FSR D    H+K+
Sbjct: 647 FHCHICPKSFKRSEHLKRHVRS--VHSNER-PFA-----CHICDKKFSRSDNLSQHIKT 697

>CAGL0K02145g Chr11 (190884..191837) [954 bp, 317 aa] {ON} some
           similarities with uniprot|P39959 Saccharomyces
           cerevisiae YER130c
          Length = 317

 Score = 32.0 bits (71), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 28/59 (47%), Gaps = 9/59 (15%)

Query: 173 FQCAFCPSNFKVKGYLTRHMKK-HLVTKDFRCPFWSVDCRCHASGEFSRKDTYKTHLKS 230
           F C FC   FK + +L RH++  H+  K + C           + +FSR D    H+K+
Sbjct: 264 FGCEFCDRRFKRQEHLKRHIRSLHMGEKPYECHI--------CNKKFSRSDNLNQHIKT 314

>AER159C Chr5 complement(935544..939119) [3576 bp, 1191 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YML081W and
           YJR127C (ZMS1)
          Length = 1191

 Score = 32.3 bits (72), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 26/60 (43%), Gaps = 8/60 (13%)

Query: 173 FQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHASGEFSRKDTYKTHLKSIH 232
           F C  C   F  + +L RH + H   K F C F     RC     F+R+D    H + +H
Sbjct: 80  FLCPVCTRGFARQEHLKRHQRSHTNEKPFLCAFCG---RC-----FARRDLVLRHQQKLH 131

>KNAG0A07040 Chr1 (1102385..1103443) [1059 bp, 352 aa] {ON}
           Anc_2.533 YMR070W
          Length = 352

 Score = 32.0 bits (71), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 27/61 (44%), Gaps = 8/61 (13%)

Query: 173 FQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHASGEFSRKDTYKTHLKSIH 232
           + C  CP +F+   +L RH   H  +  F+C  W   C+     E  R+D    H+K  H
Sbjct: 250 YPCPQCPKSFQRSAWLKRHSITHTNSHPFKC-VW---CK----SEHKRRDNMFKHMKLKH 301

Query: 233 F 233
            
Sbjct: 302 M 302

>NCAS0F00900 Chr6 complement(179873..181450) [1578 bp, 525 aa] {ON}
           Anc_2.533
          Length = 525

 Score = 32.3 bits (72), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 17/61 (27%), Positives = 27/61 (44%), Gaps = 8/61 (13%)

Query: 172 MFQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHASGEFSRKDTYKTHLKSI 231
           ++ C  C  NFK + +L RH+  H   + + CP W +           R+D    H+K  
Sbjct: 387 VYICHICSKNFKRRSWLKRHLLSHSSERHYFCP-WCL-------SRHKRRDNLLQHMKLK 438

Query: 232 H 232
           H
Sbjct: 439 H 439

>TBLA0E04770 Chr5 complement(1228439..1233406) [4968 bp, 1655 aa]
           {ON} Anc_4.351 YJR127C
          Length = 1655

 Score = 32.3 bits (72), Expect = 1.5,   Method: Composition-based stats.
 Identities = 18/60 (30%), Positives = 25/60 (41%), Gaps = 8/60 (13%)

Query: 173 FQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHASGEFSRKDTYKTHLKSIH 232
           + C  C   F  + +L RH + H   K F C F     RC     F+R+D    H   +H
Sbjct: 87  YLCQICTRGFVRQEHLRRHQRAHTNEKPFLCVFCG---RC-----FARRDLVLRHQHKLH 138

>KLTH0E06688g Chr5 (614548..615741) [1194 bp, 397 aa] {ON} weakly
           similar to uniprot|P39959 Saccharomyces cerevisiae
           YER130C Hypothetical ORF
          Length = 397

 Score = 32.0 bits (71), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 29/59 (49%), Gaps = 9/59 (15%)

Query: 173 FQCAFCPSNFKVKGYLTRHMKK-HLVTKDFRCPFWSVDCRCHASGEFSRKDTYKTHLKS 230
           F C FC   FK + +L RH++  H+  K F       DC+     +FSR D    H+K+
Sbjct: 340 FACDFCDRRFKRQEHLKRHVRSLHMGEKPF-------DCQI-CGKKFSRSDNLNQHVKT 390

>Suva_2.383 Chr2 (674568..678527) [3960 bp, 1319 aa] {ON} YDR216W
           (REAL)
          Length = 1319

 Score = 32.3 bits (72), Expect = 1.5,   Method: Composition-based stats.
 Identities = 18/60 (30%), Positives = 26/60 (43%), Gaps = 8/60 (13%)

Query: 173 FQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHASGEFSRKDTYKTHLKSIH 232
           F C  C   F  + +L RH + H   K + C   +   RC     F+R+D    H + IH
Sbjct: 104 FVCEVCTRAFARQEHLKRHYRSHTNEKPYPCGLCN---RC-----FTRRDLLIRHAQKIH 155

>YDR216W Chr4 (895035..899006) [3972 bp, 1323 aa] {ON}  ADR1Carbon
           source-responsive zinc-finger transcription factor,
           required for transcription of the glucose-repressed gene
           ADH2, of peroxisomal protein genes, and of genes
           required for ethanol, glycerol, and fatty acid
           utilization
          Length = 1323

 Score = 32.3 bits (72), Expect = 1.5,   Method: Composition-based stats.
 Identities = 18/60 (30%), Positives = 26/60 (43%), Gaps = 8/60 (13%)

Query: 173 FQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHASGEFSRKDTYKTHLKSIH 232
           F C  C   F  + +L RH + H   K + C   +   RC     F+R+D    H + IH
Sbjct: 104 FVCEVCTRAFARQEHLKRHYRSHTNEKPYPCGLCN---RC-----FTRRDLLIRHAQKIH 155

>Smik_4.463 Chr4 (838900..842874) [3975 bp, 1324 aa] {ON} YDR216W
           (REAL)
          Length = 1324

 Score = 32.3 bits (72), Expect = 1.5,   Method: Composition-based stats.
 Identities = 18/60 (30%), Positives = 26/60 (43%), Gaps = 8/60 (13%)

Query: 173 FQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHASGEFSRKDTYKTHLKSIH 232
           F C  C   F  + +L RH + H   K + C   +   RC     F+R+D    H + IH
Sbjct: 110 FVCEVCTRAFARQEHLKRHYRSHTNEKPYPCGLCN---RC-----FTRRDLLIRHAQKIH 161

>Skud_4.478 Chr4 (849367..853338) [3972 bp, 1323 aa] {ON} YDR216W
           (REAL)
          Length = 1323

 Score = 32.3 bits (72), Expect = 1.6,   Method: Composition-based stats.
 Identities = 23/76 (30%), Positives = 33/76 (43%), Gaps = 9/76 (11%)

Query: 173 FQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHASGEFSRKDTYKTHLKSIH 232
           F C  C   F  + +L RH + H   K + C   +   RC     F+R+D    H + IH
Sbjct: 104 FVCEVCTRAFARQEHLKRHHRSHTNEKPYPCGLCN---RC-----FTRRDLLIRHAQKIH 155

Query: 233 FVYPVGVAKSQRSRST 248
               +G   SQ  RS+
Sbjct: 156 -SGNLGETISQGRRSS 170

>YPL230W Chr16 (115312..116487) [1176 bp, 391 aa] {ON}  USV1Putative
           transcription factor containing a C2H2 zinc finger;
           mutation affects transcriptional regulation of genes
           involved in growth on non-fermentable carbon sources,
           response to salt stress and cell wall biosynthesis
          Length = 391

 Score = 32.0 bits (71), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 27/55 (49%), Gaps = 8/55 (14%)

Query: 178 CPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHASGEFSRKDTYKTHLKSIH 232
           C  +F    +L RH++KH   K F+CP     C       FSR D  K H +S+H
Sbjct: 49  CTMSFTRAEHLARHIRKHTGEKPFQCP----ACLKF----FSRVDNLKQHRESVH 95

>Suva_16.76 Chr16 (124796..125974) [1179 bp, 392 aa] {ON} YPL230W
           (REAL)
          Length = 392

 Score = 32.0 bits (71), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 27/55 (49%), Gaps = 8/55 (14%)

Query: 178 CPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHASGEFSRKDTYKTHLKSIH 232
           C  +F    +L RH++KH   K F+CP     C       FSR D  K H +S+H
Sbjct: 52  CAMSFTRAEHLARHIRKHTGEKPFQCPA----CLKF----FSRVDNLKQHRESVH 98

>Smik_5.276 Chr5 complement(429983..431311) [1329 bp, 442 aa] {ON}
           YER130C (REAL)
          Length = 442

 Score = 32.0 bits (71), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 29/59 (49%), Gaps = 9/59 (15%)

Query: 173 FQCAFCPSNFKVKGYLTRHMKK-HLVTKDFRCPFWSVDCRCHASGEFSRKDTYKTHLKS 230
           F C FC   FK + +L RH++  H+  K F C        C+ +  FSR D    H+K+
Sbjct: 388 FGCEFCDRRFKRQEHLKRHVRSLHMCEKPFTCHI------CNKN--FSRSDNLNQHVKT 438

>CAGL0L03916g Chr12 complement(450952..452880) [1929 bp, 642 aa]
           {ON} weakly similar to uniprot|P41696 Saccharomyces
           cerevisiae YOR113w AZF1 asparagine-rich zinc finger
           protein
          Length = 642

 Score = 32.3 bits (72), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 18/33 (54%)

Query: 173 FQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPF 205
           +QCA+C   F    +L  H+K H+  K F C F
Sbjct: 480 YQCAYCSKMFSQSTHLDVHIKAHMGYKPFECEF 512

>Smik_5.151 Chr5 complement(215590..216756) [1167 bp, 388 aa] {ON}
           YER028C (REAL)
          Length = 388

 Score = 32.0 bits (71), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 27/58 (46%), Gaps = 6/58 (10%)

Query: 173 FQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHASGEFSRKDTYKTHLKS 230
           F+C  C   F    +  RH++ H   K  +C F S    C  S  FSR D  K HL++
Sbjct: 17  FRCEICSRGFHRLEHKKRHVRTHTGEKPHKCSFQS----CPKS--FSRGDELKRHLRT 68

>YPR186C Chr16 complement(909733..911022) [1290 bp, 429 aa] {ON}
           PZF1Transcription factor IIIA (TFIIIA); essential DNA
           binding protein required for transcription of 5S rRNA by
           RNA polymerase III; not involved in transcription of
           other RNAP III genes; nine conserved zinc fingers; may
           also bind 5S rRNA
          Length = 429

 Score = 32.0 bits (71), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 19/33 (57%)

Query: 173 FQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPF 205
           FQC  C  +F  K +L RH+  H  TK F+C +
Sbjct: 80  FQCDKCAKSFVKKSHLERHLYTHSDTKPFQCSY 112

>Smik_13.207 Chr13 complement(338510..340621) [2112 bp, 703 aa] {ON}
           YMR037C (REAL)
          Length = 703

 Score = 32.3 bits (72), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 29/59 (49%), Gaps = 9/59 (15%)

Query: 173 FQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHA-SGEFSRKDTYKTHLKS 230
           F C  CP +FK   +L RH++   V  + R PF      CH    +FSR D    H+K+
Sbjct: 646 FHCHICPKSFKRSEHLKRHVRS--VHSNER-PFA-----CHICEKKFSRSDNLSQHIKT 696

>KNAG0D00900 Chr4 (144302..145270) [969 bp, 322 aa] {ON} Anc_6.256
           YPL230W
          Length = 322

 Score = 32.0 bits (71), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 26/55 (47%), Gaps = 8/55 (14%)

Query: 178 CPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHASGEFSRKDTYKTHLKSIH 232
           C  +F    +L RH +KH   K F+C      CR +    FSR D  K H  S+H
Sbjct: 68  CNMSFTRAEHLARHTRKHTGEKPFQC----YICRKY----FSRVDNLKQHRDSVH 114

>NCAS0G01270 Chr7 (228699..229523) [825 bp, 274 aa] {ON} Anc_6.256
          Length = 274

 Score = 31.6 bits (70), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 26/97 (26%), Positives = 37/97 (38%), Gaps = 20/97 (20%)

Query: 180 SNFKVKGY------------LTRHMKKHLVTKDFRCPFWSVDCRCHASGEFSRKDTYKTH 227
           +NFK  GY            L RH++KH   K F+C              FSR D  K H
Sbjct: 17  NNFKCTGYGDCHMAFTRAEHLARHIRKHTGEKPFQCDV--------CLKRFSRVDNLKQH 68

Query: 228 LKSIHFVYPVGVAKSQRSRSTGRCAACYQEFRNNNEW 264
            +S+H       +K+    + GR     +   NN  +
Sbjct: 69  RESVHATVVNAASKNVPLVAKGRVEKPKKIILNNENF 105

>NDAI0D04090 Chr4 complement(959363..960733) [1371 bp, 456 aa] {ON}
           Anc_4.189
          Length = 456

 Score = 32.0 bits (71), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 13/40 (32%), Positives = 21/40 (52%), Gaps = 4/40 (10%)

Query: 173 FQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPF----WSV 208
           ++CA CPS F        HM +  + ++F+CPF    W +
Sbjct: 304 YRCAHCPSMFGTIFEYAAHMDEFEIKREFKCPFRLCPWKI 343

>ADL051W Chr4 (595493..596014) [522 bp, 173 aa] {ON} NOHBY404; No
           homolog in Saccharomyces cerevisiae
          Length = 173

 Score = 31.2 bits (69), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 18/35 (51%)

Query: 175 CAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVD 209
           CA C  +F  K  L  HM  H   K +RCP+ + +
Sbjct: 118 CAICRKSFTRKTSLQTHMLIHTKAKPYRCPYRTCN 152

>NDAI0A07540 Chr1 (1730558..1731670) [1113 bp, 370 aa] {ON}
           Anc_3.298
          Length = 370

 Score = 32.0 bits (71), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 33/77 (42%), Gaps = 4/77 (5%)

Query: 173 FQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHASGEFSRKDTYKTHLK--S 230
           + C  C   FK    L  HM  H   K + CP+   +CR   + + +    YK H K  S
Sbjct: 258 YGCKHCNKRFKRPSSLNTHMNIHTGNKPYVCPYE--ECRKSFNAKSNMLRHYKLHFKLNS 315

Query: 231 IHFVYPVGVAKSQRSRS 247
             ++ P G   +++  S
Sbjct: 316 GAYILPNGEISAEKPTS 332

>NDAI0B06020 Chr2 complement(1462374..1463654) [1281 bp, 426 aa]
           {ON} Anc_3.518
          Length = 426

 Score = 32.0 bits (71), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 26/58 (44%), Gaps = 6/58 (10%)

Query: 173 FQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHASGEFSRKDTYKTHLKS 230
           F+C FC   F    +  RH++ H   K   C F       H    FSR+D  K H+++
Sbjct: 21  FRCQFCSRGFHRLEHKKRHVRTHTGEKPHVCNFP------HCKKGFSRRDELKRHIRT 72

>TBLA0I02700 Chr9 complement(630467..632680) [2214 bp, 737 aa] {ON}
           Anc_4.214 YGR067C
          Length = 737

 Score = 32.0 bits (71), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 27/58 (46%), Gaps = 8/58 (13%)

Query: 175 CAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHASGEFSRKDTYKTHLKSIH 232
           CAFC   F    +  RH + H   K F+C        C  +  F R+D  K H+K++H
Sbjct: 7   CAFCRRAFSRSEHRKRHERSHQGVKPFQC------AVC--NHVFVRRDLLKRHIKTVH 56

>NDAI0B04290 Chr2 (1077647..1080841) [3195 bp, 1064 aa] {ON}
           Anc_2.162
          Length = 1064

 Score = 32.0 bits (71), Expect = 1.9,   Method: Composition-based stats.
 Identities = 18/55 (32%), Positives = 20/55 (36%), Gaps = 8/55 (14%)

Query: 173 FQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHASGEFSRKDTYKTH 227
           FQC FC   F   G L  H + H   K +RC              FSRK     H
Sbjct: 628 FQCNFCGKRFTQGGNLRTHQRLHTGEKPYRCEI--------CDKRFSRKGNLAAH 674

>KLLA0B04477g Chr2 (400019..404017) [3999 bp, 1332 aa] {ON} similar
           to uniprot|Q04545 Saccharomyces cerevisiae YML081W
          Length = 1332

 Score = 32.0 bits (71), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 27/61 (44%), Gaps = 10/61 (16%)

Query: 173 FQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDC-RCHASGEFSRKDTYKTHLKSI 231
           F C  C   F  + +L RH + H   K F C F    C RC     F+R+D    H + +
Sbjct: 83  FLCPICTRGFARQEHLRRHERSHTNEKPFLCAF----CGRC-----FARRDLVLRHQQKL 133

Query: 232 H 232
           H
Sbjct: 134 H 134

>ZYRO0G19140g Chr7 complement(1587180..1588853) [1674 bp, 557 aa]
           {ON} weakly similar to uniprot|P39959 Saccharomyces
           cerevisiae YER130C Hypothetical ORF
          Length = 557

 Score = 32.0 bits (71), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 29/60 (48%), Gaps = 11/60 (18%)

Query: 173 FQCAFCPSNFKVKGYLTRHMKK-HLVTKDFRCPFWSVDCRCHASG-EFSRKDTYKTHLKS 230
           F C +C   FK + +L RH++  H+  K F          CH  G +FSR D    H+K+
Sbjct: 503 FGCEYCDRRFKRQEHLKRHVRSLHMCEKPF---------GCHICGKKFSRSDNLNQHIKT 553

>KAFR0F03940 Chr6 complement(769153..770511) [1359 bp, 452 aa] {ON}
           Anc_4.189 YGR044C
          Length = 452

 Score = 31.6 bits (70), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 12/40 (30%), Positives = 21/40 (52%), Gaps = 4/40 (10%)

Query: 173 FQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPF----WSV 208
           ++CA CP  F        H+ K+ + ++F+CPF    W +
Sbjct: 303 YRCAHCPIMFSTVFEYASHLDKYEIRREFKCPFALCPWKI 342

>Suva_5.124 Chr5 complement(186591..187811) [1221 bp, 406 aa] {ON}
           YER028C (REAL)
          Length = 406

 Score = 31.6 bits (70), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 26/58 (44%), Gaps = 6/58 (10%)

Query: 173 FQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHASGEFSRKDTYKTHLKS 230
           F+C FC   F    +  RH++ H   K   C F      C  S  FSR D  K HL++
Sbjct: 17  FKCEFCSRGFHRLEHKKRHVRTHTGEKPHACSFRG----CPKS--FSRSDELKRHLRT 68

>Kpol_543.29 s543 complement(59228..60583) [1356 bp, 451 aa] {ON}
           complement(59228..60583) [1356 nt, 452 aa]
          Length = 451

 Score = 31.6 bits (70), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 18/68 (26%), Positives = 30/68 (44%), Gaps = 13/68 (19%)

Query: 173 FQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPF----WSV-------DCRCHASGEFSRK 221
           ++C  CPS +       +HM ++ +T+ ++CPF    W +       D R H +     K
Sbjct: 300 YKCTHCPSTYPNVFEYAKHMDQYNITRAYKCPFKLCPWKILGLPRRSDLRRHCA--IQHK 357

Query: 222 DTYKTHLK 229
           D     LK
Sbjct: 358 DELPNKLK 365

>KLLA0C17072g Chr3 (1494101..1495525) [1425 bp, 474 aa] {ON} weakly
           similar to uniprot|P39959 Saccharomyces cerevisiae
           YER130C Hypothetical ORF
          Length = 474

 Score = 31.6 bits (70), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 30/60 (50%), Gaps = 11/60 (18%)

Query: 173 FQCAFCPSNFKVKGYLTRHMKK-HLVTKDFRCPFWSVDCRCHASG-EFSRKDTYKTHLKS 230
           F C +C   FK + +L RH++  H+  K    P+      CH  G +FSR D    HLK+
Sbjct: 418 FGCEYCDRRFKRQEHLKRHIRSLHICEK----PYG-----CHLCGKKFSRSDNLSQHLKT 468

>NDAI0A05650 Chr1 (1275925..1276917) [993 bp, 330 aa] {ON} Anc_3.281
          Length = 330

 Score = 31.6 bits (70), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 25/61 (40%), Gaps = 10/61 (16%)

Query: 173 FQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHASGEFSRKDT----YKTHL 228
           + C  C   F   G+L RH + H   K   C F         + +FSR D     Y+TH 
Sbjct: 270 YLCKVCSKGFTTSGHLARHNRIHTGEKSHACHFAG------CTQKFSRHDNCLQHYRTHF 323

Query: 229 K 229
           K
Sbjct: 324 K 324

>KLLA0A02629g Chr1 complement(233822..235501) [1680 bp, 559 aa] {ON}
           some similarities with uniprot|P32338 Saccharomyces
           cerevisiae YGR044C RME1 mediates cell type control of
           sporulation negatively regulates IME1 and sporulation
           zinc finger protein negative regulator of meiosis
           directly repressed by a1-a2 regulator
          Length = 559

 Score = 31.6 bits (70), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 11/40 (27%), Positives = 21/40 (52%), Gaps = 4/40 (10%)

Query: 173 FQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPF----WSV 208
           ++CA CP  F       +H+ ++ V + ++CPF    W +
Sbjct: 413 YKCAHCPEMFNTIFEFAKHIDEYQVERKYKCPFPLCPWKI 452

>Kpol_1050.116 s1050 complement(264361..265350) [990 bp, 329 aa]
           {ON} complement(264361..265350) [990 nt, 330 aa]
          Length = 329

 Score = 31.2 bits (69), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 28/62 (45%), Gaps = 10/62 (16%)

Query: 173 FQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHASGEFSRKDT----YKTHL 228
           + C  C       G+L+RH + H   K   CPF   + R      FSR+D     Y+TH 
Sbjct: 263 YYCRVCGKGLTTSGHLSRHYRIHTGEKKHCCPFEGCNQR------FSRRDNCSQHYQTHR 316

Query: 229 KS 230
           ++
Sbjct: 317 RN 318

>NDAI0H01400 Chr8 complement(340037..341662) [1626 bp, 541 aa] {ON}
           Anc_2.533
          Length = 541

 Score = 31.6 bits (70), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 16/60 (26%), Positives = 26/60 (43%), Gaps = 8/60 (13%)

Query: 173 FQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHASGEFSRKDTYKTHLKSIH 232
           ++C  C   FK + +L RH+  H   + + CP W +           R+D    H+K  H
Sbjct: 400 YRCRICEKKFKRRSWLKRHLLSHSSERHYLCP-WCL-------SRHKRRDNLLQHMKLKH 451

>Suva_12.218 Chr12 complement(338418..342230) [3813 bp, 1270 aa]
           {ON} YJR127C (REAL)
          Length = 1270

 Score = 31.6 bits (70), Expect = 2.7,   Method: Composition-based stats.
 Identities = 23/90 (25%), Positives = 36/90 (40%), Gaps = 9/90 (10%)

Query: 173 FQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHASGEFSRKDTYKTHLKSIH 232
           F C  C   F  + +L RH   H   K + C F     RC     F+R+D    H + +H
Sbjct: 36  FLCPTCTRGFVRQEHLKRHQHSHTREKPYLCIFCG---RC-----FARRDLVLRHQQKLH 87

Query: 233 FVYPVGVAKSQRSRSTGRCAACYQEFRNNN 262
               VG   +Q    +   +A +   R ++
Sbjct: 88  AAL-VGTGDTQHMAPSPSPSASFTPKRRHS 116

>KNAG0J02250 Chr10 (421560..422450) [891 bp, 296 aa] {ON} 
          Length = 296

 Score = 31.2 bits (69), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 28/67 (41%), Gaps = 7/67 (10%)

Query: 173 FQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHASGEFSRKDTYKTHLKSIH 232
           F+C  C   F+    L  H   H   K + CP+ +    CH S  F+ K     H K +H
Sbjct: 208 FKCCVCGKGFRRPSSLATHSNIHTGFKPYVCPYEN----CHKS--FNAKSNMFRHYK-LH 260

Query: 233 FVYPVGV 239
           F  P G 
Sbjct: 261 FKLPSGA 267

>CAGL0K04257g Chr11 complement(392116..393759) [1644 bp, 547 aa]
           {ON} some similarities with uniprot|P32338 Saccharomyces
           cerevisiae YGR044c
          Length = 547

 Score = 31.6 bits (70), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 24/105 (22%), Positives = 36/105 (34%), Gaps = 44/105 (41%)

Query: 172 MFQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPF----WSV-------DCRCHAS----- 215
           +++CA CPS F        H+ ++ V +  +CPF    W +       D R H +     
Sbjct: 405 LYRCAHCPSTFNNIFEYASHLDEYEVERKHKCPFKNCAWRILGLPRRSDLRRHCAIQHKY 464

Query: 216 ----------------------------GEFSRKDTYKTHLKSIH 232
                                        EF RKD YK H+  +H
Sbjct: 465 ELYGQLKKDLNLTEDAYPVLRCPVMFCQKEFYRKDAYKRHIAIVH 509

>NCAS0D02520 Chr4 (478610..479341) [732 bp, 243 aa] {ON} 
          Length = 243

 Score = 31.2 bits (69), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 26/56 (46%), Gaps = 8/56 (14%)

Query: 178 CPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHASGEFSRKDTYKTHLKSIHF 233
           C   F    +L RH++KH   K F+C    V  +C     FSR D  K H  S+H 
Sbjct: 26  CHMAFSRMEHLARHIRKHTGEKPFKC---DVCLKC-----FSRLDNLKQHRLSVHL 73

>CAGL0H04213g Chr8 (398544..402509) [3966 bp, 1321 aa] {ON} similar
           to uniprot|Q04545 Saccharomyces cerevisiae YML081w
          Length = 1321

 Score = 31.6 bits (70), Expect = 2.7,   Method: Composition-based stats.
 Identities = 17/53 (32%), Positives = 21/53 (39%), Gaps = 3/53 (5%)

Query: 175 CAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHASGEFSRKDTYKTH 227
           C  C   F    +L RH + H   K F C F     RC A  +   +  YK H
Sbjct: 35  CPICTRGFVRLEHLKRHQRAHTNEKPFLCVFCG---RCFARRDLVLRHQYKLH 84

>KLLA0F13046g Chr6 (1201353..1205492) [4140 bp, 1379 aa] {ON} weakly
           similar to uniprot|P07248 Saccharomyces cerevisiae
           YDR216W ADR1 Positive transcriptional regulator controls
           the expression of ADH2 peroxisomal protein genes and
           genes required for ethanol glycerol and fatty acid
           utilization
          Length = 1379

 Score = 31.6 bits (70), Expect = 2.8,   Method: Composition-based stats.
 Identities = 16/61 (26%), Positives = 25/61 (40%), Gaps = 8/61 (13%)

Query: 172 MFQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHASGEFSRKDTYKTHLKSI 231
           +F C  C   F  + +LTRH + H   K + C              F+R+D    H + +
Sbjct: 124 LFVCKVCTRAFARQEHLTRHERSHTKEKPYVCGI--------CERRFTRRDLLIRHCQKL 175

Query: 232 H 232
           H
Sbjct: 176 H 176

>Kwal_14.1457 s14 complement(331338..332885) [1548 bp, 515 aa] {ON}
           YGR044C (RME1) - zinc finger protein; negative regulator
           of meiosis; directly repressed by a1-a2 regulator
           [contig 242] FULL
          Length = 515

 Score = 31.2 bits (69), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 10/33 (30%), Positives = 19/33 (57%)

Query: 173 FQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPF 205
           ++CA CP  F       +H+ +  + +D++CPF
Sbjct: 369 YRCAHCPKMFSSILEYAKHIDEFQIQRDYKCPF 401

>ZYRO0B14894g Chr2 complement(1212853..1216212) [3360 bp, 1119 aa]
           {ON} similar to uniprot|Q04545 Saccharomyces cerevisiae
           YML081W Hypothetical ORF
          Length = 1119

 Score = 31.6 bits (70), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 27/61 (44%), Gaps = 10/61 (16%)

Query: 173 FQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDC-RCHASGEFSRKDTYKTHLKSI 231
           F C+ C   F  + +L RH + H   K F C F    C RC     F+R+D    H   +
Sbjct: 75  FLCSICTRGFVRQEHLKRHQRSHTNEKPFLCVF----CGRC-----FARRDLVLRHQHKL 125

Query: 232 H 232
           H
Sbjct: 126 H 126

>Klac_YGOB_Anc_3.518 Chr2 complement(46736..47455) [720 bp, 239 aa]
           {ON} ANNOTATED BY YGOB -
          Length = 239

 Score = 30.8 bits (68), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 27/61 (44%), Gaps = 7/61 (11%)

Query: 173 FQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHASGEFSRKDTYKTHLKSIH 232
           + C  C + F    + TRH++ H   K F C       R      FSR D  K H+K+ H
Sbjct: 12  YLCEICGNRFHRLEHKTRHIRTHTGEKPFACTVPGCPKR------FSRNDELKRHIKT-H 64

Query: 233 F 233
           F
Sbjct: 65  F 65

>Ecym_8403 Chr8 complement(832403..834124) [1722 bp, 573 aa] {ON}
           similar to Ashbya gossypii ACL057W
          Length = 573

 Score = 31.2 bits (69), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 27/59 (45%), Gaps = 9/59 (15%)

Query: 173 FQCAFCPSNFKVKGYLTRHMKK-HLVTKDFRCPFWSVDCRCHASGEFSRKDTYKTHLKS 230
           F C FC   FK + +L RH++  H+  K + C             +FSR D    H+K+
Sbjct: 514 FGCEFCERRFKRQEHLKRHVRSLHMGEKPYGCDI--------CGKKFSRSDNLNQHIKT 564

>KLLA0F26961g Chr6 (2486804..2488888) [2085 bp, 694 aa] {ON} weakly
           similar to uniprot|P33748 Saccharomyces cerevisiae
           YMR037C MSN2 Transcriptional activator related to Msn4p
           activated in stress conditions which results in
           translocation from the cytoplasm to the nucleus binds
           DNA at stress response elements of responsive genes
           inducing gene expression
          Length = 694

 Score = 31.2 bits (69), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 27/59 (45%), Gaps = 9/59 (15%)

Query: 173 FQCAFCPSNFKVKGYLTRHMKK-HLVTKDFRCPFWSVDCRCHASGEFSRKDTYKTHLKS 230
           F+C  C   F+   +L RH++  H   + F C F      C    +FSR D    HLK+
Sbjct: 621 FKCDQCNKTFRRSEHLKRHVRSVHSTERPFHCQF------CDK--KFSRSDNLSQHLKT 671

>Skud_10.351 Chr10
           complement(617553..621332,621389..621469,621466..621510,
           621543..621620) [3984 bp, 1327 aa] {ON} YJR127C (REAL)
          Length = 1327

 Score = 31.2 bits (69), Expect = 3.3,   Method: Composition-based stats.
 Identities = 21/71 (29%), Positives = 29/71 (40%), Gaps = 9/71 (12%)

Query: 173 FQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHASGEFSRKDTYKTHLKSIH 232
           F C  C   F  + +L RH   H   K + C F     RC     F+R+D    H + +H
Sbjct: 104 FLCPTCTRGFVRQEHLKRHQHSHTREKPYLCIFCG---RC-----FARRDLVLRHQQKLH 155

Query: 233 FVYPVGVAKSQ 243
               VG   +Q
Sbjct: 156 AAL-VGTGDAQ 165

>AGL246W Chr7 (240857..241540) [684 bp, 227 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR253C (MET32) and
           YPL038W (MET31)
          Length = 227

 Score = 30.8 bits (68), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 24/59 (40%), Gaps = 8/59 (13%)

Query: 173 FQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHASGEFSRKDTYKTHLKSI 231
           F C  C   F+  G L RH K HL       P     C     G F+RKD  K H  ++
Sbjct: 147 FHCTKCELVFRRSGDLRRHEKVHL-------PILPNICSLCGKG-FARKDALKRHFGTL 197

>NCAS0B06960 Chr2 (1324315..1326834) [2520 bp, 839 aa] {ON}
           Anc_2.162
          Length = 839

 Score = 31.2 bits (69), Expect = 3.8,   Method: Composition-based stats.
 Identities = 18/64 (28%), Positives = 24/64 (37%), Gaps = 8/64 (12%)

Query: 173 FQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHASGEFSRKDTYKTHLKSIH 232
           +QC +C   F   G L  H + H   K + C             +FSRK     HL +  
Sbjct: 543 YQCGYCGKRFTQGGNLRTHQRLHTGEKPYECEL--------CDKKFSRKGNLAAHLLTHQ 594

Query: 233 FVYP 236
            V P
Sbjct: 595 KVKP 598

>TPHA0C02580 Chr3 (572294..573391) [1098 bp, 365 aa] {ON} Anc_2.598
           YMR037C
          Length = 365

 Score = 30.8 bits (68), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 27/59 (45%), Gaps = 9/59 (15%)

Query: 173 FQCAFCPSNFKVKGYLTRHMKK-HLVTKDFRCPFWSVDCRCHASGEFSRKDTYKTHLKS 230
           F+C  C   FK   +L RH++  H   + + C F      C  +  FSR D    HLK+
Sbjct: 308 FKCNKCEKKFKRSEHLKRHIRSVHSTERPYHCQF------CEKN--FSRSDNLSQHLKT 358

>ZYRO0G20526g Chr7 (1691182..1693731) [2550 bp, 849 aa] {ON} weakly
           similar to uniprot|P47043 Saccharomyces cerevisiae
           YJL056C ZAP1 Zinc-regulated transcription factor binds
           to zinc-responsive promoter elements to induce
           transcription of certain genes in the presence of zinc
           regulates its own transcription contains seven zinc-
           finger domains
          Length = 849

 Score = 30.8 bits (68), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 25/104 (24%), Positives = 41/104 (39%), Gaps = 19/104 (18%)

Query: 173 FQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHASGE-FSRKDTYKTHLKSI 231
           F+C  C  +F  +  L +HM+ H   K F         +CH  G+ FS   + K H+++ 
Sbjct: 735 FKCQVCLKSFSSEDTLNQHMRTHSGEKPF---------KCHLCGKSFSVSSSLKIHIRT- 784

Query: 232 HFVYPVGVAKSQRSRSTGRCAACYQEFRNNNEWLTQHVESRSCS 275
                      ++      C   + E  N N+ L  H +   CS
Sbjct: 785 --------HTGEKPLQCKICGKRFNESSNLNKHLKTHRKKYKCS 820

>KNAG0D04020 Chr4 complement(726098..727558) [1461 bp, 486 aa] {ON}
           Anc_4.189 YGR044C
          Length = 486

 Score = 30.8 bits (68), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 12/40 (30%), Positives = 18/40 (45%), Gaps = 4/40 (10%)

Query: 173 FQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPF----WSV 208
           ++CA CP  F        HM    + + F+CPF    W +
Sbjct: 339 YRCAHCPETFSTIFEYAAHMDDFKIKRKFKCPFPLCPWKI 378

>KAFR0G03050 Chr7 complement(633014..635263) [2250 bp, 749 aa] {ON}
           Anc_4.214 YGR067C
          Length = 749

 Score = 30.8 bits (68), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 29/60 (48%), Gaps = 8/60 (13%)

Query: 173 FQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHASGEFSRKDTYKTHLKSIH 232
           + C+FC   F    +  RH + H   K F+C      C  HA   F R+D  + H+K++H
Sbjct: 8   YVCSFCAKAFSRSEHRIRHERSHTGYKPFQCNI----CN-HA---FVRRDLVQRHIKTVH 59

>Skud_2.189 Chr2 complement(338427..339089) [663 bp, 220 aa] {ON}
           YBR066C (REAL)
          Length = 220

 Score = 30.4 bits (67), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 25/57 (43%), Gaps = 10/57 (17%)

Query: 175 CAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHASGEFSRKDT----YKTH 227
           C  C + F   G+L+RH + H   K+  CP      R      FSR D     Y+TH
Sbjct: 155 CKICSTGFTTSGHLSRHNRIHTGEKNHICPHEGCGQR------FSRHDNCNQHYRTH 205

>TPHA0J00670 Chr10 complement(148901..150883) [1983 bp, 660 aa] {ON}
           Anc_4.189 YGR044C
          Length = 660

 Score = 30.8 bits (68), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 19/78 (24%), Positives = 33/78 (42%), Gaps = 13/78 (16%)

Query: 173 FQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPF----WSV-------DCRCHASGEFSRK 221
           ++C  CP  F       +HM    + ++++CPF    W +       D R H + +   +
Sbjct: 511 YKCTHCPETFASIFEYAKHMDSFGIRREYKCPFELCPWKILGLPRRSDLRRHCAIQHKDE 570

Query: 222 --DTYKTHLKSIHFVYPV 237
             DT K  L     +YP+
Sbjct: 571 LSDTLKKELNLNDEMYPI 588

>YBR066C Chr2 complement(370037..370699) [663 bp, 220 aa] {ON}
           NRG2Transcriptional repressor that mediates glucose
           repression and negatively regulates filamentous growth;
           has similarity to Nrg1p
          Length = 220

 Score = 30.4 bits (67), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 25/57 (43%), Gaps = 10/57 (17%)

Query: 175 CAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHASGEFSRKDT----YKTH 227
           C  C + F   G+L+RH + H   K+  CP      R      FSR D     Y+TH
Sbjct: 155 CKICSTGFTTSGHLSRHNRIHTGEKNHICPHEGCGQR------FSRHDNCNQHYRTH 205

>KNAG0H03480 Chr8 (648636..651026) [2391 bp, 796 aa] {ON} Anc_2.162
           YOR113W
          Length = 796

 Score = 30.8 bits (68), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 24/64 (37%), Gaps = 8/64 (12%)

Query: 173 FQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHASGEFSRKDTYKTHLKSIH 232
           F+C FC   F   G L  H + H   K + C         H S  FSRK     H  +  
Sbjct: 500 FECQFCGKRFTQGGNLRTHQRLHTGEKPYAC--------QHCSKRFSRKGNLAAHQLTHR 551

Query: 233 FVYP 236
            V P
Sbjct: 552 EVKP 555

>SAKL0H24816g Chr8 complement(2158299..2159531) [1233 bp, 410 aa]
           {ON} weakly similar to uniprot|P39959 Saccharomyces
           cerevisiae YER130C Hypothetical ORF
          Length = 410

 Score = 30.8 bits (68), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 27/59 (45%), Gaps = 9/59 (15%)

Query: 173 FQCAFCPSNFKVKGYLTRHMKK-HLVTKDFRCPFWSVDCRCHASGEFSRKDTYKTHLKS 230
           F C FC   FK + +L RH++  H+  K + C             +FSR D    H+K+
Sbjct: 354 FGCEFCDRRFKRQEHLKRHVRSLHMGEKPYGCEI--------CGKKFSRSDNLNQHIKT 404

>KNAG0B06710 Chr2 complement(1325084..1328245) [3162 bp, 1053 aa]
           {ON} Anc_4.351 YJR127C
          Length = 1053

 Score = 30.8 bits (68), Expect = 4.7,   Method: Composition-based stats.
 Identities = 18/58 (31%), Positives = 23/58 (39%), Gaps = 8/58 (13%)

Query: 175 CAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHASGEFSRKDTYKTHLKSIH 232
           C  C   F    +L RH + H   K + C F     RC     F+RKD    H   +H
Sbjct: 24  CPVCSRGFVRLEHLKRHQRSHTREKPYLCVFCG---RC-----FARKDLVLRHQGKLH 73

>KLTH0G17336g Chr7 (1500141..1501598) [1458 bp, 485 aa] {ON} some
           similarities with uniprot|P32338 Saccharomyces
           cerevisiae YGR044C RME1 mediates cell type control of
           sporulation negatively regulates IME1 and sporulation
           zinc finger protein negative regulator of meiosis
           directly repressed by a1-a2 regulator
          Length = 485

 Score = 30.4 bits (67), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 10/33 (30%), Positives = 19/33 (57%)

Query: 173 FQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPF 205
           ++CA CP  F       +H+ +  + +D++CPF
Sbjct: 339 YRCAHCPKMFSNVLEYAKHIDEFEIQRDYKCPF 371

>Smik_2.199 Chr2 complement(351916..352578) [663 bp, 220 aa] {ON}
           YBR066C (REAL)
          Length = 220

 Score = 30.0 bits (66), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 25/57 (43%), Gaps = 10/57 (17%)

Query: 175 CAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHASGEFSRKDT----YKTH 227
           C  C + F   G+L+RH + H   K+  CP      R      FSR D     Y+TH
Sbjct: 155 CKICSTGFTTSGHLSRHNRIHTGEKNHICPHEGCGQR------FSRHDNCNQHYRTH 205

>Suva_4.305 Chr4 complement(536954..537616) [663 bp, 220 aa] {ON}
           YBR066C (REAL)
          Length = 220

 Score = 30.0 bits (66), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 25/57 (43%), Gaps = 10/57 (17%)

Query: 175 CAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHASGEFSRKDT----YKTH 227
           C  C + F   G+L+RH + H   K+  CP      R      FSR D     Y+TH
Sbjct: 155 CKICSTGFTTSGHLSRHNRIHTGEKNHICPHEGCGQR------FSRHDNCNQHYRTH 205

>Skud_7.364 Chr7 complement(609656..612088) [2433 bp, 810 aa] {ON}
           YGR067C (REAL)
          Length = 810

 Score = 30.4 bits (67), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 17/60 (28%), Positives = 28/60 (46%), Gaps = 8/60 (13%)

Query: 173 FQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHASGEFSRKDTYKTHLKSIH 232
           + C+FC   F    +  RH + H   K F+C        C  S  F R+D  + H++++H
Sbjct: 8   YICSFCLKPFSRSEHKIRHERSHAGVKPFQCQI------CKHS--FVRRDLLQRHIRTVH 59

>TPHA0H01850 Chr8 complement(425548..426633) [1086 bp, 361 aa] {ON}
           Anc_6.256 YPL230W
          Length = 361

 Score = 30.4 bits (67), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 24/46 (52%), Gaps = 10/46 (21%)

Query: 188 LTRHMKKHLVTKDFRCPFWSVDCRCHASGE-FSRKDTYKTHLKSIH 232
           LTRH +KH   K F         +CH   + FSR D  K H++S+H
Sbjct: 52  LTRHRRKHTGEKPF---------KCHVCLKFFSRIDNLKQHIESVH 88

>Suva_7.349 Chr7 complement(598667..601105) [2439 bp, 812 aa] {ON}
           YGR067C (REAL)
          Length = 812

 Score = 30.4 bits (67), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 17/60 (28%), Positives = 28/60 (46%), Gaps = 8/60 (13%)

Query: 173 FQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHASGEFSRKDTYKTHLKSIH 232
           + C+FC   F    +  RH + H   K F+C        C  S  F R+D  + H++++H
Sbjct: 8   YICSFCLKPFSRSEHKIRHERSHAGVKPFQCQV------CKHS--FVRRDLLQRHIRTVH 59

>ZYRO0F01012g Chr6 (78166..79920) [1755 bp, 584 aa] {ON} similar to
           uniprot|P33749 Saccharomyces cerevisiae YKL062W MSN4
           Transcriptional activator related to Msn2p activated in
           stress conditions which results in translocation from
           the cytoplasm to the nucleus binds DNA at stress
           response elements of responsive genes inducing gene
           expression
          Length = 584

 Score = 30.4 bits (67), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 27/59 (45%), Gaps = 9/59 (15%)

Query: 173 FQCAFCPSNFKVKGYLTRHMKK-HLVTKDFRCPFWSVDCRCHASGEFSRKDTYKTHLKS 230
           F+C  C   F+   +L RH++  H   + F C F      C    +FSR D    HLK+
Sbjct: 527 FKCKECSKAFRRSEHLKRHIRSVHSSERPFACMF------CEK--KFSRSDNLSQHLKT 577

>CAGL0E04884g Chr5 complement(469532..474001) [4470 bp, 1489 aa]
           {ON} weakly similar to uniprot|P07248 Saccharomyces
           cerevisiae YDR216w ADR1 zinc-finger transcription factor
          Length = 1489

 Score = 30.4 bits (67), Expect = 6.3,   Method: Composition-based stats.
 Identities = 16/61 (26%), Positives = 24/61 (39%), Gaps = 8/61 (13%)

Query: 172 MFQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHASGEFSRKDTYKTHLKSI 231
           +F C  C   F  + +LTRH + H   K + C              F+R+D    H   +
Sbjct: 29  LFVCQTCTRAFARQEHLTRHERSHTKEKPYCCGI--------CDRRFTRRDLLLRHAHKV 80

Query: 232 H 232
           H
Sbjct: 81  H 81

>TDEL0B06910 Chr2 complement(1222435..1223748) [1314 bp, 437 aa]
           {ON} Anc_2.598 YMR037C
          Length = 437

 Score = 30.0 bits (66), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 27/59 (45%), Gaps = 9/59 (15%)

Query: 173 FQCAFCPSNFKVKGYLTRHMKK-HLVTKDFRCPFWSVDCRCHASGEFSRKDTYKTHLKS 230
           F+C  C   F+   +L RH++  H   + F C F      C    +FSR D    HLK+
Sbjct: 380 FKCKECAKAFRRSEHLKRHIRSVHSTERPFACMF------CEK--KFSRSDNLSQHLKT 430

>KAFR0B00280 Chr2 (65006..66256) [1251 bp, 416 aa] {ON} Anc_7.543
           YPR186C
          Length = 416

 Score = 30.0 bits (66), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 27/63 (42%), Gaps = 2/63 (3%)

Query: 173 FQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHASGEFSRKDTYKTHLKSIH 232
           F+C  C  +F  K +L RH+  HL  KD   PF    C    +     K    TH KS H
Sbjct: 95  FKCNECTKSFARKTHLERHLISHLNDKDK--PFHCKYCNKGTTTRQQLKRHEITHTKSFH 152

Query: 233 FVY 235
             Y
Sbjct: 153 CPY 155

>KAFR0J00340 Chr10 complement(58635..59291) [657 bp, 218 aa] {ON} 
          Length = 218

 Score = 29.6 bits (65), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 16/62 (25%), Positives = 29/62 (46%), Gaps = 8/62 (12%)

Query: 172 MFQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHASGEFSRKDTYKTHLKSI 231
           +++C  C   F+ + +L RH   H   ++F CP+    C+     +  R+D    H+K  
Sbjct: 118 VYRCNVCNKIFQREAWLRRHHLSHTNDRNFLCPW----CK----SKHKRRDNLFKHIKLK 169

Query: 232 HF 233
           H 
Sbjct: 170 HM 171

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.134    0.426 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 27,494,463
Number of extensions: 970014
Number of successful extensions: 2683
Number of sequences better than 10.0: 368
Number of HSP's gapped: 2602
Number of HSP's successfully gapped: 382
Length of query: 279
Length of database: 53,481,399
Length adjustment: 108
Effective length of query: 171
Effective length of database: 41,097,471
Effective search space: 7027667541
Effective search space used: 7027667541
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 65 (29.6 bits)