Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_33.15545na 1ON57657625380.0
KLTH0B01166gna 1ON57757421760.0
SAKL0G14916gna 1ON58157518810.0
Kpol_358.3na 1ON57557617680.0
Suva_16.40na 1ON60653517570.0
YPL265W (DIP5)na 1ON60853517550.0
Smik_6.473na 1ON60653517520.0
NDAI0I02660na 1ON59455917370.0
Skud_16.12na 1ON60756417360.0
NCAS0D02260na 1ON59755917330.0
Ecym_2480na 1ON58654217200.0
KLLA0E16281gna 1ON60557216880.0
TPHA0M00130singletonON61153916760.0
KAFR0B06430singletonON59357716440.0
ACL135Wna 1ON58855116390.0
CAGL0A01199gna 1ON61353616250.0
TBLA0A07060na 1ON62552716140.0
KNAG0L02460singletonON58854315800.0
KNAG0L02470singletonON63850315560.0
ZYRO0D17908gna 1ON5185168401e-105
SAKL0C02662g1.83ON5485378291e-103
SAKL0C02640gsingletonON5485428221e-102
NDAI0A006101.83ON5655178201e-101
Smik_5.241.83ON5905198181e-101
Ecym_80357.44ON5635398151e-101
Ecym_10871.83ON5705448141e-101
KLLA0C02343g1.83ON5815388101e-100
Suva_5.41.83ON5905388072e-99
Skud_5.261.83ON5905388063e-99
CAGL0E05632g7.44ON5985088063e-99
TDEL0A08030singletonON5145017961e-98
YEL063C (CAN1)1.83ON5905128021e-98
YOR348C (PUT4)7.44ON6275268032e-98
CAGL0J08184g1.83ON5725427956e-98
Kpol_2000.641.84ON6105667952e-97
Ecym_10881.84ON5675027912e-97
Smik_15.5327.44ON6315267962e-97
TDEL0C061801.83ON5835027913e-97
SAKL0C02684gsingletonON5884857897e-97
SAKL0B10956g7.44ON5725527871e-96
YNL270C (ALP1)1.83ON5735277862e-96
NCAS0E022607.44ON5935157862e-96
CAGL0J08162g1.84ON5974957853e-96
TDEL0C061701.84ON5735147825e-96
Smik_14.671.83ON5735397825e-96
NCAS0A006001.83ON5445187797e-96
KLTH0F02398g1.83ON5555437781e-95
Kwal_26.69407.44ON5705847773e-95
TDEL0H040707.44ON5775477765e-95
KNAG0F004801.84ON5975267775e-95
TBLA0A054601.84ON6085487785e-95
NDAI0E038007.44ON6215477796e-95
Skud_14.701.83ON5735557722e-94
TBLA0A054501.83ON6065357742e-94
Kpol_367.77.44ON5845837704e-94
KNAG0C05920singletonON5995157698e-94
TPHA0H028507.44ON6015617654e-93
Skud_14.711.84ON6125017638e-93
Suva_8.4027.44ON6835097681e-92
SAKL0C02728g1.84ON5625257581e-92
TPHA0B044801.83ON6035057593e-92
KAFR0D039401.83ON5975477583e-92
NCAS0B085701.83ON5325107533e-92
Kwal_23.4026singletonON5345327524e-92
TPHA0B044701.84ON5995867576e-92
YNL268W (LYP1)1.84ON6115437569e-92
Kwal_33.134011.83ON5595407511e-91
NDAI0F041901.84ON5994997542e-91
ZYRO0F16632g1.84ON6075017542e-91
Kpol_2000.651.83ON5954847514e-91
KNAG0E003907.44ON5995417514e-91
SAKL0F09790gsingletonON5585497476e-91
Skud_15.5157.44ON6265317501e-90
Suva_14.751.84ON6115017481e-90
Smik_14.681.84ON6114957482e-90
NCAS0A006101.84ON6074997472e-90
Suva_14.731.83ON4974587373e-90
AFR667C1.84ON5635267415e-90
KLTH0D01474g7.44ON6244967449e-90
KNAG0C007901.83ON5794957373e-89
AFR156W7.44ON5585377344e-89
NDAI0F042001.83ON5665527321e-88
ZYRO0F16654g1.83ON5805167312e-88
KLLA0C02365g1.84ON5795427303e-88
KLLA0F23419g7.44ON5735437242e-87
KAFR0D007001.83ON5745437216e-87
KLTH0F02420g1.84ON6215087239e-87
Kwal_33.134111.84ON5605327136e-86
AFR668W1.83ON5565267102e-85
SAKL0F16544gsingletonON5675127102e-85
TBLA0C01240singletonON6295706872e-81
KLTH0F04048gsingletonON5835366833e-81
KAFR0C051607.44ON5845626553e-77
TDEL0E05750singletonON5485366508e-77
NDAI0D021605.158ON5874996529e-77
Smik_6.482na 2ON5585406482e-76
Suva_13.517singletonON5475316402e-75
KLTH0B00154gna 3ON5565166361e-74
KLLA0B14685gna 4ON5714736334e-74
Skud_7.5255.158ON6034986354e-74
Kwal_8.590na 3ON6295296365e-74
TDEL0D00200singletonON5675116318e-74
KLTH0A00308gsingletonON5414916281e-73
ZYRO0C18502g7.44ON5755156301e-73
Kwal_23.2817na 4ON5805356301e-73
YGR191W (HIP1)5.158ON6035086321e-73
Smik_16.1155.158ON6035106312e-73
Suva_7.4855.158ON6035386197e-72
ZYRO0D03762g1.244ON6004966162e-71
NDAI0F043901.50ON6675476177e-71
SAKL0G14014g5.158ON6054996102e-70
Skud_11.2751.244ON6024966092e-70
YCL025C (AGP1)1.50ON6335206103e-70
NCAS0A071105.158ON5925566041e-69
Ecym_47895.158ON5885026031e-69
Kpol_543.791.244ON6055306032e-69
SAKL0D04664g1.244ON5934976012e-69
TPHA0E036601.50ON6475456043e-69
KAFR0E018505.158ON5604995983e-69
Kwal_27.126811.244ON5934976004e-69
Kpol_1010.325.158ON5995606004e-69
TPHA0A047005.158ON5694935968e-69
KLLA0A11770g5.158ON5815025961e-68
Smik_3.531.50ON6335205982e-68
Smik_11.3021.244ON5535615923e-68
Ecym_60211.244ON6004975943e-68
NDAI0C029505.158ON6095295935e-68
CAGL0K05753g1.50ON6605355965e-68
Suva_11.2731.244ON6015805919e-68
KAFR0C004003.284ON5824995891e-67
YKR039W (GAP1)1.244ON6025815911e-67
TDEL0C00930singletonON5954975891e-67
TPHA0A002405.158ON6034625901e-67
NCAS0B079001.244ON6194965902e-67
CAGL0B03773g5.158ON6054995866e-67
KLLA0A06886gsingletonON5874965847e-67
KLTH0E15642g1.244ON5964965857e-67
YBR068C (BAP2)3.284ON6095155857e-67
KNAG0C02140singletonON5984975831e-66
KLTH0B02046g5.158ON5895455821e-66
Skud_16.2na 2ON4964535733e-66
Kpol_2000.921.50ON6375185824e-66
Skud_3.381.50ON6334995814e-66
SAKL0D02970g3.284ON6015455795e-66
Suva_2.716singletonON6034985778e-66
NDAI0B052201.244ON6114965789e-66
Suva_3.1891.50ON6335045781e-65
NCAS0D018705.158ON5954975761e-65
TPHA0B010901.244ON6064965762e-65
SAKL0C01232gsingletonON6135105752e-65
NDAI0A006401.50ON6415355745e-65
SAKL0D00836gna 5ON6014975691e-64
Smik_2.2723.397ON5975235682e-64
NDAI0G060301.368ON5995545672e-64
Suva_4.3813.397ON5905135663e-64
CAGL0B01012g1.50ON6235365674e-64
KNAG0F002701.50ON6345685675e-64
Kpol_1052.163.284ON6135315657e-64
AAR038W3.397ON5665145618e-64
KAFR0D00510na 6ON6175025648e-64
Kpol_1065.133.284ON5965335621e-63
AEL030W1.368ON5825505611e-63
KAFR0D04120na 7ON6485355641e-63
KNAG0G009005.158ON6135105621e-63
KAFR0D04130na 6ON6445445642e-63
Skud_2.2603.397ON5985435602e-63
AGR319W5.158ON6265065622e-63
ZYRO0F13838g8.342ON8365575703e-63
KAFR0D005001.50ON6175005594e-63
KLLA0F27093gsingletonON5635235556e-63
Kpol_526.103.397ON5805335567e-63
Smik_2.2013.284ON6095195578e-63
Suva_4.3073.284ON6095335561e-62
Kwal_33.154075.158ON5875185532e-62
TBLA0B077605.158ON6584975572e-62
KLLA0A06930g1.244ON5874965532e-62
KAFR0D041401.50ON6375325562e-62
KNAG0C005901.50ON6345345543e-62
YBR132C (AGP2)3.397ON5964895514e-62
Kpol_543.78singletonON6054965524e-62
NCAS0A089201.368ON5995265515e-62
TBLA0A051801.50ON6765195555e-62
KNAG0H011503.284ON6175385508e-62
YDR508C (GNP1)1.50ON6635495521e-61
KAFR0A011203.284ON5925085481e-61
Ecym_26643.285ON5755015461e-61
Skud_2.1913.284ON6095485482e-61
Suva_2.6881.50ON6615455512e-61
Kwal_26.9612singletonON5434985442e-61
Skud_4.7841.50ON6635505502e-61
SAKL0D02948gna 8ON5945475445e-61
NCAS0I015303.284ON5955145445e-61
SAKL0C01650g1.50ON6135115437e-61
YFL055W (AGP3)na 9ON5584975391e-60
TBLA0A05190na 7ON6675455441e-60
CAGL0L03267g1.244ON5975305402e-60
Kwal_33.14276na 5ON5964975402e-60
Kwal_33.132041.50ON6074995402e-60
TBLA0I020103.285ON6284955403e-60
CAGL0H08393g3.284ON6124985384e-60
Smik_12.2na 10ON5834595365e-60
TPHA0B047501.50ON6395515386e-60
KNAG0J022103.285ON5814905357e-60
ZYRO0C17182g3.397ON5785265348e-60
KLTH0F01606gna 7ON6045065351e-59
Skud_4.3003.284ON6045355341e-59
NDAI0A074903.284ON5965325341e-59
Smik_4.7901.50ON6635165371e-59
NDAI0A056203.284ON5715115312e-59
Suva_16.18na 11ON5835405313e-59
KNAG0L00110na 9ON5715275303e-59
Smik_13.1singletonON5234675263e-59
YLL061W (MMP1)na 10ON5834975304e-59
AFR698C1.50ON6095105314e-59
KLLA0C01606g1.50ON6205075314e-59
TDEL0F02830na 12ON5615465284e-59
TDEL0C065101.50ON6425205325e-59
KAFR0D00520na 7ON5985015305e-59
KNAG0J022003.284ON6075465305e-59
TDEL0E05700singletonON5844695287e-59
AGR038C3.284ON5805205279e-59
AGR039Cna 8ON5865005271e-58
CAGL0D02178g1.368ON5775405261e-58
SAKL0C13992gsingletonON5524905241e-58
Kwal_33.13215na 7ON5985065262e-58
Skud_6.2na 9ON5585485232e-58
Smik_4.2843.284ON6045355252e-58
AER405Cna 11ON4974725192e-58
SAKL0D02926g3.285ON5835295242e-58
AFR230C1.244ON6045025253e-58
NCAS0A106803.284ON5935395243e-58
Ecym_8297na 13ON5695215223e-58
YOL020W (TAT2)1.368ON5925205225e-58
Skud_15.1381.368ON5925205226e-58
YDR046C (BAP3)3.284ON6045355226e-58
KNAG0B012703.397ON5924585191e-57
Suva_15.1481.368ON5925205191e-57
AGR040C3.285ON5735005181e-57
Kwal_27.105383.284ON6025005192e-57
Kpol_534.221.368ON5925125192e-57
TDEL0C053403.397ON5754895172e-57
NCAS0I008503.397ON5845425172e-57
CAGL0C00539g3.397ON5935725182e-57
KLTH0F01584g1.50ON5965205173e-57
Ecym_2663na 8ON5895215163e-57
NCAS0B085801.50ON6275315184e-57
Ecym_10561.50ON6065145165e-57
Smik_15.1461.368ON5935205149e-57
ZYRO0A00308gsingletonON5644905102e-56
CAGL0L07546g3.284ON6345075132e-56
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_33.15545
         (576 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_33.15545 s33 complement(1149997..1151727) [1731 bp, 576 aa]...   982   0.0  
KLTH0B01166g Chr2 (102227..103960) [1734 bp, 577 aa] {ON} simila...   842   0.0  
SAKL0G14916g Chr7 complement(1277225..1278970) [1746 bp, 581 aa]...   729   0.0  
Kpol_358.3 s358 (7369..9096) [1728 bp, 575 aa] {ON} (7369..9096)...   685   0.0  
Suva_16.40 Chr16 (56664..58484) [1821 bp, 606 aa] {ON} YPL265W (...   681   0.0  
YPL265W Chr16 (41043..42869) [1827 bp, 608 aa] {ON}  DIP5Dicarbo...   680   0.0  
Smik_6.473 Chr6 complement(778327..780147) [1821 bp, 606 aa] {ON...   679   0.0  
NDAI0I02660 Chr9 complement(619959..621743) [1785 bp, 594 aa] {O...   673   0.0  
Skud_16.12 Chr16 (20144..21967) [1824 bp, 607 aa] {ON} YPL265W (...   673   0.0  
NCAS0D02260 Chr4 (421966..423759) [1794 bp, 597 aa] {ON}              672   0.0  
Ecym_2480 Chr2 complement(940315..942075) [1761 bp, 586 aa] {ON}...   667   0.0  
KLLA0E16281g Chr5 (1455271..1457088) [1818 bp, 605 aa] {ON} simi...   654   0.0  
TPHA0M00130 Chr13 complement(25769..27604) [1836 bp, 611 aa] {ON}     650   0.0  
KAFR0B06430 Chr2 complement(1333415..1335196) [1782 bp, 593 aa] ...   637   0.0  
ACL135W Chr3 (115359..117125) [1767 bp, 588 aa] {ON} Non-synteni...   635   0.0  
CAGL0A01199g Chr1 (121067..122908) [1842 bp, 613 aa] {ON} simila...   630   0.0  
TBLA0A07060 Chr1 complement(1737650..1739527) [1878 bp, 625 aa] ...   626   0.0  
KNAG0L02460 Chr12 (437963..439729) [1767 bp, 588 aa] {ON}             613   0.0  
KNAG0L02470 Chr12 (440549..442465) [1917 bp, 638 aa] {ON}             603   0.0  
ZYRO0D17908g Chr4 (1486514..1488070) [1557 bp, 518 aa] {ON} simi...   328   e-105
SAKL0C02662g Chr3 complement(249789..251435) [1647 bp, 548 aa] {...   323   e-103
SAKL0C02640g Chr3 complement(247651..249297) [1647 bp, 548 aa] {...   321   e-102
NDAI0A00610 Chr1 complement(113913..115610) [1698 bp, 565 aa] {O...   320   e-101
Smik_5.24 Chr5 complement(34087..35859) [1773 bp, 590 aa] {ON} Y...   319   e-101
Ecym_8035 Chr8 (81434..83125) [1692 bp, 563 aa] {ON} similar to ...   318   e-101
Ecym_1087 Chr1 complement(180832..182544) [1713 bp, 570 aa] {ON}...   318   e-101
KLLA0C02343g Chr3 complement(203552..205297) [1746 bp, 581 aa] {...   316   e-100
Suva_5.4 Chr5 complement(7388..9160) [1773 bp, 590 aa] {ON} YEL0...   315   2e-99
Skud_5.26 Chr5 complement(30850..32622) [1773 bp, 590 aa] {ON} Y...   315   3e-99
CAGL0E05632g Chr5 complement(556856..558652) [1797 bp, 598 aa] {...   315   3e-99
TDEL0A08030 Chr1 (1405718..1407262) [1545 bp, 514 aa] {ON}            311   1e-98
YEL063C Chr5 complement(31694..33466) [1773 bp, 590 aa] {ON}  CA...   313   1e-98
YOR348C Chr15 complement(986899..988782) [1884 bp, 627 aa] {ON} ...   313   2e-98
CAGL0J08184g Chr10 (806631..808349) [1719 bp, 572 aa] {ON} simil...   310   6e-98
Kpol_2000.64 s2000 complement(130912..132744) [1833 bp, 610 aa] ...   310   2e-97
Ecym_1088 Chr1 (184038..185741) [1704 bp, 567 aa] {ON} similar t...   309   2e-97
Smik_15.532 Chr15 complement(932437..934332) [1896 bp, 631 aa] {...   311   2e-97
TDEL0C06180 Chr3 (1120158..1121909) [1752 bp, 583 aa] {ON} Anc_1...   309   3e-97
SAKL0C02684g Chr3 complement(251988..253754) [1767 bp, 588 aa] {...   308   7e-97
SAKL0B10956g Chr2 complement(949900..951618) [1719 bp, 572 aa] {...   307   1e-96
YNL270C Chr14 complement(135940..137661) [1722 bp, 573 aa] {ON} ...   307   2e-96
NCAS0E02260 Chr5 (437115..438896) [1782 bp, 593 aa] {ON} Anc_7.44     307   2e-96
CAGL0J08162g Chr10 complement(803679..805472) [1794 bp, 597 aa] ...   306   3e-96
TDEL0C06170 Chr3 complement(1117792..1119513) [1722 bp, 573 aa] ...   305   5e-96
Smik_14.67 Chr14 complement(114969..116690) [1722 bp, 573 aa] {O...   305   5e-96
NCAS0A00600 Chr1 complement(109246..110880) [1635 bp, 544 aa] {O...   304   7e-96
KLTH0F02398g Chr6 complement(202746..204413) [1668 bp, 555 aa] {...   304   1e-95
Kwal_26.6940 s26 (133377..135089) [1713 bp, 570 aa] {ON} YOR348C...   303   3e-95
TDEL0H04070 Chr8 complement(698717..700450) [1734 bp, 577 aa] {O...   303   5e-95
KNAG0F00480 Chr6 (73545..75338) [1794 bp, 597 aa] {ON}                303   5e-95
TBLA0A05460 Chr1 (1348452..1350278) [1827 bp, 608 aa] {ON} Anc_1...   304   5e-95
NDAI0E03800 Chr5 (829594..831459) [1866 bp, 621 aa] {ON} Anc_7.44     304   6e-95
Skud_14.70 Chr14 complement(124390..126111) [1722 bp, 573 aa] {O...   301   2e-94
TBLA0A05450 Chr1 complement(1345808..1347628) [1821 bp, 606 aa] ...   302   2e-94
Kpol_367.7 s367 (23929..25683) [1755 bp, 584 aa] {ON} (23929..25...   301   4e-94
KNAG0C05920 Chr3 (1157993..1159792) [1800 bp, 599 aa] {ON}            300   8e-94
TPHA0H02850 Chr8 complement(676524..678329) [1806 bp, 601 aa] {O...   299   4e-93
Skud_14.71 Chr14 (127310..129148) [1839 bp, 612 aa] {ON} YEL063C...   298   8e-93
Suva_8.402 Chr8 complement(722727..724778) [2052 bp, 683 aa] {ON...   300   1e-92
SAKL0C02728g Chr3 (255022..256710) [1689 bp, 562 aa] {ON} simila...   296   1e-92
TPHA0B04480 Chr2 (1050173..1051984) [1812 bp, 603 aa] {ON} Anc_1...   296   3e-92
KAFR0D03940 Chr4 complement(767673..769466) [1794 bp, 597 aa] {O...   296   3e-92
NCAS0B08570 Chr2 (1644264..1645862) [1599 bp, 532 aa] {ON}            294   3e-92
Kwal_23.4026 s23 (534468..536072) [1605 bp, 534 aa] {ON} YPL265W...   294   4e-92
TPHA0B04470 Chr2 complement(1047097..1048896) [1800 bp, 599 aa] ...   296   6e-92
YNL268W Chr14 (138550..140385) [1836 bp, 611 aa] {ON}  LYP1Lysin...   295   9e-92
Kwal_33.13401 s33 complement(206763..208442) [1680 bp, 559 aa] {...   293   1e-91
NDAI0F04190 Chr6 complement(1012142..1013941) [1800 bp, 599 aa] ...   295   2e-91
ZYRO0F16632g Chr6 complement(1371112..1372935) [1824 bp, 607 aa]...   295   2e-91
Kpol_2000.65 s2000 (134897..136684) [1788 bp, 595 aa] {ON} (1348...   293   4e-91
KNAG0E00390 Chr5 (61730..63529) [1800 bp, 599 aa] {ON} Anc_7.44 ...   293   4e-91
SAKL0F09790g Chr6 (750158..751834) [1677 bp, 558 aa] {ON} simila...   292   6e-91
Skud_15.515 Chr15 complement(924662..926542) [1881 bp, 626 aa] {...   293   1e-90
Suva_14.75 Chr14 (133164..134999) [1836 bp, 611 aa] {ON} YEL063C...   292   1e-90
Smik_14.68 Chr14 (117603..119438) [1836 bp, 611 aa] {ON} YEL063C...   292   2e-90
NCAS0A00610 Chr1 (111522..113345) [1824 bp, 607 aa] {ON}              292   2e-90
Suva_14.73 Chr14 complement(130474..131967) [1494 bp, 497 aa] {O...   288   3e-90
AFR667C Chr6 complement(1657505..1659196) [1692 bp, 563 aa] {ON}...   290   5e-90
KLTH0D01474g Chr4 (139116..140990) [1875 bp, 624 aa] {ON} simila...   291   9e-90
KNAG0C00790 Chr3 (138911..140650) [1740 bp, 579 aa] {ON}              288   3e-89
AFR156W Chr6 (717642..719318) [1677 bp, 558 aa] {ON} Non-synteni...   287   4e-89
NDAI0F04200 Chr6 (1016214..1017914) [1701 bp, 566 aa] {ON}            286   1e-88
ZYRO0F16654g Chr6 (1374093..1375835) [1743 bp, 580 aa] {ON} simi...   286   2e-88
KLLA0C02365g Chr3 (208462..210201) [1740 bp, 579 aa] {ON} simila...   285   3e-88
KLLA0F23419g Chr6 complement(2187386..2189107) [1722 bp, 573 aa]...   283   2e-87
KAFR0D00700 Chr4 complement(120768..122492) [1725 bp, 574 aa] {O...   282   6e-87
KLTH0F02420g Chr6 (205827..207692) [1866 bp, 621 aa] {ON} simila...   283   9e-87
Kwal_33.13411 s33 (210461..212143) [1683 bp, 560 aa] {ON} YNL268...   279   6e-86
AFR668W Chr6 (1659910..1661580) [1671 bp, 556 aa] {ON} Syntenic ...   278   2e-85
SAKL0F16544g Chr6 complement(1364680..1366383) [1704 bp, 567 aa]...   278   2e-85
TBLA0C01240 Chr3 (270186..272075) [1890 bp, 629 aa] {ON} Anc_1.3...   269   2e-81
KLTH0F04048g Chr6 (359492..361243) [1752 bp, 583 aa] {ON} weakly...   267   3e-81
KAFR0C05160 Chr3 (1025799..1027553) [1755 bp, 584 aa] {ON} Anc_7...   256   3e-77
TDEL0E05750 Chr5 (1074448..1076094) [1647 bp, 548 aa] {ON}            254   8e-77
NDAI0D02160 Chr4 (505202..506965) [1764 bp, 587 aa] {ON} Anc_5.158    255   9e-77
Smik_6.482 Chr6 complement(795927..797603) [1677 bp, 558 aa] {ON...   254   2e-76
Suva_13.517 Chr13 (904704..906347) [1644 bp, 547 aa] {ON} YPL265...   251   2e-75
KLTH0B00154g Chr2 complement(7385..9055) [1671 bp, 556 aa] {ON} ...   249   1e-74
KLLA0B14685g Chr2 complement(1289025..1290740) [1716 bp, 571 aa]...   248   4e-74
Skud_7.525 Chr7 (856072..857883) [1812 bp, 603 aa] {ON} YGR191W ...   249   4e-74
Kwal_8.590 s8 complement(17220..19109) [1890 bp, 629 aa] {ON} YO...   249   5e-74
TDEL0D00200 Chr4 (32432..34135) [1704 bp, 567 aa] {ON}                247   8e-74
KLTH0A00308g Chr1 (23428..25053) [1626 bp, 541 aa] {ON} weakly s...   246   1e-73
ZYRO0C18502g Chr3 complement(1448075..1449802) [1728 bp, 575 aa]...   247   1e-73
Kwal_23.2817 s23 complement(26637..28379) [1743 bp, 580 aa] {ON}...   247   1e-73
YGR191W Chr7 (880420..882231) [1812 bp, 603 aa] {ON}  HIP1High-a...   248   1e-73
Smik_16.115 Chr16 complement(214120..215931) [1812 bp, 603 aa] {...   247   2e-73
Suva_7.485 Chr7 (836820..838631) [1812 bp, 603 aa] {ON} YGR191W ...   243   7e-72
ZYRO0D03762g Chr4 complement(304207..306009) [1803 bp, 600 aa] {...   241   2e-71
NDAI0F04390 Chr6 (1073373..1075376) [2004 bp, 667 aa] {ON} Anc_1...   242   7e-71
SAKL0G14014g Chr7 (1202476..1204293) [1818 bp, 605 aa] {ON} high...   239   2e-70
Skud_11.275 Chr11 (496787..498595) [1809 bp, 602 aa] {ON} YKR039...   239   2e-70
YCL025C Chr3 complement(76018..77919) [1902 bp, 633 aa] {ON}  AG...   239   3e-70
NCAS0A07110 Chr1 (1408106..1409884) [1779 bp, 592 aa] {ON} Anc_5...   237   1e-69
Ecym_4789 Chr4 complement(1531864..1533630) [1767 bp, 588 aa] {O...   236   1e-69
Kpol_543.79 s543 (197876..199693) [1818 bp, 605 aa] {ON} (197876...   236   2e-69
SAKL0D04664g Chr4 complement(365852..367633) [1782 bp, 593 aa] {...   236   2e-69
TPHA0E03660 Chr5 (775232..777175) [1944 bp, 647 aa] {ON} Anc_1.5...   237   3e-69
KAFR0E01850 Chr5 (381160..382842) [1683 bp, 560 aa] {ON} Anc_5.1...   234   3e-69
Kwal_27.12681 s27 (1332647..1334428) [1782 bp, 593 aa] {ON} YKR0...   235   4e-69
Kpol_1010.32 s1010 (82500..84299) [1800 bp, 599 aa] {ON} (82500....   235   4e-69
TPHA0A04700 Chr1 (1064463..1066172) [1710 bp, 569 aa] {ON} Anc_5...   234   8e-69
KLLA0A11770g Chr1 (1014918..1016663) [1746 bp, 581 aa] {ON} simi...   234   1e-68
Smik_3.53 Chr3 complement(77146..79047) [1902 bp, 633 aa] {ON} Y...   234   2e-68
Smik_11.302 Chr11 (505026..506684) [1659 bp, 553 aa] {ON} YKR039...   232   3e-68
Ecym_6021 Chr6 (37898..39700) [1803 bp, 600 aa] {ON} similar to ...   233   3e-68
NDAI0C02950 Chr3 (676753..678582) [1830 bp, 609 aa] {ON} Anc_5.158    233   5e-68
CAGL0K05753g Chr11 (565111..567093) [1983 bp, 660 aa] {ON} highl...   234   5e-68
Suva_11.273 Chr11 (498611..500416) [1806 bp, 601 aa] {ON} YKR039...   232   9e-68
KAFR0C00400 Chr3 (83280..85028) [1749 bp, 582 aa] {ON}                231   1e-67
YKR039W Chr11 (515063..516871) [1809 bp, 602 aa] {ON}  GAP1Gener...   232   1e-67
TDEL0C00930 Chr3 complement(147777..149564) [1788 bp, 595 aa] {O...   231   1e-67
TPHA0A00240 Chr1 complement(28756..30567) [1812 bp, 603 aa] {ON}...   231   1e-67
NCAS0B07900 Chr2 (1500061..1501920) [1860 bp, 619 aa] {ON} Anc_1...   231   2e-67
CAGL0B03773g Chr2 (373956..375773) [1818 bp, 605 aa] {ON} highly...   230   6e-67
KLLA0A06886g Chr1 complement(621646..623409) [1764 bp, 587 aa] {...   229   7e-67
KLTH0E15642g Chr5 (1389937..1391727) [1791 bp, 596 aa] {ON} simi...   229   7e-67
YBR068C Chr2 complement(373861..375690) [1830 bp, 609 aa] {ON}  ...   229   7e-67
KNAG0C02140 Chr3 complement(416347..418143) [1797 bp, 598 aa] {O...   229   1e-66
KLTH0B02046g Chr2 complement(163199..164968) [1770 bp, 589 aa] {...   228   1e-66
Skud_16.2 Chr16 complement(1584..3074) [1491 bp, 496 aa] {ON} YP...   225   3e-66
Kpol_2000.92 s2000 (208509..210422) [1914 bp, 637 aa] {ON} (2085...   228   4e-66
Skud_3.38 Chr3 complement(63096..64997) [1902 bp, 633 aa] {ON} Y...   228   4e-66
SAKL0D02970g Chr4 (245449..247254) [1806 bp, 601 aa] {ON} unipro...   227   5e-66
Suva_2.716 Chr2 complement(1256781..1258592) [1812 bp, 603 aa] {...   226   8e-66
NDAI0B05220 Chr2 (1278386..1280221) [1836 bp, 611 aa] {ON} Anc_1...   227   9e-66
Suva_3.189 Chr3 complement(285493..287394) [1902 bp, 633 aa] {ON...   227   1e-65
NCAS0D01870 Chr4 complement(343416..345203) [1788 bp, 595 aa] {O...   226   1e-65
TPHA0B01090 Chr2 complement(246708..248528) [1821 bp, 606 aa] {O...   226   2e-65
SAKL0C01232g Chr3 (110269..112110) [1842 bp, 613 aa] {ON} simila...   226   2e-65
NDAI0A00640 Chr1 complement(118100..120025) [1926 bp, 641 aa] {O...   225   5e-65
SAKL0D00836g Chr4 complement(65731..67536) [1806 bp, 601 aa] {ON...   223   1e-64
Smik_2.272 Chr2 complement(484274..486067) [1794 bp, 597 aa] {ON...   223   2e-64
NDAI0G06030 Chr7 complement(1489584..1491383) [1800 bp, 599 aa] ...   223   2e-64
Suva_4.381 Chr4 complement(668597..670369) [1773 bp, 590 aa] {ON...   222   3e-64
CAGL0B01012g Chr2 (91330..93201) [1872 bp, 623 aa] {ON} similar ...   223   4e-64
KNAG0F00270 Chr6 complement(27784..29688) [1905 bp, 634 aa] {ON}...   223   5e-64
Kpol_1052.16 s1052 (44303..46144) [1842 bp, 613 aa] {ON} (44303....   222   7e-64
AAR038W Chr1 (409071..410771) [1701 bp, 566 aa] {ON} Syntenic ho...   220   8e-64
KAFR0D00510 Chr4 complement(80174..82027) [1854 bp, 617 aa] {ON}      221   8e-64
Kpol_1065.13 s1065 (28709..30499) [1791 bp, 596 aa] {ON} (28709....   221   1e-63
AEL030W Chr5 (577803..579551) [1749 bp, 582 aa] {ON} Syntenic ho...   220   1e-63
KAFR0D04120 Chr4 (816117..818063) [1947 bp, 648 aa] {ON} Anc_1.5...   221   1e-63
KNAG0G00900 Chr7 complement(170122..171963) [1842 bp, 613 aa] {O...   221   1e-63
KAFR0D04130 Chr4 (818573..820507) [1935 bp, 644 aa] {ON}              221   2e-63
Skud_2.260 Chr2 complement(467322..469118) [1797 bp, 598 aa] {ON...   220   2e-63
AGR319W Chr7 (1328425..1330305) [1881 bp, 626 aa] {ON} Syntenic ...   221   2e-63
ZYRO0F13838g Chr6 (1139293..1141803) [2511 bp, 836 aa] {ON} simi...   224   3e-63
KAFR0D00500 Chr4 complement(77541..79394) [1854 bp, 617 aa] {ON}      219   4e-63
KLLA0F27093g Chr6 (2501049..2502740) [1692 bp, 563 aa] {ON} simi...   218   6e-63
Kpol_526.10 s526 complement(18362..20104) [1743 bp, 580 aa] {ON}...   218   7e-63
Smik_2.201 Chr2 complement(355785..357614) [1830 bp, 609 aa] {ON...   219   8e-63
Suva_4.307 Chr4 complement(540768..542597) [1830 bp, 609 aa] {ON...   218   1e-62
Kwal_33.15407 s33 (1092383..1094146) [1764 bp, 587 aa] {ON} YGR1...   217   2e-62
TBLA0B07760 Chr2 complement(1834605..1836581) [1977 bp, 658 aa] ...   219   2e-62
KLLA0A06930g Chr1 complement(625498..627261) [1764 bp, 587 aa] {...   217   2e-62
KAFR0D04140 Chr4 (821341..823254) [1914 bp, 637 aa] {ON}              218   2e-62
KNAG0C00590 Chr3 complement(100801..102705) [1905 bp, 634 aa] {O...   218   3e-62
YBR132C Chr2 complement(499652..501442) [1791 bp, 596 aa] {ON}  ...   216   4e-62
Kpol_543.78 s543 (193316..195133) [1818 bp, 605 aa] {ON} (193316...   217   4e-62
NCAS0A08920 Chr1 (1765699..1767498) [1800 bp, 599 aa] {ON} Anc_1...   216   5e-62
TBLA0A05180 Chr1 complement(1267962..1269992) [2031 bp, 676 aa] ...   218   5e-62
KNAG0H01150 Chr8 (193585..195438) [1854 bp, 617 aa] {ON}              216   8e-62
YDR508C Chr4 complement(1466453..1468444) [1992 bp, 663 aa] {ON}...   217   1e-61
KAFR0A01120 Chr1 complement(216442..218220) [1779 bp, 592 aa] {O...   215   1e-61
Ecym_2664 Chr2 complement(1280994..1282721) [1728 bp, 575 aa] {O...   214   1e-61
Skud_2.191 Chr2 complement(342307..344136) [1830 bp, 609 aa] {ON...   215   2e-61
Suva_2.688 Chr2 complement(1219181..1221166) [1986 bp, 661 aa] {...   216   2e-61
Kwal_26.9612 s26 complement(1291552..1293183) [1632 bp, 543 aa] ...   214   2e-61
Skud_4.784 Chr4 complement(1386623..1388614) [1992 bp, 663 aa] {...   216   2e-61
SAKL0D02948g Chr4 (243064..244848) [1785 bp, 594 aa] {ON} simila...   214   5e-61
NCAS0I01530 Chr9 (286882..288669) [1788 bp, 595 aa] {ON}              214   5e-61
SAKL0C01650g Chr3 complement(139480..141321) [1842 bp, 613 aa] {...   213   7e-61
YFL055W Chr6 (17004..18680) [1677 bp, 558 aa] {ON}  AGP3Low-affi...   212   1e-60
TBLA0A05190 Chr1 complement(1271605..1273608) [2004 bp, 667 aa] ...   214   1e-60
CAGL0L03267g Chr12 (374784..376577) [1794 bp, 597 aa] {ON} highl...   212   2e-60
Kwal_33.14276 s33 complement(596760..598550) [1791 bp, 596 aa] {...   212   2e-60
Kwal_33.13204 s33 complement(120622..122445) [1824 bp, 607 aa] {...   212   2e-60
TBLA0I02010 Chr9 complement(455681..457567) [1887 bp, 628 aa] {O...   212   3e-60
CAGL0H08393g Chr8 (821998..823836) [1839 bp, 612 aa] {ON} highly...   211   4e-60
Smik_12.2 Chr12 (2207..3958) [1752 bp, 583 aa] {ON} YLL061W (REAL)    211   5e-60
TPHA0B04750 Chr2 (1119282..1121201) [1920 bp, 639 aa] {ON} Anc_1...   211   6e-60
KNAG0J02210 Chr10 complement(409847..411592) [1746 bp, 581 aa] {...   210   7e-60
ZYRO0C17182g Chr3 complement(1334883..1336619) [1737 bp, 578 aa]...   210   8e-60
KLTH0F01606g Chr6 complement(122821..124635) [1815 bp, 604 aa] {...   210   1e-59
Skud_4.300 Chr4 complement(525086..526900) [1815 bp, 604 aa] {ON...   210   1e-59
NDAI0A07490 Chr1 complement(1713048..1714838) [1791 bp, 596 aa] ...   210   1e-59
Smik_4.790 Chr4 complement(1389278..1391269) [1992 bp, 663 aa] {...   211   1e-59
NDAI0A05620 Chr1 (1268907..1270622) [1716 bp, 571 aa] {ON}            209   2e-59
Suva_16.18 Chr16 (17108..18859) [1752 bp, 583 aa] {ON} YLL061W (...   209   3e-59
KNAG0L00110 Chr12 complement(8543..10258) [1716 bp, 571 aa] {ON}...   208   3e-59
Smik_13.1 Chr13 (1838..3409) [1572 bp, 523 aa] {ON} YFL055W (REAL)    207   3e-59
YLL061W Chr12 (17956..19707) [1752 bp, 583 aa] {ON}  MMP1High-af...   208   4e-59
AFR698C Chr6 complement(1726387..1728216) [1830 bp, 609 aa] {ON}...   209   4e-59
KLLA0C01606g Chr3 complement(123485..125347) [1863 bp, 620 aa] {...   209   4e-59
TDEL0F02830 Chr6 complement(513358..515043) [1686 bp, 561 aa] {O...   207   4e-59
TDEL0C06510 Chr3 (1196039..1197967) [1929 bp, 642 aa] {ON} Anc_1...   209   5e-59
KAFR0D00520 Chr4 complement(82977..84773) [1797 bp, 598 aa] {ON}...   208   5e-59
KNAG0J02200 Chr10 complement(407267..409090) [1824 bp, 607 aa] {...   208   5e-59
TDEL0E05700 Chr5 complement(1059079..1060833) [1755 bp, 584 aa] ...   207   7e-59
AGR038C Chr7 complement(777529..779271) [1743 bp, 580 aa] {ON} S...   207   9e-59
AGR039C Chr7 complement(779720..781480) [1761 bp, 586 aa] {ON} S...   207   1e-58
CAGL0D02178g Chr4 (222597..224330) [1734 bp, 577 aa] {ON} highly...   207   1e-58
SAKL0C13992g Chr3 complement(1242080..1243738) [1659 bp, 552 aa]...   206   1e-58
Kwal_33.13215 s33 complement(123154..124950) [1797 bp, 598 aa] {...   207   2e-58
Skud_6.2 Chr6 (1506..3182) [1677 bp, 558 aa] {ON} YFL055W (REAL)      206   2e-58
Smik_4.284 Chr4 complement(515341..517155) [1815 bp, 604 aa] {ON...   206   2e-58
AER405C Chr5 complement(1413790..1415283) [1494 bp, 497 aa] {ON}...   204   2e-58
SAKL0D02926g Chr4 (240708..242459) [1752 bp, 583 aa] {ON} unipro...   206   2e-58
AFR230C Chr6 complement(855413..857227) [1815 bp, 604 aa] {ON} N...   206   3e-58
NCAS0A10680 Chr1 complement(2127039..2128820) [1782 bp, 593 aa] ...   206   3e-58
Ecym_8297 Chr8 complement(602984..604693) [1710 bp, 569 aa] {ON}...   205   3e-58
YOL020W Chr15 (286172..287950) [1779 bp, 592 aa] {ON}  TAT2High ...   205   5e-58
Skud_15.138 Chr15 (245592..247370) [1779 bp, 592 aa] {ON} YOL020...   205   6e-58
YDR046C Chr4 complement(548762..550576) [1815 bp, 604 aa] {ON}  ...   205   6e-58
KNAG0B01270 Chr2 (240862..242640) [1779 bp, 592 aa] {ON} Anc_3.3...   204   1e-57
Suva_15.148 Chr15 (258987..260765) [1779 bp, 592 aa] {ON} YOL020...   204   1e-57
AGR040C Chr7 complement(782283..784004) [1722 bp, 573 aa] {ON} S...   204   1e-57
Kwal_27.10538 s27 (380769..382577) [1809 bp, 602 aa] {ON} YBR068...   204   2e-57
Kpol_534.22 s534 (50849..52627) [1779 bp, 592 aa] {ON} (50849..5...   204   2e-57
TDEL0C05340 Chr3 complement(951770..953497) [1728 bp, 575 aa] {O...   203   2e-57
NCAS0I00850 Chr9 (156277..158031) [1755 bp, 584 aa] {ON} Anc_3.3...   203   2e-57
CAGL0C00539g Chr3 (57175..57177,57724..59502) [1782 bp, 593 aa] ...   204   2e-57
KLTH0F01584g Chr6 complement(120227..122017) [1791 bp, 596 aa] {...   203   3e-57
Ecym_2663 Chr2 complement(1278309..1280078) [1770 bp, 589 aa] {O...   203   3e-57
NCAS0B08580 Chr2 complement(1646220..1648103) [1884 bp, 627 aa] ...   204   4e-57
Ecym_1056 Chr1 (102260..104080) [1821 bp, 606 aa] {ON} similar t...   203   5e-57
Smik_15.146 Chr15 (252586..254367) [1782 bp, 593 aa] {ON} YOL020...   202   9e-57
ZYRO0A00308g Chr1 complement(16982..18676) [1695 bp, 564 aa] {ON...   201   2e-56
CAGL0L07546g Chr12 complement(833821..835725) [1905 bp, 634 aa] ...   202   2e-56
KLLA0A10813g Chr1 complement(936126..937880) [1755 bp, 584 aa] {...   200   3e-56
KLLA0C15873g Chr3 (1381699..1383405) [1707 bp, 568 aa] {ON} simi...   200   3e-56
Ecym_3430 Chr3 (807979..809658) [1680 bp, 559 aa] {ON} similar t...   199   4e-56
TDEL0F04660 Chr6 (877951..880473) [2523 bp, 840 aa] {ON} Anc_8.3...   204   4e-56
Sklu_YGOB_Anc_1.368 Chr4 complement(849414..850103,850105..85104...   199   5e-56
Skud_2.192 Chr2 complement(344951..346810) [1860 bp, 619 aa] {ON...   200   6e-56
SAKL0B08734g Chr2 complement(743379..745055) [1677 bp, 558 aa] {...   199   6e-56
KLTH0C05170g Chr3 (449510..451306) [1797 bp, 598 aa] {ON} simila...   199   8e-56
KLTH0C08052g Chr3 (685805..687604) [1800 bp, 599 aa] {ON} simila...   199   1e-55
KLLA0D16830g Chr4 (1426856..1429354) [2499 bp, 832 aa] {ON} simi...   202   2e-55
TPHA0A02500 Chr1 (533688..535460) [1773 bp, 590 aa] {ON} Anc_1.3...   198   2e-55
Kwal_26.8097 s26 (643310..644944) [1635 bp, 544 aa] {ON} YNL270C...   197   2e-55
TBLA0I02000 Chr9 complement(452716..454710) [1995 bp, 664 aa] {O...   199   4e-55
Ecym_2662 Chr2 complement(1275924..1277693) [1770 bp, 589 aa] {O...   197   6e-55
TBLA0G03120 Chr7 (825095..827116) [2022 bp, 673 aa] {ON}              198   7e-55
SAKL0H15092g Chr8 complement(1306212..1308764) [2553 bp, 850 aa]...   200   9e-55
NCAS0J00140 Chr10 complement(8478..10154) [1677 bp, 558 aa] {ON}      196   1e-54
SAKL0D04048g Chr4 (328883..330643) [1761 bp, 586 aa] {ON} simila...   196   1e-54
ZYRO0G07172g Chr7 complement(565863..567566) [1704 bp, 567 aa] {...   195   1e-54
ZYRO0G12342g Chr7 complement(976302..978164) [1863 bp, 620 aa] {...   196   2e-54
Suva_2.203 Chr2 complement(347891..349705) [1815 bp, 604 aa] {ON...   196   2e-54
TDEL0H04510 Chr8 complement(813321..815075) [1755 bp, 584 aa] {O...   195   3e-54
Kpol_2002.44 s2002 complement(89144..90370,90372..91028) [1884 b...   196   3e-54
Kwal_23.3847 s23 (457732..459471) [1740 bp, 579 aa] {ON} YBR132C...   195   3e-54
TBLA0C01210 Chr3 complement(260786..262588) [1803 bp, 600 aa] {O...   195   3e-54
KLTH0F11286g Chr6 (959314..961062) [1749 bp, 582 aa] {ON} simila...   195   3e-54
TPHA0A02450 Chr1 (522439..524190) [1752 bp, 583 aa] {ON} Anc_3.3...   194   4e-54
KLTH0G11726g Chr7 complement(986837..989311) [2475 bp, 824 aa] {...   198   4e-54
CAGL0M00154g Chr13 (22039..23691) [1653 bp, 550 aa] {ON} similar...   194   4e-54
TBLA0C02520 Chr3 (595918..597660) [1743 bp, 580 aa] {ON} Anc_3.3...   194   4e-54
Ecym_2716 Chr2 (1386630..1388408) [1779 bp, 592 aa] {ON} similar...   194   6e-54
TPHA0M01200 Chr13 complement(244556..246379) [1824 bp, 607 aa] {...   194   1e-53
Kpol_1052.14 s1052 (39793..41601) [1809 bp, 602 aa] {ON} (39793....   194   1e-53
KNAG0A05040 Chr1 complement(733928..736432) [2505 bp, 834 aa] {O...   197   1e-53
NDAI0A01340 Chr1 (296616..298280) [1665 bp, 554 aa] {ON}              192   2e-53
Ecym_4758 Chr4 (1474661..1476424) [1764 bp, 587 aa] {ON} similar...   193   2e-53
Kwal_34.16254 s34 (264235..265677) [1443 bp, 481 aa] {OFF} YOL02...   190   2e-53
Kwal_YGOB_34.16254 s34 (264235..265707) [1473 bp, 491 aa] {ON} A...   190   2e-53
NCAS0A00420 Chr1 complement(62649..64688) [2040 bp, 679 aa] {ON}...   194   2e-53
NDAI0A08190 Chr1 complement(1875783..1877543) [1761 bp, 586 aa] ...   192   2e-53
Smik_2.202 Chr2 complement(358478..360331) [1854 bp, 617 aa] {ON...   192   4e-53
KAFR0K01360 Chr11 complement(279140..280888) [1749 bp, 582 aa] {...   190   1e-52
Suva_4.308 Chr4 complement(543427..545283) [1857 bp, 618 aa] {ON...   191   1e-52
TBLA0F03240 Chr6 complement(790069..791826) [1758 bp, 585 aa] {O...   190   2e-52
KLLA0B06776g Chr2 (594172..595938) [1767 bp, 588 aa] {ON} simila...   189   3e-52
Suva_16.31 Chr16 (39282..41042) [1761 bp, 586 aa] {ON} YLL061W (...   189   3e-52
ZYRO0F17446g Chr6 (1451431..1453332) [1902 bp, 633 aa] {ON} simi...   190   4e-52
SAKL0A09724g Chr1 complement(855698..857353) [1656 bp, 551 aa] {...   188   4e-52
KLTH0H13398g Chr8 complement(1169665..1171428) [1764 bp, 587 aa]...   189   5e-52
NDAI0J00870 Chr10 complement(191679..194192) [2514 bp, 837 aa] {...   192   6e-52
TDEL0E00250 Chr5 (41958..43721) [1764 bp, 587 aa] {ON}                188   1e-51
Kwal_53.19461 s53 complement(2918..4615) [1698 bp, 565 aa] {ON} ...   187   1e-51
ADL272W Chr4 (227414..229108) [1695 bp, 564 aa] {ON} Non-synteni...   186   3e-51
TDEL0B00130 Chr2 (20136..21890) [1755 bp, 584 aa] {ON}                187   3e-51
KAFR0F02250 Chr6 (439217..440881) [1665 bp, 554 aa] {ON}              186   4e-51
Ecym_4230 Chr4 complement(478376..480949) [2574 bp, 857 aa] {ON}...   189   1e-50
YBR069C Chr2 complement(376574..378433) [1860 bp, 619 aa] {ON}  ...   185   2e-50
KLTH0D07128g Chr4 complement(624863..626494) [1632 bp, 543 aa] {...   184   2e-50
TPHA0A03960 Chr1 (877702..879549) [1848 bp, 615 aa] {ON}              185   2e-50
SAKL0H08184g Chr8 (704748..706544) [1797 bp, 598 aa] {ON} simila...   184   3e-50
YPL274W Chr16 (22938..24701) [1764 bp, 587 aa] {ON}  SAM3High-af...   184   4e-50
CAGL0E01089g Chr5 complement(96819..99380) [2562 bp, 853 aa] {ON...   186   6e-50
Skud_4.418 Chr4 (745597..748152) [2556 bp, 851 aa] {ON} YDR160W ...   186   7e-50
Kwal_56.22951 s56 complement(345097..346887) [1791 bp, 596 aa] {...   182   2e-49
KAFR0B00220 Chr2 complement(52244..54001) [1758 bp, 585 aa] {ON}      181   2e-49
Smik_6.483 Chr6 (798526..800298) [1773 bp, 590 aa] {ON} YPL274W ...   181   2e-49
Smik_4.404 Chr4 (734205..736763) [2559 bp, 852 aa] {ON} YDR160W ...   184   3e-49
NDAI0A07500 Chr1 complement(1715826..1717685) [1860 bp, 619 aa] ...   181   4e-49
YDR160W Chr4 (776163..778721) [2559 bp, 852 aa] {ON}  SSY1Compon...   184   6e-49
KAFR0F04410 Chr6 (865219..866961) [1743 bp, 580 aa] {ON}              180   7e-49
NCAS0B03380 Chr2 complement(589351..591888) [2538 bp, 845 aa] {O...   182   3e-48
ZYRO0D17952g Chr4 complement(1489975..1491732) [1758 bp, 585 aa]...   177   9e-48
TPHA0G03770 Chr7 complement(797508..799322) [1815 bp, 604 aa] {O...   176   3e-47
SAKL0H10890g Chr8 complement(940629..943046) [2418 bp, 805 aa] {...   176   3e-46
Suva_2.323 Chr2 (570119..572674) [2556 bp, 851 aa] {ON} YDR160W ...   176   3e-46
KLLA0F01012g Chr6 complement(90772..92442) [1671 bp, 556 aa] {ON...   172   4e-46
AGL171W Chr7 (377256..379811) [2556 bp, 851 aa] {ON} Syntenic ho...   167   2e-43
SAKL0B04554g Chr2 complement(401845..403461) [1617 bp, 538 aa] {...   161   2e-42
ZYRO0D09086g Chr4 complement(780326..781966) [1641 bp, 546 aa] {...   159   1e-41
KLLA0B09922g Chr2 complement(867748..870141) [2394 bp, 797 aa] {...   162   2e-41
KLTH0E11792g Chr5 (1047925..1050339) [2415 bp, 804 aa] {ON} simi...   162   2e-41
NCAS0I01520 Chr9 (284348..286192) [1845 bp, 614 aa] {ON}              158   5e-41
Kwal_YGOB_27.11900 s27 (994323..996518,996909..997118) [2406 bp,...   159   9e-41
KLTH0E00550g Chr5 (57109..58680) [1572 bp, 523 aa] {ON} similar ...   152   3e-39
Skud_51.1 Chr51 (364..1407) [1044 bp, 348 aa] {ON} YKR039W (REAL)     141   1e-36
Skud_7.4 Chr7 (9030..10079) [1050 bp, 349 aa] {ON} YKR039W (REAL)     141   1e-36
Kwal_27.11900 s27 (994323..996500) [2178 bp, 726 aa] {OFF} YDR16...   143   2e-35
Skud_47.1 Chr47 (1..987) [987 bp, 328 aa] {ON} YPL274W (REAL)         114   4e-27
Suva_78.1 Chr78 complement(3..695) [693 bp, 231 aa] {ON} YPL274W...   108   4e-26
Suva_84.1 Chr84 (1..639) [639 bp, 213 aa] {ON} YPL274W (REAL)          87   1e-18
Skud_30.1 Chr30 (3097..3933) [837 bp, 279 aa] {ON} YPL274W (REAL)      87   3e-18
Skud_16.3 Chr16 (4274..5350) [1077 bp, 358 aa] {ON} YPL274W (REAL)     87   1e-17
Skud_7.5 Chr7 (10082..10387) [306 bp, 102 aa] {ON} YKR039W (REAL)      68   3e-13
TDEL0C00100 Chr3 complement(1863..2399) [537 bp, 178 aa] {ON}          59   2e-09
NCAS0E01810 Chr5 complement(354074..354589) [516 bp, 171 aa] {ON...    57   7e-09
Suva_13.516 Chr13 complement(902560..903123,903176..903289) [678...    55   7e-08
Skud_7.6 Chr7 (10388..10840) [453 bp, 150 aa] {ON} YKR039W (REAL)      53   1e-07
NDAI0F04210 Chr6 (1018256..1018768) [513 bp, 170 aa] {ON}              51   8e-07
Skud_12.5 Chr12 (6025..6258,6262..6279,6283..6312,6359..6424,642...    35   0.32 
TPHA0A04703 Chr1 (1067266..1067586) [321 bp, 106 aa] {ON}              33   0.47 

>Kwal_33.15545 s33 complement(1149997..1151727) [1731 bp, 576 aa]
           {ON} YPL265W (DIP5) - dicarboxylic amino acid permease
           [contig 290] FULL
          Length = 576

 Score =  982 bits (2538), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 494/576 (85%), Positives = 494/576 (85%)

Query: 1   MNSDTSMEKKNAGVLYSNETLEEGIVTLESEGQVRSVSEGVDGKHEGIRLKKELEARHVS 60
           MNSDTSMEKKNAGVLYSNETLEEGIVTLESEGQVRSVSEGVDGKHEGIRLKKELEARHVS
Sbjct: 1   MNSDTSMEKKNAGVLYSNETLEEGIVTLESEGQVRSVSEGVDGKHEGIRLKKELEARHVS 60

Query: 61  MXXXXXXXXXXXXXXXXXXXXXXXPVSILISYSFVGLLVYTVMSCLGEMAAFIPLDGFTS 120
           M                       PVSILISYSFVGLLVYTVMSCLGEMAAFIPLDGFTS
Sbjct: 61  MIAIGGSLGTGLLIGTGSSLASAGPVSILISYSFVGLLVYTVMSCLGEMAAFIPLDGFTS 120

Query: 121 YASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVNPGVWITIFLALIV 180
           YASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVNPGVWITIFLALIV
Sbjct: 121 YASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVNPGVWITIFLALIV 180

Query: 181 LINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGFRFWRDPGAFKPY 240
           LINTVGVRFFGEFEFWLSSVK                   PNHDRTGFRFWRDPGAFKPY
Sbjct: 181 LINTVGVRFFGEFEFWLSSVKVLVMLGLILLLFIIMLGGGPNHDRTGFRFWRDPGAFKPY 240

Query: 241 SEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVVFY 300
           SEAISGSKGK              YTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVVFY
Sbjct: 241 SEAISGSKGKFVSFASVFALALFAYTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVVFY 300

Query: 301 VITILLLGMTVAYNDPRLLXXXXXXXXXXXXPFVVAIENASIPVLPHIFNVCVLVFVFSA 360
           VITILLLGMTVAYNDPRLL            PFVVAIENASIPVLPHIFNVCVLVFVFSA
Sbjct: 301 VITILLLGMTVAYNDPRLLKAKKMATSAAASPFVVAIENASIPVLPHIFNVCVLVFVFSA 360

Query: 361 CNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCLLAYMNVSSGSAQVF 420
           CNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCLLAYMNVSSGSAQVF
Sbjct: 361 CNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCLLAYMNVSSGSAQVF 420

Query: 421 NYFVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLSYTAAFQPWSTYVALFFCCLI 480
           NYFVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLSYTAAFQPWSTYVALFFCCLI
Sbjct: 421 NYFVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLSYTAAFQPWSTYVALFFCCLI 480

Query: 481 GLIKNYTVFLGHKFDYKTFISGYIGIPVYLICYVGYKVVYRTKLIKPEDVDLYTFKDAID 540
           GLIKNYTVFLGHKFDYKTFISGYIGIPVYLICYVGYKVVYRTKLIKPEDVDLYTFKDAID
Sbjct: 481 GLIKNYTVFLGHKFDYKTFISGYIGIPVYLICYVGYKVVYRTKLIKPEDVDLYTFKDAID 540

Query: 541 AXXXXXXXXXXXXXXNMENSPKNFKWFYETFLGWIF 576
           A              NMENSPKNFKWFYETFLGWIF
Sbjct: 541 AEEEEYKLLEKERLENMENSPKNFKWFYETFLGWIF 576

>KLTH0B01166g Chr2 (102227..103960) [1734 bp, 577 aa] {ON} similar
           to uniprot|P53388 Saccharomyces cerevisiae YPL265W DIP5
           Dicarboxylic amino acid permease mediates high-affinity
           and high-capacity transport of L- glutamate and
           L-aspartate also a transporter for Gln Asn Ser Ala and
           Gly
          Length = 577

 Score =  842 bits (2176), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 421/574 (73%), Positives = 453/574 (78%), Gaps = 3/574 (0%)

Query: 6   SMEKKNAGVLYSNETLEEGIVTLESE---GQVRSVSEGVDGKHEGIRLKKELEARHVSMX 62
           S+EKKNAG+LYSNETLEE +   + E       +    VDGKHEGIRLKK LEARHVSM 
Sbjct: 4   SLEKKNAGILYSNETLEEDVAFDKLERGASGASAAGASVDGKHEGIRLKKALEARHVSMI 63

Query: 63  XXXXXXXXXXXXXXXXXXXXXXPVSILISYSFVGLLVYTVMSCLGEMAAFIPLDGFTSYA 122
                                 P SILISYSFVGLLVYTVM+CLGEMAAFIPLDGFTSYA
Sbjct: 64  AIGGSLGTGLLIGTGSSLASAGPASILISYSFVGLLVYTVMACLGEMAAFIPLDGFTSYA 123

Query: 123 SRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVNPGVWITIFLALIVLI 182
           SRYVDPA+GFAVGY YLFKYFIVTPNQLTAGAMVMQ+WVSR++VNPGVWITIFL LIVLI
Sbjct: 124 SRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSREKVNPGVWITIFLVLIVLI 183

Query: 183 NTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGFRFWRDPGAFKPYSE 242
           NTVGVRFFGEFEFWLSSVK                   PNHDRTGFR+WRDPGAFKPYSE
Sbjct: 184 NTVGVRFFGEFEFWLSSVKVLVMLGLILLLFIIMLGGGPNHDRTGFRYWRDPGAFKPYSE 243

Query: 243 AISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVVFYVI 302
           AISGSKGK              YTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIV+FYVI
Sbjct: 244 AISGSKGKFVSFASVFALALFAYTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVLFYVI 303

Query: 303 TILLLGMTVAYNDPRLLXXXXXXXXXXXXPFVVAIENASIPVLPHIFNVCVLVFVFSACN 362
           +ILLLGMTVAYNDP L+            PFVVAI+NA IPVLPHIFN CVL+FVFSACN
Sbjct: 304 SILLLGMTVAYNDPLLIKAKKMSTSAAASPFVVAIKNAGIPVLPHIFNACVLLFVFSACN 363

Query: 363 SDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCLLAYMNVSSGSAQVFNY 422
           SDLYVASR+LYGLAID KAP+IFA TN WGVPYYSL +SVLFCLLAYMNVSSGSAQ+FNY
Sbjct: 364 SDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLFCLLAYMNVSSGSAQIFNY 423

Query: 423 FVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLSYTAAFQPWSTYVALFFCCLIGL 482
           FVNVVSIFGLLSWI+ILITY+RF KA+  QFGDKS  SYTA FQPWST+V+LFFCCLIGL
Sbjct: 424 FVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSYTAPFQPWSTWVSLFFCCLIGL 483

Query: 483 IKNYTVFLGHKFDYKTFISGYIGIPVYLICYVGYKVVYRTKLIKPEDVDLYTFKDAIDAX 542
           IKNYTVFLGH FDYKTFISGYIGIPVY ICYVGYK+V+R+KLIKPEDVDLYTFK AIDA 
Sbjct: 484 IKNYTVFLGHTFDYKTFISGYIGIPVYAICYVGYKLVHRSKLIKPEDVDLYTFKAAIDAE 543

Query: 543 XXXXXXXXXXXXXNMENSPKNFKWFYETFLGWIF 576
                         +++SPKN  WFY+TFLGWIF
Sbjct: 544 EEEGKLLELERKEQLKSSPKNLTWFYDTFLGWIF 577

>SAKL0G14916g Chr7 complement(1277225..1278970) [1746 bp, 581 aa]
           {ON} uniprot|Q875Q9 Saccharomyces kluyveri DIP5
          Length = 581

 Score =  729 bits (1881), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/575 (64%), Positives = 420/575 (73%), Gaps = 4/575 (0%)

Query: 6   SMEKKNAGVLYSNETLEEGIVTLESEGQVRSVSE----GVDGKHEGIRLKKELEARHVSM 61
           S  K    ++ ++ T  + +  L+   Q    S+     +DGKH+GIRLKKELEARHVSM
Sbjct: 7   SYRKDLEKIVSNSNTTSKDVENLDLSNQDDISSQESHLNIDGKHDGIRLKKELEARHVSM 66

Query: 62  XXXXXXXXXXXXXXXXXXXXXXXPVSILISYSFVGLLVYTVMSCLGEMAAFIPLDGFTSY 121
                                  PVSILI+YSFVG LVY VM+CLGEMA +IPLDGFTSY
Sbjct: 67  IAIGGSLGTGLLIGTGTSLSLAGPVSILIAYSFVGFLVYIVMTCLGEMATYIPLDGFTSY 126

Query: 122 ASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVNPGVWITIFLALIVL 181
           ASRY DPA+GFAVGYSYLFKY I+TPNQLTA A+V+Q+WVSR++VNPGVWITIFL +IV 
Sbjct: 127 ASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNPGVWITIFLVIIVT 186

Query: 182 INTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGFRFWRDPGAFKPYS 241
           IN VGV+FFGEFEFWLSS K                   P+HDR GFRF++DPGAF+PYS
Sbjct: 187 INVVGVKFFGEFEFWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGFRFYKDPGAFRPYS 246

Query: 242 EAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVVFYV 301
           EAISGSKGK              Y GTELCGIVAAE KNPRR+VPRAIKLTLYRIVVFY+
Sbjct: 247 EAISGSKGKFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPRAIKLTLYRIVVFYL 306

Query: 302 ITILLLGMTVAYNDPRLLXXXXXXXXXXXXPFVVAIENASIPVLPHIFNVCVLVFVFSAC 361
           +TI LLGMTVAYNDP LL            PFVVAI+NA IPVLPHIFN CVL+FVFSAC
Sbjct: 307 VTIFLLGMTVAYNDPLLLQAKKKSTSAAASPFVVAIKNAGIPVLPHIFNACVLMFVFSAC 366

Query: 362 NSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCLLAYMNVSSGSAQVFN 421
           NSDLYVASRSLYGLAID KAP+IFA TNKWGVPY SL L +LFCLLAYMNVSSGSAQVFN
Sbjct: 367 NSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLAYMNVSSGSAQVFN 426

Query: 422 YFVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLSYTAAFQPWSTYVALFFCCLIG 481
           YFVNVVSIFGL+SWI ILITYI FD+A+R Q  DKS+L+Y A       Y ALFFCCLI 
Sbjct: 427 YFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLASKGAYFALFFCCLIA 486

Query: 482 LIKNYTVFLGHKFDYKTFISGYIGIPVYLICYVGYKVVYRTKLIKPEDVDLYTFKDAIDA 541
           LIKN+TVFLGHKFDYK FI+GYIGIPV++IC+ GYK +  TK +KPE+ DLYTFK+ ID 
Sbjct: 487 LIKNFTVFLGHKFDYKNFITGYIGIPVFIICFFGYKYIRGTKFVKPEEADLYTFKELIDL 546

Query: 542 XXXXXXXXXXXXXXNMENSPKNFKWFYETFLGWIF 576
                          ME+SPKNFKWFYE FLGWIF
Sbjct: 547 EEEEGKLWDAAQKEKMESSPKNFKWFYEKFLGWIF 581

>Kpol_358.3 s358 (7369..9096) [1728 bp, 575 aa] {ON} (7369..9096)
           [1728 nt, 576 aa]
          Length = 575

 Score =  685 bits (1768), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 336/576 (58%), Positives = 416/576 (72%), Gaps = 6/576 (1%)

Query: 1   MNSDTSMEKKNAGVLYSNETLEEGIVTLESEGQVRSVSEGVDGKHEGIRLKKELEARHVS 60
           +  D+ + +++   L  N T    + + E E     +S   DGK +G+RLKKEL+ARH+S
Sbjct: 6   VTKDSKLIREDIIDLEKNTT--SSLNSFEQEDDSNKIS---DGKEDGVRLKKELKARHIS 60

Query: 61  MXXXXXXXXXXXXXXXXXXXXXXXPVSILISYSFVGLLVYTVMSCLGEMAAFIPLDGFTS 120
           M                       P SILI+YSFVG+LV+ VM+CLGEMA +IPLDGFTS
Sbjct: 61  MIAIGGSLGTGLLIGTGTALRTGGPASILIAYSFVGILVFFVMACLGEMATYIPLDGFTS 120

Query: 121 YASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVNPGVWITIFLALIV 180
           YA+RY DPA+GFAVGY YLFKYFI+TPNQLTAGA+V+Q+W+ R+ VNPGVWITIFL +IV
Sbjct: 121 YATRYCDPALGFAVGYCYLFKYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVIV 180

Query: 181 LINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGFRFWRDPGAFKPY 240
           +INTVGVR+FGEFEFWLSS K                   PNHDR GFR+W++PGAFKPY
Sbjct: 181 IINTVGVRYFGEFEFWLSSFKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKPY 240

Query: 241 SEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVVFY 300
           SE+I+GSKGK              Y G EL GIVAAEA+NPRR++PRAIKLT+YRI++FY
Sbjct: 241 SESITGSKGKFVSFVAVFVYALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRIILFY 300

Query: 301 VITILLLGMTVAYNDPRLLXXXXXXXXXXXXPFVVAIENASIPVLPHIFNVCVLVFVFSA 360
           ++TI LLGM VAYNDPRLL            PFVVAI+N+ +  LPHIFNVCVL+FVFSA
Sbjct: 301 IVTIFLLGMCVAYNDPRLLAAAHASTSAAASPFVVAIQNSGVRALPHIFNVCVLIFVFSA 360

Query: 361 CNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCLLAYMNVSSGSAQVF 420
           CNSDLYV +RSLY LAIDGKAP++FA TN+WGVPY +L    LFCLLAYMNVSSGSAQ+F
Sbjct: 361 CNSDLYVGTRSLYSLAIDGKAPKLFAKTNRWGVPYNALFGCFLFCLLAYMNVSSGSAQIF 420

Query: 421 NYFVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLSYTAAFQPWSTYVALFFCCLI 480
           NYFVNVVSIFG+LSWI+ILITYI F +A   Q  D++S +Y A FQP+  Y+ LFFC LI
Sbjct: 421 NYFVNVVSIFGILSWISILITYIFFYRACIAQNVDRNSFAYRAPFQPYGAYITLFFCVLI 480

Query: 481 GLIKNYTVFLGHKFDYKTFISGYIGIPVYLICYVGYKVVYRTKLIKPEDVDLYTFKDAID 540
             IKN+TVF+G +FDYK+FI+GYIG+P+Y+I Y GYK++Y+TKL+K E+ DLY+FK+AID
Sbjct: 481 AFIKNFTVFIG-EFDYKSFITGYIGLPLYVIFYFGYKIIYKTKLVKAEEADLYSFKEAID 539

Query: 541 AXXXXXXXXXXXXXXNMENSPKNFKWFYETFLGWIF 576
                           ++NS K+ KWFYE +LG+IF
Sbjct: 540 REEAEGKIKEAEAKERLKNSKKSLKWFYEKYLGYIF 575

>Suva_16.40 Chr16 (56664..58484) [1821 bp, 606 aa] {ON} YPL265W
           (REAL)
          Length = 606

 Score =  681 bits (1757), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 333/535 (62%), Positives = 393/535 (73%)

Query: 42  DGKHEGIRLKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILISYSFVGLLVYT 101
           DGK E  RL+K+L+ARH+SM                       PVS+LI+Y FVGLLV+ 
Sbjct: 72  DGKDETTRLRKDLKARHISMIAIGGSLGTGLLIGTGTALLTGGPVSMLIAYGFVGLLVFF 131

Query: 102 VMSCLGEMAAFIPLDGFTSYASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWV 161
            M+CLGEMA++IPLDGFTSYASRYVDPA+GFA+GY+YLFKYFI+ PNQLTA A+V+Q+WV
Sbjct: 132 TMACLGEMASYIPLDGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWV 191

Query: 162 SRDRVNPGVWITIFLALIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXP 221
           SRDRVNPGVWITIFL +IV IN VGVRFFGEFEFWLSS K                   P
Sbjct: 192 SRDRVNPGVWITIFLVVIVAINIVGVRFFGEFEFWLSSFKVMVMLGLILLLFIIMLGGGP 251

Query: 222 NHDRTGFRFWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNP 281
           +HDR GFR+WRDPGAFK YS AI+GSKGK              YTG EL GIV +EAKNP
Sbjct: 252 DHDRLGFRYWRDPGAFKEYSTAITGSKGKFVAFASVFVYSLFSYTGIELTGIVCSEAKNP 311

Query: 282 RRSVPRAIKLTLYRIVVFYVITILLLGMTVAYNDPRLLXXXXXXXXXXXXPFVVAIENAS 341
           R+SVP+AIKLT+YRI+VFY+ T+ LLGM VAYNDPRLL            PFVVAI+N+ 
Sbjct: 312 RKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKAMSAAASPFVVAIQNSG 371

Query: 342 IPVLPHIFNVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLS 401
           I VLPHIFN CVLVFVFSACNSDLYV+SR+LY LAIDGKAP+IFA T+KWGVPYY+L +S
Sbjct: 372 IKVLPHIFNGCVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYYALMVS 431

Query: 402 VLFCLLAYMNVSSGSAQVFNYFVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLSY 461
           VLFC LAYMNVS+GSA++FNYFVNVVS+FG+LSWITILI YI FD+A R Q  DKS  +Y
Sbjct: 432 VLFCCLAYMNVSAGSAKIFNYFVNVVSMFGILSWITILIVYIYFDRACRAQGVDKSKFAY 491

Query: 462 TAAFQPWSTYVALFFCCLIGLIKNYTVFLGHKFDYKTFISGYIGIPVYLICYVGYKVVYR 521
            A  Q +  Y ALFFC LI LIKN+TVFLGH FDYKTFI+GYIG+P+Y+  +VGYK++Y+
Sbjct: 492 VAPGQRYGAYFALFFCILIALIKNFTVFLGHTFDYKTFITGYIGLPIYVFSWVGYKLIYK 551

Query: 522 TKLIKPEDVDLYTFKDAIDAXXXXXXXXXXXXXXNMENSPKNFKWFYETFLGWIF 576
           TK++KP D DLYT K+  D                ++ + KN +WFYE FLG IF
Sbjct: 552 TKVVKPADADLYTLKEIYDREEEQGKLQDQEKEERLQRNGKNLEWFYEKFLGNIF 606

>YPL265W Chr16 (41043..42869) [1827 bp, 608 aa] {ON}
           DIP5Dicarboxylic amino acid permease, mediates
           high-affinity and high-capacity transport of L-glutamate
           and L-aspartate; also a transporter for Gln, Asn, Ser,
           Ala, and Gly
          Length = 608

 Score =  680 bits (1755), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 334/535 (62%), Positives = 395/535 (73%)

Query: 42  DGKHEGIRLKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILISYSFVGLLVYT 101
           DGK E  RL+K+L+ARH+SM                       PV++LI+Y+FVGLLV+ 
Sbjct: 74  DGKDENTRLRKDLKARHISMIAIGGSLGTGLLIGTGTALLTGGPVAMLIAYAFVGLLVFY 133

Query: 102 VMSCLGEMAAFIPLDGFTSYASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWV 161
            M+CLGEMA++IPLDGFTSYASRYVDPA+GFA+GY+YLFKYFI+ PNQLTA A+V+Q+W+
Sbjct: 134 TMACLGEMASYIPLDGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWI 193

Query: 162 SRDRVNPGVWITIFLALIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXP 221
           SRDRVNPGVWITIFL +IV IN VGV+FFGEFEFWLSS K                   P
Sbjct: 194 SRDRVNPGVWITIFLVVIVAINVVGVKFFGEFEFWLSSFKVMVMLGLILLLFIIMLGGGP 253

Query: 222 NHDRTGFRFWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNP 281
           NHDR GFR+WRDPGAFK YS AI+G KGK              YTG EL GIV +EA+NP
Sbjct: 254 NHDRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAENP 313

Query: 282 RRSVPRAIKLTLYRIVVFYVITILLLGMTVAYNDPRLLXXXXXXXXXXXXPFVVAIENAS 341
           R+SVP+AIKLT+YRI+VFY+ T+ LLGM VAYNDPRLL            PFVVAI+N+ 
Sbjct: 314 RKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSG 373

Query: 342 IPVLPHIFNVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLS 401
           I VLPHIFN CVLVFVFSACNSDLYV+SR+LY LAIDGKAP+IFA T++WGVPY +L LS
Sbjct: 374 IEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALILS 433

Query: 402 VLFCLLAYMNVSSGSAQVFNYFVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLSY 461
           VLFC LAYMNVSSGSA++FNYFVNVVS+FG+LSWITILI YI FDKA R Q  DKS  +Y
Sbjct: 434 VLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAY 493

Query: 462 TAAFQPWSTYVALFFCCLIGLIKNYTVFLGHKFDYKTFISGYIGIPVYLICYVGYKVVYR 521
            A  Q +  Y ALFFC LI LIKN+TVFLGHKFDYKTFI+GYIG+PVY+I + GYK++Y+
Sbjct: 494 VAPGQRYGAYFALFFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYIISWAGYKLIYK 553

Query: 522 TKLIKPEDVDLYTFKDAIDAXXXXXXXXXXXXXXNMENSPKNFKWFYETFLGWIF 576
           TK+IK  DVDLYTFK+  D                ++++ KN +WFYE FLG IF
Sbjct: 554 TKVIKSTDVDLYTFKEIYDREEEEGRMKDQEKEERLKSNGKNMEWFYEKFLGNIF 608

>Smik_6.473 Chr6 complement(778327..780147) [1821 bp, 606 aa] {ON}
           YPL265W (REAL)
          Length = 606

 Score =  679 bits (1752), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 334/535 (62%), Positives = 393/535 (73%)

Query: 42  DGKHEGIRLKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILISYSFVGLLVYT 101
           DGK E  RLKKEL+ARH+SM                       PV++LI+Y+FVGLLV+ 
Sbjct: 72  DGKDENTRLKKELKARHISMIAIGGSLGTGLLIGTGTALLTGGPVAMLIAYAFVGLLVFF 131

Query: 102 VMSCLGEMAAFIPLDGFTSYASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWV 161
            M+CLGEMA++IPLDGFTSYASRYVDPA+GFA+GY+YLFKYFI+ PNQLTA A+V+Q+W+
Sbjct: 132 TMACLGEMASYIPLDGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWI 191

Query: 162 SRDRVNPGVWITIFLALIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXP 221
           SRDRVNPGVWITIFL +IV IN VGV+FFGEFEFWLSS K                   P
Sbjct: 192 SRDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKVMVMLGLILLLFIIMLGGGP 251

Query: 222 NHDRTGFRFWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNP 281
           +HDR GFR+WRDPGAFK YS AI+GS GK              YTG EL GIV +EA+NP
Sbjct: 252 DHDRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAENP 311

Query: 282 RRSVPRAIKLTLYRIVVFYVITILLLGMTVAYNDPRLLXXXXXXXXXXXXPFVVAIENAS 341
           R+SVP+AIKLT+YRI+VFY+ T+ LLGM VAYNDPRLL            PFVVAI+N+ 
Sbjct: 312 RKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSG 371

Query: 342 IPVLPHIFNVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLS 401
           I VLPHIFN CVLVFVFSACNSDLYV+SR+LY LAIDGKAP+IFA T+KWGVPY +L LS
Sbjct: 372 IKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALILS 431

Query: 402 VLFCLLAYMNVSSGSAQVFNYFVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLSY 461
           VLFC LAYMNVSSGSA++FNYFVNVVS+FG+LSWITILI YI FDKA R Q  DKS  +Y
Sbjct: 432 VLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAY 491

Query: 462 TAAFQPWSTYVALFFCCLIGLIKNYTVFLGHKFDYKTFISGYIGIPVYLICYVGYKVVYR 521
            A  Q +  Y AL FC LI LIKN+TVFLGHKFDYKTFI+GYIG+PVY++ + GYK++Y+
Sbjct: 492 VAPGQRYGAYFALSFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYILSWAGYKLIYK 551

Query: 522 TKLIKPEDVDLYTFKDAIDAXXXXXXXXXXXXXXNMENSPKNFKWFYETFLGWIF 576
           TK+IK  DVDLYTFK+  D                ++ + KN +WFYE FLG IF
Sbjct: 552 TKVIKSTDVDLYTFKEIYDREEEEGRIKDQEREERLQRNGKNMEWFYEKFLGRIF 606

>NDAI0I02660 Chr9 complement(619959..621743) [1785 bp, 594 aa] {ON} 
          Length = 594

 Score =  673 bits (1737), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/559 (58%), Positives = 397/559 (71%), Gaps = 2/559 (0%)

Query: 18  NETLEEGIVTLESEGQVRSVSEGVDGKHEGIRLKKELEARHVSMXXXXXXXXXXXXXXXX 77
           N+ LE  I +  S+ +  + S  +DGK EG RLKK L+ARHVSM                
Sbjct: 38  NDDLERNISSASSQDE--NDSYNIDGKTEGTRLKKALKARHVSMIAIGGSLGTGLLIGTG 95

Query: 78  XXXXXXXPVSILISYSFVGLLVYTVMSCLGEMAAFIPLDGFTSYASRYVDPAVGFAVGYS 137
                  PVS LI+Y+FVGLLV+  M+CLGEMA +IPLDGFTSYASRY DPA+GFAVGY+
Sbjct: 96  TSLALAGPVSTLIAYAFVGLLVFFTMACLGEMATYIPLDGFTSYASRYCDPALGFAVGYA 155

Query: 138 YLFKYFIVTPNQLTAGAMVMQFWVSRDRVNPGVWITIFLALIVLINTVGVRFFGEFEFWL 197
           YLFKYFI+ PNQLTA A+V+Q+WV +++VNPGVW+TIFL +IV IN  GVRFFGEFEFWL
Sbjct: 156 YLFKYFILPPNQLTAAALVIQYWVDKEKVNPGVWVTIFLVVIVSINVFGVRFFGEFEFWL 215

Query: 198 SSVKXXXXXXXXXXXXXXXXXXXPNHDRTGFRFWRDPGAFKPYSEAISGSKGKXXXXXXX 257
           SS K                   P+HDR GFR+WR PG+FK YSE I+G  G+       
Sbjct: 216 SSFKVLVMLGLMLLLFILMLGGGPDHDRLGFRYWRHPGSFKEYSETITGDTGRFVAFVSV 275

Query: 258 XXXXXXXYTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVVFYVITILLLGMTVAYNDPR 317
                  Y G EL GIVAAEA+NPR+S+P+AIKLT+YRIV+FY+I+I LLGM VAY+DP 
Sbjct: 276 FVYATYAYLGIELTGIVAAEAQNPRKSIPKAIKLTMYRIVIFYLISIFLLGMCVAYDDPL 335

Query: 318 LLXXXXXXXXXXXXPFVVAIENASIPVLPHIFNVCVLVFVFSACNSDLYVASRSLYGLAI 377
           L+            PFVVAI N+ I  LPHI N CVLVFVFSACNSDLYV+SRSLY LAI
Sbjct: 336 LIKAKNSSTSAAASPFVVAIINSGINALPHIINACVLVFVFSACNSDLYVSSRSLYSLAI 395

Query: 378 DGKAPRIFATTNKWGVPYYSLGLSVLFCLLAYMNVSSGSAQVFNYFVNVVSIFGLLSWIT 437
           D KAP+IFA TN+WG+PYY+L +SVLFCLLAYM VSS SA++FNYFVNVVSIFG+LSWI+
Sbjct: 396 DNKAPKIFAKTNRWGIPYYALSVSVLFCLLAYMCVSSASAKIFNYFVNVVSIFGILSWIS 455

Query: 438 ILITYIRFDKAIRVQFGDKSSLSYTAAFQPWSTYVALFFCCLIGLIKNYTVFLGHKFDYK 497
           ILITYI FD+A+R Q  DKS+ +Y A FQP+  + +LFFCCLI LIKN+TVFL H+FDYK
Sbjct: 456 ILITYICFDRAVRAQGVDKSTFAYVAPFQPYGAWFSLFFCCLIALIKNFTVFLNHQFDYK 515

Query: 498 TFISGYIGIPVYLICYVGYKVVYRTKLIKPEDVDLYTFKDAIDAXXXXXXXXXXXXXXNM 557
            FI+GYIG+PV+  CY GYK  Y+TK+I P  VDLYTFK AID                +
Sbjct: 516 NFITGYIGLPVFFFCYFGYKFTYKTKVIDPLKVDLYTFKAAIDQEEEDGKMADAEKAERI 575

Query: 558 ENSPKNFKWFYETFLGWIF 576
           + + KNF+WFY+ FLG IF
Sbjct: 576 KQNGKNFEWFYDKFLGNIF 594

>Skud_16.12 Chr16 (20144..21967) [1824 bp, 607 aa] {ON} YPL265W
           (REAL)
          Length = 607

 Score =  673 bits (1736), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 337/564 (59%), Positives = 400/564 (70%), Gaps = 5/564 (0%)

Query: 18  NETLEEGIVTLESEG----QVRSVSEGV-DGKHEGIRLKKELEARHVSMXXXXXXXXXXX 72
           N  LEE  V+  S        R  S  V DGK E  RL+K+L+ARH+SM           
Sbjct: 44  NIDLEENNVSSRSSTFTSPSARDDSFAVPDGKDETTRLRKDLKARHISMIAIGGSLGTGL 103

Query: 73  XXXXXXXXXXXXPVSILISYSFVGLLVYTVMSCLGEMAAFIPLDGFTSYASRYVDPAVGF 132
                       PV++LI+Y+FVGLLV+  M+CLGEMA++IPLDGFTSYASRYVDPA+GF
Sbjct: 104 LIGTGTALMTGGPVAMLIAYAFVGLLVFFTMACLGEMASYIPLDGFTSYASRYVDPALGF 163

Query: 133 AVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVNPGVWITIFLALIVLINTVGVRFFGE 192
           A+GY+YLFKYFI+ PNQLTA A+V+Q+WVSRDRVNPGVWITIF+ +IV IN +GV+FFGE
Sbjct: 164 AIGYTYLFKYFILPPNQLTAAALVIQYWVSRDRVNPGVWITIFMVVIVAINVIGVKFFGE 223

Query: 193 FEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGFRFWRDPGAFKPYSEAISGSKGKXX 252
           FEFWLSS K                   P+HDR GFR+WRDPGAFK YS AI G KGK  
Sbjct: 224 FEFWLSSFKVLVMLGLILLLFIIMLGGGPDHDRLGFRYWRDPGAFKEYSAAIGGGKGKFV 283

Query: 253 XXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVVFYVITILLLGMTVA 312
                       YTG EL GIV +EA+NPR+SVP+AIKLT+YRI+VFY+ T+ LLGM VA
Sbjct: 284 SFLAVFVYSLFSYTGIELTGIVCSEAQNPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVA 343

Query: 313 YNDPRLLXXXXXXXXXXXXPFVVAIENASIPVLPHIFNVCVLVFVFSACNSDLYVASRSL 372
           YNDPRL+            PFVVAI+N+ I VLPHIFN CVLVFVFSACNSDLYV+SR+L
Sbjct: 344 YNDPRLISTKGKALSAAASPFVVAIQNSGIKVLPHIFNACVLVFVFSACNSDLYVSSRNL 403

Query: 373 YGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCLLAYMNVSSGSAQVFNYFVNVVSIFGL 432
           Y LAIDGKAP+IF+ TNKWGVPY +L  SVLFC LAYMNVS+GSA++FNYFVNVVS+FG+
Sbjct: 404 YALAIDGKAPKIFSKTNKWGVPYNALIFSVLFCCLAYMNVSAGSAKIFNYFVNVVSMFGI 463

Query: 433 LSWITILITYIRFDKAIRVQFGDKSSLSYTAAFQPWSTYVALFFCCLIGLIKNYTVFLGH 492
           LSWITILI YI FDKA R Q  DKS  +Y A  Q +  Y AL FC  I LIKN+TVFLGH
Sbjct: 464 LSWITILIVYIYFDKACRAQGIDKSKFAYVAPGQRYGAYFALVFCIFIALIKNFTVFLGH 523

Query: 493 KFDYKTFISGYIGIPVYLICYVGYKVVYRTKLIKPEDVDLYTFKDAIDAXXXXXXXXXXX 552
           KFDYKTFI+GYIG+PVY+  +VGYK++Y+TK+IK  DVDLYTFK+  D            
Sbjct: 524 KFDYKTFITGYIGLPVYVFSWVGYKLIYKTKVIKSTDVDLYTFKEIYDREEEQGKIEDQE 583

Query: 553 XXXNMENSPKNFKWFYETFLGWIF 576
               ++ + KN +WFYE FLG IF
Sbjct: 584 KEERLKKNGKNMEWFYEKFLGHIF 607

>NCAS0D02260 Chr4 (421966..423759) [1794 bp, 597 aa] {ON} 
          Length = 597

 Score =  672 bits (1733), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 335/559 (59%), Positives = 400/559 (71%), Gaps = 1/559 (0%)

Query: 18  NETLEEGIVTLESEGQVRSVSEGVDGKHEGIRLKKELEARHVSMXXXXXXXXXXXXXXXX 77
           ++ LE  I +L +  + ++ S  VDGK EG RLKK LE R VSM                
Sbjct: 40  HDDLENNI-SLSTSAEDQNDSYNVDGKTEGTRLKKVLEGRVVSMVAIGGSLGTGLLIGTG 98

Query: 78  XXXXXXXPVSILISYSFVGLLVYTVMSCLGEMAAFIPLDGFTSYASRYVDPAVGFAVGYS 137
                  PVS+LI+Y+FVGLLV+  M+ LGEMA++IPLDGFTSYA+RY DPA+GFAVGY 
Sbjct: 99  NSLATAGPVSMLIAYAFVGLLVFFTMASLGEMASYIPLDGFTSYATRYADPALGFAVGYC 158

Query: 138 YLFKYFIVTPNQLTAGAMVMQFWVSRDRVNPGVWITIFLALIVLINTVGVRFFGEFEFWL 197
           YLFKYFI+ PNQLTA A+V+Q+W+ R++VNPGVWITIFL +IV INT+GV+FFGEFEFWL
Sbjct: 159 YLFKYFILPPNQLTAAALVIQYWIPREKVNPGVWITIFLVVIVAINTLGVQFFGEFEFWL 218

Query: 198 SSVKXXXXXXXXXXXXXXXXXXXPNHDRTGFRFWRDPGAFKPYSEAISGSKGKXXXXXXX 257
           SS K                   PNHDR GFR W+ PGAF  YS AI+G  GK       
Sbjct: 219 SSFKVLVMFALIILLFILMLGGGPNHDRLGFRHWKHPGAFNNYSPAITGDTGKFVAFVSV 278

Query: 258 XXXXXXXYTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVVFYVITILLLGMTVAYNDPR 317
                  Y GTEL GIV  EA+NPR+SVP+AIKLT+YRI++FY+I+ILLLGM V Y+DP 
Sbjct: 279 FVYATFAYLGTELVGIVVGEARNPRKSVPKAIKLTMYRIIIFYLISILLLGMCVGYDDPL 338

Query: 318 LLXXXXXXXXXXXXPFVVAIENASIPVLPHIFNVCVLVFVFSACNSDLYVASRSLYGLAI 377
           LL            PFVVAI N+ I VLPHIFN CVLVFVFSACNSDLYVASRSLY LAI
Sbjct: 339 LLEAKTKSTSAAASPFVVAIVNSGIKVLPHIFNACVLVFVFSACNSDLYVASRSLYSLAI 398

Query: 378 DGKAPRIFATTNKWGVPYYSLGLSVLFCLLAYMNVSSGSAQVFNYFVNVVSIFGLLSWIT 437
           D KAP+IFA TN+WG+PYYSLGLSVLFCLLAYM+VSSGSA++FNYFVNVVSIFGLLSWI 
Sbjct: 399 DNKAPKIFARTNRWGIPYYSLGLSVLFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWIC 458

Query: 438 ILITYIRFDKAIRVQFGDKSSLSYTAAFQPWSTYVALFFCCLIGLIKNYTVFLGHKFDYK 497
           IL+TY+ FD+A+R Q  DKS+ SY A  Q +  Y ALFFC LI LIKN+TVFLGH+FDYK
Sbjct: 459 ILVTYLAFDRAVRAQGIDKSTFSYVAPGQRYGAYFALFFCSLIALIKNFTVFLGHQFDYK 518

Query: 498 TFISGYIGIPVYLICYVGYKVVYRTKLIKPEDVDLYTFKDAIDAXXXXXXXXXXXXXXNM 557
           TFI+GYIGIPV+ I Y GYK++Y+TK+I P +VDLYTFK AID                +
Sbjct: 519 TFITGYIGIPVFFISYFGYKLIYKTKIIDPLEVDLYTFKAAIDQEEEDGKLEDIARKERI 578

Query: 558 ENSPKNFKWFYETFLGWIF 576
           + + +NF+WFY+ FL  IF
Sbjct: 579 KANGRNFEWFYDKFLSNIF 597

>Ecym_2480 Chr2 complement(940315..942075) [1761 bp, 586 aa] {ON}
           similar to Ashbya gossypii ACL135W
          Length = 586

 Score =  667 bits (1720), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/542 (60%), Positives = 390/542 (71%), Gaps = 2/542 (0%)

Query: 37  VSEGVDGKHEGIRLKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILISYSFVG 96
           V  G DGKH+GIRLKK+L+ARHVSM                       P++ILI+YS +G
Sbjct: 45  VDWGYDGKHKGIRLKKDLQARHVSMIAIGGSLGTGLLIGTGSALSQAGPIAILIAYSIMG 104

Query: 97  LLVYTVMSCLGEMAAFIPLDGFTSYASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMV 156
            +V+TVMSCLGEMAA+IPLDGFTSYA+RY DPA+GFAVGY+YLFKY ++TPNQLTA A+V
Sbjct: 105 WVVFTVMSCLGEMAAYIPLDGFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALV 164

Query: 157 MQFWVSRDRVNPGVWITIFLALIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXX 216
           MQ+WV R +VNPGVWIT+FLA+I+ IN VGV+FFGEFEFWLSS K               
Sbjct: 165 MQYWVGRGKVNPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKVLVMLCVMTLLLVLV 224

Query: 217 XXXXPNHDRTGFRFWRDPGAFKPYSEAIS--GSKGKXXXXXXXXXXXXXXYTGTELCGIV 274
               P+H+R GFR+W+DPG FKPYS A+S  G KGK              Y GTELCGIV
Sbjct: 225 LGGGPSHNRLGFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIV 284

Query: 275 AAEAKNPRRSVPRAIKLTLYRIVVFYVITILLLGMTVAYNDPRLLXXXXXXXXXXXXPFV 334
           AAE KNPRR+VPRAIKLTLYRIVVFY+ T+ LLG++VAYNDP LL            P+V
Sbjct: 285 AAECKNPRRNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQTKKAKTSAAASPYV 344

Query: 335 VAIENASIPVLPHIFNVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVP 394
           VAI+NA IPVLPHIFN CVL FVFSACNSDLYV SRSLYGLAID KAP+IFA TN WGVP
Sbjct: 345 VAIKNAGIPVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVP 404

Query: 395 YYSLGLSVLFCLLAYMNVSSGSAQVFNYFVNVVSIFGLLSWITILITYIRFDKAIRVQFG 454
           Y SL L  LFC LAYMNVSS +  +F+YFVNV SIFGLLSWI+ILITYI FD+A RVQ  
Sbjct: 405 YNSLALCTLFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGI 464

Query: 455 DKSSLSYTAAFQPWSTYVALFFCCLIGLIKNYTVFLGHKFDYKTFISGYIGIPVYLICYV 514
           DK++LSY A FQP + ++AL FC ++ L+KN+TVFLG  FDYKTFI+GYIGIPVY++C+V
Sbjct: 465 DKNTLSYQAPFQPVTAWIALGFCLMVALVKNFTVFLGDTFDYKTFITGYIGIPVYILCFV 524

Query: 515 GYKVVYRTKLIKPEDVDLYTFKDAIDAXXXXXXXXXXXXXXNMENSPKNFKWFYETFLGW 574
            YK+V++TK IK  +VDL+T+K AID                 +     +K FY+   GW
Sbjct: 525 CYKIVHKTKWIKSANVDLFTYKTAIDLEEEEGKLEMMRLKEERKQHGWTWKQFYDYIFGW 584

Query: 575 IF 576
           IF
Sbjct: 585 IF 586

>KLLA0E16281g Chr5 (1455271..1457088) [1818 bp, 605 aa] {ON} similar
           to uniprot|P53388 Saccharomyces cerevisiae YPL265W DIP5
           Dicarboxylic amino acid permease mediates high-affinity
           and high-capacity transport of L-glutamate and
           L-aspartate also a transporter for Gln Asn Ser Ala and
           Gly
          Length = 605

 Score =  654 bits (1688), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/572 (56%), Positives = 399/572 (69%), Gaps = 9/572 (1%)

Query: 4   DTSMEKKNAGVLYSNETLEEGIVTLESEGQVRSVSEGVDGKHEGIRLKKELEARHVSMXX 63
           D   + K  G+   + +  + +VT  SE          DGKH+GIRLKK LEARHVSM  
Sbjct: 42  DGQSDSKVHGITSGHGSDVKNVVTHTSE---------FDGKHDGIRLKKALEARHVSMIA 92

Query: 64  XXXXXXXXXXXXXXXXXXXXXPVSILISYSFVGLLVYTVMSCLGEMAAFIPLDGFTSYAS 123
                                P +ILI+Y+FVGLLV+ VMSCLGEMAA+IPLDGFTSY++
Sbjct: 93  IGGSLGTGLLIGTGSSLALAGPAAILIAYAFVGLLVFFVMSCLGEMAAYIPLDGFTSYST 152

Query: 124 RYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVNPGVWITIFLALIVLIN 183
           RY DPA+GFAVGY+YLFKY+I+ PNQLTAGA+V+Q+WV RD+VNPGVWITI L  I+ IN
Sbjct: 153 RYADPALGFAVGYAYLFKYWIIVPNQLTAGALVIQYWVDRDKVNPGVWITILLVAIITIN 212

Query: 184 TVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGFRFWRDPGAFKPYSEA 243
            +GVRFFGE E+++S+VK                   PNH+  GF++W++PGAFK YS A
Sbjct: 213 FLGVRFFGEIEYYISAVKITVMLGLIILLLVLACGGGPNHEVLGFKYWKNPGAFKEYSTA 272

Query: 244 ISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVVFYVIT 303
           I+G+KG+              Y GTELCGIV +E KNPR++VP+AIKLT+YRI+VFY+I+
Sbjct: 273 ITGAKGRFVSFASVFVLALFAYLGTELCGIVVSECKNPRKAVPKAIKLTMYRIIVFYLIS 332

Query: 304 ILLLGMTVAYNDPRLLXXXXXXXXXXXXPFVVAIENASIPVLPHIFNVCVLVFVFSACNS 363
           I LLGM V +NDP L+            PFVVAI NA IPVLPHI N C+L+FVFSA NS
Sbjct: 333 IFLLGMCVPFNDPLLISAKSAKTSASASPFVVAIVNAGIPVLPHIMNACILIFVFSAANS 392

Query: 364 DLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCLLAYMNVSSGSAQVFNYF 423
           DLYVASRSLYGLAID KAPRIFA TNK GVPY+SL + VLF LLAYMNVSSGS++VF YF
Sbjct: 393 DLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYWSLLVGVLFALLAYMNVSSGSSEVFTYF 452

Query: 424 VNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLSYTAAFQPWSTYVALFFCCLIGLI 483
           VN VSIFGLLSWI+ILITYIRFDKA RVQ  DKS+L+Y +  QP+  + +LFFC LIGLI
Sbjct: 453 VNCVSIFGLLSWISILITYIRFDKAFRVQGIDKSTLAYQSPLQPYGAWFSLFFCILIGLI 512

Query: 484 KNYTVFLGHKFDYKTFISGYIGIPVYLICYVGYKVVYRTKLIKPEDVDLYTFKDAIDAXX 543
           KN+  FLG  FDYK+FI+GYIGIP Y+I Y+GYK+ Y+TK+I  E+VDL +FK+A+D   
Sbjct: 513 KNFPAFLGDTFDYKSFITGYIGIPTYIISYIGYKLWYKTKIIPSEEVDLVSFKEAVDLEE 572

Query: 544 XXXXXXXXXXXXNMENSPKNFKWFYETFLGWI 575
                       ++    K+ KW YE   GW+
Sbjct: 573 EEGKMLDEERAAHLAAHGKDLKWCYEKIFGWV 604

>TPHA0M00130 Chr13 complement(25769..27604) [1836 bp, 611 aa] {ON} 
          Length = 611

 Score =  650 bits (1676), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/539 (58%), Positives = 390/539 (72%), Gaps = 3/539 (0%)

Query: 41  VDGKHEGIRLKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILISYSFVGLLVY 100
           +DGK +G RLKK+L+ARH+SM                       P SILI+Y+FVG LV+
Sbjct: 73  MDGKDDGTRLKKDLKARHISMIAIGGSLGTGLLIGTGTALRTAGPASILIAYTFVGTLVF 132

Query: 101 TVMSCLGEMAAFIPLDGFTSYASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFW 160
             M+ LGEMAA+IPLDGFTSYASRY DPA+GFAVGYSYLFKYFI+TPNQLTA A+V+Q+W
Sbjct: 133 FTMAALGEMAAYIPLDGFTSYASRYCDPALGFAVGYSYLFKYFIITPNQLTAAALVIQYW 192

Query: 161 VSRDRVNPGVWITIFLALIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXX 220
           V RD VNPGVWITIFL +I+ INT+GV++FGEFEFWLSS K                   
Sbjct: 193 VDRDTVNPGVWITIFLVVIIAINTIGVKYFGEFEFWLSSFKIMVMIGVMIFLFVIMLGGG 252

Query: 221 PNHDRTGFRFWRDPGAFKPYSEA---ISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAE 277
           PNHDR GFR+W+ PGAFKPYS +   I GS GK              Y G EL GIVAAE
Sbjct: 253 PNHDRLGFRYWKTPGAFKPYSSSVVNIEGSTGKFVAFVNVFVYALFAYLGIELTGIVAAE 312

Query: 278 AKNPRRSVPRAIKLTLYRIVVFYVITILLLGMTVAYNDPRLLXXXXXXXXXXXXPFVVAI 337
           A+NPRR++PRAIKLT++RI+ FYV TI LLGM VAY+DP LL            PFVVAI
Sbjct: 313 AENPRRNIPRAIKLTVWRILFFYVATIFLLGMCVAYDDPLLLAAANAQTSAAASPFVVAI 372

Query: 338 ENASIPVLPHIFNVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYS 397
           +N+ + VLPHIFNVCVL+FVFSACNSDLYV +RSLY LA+DGKAP+IFA TN+WGVPY +
Sbjct: 373 QNSGVDVLPHIFNVCVLMFVFSACNSDLYVGTRSLYSLAVDGKAPKIFAKTNRWGVPYNA 432

Query: 398 LGLSVLFCLLAYMNVSSGSAQVFNYFVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKS 457
           +G  VLFCLLAYMNVSSGSA++FNYFVNVVSIFG+LSW +ILIT+I FD+A+R Q  D+S
Sbjct: 433 MGGCVLFCLLAYMNVSSGSAEIFNYFVNVVSIFGVLSWSSILITFIYFDRAVRAQGIDRS 492

Query: 458 SLSYTAAFQPWSTYVALFFCCLIGLIKNYTVFLGHKFDYKTFISGYIGIPVYLICYVGYK 517
           + +Y A FQP+ +Y ALFFC L+ LIKN++VFLG++FDYKTFI+GYIG+PVY   ++GYK
Sbjct: 493 TFAYVAPFQPYGSYFALFFCVLLALIKNFSVFLGNEFDYKTFITGYIGLPVYAFSFIGYK 552

Query: 518 VVYRTKLIKPEDVDLYTFKDAIDAXXXXXXXXXXXXXXNMENSPKNFKWFYETFLGWIF 576
           + Y+TK +KP + DL ++K A+D                +++  K+ +WFYE ++  IF
Sbjct: 553 LYYKTKTVKPHEADLNSYKAAVDREEEEGKIKEAERKERLKHGKKDLEWFYEKYISSIF 611

>KAFR0B06430 Chr2 complement(1333415..1335196) [1782 bp, 593 aa]
           {ON} 
          Length = 593

 Score =  637 bits (1644), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/577 (56%), Positives = 392/577 (67%), Gaps = 6/577 (1%)

Query: 5   TSMEKKNAGVLYSNETLEEGIVTLESEGQVRSVSEGV--DGKHEGIRLKKELEARHVSMX 62
           T ++K++  V  S++ LE+  +++ S          +  DGK EG RLKK L+ARHVSM 
Sbjct: 18  TDLQKQSDQVTISSD-LEQNSISIASSRNSSIGDRDIFDDGKTEGFRLKKNLKARHVSMI 76

Query: 63  XXXXXXXXXXXXXXXXXXXXXXPVSILISYSFVGLLVYTVMSCLGEMAAFIPLDGFTSYA 122
                                 P S+ I+YSFVG+LV+  MSCLGEMAAFIPLDGFTSYA
Sbjct: 77  AIGGSLGTGLLIGTGTSLAAAGPGSLFITYSFVGVLVFFTMSCLGEMAAFIPLDGFTSYA 136

Query: 123 SRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVNPGVWITIFLALIVLI 182
           SRYVDPA+GFAVGYSYL KY I+  NQLTAGAMV+Q+WV RD +NPGV+ITIFL LIV I
Sbjct: 137 SRYVDPALGFAVGYSYLCKYLILPANQLTAGAMVVQYWVDRDTLNPGVFITIFLILIVTI 196

Query: 183 NTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGFRFWRDPGAFKPYSE 242
           N  GV+ FGEFEFWLSS K                   PNHDR GFR+WRDPG+FKPYS 
Sbjct: 197 NIFGVKIFGEFEFWLSSFKVLVMLGLILLMFIIMLGGGPNHDRLGFRYWRDPGSFKPYSS 256

Query: 243 AISGS---KGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVVF 299
           +I       GK              Y G EL GIVAAEA+NPR+++P+AIKLT+YRI++F
Sbjct: 257 SIISISGSTGKFVSFTSCFVYALFCYLGIELTGIVAAEAQNPRKNIPKAIKLTMYRIIIF 316

Query: 300 YVITILLLGMTVAYNDPRLLXXXXXXXXXXXXPFVVAIENASIPVLPHIFNVCVLVFVFS 359
           YVITILLL M VAYNDP LL            PFVVAIEN+ I +LPHIFNVCVL FV S
Sbjct: 317 YVITILLLTMCVAYNDPLLLKATGQSTSAAASPFVVAIENSGINILPHIFNVCVLAFVLS 376

Query: 360 ACNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCLLAYMNVSSGSAQV 419
           A NSDLYVASRSLY LAID KAP+ F  TNKWG+PY+SL  S  F  LAYMNVSS ++ V
Sbjct: 377 AANSDLYVASRSLYSLAIDNKAPKFFGKTNKWGIPYWSLAFSTAFSCLAYMNVSSSASNV 436

Query: 420 FNYFVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLSYTAAFQPWSTYVALFFCCL 479
           FNYFVN VSIFG++SWI IL+TYI FDKA + Q  DKS+ +Y A +QP+  Y ALFFCC+
Sbjct: 437 FNYFVNAVSIFGVISWICILVTYIHFDKACKAQGMDKSNFTYVAPWQPYGAYFALFFCCV 496

Query: 480 IGLIKNYTVFLGHKFDYKTFISGYIGIPVYLICYVGYKVVYRTKLIKPEDVDLYTFKDAI 539
           + L+KN+TVFLG +FDYK FI+GYIGIPV+ IC+VGYK+VY+TK  +PE+VDL T K  I
Sbjct: 497 LALVKNFTVFLGGQFDYKNFITGYIGIPVFFICFVGYKIVYKTKTHRPEEVDLVTLKALI 556

Query: 540 DAXXXXXXXXXXXXXXNMENSPKNFKWFYETFLGWIF 576
           D                ++N  K++ WFY+ FLG IF
Sbjct: 557 DQEEEDGKIEDAEREERLKNGNKDWAWFYDRFLGKIF 593

>ACL135W Chr3 (115359..117125) [1767 bp, 588 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YPL265W (DIP5)
          Length = 588

 Score =  635 bits (1639), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/551 (57%), Positives = 383/551 (69%), Gaps = 3/551 (0%)

Query: 29  ESEGQVRSVSEGVDGKHEGIRLKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSI 88
            ++ + +SV    DGKHEGIRLKK+L+ARHVSM                       P SI
Sbjct: 38  STDQEAQSVDWNYDGKHEGIRLKKDLQARHVSMIAIGGSLGTGLLIGTGSSLMRAGPGSI 97

Query: 89  LISYSFVGLLVYTVMSCLGEMAAFIPLDGFTSYASRYVDPAVGFAVGYSYLFKYFIVTPN 148
           LI+YS +G +V+TVMSCLGEMAA+IPLDGFTSYA+RY DPA+GFAVG++YLFKY ++TPN
Sbjct: 98  LIAYSIMGWVVFTVMSCLGEMAAYIPLDGFTSYATRYADPALGFAVGWAYLFKYLVLTPN 157

Query: 149 QLTAGAMVMQFWVSRDRVNPGVWITIFLALIVLINTVGVRFFGEFEFWLSSVKXXXXXXX 208
           QLTAGA+V+QFW+   RV+PGVWIT+ LA+IV+INTVGVRFFGEFEFWLSS K       
Sbjct: 158 QLTAGALVIQFWIPAARVSPGVWITVVLAVIVVINTVGVRFFGEFEFWLSSFKVLVMLCV 217

Query: 209 XXXXXXXXXXXXPNHDRTGFRFWRDPGAFKPYSEA---ISGSKGKXXXXXXXXXXXXXXY 265
                       P HDR GFR+W DPGAFK YS+    I G  GK              Y
Sbjct: 218 MILLLVLALGGGPTHDRLGFRYWSDPGAFKEYSKKDTHIKGGLGKFVAFLSVFVYALFAY 277

Query: 266 TGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVVFYVITILLLGMTVAYNDPRLLXXXXXX 325
            GTELCGIVAAE K+PRR+VPRAIKLTLYRIVVFY++TI LLGM VAYNDP L+      
Sbjct: 278 LGTELCGIVAAECKDPRRNVPRAIKLTLYRIVVFYLVTIFLLGMCVAYNDPLLMQASSAE 337

Query: 326 XXXXXXPFVVAIENASIPVLPHIFNVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPRIF 385
                 P+VVAIENA IPVLP++FN CVL FVFSACNSDLYV SRSLYGLAIDGKAP++F
Sbjct: 338 VSAAASPYVVAIENAVIPVLPNLFNACVLTFVFSACNSDLYVGSRSLYGLAIDGKAPKLF 397

Query: 386 ATTNKWGVPYYSLGLSVLFCLLAYMNVSSGSAQVFNYFVNVVSIFGLLSWITILITYIRF 445
           A TNKWGVPY +L    LFC LAYM+VS  +   F YFVNV SIFGL+SW++ILITYI F
Sbjct: 398 ARTNKWGVPYNALACCTLFCCLAYMSVSKSARTAFGYFVNVTSIFGLMSWVSILITYICF 457

Query: 446 DKAIRVQFGDKSSLSYTAAFQPWSTYVALFFCCLIGLIKNYTVFLGHKFDYKTFISGYIG 505
           D+A R Q   KS+LSY A  QP++ +VAL FC  + LIKN+  F+G + D  TFI+GYIG
Sbjct: 458 DRAFRAQGIPKSTLSYVAPCQPYAGWVALIFCIFVALIKNFDAFIGKEVDVPTFITGYIG 517

Query: 506 IPVYLICYVGYKVVYRTKLIKPEDVDLYTFKDAIDAXXXXXXXXXXXXXXNMENSPKNFK 565
           +P+Y+ C++GYK+V++TK I  ++VDL+TFK+AID                +     ++K
Sbjct: 518 LPIYIFCFIGYKIVHKTKWIPSKEVDLFTFKEAIDLEEEECIRERALMKEQLAKGGLSWK 577

Query: 566 WFYETFLGWIF 576
             Y+  LGWIF
Sbjct: 578 KIYDNVLGWIF 588

>CAGL0A01199g Chr1 (121067..122908) [1842 bp, 613 aa] {ON} similar
           to uniprot|P53388 Saccharomyces cerevisiae YPL265w DIP5
           dicarboxylic amino acid permease
          Length = 613

 Score =  630 bits (1625), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/536 (58%), Positives = 380/536 (70%), Gaps = 1/536 (0%)

Query: 42  DGKHEGIRLKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILISYSFVGLLVYT 101
           DGK E  RL+K+L+ARH+SM                       P+S+ I+Y+FVG+LV+ 
Sbjct: 78  DGKDEHTRLRKDLKARHISMIAIGGSIGTGLLIGTGNSLYTAGPMSMFIAYAFVGVLVFF 137

Query: 102 VMSCLGEMAAFIPLDGFTSYASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWV 161
            M+ LGEMA++IPLDGFTSYASRY DPA+GFAVGY+YL KY I+ PNQLTA A+V+Q+W+
Sbjct: 138 TMAALGEMASYIPLDGFTSYASRYCDPALGFAVGYAYLCKYLILPPNQLTAAALVIQYWL 197

Query: 162 SRDRVNPGVWITIFLALIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXP 221
            R++VNPGVWITIFL +IV +N +GV+FFGEFEFWLS+ K                   P
Sbjct: 198 DREQVNPGVWITIFLVIIVAMNFIGVKFFGEFEFWLSTFKVIVMIGLIILLFVIMLGGGP 257

Query: 222 NHDRTGFRFWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNP 281
            HDR GFRF+  PGAFKPYS++I GSKGK              Y G EL GIVAAEA NP
Sbjct: 258 THDRLGFRFYDHPGAFKPYSKSIDGSKGKFVAFVAVLVYALFAYLGIELTGIVAAEAANP 317

Query: 282 RRSVPRAIKLTLYRIVVFYVITILLLGMTVAYNDPRLLXXXXXXXXXXXXPFVVAIENAS 341
           R+S+P+AIKLT+YRI+VFY++TI LLGM VAY+DP L             P+VVAI N+ 
Sbjct: 318 RKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYDDPLLKKAKTSGTGAAASPYVVAIINSG 377

Query: 342 IPVLPHIFNVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLS 401
           I  LPHIFN CVL+FVFSACNSDLYVASR+LYGLAID KAP+IFA TN+WGVPYYSL +S
Sbjct: 378 IKALPHIFNACVLMFVFSACNSDLYVASRTLYGLAIDNKAPKIFAVTNRWGVPYYSLLMS 437

Query: 402 VLFCLLAYMNVSSGSAQVFNYFVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLSY 461
             FCLLAYM+VSSGSA++FNYFVNVVSIFGLLSWI+ILITY+ F +A++ Q  D+S  +Y
Sbjct: 438 SCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWISILITYLCFFRAVKAQNVDRSRFAY 497

Query: 462 TAAFQPWSTYVALFFCCLIGLIKNYTVFLGHKFDYKTFISGYIGIPVYLICYVGYKVVYR 521
            A FQP+ +Y  L FC LI  IKN+TVFL H FDYK FI+GYIGIPV++I Y GYK V +
Sbjct: 498 RAPFQPYGSYFTLAFCILIAFIKNFTVFLNHHFDYKNFITGYIGIPVFVISYFGYKFVKK 557

Query: 522 TKLIKPEDVDLYTFKDAIDAXXXXXXXXXXXXXXNMENSP-KNFKWFYETFLGWIF 576
           TK+ KPE+VDLYTFK AID                ++NS  K + WFYE  LG IF
Sbjct: 558 TKIWKPEEVDLYTFKAAIDEEEEQGKIADAERRERLKNSKTKGWDWFYEKVLGNIF 613

>TBLA0A07060 Chr1 complement(1737650..1739527) [1878 bp, 625 aa]
           {ON} 
          Length = 625

 Score =  626 bits (1614), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/527 (58%), Positives = 370/527 (70%)

Query: 50  LKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILISYSFVGLLVYTVMSCLGEM 109
           LKK L+ARHVSM                       P S+ I+YSFVG+LV+  M+ +GEM
Sbjct: 99  LKKNLQARHVSMIAIGGSLGTGLLIGTGTSLSAAGPASMFIAYSFVGILVFFTMAAIGEM 158

Query: 110 AAFIPLDGFTSYASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVNPG 169
           A++IP+DGFTSYASRYVDPA+GFAVGY YLFKY I+ PNQLTA ++V+Q+W+ RD VNPG
Sbjct: 159 ASYIPMDGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDTVNPG 218

Query: 170 VWITIFLALIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGFR 229
           VWITIFL +IV+IN  GV+FFGEFEFWLSS K                   P+HDR GFR
Sbjct: 219 VWITIFLVVIVIINVAGVKFFGEFEFWLSSFKVLVMLGLILLMFILMLGGGPDHDRLGFR 278

Query: 230 FWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPRAI 289
           +W+ PGAFKPYS+AI GS GK              Y G EL GIVAAEA NPR+SVPRA+
Sbjct: 279 YWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKSVPRAV 338

Query: 290 KLTLYRIVVFYVITILLLGMTVAYNDPRLLXXXXXXXXXXXXPFVVAIENASIPVLPHIF 349
           KLT++RIV+FY++TI LLGM VAYNDPRLL            PFVVAI+N+ I VLPHIF
Sbjct: 339 KLTVWRIVIFYLVTIFLLGMCVAYNDPRLLAAKGAGTSAAASPFVVAIQNSGIRVLPHIF 398

Query: 350 NVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCLLAY 409
           N CVL+FVFSACNSDLYV SRSLY LA+DGKAP IF  T  WG+P+YSLG+ VLF LLAY
Sbjct: 399 NACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLFALLAY 458

Query: 410 MNVSSGSAQVFNYFVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLSYTAAFQPWS 469
           MNVSSGSAQVFNYFVNVVSIFGLLSWI I ITYI F +A++VQ  D+S  +Y+A FQP+ 
Sbjct: 459 MNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAPFQPYG 518

Query: 470 TYVALFFCCLIGLIKNYTVFLGHKFDYKTFISGYIGIPVYLICYVGYKVVYRTKLIKPED 529
           TY +L +C  I  IKN+TVFLGH FDYK FI+GYIG+PV++I Y GYK + +TK++K  +
Sbjct: 519 TYFSLAWCVFIAFIKNFTVFLGHSFDYKNFITGYIGLPVFVIFYFGYKFIKKTKIVKSHE 578

Query: 530 VDLYTFKDAIDAXXXXXXXXXXXXXXNMENSPKNFKWFYETFLGWIF 576
           VDL+T K+  D                +  +  + +W YE FLG IF
Sbjct: 579 VDLFTGKEVFDQQEIEGKILDQEKQIRLRENKFSLEWIYEKFLGNIF 625

>KNAG0L02460 Chr12 (437963..439729) [1767 bp, 588 aa] {ON} 
          Length = 588

 Score =  613 bits (1580), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/543 (58%), Positives = 393/543 (72%)

Query: 34  VRSVSEGVDGKHEGIRLKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILISYS 93
           +   +E  DGK    RLKK+L+ARHVSM                       PVS+LISYS
Sbjct: 46  LDDTNEQFDGKCSDQRLKKDLKARHVSMIAIGGSLGTGLLIGTGNSLAVAGPVSMLISYS 105

Query: 94  FVGLLVYTVMSCLGEMAAFIPLDGFTSYASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAG 153
           FVG+LV+ VMSC+GEMAA+IPLDGFTSYASRY DPA+GFAVGY+YL KYFI+ PNQLTA 
Sbjct: 106 FVGVLVFFVMSCIGEMAAYIPLDGFTSYASRYCDPALGFAVGYAYLVKYFILPPNQLTAA 165

Query: 154 AMVMQFWVSRDRVNPGVWITIFLALIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXX 213
           A+V+Q+W+ R++VNPGVWITI L +IV+INT GV+FFGEFEFWLSS K            
Sbjct: 166 ALVIQYWIPREKVNPGVWITIVLVVIVVINTFGVKFFGEFEFWLSSFKVIVMLGLIILMF 225

Query: 214 XXXXXXXPNHDRTGFRFWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGI 273
                  P HDR GFR+W+ PGAFK YS++I G  G+              Y G EL GI
Sbjct: 226 IIMLGGTPTHDRLGFRYWKHPGAFKEYSKSIHGDIGRFVSFVSCFVYGLFCYLGIELTGI 285

Query: 274 VAAEAKNPRRSVPRAIKLTLYRIVVFYVITILLLGMTVAYNDPRLLXXXXXXXXXXXXPF 333
           VAAEA+NPR+++P+AIKLT++RI++FY+ITI LLGM V+ NDP LL            PF
Sbjct: 286 VAAEAENPRKNIPKAIKLTMWRIIIFYIITIFLLGMCVSSNDPLLLEAKTKSTSAAASPF 345

Query: 334 VVAIENASIPVLPHIFNVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPRIFATTNKWGV 393
           VVAI N+ I  LPHIFN CVL+FVFSACNSDLYVASR+LY LAID KAP+IFA TN++G+
Sbjct: 346 VVAIVNSGIEALPHIFNACVLMFVFSACNSDLYVASRNLYSLAIDNKAPKIFAKTNRFGI 405

Query: 394 PYYSLGLSVLFCLLAYMNVSSGSAQVFNYFVNVVSIFGLLSWITILITYIRFDKAIRVQF 453
           PY SLG++VLFCLLAYM+VSSGSA++FNYFVNVVSI G+L+WI+ILITYI FD+A+R Q 
Sbjct: 406 PYNSLGVAVLFCLLAYMSVSSGSAKIFNYFVNVVSITGVLTWISILITYICFDRAVRAQG 465

Query: 454 GDKSSLSYTAAFQPWSTYVALFFCCLIGLIKNYTVFLGHKFDYKTFISGYIGIPVYLICY 513
            DKS+ +Y A  QP+  Y +LFFCCL+ LIKN+TVFL HKFDY+ FI+GYIG+P++ ICY
Sbjct: 466 IDKSTFAYVAPLQPYGAYFSLFFCCLLALIKNFTVFLNHKFDYRNFITGYIGLPLFFICY 525

Query: 514 VGYKVVYRTKLIKPEDVDLYTFKDAIDAXXXXXXXXXXXXXXNMENSPKNFKWFYETFLG 573
            GYK V +TK+ KPE+VDL++FK AID                ++ + KN++WFYET+LG
Sbjct: 526 FGYKFVKKTKIRKPEEVDLFSFKAAIDQEEEDGRIKDAATAERIKKNGKNWEWFYETYLG 585

Query: 574 WIF 576
            IF
Sbjct: 586 KIF 588

>KNAG0L02470 Chr12 (440549..442465) [1917 bp, 638 aa] {ON} 
          Length = 638

 Score =  603 bits (1556), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/503 (59%), Positives = 362/503 (71%), Gaps = 3/503 (0%)

Query: 38  SEGVDGKHEGIRLKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILISYSFVGL 97
           SE  DGK+EGIRLKK+L++RH+SM                       PVS LI+Y+FVG+
Sbjct: 53  SEIGDGKYEGIRLKKQLKSRHISMIAIGGSLGTGLLIATGESLKVAGPVSTLIAYTFVGI 112

Query: 98  LVYTVMSCLGEMAAFIPLDGFTSYASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVM 157
           +V+  M+CLGEMA FIPLDGFTSYASRY DPA+GFAVGY+YL KYFI+ PNQLTA AMVM
Sbjct: 113 MVFFTMACLGEMATFIPLDGFTSYASRYCDPALGFAVGYAYLIKYFILPPNQLTAAAMVM 172

Query: 158 QFWVSRDRVNPGVWITIFLALIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXX 217
           Q+WV RD VNPG+W+T+  A+I +IN  GVRFFGEFEFWLSS+K                
Sbjct: 173 QYWVPRDTVNPGIWVTLVFAVITVINIFGVRFFGEFEFWLSSLKVLIMIGLIILLFVIML 232

Query: 218 XXXPNHDRTGFRFWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAE 277
               +HDR GFR+W+ PGAF  YS+ ISGS GK              Y G EL GIVAAE
Sbjct: 233 GGAGSHDRLGFRYWKHPGAFNDYSDDISGSLGKFVSFVAVLVLGVFAYLGIELTGIVAAE 292

Query: 278 AKNPRRSVPRAIKLTLYRIVVFYVITILLLGMTVAYNDPRLLXXXXXXXXXXXXPFVVAI 337
           A NPRRSVP+AIKLT YRI+VFYV++I LLGM V YND +L+            PF +AI
Sbjct: 293 ASNPRRSVPKAIKLTFYRILVFYVVSIFLLGMCVPYNDEKLVTTNENSLTAS--PFSIAI 350

Query: 338 ENASIPVLPHIFNVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYS 397
            NA I VLP IFN C+L+FVFSA NSDLYVASR+LY LA+D KAP+IFA TN+WG+PY S
Sbjct: 351 LNAGITVLPDIFNGCLLIFVFSAANSDLYVASRNLYSLAVDNKAPKIFAHTNRWGIPYNS 410

Query: 398 LGLSVLFCLLAYMNVSSGSAQVFNYFVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKS 457
           L +S LFCLLAYM VSS SAQVF YFVNVVSI GLL+WI+ILITYI FD+A+R Q  DKS
Sbjct: 411 LFVSCLFCLLAYMTVSSSSAQVFKYFVNVVSIAGLLTWISILITYICFDRAVRAQHVDKS 470

Query: 458 SLSYTAAFQPWSTYVALFFCCLIGLIKNYTVFLGHKFDYKTFISGYIGIPVYLICYVGYK 517
           + +Y A FQP+  YV+LFFCCLI +IKN+TVFLGH FDYKTFI+GYIG+P++++CY GYK
Sbjct: 471 TFAYVAPFQPYGAYVSLFFCCLIAIIKNFTVFLGH-FDYKTFITGYIGLPIFVLCYFGYK 529

Query: 518 VVYRTKLIKPEDVDLYTFKDAID 540
           +  ++++     VDL + K  +D
Sbjct: 530 ITCKSEIRSARYVDLVSQKSLVD 552

>ZYRO0D17908g Chr4 (1486514..1488070) [1557 bp, 518 aa] {ON} similar
           to uniprot|P53388 Saccharomyces cerevisiae YPL265W DIP5
           Dicarboxylic amino acid permease, mediates high-affinity
           and high-capacity transport of L-glutamate and
           L-aspartate; also a transporter for Gln, Asn, Ser, Ala,
           and Gly
          Length = 518

 Score =  328 bits (840), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 186/516 (36%), Positives = 278/516 (53%), Gaps = 13/516 (2%)

Query: 22  EEGIVTLE--SEGQVRSVSEGVDGKHEGIRLKKELEARHVSMXXXXXXXXXXXXXXXXXX 79
           ++G V LE  + G+    SE +D K+    L +EL+ R VS+                  
Sbjct: 4   KKGTVVLERPASGEDECESEEIDEKNG--NLSRELKPRVVSLLTLGSAVGTGLIIGSGSA 61

Query: 80  XXXXXPVSILISYSFVGLLVYTVMSCLGEMAAFIPLD-GFTSYASRYVDPAVGFAVGYSY 138
                P+S+ I+Y F G L+  V+  L EMA+F P+D GF+ Y +RYVDPA GFA G++Y
Sbjct: 62  LAKGGPISLFIAYLFTGSLLCVVIFSLSEMASFAPMDKGFSGYLNRYVDPAFGFAAGWNY 121

Query: 139 LFKYFIVTPNQLTAGAMVMQFWVSRDRVNPGVWITIFLALIVLINTVGVRFFGEFEFWLS 198
             KY IV    LTA  +V+ +W  R  VN GVW+T+    +  +N + V++FGE E  L+
Sbjct: 122 FLKYAIVLSANLTAFGLVIGYW--RPDVNVGVWVTVLYVTVFCVNFLAVKYFGEIEALLT 179

Query: 199 SVKXXXXXXXXXXXXXXXXXXXPNHDRTGFRFWRDPGAFKPYSEAISGSKGKXXXXXXXX 258
             K                   PNH  TGFR+WR+ GA  PY   + G  GK        
Sbjct: 180 VFKLLVLVIVYITCLIITCGGAPNHTTTGFRYWRESGAL-PY--LVGGGTGKFLGWWACV 236

Query: 259 XXXXXXYTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVVFYVITILLLGMTVAYNDPRL 318
                 + G+E+ GIV  E  NP++++P++     +RI   YV  + +LG+ ++  + +L
Sbjct: 237 VQSIFGFMGSEMIGIVYGETANPKKTIPKSSMNVFFRIGFLYVFGVFILGLAISPVNSKL 296

Query: 319 LXXXXXXXXXXXXPFVVAIENASIPVLPHIFNVCVLVFVFSACNSDLYVASRSLYGLAID 378
           +            PFV+AI ++ I VLP+  N  +LVF+ S+ N+D+Y+ SR LYGLA D
Sbjct: 297 VHAHSTDANAS--PFVIAISSSGIKVLPNFVNAALLVFIISSANTDIYICSRQLYGLAKD 354

Query: 379 GKAPRIFATTNKWGVPYYSLGLSVLFCLLAYMNVSSGSAQVFNYFVNVVSIFGLLSWITI 438
           G AP+IF   N++ VP        L   LAYMN    +A VF+Y  + VS+FG+L+W  I
Sbjct: 355 GAAPKIFLLVNRFKVPVVGCVTGSLLGFLAYMNTKKSAATVFSYITSTVSVFGILNWFYI 414

Query: 439 LITYIRFDKAIRVQFGDKSSLSYTAAFQPWSTYVALFFCCLIGLIKNYTVFLGHKFDYKT 498
           LI YI +D+AI+ +      + +   FQP++ YV LFF  +I     Y  F+  KF YKT
Sbjct: 415 LIAYINYDRAIKAKGISIDDIPFRMWFQPYAAYVTLFFVTIITFFNGYNAFI-IKFHYKT 473

Query: 499 FISGYIGIPVYLICYVGYKVVYRTKLIKPEDVDLYT 534
           FI+ YIG+   ++  +GYK+ ++TK +KP ++   T
Sbjct: 474 FITSYIGVFANILMVIGYKLYFKTKFVKPSEISFRT 509

>SAKL0C02662g Chr3 complement(249789..251435) [1647 bp, 548 aa] {ON}
           uniprot|Q875R1 Saccharomyces kluyveri CAN1 Plasma
           membrane arginine permease requires phosphatidyl
           ethanolamine (PE) for localization exclusively
           associated with lipid rafts mutation confers canavanine
           resistance
          Length = 548

 Score =  323 bits (829), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 182/537 (33%), Positives = 284/537 (52%), Gaps = 20/537 (3%)

Query: 6   SMEKKNAGVLYSNETLEEGIVTLESEGQVRSVSEGVDGKHEGIRLKKELEARHVSMXXXX 65
           +  +K+   L    ++ E  V++ES G V+             ++K+ L+ RH+SM    
Sbjct: 9   ATREKDGSHLIIKPSIAEDAVSMESLGSVKET-----------QVKRALKPRHISMIALG 57

Query: 66  XXXXXXXXXXXXXXXXXXXPVSILISYSFVGLLVYTVMSCLGEMAAFIPL-DGFTSYASR 124
                              PV  LI+Y F+G L Y+V   LGEMA FIP+   FT +  R
Sbjct: 58  GTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYSVTQSLGEMATFIPVTSSFTVFTQR 117

Query: 125 YVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVNPGVWITIFLALIVLINT 184
           ++ PA+G A GY Y   + I    +L+    ++QFW   D V    WI IF  ++ + N 
Sbjct: 118 FLSPALGSANGYLYWLSWAITFALELSVVGQIIQFWT--DAVPLTAWIAIFWVILTISNL 175

Query: 185 VGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGFRFWRDPGAFKPYSEAI 244
             V+++GE EFW++ +K                         GFR+WR+PG + P   + 
Sbjct: 176 FPVKYYGEVEFWIACIKVLAIVGFIIYAFIMVCGAG-KTGPVGFRYWRNPGPWGPGIISK 234

Query: 245 SGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVVFYVITI 304
             ++G+              Y GTEL GI A EA NPR++VPRAI    +RI+ FY++++
Sbjct: 235 DVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVPRAINKVFFRILFFYILSL 294

Query: 305 LLLGMTVAYNDPRLLXXXXXXXXXXXXPFVVAIENASIPVLPHIFNVCVLVFVFSACNSD 364
           L +G+ V +NDP+L             PFV+AIEN+   VLPHIFN  +L  + SA NS+
Sbjct: 295 LFIGLLVPFNDPKL---KSEDSYISSSPFVIAIENSGTKVLPHIFNAVILSTIISAGNSN 351

Query: 365 LYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCLLAYMNVSSGSAQVFNYFV 424
           +YV SR  Y +A++G AP+    T K G+PY ++  + +   LAY+  SSG++ VFN+ +
Sbjct: 352 VYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAVLTTSVLGFLAYLESSSGASAVFNWLL 411

Query: 425 NVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLSYTAAFQPWSTYVALFFCCLIGLIK 484
           N+ ++ G  +WI I I++IRF +A++ Q   +  L + A F PW  Y A FF  +I +I+
Sbjct: 412 NITAVAGFFTWILISISHIRFMQALKHQGISRDDLPFKAKFMPWGAYYAAFFIGVIIIIQ 471

Query: 485 NYTVFLGHKFDYKTFISGYIGIPVYLICYVGYKVVYRTKL-IKPEDVDLYTFKDAID 540
            +T F   KF    F + YI + ++ + ++G+++ +R  L IK ED+DL T +  ID
Sbjct: 472 GFTAF-APKFKVSDFFTAYISVMLFFVFWIGFQIWFRGPLFIKTEDIDLDTDRREID 527

>SAKL0C02640g Chr3 complement(247651..249297) [1647 bp, 548 aa] {ON}
           highly similar to uniprot|Q875R1 Saccharomyces kluyveri
           CAN1 and similar to YEL063C uniprot|P04817 Saccharomyces
           cerevisiae YEL063C CAN1 Plasma membrane arginine
           permease requires phosphatidyl ethanolamine (PE) for
           localization exclusively associated with lipid rafts
           mutation confers canavanine resistance
          Length = 548

 Score =  321 bits (822), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 181/542 (33%), Positives = 283/542 (52%), Gaps = 20/542 (3%)

Query: 1   MNSDTSMEKKNAGVLYSNETLEEGIVTLESEGQVRSVSEGVDGKHEGIRLKKELEARHVS 60
               +S ++KN+  L S  +  + +V+LES G V+             ++K+ L+ RH+S
Sbjct: 4   QQHHSSEKEKNSEELVSEFSRSKDVVSLESLGSVKET-----------QVKRALKPRHIS 52

Query: 61  MXXXXXXXXXXXXXXXXXXXXXXXPVSILISYSFVGLLVYTVMSCLGEMAAFIPL-DGFT 119
           M                       PV  LI+Y F+G L Y V   LGEMA FIP+   F 
Sbjct: 53  MIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMVSQSLGEMATFIPVTSSFM 112

Query: 120 SYASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVNPGVWITIFLALI 179
            +  R++ PA+G A GY Y   + I    +L+    V+QFW   D V    WI I   ++
Sbjct: 113 VFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFWT--DAVPLTAWIIILWVVL 170

Query: 180 VLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGFRFWRDPGAFKP 239
           V  N   V+F+GE EFW++ +K                         GFR+WR+PG + P
Sbjct: 171 VSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKT-GPVGFRYWRNPGPWGP 229

Query: 240 YSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVVF 299
              +   ++G+              Y GTEL GI A EA NPR++VPRAI    +RI+ F
Sbjct: 230 GIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVPRAINKVFFRILFF 289

Query: 300 YVITILLLGMTVAYNDPRLLXXXXXXXXXXXXPFVVAIENASIPVLPHIFNVCVLVFVFS 359
           Y++++L +G+ V +NDP+L             PFV+AIEN+   VLPHIFN  +L  + S
Sbjct: 290 YILSLLFIGLLVPFNDPKL---KSEDSYISSSPFVIAIENSGTKVLPHIFNAVILSTIIS 346

Query: 360 ACNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCLLAYMNVSSGSAQV 419
           A NSD+Y++SR LY + ++G AP+    T K G+PY ++  + L   LAY+  S G++ V
Sbjct: 347 AGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTTSLVGFLAYLESSHGASVV 406

Query: 420 FNYFVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLSYTAAFQPWSTYVALFFCCL 479
           F++ +N+ ++ G  +W+ I + +IRF +A++ Q   +  L + A F PW  Y A FF  +
Sbjct: 407 FDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPFKAKFMPWGAYYAAFFIGV 466

Query: 480 IGLIKNYTVFLGHKFDYKTFISGYIGIPVYLICYVGYKVVYRTKLIKP-EDVDLYTFKDA 538
           I +I+ +T F   KF+   F + Y+ + ++   ++G+++ +R  L K  ED+DL T +  
Sbjct: 467 IIIIQGFTAF-APKFNVSDFFTAYVSVILFFAVWIGFQIWFRGPLFKKTEDIDLDTDRRE 525

Query: 539 ID 540
           ID
Sbjct: 526 ID 527

>NDAI0A00610 Chr1 complement(113913..115610) [1698 bp, 565 aa] {ON} 
          Length = 565

 Score =  320 bits (820), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 186/517 (35%), Positives = 282/517 (54%), Gaps = 14/517 (2%)

Query: 26  VTLESEGQVRSVSEGVDGKHEGIRLKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXP 85
           +T+ES+ +     E  +G+     +K+EL+ RH+ M                       P
Sbjct: 40  ITIESQEE-----EIANGQIREAEVKRELKQRHIGMIALGGTIGTGLFIGLSTPLTNAGP 94

Query: 86  VSILISYSFVGLLVYTVMSCLGEMAAFIPL-DGFTSYASRYVDPAVGFAVGYSYLFKYFI 144
           V  LI+Y F+G LVY+V   LGEMA FIP+   FT ++ R++ P+ G A GY Y F + I
Sbjct: 95  VGALIAYLFMGTLVYSVTQSLGEMATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAI 154

Query: 145 VTPNQLTAGAMVMQFWVSRDRVNPGVWITIFLALIVLINTVGVRFFGEFEFWLSSVKXXX 204
               +L+    ++QFW S   V    WI+IF  L+V +N   VRF+GEFEFW++S+K   
Sbjct: 155 TFALELSVVGQIIQFWTSA--VPIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLA 212

Query: 205 XXXXXXXXXXXXXXXXPNHDRTGFRFWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXX 264
                                 GFR+WR+PG   P   A + ++ K              
Sbjct: 213 IMGFLIYCLCMVCGAGVTGP-VGFRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFT 271

Query: 265 YTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVVFYVITILLLGMTVAYNDPRLLXXXXX 324
           Y GTEL GI A EA NPR+SVPRAIK  ++RI+ FY+ ++  +G+ V YNDP+L      
Sbjct: 272 YQGTELVGITAGEAANPRKSVPRAIKKVVFRILFFYIGSLFFIGLLVPYNDPKL---TSD 328

Query: 325 XXXXXXXPFVVAIENASIPVLPHIFNVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPRI 384
                  PF+++I+N+  P+LPHIFN  +L  + SA NS++YV SR ++GL+    APRI
Sbjct: 329 DSYVAASPFIISIQNSGTPILPHIFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRI 388

Query: 385 FATTNKWGVPYYSLGLSVLFCLLAYMNVSSGSAQVFNYFVNVVSIFGLLSWITILITYIR 444
            + TNK GVP+ S+  + LF  LAYM  S+G    FN+ +N+  + G  SW+ I I+++R
Sbjct: 389 LSRTNKNGVPWVSVIFTGLFGALAYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVR 448

Query: 445 FDKAIRVQFGDKSSLSYTAAFQPWSTYVALFFCCLIGLIKNYTVFLGHKFDYKTFISGYI 504
           F +A+  +   +  L + A F P   Y A+FF  LI +I+ +T F    FD   F++ YI
Sbjct: 449 FMQALEYRGISRDDLPFKAKFMPGLAYYAIFFMTLIIIIQGFTSFC-PSFDGIDFLAAYI 507

Query: 505 GIPVYLICYVGYKVVYRTKLI-KPEDVDLYTFKDAID 540
              +++  ++ +++ +R +LI K EDVD+ T +  I+
Sbjct: 508 SCFLFIAIWIVFQLWFRCRLIWKIEDVDIDTDRRDIE 544

>Smik_5.24 Chr5 complement(34087..35859) [1773 bp, 590 aa] {ON}
           YEL063C (REAL)
          Length = 590

 Score =  319 bits (818), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 180/519 (34%), Positives = 284/519 (54%), Gaps = 20/519 (3%)

Query: 25  IVTLESEGQVRSVSEGVDGKHEGIRLKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXX 84
           ++  E +G+VR+             +K+EL+ RH+ M                       
Sbjct: 70  VIRDEDQGEVRNA-----------EVKRELKQRHIGMIALGGTIGTGLFIGLSKPLANAG 118

Query: 85  PVSILISYSFVGLLVYTVMSCLGEMAAFIPL-DGFTSYASRYVDPAVGFAVGYSYLFKYF 143
           PV  LISY F+G L Y+V   LGEMA FIP+   FT ++ R++ PA G A GY Y F + 
Sbjct: 119 PVGALISYLFMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWA 178

Query: 144 IVTPNQLTAGAMVMQFWVSRDRVNPGVWITIFLALIVLINTVGVRFFGEFEFWLSSVKXX 203
           I    +L+    V++FW   ++V    WI+IF  +I ++N   V+++GEFEFW++S+K  
Sbjct: 179 ITFALELSVVGQVIEFWT--NKVPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVL 236

Query: 204 XXXXXXXXXXXXXXXXXPNHDRTGFRFWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXX 263
                                  GFR+WR+PGA+ P   +   ++G+             
Sbjct: 237 AIIGFLIYCFCMVCGAGVTGP-VGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAF 295

Query: 264 XYTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVVFYVITILLLGMTVAYNDPRLLXXXX 323
            + GTEL GI A EA NPR++VPRAIK  ++RI+ FY+ ++L +G+ V YNDP+L     
Sbjct: 296 TFQGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKL---TT 352

Query: 324 XXXXXXXXPFVVAIENASIPVLPHIFNVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPR 383
                   PF++AIEN+   VLPHIFN  +L  + SA NS++YV SR L+GL+ +  AP+
Sbjct: 353 ATSYVSVSPFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPK 412

Query: 384 IFATTNKWGVPYYSLGLSVLFCLLAYMNVSSGSAQVFNYFVNVVSIFGLLSWITILITYI 443
             + T K GVPY ++ ++ +F  LAYM  S+G  +VF + +N+  + G  +W+ I I++I
Sbjct: 413 FLSRTTKGGVPYIAVFITAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLLISISHI 472

Query: 444 RFDKAIRVQFGDKSSLSYTAAFQPWSTYVALFFCCLIGLIKNYTVFLGHKFDYKTFISGY 503
           RF +A++ +   +  L + A   P   Y A  F  +I LI+ +T F   KFD   F++ Y
Sbjct: 473 RFMQALKYRGISRDELPFKAKLMPGLAYFAATFMIIIILIQGFTAF-APKFDGIDFLAAY 531

Query: 504 IGIPVYLICYVGYKVVYRTKLI-KPEDVDLYTFKDAIDA 541
           I I ++L  ++ +++++R + I K EDVD+ + +  I+A
Sbjct: 532 ISIFLFLAIWILFEIIFRCRFIWKIEDVDIDSDRRDIEA 570

>Ecym_8035 Chr8 (81434..83125) [1692 bp, 563 aa] {ON} similar to
           Ashbya gossypii AFR156W
          Length = 563

 Score =  318 bits (815), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 184/539 (34%), Positives = 287/539 (53%), Gaps = 14/539 (2%)

Query: 1   MNSDTSMEKKNAGVLYSNETLEEGIVTLESEGQVRSVSEGVDGKHEGIRLKKELEARHVS 60
           +  + S+ K+    +   ++ EE   T  S  + ++     D +H    LKK L  RH+ 
Sbjct: 5   IKKEASVSKQEFNGMKEVKSNEETYRTSHSNLESQNSDVVSDYEHN---LKKGLSNRHIQ 61

Query: 61  MXXXXXXXXXXXXXXXXXXXXXXXPVSILISYSFVGLLVYTVMSCLGEMAAFIPLDG-FT 119
           +                       P  + +S+  +  +VY +M  L EM  ++P  G   
Sbjct: 62  LIALGGCIGTGLFVGTSSTLTQCGPAPLFLSFIIISTMVYCIMCTLAEMVCYLPQQGSVP 121

Query: 120 SYASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVNPGVWITIFLALI 179
              +RYVDP++GFA G++Y + Y ++   +LTA A ++++W   D+V  GVWITIFL ++
Sbjct: 122 ELVTRYVDPSLGFAAGWNYAYSYAMLVATELTAAAGIVRYWT--DQVPQGVWITIFLIVV 179

Query: 180 VLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGFRFWRDPGAFKP 239
           V++N   VRF+GE EFW +S+K                   PNHDR GFR+WR+PGAF  
Sbjct: 180 VVLNFSAVRFYGESEFWFASLKIICILALLVVSIVIFFGGAPNHDRVGFRYWRNPGAFGY 239

Query: 240 YSEAISGSKGKXXXXXXXXXXXXXXYT-GTELCGIVAAEAKNPRRSVPRAIKLTLYRIVV 298
           +     G+ G+              +    EL G+   EAK+ RR++ +A +  +YRI+ 
Sbjct: 240 H--ITGGNLGRFLDLWTAIIKSAFAFILSPELVGLACVEAKDTRRNIEKASRRFIYRIIF 297

Query: 299 FYVITILLLGMTVAYNDPRLLXXXXXXX-XXXXXPFVVAIENASIPVLPHIFNVCVLVFV 357
           FY+ + L++G+ VA ND  LL             PFV  I N+ IPVL H+ NV +L   
Sbjct: 298 FYLSSSLMIGVIVAKNDHNLLLALEENRPGAASSPFVQGIANSGIPVLNHVINVAILTSA 357

Query: 358 FSACNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCLLAYMNVSSGSA 417
           +SA NS  Y +SRS+  L+  G AP+IF+  N++GVPY ++ L  L   LAY+NVSS S+
Sbjct: 358 WSAGNSFFYASSRSILALSKQGDAPKIFSKINRFGVPYNAVFLCSLVACLAYLNVSSTSS 417

Query: 418 QVFNYFVNVVSIFGLLSWITILITYIRFDKAIRV-QFGDKSSLSYTAAFQPWSTYVALFF 476
           +VF +  N+ +I G + W  I + YIRF KAI   +  D+  + Y +  QP+S Y     
Sbjct: 418 KVFQWLSNICTISGFIGWFLIGVAYIRFRKAILFNRLLDR--IPYRSPLQPFSAYFFTIV 475

Query: 477 CCLIGLIKNYTVFLGHKFDYKTFISGYIGIPVYLICYVGYKVVYRTKLIKPED-VDLYT 534
             +I L   Y VF+  ++DYK F++ YI +P++L  Y+G+K +Y+T+   P D +D+ T
Sbjct: 476 VAIITLTNGYVVFIKGRWDYKDFLTSYISLPIFLAFYLGHKTIYKTRFCIPVDQIDVIT 534

>Ecym_1087 Chr1 complement(180832..182544) [1713 bp, 570 aa] {ON}
           similar to Ashbya gossypii AFR668W
          Length = 570

 Score =  318 bits (814), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 180/544 (33%), Positives = 299/544 (54%), Gaps = 15/544 (2%)

Query: 2   NSDTSMEKKNAGVLYS-NETLEEGI-VTLESEGQVRSVSEGVDGKHEGIRLKKELEARHV 59
           N  ++   +++ VL+   ET  EGI +  E+  +V S+    D       +K++L+ RH+
Sbjct: 17  NDRSAESSESSDVLHHRKETKNEGIFINQENMSEVESLYGNDDPD-----VKRDLKPRHM 71

Query: 60  SMXXXXXXXXXXXXXXXXXXXXXXXPVSILISYSFVGLLVYTVMSCLGEMAAFIPL-DGF 118
           SM                       PV  L++Y F+G + + V   LGEMA FIP+   F
Sbjct: 72  SMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSLGEMATFIPVTSSF 131

Query: 119 TSYASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVNPGVWITIFLAL 178
           T Y  R++ PA+G A GY Y F + +    +L+    ++Q+W     V   VWI +F  L
Sbjct: 132 TMYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTFA--VPLSVWIVVFWIL 189

Query: 179 IVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGFRFWRDPGAFK 238
           +   N + VRF+GE EFW++++K                    +    GFR+W++PG + 
Sbjct: 190 LTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGGS-SEGALGFRYWKNPGPWG 248

Query: 239 PYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVV 298
               + +  + +              Y GTEL GI A E+KNPR++VP+AI    +RI+ 
Sbjct: 249 MGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVPKAINKVFFRILF 308

Query: 299 FYVITILLLGMTVAYNDPRLLXXXXXXXXXXXXPFVVAIENASIPVLPHIFNVCVLVFVF 358
           FY++++  +G+ V Y DPRL             PFV+AI+N+   VLP +FN  +LV + 
Sbjct: 309 FYILSLFFVGLLVPYTDPRL--STTSDSDINTSPFVMAIQNSGTKVLPSVFNGVILVTIL 366

Query: 359 SACNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCLLAYMNVSSGSAQ 418
           SA NS++Y+ SR LYGL+  G AP +F  TNK GVP+Y++  S +F  LAY+N+S  + +
Sbjct: 367 SAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLAYLNISQNAKK 426

Query: 419 VFNYFVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLSYTAAFQPWSTYVALFFCC 478
           VF++ + + ++ G  +W+ I +++IRF + ++ +   ++ L + A F PW  Y A FF  
Sbjct: 427 VFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPWGAYYAAFFIT 486

Query: 479 LIGLIKNYTVFLGHKFDYKTFISGYIGIPVYLICYVGYKVVYRTKLI-KPEDVDLYTFKD 537
           +I LI+ +  F   +F +  FI+ YI + ++++C++G++V+++T+LI + EDVD+ T + 
Sbjct: 487 VIILIQGFDSF-APEFVFSEFIADYISVFLFIVCWLGFQVLFKTRLILRKEDVDIDTDRR 545

Query: 538 AIDA 541
            IDA
Sbjct: 546 EIDA 549

>KLLA0C02343g Chr3 complement(203552..205297) [1746 bp, 581 aa] {ON}
           similar to uniprot|P04817 Saccharomyces cerevisiae
           YEL063C CAN1 Plasma membrane arginine permease requires
           phosphatidyl ethanolamine (PE) for localization
           exclusively associated with lipid rafts mutation confers
           canavanine resistance
          Length = 581

 Score =  316 bits (810), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 182/538 (33%), Positives = 288/538 (53%), Gaps = 14/538 (2%)

Query: 1   MNSDTSM-EKKNAGVLYSNETLEEGI-------VTLESEGQVRSVSEGVDGKHEGIRLKK 52
           ++S+ S  +   +G+  SN  +++ +       +TLE+     S     +G      +K+
Sbjct: 16  LHSNLSQSQSARSGMHVSNSKIDDPLRFSKDNNLTLEAIDDDSSRMFDPEGSIGQAEVKR 75

Query: 53  ELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILISYSFVGLLVYTVMSCLGEMAAF 112
            L+ RHVSM                       PV  LI++  +G L Y+V   LGEMA F
Sbjct: 76  ALKPRHVSMIALGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYSVTQSLGEMATF 135

Query: 113 IPL-DGFTSYASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVNPGVW 171
           IP+   FT ++ R++ PAVG A GY Y F + I    +L+    ++Q+W   D V    W
Sbjct: 136 IPVTSSFTVFSQRFISPAVGAANGYMYWFSWAITFALELSIVGQIIQYWT--DAVPLEAW 193

Query: 172 ITIFLALIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGFRFW 231
           I IF  L+V  N   V+++GEFEFW++S+K                   P     GFR+W
Sbjct: 194 IAIFWVLLVSFNMFPVKWYGEFEFWVASIKVIAIIGFLIYSLCMVCGAGP-EGPIGFRYW 252

Query: 232 RDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPRAIKL 291
           R PG +     A + +K +              Y GTEL GI A E KNPR++VPRAI  
Sbjct: 253 RKPGPWGNGIIAKNVNKARFLGWVSSLISAAFTYQGTELVGITAGETKNPRKAVPRAINK 312

Query: 292 TLYRIVVFYVITILLLGMTVAYNDPRLLXXXXXXXXXXXXPFVVAIENASIPVLPHIFNV 351
             +RI++FY+ ++  +G+ V YNDP+L             PF++AI N   PVLPHIFN 
Sbjct: 313 VFFRILIFYIGSLFFIGLLVPYNDPKL-EGSDNGSYIAQSPFLIAILNCRTPVLPHIFNA 371

Query: 352 CVLVFVFSACNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCLLAYMN 411
            +L  + SA NS++YV SR L+GL+ +  AP+ F+ T K GVP+ ++ ++ +F  LAY+N
Sbjct: 372 VILTTIISAGNSNVYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAVLITAVFGFLAYLN 431

Query: 412 VSSGSAQVFNYFVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLSYTAAFQPWSTY 471
           VS+ + +VF++ +N+ +I G ++W+ I I++IRF + ++ +   +  L Y A F P++ Y
Sbjct: 432 VSNDAQEVFDWLLNITAIAGFITWLLISISHIRFMQTLKHRGISRDDLPYKAKFMPYAAY 491

Query: 472 VALFFCCLIGLIKNYTVFLGHKFDYKTFISGYIGIPVYLICYVGYKVVYRTKLIKPED 529
            A FF  +I +I+ +T F  H F+   F + YI + ++ I +  ++ +YRTKL +  D
Sbjct: 492 YAAFFITVIIIIQGFTAFAPH-FNVSDFFAAYISVFLFFIVWAIFQTIYRTKLFRTLD 548

>Suva_5.4 Chr5 complement(7388..9160) [1773 bp, 590 aa] {ON} YEL063C
           (REAL)
          Length = 590

 Score =  315 bits (807), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 177/538 (32%), Positives = 289/538 (53%), Gaps = 9/538 (1%)

Query: 6   SMEKKNAGVLYSNETLEEGIVTLESEGQVRSVSEGVDGKHEGIRLKKELEARHVSMXXXX 65
           S++ + +  LY   +   G+   ++      + +  +G+ +   +K+EL+ RH+ M    
Sbjct: 40  SLKDEKSKELYPLRSFPNGVNGQDTFSMEEDIQDEDEGEVQNAEVKRELKQRHIGMIALG 99

Query: 66  XXXXXXXXXXXXXXXXXXXPVSILISYSFVGLLVYTVMSCLGEMAAFIPL-DGFTSYASR 124
                              PV  LISY F+G L Y+V   LGEMA FIP+   FT ++ R
Sbjct: 100 GTIGTGLFIGLSTPLTNAGPVGALISYLFMGSLAYSVTQSLGEMATFIPVTSSFTVFSQR 159

Query: 125 YVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVNPGVWITIFLALIVLINT 184
           ++ PA G A GY Y F + +    +L+    V+QFW     V    WI+IF  +I  +N 
Sbjct: 160 FLSPAFGAANGYMYWFSWAVTFALELSVVGQVIQFWTYA--VPLAAWISIFWVIITAMNM 217

Query: 185 VGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGFRFWRDPGAFKPYSEAI 244
             V+++GEFEFW++S+K                         GFR+WR+PGA+ P   + 
Sbjct: 218 FPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVTGP-VGFRYWRNPGAWGPGIISK 276

Query: 245 SGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVVFYVITI 304
           + ++ +              + GTEL GI A EA NPR++VPRAIK  ++RI+ FY+ ++
Sbjct: 277 NKNEARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSL 336

Query: 305 LLLGMTVAYNDPRLLXXXXXXXXXXXXPFVVAIENASIPVLPHIFNVCVLVFVFSACNSD 364
           L +G+ V YNDP+L             PF++AIEN+   VLPHIFN  +L  + SA NS+
Sbjct: 337 LFIGLLVPYNDPKL---TSATSYVSTSPFIIAIENSGTKVLPHIFNAVILTTIISAANSN 393

Query: 365 LYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCLLAYMNVSSGSAQVFNYFV 424
           +YV SR L+GL+    AP+ F+ T K GVPY ++  + +F  LAYM  S+G  +VF + +
Sbjct: 394 IYVGSRVLFGLSKSKLAPKFFSKTTKGGVPYIAVFATSIFGALAYMETSTGGGKVFAWLL 453

Query: 425 NVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLSYTAAFQPWSTYVALFFCCLIGLIK 484
           N+  + G  +W+ I +++IRF +A++ +   +  L + A   P   Y A FF  +I LI+
Sbjct: 454 NITGVAGFFAWLFISVSHIRFMQALKYRGISRDELPFKAKLMPGLAYYATFFMVVIILIQ 513

Query: 485 NYTVFLGHKFDYKTFISGYIGIPVYLICYVGYKVVYRTKLI-KPEDVDLYTFKDAIDA 541
            +T F    F+   F++ YI + ++L  ++ +++++R + + K EDVD+ + +  I+A
Sbjct: 514 GFTSFT-PTFNGVNFLAAYISVFLFLAIWILFELIFRCRFVWKIEDVDIDSDRRDIEA 570

>Skud_5.26 Chr5 complement(30850..32622) [1773 bp, 590 aa] {ON}
           YEL063C (REAL)
          Length = 590

 Score =  315 bits (806), Expect = 3e-99,   Method: Compositional matrix adjust.
 Identities = 178/538 (33%), Positives = 295/538 (54%), Gaps = 9/538 (1%)

Query: 6   SMEKKNAGVLYSNETLEEGIVTLESEGQVRSVSEGVDGKHEGIRLKKELEARHVSMXXXX 65
           S++ + +  LY   +   G+   ++     ++ +  +G+ +   +K+EL+ RH+ M    
Sbjct: 40  SLKDEKSKELYPLRSFPTGVNGQDTFSMEENLQDEDEGEVQNAEVKRELKQRHIGMIALG 99

Query: 66  XXXXXXXXXXXXXXXXXXXPVSILISYSFVGLLVYTVMSCLGEMAAFIPL-DGFTSYASR 124
                              PV  LI+Y F+G L ++V   LGEMA FIP+   FT ++ R
Sbjct: 100 GTIGTGLFIGLSTPLANAGPVGALIAYLFMGSLAFSVTQSLGEMATFIPVTSSFTVFSQR 159

Query: 125 YVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVNPGVWITIFLALIVLINT 184
           ++ PA G A GY Y F + I    +L+    V+QFW    +V    WI+IF  LI ++N 
Sbjct: 160 FLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWT--HKVPLAAWISIFWVLITIMNL 217

Query: 185 VGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGFRFWRDPGAFKPYSEAI 244
             V+++GEFEFW++S+K                         GFR+WR+PGA+ P   + 
Sbjct: 218 FPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVTGP-VGFRYWRNPGAWGPGIISK 276

Query: 245 SGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVVFYVITI 304
           + ++G+              + GTEL GI A EA NPR++VPRAIK  ++RI+ FY+ ++
Sbjct: 277 NKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSL 336

Query: 305 LLLGMTVAYNDPRLLXXXXXXXXXXXXPFVVAIENASIPVLPHIFNVCVLVFVFSACNSD 364
           L +G+ V YNDP+L             PF+VAI+N+   VLPHIFN  +L  + SA NS+
Sbjct: 337 LFIGLLVPYNDPKL---TEATSYVSTSPFIVAIQNSGTKVLPHIFNAVILTTIISAANSN 393

Query: 365 LYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCLLAYMNVSSGSAQVFNYFV 424
           +YV SR L+GL+ +  AP+  + T+K GVPY ++  + +F  LAYM  S+G  +VF + +
Sbjct: 394 IYVGSRILFGLSKNKLAPKFLSRTSKGGVPYIAVFATAVFGALAYMETSTGGDKVFEWLL 453

Query: 425 NVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLSYTAAFQPWSTYVALFFCCLIGLIK 484
           N+  + G  +W+ I I++IRF +A++ +   +  L + A   P   Y + FF  +I +I+
Sbjct: 454 NITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPGLAYYSSFFMIIIIIIQ 513

Query: 485 NYTVFLGHKFDYKTFISGYIGIPVYLICYVGYKVVYRTKLI-KPEDVDLYTFKDAIDA 541
            +T F   KF+  +F++ YI I +++  ++ ++ ++R + I K EDVD+ + +  I+A
Sbjct: 514 GFTAF-APKFNGSSFLAAYISIFLFIAVWILFECIFRCRFIWKIEDVDIDSDRRDIEA 570

>CAGL0E05632g Chr5 complement(556856..558652) [1797 bp, 598 aa] {ON}
           similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348c PUT4 proline and gamma-aminobutyrate permease
          Length = 598

 Score =  315 bits (806), Expect = 3e-99,   Method: Compositional matrix adjust.
 Identities = 178/508 (35%), Positives = 275/508 (54%), Gaps = 20/508 (3%)

Query: 47  GIRLKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILISYSFVGLLVYTVMSCL 106
           G  LK+ L++RHV +                       P  + ISY  +  ++Y +M  +
Sbjct: 72  GHELKQGLKSRHVQLIALGGAIGTGLFVGTSSTLHTCGPAGLFISYCIISSVIYPIMQGI 131

Query: 107 GEMAAFIP-----LDGFTSY-ASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFW 160
           GEM  ++P      +GF +Y   +YVD ++GFA  ++Y + Y I+   + TA + V+++W
Sbjct: 132 GEMVCYLPGSGSKPEGFAAYLVGKYVDESLGFADAWNYYYCYVILVAAECTAASGVVEYW 191

Query: 161 VSRDRVNPGVWITIFLALIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXX 220
            +   V    WITIFLA +V++N   V+F+GE EFW +S+K                   
Sbjct: 192 TTS--VPKAAWITIFLAAVVILNFTAVKFYGESEFWFASIKILCIVGLIILSFILFWGGG 249

Query: 221 PNHDRTGFRFWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYT-GTELCGIVAAEAK 279
           PNHDR GFR+W++PG F  +     GS G               +  G E+  + ++E +
Sbjct: 250 PNHDRLGFRYWQNPGGFAHHIRG--GSFGSFLDIYTGIIKGGFAFILGPEMIAMTSSEVE 307

Query: 280 NPRRSVPRAIKLTLYRIVVFYVITILLLGMTVAYNDPRLLXXXXXXX-XXXXXPFVVAIE 338
           + RR++ +A +  ++R++ FY++  L + + VAYNDP L              PFV+ I+
Sbjct: 308 DQRRNIAKAARRFVWRLMFFYILGALSISVIVAYNDPALENALAQNKPGAGSSPFVIGIQ 367

Query: 339 NASIPVLPHIFNVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSL 398
           NA I VLPHI N C+L   +SA N+ ++ +SRSL  +A +G+APRIFA  N+WGVPYY++
Sbjct: 368 NAGIKVLPHIINACILSSAWSAGNAFMFTSSRSLLTMAQNGQAPRIFAKVNRWGVPYYAV 427

Query: 399 GLSVLFCLLAYMNVSSGSAQVFNYFVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSS 458
           GLS     LAY+N SS +A VFN+F N+  I G + WI + I YIRF KAI    G +S 
Sbjct: 428 GLSSAISCLAYLNCSSSTADVFNWFSNISVISGFIGWICVCIAYIRFHKAILFH-GMQSR 486

Query: 459 LSYTAAFQPWSTYVALFFCCLIGLIKNYTVFLGHKFDYKTFISGYIGIPVYLICYVGYKV 518
           L YTA   P+  Y  L    +I L   Y VF+   +D K F++ YI +PV+ + ++G++ 
Sbjct: 487 LPYTARGMPYLIYWPLLVISIITLTNGYEVFIPRFWDAKNFVAAYITLPVFWVLWIGHR- 545

Query: 519 VYRTKLI------KPEDVDLYTFKDAID 540
           VYR K+         E++D+ T  + I+
Sbjct: 546 VYRRKIFTLKWWKSIEEIDVVTGVEEIE 573

>TDEL0A08030 Chr1 (1405718..1407262) [1545 bp, 514 aa] {ON} 
          Length = 514

 Score =  311 bits (796), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 174/501 (34%), Positives = 269/501 (53%), Gaps = 14/501 (2%)

Query: 36  SVSEGVDGKHEG-----IRLKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILI 90
           ++S+    + EG       L +EL    VS+                       P+SI +
Sbjct: 14  TLSDSASSRDEGGSTNEATLSRELSPGVVSLLTLGSAVGTGLIIGSGTALARGGPISIFL 73

Query: 91  SYSFVGLLVYTVMSCLGEMAAFIPLD-GFTSYASRYVDPAVGFAVGYSYLFKYFIVTPNQ 149
           +Y F G ++  V+  L EMAAF P+D GF+ Y ++YVDPA GFA G++Y  KY IV    
Sbjct: 74  AYLFTGSILAVVIFSLSEMAAFHPMDRGFSGYLTKYVDPAFGFAAGWNYFLKYAIVLSAN 133

Query: 150 LTAGAMVMQFWVSRDRVNPGVWITIFLALIVLINTVGVRFFGEFEFWLSSVKXXXXXXXX 209
           LTA  +V+ +W  R  +N  VW+T+  A   ++N + VR+FG+ E +++  K        
Sbjct: 134 LTAFGLVIGYW--RPDINVAVWVTVLYANAFVVNFLAVRYFGKLEAFMTVAKLTILLLIF 191

Query: 210 XXXXXXXXXXXPNHDRTGFRFWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTE 269
                      P+H   GFR+WR+ G F PY   + G+ GK              + G+E
Sbjct: 192 IVCLVITCGGGPDHTTIGFRYWRESG-FLPY--LVKGNTGKFLGWWACVIQSIFGFMGSE 248

Query: 270 LCGIVAAEAKNPRRSVPRAIKLTLYRIVVFYVITILLLGMTVAYNDPRLLXXXXXXXXXX 329
           + GI+  E  NPR+++P+A +  + RI VFY+  + +LG+ V+ ++ +L+          
Sbjct: 249 MIGIIYGETANPRKTIPKASRNVIIRICVFYIFGVFVLGLAVSPHNAKLVHAHSTDANAS 308

Query: 330 XXPFVVAIENASIPVLPHIFNVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPRIFATTN 389
             PFV+AI  + I VLP   N  +LVF+ S+  +D+Y+ SR LYGLA DG AP+IF   N
Sbjct: 309 --PFVIAISTSGIKVLPSFVNAFLLVFITSSAYTDIYICSRQLYGLAKDGAAPKIFLRLN 366

Query: 390 KWGVPYYSLGLSVLFCLLAYMNVSSGSAQVFNYFVNVVSIFGLLSWITILITYIRFDKAI 449
           K  +P     +  L   LAYMN    +A VF Y  + VS+FG+L+W  IL+ YI +D+ +
Sbjct: 367 KHKIPMVGCVVGSLLGFLAYMNTKKSAATVFGYITSTVSVFGILNWFYILVAYIHYDRVV 426

Query: 450 RVQFGDKSSLSYTAAFQPWSTYVALFFCCLIGLIKNYTVFLGHKFDYKTFISGYIGIPVY 509
           +        + +   FQP++ Y+ALFF  +I     Y+ F+  KF+YK FI+ YIGI   
Sbjct: 427 KSHGVRLDEIPFRMPFQPYAAYIALFFVSVITFFNGYSAFI-LKFNYKLFITSYIGIFAN 485

Query: 510 LICYVGYKVVYRTKLIKPEDV 530
           ++  +GYK+ Y+TK +KPE++
Sbjct: 486 VLLVLGYKLYYKTKWVKPEEI 506

>YEL063C Chr5 complement(31694..33466) [1773 bp, 590 aa] {ON}
           CAN1Plasma membrane arginine permease, requires
           phosphatidyl ethanolamine (PE) for localization,
           exclusively associated with lipid rafts; mutation
           confers canavanine resistance
          Length = 590

 Score =  313 bits (802), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 179/512 (34%), Positives = 279/512 (54%), Gaps = 13/512 (2%)

Query: 36  SVSEGVDGKHEG----IRLKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILIS 91
           S+ +G+  + EG      +K+EL+ RH+ M                       PV  LIS
Sbjct: 66  SMEDGIGDEDEGEVQNAEVKRELKQRHIGMIALGGTIGTGLFIGLSTPLTNAGPVGALIS 125

Query: 92  YSFVGLLVYTVMSCLGEMAAFIPL-DGFTSYASRYVDPAVGFAVGYSYLFKYFIVTPNQL 150
           Y F+G L Y+V   LGEMA FIP+   FT ++ R++ PA G A GY Y F + I    +L
Sbjct: 126 YLFMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALEL 185

Query: 151 TAGAMVMQFWVSRDRVNPGVWITIFLALIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXX 210
           +    V+QFW  +  V    WI+IF  +I ++N   V+++GEFEFW++S+K         
Sbjct: 186 SVVGQVIQFWTYK--VPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLI 243

Query: 211 XXXXXXXXXXPNHDRTGFRFWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTEL 270
                           GFR+WR+PGA+ P   +   ++G+              + GTEL
Sbjct: 244 YCFCMVCGAGVTGP-VGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTEL 302

Query: 271 CGIVAAEAKNPRRSVPRAIKLTLYRIVVFYVITILLLGMTVAYNDPRLLXXXXXXXXXXX 330
            GI A EA NPR+SVPRAIK  ++RI+ FY+ ++L +G+ V YNDP+L            
Sbjct: 303 VGITAGEAANPRKSVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKL---TQSTSYVST 359

Query: 331 XPFVVAIENASIPVLPHIFNVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPRIFATTNK 390
            PF++AIEN+   VLPHIFN  +L  + SA NS++YV SR L+GL+ +  AP+  + T K
Sbjct: 360 SPFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTK 419

Query: 391 WGVPYYSLGLSVLFCLLAYMNVSSGSAQVFNYFVNVVSIFGLLSWITILITYIRFDKAIR 450
            GVPY ++ ++  F  LAYM  S+G  +VF + +N+  + G  +W+ I I++IRF +A++
Sbjct: 420 GGVPYIAVFVTAAFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALK 479

Query: 451 VQFGDKSSLSYTAAFQPWSTYVALFFCCLIGLIKNYTVFLGHKFDYKTFISGYIGIPVYL 510
            +   +  L + A   P   Y A  F  +I +I+ +T F   KF+  +F + YI I ++L
Sbjct: 480 YRGISRDELPFKAKLMPGLAYYAATFMTIIIIIQGFTAF-APKFNGVSFAAAYISIFLFL 538

Query: 511 ICYVGYKVVYRTKLI-KPEDVDLYTFKDAIDA 541
             ++ ++ ++R + I K  DVD+ + +  I+A
Sbjct: 539 AVWILFQCIFRCRFIWKIGDVDIDSDRRDIEA 570

>YOR348C Chr15 complement(986899..988782) [1884 bp, 627 aa] {ON}
           PUT4Proline permease, required for high-affinity
           transport of proline; also transports the toxic proline
           analog azetidine-2-carboxylate (AzC); PUT4 transcription
           is repressed in ammonia-grown cells
          Length = 627

 Score =  313 bits (803), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 182/526 (34%), Positives = 277/526 (52%), Gaps = 20/526 (3%)

Query: 7   MEK--KNAGVLYSNETLEEGIVTLESEGQVRSVSEGVDGKHEGIRLKKELEARHVSMXXX 64
           MEK  KN     +    E+ I+ ++ E      S  VDG  E  +LK+ L++RHV +   
Sbjct: 66  MEKISKNQSASSNGTIREDLIMDVDLEK-----SPSVDGDSEPHKLKQGLQSRHVQLIAL 120

Query: 65  XXXXXXXXXXXXXXXXXXXXPVSILISYSFVGLLVYTVMSCLGEMAAFIPLDGFTSYAS- 123
                               P  + ISY  +  ++Y +M  LGEM  F+P DG  S  S 
Sbjct: 121 GGAIGTGLLVGTSSTLHTCGPAGLFISYIIISAVIYPIMCALGEMVCFLPGDGSDSAGST 180

Query: 124 -----RYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVNPGVWITIFLAL 178
                RYVDP++GFA G++Y + Y I+   + TA + V+++W +   V  GVWITIFL +
Sbjct: 181 ANLVTRYVDPSLGFATGWNYFYCYVILVAAECTAASGVVEYWTTA--VPKGVWITIFLCV 238

Query: 179 IVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGFRFWRDPGAFK 238
           +V++N   V+ +GE EFW +S+K                   PNHDR GFR+W+ PGAF 
Sbjct: 239 VVILNFSAVKVYGESEFWFASIKILCIVGLIILSFILFWGGGPNHDRLGFRYWQHPGAFA 298

Query: 239 PYSEAISGSKGKXXXXXXXXXXXXXXYT-GTELCGIVAAEAKNPRRSVPRAIKLTLYRIV 297
            +     GS G               +  G EL  + +AE  + RR++ +A +  ++R++
Sbjct: 299 HH--LTGGSLGNFTDIYTGIIKGAFAFILGPELVCMTSAECADQRRNIAKASRRFVWRLI 356

Query: 298 VFYVITILLLGMTVAYNDPRLLXXXXXXX-XXXXXPFVVAIENASIPVLPHIFNVCVLVF 356
            FYV+  L + + V YNDP L+             PFV+ I+NA I VLPHI N C+L  
Sbjct: 357 FFYVLGTLAISVIVPYNDPTLVNALAQGKPGAGSSPFVIGIQNAGIKVLPHIINGCILTS 416

Query: 357 VFSACNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCLLAYMNVSSGS 416
            +SA N+ ++ ++RSL  +A  G+AP+     NKWGVPY ++G+S L   LAY+NVSS +
Sbjct: 417 AWSAANAFMFASTRSLLTMAQTGQAPKCLGRINKWGVPYVAVGVSFLCSCLAYLNVSSST 476

Query: 417 AQVFNYFVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLSYTAAFQPWSTYVALFF 476
           A VFN+F N+ +I G L W+   I Y+RF KAI    G    L +    QP++ + +L  
Sbjct: 477 ADVFNWFSNISTISGFLGWMCGCIAYLRFRKAIFYN-GLYDRLPFKTWGQPYTVWFSLIV 535

Query: 477 CCLIGLIKNYTVFLGHKFDYKTFISGYIGIPVYLICYVGYKVVYRT 522
             +I +   Y +F+   +    FI+ YI +P++L+ + G+K+  RT
Sbjct: 536 IGIITITNGYAIFIPKYWRVADFIAAYITLPIFLVLWFGHKLYTRT 581

>CAGL0J08184g Chr10 (806631..808349) [1719 bp, 572 aa] {ON} similar
           to uniprot|P04817 Saccharomyces cerevisiae YEL063c CAN1
           or uniprot|P38971 Saccharomyces cerevisiae YNL270c ALP1
           or uniprot|P32487 Saccharomyces cerevisiae YNL268w LYP1
          Length = 572

 Score =  310 bits (795), Expect = 6e-98,   Method: Compositional matrix adjust.
 Identities = 179/542 (33%), Positives = 283/542 (52%), Gaps = 14/542 (2%)

Query: 2   NSDTSMEKKNAGVLYSNETLEEGIVTLESEGQVRSVSEGVDGKHEGIRLKKELEARHVSM 61
            +D+     N G L   +       T  S  Q   ++   D   E   +K+ L+ RH+ M
Sbjct: 23  GNDSDSHNSNTGELGRRKR-----KTSVSSTQYEDLATEKDELLEHHDVKRSLKQRHIGM 77

Query: 62  XXXXXXXXXXXXXXXXXXXXXXXPVSILISYSFVGLLVYTVMSCLGEMAAFIPL-DGFTS 120
                                  PV  L++Y F+G +V++V   LGEMA FIP+   F+ 
Sbjct: 78  IALGGTIGTGLFIGIATPLANAGPVGALVAYLFMGTVVFSVTQSLGEMATFIPVTSSFSV 137

Query: 121 YASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVNPGVWITIFLALIV 180
           +A R++ PA+G A GY Y   +      +L+    ++QFW  +  V    WI+IF  L+ 
Sbjct: 138 FAQRFLSPALGAANGYMYFLSWCFTFALELSVVGQIIQFWTFK--VPLAAWISIFWVLLT 195

Query: 181 LINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGFRFWRDPGAFKPY 240
             N   V+F+GEFEFW++S+K                         GFR+WR+PGA  P 
Sbjct: 196 AFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLCIVCGAGKTGP-IGFRYWRNPGAMGPG 254

Query: 241 SEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVVFY 300
             + +  + +              Y GTEL GI A EA NPR++VPRAI+  L RI++FY
Sbjct: 255 IISSNTGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAVPRAIRKVLIRILLFY 314

Query: 301 VITILLLGMTVAYNDPRLLXXXXXXXXXXXXPFVVAIENASIPVLPHIFNVCVLVFVFSA 360
           + ++  +G+TV YNDP+L             PF++ I+NA   VLPHIFN  +L  + SA
Sbjct: 315 IGSLFFIGLTVPYNDPKL---TSTDSYVSSSPFIITIQNAGTRVLPHIFNAVILTTIISA 371

Query: 361 CNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCLLAYMNVSSGSAQVF 420
            NS++YV SR L+ +A +G AP+  A T   GVPY S+     F  L+YM +S+G A+ F
Sbjct: 372 GNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVLAISAFGSLSYMELSTGGAKAF 431

Query: 421 NYFVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLSYTAAFQPWSTYVALFFCCLI 480
           N+ +N+  + G  +W+ I  +++RF +A++ +   +  L Y A + PW  Y A+FF  +I
Sbjct: 432 NWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDDLPYKALWMPWLAYYAIFFMVVI 491

Query: 481 GLIKNYTVFLGHKFDYKTFISGYIGIPVYLICYVGYKVVYRTKLI-KPEDVDLYTFKDAI 539
            LI+ +T F  H F  + F++ YI + ++L+ +  +++ +R ++I K EDVD+ T +  I
Sbjct: 492 ILIQGFTSFAPH-FSGRDFVAAYISVGLFLVFWGFFQIYFRCRIIWKLEDVDIDTDRREI 550

Query: 540 DA 541
           ++
Sbjct: 551 ES 552

>Kpol_2000.64 s2000 complement(130912..132744) [1833 bp, 610 aa]
           {ON} complement(130912..132744) [1833 nt, 611 aa]
          Length = 610

 Score =  310 bits (795), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 183/566 (32%), Positives = 290/566 (51%), Gaps = 29/566 (5%)

Query: 13  GVLYSNETLEE-GIVTLESEGQVRSVSEGVDGKHEGIRLKKELEARHVSMXXXXXXXXXX 71
           G L+S   L + G  +L  + +    S+  + +++  R+K+ L+ RH+ M          
Sbjct: 70  GSLHSGSNLHQHGTTSLHDDEE----SDTEEAQYQDTRVKRALKQRHIGMIALGGTIGTG 125

Query: 72  XXXXXXXXXXXXXPVSILISYSFVGLLVYTVMSCLGEMAAFIPL-DGFTSYASRYVDPAV 130
                        PV  LI+Y F+G +VY V   LGEMA FIP+    T ++ R++ PA 
Sbjct: 126 LFVGIATPLSNAGPVGSLIAYIFMGSVVYFVTQSLGEMATFIPVTSSITVFSKRFLSPAF 185

Query: 131 GFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVNPGVWITIFLALIVLINTVGVRFF 190
           G A GY Y F + I    +++    V+Q+W     V    WI IF  ++ L+N   V+ +
Sbjct: 186 GVANGYMYWFNWAITYAVEISVIGQVIQYWTKA--VPLAAWIGIFWVIVTLMNFFPVKVY 243

Query: 191 GEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGFRFWRDPGAFKPYSEAISGSKGK 250
           GEFEFW++S+K                    +    GFR+WR+PG + P   +    + +
Sbjct: 244 GEFEFWIASIKVLAIMGYLIYALIIVCGGS-HQGPIGFRYWRNPGPWGPGIISDKTGEAR 302

Query: 251 XXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVVFYVITILLLGMT 310
                         Y GTEL GI A EA NPR+SVPRAI   ++RI +FY++++  +G+ 
Sbjct: 303 FLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAINKVVFRIALFYIMSLFFIGLL 362

Query: 311 VAYNDPRLLXXXXXXXXXXXXPFVVAIENASIPVLPHIFNVCVLVFVFSACNSDLYVASR 370
           V +ND RL             PFV++I+NA    LP IFN  VL+ + SA NS++YV SR
Sbjct: 363 VPFNDDRL---ANDSAVIASSPFVISIQNAGTRALPDIFNAVVLLTIISAANSNVYVGSR 419

Query: 371 SLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCLLAYMNVSSGSAQVFNYFVNVVSIF 430
            LY LA+ G AP+IF+   K+GVPY  +  +    LLA++ V++ +   FN+ +N+ ++ 
Sbjct: 420 VLYALALTGNAPKIFSYVTKYGVPYMGVICTAALGLLAFLVVNNNANTAFNWLINISTLA 479

Query: 431 GLLSWITILITYIRFDKAIRVQFGDKSSLSYTAAFQPWSTYVALFFCCLIGLIKNYTVFL 490
           GL +W+ I +++IRF +A++ +   +  L + A   PW  Y A FF  +I  I+ +  F 
Sbjct: 480 GLCAWLFISLSHIRFMQALKYRGISRDDLPFKAKLMPWGAYYASFFVTVIIFIQGFQAFT 539

Query: 491 GHKFDYKTFISGYIGIPVYLICYVGYKVVYRTKLI-KPEDVDLYTFKDAIDAXXXXXXXX 549
             KFD  TF + YI + +  + + G ++ YR + I K ED+D+ + +  I+A        
Sbjct: 540 -PKFDVSTFFTSYISLILLAVLFSGCQLYYRCRFIWKVEDIDIDSDRREIEAIIWE---- 594

Query: 550 XXXXXXNMENSPKNFKWFYETFLGWI 575
                   E+ PKN    +E F  W+
Sbjct: 595 --------EDEPKN---LWEKFWAWV 609

>Ecym_1088 Chr1 (184038..185741) [1704 bp, 567 aa] {ON} similar to
           Ashbya gossypii AFR667C
          Length = 567

 Score =  309 bits (791), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 172/502 (34%), Positives = 271/502 (53%), Gaps = 8/502 (1%)

Query: 42  DGKHEGIRLKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILISYSFVGLLVYT 101
           +G +    +K+ L+ARH+SM                       PV  LI+Y F+G +VY+
Sbjct: 52  EGDYHETEVKRALKARHISMIALGGTIGTGLFIVIASPLRTAGPVGSLIAYIFMGTVVYS 111

Query: 102 VMSCLGEMAAFIPL-DGFTSYASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFW 160
           +   LGEMA FIP+    T ++ R++ PA G A GY Y F + I    +L+    ++ +W
Sbjct: 112 ITQSLGEMATFIPVTSSVTVFSKRFLSPAFGVANGYMYWFNWAITFAVELSVVGQIINYW 171

Query: 161 VSRDRVNPGVWITIFLALIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXX 220
            S   V  G WITIF  ++ L+N   VRF+GE EFW++SVK                   
Sbjct: 172 TSV--VPLGAWITIFWIIVTLLNFFPVRFYGEIEFWIASVKVITIVGYLIYAFIVVCGGS 229

Query: 221 PNHDRTGFRFWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKN 280
            +    GFR WR+PG +     + + ++ +              Y GTEL GI A E+KN
Sbjct: 230 -SQGPIGFRNWRNPGPWGTGVISSNQTEARFLGWVSSLIKAAFTYQGTELVGITAGESKN 288

Query: 281 PRRSVPRAIKLTLYRIVVFYVITILLLGMTVAYNDPRLLXXXXXXXXXXXXPFVVAIENA 340
           PR++VP+AI    +RI+ FY++++  +G+ V YNDPR+             PFV++I NA
Sbjct: 289 PRKTVPKAINKVFFRILFFYILSLFFVGLLVPYNDPRM--DNTSDTDVNASPFVISIRNA 346

Query: 341 SIPVLPHIFNVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGL 400
              +LP IFN  VLV V SA NS++Y+ SR +Y LA  G AP+ F   N+ GVP   + +
Sbjct: 347 GTKILPDIFNAVVLVTVVSAANSNVYIGSRVIYSLAQSGNAPKQFGYVNRHGVPVLGVMV 406

Query: 401 SVLFCLLAYMNVSSGSAQVFNYFVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLS 460
           + L  L+A++ V++ +   FN+ VN+ ++ GL +W+ I + +IRF + ++ +   + +L 
Sbjct: 407 TALMGLMAFLVVNNNAKAAFNWLVNISTLAGLCAWLFISLAHIRFMQCLKQRGISRDALP 466

Query: 461 YTAAFQPWSTYVALFFCCLIGLIKNYTVFLGHKFDYKTFISGYIGIPVYLICYVGYKVVY 520
           + A F PW+ Y A  F  +I  I+ YT F   KFD   F + YI + + L+ ++G ++ Y
Sbjct: 467 FKAKFMPWAAYYAASFVFVIIFIQGYTAF-SPKFDVTQFFTAYISLMLMLVVFIGCQIYY 525

Query: 521 RTKLI-KPEDVDLYTFKDAIDA 541
           + + + K ED+D+ T +  IDA
Sbjct: 526 KCRFLWKLEDIDIDTNRREIDA 547

>Smik_15.532 Chr15 complement(932437..934332) [1896 bp, 631 aa] {ON}
           YOR348C (REAL)
          Length = 631

 Score =  311 bits (796), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 181/526 (34%), Positives = 277/526 (52%), Gaps = 20/526 (3%)

Query: 7   MEK--KNAGVLYSNETLEEGIVTLESEGQVRSVSEGVDGKHEGIRLKKELEARHVSMXXX 64
           MEK  KN     +    E+ I+ ++ E      S  V+G +E  +LK+ L++RHV +   
Sbjct: 70  MEKISKNHSASSNGTIREDLIMDVDVEK-----SPSVEGDNEPHKLKQGLQSRHVQLIAL 124

Query: 65  XXXXXXXXXXXXXXXXXXXXPVSILISYSFVGLLVYTVMSCLGEMAAFIPLDGFTSYAS- 123
                               P  + ISY  +  ++Y +M  LGEM  F+P DG  S  S 
Sbjct: 125 GGAIGTGLLVGTSSTLHTCGPAGLFISYIIISAVIYPIMCALGEMVCFLPGDGSDSAGST 184

Query: 124 -----RYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVNPGVWITIFLAL 178
                RYVD ++GFA G++Y + Y I+   + TA + V+++W +   V  GVWITIFL +
Sbjct: 185 ANLVTRYVDASLGFATGWNYFYCYVILVAAECTAASGVVEYWTTA--VPKGVWITIFLCV 242

Query: 179 IVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGFRFWRDPGAFK 238
           +VL+N   V+ +GE EFW +S+K                   PNHDR GFR+W+ PGAF 
Sbjct: 243 VVLLNLSAVKVYGESEFWFASIKILCIVGLIILSFILFWGGGPNHDRLGFRYWQHPGAFA 302

Query: 239 PYSEAISGSKGKXXXXXXXXXXXXXXYT-GTELCGIVAAEAKNPRRSVPRAIKLTLYRIV 297
            +     GS G               +  G EL  + +AE  + RR++ +A +  ++R++
Sbjct: 303 HH--LTGGSLGNFTDIYTGIIKGAFAFILGPELVCMTSAECADQRRNISKASRRFVWRLI 360

Query: 298 VFYVITILLLGMTVAYNDPRLLXXXXXXX-XXXXXPFVVAIENASIPVLPHIFNVCVLVF 356
            FYV+  L + + V YNDP L+             PFV+ I+NA I VLPHI N C+L  
Sbjct: 361 FFYVLGTLAISVIVPYNDPSLVNALAQGKPGAGSSPFVIGIQNAGIKVLPHIINGCILSS 420

Query: 357 VFSACNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCLLAYMNVSSGS 416
            +SA N+ ++ ++RSL  +A  G+AP+     N+WGVPY ++G+S L   LAY+NVSS +
Sbjct: 421 AWSAANAFMFASTRSLLTMAQTGQAPKCLGRINRWGVPYVAVGVSFLCSCLAYLNVSSST 480

Query: 417 AQVFNYFVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLSYTAAFQPWSTYVALFF 476
           A VFN+F N+ +I G L W+   I Y+RF KAI    G    L +    QP++ + +L  
Sbjct: 481 ADVFNWFSNISTISGFLGWMCGCIAYLRFRKAIFYN-GLFDRLPFKTWGQPYTVWASLIV 539

Query: 477 CCLIGLIKNYTVFLGHKFDYKTFISGYIGIPVYLICYVGYKVVYRT 522
             +I L   Y +F+   +    FI+ YI +P++L+ + G+K+  RT
Sbjct: 540 VGIITLTNGYAIFIPKYWKIADFIAAYITLPIFLVLWFGHKLYTRT 585

>TDEL0C06180 Chr3 (1120158..1121909) [1752 bp, 583 aa] {ON} Anc_1.83
           YEL063C
          Length = 583

 Score =  309 bits (791), Expect = 3e-97,   Method: Compositional matrix adjust.
 Identities = 177/502 (35%), Positives = 270/502 (53%), Gaps = 9/502 (1%)

Query: 42  DGKHEGIRLKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILISYSFVGLLVYT 101
           +G+     +K+ L+ RH+ M                       PV  LI+Y F+  LVY+
Sbjct: 69  EGQVHEAEVKRALKQRHIGMIALGGTIGTGLFIGISTPLSNAGPVGGLIAYLFMATLVYS 128

Query: 102 VMSCLGEMAAFIPL-DGFTSYASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFW 160
           V+  LGEMA FIP+   FT ++SR++ PA G A GY Y F + I    +L+    +++FW
Sbjct: 129 VVQSLGEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFW 188

Query: 161 VSRDRVNPGVWITIFLALIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXX 220
            +   V    WITIF  L+ + N   V+++GEFEFW++ +K                   
Sbjct: 189 TTA--VPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGAG 246

Query: 221 PNHDRTGFRFWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKN 280
                 GFR+WR+PGA+ P   +   ++G+              Y GTEL GI A EA N
Sbjct: 247 ITGP-VGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAAN 305

Query: 281 PRRSVPRAIKLTLYRIVVFYVITILLLGMTVAYNDPRLLXXXXXXXXXXXXPFVVAIENA 340
           PR+SVPRAIK  ++RI+VFY    + +G+ V YNDP+L             PF++AIEN+
Sbjct: 306 PRKSVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKL---NSSDSYVSSSPFIIAIENS 362

Query: 341 SIPVLPHIFNVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGL 400
              VLPHIFN  VL  + SA NS++YV SR +YGLA    AP  F  TN  GVPY+++  
Sbjct: 363 GTKVLPHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFF 422

Query: 401 SVLFCLLAYMNVSSGSAQVFNYFVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLS 460
           +  F  LAYM +S+G A  FN+ +N+  + G  +W+ I   +IRF +A++ +   +  L 
Sbjct: 423 TSAFGALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLP 482

Query: 461 YTAAFQPWSTYVALFFCCLIGLIKNYTVFLGHKFDYKTFISGYIGIPVYLICYVGYKVVY 520
           + A F PW  Y ALFF  +I LI+ +T F    F    F + Y+ + +++  ++G ++ +
Sbjct: 483 FKAKFMPWLAYYALFFMVVIILIQGFTAF-APTFSGVDFAAAYVSVFLFIAIWLGAQIWF 541

Query: 521 RTKLI-KPEDVDLYTFKDAIDA 541
           R ++  + ++VD+ T +  I+A
Sbjct: 542 RCRIFHRLDEVDIDTDRRDIEA 563

>SAKL0C02684g Chr3 complement(251988..253754) [1767 bp, 588 aa] {ON}
           similar to uniprot|P04817 Saccharomyces cerevisiae
           YEL063C CAN1 Plasma membrane arginine permease requires
           phosphatidyl ethanolamine (PE) for localization
           exclusively associated with lipid rafts mutation confers
           canavanine resistance
          Length = 588

 Score =  308 bits (789), Expect = 7e-97,   Method: Compositional matrix adjust.
 Identities = 170/485 (35%), Positives = 262/485 (54%), Gaps = 8/485 (1%)

Query: 42  DGKHEGIRLKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILISYSFVGLLVYT 101
           +G  +   +K+ L+ RH+SM                       PV  LI+Y F+G + Y 
Sbjct: 74  EGNVQDAEVKRALKPRHISMIALGGTIGTGLFIGISSPLADAGPVGALIAYMFMGTIAYF 133

Query: 102 VMSCLGEMAAFIPL-DGFTSYASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFW 160
           V   LGEMA FIP+   FT +  R++ PA G A GY Y F + I    +L+    ++QFW
Sbjct: 134 VTQSLGEMATFIPVTSSFTVFTQRFLSPAFGVANGYLYWFSWCITFALELSVVGQIIQFW 193

Query: 161 VSRDRVNPGVWITIFLALIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXX 220
                V  G WI IF  ++   N   V+++GE EFW++ +K                   
Sbjct: 194 TFA--VPLGAWIAIFWVILTTSNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFIMVCGAG 251

Query: 221 PNHDRTGFRFWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKN 280
                 GFR+WR+PG + P   +   ++G+              Y GTEL GI A E+KN
Sbjct: 252 -KTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLINAAFTYQGTELVGITAGESKN 310

Query: 281 PRRSVPRAIKLTLYRIVVFYVITILLLGMTVAYNDPRLLXXXXXXXXXXXXPFVVAIENA 340
           PRR+VPRAI    +RI+ FY++++L +G+ V +NDP+L             PFV+AIEN+
Sbjct: 311 PRRTVPRAINKVFFRILFFYILSLLFIGLLVPFNDPKL---KSEDSYISSSPFVIAIENS 367

Query: 341 SIPVLPHIFNVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGL 400
              VLPHIFN  +L  + SA NS++YV SR LYGLA +  AP++FA   K GVPY S+  
Sbjct: 368 GTKVLPHIFNAVILSTIISAGNSNIYVGSRVLYGLAKNKLAPKVFARATKDGVPYISVLG 427

Query: 401 SVLFCLLAYMNVSSGSAQVFNYFVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLS 460
           +  F  LAY+N+S+ + +VF++ +N+ +I G  +W+ I + +IRF + ++ +   ++ L 
Sbjct: 428 TAAFGFLAYLNLSNSAQKVFDWLLNITAIAGFFAWLFISLAHIRFMQVLKDRNMSRNDLP 487

Query: 461 YTAAFQPWSTYVALFFCCLIGLIKNYTVFLGHKFDYKTFISGYIGIPVYLICYVGYKVVY 520
           + A F PW  Y + FF  LI +I+ +T F   KF+   F + YI + ++L  +V +++ +
Sbjct: 488 FKAKFMPWGAYYSAFFISLIIIIQGFTAF-APKFNVSNFFAAYISVFLFLAIWVVFQIRF 546

Query: 521 RTKLI 525
           RT+ I
Sbjct: 547 RTRFI 551

>SAKL0B10956g Chr2 complement(949900..951618) [1719 bp, 572 aa] {ON}
           similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348C PUT4 proline-specific permease (also capable of
           transporting alanine and glycine) putative proline-
           specific permease
          Length = 572

 Score =  307 bits (787), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 183/552 (33%), Positives = 293/552 (53%), Gaps = 31/552 (5%)

Query: 4   DTSMEKKNAGVLYSNETLEEGIVTLESEGQVR----SVSEGVDGKHEGIRLKKELEARHV 59
           +T++  K  G +Y         + +ES  Q+     S S+   G H    LKK L++RH+
Sbjct: 12  ETTVTDKQTGQVYE--------IDIESYSQISGPKVSSSDAPQGDHT---LKKGLKSRHI 60

Query: 60  SMXXXXXXXXXXXXXXXXXXXXXXXPVSILISYSFVGLLVYTVMSCLGEMAAFIPLDGFT 119
            +                       P  +  SY  + +++Y VM+ LGEM  ++P DG +
Sbjct: 61  QLIALGGCIGTGLFVGTSSTLHACGPAGLFTSYCIISVIIYPVMNALGEMVCYLPGDGSS 120

Query: 120 ------SYASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVNPGVWIT 173
                    +RYVDP++GFA G++Y + Y I+   + TA + V+Q+W +   V  G WIT
Sbjct: 121 SGGSISKLVTRYVDPSLGFATGWNYYYCYVILVAAECTAASGVVQYWTTA--VPKGAWIT 178

Query: 174 IFLALIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGFRFWRD 233
           IFL ++VL+N   V+F+GE EFW +S+K                   P+HDR GFR+W+ 
Sbjct: 179 IFLGVVVLLNFCAVKFYGESEFWFASMKILCILGLLFVSFILFWGGGPHHDRLGFRYWQK 238

Query: 234 PGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYT-GTELCGIVAAEAKNPRRSVPRAIKLT 292
           PGAF  +    SG+ G+              +  G EL  + +AEA++ RR++ +A +  
Sbjct: 239 PGAFAYH--ITSGNTGRFLDIWTGVIKGGFAFILGPELVALTSAEAQDARRNIQKASRRF 296

Query: 293 LYRIVVFYVITILLLGMTVAYNDPRL-LXXXXXXXXXXXXPFVVAIENASIPVLPHIFNV 351
           +YR++ FYV + L +G  VAYND  L              PFV+ I+NA I VLPHI NV
Sbjct: 297 VYRLIFFYVSSSLAIGCIVAYNDKTLSTALDQGKPGAGSSPFVIGIQNAGIKVLPHIINV 356

Query: 352 CVLVFVFSACNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCLLAYMN 411
           C+L   +S+ NS ++ ASRSL  ++ +G AP+I    N++GVPY ++ L+ L   +AY+N
Sbjct: 357 CILSSAWSSGNSFMFAASRSLLSMSQEGFAPKILGRVNRFGVPYAAVALTSLLSCIAYLN 416

Query: 412 VSSGSAQVFNYFVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLSYTAAFQPWSTY 471
           VSS +A VF +F N+ +I G + WI I I Y+RF KAI  Q      + +   FQP+ T+
Sbjct: 417 VSSSTADVFTWFSNISTISGFIGWICIGIAYLRFRKAIFFQ-NLYERVPFKTPFQPYGTW 475

Query: 472 VALFFCCLIGLIKNYTVFLGHKFDYKTFISGYIGIPVYLICYVGYKV---VYRTKLIKPE 528
             +    +I L   Y +F+   ++   FI+ Y+ +P++L+ ++G+K+    ++T  I   
Sbjct: 476 FFIIAVSVICLTNGYAIFIPANWNVSDFIAAYVTLPIFLVLWIGHKLWTRTWKTWAIPVP 535

Query: 529 DVDLYTFKDAID 540
           ++D+ T    I+
Sbjct: 536 EIDVTTGLKEIE 547

>YNL270C Chr14 complement(135940..137661) [1722 bp, 573 aa] {ON}
           ALP1Arginine transporter; expression is normally very
           low and it is unclear what conditions would induce
           significant expression
          Length = 573

 Score =  307 bits (786), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 174/527 (33%), Positives = 281/527 (53%), Gaps = 9/527 (1%)

Query: 16  YSNETLEEGIVTLESEGQVRSVSEGVDGKHEGIRLKKELEARHVSMXXXXXXXXXXXXXX 75
           YS E + + I T E + +  +  E      E   +K++L+ RH+ M              
Sbjct: 33  YSGENVTKAITT-ERKVEDDAAKETESSPQERREVKRKLKQRHIGMIALGGTIGTGLIIG 91

Query: 76  XXXXXXXXXPVSILISYSFVGLLVYTVMSCLGEMAAFIPL-DGFTSYASRYVDPAVGFAV 134
                    PV  LISY F+G ++Y+V   LGEM  FIP+   F+ +A R++ PA+G   
Sbjct: 92  IGPPLAHAGPVGALISYLFMGTVIYSVTQSLGEMVTFIPVTSSFSVFAQRFLSPALGATN 151

Query: 135 GYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVNPGVWITIFLALIVLINTVGVRFFGEFE 194
           GY Y   +      +L+    V+Q+W   + V    WI IF  L+  +N   V+++GEFE
Sbjct: 152 GYMYWLSWCFTFALELSVLGKVIQYWT--EAVPLAAWIVIFWCLLTSMNMFPVKYYGEFE 209

Query: 195 FWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGFRFWRDPGAFKPYSEAISGSKGKXXXX 254
           F ++S+K                    +    GFR+WR+PGA+ P   +   ++G+    
Sbjct: 210 FCIASIKVIALLGFIIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGW 269

Query: 255 XXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVVFYVITILLLGMTVAYN 314
                     Y GTEL GI A EA NPR+++PRAIK  + RI+VFY++++  +G+ V YN
Sbjct: 270 VSSLINAAFTYQGTELVGITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYN 329

Query: 315 DPRLLXXXXXXXXXXXXPFVVAIENASIPVLPHIFNVCVLVFVFSACNSDLYVASRSLYG 374
           DP+L             PF+++IEN+   VLP IFN  VL+ + SA NS++Y+ SR LY 
Sbjct: 330 DPKL---DSDGIFVSSSPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYS 386

Query: 375 LAIDGKAPRIFATTNKWGVPYYSLGLSVLFCLLAYMNVSSGSAQVFNYFVNVVSIFGLLS 434
           L+ +  APR  +   + GVPY+S+  + +F  LA++ VS+GS + FN+ +N+  + G  +
Sbjct: 387 LSKNSLAPRFLSNVTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFA 446

Query: 435 WITILITYIRFDKAIRVQFGDKSSLSYTAAFQPWSTYVALFFCCLIGLIKNYTVFLGHKF 494
           W+ I  ++IRF +AIR +   +  L Y A   P+  Y A FF  LI LI+ +T F    F
Sbjct: 447 WLLISFSHIRFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAF-APTF 505

Query: 495 DYKTFISGYIGIPVYLICYVGYKVVYRTKLI-KPEDVDLYTFKDAID 540
               F++ YI I ++L  ++ ++V ++ +L+ K +D+D+ + +  I+
Sbjct: 506 QPIDFVAAYISIFLFLAIWLSFQVWFKCRLLWKLQDIDIDSDRRQIE 552

>NCAS0E02260 Chr5 (437115..438896) [1782 bp, 593 aa] {ON} Anc_7.44
          Length = 593

 Score =  307 bits (786), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 175/515 (33%), Positives = 274/515 (53%), Gaps = 16/515 (3%)

Query: 38  SEGVDGKHEGIRLKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILISYSFVGL 97
            E      E  +LK+ L++RHV +                       P  +  SY  +  
Sbjct: 58  EEKQQQPEENGKLKQGLKSRHVQLIALGGTIGTGLLVGSSQTLATCGPAGLFTSYLIICT 117

Query: 98  LVYTVMSCLGEMAAFIPLDGFTSYAS------RYVDPAVGFAVGYSYLFKYFIVTPNQLT 151
            +Y +M+  GEM  ++P +G  S  S      +YVD ++GFA  ++Y + + I+   + T
Sbjct: 118 FIYPIMNAFGEMVCYLPGNGSDSAGSSAYLVEKYVDRSLGFASSWNYYYCFVILVATECT 177

Query: 152 AGAMVMQFWVSRDRVNPGVWITIFLALIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXX 211
           A A V+++W    +V  G WITIFL  +V +N + V F+GE EFW +S+K          
Sbjct: 178 AAAGVVEYWAWALKVPKGAWITIFLFCVVALNMLPVNFYGESEFWFASIKILCILGLIIL 237

Query: 212 XXXXXXXXXPNHDRTGFRFWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYT-GTEL 270
                    P+HDR GFR+W+ PGAF  +     G+ G               +  G EL
Sbjct: 238 SFILFWGGGPSHDRLGFRYWQRPGAFADH--ITDGTGGNFLDVYTGVIKGGFAFVLGPEL 295

Query: 271 CGIVAAEAKNPRRSVPRAIKLTLYRIVVFYVITILLLGMTVAYNDPRLLXXXXXXX-XXX 329
             + ++E  + RR++ +A +  ++R+++FYV+  L + + VAYNDP L            
Sbjct: 296 VSLTSSECHDQRRNIAKASRRFVWRLMIFYVLGSLSISVIVAYNDPNLQNALAQSKPGAG 355

Query: 330 XXPFVVAIENASIPVLPHIFNVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPRIFATTN 389
             PFV+ I+NA I VLPHI NVC++   +SA N+ ++ +SRSL  +A  G AP+ F+  N
Sbjct: 356 SSPFVIGIQNAGIKVLPHIINVCIMTSAWSAGNAYMFASSRSLLTMASHGHAPKFFSKIN 415

Query: 390 KWGVPYYSLGLSVLFCLLAYMNVSSGSAQVFNYFVNVVSIFGLLSWITILITYIRFDKAI 449
           ++GVPY ++G S LFC LAY+NVSS +A VFN+F N+ +I G + WI   + YIRF KAI
Sbjct: 416 RFGVPYVAVGFSFLFCCLAYLNVSSSTANVFNWFSNISTISGFIGWICACVAYIRFRKAI 475

Query: 450 RVQFGD-KSSLSYTAAFQPWSTYVALFFCCLIGLIKNYTVFLGHKFDYKTFISGYIGIPV 508
              F D    L Y    Q +  + +LF   LI L   Y +F+   +DYK FI+ YI +PV
Sbjct: 476 --IFNDLYDRLPYKGFAQKYLIWYSLFMVSLITLTNGYQIFIPRFWDYKDFIAAYITLPV 533

Query: 509 YLICYVGYKVV---YRTKLIKPEDVDLYTFKDAID 540
           +++ ++G+K+V   +R   I  + +D++T  + I+
Sbjct: 534 FIVLWIGHKLVTRSWRQWYIPVDKIDVFTGLEEIE 568

>CAGL0J08162g Chr10 complement(803679..805472) [1794 bp, 597 aa]
           {ON} highly similar to uniprot|P32487 Saccharomyces
           cerevisiae YNL268w LYP1 or uniprot|P04817 Saccharomyces
           cerevisiae YEL063c CAN1 or uniprot|P38971 Saccharomyces
           cerevisiae YNL270c ALP1
          Length = 597

 Score =  306 bits (785), Expect = 3e-96,   Method: Compositional matrix adjust.
 Identities = 176/495 (35%), Positives = 263/495 (53%), Gaps = 9/495 (1%)

Query: 49  RLKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILISYSFVGLLVYTVMSCLGE 108
           R+K+ L+ RH+ M                       PV  LI+Y F+G ++Y V   LGE
Sbjct: 90  RVKRALKQRHIGMIALGGTIGTGLFVGISTPLSNSGPVGALIAYIFMGTIIYFVTQSLGE 149

Query: 109 MAAFIPL-DGFTSYASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVN 167
           MA FIP+    T ++ R++ PA G A GY Y F + I    +++    V+Q+W  +  V 
Sbjct: 150 MATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEVSVIGQVIQYWTFK--VP 207

Query: 168 PGVWITIFLALIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTG 227
              WI IF  LI L+N   V+ +GEFEFW++S+K                    +    G
Sbjct: 208 LAAWIGIFWVLITLMNFFPVKIYGEFEFWVASIKVIAIVGYLIYALIIVCGGS-HQGPIG 266

Query: 228 FRFWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPR 287
           FR+WR+PGA      +    + +              Y GTEL GI A EA NPR+SVPR
Sbjct: 267 FRYWRNPGAMGAGIISSDLGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPR 326

Query: 288 AIKLTLYRIVVFYVITILLLGMTVAYNDPRLLXXXXXXXXXXXXPFVVAIENASIPVLPH 347
           AI   ++RIV+FY++++  +G+ V YNDPRL             PFV++I+NA   VLP 
Sbjct: 327 AINKVVFRIVLFYIMSLFFVGLLVPYNDPRLSASSAVIASS---PFVISIQNAGTKVLPD 383

Query: 348 IFNVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCLL 407
           IFN  VLV V SA NS++YV SR LY LA  G AP+ FA   + GVPY  +  + L  LL
Sbjct: 384 IFNAVVLVTVISAANSNVYVGSRVLYALAQSGNAPKQFAYVTRHGVPYLGVICTALLGLL 443

Query: 408 AYMNVSSGSAQVFNYFVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLSYTAAFQP 467
           A++ V+  +   FN+ +N+ ++ GL +W+ I + +IRF +A++ +   +  L + A F P
Sbjct: 444 AFLVVNHNANTAFNWLINISTLAGLCAWLFISLAHIRFMQALKFRGISRDDLPFKAKFMP 503

Query: 468 WSTYVALFFCCLIGLIKNYTVFLGHKFDYKTFISGYIGIPVYLICYVGYKVVYRTKLI-K 526
           W  Y A FF  +I  I+ +  F   KFD   F + YI + + ++ + G ++ YR + + K
Sbjct: 504 WGAYYASFFVTVIIFIQGFQAF-APKFDVSEFFTAYISLILLVVLFAGCQLYYRCRFLWK 562

Query: 527 PEDVDLYTFKDAIDA 541
            ED+D+ + +  IDA
Sbjct: 563 LEDIDIDSDRREIDA 577

>TDEL0C06170 Chr3 complement(1117792..1119513) [1722 bp, 573 aa]
           {ON} Anc_1.84 YNL268W
          Length = 573

 Score =  305 bits (782), Expect = 5e-96,   Method: Compositional matrix adjust.
 Identities = 176/514 (34%), Positives = 270/514 (52%), Gaps = 12/514 (2%)

Query: 26  VTLESEGQVRSVSEGVDGKHEG---IRLKKELEARHVSMXXXXXXXXXXXXXXXXXXXXX 82
           VTL +   V    E  D +  G    R+K+ L+ RH+ M                     
Sbjct: 40  VTLRTVTNVCDGLEEEDAEEAGYHDTRVKRALKQRHIGMIALGGTIGTGLFVGIATPLSN 99

Query: 83  XXPVSILISYSFVGLLVYTVMSCLGEMAAFIPL-DGFTSYASRYVDPAVGFAVGYSYLFK 141
             PV  LI+Y F+G +VY +   LGEMA FIP+    T ++ R++ PA G A GY Y F 
Sbjct: 100 AGPVGSLIAYLFMGSIVYFITQSLGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFN 159

Query: 142 YFIVTPNQLTAGAMVMQFWVSRDRVNPGVWITIFLALIVLINTVGVRFFGEFEFWLSSVK 201
           + I    +++    V+QFW S   V    WI IF   + L+N   V+ +GE EFW++S+K
Sbjct: 160 WAITYAVEISVIGQVIQFWTSA--VPLAAWIAIFWVFVSLLNFFPVKVYGEIEFWVASIK 217

Query: 202 XXXXXXXXXXXXXXXXXXXPNHDRTGFRFWRDPGAFKPYSEAISGSKGKXXXXXXXXXXX 261
                               +    GFR+WR+PG + P   +   ++G+           
Sbjct: 218 VIAIVGYLIYALVIVCGGS-SQGPIGFRYWRNPGPWGPGIISDDKNEGRFLGWVSSLINA 276

Query: 262 XXXYTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVVFYVITILLLGMTVAYNDPRLLXX 321
              Y GTEL GI A EA NPR+SVPRAI   ++RIV+FY++++  +GM V +NDPRL   
Sbjct: 277 AFTYQGTELVGITAGEAANPRKSVPRAINKVVFRIVIFYIMSLFFVGMLVPFNDPRL--- 333

Query: 322 XXXXXXXXXXPFVVAIENASIPVLPHIFNVCVLVFVFSACNSDLYVASRSLYGLAIDGKA 381
                     PFV++I+NA   VLPHIFN  V++ + SA NS++YV SR LY L+  G A
Sbjct: 334 ASNVAVIASSPFVISIQNAGTRVLPHIFNAVVMLTIISAANSNVYVGSRVLYALSQTGNA 393

Query: 382 PRIFATTNKWGVPYYSLGLSVLFCLLAYMNVSSGSAQVFNYFVNVVSIFGLLSWITILIT 441
           P+ F    + GVPY  +  + L  LLA++ V++ +   FN+ +N+ ++ GL +W+ I ++
Sbjct: 394 PKQFGYVTRHGVPYLGVIATSLLGLLAFLVVNNNANTAFNWLINISTLAGLCAWLFISLS 453

Query: 442 YIRFDKAIRVQFGDKSSLSYTAAFQPWSTYVALFFCCLIGLIKNYTVFLGHKFDYKTFIS 501
           +IRF +A++ +   +  L + A   PW  Y A FF  +I  I+ +  F   KFD   F +
Sbjct: 454 HIRFMQALKFRGISRDDLPFKAKLMPWGAYYAAFFVTVIIFIQGFEAF-SPKFDVSGFFT 512

Query: 502 GYIGIPVYLICYVGYKVVYRTKLI-KPEDVDLYT 534
            YI + + ++  +G ++ YR + + K ED+D+ T
Sbjct: 513 AYISLIILVVLLIGCQLYYRCRFLWKLEDIDIDT 546

>Smik_14.67 Chr14 complement(114969..116690) [1722 bp, 573 aa] {ON}
           YNL270C (REAL)
          Length = 573

 Score =  305 bits (782), Expect = 5e-96,   Method: Compositional matrix adjust.
 Identities = 177/539 (32%), Positives = 285/539 (52%), Gaps = 9/539 (1%)

Query: 4   DTSMEKKNAGVLYSNETLEEGIVTLESEGQVRSVSEGVDGKHEGIRLKKELEARHVSMXX 63
            T  E++     Y  +  EE +   +S     S  E      +G  +K++L+ RH+ M  
Sbjct: 21  STIKEEELICARYDGQDTEEAVAG-KSSINNDSAKETETSPRKGGEVKRKLKQRHIGMIA 79

Query: 64  XXXXXXXXXXXXXXXXXXXXXPVSILISYSFVGLLVYTVMSCLGEMAAFIPL-DGFTSYA 122
                                PV  LISY F+G ++Y+V   LGEMA FIP+   F+ +A
Sbjct: 80  LGGTIGTGLIIGIGPPLAHAGPVGALISYLFMGTVIYSVTQSLGEMATFIPVTSSFSVFA 139

Query: 123 SRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVNPGVWITIFLALIVLI 182
            R++ PA+G   GY Y   +      +L+    ++Q+W   D V    WI IF  L+ L+
Sbjct: 140 QRFLSPALGATNGYMYWLSWCFTFALELSVLGQIIQYWT--DAVPLVAWIVIFWCLLTLM 197

Query: 183 NTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGFRFWRDPGAFKPYSE 242
           N   V+++GEFEF ++S+K                    +    GFR+WR+PGA+ P   
Sbjct: 198 NMFPVKYYGEFEFCIASIKVIALLGFIFFSFCIVCGAGQSGGPIGFRYWRNPGAWGPGII 257

Query: 243 AISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVVFYVI 302
           + + ++G+              Y GTEL GI A EA NPRR+VPRAIK  + RI+VFY++
Sbjct: 258 SKNKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRRAVPRAIKKVVVRILVFYIL 317

Query: 303 TILLLGMTVAYNDPRLLXXXXXXXXXXXXPFVVAIENASIPVLPHIFNVCVLVFVFSACN 362
           ++  +G+ V YNDP+L             PF+++IEN+   VLP IFN  VL+ + SA N
Sbjct: 318 SLFFIGLLVPYNDPKL---DSEGTFVSSSPFMISIENSGTKVLPDIFNAVVLITILSAGN 374

Query: 363 SDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCLLAYMNVSSGSAQVFNY 422
           S++Y+ SR LY L+ +  APR  +   K GVPY+++  +  F  LA++  S+GS +VFN+
Sbjct: 375 SNVYIGSRVLYSLSKNSLAPRFLSNVTKGGVPYFAVLSTSAFGFLAFLETSAGSGKVFNW 434

Query: 423 FVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLSYTAAFQPWSTYVALFFCCLIGL 482
            +N+  + G  +W+ I +++IRF +AI+ +   +  L Y A   P+  Y A FF  LI L
Sbjct: 435 LLNITGVAGFFAWLLISLSHIRFMQAIKKRGISRDDLPYRARMMPFLAYYASFFIALIVL 494

Query: 483 IKNYTVFLGHKFDYKTFISGYIGIPVYLICYVGYKVVYRTKLI-KPEDVDLYTFKDAID 540
           I+ +T F    F    FI+ YI + +++  ++ ++V ++ + + K +DVD+ + +  I+
Sbjct: 495 IQGFTAF-APTFQPIDFIAAYISVFLFIAIWLLFQVWFKCRFVWKLQDVDIDSDRRDIE 552

>NCAS0A00600 Chr1 complement(109246..110880) [1635 bp, 544 aa] {ON} 
          Length = 544

 Score =  304 bits (779), Expect = 7e-96,   Method: Compositional matrix adjust.
 Identities = 172/518 (33%), Positives = 279/518 (53%), Gaps = 15/518 (2%)

Query: 28  LESEGQVRSVSEGVDGKHEGIRLKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVS 87
           ++S     ++S   D + +   +K+EL+ RH+SM                       P+ 
Sbjct: 13  VDSNDTPTTISTLDDDQEKQQDVKRELKKRHISMIALGGTIGTGLFLGIARPLIIAGPIG 72

Query: 88  ILISYSFVGLLVYTVMSCLGEMAAFIPLDG-FTSYASRYVDPAVGFAVGYSYLFKYFIVT 146
            LI+Y F+G +V++V   LGEM  FIP+   FT +A R++ PA G A GY Y F + +  
Sbjct: 73  ALIAYLFMGTVVFSVTQSLGEMCTFIPVTASFTVFAQRFLSPAFGAANGYMYWFSWAMTF 132

Query: 147 PNQLTAGAMVMQFWVSRDRVNPGVWITIFLALIVLINTVGVRFFGEFEFWLSSVKXXXXX 206
             +L+    ++QFW     V    WI+I   L+ + N   VR +GE EFW++SVK     
Sbjct: 133 ALELSVVGQIIQFWTMA--VPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLAIL 190

Query: 207 XXXXXXXXXXXXXXPNHDRTGFRFWRDPGAFKPYSEAISGS---KGKXXXXXXXXXXXXX 263
                               GFR+W++PG   P+   I  S   + +             
Sbjct: 191 GFIIYGICIICGAGVTGP-VGFRYWKNPG---PWGMGIISSNVNEARFFGWVSSLINAAF 246

Query: 264 XYTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVVFYVITILLLGMTVAYNDPRLLXXXX 323
            + GTEL GI A E + PR++VP+AIK  ++RI+VFY+ ++L++G+ V YNDP+L     
Sbjct: 247 TFQGTELVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKL---QS 303

Query: 324 XXXXXXXXPFVVAIENASIPVLPHIFNVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPR 383
                   PF++ I+NA   +LPHIFN  +L+ + SA NS++Y+ SR LYGLA +  AP+
Sbjct: 304 NDSYVSSSPFIITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPK 363

Query: 384 IFATTNKWGVPYYSLGLSVLFCLLAYMNVSSGSAQVFNYFVNVVSIFGLLSWITILITYI 443
            F  T+K GVPY ++  + +F  LAYM  ++G  + F + +N+V + G  +W+ I  ++I
Sbjct: 364 FFTNTSKAGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHI 423

Query: 444 RFDKAIRVQFGDKSSLSYTAAFQPWSTYVALFFCCLIGLIKNYTVFLGHKFDYKTFISGY 503
           RF KA++ +   ++ L Y A   PW  Y A+FF  +I +I+ +T F   KF    F + Y
Sbjct: 424 RFMKALKQRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSF-APKFKVANFFAAY 482

Query: 504 IGIPVYLICYVGYKVVYRTKLI-KPEDVDLYTFKDAID 540
           I + +++I +V +++ ++ +L+ K +DVDL T +  I+
Sbjct: 483 ISVFLFIIFWVAFQIWFKCRLVWKLQDVDLDTDRRDIE 520

>KLTH0F02398g Chr6 complement(202746..204413) [1668 bp, 555 aa] {ON}
           similar to uniprot|P04817 Saccharomyces cerevisiae
           YEL063C CAN1 Plasma membrane arginine permease requires
           phosphatidyl ethanolamine (PE) for localization
           exclusively associated with lipid rafts mutation confers
           canavanine resistance
          Length = 555

 Score =  304 bits (778), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 188/543 (34%), Positives = 292/543 (53%), Gaps = 19/543 (3%)

Query: 6   SMEKKNAGVLYSNE--TLEEGIVTLESEGQVRSVSEGVDGKHEGIRLKKELEARHVSMXX 63
           S EK+    L+ NE   +EEG  +  ++G +   S+      +   +++ L+ RHVSM  
Sbjct: 5   SFEKQPQ--LHKNEIKVMEEGESSSLADGVLEQQSQIDTASSQERGIQRALKPRHVSMIA 62

Query: 64  XXXXXXXXXXXXXXXXXXXXXPVSILISYSFVGLLVYTVMSCLGEMAAFIPL-DGFTSYA 122
                                PV  LISY F+G L + V   LGEMA FIP+   FT + 
Sbjct: 63  LGGTIGTGLFVGIANPLRDAGPVGSLISYLFMGSLAFFVTQSLGEMATFIPVASSFTVFT 122

Query: 123 SRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVNPGVWITIFLALIVLI 182
            R++ PA+G A GY Y F + I    +L+    ++Q+W     V    WI IF   I L 
Sbjct: 123 RRFLSPALGAANGYMYCFSWCITFALELSIVGEIIQYWTLG--VPNAAWIIIFWVPISLS 180

Query: 183 NTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGFRFWRDPGAFKPYSE 242
           N V V+F+GEF+FW++ +K                         GFR+WR+PG   P+ +
Sbjct: 181 NLVSVKFYGEFQFWIALIKVIAIVGFLIYCLCMVCGAGKTGP-VGFRYWRNPG---PWGD 236

Query: 243 AI---SGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVVF 299
            I   S S+G+              Y GTEL G+ A E+ NPR++VP+AI+    RI++F
Sbjct: 237 GIISKSKSEGRFLGWVSSLVNAAFTYQGTELVGVSAGESANPRKTVPKAIRKVFLRILLF 296

Query: 300 YVITILLLGMTVAYNDPRLLXXXXXXXXXXXXPFVVAIENASIPVLPHIFNVCVLVFVFS 359
           YV ++  +G+ V +NDP+L             PF++AI+N+    LP IFN  +L  + S
Sbjct: 297 YVGSLFFIGLLVPFNDPKL---DSTANYSASSPFIIAIQNSGTRALPDIFNAVILTTIIS 353

Query: 360 ACNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCLLAYMNVSSGSAQV 419
           A NS++YV SR LYGLA +G AP+I    N+ GVPY  +G+  LF  L Y++VSSGSA+ 
Sbjct: 354 AANSNVYVGSRVLYGLAKEGLAPKIIGRINRHGVPYICVGIVSLFGFLGYLSVSSGSAKA 413

Query: 420 FNYFVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLSYTAAFQPWSTYVALFFCCL 479
           F++ +N+ +I G  +W+ I + +IRF +A++ Q   +  L + A   PW  Y A FF  L
Sbjct: 414 FDWLLNITAIAGFFAWLFISLCHIRFMQALKYQGISRDDLPFKAKLMPWGAYYAAFFILL 473

Query: 480 IGLIKNYTVFLGHKFDYKTFISGYIGIPVYLICYVGYKVVYRTKLI-KPEDVDLYTFKDA 538
           I +I+ +T F   KF+   F + Y+ + +++  +V ++V+++++LI K EDVD+ + +  
Sbjct: 474 IIIIQGFTAF-APKFNVSNFFAAYVSVFLFIAVWVIFQVIFKSRLIHKVEDVDIDSDRRE 532

Query: 539 IDA 541
           I+A
Sbjct: 533 IEA 535

>Kwal_26.6940 s26 (133377..135089) [1713 bp, 570 aa] {ON} YOR348C
           (PUT4) - 1:1 [contig 46] FULL
          Length = 570

 Score =  303 bits (777), Expect = 3e-95,   Method: Compositional matrix adjust.
 Identities = 188/584 (32%), Positives = 294/584 (50%), Gaps = 36/584 (6%)

Query: 4   DTSMEKKNAGVLYSNETLEEGIVTLESEGQVRSVSEGVDGKHEGIRLKKELEARHVSMXX 63
            TS+  K  G ++  +T  E +  L + G           K E   LK+ L++RH+ +  
Sbjct: 12  QTSIVDKQTGQVFELDT--ESLSALNTGGSESQ-------KREPHTLKQGLQSRHIQLIA 62

Query: 64  XXXXXXXXXXXXXXXXXXXXXPVSILISYSFVGLLVYTVMSCLGEMAAFIPLDGFTS--- 120
                                P  +L SY  + L++Y VM+ LGEM  ++P  G  S   
Sbjct: 63  LGGVIGTGLFVGTSSTLSTCGPAGLLTSYIIISLVIYPVMNALGEMVCYLPGSGTDSGGS 122

Query: 121 ---YASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVNPGVWITIFLA 177
                SRY DP++GFA G++Y + Y I+   + TA + V+ +W +   V    WITIFL 
Sbjct: 123 ISKLVSRYADPSLGFATGWNYYYCYVILIAAECTAASGVVTYWTTV--VPKAAWITIFLG 180

Query: 178 LIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGFRFWRDPGAF 237
           ++ ++N   V+F+GE EFW + +K                   P+HDR GFR+W+ PGAF
Sbjct: 181 VVTMLNFGPVKFYGESEFWFAILKILCIVGLLFVSFILFWGGGPSHDRLGFRYWQKPGAF 240

Query: 238 KPYSEAISGSKGKXXXXXXXXXXXXXXYT-GTELCGIVAAEAKNPRRSVPRAIKLTLYRI 296
             +    +G+ G+              +  G EL  + ++EA + RR++ +A +   YR+
Sbjct: 241 AYH--ITTGNTGRFLDVWTGVIKGGFAFILGPELVAVTSSEAMDQRRNIEKASRRFAYRL 298

Query: 297 VVFYVITILLLGMTVAYNDPRLLXXXXXXXX-XXXXPFVVAIENASIPVLPHIFNVCVLV 355
           + FYV + L +G+ VA NDP L              PFV+AI+NA I +LPHI N C+L 
Sbjct: 299 IFFYVASALAIGVIVAQNDPVLRDALASGKAGAASSPFVIAIQNAHIKILPHIINACILS 358

Query: 356 FVFSACNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCLLAYMNVSSG 415
             +S+ NS ++ ASRSL  +A DG AP++F   N+ GVPY ++ +S  F  LAY+NVSSG
Sbjct: 359 SAWSSGNSFMFAASRSLLSMAEDGVAPKMFKKINRAGVPYNAVAVSAAFSCLAYLNVSSG 418

Query: 416 SAQVFNYFVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLSYTAAFQPWSTYVALF 475
           SA+ F +F N+ +I G + WI I + Y+RF KAI  + G    + + + FQP+ TY  + 
Sbjct: 419 SAKAFTWFSNISTISGFIGWICIGVAYLRFRKAIFFR-GLYDRVPFKSPFQPYGTYFFII 477

Query: 476 FCCLIGLIKNYTVFLGHKFDYKTFISGYIGIPVYLICYVGYKVVYRTK---LIKPEDVDL 532
              +I L   Y  F+   +    F++ YI +PV+++ +VG+K+  RT    +I   +VD+
Sbjct: 478 VVSIICLTNGYATFIPRFWKGADFVAAYITLPVFVVLWVGHKIYTRTLSTWVIPVAEVDV 537

Query: 533 YTFKDAIDAXXXXXXXXXXXXXXNMENSPKNFKWFYETFLGWIF 576
            T    I+               +    P N  W  E F+ W+ 
Sbjct: 538 TTGLAEIEE---------LTKELDALRVPPNSAW--EKFMDWLL 570

>TDEL0H04070 Chr8 complement(698717..700450) [1734 bp, 577 aa] {ON}
           Anc_7.44 YOR348C
          Length = 577

 Score =  303 bits (776), Expect = 5e-95,   Method: Compositional matrix adjust.
 Identities = 176/547 (32%), Positives = 288/547 (52%), Gaps = 22/547 (4%)

Query: 4   DTSMEKKNAGVLYSNET---LEEGIVTLESEGQV--RSVSEGVDGKHEGIRLKKELEARH 58
           +   E    G L+  +T   LE  + +L  EG    R ++   D K EG +L++ L ARH
Sbjct: 6   EKEKETTTNGNLFDQKTGQVLEIDLESLTPEGSSTNRGINGNKDAKLEG-KLQQGLSARH 64

Query: 59  VSMXXXXXXXXXXXXXXXXXXXXXXXPVSILISYSFVGLLVYTVMSCLGEMAAFIPLDGF 118
           + +                       P  + ISY  +  ++Y +M+  GEM  ++P +G 
Sbjct: 65  IQLIALGGAIGTGLFVGTSSTLHTCGPAGLFISYVIISTVLYPIMNAFGEMVCYLPGNGD 124

Query: 119 TSYAS------RYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVNPGVWI 172
            S  S      RYVDP++ FA G++Y + Y I+   + TA + V+++W   D V    WI
Sbjct: 125 DSAGSVSHLVDRYVDPSLSFATGWNYFYCYVILVAAECTAASGVVKYWT--DAVPTAAWI 182

Query: 173 TIFLALIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGFRFWR 232
           TIFL+++VL+N   V+++GE EFW +S+K                   PNHDR GFR+W+
Sbjct: 183 TIFLSIVVLLNLCAVKYYGETEFWFASIKVLCIVGLIILSFILFWGGGPNHDRLGFRYWK 242

Query: 233 DPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYT-GTELCGIVAAEAKNPRRSVPRAIKL 291
           +PG F  +     G+ G               +  G EL  + ++E K+ RR++ +A K 
Sbjct: 243 NPGGFAHH--ITGGNLGNFLDVYSGIIKGAFAFILGPELIALASSECKDQRRNIMKASKR 300

Query: 292 TLYRIVVFYVITILLLGMTVAYNDPRLLXXXXXXX-XXXXXPFVVAIENASIPVLPHIFN 350
            ++R++ FY++  L + + VA NDP L              PFV+ I+NA I +LPHI N
Sbjct: 301 FVWRLMFFYILGALSISVIVASNDPALTSALASGKPGAGSSPFVIGIQNAGIKILPHIIN 360

Query: 351 VCVLVFVFSACNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCLLAYM 410
            C+L   +SA N+ ++ +SRSL  +A +G+AP+IF   N++GVP+ ++  S L   LAY+
Sbjct: 361 ACILTSAWSAGNAFMFASSRSLLTMASNGQAPKIFGKINRFGVPWVAVTFSALISCLAYL 420

Query: 411 NVSSGSAQVFNYFVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLSYTAAFQPWST 470
           NVSS +A VF +F N+ +I G + W   L+ Y+RF KAI+   G ++ L Y   FQ +  
Sbjct: 421 NVSSSTADVFAWFTNISTISGFIGWDCGLVAYLRFRKAIKYN-GLENRLPYAPRFQQYMV 479

Query: 471 YVALFFCCLIGLIKNYTVFLGHKFDYKTFISGYIGIPVYLICYVGYKVVYR--TKLIKP- 527
           + ++    L+     Y VF+   ++   FI+ YI +P++++ ++G+K+  R   K   P 
Sbjct: 480 WWSILVVTLVIFTNGYQVFIPRFWNVSDFIAAYITLPLFVVLWIGHKIYTRDFKKWWYPV 539

Query: 528 EDVDLYT 534
           E++D+ T
Sbjct: 540 EEIDVVT 546

>KNAG0F00480 Chr6 (73545..75338) [1794 bp, 597 aa] {ON} 
          Length = 597

 Score =  303 bits (777), Expect = 5e-95,   Method: Compositional matrix adjust.
 Identities = 178/526 (33%), Positives = 277/526 (52%), Gaps = 18/526 (3%)

Query: 18  NETLEEGIVTLESEGQVRSVSEGVDGKHEGIRLKKELEARHVSMXXXXXXXXXXXXXXXX 77
           N  +++G    ES+G     S+ ++ +    ++K+ L+ RH+ M                
Sbjct: 68  NSRVDDG---AESDG-----SDELEAEVHETKVKRALKQRHIGMIALGGTIGTGLFVGIS 119

Query: 78  XXXXXXXPVSILISYSFVGLLVYTVMSCLGEMAAFIPL-DGFTSYASRYVDPAVGFAVGY 136
                  PV  LI+Y F+G ++Y V   LGEMA FIP+    T ++ R++ PA G A GY
Sbjct: 120 TPLSVAGPVGSLIAYIFMGTIIYFVTQSLGEMATFIPVTSSITVFSKRFLSPAFGVANGY 179

Query: 137 SYLFKYFIVTPNQLTAGAMVMQFWVSRDRVNPGVWITIFLALIVLINTVGVRFFGEFEFW 196
            Y F + I    +++    V+Q+W     V    WI IF  L+ L+N   V+ +GE EFW
Sbjct: 180 MYWFNWAITYAVEISVIGQVIQYWTKA--VPLAAWIAIFWVLVTLMNFFPVKVYGEVEFW 237

Query: 197 LSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGFRFWRDPGAFKPYSEAISGSKGKXXXXXX 256
           ++ VK                    +    GFR+WR PGAF P   + + + GK      
Sbjct: 238 IAFVKVLAIVGYLIYALVIVCGGS-HQGPIGFRYWRHPGAFGPGIISKNKNTGKFLGWVA 296

Query: 257 XXXXXXXXYTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVVFYVITILLLGMTVAYNDP 316
                   Y GTEL GI A EA NPR++VPRAI   ++RIV+FY++++  +GM + YND 
Sbjct: 297 SLINAAFTYQGTELVGITAGEAANPRKTVPRAINKVVFRIVLFYIMSLFFIGMLLPYNDK 356

Query: 317 RLLXXXXXXXXXXXXPFVVAIENASIPVLPHIFNVCVLVFVFSACNSDLYVASRSLYGLA 376
           RL             PFV++I+NA   VLP IFN  V+V V SA NS++YV SR LY LA
Sbjct: 357 RL---SAQDAVIASSPFVISIKNAHTKVLPDIFNAVVMVTVMSAANSNVYVGSRVLYALA 413

Query: 377 IDGKAPRIFATTNKWGVPYYSLGLSVLFCLLAYMNVSSGSAQVFNYFVNVVSIFGLLSWI 436
           + G AP+ F+   ++GVPY  +  +    LLA++ V++ +   FN+ +N+ ++ GL +W+
Sbjct: 414 LTGNAPKQFSYVTRYGVPYLGVVCTASLGLLAFLVVNNNANTAFNWLINISTLAGLCAWL 473

Query: 437 TILITYIRFDKAIRVQFGDKSSLSYTAAFQPWSTYVALFFCCLIGLIKNYTVFLGHKFDY 496
            I + +IRF +A++ +   +  L + A   PW  Y A FF  +I  I+ Y  F    +D 
Sbjct: 474 FISLAHIRFMQALKFRGISRDDLPFKAKLMPWGAYYAAFFVTVIIFIQGYQAFC--PWDV 531

Query: 497 KTFISGYIGIPVYLICYVGYKVVYRTK-LIKPEDVDLYTFKDAIDA 541
            TF + YI + +  +  VG ++ YR + L+K ED+D+ T +  I++
Sbjct: 532 STFFTSYISLILLAVLVVGCQLYYRGRFLLKLEDIDIDTDRREIES 577

>TBLA0A05460 Chr1 (1348452..1350278) [1827 bp, 608 aa] {ON} Anc_1.84
           YNL268W
          Length = 608

 Score =  304 bits (778), Expect = 5e-95,   Method: Compositional matrix adjust.
 Identities = 178/548 (32%), Positives = 288/548 (52%), Gaps = 22/548 (4%)

Query: 8   EKKNAGVLYSNETLEEG------------IVTLESEGQVRSVS-EGVDGKHEGIRLKKEL 54
           +KK+  V Y NE LE+               +  SE ++ S   +  + + +  ++K+ L
Sbjct: 47  DKKDMTVTYDNEILEKKDSKSDIFTSVNRYASHPSEARISSDEYDHQEAEFKDTKVKRAL 106

Query: 55  EARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILISYSFVGLLVYTVMSCLGEMAAFIP 114
           + RH+ M                       PV  LI+Y F+G +VY V   LGEMA FIP
Sbjct: 107 KPRHIGMIALGGTIGTGLFIGISDPLQKSGPVGSLIAYIFMGTVVYFVTQALGEMATFIP 166

Query: 115 L-DGFTSYASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVNPGVWIT 173
           +    T ++SR++ PA G + GY Y F + I    +++    V++FW ++  V    WI+
Sbjct: 167 VTSSITVFSSRFLSPAFGVSNGYLYWFNWAITYAVEISVVGQVIEFWTTK--VPLAAWIS 224

Query: 174 IFLALIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGFRFWRD 233
           IF  L+  +N   V  +GE EFW++SVK                         GFR+WR 
Sbjct: 225 IFWVLVTALNFFPVSVYGEIEFWVASVKVLAIVGYLIYALVIVCGGS-KQGPIGFRYWRH 283

Query: 234 PGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPRAIKLTL 293
             A      +   ++ +              Y GTEL GI A EA NPR+SVPRAI   +
Sbjct: 284 GYAMGGGMISKDKNEARFLGWVASLINAAFTYQGTELVGITAGEAANPRKSVPRAINKVV 343

Query: 294 YRIVVFYVITILLLGMTVAYNDPRLLXXXXXXXXXXXXPFVVAIENASIPVLPHIFNVCV 353
           +RIV+FY++++  +G+ V YNDP+L             PFV++IENA    LPHIFN  +
Sbjct: 344 FRIVIFYILSLFFIGLLVPYNDPKL---NSATSYIASSPFVISIENAGTRALPHIFNAII 400

Query: 354 LVFVFSACNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCLLAYMNVS 413
           ++ + SA NS++YV+SR LY LA+ G AP+IFA     GVP+  + ++ L  LLA++ V+
Sbjct: 401 MITIISAANSNVYVSSRVLYSLALSGHAPKIFARVTPQGVPFLGVIVTALMGLLAFLVVN 460

Query: 414 SGSAQVFNYFVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLSYTAAFQPWSTYVA 473
           + + + FN+ +N+ ++ GL +W+ I ++++RF +A++ +   +  L + A F P+ +Y A
Sbjct: 461 NNANEAFNWLINISTLAGLCAWLFISMSHLRFMEALKYRGISRDDLPFKARFMPYGSYYA 520

Query: 474 LFFCCLIGLIKNYTVFLGHKFDYKTFISGYIGIPVYLICYVGYKVVYRTKLI-KPEDVDL 532
            FF  +I  I+ +T F   KFD  +F + YI + +  + ++G ++ YR +   K ED+D+
Sbjct: 521 CFFITVIIFIQGFTAF-SPKFDVASFFTAYISLILLAVLFIGCQLYYRCRFFWKVEDIDI 579

Query: 533 YTFKDAID 540
            T +  ID
Sbjct: 580 DTDRREID 587

>NDAI0E03800 Chr5 (829594..831459) [1866 bp, 621 aa] {ON} Anc_7.44
          Length = 621

 Score =  304 bits (779), Expect = 6e-95,   Method: Compositional matrix adjust.
 Identities = 176/547 (32%), Positives = 290/547 (53%), Gaps = 24/547 (4%)

Query: 8   EKKNAGVLYSNETLEEGIVTLESEGQVRSVSEGVDGKHEGIR------LKKELEARHVSM 61
            KKN  ++Y+ ++  +  +   S   + S+ +  + +    R      LK+ L++RH+ +
Sbjct: 48  NKKNPQIIYNEKSYSQDELQTTSPTIIDSIDDEAEKEQGKERSSSNGELKQGLKSRHIQL 107

Query: 62  XXXXXXXXXXXXXXXXXXXXXXXPVSILISYSFVGLLVYTVMSCLGEMAAFIPLDGFTSY 121
                                  P  + ISY  +   VY +M+ LGEM  F+P +G  S 
Sbjct: 108 IALGGTIGTSLLVGTSSALANCGPAGLFISYLIISTFVYPIMNALGEMVCFLPGNGSDSA 167

Query: 122 AS------RYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVNPGVWITIF 175
            S      +YVDP++GFA  ++Y + + I+   +++A + V+++W   + V  G WITIF
Sbjct: 168 GSAAHLVHKYVDPSLGFAASWNYYYCFVILVAAEVSAASGVIEYWAWAEHVPKGAWITIF 227

Query: 176 LALIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRT-GFRFWRDP 234
           L+LIV++N + V  +GE EFW +S+K                   P  D   GFR+W++P
Sbjct: 228 LSLIVILNFLPVNVYGESEFWFASIKILCITGLIILSFILFWGGGPKSDGILGFRYWKNP 287

Query: 235 GAFKPYSEAISGSKGKXXXXXXXXXXXX--XXYTGTELCGIVAAEAKNPRRSVPRAIKLT 292
           G+F   +  I+G  G                   G EL  + ++E  + RR++ +A K  
Sbjct: 288 GSF---AHHITGGGGGNFLDIYTGIIKGGFSVILGPELVCLTSSECADQRRNIAKASKRF 344

Query: 293 LYRIVVFYVITILLLGMTVAYNDPRLLXXXXXXXXXX-XXPFVVAIENASIPVLPHIFNV 351
           ++R++ FY++  L +G+ VAYNDP L              PFV+ I+NA I  +PHI N 
Sbjct: 345 VWRLMFFYILGSLSIGVIVAYNDPVLQNALAQSKAGAGSSPFVIGIQNAGIRAVPHIVNF 404

Query: 352 CVLVFVFSACNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCLLAYMN 411
           C+L   +SA N+ ++ +SRSL  +A +G AP+IF   N+ GVPY ++G S+L   LAY+N
Sbjct: 405 CILTSAWSAGNAYMFASSRSLLTMARNGNAPKIFCRINQLGVPYTAVGASLLLSCLAYLN 464

Query: 412 VSSGSAQVFNYFVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLSYTAAFQPWSTY 471
           VSS +A VFN+F N+ +I G + WI   + YIRF KAI         + + A  Q ++ +
Sbjct: 465 VSSSTADVFNWFSNISTISGFIGWICACVAYIRFRKAITYN-KLTHRIPFRAKGQQYTIW 523

Query: 472 VALFFCCLIGLIKNYTVFLGHKFDYKTFISGYIGIPVYLICYVGYKVVYRTKL---IKPE 528
            +LF+  LI L   Y +F+   ++ K FI+ YI +P++++ ++G+KV  RT L   ++P 
Sbjct: 524 YSLFWVSLITLTNGYAIFIPRNWNVKDFIAAYITLPIFIVLWIGHKVFTRTLLKAWLRPI 583

Query: 529 D-VDLYT 534
           D +D+YT
Sbjct: 584 DKIDVYT 590

>Skud_14.70 Chr14 complement(124390..126111) [1722 bp, 573 aa] {ON}
           YNL270C (REAL)
          Length = 573

 Score =  301 bits (772), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 178/555 (32%), Positives = 289/555 (52%), Gaps = 22/555 (3%)

Query: 2   NSDTSMEKKNAGVLYSNETLEEG-IVTLESEGQVRSVS---------EGVDGKHEGIR-- 49
           N D    K+      S  T++E  +V  + E Q  S +         +G  G     R  
Sbjct: 4   NVDICTSKEGKREANSAPTIKEKELVDAQYEEQDTSAAIAANSSIENDGAKGTETSPRSR 63

Query: 50  --LKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILISYSFVGLLVYTVMSCLG 107
             ++++L+ RH+ M                       PV  LISY F+G ++Y+V   LG
Sbjct: 64  GEVQRKLKERHIGMIALGGTIGTGLIIGIGPPLAHAGPVGALISYLFMGTVIYSVTQSLG 123

Query: 108 EMAAFIPL-DGFTSYASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRV 166
           EMA FIP+   F+ +A R++ PA+G   GY Y   +      +L+    ++Q+W     V
Sbjct: 124 EMATFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALELSVLGQIIQYWT--HAV 181

Query: 167 NPGVWITIFLALIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRT 226
               WI IF  L+ L+N   V+++GEFEF ++S+K                         
Sbjct: 182 PLAAWIVIFWCLLTLMNMFPVKYYGEFEFCIASIKVITLLGFIIFSFCIVCGAGQPDGPI 241

Query: 227 GFRFWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVP 286
           GFR+WR+PGA+ P   + + ++G+              Y GTEL GI A EA NPR++VP
Sbjct: 242 GFRYWRNPGAWGPGIISSNKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAVP 301

Query: 287 RAIKLTLYRIVVFYVITILLLGMTVAYNDPRLLXXXXXXXXXXXXPFVVAIENASIPVLP 346
           RAIK  + RI+VFY++++  +G+ V YNDP+L             PF+++IEN+   VLP
Sbjct: 302 RAIKKVVIRILVFYILSLFFIGLLVPYNDPKL---DSDGTFVSASPFMISIENSGTKVLP 358

Query: 347 HIFNVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCL 406
            IFN  VL+ +FSA NS++Y+ SR LY L+ +  AP+  +   + GVPY ++ L+ LF  
Sbjct: 359 DIFNAVVLITIFSAGNSNVYIGSRVLYSLSKNSLAPKCLSNVTRGGVPYLAVLLTSLFGF 418

Query: 407 LAYMNVSSGSAQVFNYFVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLSYTAAFQ 466
           LA++  S+GS + FN+ +N+  + G  +W+ I  ++IRF +AI+ +   +  L Y A   
Sbjct: 419 LAFLETSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIKKRGISRDDLPYKARMM 478

Query: 467 PWSTYVALFFCCLIGLIKNYTVFLGHKFDYKTFISGYIGIPVYLICYVGYKVVYRTKLI- 525
           P+  Y A FF  LI LI+ +T F    F    F++ YI + ++ I ++ +++ ++ +LI 
Sbjct: 479 PFLAYYASFFIALIVLIQGFTAF-APTFQPVDFVAAYISVFLFAIIWLSFQLWFKCRLIC 537

Query: 526 KPEDVDLYTFKDAID 540
           K +D+D+ + +  I+
Sbjct: 538 KLQDIDIDSDRREIE 552

>TBLA0A05450 Chr1 complement(1345808..1347628) [1821 bp, 606 aa]
           {ON} Anc_1.83 YEL063C
          Length = 606

 Score =  302 bits (774), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 183/535 (34%), Positives = 275/535 (51%), Gaps = 21/535 (3%)

Query: 8   EKKNAGVLYSNETLEEGIVTLESEGQVRSV----------SEGVD--GKHEGIRLKKELE 55
            + + G +   ++ E+  +T  S+  VR+            E +D  G  E  ++K+EL+
Sbjct: 48  HRGSEGEVEYAKSDEDATLTKASKRHVRASSVSTASSSIAEEDIDATGVVEEAQVKRELK 107

Query: 56  ARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILISYSFVGLLVYTVMSCLGEMAAFIPL 115
            RH+ M                       PV  LI+Y F+G LV++V   LGEMA FIP+
Sbjct: 108 PRHIGMIALGGTIGTGLFIGIATPIQNAGPVGSLIAYIFMGTLVFSVTQSLGEMATFIPV 167

Query: 116 -DGFTSYASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVNPGVWITI 174
              FT +ASR+V    G A GY Y F + I    +L+    V++FW  +  V    WI+I
Sbjct: 168 TSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQVIEFWTFK--VPLAAWISI 225

Query: 175 FLALIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGFRFWRDP 234
           F  LIV++N   V+ +GEFEFW++S+K                         GFR+WR P
Sbjct: 226 FWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMVCGAGITGP-VGFRYWRHP 284

Query: 235 GAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPRAIKLTLY 294
           G + P   +   ++ +              Y GTEL GI A EA NPR+SVPRAIK    
Sbjct: 285 GPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAIKKVSV 344

Query: 295 RIVVFYVITILLLGMTVAYNDPRLLXXXXXXXXXXXXPFVVAIENASIPVLPHIFNVCVL 354
           RI++FY++++  +G+ V YNDP+L             PF++AI+N+   VLPHIFN  +L
Sbjct: 345 RILLFYILSLFFIGLLVPYNDPKL---SSTDSYVSASPFIIAIQNSGTKVLPHIFNAVIL 401

Query: 355 VFVFSACNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCLLAYMNVSS 414
             + SA NS++YV SR LYGL+    AP+ F  T   GVP+ ++  +  F  LAYM  S+
Sbjct: 402 TTIISAANSNVYVGSRILYGLSSAKLAPKFFQKTRN-GVPFIAVLFTAAFGALAYMETSA 460

Query: 415 GSAQVFNYFVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLSYTAAFQPWSTYVAL 474
           G    FN+ +N+  + G  +W++I I++IRF + ++ +   +  L Y AA  P   Y   
Sbjct: 461 GGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPYKAALMPGLAYYGA 520

Query: 475 FFCCLIGLIKNYTVFLGHKFDYKTFISGYIGIPVYLICYVGYKVVYRTKLIKPED 529
           FF  LI LI+ +T F   KFD   F++ YI   ++L  Y+  +  +RT+L +  D
Sbjct: 521 FFVTLIILIQGFTAF-APKFDSTAFLTAYISCFLFLFIYIVAQCYFRTRLWRTLD 574

>Kpol_367.7 s367 (23929..25683) [1755 bp, 584 aa] {ON}
           (23929..25683) [1755 nt, 585 aa]
          Length = 584

 Score =  301 bits (770), Expect = 4e-94,   Method: Compositional matrix adjust.
 Identities = 189/583 (32%), Positives = 292/583 (50%), Gaps = 21/583 (3%)

Query: 6   SMEKKNAGVLYSNETL---EEGIVTLESEGQVRSVSEG-VDGKHEGIRLKKELEARHVSM 61
           S E++    ++ N  +   E  + +L  E   RS S   V+ +  G +LK+ L +RHV  
Sbjct: 11  SKEEEEKKTVFDNRQILINELDLESLTREKITRSDSSSEVEAEGNG-KLKQGLSSRHVQF 69

Query: 62  XXXXXXXXXXXXXXXXXXXXXXXPVSILISYSFVGLLVYTVMSCLGEMAAFIPLDGFTSY 121
                                  P  ++ISY  +  ++Y +M+ LGEM  ++P +G  S 
Sbjct: 70  IALGGTIGTGLFVGTSVTLKTVGPGGLVISYIIISTVIYPIMNALGEMVCYLPGNGEDSA 129

Query: 122 AS------RYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVNPGVWITIF 175
            S      RYVD ++ FA G++Y + + I+   + TA + V+ +W +   V   VWITIF
Sbjct: 130 GSVAHLVGRYVDKSLAFATGWNYYYCFVILVAAECTAASGVVTYWTTS--VPTAVWITIF 187

Query: 176 LALIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGFRFWRDPG 235
           L ++ L+N   V++FGE EFW +S+K                   P+H R GF +W+DPG
Sbjct: 188 LGIVTLLNFSAVKYFGETEFWFASIKILCILGLILVSFILFWGGGPSHVRLGFHYWKDPG 247

Query: 236 AFKPYSEAISGSKGKXXXXXXXXXXXXXXYT-GTELCGIVAAEAKNPRRSVPRAIKLTLY 294
            F  +     GS G               +  G EL  + ++E  + RR++ +A K  ++
Sbjct: 248 TFAHH--ITGGSWGSFLDIYTGIIKGAFAFILGPELVALTSSECNDQRRNIAKASKRFIW 305

Query: 295 RIVVFYVITILLLGMTVAYNDPRLLXXXXXXXX-XXXXPFVVAIENASIPVLPHIFNVCV 353
           R++ FY++  L + + VAYNDP LL             PFV+ I+NA I VLPHI N C+
Sbjct: 306 RLMFFYILGTLSISVIVAYNDPVLLNALEEGKEGAASSPFVIGIQNAGIKVLPHIINACI 365

Query: 354 LVFVFSACNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCLLAYMNVS 413
           L   +SA NS ++ +SRSL  +A +G AP+IF   N++GVPYYS+GLS +   LA++NVS
Sbjct: 366 LSSAWSAGNSFMFASSRSLMTMAHNGSAPKIFCKVNRFGVPYYSVGLSAMLSCLAFLNVS 425

Query: 414 SGSAQVFNYFVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLSYTAAFQPWSTYVA 473
           S +AQVF++F N+ +I G L WI  +I Y+RF KAI         L +    QP+  + +
Sbjct: 426 SSTAQVFDWFSNISTISGFLGWICAIIAYLRFRKAIFYN-NMYDRLPFKTFGQPYLIWYS 484

Query: 474 LFFCCLIGLIKNYTVFLGHKFDYKTFISGYIGIPVYLICYVGYKVVYRTKLIKPEDVDLY 533
           L    +I L   Y  F+   +    F++ YI +P++LI +VG+K   R K   P  + LY
Sbjct: 485 LLVISVITLTNGYQTFIPRFWSGSDFVAAYITLPLFLILWVGHKFWARYKHAVPL-LKLY 543

Query: 534 TFKDAIDAXXXXXXXXXXXXXXNMENSPKNFKWFYETFLGWIF 576
              D ID               +M   P +  W    F+ W+ 
Sbjct: 544 YPVDEIDVITGLAEAEEVAEKLDMNRIPPSTYW--GKFINWLL 584

>KNAG0C05920 Chr3 (1157993..1159792) [1800 bp, 599 aa] {ON} 
          Length = 599

 Score =  300 bits (769), Expect = 8e-94,   Method: Compositional matrix adjust.
 Identities = 174/515 (33%), Positives = 278/515 (53%), Gaps = 11/515 (2%)

Query: 28  LESEGQVRSVSEGVDGKHEGIRLKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVS 87
           L+S     ++      KH  +  K+ L+ RH++M                       PV 
Sbjct: 73  LQSATNTGTLCTEEHVKHRSV--KRALKPRHIAMIALGGTIGTGLFMGIAKPLRNAGPVG 130

Query: 88  ILISYSFVGLLVYTVMSCLGEMAAFIPL-DGFTSYASRYVDPAVGFAVGYSYLFKYFIVT 146
            LI+Y FVG ++++V   LGEM  FIP+   FT ++ R++ PA G A GY Y F + +  
Sbjct: 131 ALIAYIFVGTIIFSVTQSLGEMVTFIPVTSSFTVFSHRFLSPAFGAANGYMYWFSWAMTF 190

Query: 147 PNQLTAGAMVMQFWVSRDRVNPGVWITIFLALIVLINTVGVRFFGEFEFWLSSVKXXXXX 206
             +L+    V+QFW +   V    WI IF  L+ L N   V+++GE EFW++ +K     
Sbjct: 191 AVELSVLGKVIQFWTTA--VPLAAWIVIFWFLLTLSNMFPVKYYGEIEFWIAFLKVLSLV 248

Query: 207 XXXXXXXXXXXXXXPNHDRTGFRFWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYT 266
                         P H   GFR+WRDPGA+ P   A   S+ +              Y 
Sbjct: 249 GFLIFCLCITSGAGP-HGPFGFRYWRDPGAWGPGIIAEDQSEARFLGWVSSLINAAFTYQ 307

Query: 267 GTELCGIVAAEAKNPRRSVPRAIKLTLYRIVVFYVITILLLGMTVAYNDPRLLXXXXXXX 326
           GTEL GI A EA NPR++VP+AIK  + RI+ FYV ++  +GM V +NDP+L        
Sbjct: 308 GTELVGITAGEAANPRKAVPKAIKKVILRILFFYVGSLFFIGMLVPFNDPKL---TSATS 364

Query: 327 XXXXXPFVVAIENASIPVLPHIFNVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPRIFA 386
                PF++AI+N+ + +LP IFN  +L+ + SA NS++YV SR L+GLA    AP+ F 
Sbjct: 365 FVSSSPFIIAIQNSGVSLLPSIFNGVILITIISAGNSNVYVGSRILFGLAHSNLAPQFFT 424

Query: 387 TTNKWGVPYYSLGLSVLFCLLAYMNVSSGSAQVFNYFVNVVSIFGLLSWITILITYIRFD 446
            T K GVP+ ++  + LF  LA++ +++   +VFN+ +++V+I G  +W+ I +++IRF 
Sbjct: 425 RTTKTGVPFVAVLFTSLFGSLAFLELTTDGDKVFNWLLSIVAIAGFFAWLLISLSHIRFM 484

Query: 447 KAIRVQFGDKSSLSYTAAFQPWSTYVALFFCCLIGLIKNYTVFLGHKFDYKTFISGYIGI 506
           KA+  +   ++SL + A F PW  Y A  F  LI LI+ +T F   +F+   F++ YI +
Sbjct: 485 KALEYRGISRNSLPFKAIFMPWLAYYATAFIILIILIQGFTAF-APRFNVSDFVASYISL 543

Query: 507 PVYLICYVGYKVVYRTKLI-KPEDVDLYTFKDAID 540
            +++I +  ++ + + ++  K ED+DL + +  I+
Sbjct: 544 LLFVIIWGVFQAMKKCRIFWKVEDIDLDSDRKDIE 578

>TPHA0H02850 Chr8 complement(676524..678329) [1806 bp, 601 aa] {ON}
           Anc_7.44 YOR348C
          Length = 601

 Score =  299 bits (765), Expect = 4e-93,   Method: Compositional matrix adjust.
 Identities = 184/561 (32%), Positives = 286/561 (50%), Gaps = 40/561 (7%)

Query: 1   MNSDTSME----KKNAGVLYSNETLEEGIVTLESEGQVRSVSEGVDGKHEGIRLKKELEA 56
           MN D S++    KK++G+          ++T+ S+    S+ E          LK+ L++
Sbjct: 35  MNLDDSLDDRFNKKDSGL--------NKVLTVSSDTSTNSLEEDYTNT-----LKQGLKS 81

Query: 57  RHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILISYSFVGLLVYTVMSCLGEMAAFIPLD 116
           RHV +                       P  + I+Y  +  ++Y +M+ +GEM  ++P D
Sbjct: 82  RHVQLIALGGCIGTGLFVGTSSTLHTCGPAGLFIAYCIISSVIYPIMNAVGEMVCYLPGD 141

Query: 117 GFTSYAS------RYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVNPGV 170
           G  S  S      RYVD ++ FA G++Y + Y I+   + TA A V+++W     V    
Sbjct: 142 GHDSAGSVTHLVKRYVDESLAFATGWNYFYCYVILVAAECTAAAGVVEYWTLA--VPKAA 199

Query: 171 WITIFLALIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGFRF 230
           WITIFLA+I L+N   V++FGE EFW +S+K                   P+HDR GFR+
Sbjct: 200 WITIFLAIIFLLNMSSVKYFGETEFWFASIKILCIMGLIILSFILFWGGGPSHDRLGFRY 259

Query: 231 WRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYT-GTELCGIVAAEAKNPRRSVPRAI 289
           W++PGAF  +     GS G               +  G EL  + ++E  + RR++ +A 
Sbjct: 260 WKNPGAFAHH--VTDGSLGNFLDIYSGIIKGAFAFILGPELVALTSSECSDQRRNIAKAS 317

Query: 290 KLTLYRIVVFYVITILLLGMTVAYNDPRLLXXXXXXX-XXXXXPFVVAIENASIPVLPHI 348
           K  +YR++ FY++  L +G+ VA+NDP L              PFV+ I+NA I VLPHI
Sbjct: 318 KRFIYRLMFFYILGTLAIGVIVAWNDPVLASALSNNTPGAGSSPFVIGIQNAGIEVLPHI 377

Query: 349 FNVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCLLA 408
            N C+L   +S+ N+ ++ +SRSL+ +A +G AP+IF   NK+GVPY ++ LS L   LA
Sbjct: 378 INACILTSAWSSGNAFMFASSRSLFTMAQNGTAPKIFGRINKYGVPYMAVILSTLISCLA 437

Query: 409 YMNVSSGSAQVFNYFVNVVSIFGLLSWITILITYIRFDKAI-RVQFGDKSSLSYTAAFQP 467
           Y+N SS +A+VF +  N+ +I G L WI   I Y+RF KAI      D+  + +    QP
Sbjct: 438 YLNASSSAARVFTWLSNISTISGFLGWICACIAYLRFRKAIFYNNLYDR--MPFKTWGQP 495

Query: 468 WSTYVALFFCCLIGLIKNYTVFLGHKFDYKTFISGYIGIPVYLICYVGYKVVYRTKLIKP 527
           +    +L    +I +   Y  F+   ++   FI+ YI +P++L  YVG+KV    K   P
Sbjct: 496 YLILWSLTVVSIITITNGYQTFIPKFWNVSDFIAAYITLPIFLALYVGHKVYNHFKNDYP 555

Query: 528 --------EDVDLYTFKDAID 540
                   ED+D+ T  D I+
Sbjct: 556 LMKLAYSVEDIDVITGLDEIE 576

>Skud_14.71 Chr14 (127310..129148) [1839 bp, 612 aa] {ON} YEL063C
           (REAL)
          Length = 612

 Score =  298 bits (763), Expect = 8e-93,   Method: Compositional matrix adjust.
 Identities = 173/501 (34%), Positives = 263/501 (52%), Gaps = 10/501 (1%)

Query: 43  GKHEGIRLKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILISYSFVGLLVYTV 102
             +E   +K+ L+ RH+ M                       PV  LISY F+G +VY +
Sbjct: 100 AHYEDKHVKRALKQRHIGMIALGGTIGTGLFVGISTPLSKAGPVGSLISYIFMGTVVYFI 159

Query: 103 MSCLGEMAAFIPL-DGFTSYASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWV 161
              LGEMA FIP+    T ++ R++ PA G A GY Y F + I    +++    V+Q+W 
Sbjct: 160 TQSLGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEVSVIGQVIQYWT 219

Query: 162 SRDRVNPGVWITIFLALIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXP 221
             D+V   VWI IF  LI L+N   V+ +GEFEFW++SVK                    
Sbjct: 220 --DKVPLAVWIAIFWVLITLMNFFPVKVYGEFEFWVASVKVLAIMGYLIYALVIVCGGS- 276

Query: 222 NHDRTGFRFWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNP 281
           +    GFR+WR+PGA+ P   +   ++G+              Y GTEL GI A EA NP
Sbjct: 277 HQGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANP 336

Query: 282 RRSVPRAIKLTLYRIVVFYVITILLLGMTVAYNDPRLLXXXXXXXXXXXXPFVVAIENAS 341
           R++VPRAI   ++RIV+FY++++  +G+ V YN+PRL             PFV++I+NA 
Sbjct: 337 RKTVPRAINKVVFRIVLFYIMSLFFIGLLVPYNEPRLSASSAVIASS---PFVISIQNAG 393

Query: 342 IPVLPHIFNVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLS 401
              LP IFN  VL+ V SA NS++YV SR LY LA  G AP+ F    K GVPY  +  +
Sbjct: 394 TYALPDIFNAVVLITVISAANSNVYVGSRVLYSLAQTGNAPKQFGYVTKQGVPYLGVLST 453

Query: 402 VLFCLLAYMNVSSGSAQVFNYFVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLSY 461
               LLA++ V++ +   FN+ +N+ ++ GL +W+ I + +IRF +A+  +   +  L +
Sbjct: 454 AALGLLAFLVVNNNANTAFNWLINISTLAGLCAWLFISLAHIRFMQALEQRGISRDDLPF 513

Query: 462 TAAFQPWSTYVALFFCCLIGLIKNYTVFLGHKFDYKTFISGYIGIPVYLICYVGYKVVYR 521
            A   P+  Y A FF  +I  I+ +  F    F    F + YI + +  + + G ++ Y+
Sbjct: 514 KAKLMPYGAYYAAFFVTVIIFIQGFQAFC--PFKVSDFFTSYISLILLAVVFTGCQLYYK 571

Query: 522 TKLI-KPEDVDLYTFKDAIDA 541
            + I K ED+D+ T +  I+A
Sbjct: 572 CRFIWKLEDIDIDTDRREIEA 592

>Suva_8.402 Chr8 complement(722727..724778) [2052 bp, 683 aa] {ON}
           YOR348C (REAL)
          Length = 683

 Score =  300 bits (768), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 172/509 (33%), Positives = 269/509 (52%), Gaps = 16/509 (3%)

Query: 22  EEGIVTLESEGQVRSVSEGVDGKHEGIRLKKELEARHVSMXXXXXXXXXXXXXXXXXXXX 81
             G V  E + +    ++G  G H   RLK+ L++RHV +                    
Sbjct: 137 SNGTVREELDLEKSPSADGDAGPH---RLKQGLQSRHVQLIALGGAIGTGLLVGTSSTLH 193

Query: 82  XXXPVSILISYSFVGLLVYTVMSCLGEMAAFIPLDGFTSYAS------RYVDPAVGFAVG 135
              P  + ISY  +  ++Y +M  LGEM  F+P DG  S  S      RYVD ++GFA G
Sbjct: 194 TCGPAGLFISYIIISAVIYPIMCALGEMVCFLPGDGSDSAGSSANLVTRYVDASLGFATG 253

Query: 136 YSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVNPGVWITIFLALIVLINTVGVRFFGEFEF 195
           ++Y + Y I+   + TA + V+++W +   V  GVWITIFL ++VL+N   V+ +GE EF
Sbjct: 254 WNYYYCYVILVAAECTAASGVVEYWTTA--VPKGVWITIFLCVVVLLNFSAVKVYGESEF 311

Query: 196 WLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGFRFWRDPGAFKPYSEAISGSKGKXXXXX 255
           W +S+K                   P HDR GFR+W+ PG+F  +     GS G      
Sbjct: 312 WFASIKILCIVGLIILSFILFWGGGPKHDRLGFRYWQHPGSFAHHLAG--GSLGNFTDIY 369

Query: 256 XXXXXXXXXYT-GTELCGIVAAEAKNPRRSVPRAIKLTLYRIVVFYVITILLLGMTVAYN 314
                    +  G EL  + +AE  + RR++ +A +  ++R++ FYV+  L + + V YN
Sbjct: 370 TGIIKGAFAFILGPELVCMTSAECADQRRNIAKASRRFVWRLIFFYVLGTLAITVIVPYN 429

Query: 315 DPRLLXXXXXXX-XXXXXPFVVAIENASIPVLPHIFNVCVLVFVFSACNSDLYVASRSLY 373
           DP L+             P+V+ I+NA I VLPHI N C+L   +SA N+ ++ ++RSL 
Sbjct: 430 DPSLVNALAQGKPGAGSSPYVIGIQNAGIKVLPHIINGCILTSAWSAANAFMFASTRSLL 489

Query: 374 GLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCLLAYMNVSSGSAQVFNYFVNVVSIFGLL 433
            +A  G+AP+     N++GVPY ++G+S L   LAY+NVSS +A VFN+F N+ +I G L
Sbjct: 490 TMAQTGQAPKCLGKINRFGVPYVAVGVSFLCSCLAYLNVSSSTADVFNWFSNISTISGFL 549

Query: 434 SWITILITYIRFDKAIRVQFGDKSSLSYTAAFQPWSTYVALFFCCLIGLIKNYTVFLGHK 493
            WI   I Y+RF KAI    G    L +    QP++ + +L    +I +   Y +F+   
Sbjct: 550 GWICGCIAYLRFRKAIFFN-GLYDRLPFKTWGQPYTVWFSLTVVSIITITNGYAIFIPKY 608

Query: 494 FDYKTFISGYIGIPVYLICYVGYKVVYRT 522
           ++   FI+ YI +P++L+ ++G+K+  RT
Sbjct: 609 WNVADFIAAYITLPIFLVLWLGHKLYTRT 637

>SAKL0C02728g Chr3 (255022..256710) [1689 bp, 562 aa] {ON} similar
           to uniprot|P32487 Saccharomyces cerevisiae YNL268w LYP1
           lysine-specific high-affinity permease
          Length = 562

 Score =  296 bits (758), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 175/525 (33%), Positives = 271/525 (51%), Gaps = 14/525 (2%)

Query: 2   NSDTSMEKKNAGVLYSNETLEEGIVTLESEGQVRSVSEGVDGKHEGIRLKKELEARHVSM 61
           N+  S+ KK    + S+ETL      + S     +  E  +G      +K+ L+ RH+SM
Sbjct: 14  NTKPSVSKKLEDYV-SSETLP-----IYSHSGDNAPCEKGEGDCRETEVKRALKPRHISM 67

Query: 62  XXXXXXXXXXXXXXXXXXXXXXXPVSILISYSFVGLLVYTVMSCLGEMAAFIPL-DGFTS 120
                                  PV  LI+Y F+G +VY V   LGEMA FIP+    T 
Sbjct: 68  IALGGTIGTGLFVGIASPLSESGPVGALIAYIFIGSIVYFVTQSLGEMATFIPVTSSITV 127

Query: 121 YASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVNPGVWITIFLALIV 180
           ++ R++ PA G A GY Y F + I    ++     V+Q+W   D V    WI IF  L+ 
Sbjct: 128 FSKRFLSPAFGVANGYMYWFNWAITYAVEIAVVGQVIQYWT--DAVPLAAWIAIFWVLVT 185

Query: 181 LINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGFRFWRDPGAFKPY 240
           L N   V+F+GE EFW++SVK                    +    GFR+WR+PG + P 
Sbjct: 186 LANFFPVKFYGEVEFWVASVKVIAIVGYLIYALVIVCGGS-HQGPIGFRYWRNPGPWGPG 244

Query: 241 SEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVVFY 300
             +   ++G+              Y GTEL GI A EA NPR++VPRAI    +RI+ FY
Sbjct: 245 IISKDVNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPRAINKVFFRILFFY 304

Query: 301 VITILLLGMTVAYNDPRLLXXXXXXXXXXXXPFVVAIENASIPVLPHIFNVCVLVFVFSA 360
           ++++  +G+ V Y+D RL             PFV++I+NA   VLPHIFN  V++ + SA
Sbjct: 305 ILSLFFIGLLVPYDDLRL---SNTTAVIASSPFVISIQNAGTKVLPHIFNAIVMITIISA 361

Query: 361 CNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCLLAYMNVSSGSAQVF 420
            NS++YV SR LY LA+ G AP+ F    K GVPY  + ++ L  LLA++ V++ + + F
Sbjct: 362 ANSNVYVGSRVLYSLALSGNAPKQFGYVTKQGVPYLGVIVTALLGLLAFLVVNNNANEAF 421

Query: 421 NYFVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLSYTAAFQPWSTYVALFFCCLI 480
           N+ VN+ ++ GL +W+ I ++++RF + ++ +   +  L + A   PW  Y A FF  +I
Sbjct: 422 NWLVNISTLAGLCAWLFISLSHVRFMQCLKHRGISREDLPFKAKLMPWGAYYAAFFIGVI 481

Query: 481 GLIKNYTVFLGHKFDYKTFISGYIGIPVYLICYVGYKVVYRTKLI 525
            +I+ +  F   KF    F + YI + +  + ++G ++ YR + I
Sbjct: 482 IIIQGFKAFT-PKFRVSDFFTSYISLILLAVLFLGCQLFYRCRFI 525

>TPHA0B04480 Chr2 (1050173..1051984) [1812 bp, 603 aa] {ON} Anc_1.83
           YEL063C
          Length = 603

 Score =  296 bits (759), Expect = 3e-92,   Method: Compositional matrix adjust.
 Identities = 172/505 (34%), Positives = 280/505 (55%), Gaps = 12/505 (2%)

Query: 39  EGVDGKHEGIRLKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILISYSFVGLL 98
           EGV  + E   +K++L+ RH+ M                       PV  LI+Y F+  +
Sbjct: 89  EGVVKEAE---VKRQLKQRHIGMIALGGTIGTGLFIGIATPLGNAGPVGALIAYLFMATI 145

Query: 99  VYTVMSCLGEMAAFIPL-DGFTSYASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVM 157
           V++V   LGEMA FIP+   FT ++SR++ PA+G A GY Y F + +    +L+    ++
Sbjct: 146 VFSVTQSLGEMATFIPVTSSFTVFSSRFLSPAIGAANGYMYWFSWAVTFALELSVVGQII 205

Query: 158 QFWVSRDRVNPGVWITIFLALIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXX 217
           QFW     V    WI I+  ++ ++N   V+F+GEFEFW++S+K                
Sbjct: 206 QFWT--HAVPLSAWIVIWWVILTIMNLFPVKFYGEFEFWVASIKVLAIIGFLIYCLCMVC 263

Query: 218 XXXPNHDRTGFRFWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAE 277
                    GFR+WR+PG + P   +   ++G+              Y GTEL GI A E
Sbjct: 264 GAGVTGP-VGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLINAAFTYQGTELVGITAGE 322

Query: 278 AKNPRRSVPRAIKLTLYRIVVFYVITILLLGMTVAYNDPRLLXXXXXXXXXXXXPFVVAI 337
           A NPR++VPRAIK   +RI++FY++++  +G+ V Y+D +L             PF++AI
Sbjct: 323 AANPRKTVPRAIKKVTFRILIFYILSLFFIGLLVPYDDEKL---TSTDSYISASPFIIAI 379

Query: 338 ENASIPVLPHIFNVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYS 397
           EN+   +LPHIFN  +L  + SA NS++YV SR L+GLA    AP+ F  T++ GVPYYS
Sbjct: 380 ENSGTKILPHIFNAVILSTIISAGNSNVYVGSRILFGLAKTKLAPKWFGYTSRGGVPYYS 439

Query: 398 LGLSVLFCLLAYMNVSSGSAQVFNYFVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKS 457
           +  +  F  LA++ VSSG A+ FN+ +N++S+ G  +W+ I I ++RF +A++ +   + 
Sbjct: 440 VFFTSSFGALAFLEVSSGGAKAFNWLLNIISVAGFFAWLLISIAHVRFMQALKHRGISRD 499

Query: 458 SLSYTAAFQPWSTYVALFFCCLIGLIKNYTVFLGHKFDYKTFISGYIGIPVYLICYVGYK 517
            L + A F P   Y ++FF  +I +I+ +T F    F+   F++ YI I ++   ++ ++
Sbjct: 500 DLPFKARFMPHLAYYSIFFMTIIIIIQGFTAF-APTFNGSDFVAAYISIFLFFFLWLCFQ 558

Query: 518 VVYRTKLI-KPEDVDLYTFKDAIDA 541
           + +R+KL+   E+VD+ T +  +DA
Sbjct: 559 LYFRSKLLWTVEEVDIDTDRRDVDA 583

>KAFR0D03940 Chr4 complement(767673..769466) [1794 bp, 597 aa] {ON}
           Anc_1.84 YNL268W
          Length = 597

 Score =  296 bits (758), Expect = 3e-92,   Method: Compositional matrix adjust.
 Identities = 178/547 (32%), Positives = 280/547 (51%), Gaps = 18/547 (3%)

Query: 2   NSDTSMEKKNAGVLYSNETLEEGIVTLESEGQVRSVSEGVDGKHEGIRLKKELEARHVSM 61
           + D S++KK      ++ T       +E E       +  +  +E  ++K+EL+ RH+ M
Sbjct: 40  SKDNSIKKKIPNSELASLTHAYSRSRVEPEHD----EDAEEADYEDKQVKRELKQRHIGM 95

Query: 62  XXXXXXXXXXXXXXXXXXXXXXXPVSILISYSFVGLLVYTVMSCLGEMAAFIPL-DGFTS 120
                                  PV  LI+Y F+G +VY V   LGEMA FIP+    T 
Sbjct: 96  IALGGTIGTGLFVGIATPLADAGPVGALIAYIFMGSIVYFVTQALGEMATFIPVTSSITV 155

Query: 121 YASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVNPGVWITIFLALIV 180
           ++ R++ PA G A GY Y F + I    +++    V+Q+W   D V    WI IF  L+ 
Sbjct: 156 FSQRFLSPAFGVANGYMYWFNWAITFAVEISVVGQVIQYWT--DAVPLAAWIAIFWVLVT 213

Query: 181 LINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGFRFWRDPGAF--- 237
           L+N   V+ +GE EFW++ +K                         GFR+WR+PGA+   
Sbjct: 214 LMNFFPVKVYGEVEFWVAFMKVIAIVGYLLYALIIVCGGSKKQGPIGFRYWRNPGAWGNG 273

Query: 238 -KPYSEAISGSK--GKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPRAIKLTLY 294
                E I  SK  G+              Y GTEL GI A EA NPR++VPRAI   ++
Sbjct: 274 LTSDGEPIYSSKYEGRFLGWVASLINAAFTYQGTELVGITAGEAANPRKTVPRAINKVVF 333

Query: 295 RIVVFYVITILLLGMTVAYNDPRLLXXXXXXXXXXXXPFVVAIENASIPVLPHIFNVCVL 354
           RIV+FY++++  +G+ V + D RL             PFV++IENA   +LP IFN  V+
Sbjct: 334 RIVLFYIMSLFFIGLLVPFTDSRL---SDDTTVIASSPFVISIENAGTKILPDIFNAIVM 390

Query: 355 VFVFSACNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCLLAYMNVSS 414
           V V SA NS++YV SR LY LA    AP+IFA   + GVP+  +  + L  LLA++ V +
Sbjct: 391 VTVLSAANSNVYVGSRVLYSLAHTKVAPKIFARVTRQGVPFMGVICTSLLGLLAFLVVDN 450

Query: 415 GSAQVFNYFVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLSYTAAFQPWSTYVAL 474
            +   FN+ V++ ++ GL +W+ I + ++RF + ++ +   +  L + A F PW +Y A 
Sbjct: 451 NANTAFNWLVDISTLAGLCAWLFISLAHVRFMQVLKQRGISRDDLPFKAKFMPWGSYYAA 510

Query: 475 FFCCLIGLIKNYTVFLGHKFDYKTFISGYIGIPVYLICYVGYKVVYRTKLI-KPEDVDLY 533
           F+  +I  ++ +  F  H FD  TF + YI + +  + ++G ++ YR + + K EDVD+ 
Sbjct: 511 FWVFVIIFVQGFQAFSPH-FDVTTFFTDYISLILLAVVFIGAQLYYRCRFLWKLEDVDID 569

Query: 534 TFKDAID 540
           + +  I+
Sbjct: 570 SDRREIE 576

>NCAS0B08570 Chr2 (1644264..1645862) [1599 bp, 532 aa] {ON} 
          Length = 532

 Score =  294 bits (753), Expect = 3e-92,   Method: Compositional matrix adjust.
 Identities = 169/510 (33%), Positives = 274/510 (53%), Gaps = 14/510 (2%)

Query: 33  QVRSVSEGVDGKHEGIRLKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILISY 92
           ++R +S  V+ +     +++EL+ RH+ M                       PV  LI+Y
Sbjct: 14  EIREISVEVEAE----TVRRELKQRHMGMIALGGTIGTGLFIGVSTPLMNAGPVGALIAY 69

Query: 93  SFVGLLVYTVMSCLGEMAAFIPL-DGFTSYASRYVDPAVGFAVGYSYLFKYFIVTPNQLT 151
            F+  L Y+V   LGEMA FIP+   FT ++ R+V PA G A GY Y F + I    +L+
Sbjct: 70  LFMATLAYSVTQSLGEMATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALELS 129

Query: 152 AGAMVMQFWVSRDRVNPGVWITIFLALIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXX 211
               V+QFW     V    WI+IF  L+  +N   V+++GEFEFW++ VK          
Sbjct: 130 VVGQVIQFWTFA--VPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIY 187

Query: 212 XXXXXXXXXPNHDRTGFRFWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELC 271
                          GFR+WR PGAF P   A   ++ +              + GTEL 
Sbjct: 188 CFCMVCGAGVTGP-VGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTELV 246

Query: 272 GIVAAEAKNPRRSVPRAIKLTLYRIVVFYVITILLLGMTVAYNDPRLLXXXXXXXXXXXX 331
           GI A EA NPR++VPRAIK  ++RI+ FY++++  +G+ V Y+D +L             
Sbjct: 247 GITAGEAANPRKTVPRAIKKVVFRILFFYILSLFFIGLLVPYDDWKL---TSTDSYVSAS 303

Query: 332 PFVVAIENASIPVLPHIFNVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPRIFATTNKW 391
           PF++AIEN+   VLPHIFN  ++  + SA NS++YV SR +YGL+    AP I + T + 
Sbjct: 304 PFIIAIENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQH 363

Query: 392 GVPYYSLGLSVLFCLLAYMNVSSGSAQVFNYFVNVVSIFGLLSWITILITYIRFDKAIRV 451
           GVP+ ++ ++ LF  LAYM  S+G  + FN+ +N+  + G  +W+ I +++IRF +A+ +
Sbjct: 364 GVPWVAVLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEM 423

Query: 452 QFGDKSSLSYTAAFQPWSTYVALFFCCLIGLIKNYTVFLGHKFDYKTFISGYIGIPVYLI 511
           +   +  L + A + P   Y  +FF  LI +I+ +T F    ++   F++ YI + +++ 
Sbjct: 424 RGISRDDLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFC--PWNGIDFLTAYISVFMFIA 481

Query: 512 CYVGYKVVYRTKLI-KPEDVDLYTFKDAID 540
            ++ ++  +R +LI + EDVD+ T + A++
Sbjct: 482 IWIAFQAWFRCRLIWRVEDVDIDTDRRAVE 511

>Kwal_23.4026 s23 (534468..536072) [1605 bp, 534 aa] {ON} YPL265W
           (DIP5) - dicarboxylic amino acid permease [contig 255]
           FULL
          Length = 534

 Score =  294 bits (752), Expect = 4e-92,   Method: Compositional matrix adjust.
 Identities = 174/532 (32%), Positives = 288/532 (54%), Gaps = 9/532 (1%)

Query: 9   KKNAGVLYSNETLEEGIVTLESEGQVRSVSEGVDGKHEGIRLKKELEARHVSMXXXXXXX 68
           K   G +   +TL+ G    +  G+V  +            L++  + RHV M       
Sbjct: 5   KGATGFVKRVDTLDTGNSDTQQNGEVYELDFQEAIGESSQTLQRGFKQRHVDMLAIAGAI 64

Query: 69  XXXXXXXXXXXXXXXXPVSILISYSFVGLLVYTVMSCLGEMAAFIPLD-GFTSYASRYVD 127
                           P S+LI++ F G L+  V+  L EMA+F P+D  F+ YA+RYVD
Sbjct: 65  GTGLVIGTGTALKRGGPGSLLIAFIFTGSLLIGVLMSLAEMASFAPMDKSFSGYATRYVD 124

Query: 128 PAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVNPGVWITIFLALIVLINTVGV 187
           PA+GFA G++Y  KY I   ++L+A  +++Q+W  R+ ++  ++I +FL +++ +N + +
Sbjct: 125 PALGFATGWNYFLKYAIALASELSAIGLLVQYW--REDLSIAIFIVVFLVVLLSLNFMNI 182

Query: 188 RFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGFRFWRDPGAFKPYSEAISGS 247
           +F+GE EFW + +K                   P+ +  GFR+WR+  AF PY   + G+
Sbjct: 183 KFYGEVEFWSALLKFLVLIICFVTGLVLTCGGGPSKETIGFRYWREY-AFVPY--LVKGT 239

Query: 248 KGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVVFYVITILLL 307
            G+              Y G+E  G+V  EA NP++++P A +  ++RI  FY++ +L+L
Sbjct: 240 TGRFLGWWACVIQSCYAYIGSETIGVVFGEAPNPKKTIPAATRNVIFRITGFYIVGVLIL 299

Query: 308 GMTVAYNDPRLLXXXXXXXXXXXXPFVVAIENASIPVLPHIFNVCVLVFVFSACNSDLYV 367
           G+ ++ +D  L             PFV+A  NA I  LP   N  +++F+ SA N+ LYV
Sbjct: 300 GLIISPHDKTL--ANAKTSDASGSPFVIAFTNAGIKGLPSFINAMLIMFIASAANTALYV 357

Query: 368 ASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCLLAYMNVSSGSAQVFNYFVNVV 427
            SR+ YGLA DG AP+IF   N++GVP+    L+ L  LL++MN+S+ S+ +F Y  + V
Sbjct: 358 CSRTAYGLAKDGMAPKIFLAQNRYGVPFNGCLLAGLISLLSFMNISNSSSVIFGYLTSSV 417

Query: 428 SIFGLLSWITILITYIRFDKAIRVQFGDKSSLSYTAAFQPWSTYVALFFCCLIGLIKNYT 487
           ++FG L+W+++LI+YI +++A       +  + +   FQP+S YV LFF  LI     Y+
Sbjct: 418 TVFGTLNWLSVLISYIGYERARVFHDVPRDRIPFRMWFQPYSAYVCLFFVSLIIFFNGYS 477

Query: 488 VFLGHKFDYKTFISGYIGIPVYLICYVGYKVVYRTKLIKPEDVDLYTFKDAI 539
            F+   F YK+FI  YIGI V++   + +K   ++   +PED+     ++AI
Sbjct: 478 AFIAG-FKYKSFIVSYIGIAVFIGNTLFWKFWKKSAATRPEDLRSIMVEEAI 528

>TPHA0B04470 Chr2 complement(1047097..1048896) [1800 bp, 599 aa]
           {ON} Anc_1.84 YNL268W
          Length = 599

 Score =  296 bits (757), Expect = 6e-92,   Method: Compositional matrix adjust.
 Identities = 181/586 (30%), Positives = 294/586 (50%), Gaps = 36/586 (6%)

Query: 2   NSDTSMEKKN------AGVLYSNETLEEGIVTLESEGQVR---SVSEGVDGKH-EGIRLK 51
           +SDT ME         AG L+S++ L   +   ++         +S+  +  H +  R+K
Sbjct: 37  DSDTDMEPSQRKKAAMAGKLFSDQ-LSYNVSVADNSSAANGDLDLSDTEEAGHVQDTRVK 95

Query: 52  KELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILISYSFVGLLVYTVMSCLGEMAA 111
           + L+ RH+ M                       PV  LI+Y F+G ++Y +   LGEMA 
Sbjct: 96  RALKQRHIGMIALGGTIGTGLFVGISTPLGNAGPVGALIAYIFMGSIIYFITQSLGEMAT 155

Query: 112 FIPL-DGFTSYASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVNPGV 170
           FIP+    T ++ R++ PA G   GY Y F + I    +++    V+Q+W   D V    
Sbjct: 156 FIPVTSSITVFSKRFLSPAFGVTNGYMYWFNWAITYAVEISVVGQVIQYWT--DAVPLAA 213

Query: 171 WITIFLALIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGFRF 230
           WI IF   + L+N   V+ +GE EFW++S+K                    +    GFR+
Sbjct: 214 WIAIFWVFVTLLNFFPVKVYGEVEFWVASIKVLAIIGYLIYALVIVCGGS-SQGPIGFRY 272

Query: 231 WRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPRAIK 290
           WR+PG + P   +   ++G+              Y GTEL GI A EA NPR+SVPRAI 
Sbjct: 273 WRNPGPWGPGIISKDVNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAIN 332

Query: 291 LTLYRIVVFYVITILLLGMTVAYNDPRLLXXXXXXXXXXXXPFVVAIENASIPVLPHIFN 350
             ++RI +FY++++  +G+ V YND  L             PFV++I+NA    LP IFN
Sbjct: 333 KVVFRIALFYIMSLFFIGLLVPYNDHTL---SSGDSYIASSPFVISIQNAGTYALPDIFN 389

Query: 351 VCVLVFVFSACNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCLLAYM 410
             V++ + SA NS++YV SR LY LA  G AP+ FA   K GVP+  + ++    LLA++
Sbjct: 390 AVVMLTIISAANSNVYVGSRVLYALAQTGNAPKQFAYVTKHGVPWLGVIVTASLGLLAFL 449

Query: 411 NVSSGSAQVFNYFVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLSYTAAFQPWST 470
            V++ +   FN+ +N+ ++ GL +W  I +++IRF +A++ +   +  L + A   PW  
Sbjct: 450 VVNNNANTAFNWLINISTLAGLCAWFFIALSHIRFMQALKYRGISRDDLPFKAKLMPWGA 509

Query: 471 YVALFFCCLIGLIKNYTVFLGHKFDYKTFISGYIGIPVYLICYVGYKVVYRTK-LIKPED 529
           Y + FF  +I  I+ +  F    +D  TF + YI + + ++ ++G ++ YR + L+K ED
Sbjct: 510 YYSAFFVFVIIFIQGFEAFT--PWDTTTFFTSYISLILLVVVFIGCQLYYRCRFLLKVED 567

Query: 530 VDLYTFKDAIDAXXXXXXXXXXXXXXNMENSPKNFKWFYETFLGWI 575
           +D+ T +  I+A                ++ PKN    +E F  W+
Sbjct: 568 IDIDTDRREIEAIIWE------------DDEPKN---LWEKFWAWV 598

>YNL268W Chr14 (138550..140385) [1836 bp, 611 aa] {ON}  LYP1Lysine
           permease; one of three amino acid permeases (Alp1p,
           Can1p, Lyp1p) responsible for uptake of cationic amino
           acids
          Length = 611

 Score =  295 bits (756), Expect = 9e-92,   Method: Compositional matrix adjust.
 Identities = 173/543 (31%), Positives = 276/543 (50%), Gaps = 11/543 (2%)

Query: 2   NSDTSMEKKNAGVLYSNETLEEGIVTLESEGQVRSVSEGVDGKH-EGIRLKKELEARHVS 60
           N+         G +    ++   +  L+       ++E  +  H E   +K+ L+ RH+ 
Sbjct: 57  NTKKKHGSLQGGAIADVNSITNSLTRLQVVSHETDINEDEEEAHYEDKHVKRALKQRHIG 116

Query: 61  MXXXXXXXXXXXXXXXXXXXXXXXPVSILISYSFVGLLVYTVMSCLGEMAAFIPL-DGFT 119
           M                       PV  LI+Y F+G +VY V   LGEMA FIP+    T
Sbjct: 117 MIALGGTIGTGLFVGISTPLSNAGPVGSLIAYIFMGTIVYFVTQSLGEMATFIPVTSSIT 176

Query: 120 SYASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVNPGVWITIFLALI 179
            ++ R++ PA G + GY Y F + I    +++    V+++W   D+V    WI IF  +I
Sbjct: 177 VFSKRFLSPAFGVSNGYMYWFNWAITYAVEVSVIGQVIEYWT--DKVPLAAWIAIFWVII 234

Query: 180 VLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGFRFWRDPGAFKP 239
            L+N   V+ +GEFEFW++SVK                    +    GFR+WR+PGA+ P
Sbjct: 235 TLMNFFPVKVYGEFEFWVASVKVLAIMGYLIYALIIVCGGS-HQGPIGFRYWRNPGAWGP 293

Query: 240 YSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVVF 299
              +   S+G+              Y GTEL GI A EA NPR++VPRAI   ++RIV+F
Sbjct: 294 GIISSDKSEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPRAINKVVFRIVLF 353

Query: 300 YVITILLLGMTVAYNDPRLLXXXXXXXXXXXXPFVVAIENASIPVLPHIFNVCVLVFVFS 359
           Y++++  +G+ V YND RL             PFV++I+NA    LP IFN  VL+ V S
Sbjct: 354 YIMSLFFIGLLVPYNDSRLSASSAVIASS---PFVISIQNAGTYALPDIFNAVVLITVVS 410

Query: 360 ACNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCLLAYMNVSSGSAQV 419
           A NS++YV SR LY LA  G AP+ F    + GVPY  +  +    LLA++ V++ +   
Sbjct: 411 AANSNVYVGSRVLYSLARTGNAPKQFGYVTRQGVPYLGVVCTAALGLLAFLVVNNNANTA 470

Query: 420 FNYFVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLSYTAAFQPWSTYVALFFCCL 479
           FN+ +N+ ++ GL +W+ I + +IRF +A++ +   +  L + A   P+  Y A FF  +
Sbjct: 471 FNWLINISTLAGLCAWLFISLAHIRFMQALKHRGISRDDLPFKAKLMPYGAYYAAFFVTV 530

Query: 480 IGLIKNYTVFLGHKFDYKTFISGYIGIPVYLICYVGYKVVYRTKLI-KPEDVDLYTFKDA 538
           I  I+ +  F    F    F + YI + +  + ++G ++ Y+ + I K ED+D+ + +  
Sbjct: 531 IIFIQGFQAFC--PFKVSEFFTSYISLILLAVVFIGCQIYYKCRFIWKLEDIDIDSDRRE 588

Query: 539 IDA 541
           I+A
Sbjct: 589 IEA 591

>Kwal_33.13401 s33 complement(206763..208442) [1680 bp, 559 aa] {ON}
           YEL063C (CAN1) - arginine permease [contig 118] FULL
          Length = 559

 Score =  293 bits (751), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 175/540 (32%), Positives = 277/540 (51%), Gaps = 15/540 (2%)

Query: 7   MEKKNAGVLYSNETLEEGIVTLESEGQVRSVSEGVDGKHEGIRLKKELEARHVSMXXXXX 66
           M +K    L   E        L+ E Q    S+     H    ++++L+ RHVSM     
Sbjct: 10  MSQKTETRLEDYEMGSFAEEALDQEAQSSQDSQLGSSGHGRNAVQRQLKPRHVSMIALGG 69

Query: 67  XXXXXXXXXXXXXXXXXXPVSILISYSFVGLLVYTVMSCLGEMAAFIPL-DGFTSYASRY 125
                             PV  LISY F+G + Y V   LGEMA FIP+   FT +  R+
Sbjct: 70  TIGTGLFIGIESPLRNAGPVGALISYLFMGSIAYCVTQSLGEMATFIPVTSSFTVFTRRF 129

Query: 126 VDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVNPGVWITIFLALIVLINTV 185
           +   +G A GY Y F + +    +L+    ++++W S   V    WI IF   I L N V
Sbjct: 130 LSLPLGAANGYMYCFSWSVTYALELSIVGQIIEYWTSA--VPNAAWIAIFWVPITLSNLV 187

Query: 186 GVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGFRFWRDPGAFKPYSEAIS 245
            V+F+GEF+FW++ +K                         GFR+WR+PG   P+ + I 
Sbjct: 188 PVKFYGEFQFWIALIKVVAIIGFLVYCLCMVCGAGKTGP-VGFRYWRNPG---PWGDGII 243

Query: 246 GS---KGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVVFYVI 302
                +G+              Y GTEL GI A E+ NPR++VP+AI    +RI++FYV 
Sbjct: 244 SHDIHEGRFLGWVSSLVNAAFTYQGTELVGISAGESANPRKTVPKAINKVFFRILLFYVG 303

Query: 303 TILLLGMTVAYNDPRLLXXXXXXXXXXXXPFVVAIENASIPVLPHIFNVCVLVFVFSACN 362
           ++  +G+ V +ND +L             PF++AI+N+   +LP IFN  +L  + SA N
Sbjct: 304 SLFFIGLLVPFNDEKL---TSSDSYSAGSPFIIAIQNSGTKILPDIFNAVILATIISAAN 360

Query: 363 SDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCLLAYMNVSSGSAQVFNY 422
           S++YV SR LYGLA +  APR FA TN+ GVP  ++     F  L Y++VS+G+++ F++
Sbjct: 361 SNVYVGSRVLYGLAKERLAPRFFARTNRHGVPDVAVLFVANFGFLGYLSVSNGASKAFDW 420

Query: 423 FVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLSYTAAFQPWSTYVALFFCCLIGL 482
            +N+ +I G  SW+ I + ++RF +A+++Q   +  L + A   PW  Y + FF  LI +
Sbjct: 421 LLNITAIAGFFSWLFISLCHVRFMQALKLQGISRDDLPFKAKLMPWGAYYSAFFITLIII 480

Query: 483 IKNYTVFLGHKFDYKTFISGYIGIPVYLICYVGYKVVYRTKLI-KPEDVDLYTFKDAIDA 541
           I+ +T  L   F+   F + YI + ++L+ +  ++  YRT++I + E VD+ + +  +DA
Sbjct: 481 IQGFTS-LAPTFNVSNFFAAYISVFMFLVIWAVFQCWYRTRIIHRIEHVDIDSDRREVDA 539

>NDAI0F04190 Chr6 complement(1012142..1013941) [1800 bp, 599 aa]
           {ON} 
          Length = 599

 Score =  295 bits (754), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 163/499 (32%), Positives = 265/499 (53%), Gaps = 9/499 (1%)

Query: 45  HEGIRLKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILISYSFVGLLVYTVMS 104
           +   ++K+ L+ RH+ M                       PV  LI+Y F+G ++Y +  
Sbjct: 88  YHDTQVKRALKQRHLGMIALGGTIGTGLFIGIATPLTNSGPVGSLIAYLFMGSIIYFITQ 147

Query: 105 CLGEMAAFIPL-DGFTSYASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSR 163
            LGEMA FIP+    T ++ R++ PA G A GY Y F + I    +++    V+++W   
Sbjct: 148 SLGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITFAVEISVVGQVIEYWT-- 205

Query: 164 DRVNPGVWITIFLALIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNH 223
           D+V    WI IF  LI L+N   V+ +GE EFW++ +K                    + 
Sbjct: 206 DKVPLAAWIAIFWVLITLLNFFPVKVYGEIEFWIAFIKVLAIMGYLLYALIIVCGGS-SQ 264

Query: 224 DRTGFRFWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRR 283
              GFR+WR+PG + P   +   + G+              Y GTEL GI A EA NPR+
Sbjct: 265 GPIGFRYWRNPGPWGPGIISKDVNTGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRK 324

Query: 284 SVPRAIKLTLYRIVVFYVITILLLGMTVAYNDPRLLXXXXXXXXXXXXPFVVAIENASIP 343
           +VPRAI   ++RI +FY++++  +GM V YND RL             PFV++I+NA   
Sbjct: 325 TVPRAINKVVFRIALFYIMSLFFIGMLVPYNDERL---ASTSAVIASSPFVISIQNAGTK 381

Query: 344 VLPHIFNVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVL 403
           VLP IFN  V++ + SA NS++YV SR LY LA+ G AP+ FA   ++GVPY  + ++  
Sbjct: 382 VLPDIFNAIVMITIISAANSNVYVGSRVLYALALSGNAPKQFAFVTRYGVPYLGVIVTSA 441

Query: 404 FCLLAYMNVSSGSAQVFNYFVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLSYTA 463
             LLA++ V++ +   FN+ +N+ ++ GL +W+ I I++IRF +A++ +   +  L + A
Sbjct: 442 LGLLAFLVVNNNANTAFNWLINISTLAGLCAWLFISISHIRFMQALKFRGISRDDLPFKA 501

Query: 464 AFQPWSTYVALFFCCLIGLIKNYTVFLGHKFDYKTFISGYIGIPVYLICYVGYKVVYRTK 523
              P+  Y A FF  +I  I+ +  F  H +D   F + YI + +  + ++G ++ YR +
Sbjct: 502 KLMPFGAYYATFFVTVIIFIQGFQAFSPH-WDTTAFFTSYISLIILAVLFIGCQIFYRCR 560

Query: 524 LI-KPEDVDLYTFKDAIDA 541
              + ED+D+ + +  I+A
Sbjct: 561 FFWRVEDIDIDSDRREIEA 579

>ZYRO0F16632g Chr6 complement(1371112..1372935) [1824 bp, 607 aa]
           {ON} similar to uniprot|P32487 Saccharomyces cerevisiae
           YNL268W LYP1 Lysine permease one of three amino acid
           permeases (Alp1p Can1p Lyp1p) responsible for uptake of
           cationic amino acids
          Length = 607

 Score =  295 bits (754), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 171/501 (34%), Positives = 261/501 (52%), Gaps = 10/501 (1%)

Query: 43  GKHEGIRLKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILISYSFVGLLVYTV 102
           GK    ++K+ L+ RH+ M                       PV  LI+Y F+G +VY V
Sbjct: 95  GKFHDTQVKRALKPRHLGMIALGGTIGTGLFVGISEPLSRSGPVGSLIAYIFMGSVVYFV 154

Query: 103 MSCLGEMAAFIPL-DGFTSYASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWV 161
              LGEMA FIP+    T +  R++ PA+G + GY Y F + I    +L+    ++Q+W 
Sbjct: 155 TQSLGEMATFIPVTSSITVFTKRFLSPALGVSNGYMYWFNWAITFATELSVTGQIIQYWT 214

Query: 162 SRDRVNPGVWITIFLALIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXP 221
            +  V    WI IF  ++ ++N   V+ +GE EFW+SSVK                    
Sbjct: 215 YK--VPLAAWIPIFWVIVAVLNFFPVKIYGEIEFWVSSVKVLAIVGYLIYALVIVCGGS- 271

Query: 222 NHDRTGFRFWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNP 281
                GFR+WR   AF     + +  + +              Y GTEL GI A EA NP
Sbjct: 272 RQGPIGFRYWRHGYAFGDGYISKNKDEARFLGWVSSLINAAFTYQGTELVGISAGEAANP 331

Query: 282 RRSVPRAIKLTLYRIVVFYVITILLLGMTVAYNDPRLLXXXXXXXXXXXXPFVVAIENAS 341
           R++VPRAI   ++RI +FY++++  +G+ V YND RL             PFV+++ NA 
Sbjct: 332 RKTVPRAINKVIFRIALFYILSLFFIGLLVPYNDKRL---SDGSAIIASSPFVISMLNAG 388

Query: 342 IPVLPHIFNVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLS 401
              LP IFN  +L+ V SA NSD+Y+ASR LY LA  G AP+ F   N++GVPY  + ++
Sbjct: 389 TSALPDIFNAVILITVLSAANSDVYIASRVLYALAGQGNAPKQFTYVNRYGVPYLGVFVT 448

Query: 402 VLFCLLAYMNVSSGSAQVFNYFVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLSY 461
            L   LA++ VS+ +   FN+ +N+ ++ GL +W  I   +IRF +A++ +   +  L +
Sbjct: 449 CLVGWLAFLVVSNNANTAFNWLINISTLAGLTAWFFICFAHIRFMQALKHKGISRDDLPF 508

Query: 462 TAAFQPWSTYVALFFCCLIGLIKNYTVFLGHKFDYKTFISGYIGIPVYLICYVGYKVVYR 521
            A F PW  Y A FF  LI  I+ Y  F    +D K+F + YI + ++ + Y+G  + YR
Sbjct: 509 KARFMPWGAYYAAFFVGLIIFIQGYDAFT--PWDTKSFFTSYISLILFGVLYLGCLIYYR 566

Query: 522 TK-LIKPEDVDLYTFKDAIDA 541
            + LIK ED+D+ T +  ++A
Sbjct: 567 GRLLIKIEDIDIDTDRKEVEA 587

>Kpol_2000.65 s2000 (134897..136684) [1788 bp, 595 aa] {ON}
           (134897..136684) [1788 nt, 596 aa]
          Length = 595

 Score =  293 bits (751), Expect = 4e-91,   Method: Compositional matrix adjust.
 Identities = 165/484 (34%), Positives = 263/484 (54%), Gaps = 8/484 (1%)

Query: 42  DGKHEGIRLKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILISYSFVGLLVYT 101
            G  +   +K+EL+ RH+ M                       PV  LI+Y F+  +V++
Sbjct: 81  QGVVQDAEVKRELKQRHIGMIALGGTIGTGLFIGISTPLKNAGPVGSLIAYLFMATIVFS 140

Query: 102 VMSCLGEMAAFIPL-DGFTSYASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFW 160
           V   LGEMA FIP+   FT ++SR++ P++G A GY Y F + I    +L+    ++QFW
Sbjct: 141 VTQSLGEMATFIPVTSSFTVFSSRFISPSIGAANGYMYWFSWAITFALELSVVGQIIQFW 200

Query: 161 VSRDRVNPGVWITIFLALIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXX 220
              D V    WI I+  ++ ++N   V+F+GEFEFW++S+K                   
Sbjct: 201 T--DAVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCMVCGAG 258

Query: 221 PNHDRTGFRFWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKN 280
                 GFR+WR+PG + P   +   ++G+              Y GTEL GI A EA N
Sbjct: 259 VT-GPVGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAGEAAN 317

Query: 281 PRRSVPRAIKLTLYRIVVFYVITILLLGMTVAYNDPRLLXXXXXXXXXXXXPFVVAIENA 340
           PR++VPRAIK   +RI++FY++++  +G+ V ++DP+L             PF++AI+N+
Sbjct: 318 PRKTVPRAIKKVSFRILIFYILSLFFIGLLVPFDDPKLSSDDSYVSSS---PFIIAIQNS 374

Query: 341 SIPVLPHIFNVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGL 400
              VLPHIFN  +L  + SA NS++YV SR ++GLA    APR F  T K GVPY ++  
Sbjct: 375 GTKVLPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVLF 434

Query: 401 SVLFCLLAYMNVSSGSAQVFNYFVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLS 460
           +  F  LA++ VSSG A+ FN+ +N+V + G  +W+ I I ++RF + +  +   +  L 
Sbjct: 435 TSAFGALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDLP 494

Query: 461 YTAAFQPWSTYVALFFCCLIGLIKNYTVFLGHKFDYKTFISGYIGIPVYLICYVGYKVVY 520
           + AA  PW  Y A+FF  +I +I+ +T F    F+   F++ YI + ++   +V +++ +
Sbjct: 495 FKAALMPWLAYYAIFFMIIIIIIQGFTAF-APTFNGSDFVAAYISVFLFFFLWVSFQLYF 553

Query: 521 RTKL 524
           R KL
Sbjct: 554 RCKL 557

>KNAG0E00390 Chr5 (61730..63529) [1800 bp, 599 aa] {ON} Anc_7.44
           YOR348C
          Length = 599

 Score =  293 bits (751), Expect = 4e-91,   Method: Compositional matrix adjust.
 Identities = 174/541 (32%), Positives = 281/541 (51%), Gaps = 26/541 (4%)

Query: 2   NSDTSMEKKNAGVLYSNETLEEGIVTLESEGQVRSVSEGVDGK------------HEGIR 49
           ++ T+    +AG L + +   + I  ++ E Q  + S  +  K            +EG  
Sbjct: 18  DAATTHTIGSAGALPAKDKYNKTIEFVDVESQQSTSSATISEKLGDGDGDADPFANEG-S 76

Query: 50  LKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILISYSFVGLLVYTVMSCLGEM 109
           L++ L++RH+ M                       P  + ISY  +  +VY +M   GEM
Sbjct: 77  LQQGLKSRHIQMIALGGAIGTGLFVGTSSTLALCGPAGLFISYIIISSVVYPIMCGFGEM 136

Query: 110 AAFIPLDGFTSYAS------RYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSR 163
             ++P +G  +  S      RYVD ++GFA  ++Y + Y I+   + TA + V+++W   
Sbjct: 137 VCYLPGNGNDASGSAAHLVARYVDKSLGFATAWNYYYCYIILVAAECTAASGVVEYWTVA 196

Query: 164 DRVNPGVWITIFLALIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNH 223
             V  GVWI IFL ++V++N   V+++GE EFW +S+K                   PNH
Sbjct: 197 --VPKGVWILIFLGIVVILNFGPVKYYGEAEFWFASIKILCIVGLIILSFILFWGGGPNH 254

Query: 224 DRTGFRFWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYT-GTELCGIVAAEAKNPR 282
           DR GFR+W+ PGAF  +   + G  G+              +  G EL  + +AE ++ R
Sbjct: 255 DRLGFRYWQRPGAFTEH--IMKGGFGRFLDIYSGVIKGGFAFILGPELVCLTSAECEDQR 312

Query: 283 RSVPRAIKLTLYRIVVFYVITILLLGMTVAYNDPRLLXXXXXXX-XXXXXPFVVAIENAS 341
           R++ +A +  ++R++ FYV+  L + + VAYNDP L+             PFV+ I+NA 
Sbjct: 313 RNIAKAARRFIWRLMFFYVLGTLAISVIVAYNDPSLVSALASGKPGAGSSPFVIGIQNAG 372

Query: 342 IPVLPHIFNVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLS 401
           I VLPHI N C+L   +SA N+ ++ ++RSL  +A +G APR+F   N++GVPY ++ LS
Sbjct: 373 IRVLPHIINACILSSAWSAGNAFMFASTRSLLTMARNGDAPRVFGKINRFGVPYVAISLS 432

Query: 402 VLFCLLAYMNVSSGSAQVFNYFVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLSY 461
                LA++NVSS +A VFN+F N+ +I G + WI   + YIRF KAI    G    L +
Sbjct: 433 GGLSCLAFLNVSSSTADVFNWFSNISTISGFIGWICGCVAYIRFRKAIFFN-GMYDRLPF 491

Query: 462 TAAFQPWSTYVALFFCCLIGLIKNYTVFLGHKFDYKTFISGYIGIPVYLICYVGYKVVYR 521
               QP++ Y +LF   LI L   Y  F+   +    F++ YI +P++++ +VG+K+  R
Sbjct: 492 KTWGQPYAVYYSLFVISLITLTNGYATFIPKNWKGSDFVAAYITLPIFVVLWVGHKLWTR 551

Query: 522 T 522
           T
Sbjct: 552 T 552

>SAKL0F09790g Chr6 (750158..751834) [1677 bp, 558 aa] {ON} similar
           to uniprot|P15380 Saccharomyces cerevisiae YOR348C PUT4
           proline-specific permease (also capable of transporting
           alanine and glycine) putative proline- specific permease
          Length = 558

 Score =  292 bits (747), Expect = 6e-91,   Method: Compositional matrix adjust.
 Identities = 177/549 (32%), Positives = 281/549 (51%), Gaps = 26/549 (4%)

Query: 33  QVRSVSEGVDGKHEGIRLKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILISY 92
           Q+ S  EG   K +   L+K L +RH+ +                       P+ + +S+
Sbjct: 31  QLESQLEGT--KCDENNLEKGLSSRHIQLIALGGCIGTGLFVGTSSTLHNCGPLPLFLSF 88

Query: 93  SFVGLLVYTVMSCLGEMAAFIPLDG-FTSYASRYVDPAVGFAVGYSYLFKYFIVTPNQLT 151
             +  +VY VM+ L EM  ++P  G      SRYVDP++GFA G++Y + Y I+   +L+
Sbjct: 89  VIISFIVYPVMNTLAEMICYLPQQGTVPELTSRYVDPSLGFAAGWNYAYSYSILVATELS 148

Query: 152 AGAMVMQFWVSRDRVNPGVWITIFLALIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXX 211
           A A V+Q+W   D+V+  VWITIFL ++V +N   V+F+GE EFW +S+K          
Sbjct: 149 AAAGVVQYWT--DKVHVAVWITIFLVIVVGLNFAPVKFYGESEFWFASLKIICILGLLIV 206

Query: 212 XXXXXXXXXPNHDRTGFRFWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYT-GTEL 270
                    P+HDR GFR+W +PG F  +     G+ G+              +    EL
Sbjct: 207 SIVIFFGGAPSHDRLGFRYWNNPGPFAYH--ITGGNTGRFLDIWTAIIKSGFAFILSPEL 264

Query: 271 CGIVAAEAKNPRRSVPRAIKLTLYRIVVFYVITILLLGMTVAYNDPRLLXXXXXXX-XXX 329
            G+   EAK+ RR++ +A +  ++RI+ FY+ + L +G  ++ +DP+L+           
Sbjct: 265 IGLACVEAKDTRRNIEKASRRFIWRIIFFYITSTLCIGFILSRDDPKLIQALTSDAPGAA 324

Query: 330 XXPFVVAIENASIPVLPHIFNVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPRIFATTN 389
             PFV  I NA IPVL HI N  +L   +S+ NS +Y +SRS+  LA  G AP++F   N
Sbjct: 325 SSPFVQGISNAGIPVLNHIINAVILSSAWSSANSFMYASSRSILALAKQGDAPKVFTRIN 384

Query: 390 KWGVPYYSLGLSVLFCLLAYMNVSSGSAQVFNYFVNVVSIFGLLSWITILITYIRFDKAI 449
           + GVPY ++ LS     L Y+N SS SAQVF +  N+ +I G + W  I ITY+RF KAI
Sbjct: 385 RLGVPYNAVALSTAVSCLTYLNASSSSAQVFTWLSNICTISGFIGWALIGITYLRFRKAI 444

Query: 450 RVQFGDKSSLSYTAAFQPWSTYVALFFCCLIGLIKNYTVFLGHKFDYKTFISGYIGIPVY 509
                    + + +A QP+ TY  + F  L+ L   Y  F+   ++   F++ YI +P++
Sbjct: 445 FYN-NLYERVPFKSALQPYFTYFFVVFVVLLCLTNGYATFIPKYWNASDFVAAYITLPIF 503

Query: 510 LICYVGYKVVYRTKLIKP-EDVDLYT-FKDAIDAXXXXXXXXXXXXXXNMENSPKNFKWF 567
            + Y+G+K+ ++T+   P  ++D+ T   DA +                   +PKN    
Sbjct: 504 FLLYLGHKIWFKTRWYIPFREIDVITGLADAEEE-----------AKMTQPRTPKN---M 549

Query: 568 YETFLGWIF 576
           +E F+ W+ 
Sbjct: 550 WEKFMYWLL 558

>Skud_15.515 Chr15 complement(924662..926542) [1881 bp, 626 aa] {ON}
           YOR348C (REAL)
          Length = 626

 Score =  293 bits (750), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 177/531 (33%), Positives = 276/531 (51%), Gaps = 20/531 (3%)

Query: 2   NSDTSMEK--KNAGVLYSNETLEEGIVTLESEGQVRSVSEGVDGKHEGIRLKKELEARHV 59
           + D  MEK  K+     +    EE ++ ++ E      S   DG +E  +LK+ L++RHV
Sbjct: 60  DDDIRMEKISKDQSASSNGTIHEELVMDVDLEK-----SPSADGDNEPRKLKQGLQSRHV 114

Query: 60  SMXXXXXXXXXXXXXXXXXXXXXXXPVSILISYSFVGLLVYTVMSCLGEMAAFIPLDGFT 119
            +                       P  + ISY  +  ++Y +M  LGEM  F+P DG  
Sbjct: 115 QLIALGGAIGTGLLVGTSSTLHTCGPGGLFISYIIISAVIYPIMCALGEMVCFLPGDGSD 174

Query: 120 SYAS------RYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVNPGVWIT 173
           S  S      RYVD ++GFA G++Y + Y I+   + TA + V+++W +   V  GVWIT
Sbjct: 175 SAGSTANLVTRYVDASLGFATGWNYFYCYVILVAAECTAASGVVEYWTTA--VPKGVWIT 232

Query: 174 IFLALIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGFRFWRD 233
           +FL ++VL+N   V+ +GE EFW +S+K                   P HDR GFR+W+ 
Sbjct: 233 VFLLVVVLLNFSAVKVYGESEFWFASIKILCIVGLIILSFILFWGGGPKHDRLGFRYWQH 292

Query: 234 PGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYT-GTELCGIVAAEAKNPRRSVPRAIKLT 292
           PGAF  +     GS G               +  G EL  + +AE  + RR++ +A +  
Sbjct: 293 PGAFAHH--LTGGSLGNFTDIYTGIIKGAFAFILGPELVCMTSAECADQRRNIAKASRRF 350

Query: 293 LYRIVVFYVITILLLGMTVAYNDPRLLXXXXXXX-XXXXXPFVVAIENASIPVLPHIFNV 351
           ++R++ FYV+  L + + V YNDP L+             PFV+ I+NA I VLPHI N 
Sbjct: 351 VWRLIFFYVLGTLSISVIVPYNDPVLVNALAQGKPGAGSSPFVIGIQNAGIKVLPHIING 410

Query: 352 CVLVFVFSACNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCLLAYMN 411
           C+L   +SA N+ ++ ++RSL  +A  G+AP+     N+WGVPY ++  S L   LAY+N
Sbjct: 411 CILTSAWSAANAFMFASTRSLLTMAQTGQAPKCLGKINRWGVPYVAVAASFLCSCLAYLN 470

Query: 412 VSSGSAQVFNYFVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLSYTAAFQPWSTY 471
           VSS +A VFN+F N+ +I G L WI   I Y+RF KAI    G    L +    QP++ +
Sbjct: 471 VSSSTADVFNWFSNISTISGFLGWICGCIAYLRFRKAIFYN-GLYDRLPFKTWGQPYTVW 529

Query: 472 VALFFCCLIGLIKNYTVFLGHKFDYKTFISGYIGIPVYLICYVGYKVVYRT 522
            +L    +I +   Y +F+   +    FI+ Y+ +P++L+ ++G+K+  RT
Sbjct: 530 FSLIVVSIITITNGYAIFIPKYWKVADFIAAYVTLPIFLVLWLGHKLYTRT 580

>Suva_14.75 Chr14 (133164..134999) [1836 bp, 611 aa] {ON} YEL063C
           (REAL)
          Length = 611

 Score =  292 bits (748), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 170/501 (33%), Positives = 264/501 (52%), Gaps = 10/501 (1%)

Query: 43  GKHEGIRLKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILISYSFVGLLVYTV 102
             +E   +++ L+ RH+ M                       PV  LI+Y F+G +VY V
Sbjct: 99  AHYEDKHVRRALKQRHIGMIALGGTIGTGLFVGISTPLSNAGPVGSLIAYIFMGTVVYFV 158

Query: 103 MSCLGEMAAFIPL-DGFTSYASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWV 161
              LGEMA FIP+    T ++ R++ PA G + GY Y F + I    +++    V+++W 
Sbjct: 159 TQSLGEMATFIPVTSSITVFSKRFLSPAFGVSNGYMYWFNWAITYAVEVSVIGQVIEYWT 218

Query: 162 SRDRVNPGVWITIFLALIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXP 221
           ++  V  GVWI IF  LI L+N   V+ +GEFEFW++SVK                    
Sbjct: 219 TK--VPLGVWIAIFWVLITLMNFFPVKVYGEFEFWVASVKVLAIMGYLIYALVIVCGGS- 275

Query: 222 NHDRTGFRFWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNP 281
                GFR+WR+PGA+ P   +   ++G+              Y GTEL GI A EA NP
Sbjct: 276 KQGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANP 335

Query: 282 RRSVPRAIKLTLYRIVVFYVITILLLGMTVAYNDPRLLXXXXXXXXXXXXPFVVAIENAS 341
           R++VPRAI   ++RIV+FY++++  +G+ V Y DPRL             PFV++I+NA 
Sbjct: 336 RKTVPRAINKVVFRIVLFYIMSLFFIGLLVPYTDPRLSASSAVIASS---PFVISIQNAG 392

Query: 342 IPVLPHIFNVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLS 401
              LP IFN  VL+ V SA NS++YV SR LY LA  G AP+ F    K GVPY  +  +
Sbjct: 393 TYALPDIFNAIVLITVISAANSNVYVGSRVLYSLAQTGNAPKQFGYVTKQGVPYLGVLST 452

Query: 402 VLFCLLAYMNVSSGSAQVFNYFVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLSY 461
               LLA++ V++ +   FN+ +N+ ++ GL +W+ I +++IRF +A+  +   +  L +
Sbjct: 453 AALGLLAFLVVNNNANTAFNWLINISTLAGLCAWLFISLSHIRFMQALNQRGISRDDLPF 512

Query: 462 TAAFQPWSTYVALFFCCLIGLIKNYTVFLGHKFDYKTFISGYIGIPVYLICYVGYKVVYR 521
            A F P+  Y A FF  +I  I+ +  F    F    F + YI + +  + + G ++ Y+
Sbjct: 513 KAKFMPYGAYYASFFVTVIIFIQGFQSFC--PFRVADFFTSYISLILLAVVFTGCQLYYK 570

Query: 522 TKLI-KPEDVDLYTFKDAIDA 541
            + I K ED+D+ + +  I+A
Sbjct: 571 CRFIWKLEDIDIDSDRREIEA 591

>Smik_14.68 Chr14 (117603..119438) [1836 bp, 611 aa] {ON} YEL063C
           (REAL)
          Length = 611

 Score =  292 bits (748), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 166/495 (33%), Positives = 262/495 (52%), Gaps = 10/495 (2%)

Query: 49  RLKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILISYSFVGLLVYTVMSCLGE 108
            +K+ L+ RH+ M                       PV  LI+Y F+G ++Y +   LGE
Sbjct: 105 HVKRALKQRHIGMIALGGTIGTGLFVGISTPLSNAGPVGSLIAYIFMGTVIYFITQSLGE 164

Query: 109 MAAFIPL-DGFTSYASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVN 167
           MA FIP+    T ++ R++ PA G + GY Y F + I    +++    V+Q+W   D+V 
Sbjct: 165 MATFIPVTSSITVFSKRFLSPAFGVSNGYMYWFNWAITYAVEVSVIGQVIQYWT--DKVP 222

Query: 168 PGVWITIFLALIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTG 227
              WI IF  LI L+N   V+ +GEFEFW++SVK                    +    G
Sbjct: 223 LAAWIAIFWVLITLMNFFPVKVYGEFEFWVASVKVLAIVGYLIYALVIVCGGS-HQGPIG 281

Query: 228 FRFWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPR 287
           FR+WR+PGA+ P   + + S+G+              Y GTEL GI A EA NPR++VPR
Sbjct: 282 FRYWRNPGAWGPGIISKNKSEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPR 341

Query: 288 AIKLTLYRIVVFYVITILLLGMTVAYNDPRLLXXXXXXXXXXXXPFVVAIENASIPVLPH 347
           AI   ++RIV+FY++++  +G+ V YN+PRL             PFV++I+NA    LP 
Sbjct: 342 AINKVVFRIVIFYIMSLFFIGLLVPYNEPRL---SPSSAVIASSPFVISIQNAGTYALPD 398

Query: 348 IFNVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCLL 407
           IFN  VL+ V SA NS++YV SR LY LA  G AP+ F    K GVPY  +  +    LL
Sbjct: 399 IFNAVVLITVISAANSNVYVGSRVLYSLAQSGNAPKQFGYVTKQGVPYMGVLSTAALGLL 458

Query: 408 AYMNVSSGSAQVFNYFVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLSYTAAFQP 467
           A++ V++ +   FN+ +++ ++ GL +W+ I + +IRF +A++ +   +  L + A   P
Sbjct: 459 AFLVVNNNANTAFNWLISISTLAGLCAWLFISLAHIRFMQALKQRGISRDDLPFKAKLMP 518

Query: 468 WSTYVALFFCCLIGLIKNYTVFLGHKFDYKTFISGYIGIPVYLICYVGYKVVYRTKLI-K 526
           +  Y A FF  +I  I+ +  F    F    F + YI + +  + ++  ++ Y+ + I K
Sbjct: 519 YGAYYASFFVTIIIFIQGFQAFC--PFSVSEFFTSYISLILLAVVFISCQLYYKCRFIWK 576

Query: 527 PEDVDLYTFKDAIDA 541
            ED+D+ + +  I+A
Sbjct: 577 LEDIDIDSDRREIEA 591

>NCAS0A00610 Chr1 (111522..113345) [1824 bp, 607 aa] {ON} 
          Length = 607

 Score =  292 bits (747), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 162/499 (32%), Positives = 261/499 (52%), Gaps = 9/499 (1%)

Query: 44  KHEGIRLKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILISYSFVGLLVYTVM 103
           ++    +K+ L+ RH+ M                       PV  LI+Y F+G ++Y++ 
Sbjct: 95  QYHDTEVKRALKQRHIGMIALGGTIGTGLFVGISVPLTNSGPVGSLIAYLFMGSIIYSIT 154

Query: 104 SCLGEMAAFIPL-DGFTSYASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVS 162
             LGEMA FIP+    T ++ R++ PA G A GY Y F + I    +++    V+++W  
Sbjct: 155 QSLGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEISVVGQVIEYWTK 214

Query: 163 RDRVNPGVWITIFLALIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPN 222
           +  V    WI IF   + L+N   V+ +GE EFW++ +K                    +
Sbjct: 215 K--VPLAAWIAIFWVFVTLMNFFPVKVYGEIEFWIAFMKVLAIAGYLLYALIIVCGGS-S 271

Query: 223 HDRTGFRFWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPR 282
               GFR+WR+PG +     +   +  +              Y GTEL GI A EA NPR
Sbjct: 272 QGPIGFRYWRNPGPWGAGIISKDKNTSRFLGWVSSLINAAFTYQGTELVGITAGEAANPR 331

Query: 283 RSVPRAIKLTLYRIVVFYVITILLLGMTVAYNDPRLLXXXXXXXXXXXXPFVVAIENASI 342
           +SVPRAI   ++RI +FY++++  +G+ V Y+DPRL             PFV++I+NA  
Sbjct: 332 KSVPRAINKVVFRIALFYIMSLFFIGLLVPYDDPRLSSDSAVVASS---PFVISIQNAGT 388

Query: 343 PVLPHIFNVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSV 402
            +LP IFN  V++ V SA NS++YV SR LY LA  G AP+ FA   + GVPY  +  + 
Sbjct: 389 KILPDIFNAIVMITVISAANSNVYVGSRVLYALAQTGNAPKQFAYVTRHGVPYLGVLCTA 448

Query: 403 LFCLLAYMNVSSGSAQVFNYFVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLSYT 462
              LLA++ V++ +   FN+ +N+ ++ GL +W+ I I++IRF +A++ +   +  L + 
Sbjct: 449 ALGLLAFLVVNNNANTAFNWLINISTLAGLCAWLFISISHIRFMQALKFRGISRDDLPFK 508

Query: 463 AAFQPWSTYVALFFCCLIGLIKNYTVFLGHKFDYKTFISGYIGIPVYLICYVGYKVVYRT 522
           A F PW+ Y A FF  +I  I+ +  F  H FD   F + YI + +  + ++G ++ YR 
Sbjct: 509 AKFMPWAAYYATFFVTVIIFIQGFQAFSPH-FDVTAFFTAYISLIILAVLFIGCQIYYRC 567

Query: 523 KLI-KPEDVDLYTFKDAID 540
           +   K ED+D+ T +  I+
Sbjct: 568 RFFWKLEDIDIDTDRREIE 586

>Suva_14.73 Chr14 complement(130474..131967) [1494 bp, 497 aa] {ON}
           YNL268W (REAL)
          Length = 497

 Score =  288 bits (737), Expect = 3e-90,   Method: Compositional matrix adjust.
 Identities = 160/458 (34%), Positives = 256/458 (55%), Gaps = 8/458 (1%)

Query: 85  PVSILISYSFVGLLVYTVMSCLGEMAAFIPL-DGFTSYASRYVDPAVGFAVGYSYLFKYF 143
           PV  LISY F+G ++Y+V   LGEMA FIP+   F+ +A R++ PA+G   GY Y   + 
Sbjct: 25  PVGALISYIFMGTVIYSVTQSLGEMATFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWC 84

Query: 144 IVTPNQLTAGAMVMQFWVSRDRVNPGVWITIFLALIVLINTVGVRFFGEFEFWLSSVKXX 203
                +L+    ++Q+W   D V    WI IF  L+ L+N   V+++GEFEF ++S+K  
Sbjct: 85  FTFALELSVLGQIIQYWT--DAVPLSAWIVIFWCLLTLMNMFPVKYYGEFEFCIASIKVI 142

Query: 204 XXXXXXXXXXXXXXXXXPNHDRTGFRFWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXX 263
                                  GFR+WR+PGA+ P   +   ++G+             
Sbjct: 143 ALLGFIIYSFCMVCGAGQPDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAF 202

Query: 264 XYTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVVFYVITILLLGMTVAYNDPRLLXXXX 323
            Y GTEL GI A EA NPR++VPRAIK  + RI+VFY++++  +G+ V YNDP+L     
Sbjct: 203 TYQGTELVGITAGEAANPRKAVPRAIKKVVVRILVFYIMSLFFIGLLVPYNDPKL---DS 259

Query: 324 XXXXXXXXPFVVAIENASIPVLPHIFNVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPR 383
                   PF+++IEN+   VLP IFN  VL+ + SA NS++Y+ SR LY L+ +  APR
Sbjct: 260 DGSFVSASPFMISIENSGTKVLPDIFNAVVLITIVSAGNSNVYIGSRVLYSLSKNDLAPR 319

Query: 384 IFATTNKWGVPYYSLGLSVLFCLLAYMNVSSGSAQVFNYFVNVVSIFGLLSWITILITYI 443
             +   K GVPY+++  + +F  LA++  S+GS + FN+ +N+  + G  +W+ I  ++I
Sbjct: 320 FLSIVTKGGVPYFAVLATSVFGFLAFLETSAGSGKAFNWLLNITGVAGFFAWLLISFSHI 379

Query: 444 RFDKAIRVQFGDKSSLSYTAAFQPWSTYVALFFCCLIGLIKNYTVFLGHKFDYKTFISGY 503
           RF +AI  +   ++ L Y A   P+  Y A FF  LI LI+ +T F    F    F++ Y
Sbjct: 380 RFMQAISKRGISRNDLPYKARMMPYLAYYASFFIALIVLIQGFTAF-APSFQPVDFVAAY 438

Query: 504 IGIPVYLICYVGYKVVYRTKLI-KPEDVDLYTFKDAID 540
           I + +++  +  +++ ++  +I K +DVD+ + +  I+
Sbjct: 439 ISVFLFVAIWFSFQLWFKCPIILKLQDVDIDSDRREIE 476

>AFR667C Chr6 complement(1657505..1659196) [1692 bp, 563 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL268W
           (LYP1)
          Length = 563

 Score =  290 bits (741), Expect = 5e-90,   Method: Compositional matrix adjust.
 Identities = 169/526 (32%), Positives = 273/526 (51%), Gaps = 16/526 (3%)

Query: 27  TLESEGQVRSVSEGV---------DGKHEGIRLKKELEARHVSMXXXXXXXXXXXXXXXX 77
           TLE++ +++SV+            +G ++   +K+ L+ARH+SM                
Sbjct: 23  TLENDIELQSVTPATGEFPEDHTEEGDYQETEVKRALKARHISMIALGGTIGTGLFIVIA 82

Query: 78  XXXXXXXPVSILISYSFVGLLVYTVMSCLGEMAAFIPL-DGFTSYASRYVDPAVGFAVGY 136
                  PV  L++Y F+G +VY++   LGEMA FIP+    T ++ R++ PA G A GY
Sbjct: 83  SPLRTAGPVGSLLAYIFIGTVVYSITQSLGEMATFIPVTSSVTVFSKRFLSPAFGVANGY 142

Query: 137 SYLFKYFIVTPNQLTAGAMVMQFWVSRDRVNPGVWITIFLALIVLINTVGVRFFGEFEFW 196
            Y F + I    +L+    ++Q+W   DRV    WI IF  L+ L+N   VRF+GE EFW
Sbjct: 143 MYWFNWAITFAVELSVVGQIIQYWT--DRVPIAAWIVIFWVLVTLVNFFPVRFYGEIEFW 200

Query: 197 LSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGFRFWRDPGAFKPYSEAISGSKGKXXXXXX 256
           ++SVK                                P      S   +  +        
Sbjct: 201 IASVKVLTIVGYLIYAFIIVCGGSKQGPIGLPATGGIPARGARASSRTTRKRHGFLGWVS 260

Query: 257 XXXXXXXXYTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVVFYVITILLLGMTVAYNDP 316
                   Y GTEL GI A E+ NPR++VP+AI    +RI+ FY+ ++L +G+ V Y+DP
Sbjct: 261 SLIKAAFTYQGTELVGITAGESTNPRKNVPKAINKVFFRILFFYIGSLLFVGLLVPYDDP 320

Query: 317 RLLXXXXXXXXXXXXPFVVAIENASIPVLPHIFNVCVLVFVFSACNSDLYVASRSLYGLA 376
           RL             PFV++I+NA   +LP IFN  VL+ V SA NS++Y+ SR  Y LA
Sbjct: 321 RL--NSESSTDVNASPFVISIKNAGTKILPDIFNAVVLITVISAANSNVYIGSRVAYSLA 378

Query: 377 IDGKAPRIFATTNKWGVPYYSLGLSVLFCLLAYMNVSSGSAQVFNYFVNVVSIFGLLSWI 436
           + G AP+  A   K GVPY+ + ++ L  L++++ ++  ++  F++ VN+ ++ GL +W+
Sbjct: 379 LAGNAPKQLAFVTKQGVPYFGVLITSLMGLMSFLVLNHNASTAFDWLVNISTLAGLCAWL 438

Query: 437 TILITYIRFDKAIRVQFGDKSSLSYTAAFQPWSTYVALFFCCLIGLIKNYTVFLGHKFDY 496
            I + +IRF + ++ +   +  L + A F PW+ Y A FF  +I  I+ YT F   KFD 
Sbjct: 439 FISLAHIRFMQCLKHRGISRDDLPFKAKFMPWAAYYATFFVTVIIFIQGYTAFT-PKFDV 497

Query: 497 KTFISGYIGIPVYLICYVGYKVVYRTKLI-KPEDVDLYTFKDAIDA 541
            TF + YI + + L+ ++G ++ Y+ + +   ED+D+ + +  IDA
Sbjct: 498 TTFFTSYISLFLMLLVFIGCQIYYKCRFLWAVEDIDIDSDRREIDA 543

>KLTH0D01474g Chr4 (139116..140990) [1875 bp, 624 aa] {ON} similar
           to uniprot|P15380 Saccharomyces cerevisiae YOR348C PUT4
           proline-specific permease (also capable of transporting
           alanine and glycine) putative proline- specific permease
          Length = 624

 Score =  291 bits (744), Expect = 9e-90,   Method: Compositional matrix adjust.
 Identities = 171/496 (34%), Positives = 263/496 (53%), Gaps = 18/496 (3%)

Query: 50  LKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILISYSFVGLLVYTVMSCLGEM 109
           LKK L++RH+ +                       P  +L SY  + L++Y VM+ LGEM
Sbjct: 105 LKKGLQSRHIQLIALGGVIGTGLFVGTSSTLSTCGPAGLLTSYIIISLVIYPVMNSLGEM 164

Query: 110 AAFIPLDGFTSYAS------RYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSR 163
             F+P     S  S      RY DP++GFA G++Y + Y I+   + TA + V+ +W + 
Sbjct: 165 VCFLPGSNGQSGGSISKIVTRYADPSLGFATGWNYYYCYVILIAAECTAASGVVTYWTTA 224

Query: 164 DRVNPGVWITIFLALIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNH 223
             V  G WI IFL ++ ++N   V+ +GE EFW + +K                   P H
Sbjct: 225 --VPKGAWIAIFLGVVTVLNFSPVKIYGETEFWFAILKILCIVGLLFVSFILFWGGGPTH 282

Query: 224 DRTGFRFWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYT-GTELCGIVAAEAKNPR 282
           DR GFR+W+ PGAF  +    +G+ G+              +  G EL  I ++EA + R
Sbjct: 283 DRLGFRYWQHPGAFAYH--ITTGNTGRFLDIWTGVIKGGFAFILGPELVAITSSEALDAR 340

Query: 283 RSVPRAIKLTLYRIVVFYVITILLLGMTVAYNDPRLLXXXXXXXXXX-XXPFVVAIENAS 341
           R++ +A +   YR+V FYV + L +G+ V+  DP L              PFV+AI+NA 
Sbjct: 341 RNIEKASRRFAYRLVFFYVASALAIGVIVSRTDPVLKNALAEGKAGAGSSPFVIAIQNAH 400

Query: 342 IPVLPHIFNVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLS 401
           I VLPHI N C+L   +S+ NS ++ ASRSL  +A DG APRI    N+ GVPYY++ LS
Sbjct: 401 IKVLPHIINACILSSAWSSGNSFMFAASRSLLSMAEDGNAPRILGRINRQGVPYYAVALS 460

Query: 402 VLFCLLAYMNVSSGSAQVFNYFVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLSY 461
             F  LA++NVSSGSA+ F +F N+ +I G + WI I + Y++F KA+  + G    + +
Sbjct: 461 AAFSCLAFLNVSSGSAKAFTWFSNISTISGFIGWICIGVAYLQFRKAVFFR-GLYERVPF 519

Query: 462 TAAFQPWSTYVALFFCCLIGLIKNYTVFLGHKFDYKTFISGYIGIPVYLICYVGYKVVYR 521
            +  QP+ TY  +    LI L   Y  F+   ++   F++ YI +P++++ +VG+K+  R
Sbjct: 520 KSPLQPYGTYFFIVVVSLICLTNGYASFV--NWNASDFVAAYITLPIFVVLWVGHKIYTR 577

Query: 522 ---TKLIKPEDVDLYT 534
              T L+   +VD+ T
Sbjct: 578 TWSTWLLPVAEVDVTT 593

>KNAG0C00790 Chr3 (138911..140650) [1740 bp, 579 aa] {ON} 
          Length = 579

 Score =  288 bits (737), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 167/495 (33%), Positives = 264/495 (53%), Gaps = 9/495 (1%)

Query: 49  RLKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILISYSFVGLLVYTVMSCLGE 108
            +K+EL+ RH+ M                       PV  LISY F+G LVY+V   LGE
Sbjct: 72  EVKRELKQRHIGMIALGATIGTGLFIGLSTPLKQAGPVGALISYIFMGTLVYSVTQSLGE 131

Query: 109 MAAFIPL-DGFTSYASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVN 167
           MA FIP+   FT +A R++ P++G A GY Y F + +    +L+    V+Q+W     V 
Sbjct: 132 MATFIPVTSSFTVFAQRFLSPSIGAATGYMYWFSWAVTFALELSVIGQVIQYWTYA--VP 189

Query: 168 PGVWITIFLALIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTG 227
              WI+IF  +I   N   V+++GE EFW++ +K                         G
Sbjct: 190 LAAWISIFWVVITAGNMFPVKYYGEVEFWIAFIKVIAIVGFLLYCLCMVCGAGVTGP-VG 248

Query: 228 FRFWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPR 287
           FR+WR+PG + P   +   ++ +              Y GTEL GI A EA NPR++VPR
Sbjct: 249 FRYWRNPGPWGPGIISKDKNEARFLGWVSSLINGAFTYQGTELVGISAGEAANPRKAVPR 308

Query: 288 AIKLTLYRIVVFYVITILLLGMTVAYNDPRLLXXXXXXXXXXXXPFVVAIENASIPVLPH 347
           AIK  ++RI+ FY+ ++  +G+ V YND  L             PF++AI+N+  PVLPH
Sbjct: 309 AIKKVVFRILFFYIGSLFFIGLLVPYNDDAL---NNTDSYVASSPFIIAIKNSGTPVLPH 365

Query: 348 IFNVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCLL 407
           IFN  +   + SA NS++YV SR L+GL+ +  AP+I + T K GVP+ ++ ++ +   L
Sbjct: 366 IFNAVIACTIVSAGNSNVYVGSRILFGLSKNKLAPKILSRTTKGGVPWIAVLVTSVVGAL 425

Query: 408 AYMNVSSGSAQVFNYFVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLSYTAAFQP 467
           AYM  S+G    FN+ +N+ ++ G  +W+ I +++IRF +A++ +   +  L + AA  P
Sbjct: 426 AYMETSTGGQNAFNWLLNITAVAGFFTWLFISLSHIRFMQALKYRGISRDDLPFKAALMP 485

Query: 468 WSTYVALFFCCLIGLIKNYTVFLGHKFDYKTFISGYIGIPVYLICYVGYKVVYRTKLI-K 526
              Y A F   +I +I+ +T F   KF    F + YI I +++  +  +++++R + I K
Sbjct: 486 GLAYYASFLMFVIIIIQGFTAF-APKFSGSDFAAAYISIFLFIGIWCLFQIIFRCRFIHK 544

Query: 527 PEDVDLYTFKDAIDA 541
            EDVD+ T +  I+A
Sbjct: 545 VEDVDIDTDRRDIEA 559

>AFR156W Chr6 (717642..719318) [1677 bp, 558 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YOR348C (PUT4)
          Length = 558

 Score =  287 bits (734), Expect = 4e-89,   Method: Compositional matrix adjust.
 Identities = 169/537 (31%), Positives = 276/537 (51%), Gaps = 18/537 (3%)

Query: 3   SDTSMEKKNAGVLYSNETLEEGIVTLESEGQVRSVSEGVDGKHEGIRLKKELEARHVSMX 62
           S  S+EK + G             +LE E + +S     +  H+G      L++RH+ + 
Sbjct: 6   SSASIEKADNGGYMHKVKTPHSRTSLE-ELETQSAGSEYNTLHKG------LQSRHIQLI 58

Query: 63  XXXXXXXXXXXXXXXXXXXXXXPVSILISYSFVGLLVYTVMSCLGEMAAFIPLDG-FTSY 121
                                    +L+S+  +  +VY +M  L EM  ++P  G     
Sbjct: 59  ALGGCIGTGLFVGTSWTLHNCGAAPLLLSFILISTIVYPIMCSLAEMICYLPQQGSVPEL 118

Query: 122 ASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVNPGVWITIFLALIVL 181
            SRYVDP++GFA G++Y + Y I+   +L+A A V+ +W   + V    WITIFL ++V 
Sbjct: 119 VSRYVDPSLGFATGWNYAYAYAILVAAELSAAASVVSYW--DNPVPMAAWITIFLVVVVG 176

Query: 182 INTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGFRFWRDPGAFKPYS 241
           +N   V+++GE EFW +S+K                   PNHDRTGFR+W++PG   P++
Sbjct: 177 LNFTAVKYYGEAEFWFASIKLICILGLLVVSVVIFFGGAPNHDRTGFRYWKNPG---PFA 233

Query: 242 EAIS-GSKGKXXXXXXXXXXXXXXYT-GTELCGIVAAEAKNPRRSVPRAIKLTLYRIVVF 299
            +++ GS G+              +    EL GI   EA++ RR+  +A +  +YRI+ F
Sbjct: 234 MSLAPGSTGRFLDVWRAVIKSAFAFILSPELIGIACVEAQDTRRNTEKASRRFIYRIIFF 293

Query: 300 YVITILLLGMTVAYNDPRLLXXXXXXX-XXXXXPFVVAIENASIPVLPHIFNVCVLVFVF 358
           YV   L++G+ ++  DP+L+             PFV  I NA IPVL H+ NV +L   +
Sbjct: 294 YVSCALMIGVILSRTDPKLIEALETGAPGAASSPFVQGIANAGIPVLDHVINVAILSSAW 353

Query: 359 SACNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCLLAYMNVSSGSAQ 418
           SA NS +Y ++R +  LA +G AP+     N++GVPY ++ +  L   LAY+NV + SA 
Sbjct: 354 SAGNSFMYASTRMVLALAREGNAPKFLTKINRYGVPYNAVIVCTLVACLAYLNVKTTSAN 413

Query: 419 VFNYFVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLSYTAAFQPWSTYVALFFCC 478
           VF +  N+ +I G + W  + I +IRF + I V    +S + Y    QP+  Y   F   
Sbjct: 414 VFQWLSNICTISGFIGWFAMGIAFIRFRRGI-VFNNLQSRIPYQGPLQPYIAYYFTFMTV 472

Query: 479 LIGLIKNYTVFLGHKFDYKTFISGYIGIPVYLICYVGYKVVYRTKLIKP-EDVDLYT 534
           ++ L   + VFL  +++   F++ Y+ +P+YL+ Y+G+K+ +RT+   P E +D+ T
Sbjct: 473 VVCLTNGFHVFLKGRWNVVDFVAAYVTLPIYLVLYLGHKLWFRTRWYIPVEQIDVIT 529

>NDAI0F04200 Chr6 (1016214..1017914) [1701 bp, 566 aa] {ON} 
          Length = 566

 Score =  286 bits (732), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 175/552 (31%), Positives = 288/552 (52%), Gaps = 24/552 (4%)

Query: 1   MNSDTSMEKKNAGVLYSNETLE-------EGIVTLESEGQVRSVSEGVDGKHEGIRLKKE 53
           +N++ ++E K+  V+ S E+LE       E   T  +     +VSE  + K E   +K++
Sbjct: 6   INTEETLEGKSKIVIKSTESLEQHDLQGNEDKNTPTTTPSKENVSE--NEKDEYHEVKRD 63

Query: 54  LEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILISYSFVGLLVYTVMSCLGEMAAFI 113
           L  RH++M                       PV  LI+Y F+G +VY+V   LGEMA FI
Sbjct: 64  LSKRHIAMIALGGTIGTGLFLGIANPLMISGPVGSLIAYLFLGTVVYSVTQSLGEMATFI 123

Query: 114 PLDG-FTSYASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVNPGVWI 172
           P+   FT ++ R++ PA+G A GY Y F + +    +L+    ++QFW     V    WI
Sbjct: 124 PVTASFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSVVGQIIQFWTFA--VPLPAWI 181

Query: 173 TIFLALIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGFRFWR 232
           +IF  ++ + N   VR +GE EFW++ +K                         GFR+WR
Sbjct: 182 SIFWVILTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCIVCGAGKTGP-VGFRYWR 240

Query: 233 DPGAFKPYSEAISGS---KGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPRAI 289
           +PG   P+   I  S   + +              + GTEL GI A EA NPR++VP+AI
Sbjct: 241 NPG---PWGTGIISSNIAEARFLGWASSLINAAFTFQGTELVGITAGEAANPRQTVPKAI 297

Query: 290 KLTLYRIVVFYVITILLLGMTVAYNDPRLLXXXXXXXXXXXXPFVVAIENASIPVLPHIF 349
           +  ++RI+VFY++++  +G+ V Y+D +L             PF++AIEN+   +LPHIF
Sbjct: 298 RKVVFRILVFYILSLFFIGLLVPYDDVKL---KSENSYVSSSPFIIAIENSGTKILPHIF 354

Query: 350 NVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCLLAY 409
           N  +LV + SA NS++Y+ SR L+GLA +G  P++FA T K GVP +++  + LF  LA+
Sbjct: 355 NGVILVTIISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGALAF 414

Query: 410 MNVSSGSAQVFNYFVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLSYTAAFQPWS 469
           M  S+G  + F + +NVV + G  SW+ I   +IRF + ++ +   ++ L + A F P+ 
Sbjct: 415 METSTGGDEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLPFKAKFMPYL 474

Query: 470 TYVALFFCCLIGLIKNYTVFLGHKFDYKTFISGYIGIPVYLICYVGYKVVYRTKLI-KPE 528
            Y A     +I   + +T F   KFD   F + YI + ++ I +  +++ ++ + + K  
Sbjct: 475 AYYATIVMIIIIFFQGFTAF-APKFDVLNFFASYISVFLFFIFWGSFQLWFKCRYVWKLV 533

Query: 529 DVDLYTFKDAID 540
           D+D+   +  I+
Sbjct: 534 DIDIDKDRREIE 545

>ZYRO0F16654g Chr6 (1374093..1375835) [1743 bp, 580 aa] {ON} similar
           to uniprot|P04817 Saccharomyces cerevisiae YEL063C CAN1
           Plasma membrane arginine permease requires phosphatidyl
           ethanolamine (PE) for localization exclusively
           associated with lipid rafts mutation confers canavanine
           resistance
          Length = 580

 Score =  286 bits (731), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 165/516 (31%), Positives = 269/516 (52%), Gaps = 9/516 (1%)

Query: 28  LESEGQVRSVSEGVDGKHEGIRLKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVS 87
           +++E  V    +G  G+     +K+ L+ RH+ M                       PV 
Sbjct: 52  VDNEYDVDDSVDGEKGEVRSTEVKRALKPRHIGMIALGGTIGTGLFVGISEPLQNAGPVG 111

Query: 88  ILISYSFVGLLVYTVMSCLGEMAAFIPL-DGFTSYASRYVDPAVGFAVGYSYLFKYFIVT 146
           +LI+Y F+  + ++VM  LGEMA +IP+   F+ ++ R++ PA G A GY Y F + I  
Sbjct: 112 MLIAYLFMATIAFSVMQSLGEMATYIPVTSAFSVFSQRFLSPAFGAANGYMYWFSWSITF 171

Query: 147 PNQLTAGAMVMQFWVSRDRVNPGVWITIFLALIVLINTVGVRFFGEFEFWLSSVKXXXXX 206
             +L+    ++Q+W  +  V    WI+IF  LI  +N   V+F+GEFEFW++ +K     
Sbjct: 172 ALELSVIGQIVQYWTFK--VPVAAWISIFWVLIAGLNFCPVKFYGEFEFWIAFIKVVAIV 229

Query: 207 XXXXXXXXXXXXXXPNHDRTGFRFWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYT 266
                               GFR+WR   AF     + + ++ +              Y 
Sbjct: 230 GFIIYCFIMVCGAGKTGP-VGFRYWRHGYAFGDGIISKNKNEARFLGWVSSLINAAFTYQ 288

Query: 267 GTELCGIVAAEAKNPRRSVPRAIKLTLYRIVVFYVITILLLGMTVAYNDPRLLXXXXXXX 326
           GTEL GI A EA NPR++VP++IK TL+RI++FY+ ++L +G+ V +ND  L        
Sbjct: 289 GTELVGITAGEAANPRKTVPKSIKRTLWRILIFYIFSLLFVGLLVPFNDHGL---QDSRS 345

Query: 327 XXXXXPFVVAIENASIPVLPHIFNVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPRIFA 386
                PF++AI+N+    LP IFN  +L  V SA NSD+YV SR +Y +A +  AP I A
Sbjct: 346 YAASSPFILAIKNSGTKALPDIFNAVILTTVISAANSDVYVGSRVMYSMARNRLAPPILA 405

Query: 387 TTNKWGVPYYSLGLSVLFCLLAYMNVSSGSAQVFNYFVNVVSIFGLLSWITILITYIRFD 446
             +K GVPY ++  +     LAY+  SS  A VFN+ +N+  + G  SW  I  +++RF 
Sbjct: 406 KASKGGVPYAAVLFTSAIGALAYLETSSSGANVFNWLMNITGVAGFFSWWLISWSHLRFM 465

Query: 447 KAIRVQFGDKSSLSYTAAFQPWSTYVALFFCCLIGLIKNYTVFLGHKFDYKTFISGYIGI 506
           KA++ +   ++ L + A+F PW    + FF  LI L++ +T F  H F    F++ YI +
Sbjct: 466 KALKQRGISRNDLPFKASFMPWIAIYSFFFMTLIILVQGFTCFTPH-FQASDFVASYISV 524

Query: 507 PVYLICYVGYKVVYRTKLIKP-EDVDLYTFKDAIDA 541
            ++ + +  +++ +R  L+ P  ++D+ T +  +DA
Sbjct: 525 GLFFVIWAVFQIWFRCPLLVPIAEIDIDTDRRDVDA 560

>KLLA0C02365g Chr3 (208462..210201) [1740 bp, 579 aa] {ON} similar
           to uniprot|P32487 Saccharomyces cerevisiae YNL268W LYP1
           Lysine permease one of three amino acid permeases (Alp1p
           Can1p Lyp1p) responsible for uptake of cationic amino
           acids
          Length = 579

 Score =  285 bits (730), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 181/542 (33%), Positives = 280/542 (51%), Gaps = 13/542 (2%)

Query: 2   NSDTSMEKKNAGVLYSNETLEEGIVTLESEGQVRSVSEGVDGKHEGIRLKKELEARHVSM 61
           +S T  ++  AG     +++E   V + SE    + SE  +G      +K+ L+ RHVSM
Sbjct: 29  DSGTLSKRSKAG----EDSIELSDVQVSSELYDHAESEEGEGDFHETEVKRALKPRHVSM 84

Query: 62  XXXXXXXXXXXXXXXXXXXXXXXPVSILISYSFVGLLVYTVMSCLGEMAAFIPL-DGFTS 120
                                  PV  LI+Y F+G +VY V   LGEMA FIP+    T 
Sbjct: 85  IALGGTIGTGLFVGIAKPLSLSGPVGSLIAYIFMGSVVYFVTQSLGEMATFIPVTSSITV 144

Query: 121 YASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVNPGVWITIFLALIV 180
           ++ R++ PA G A GY Y F + I    +L+    ++ +W   D V    WI IF  L+ 
Sbjct: 145 FSKRFLSPAFGVANGYMYWFNWAITYAVELSVLGQIINYWT--DAVPLAAWIAIFWVLLT 202

Query: 181 LINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGFRFWRDPGAFKPY 240
             N   V+++GEFEF ++S+K                    +    GFR+WR+PG +   
Sbjct: 203 AANFFPVKWYGEFEFCVASIKVIAIVGYLLYALIIVCGGS-SQGPIGFRYWRNPGPWGTG 261

Query: 241 SEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVVFY 300
           + A + +K +              Y GTEL GI A EA NPR++VP+AI    +RI+VFY
Sbjct: 262 TIAKNVNKARFLGWVGSLVNASFTYQGTELVGITAGEASNPRKTVPKAINKVFFRILVFY 321

Query: 301 VITILLLGMTVAYNDPRLLXXXXXXXXXXXXPFVVAIENASIPVLPHIFNVCVLVFVFSA 360
           + ++  +G+ V YN P+L             PFV++I+NA   VLP IFN  VLV + SA
Sbjct: 322 IGSLFFVGLLVPYNSPQL---ESNSAVIASSPFVISIQNAGTKVLPDIFNAVVLVTILSA 378

Query: 361 CNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCLLAYMNVSSGSAQVF 420
            NS++YV SR LY LA+ G AP+ F+   K GVPY  +  + L  LLA++  +  +   F
Sbjct: 379 GNSNVYVGSRVLYSLALSGNAPKQFSYVTKQGVPYLGVICTALLGLLAFLATNENANTAF 438

Query: 421 NYFVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLSYTAAFQPWSTYVALFFCCLI 480
           N+ +N+ ++ GL +W  I + +IRF + ++++   + SL + A   PW  Y A FF  LI
Sbjct: 439 NWLINISTLAGLCAWFFISVAHIRFMQCLKLRGISRDSLPFKAKLMPWGAYYAAFFVGLI 498

Query: 481 GLIKNYTVFLGHKFDYKTFISGYIGIPVYLICYVGYKVVYRTK-LIKPEDVDLYTFKDAI 539
             I+ +T F   +FD   F + YI + + ++ ++  ++ YR + L K ED+D+ + +  I
Sbjct: 499 VFIQGFTAF-APRFDVSEFFTAYISLILLVVLFILCQLYYRCRFLTKIEDIDIDSDRREI 557

Query: 540 DA 541
           DA
Sbjct: 558 DA 559

>KLLA0F23419g Chr6 complement(2187386..2189107) [1722 bp, 573 aa]
           {ON} similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348C PUT4 proline-specific permease (also capable of
           transporting alanine and glycine) putative proline-
           specific permease
          Length = 573

 Score =  283 bits (724), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 180/543 (33%), Positives = 277/543 (51%), Gaps = 24/543 (4%)

Query: 4   DTSMEKKNAGVLYSNETLEEGIVTLESEGQVRSVSEGVDGKHEGIRLKKELEARHVSMXX 63
           +TS+  K  G +Y    L+    + +SE      ++   G H    LKK L++ H+ +  
Sbjct: 12  ETSVVDKQTGQVYE---LDLTSYSNDSEKNGSLPNKPQSGDHN---LKKGLKSAHIQLIA 65

Query: 64  XXXXXXXXXXXXXXXXXXXXXPVSILISYSFVGLLVYTVMSCLGEMAAFIPL-------- 115
                                P  + ISY  +  ++Y VM+ L EM  F+P         
Sbjct: 66  IGGCIGTGLFVGTSSTLYKCGPAGLFISYCIMSTIIYPVMNALAEMVCFLPGLPDENETG 125

Query: 116 DGFTSYASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVNPGVWITIF 175
              ++  +RYVD ++GFAVG++Y++ Y I+   + TA + V+ +W +   V    WITIF
Sbjct: 126 GSISTLCTRYVDSSLGFAVGWNYVYCYVILVAAECTAASGVVTYWTTA--VPKAAWITIF 183

Query: 176 LALIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGFRFWRDPG 235
           L +IV++N   V F+G  E    S+K                   PNHDR GFRFW+DPG
Sbjct: 184 LGIIVVLNCTAVEFYGTSEAIFCSLKIFCILGIIIVSIVLFFGGGPNHDRLGFRFWKDPG 243

Query: 236 AFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPRAIKLTLYR 295
           A+  Y  A  G+                   G EL  + + EA++ RR++ +A +  ++R
Sbjct: 244 AWA-YHLADGGAGRLSDIITGVIRAGFAFILGPELVVLTSTEAQDSRRNIEKAARRFVWR 302

Query: 296 IVVFYVITILLLGMTVAYNDPRLLXXXXXXX-XXXXXPFVVAIENASIPVLPHIFNVCVL 354
           ++ FY ++ L  G+ V+ NDP LL             PFV+ I+NA I VLPHI NVC+L
Sbjct: 303 LIFFYCVSSLCAGVIVSRNDPVLLNALSQGKPGAGSSPFVIGIQNAGIKVLPHIINVCIL 362

Query: 355 VFVFSACNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCLLAYMNVSS 414
              +S+ NS +Y  +RSL  L+ +G AP+IF   N+WGVPY  +  +  F  LAY+NVSS
Sbjct: 363 SSAWSSGNSFMYATTRSLLSLSQEGYAPKIFNRVNRWGVPYTGVAFATAFSCLAYLNVSS 422

Query: 415 GSAQVFNYFVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLSYTAAFQPWSTYVAL 474
            +A VFN+F N+ +I G L WI   + Y+RF KA+         L +   FQP+ T+  +
Sbjct: 423 STADVFNWFSNISTISGFLGWICSGVAYLRFRKAVFFN-NLYDRLPFKTPFQPYFTWFYI 481

Query: 475 FFCCLIGLIKNYTVFLGHKFDYKTFISGYIGIPVYLICYVGYKVVYRT---KLIKPEDVD 531
               +I LI  Y  F+   ++YK FI+ YI +P++LI ++G+K   RT    +I   ++D
Sbjct: 482 ILIAIICLINGYESFV--HWNYKDFIAAYITLPLFLILWLGHKAYTRTWSQWMISVSEID 539

Query: 532 LYT 534
           + T
Sbjct: 540 VTT 542

>KAFR0D00700 Chr4 complement(120768..122492) [1725 bp, 574 aa] {ON} 
          Length = 574

 Score =  282 bits (721), Expect = 6e-87,   Method: Compositional matrix adjust.
 Identities = 174/543 (32%), Positives = 279/543 (51%), Gaps = 33/543 (6%)

Query: 1   MNSDTSMEKKNAGVLYSNETLEEGIVTLESEGQVRSVSEGVDGKHEGIRLKKELEARHVS 60
           M+ D  M+K N  ++   +       T E E  + S      G      +K+EL+ RH+ 
Sbjct: 25  MSQDDDMKKIN--IIQQTDASS----TTEDEEMLNS------GSVHDAEVKRELKQRHIG 72

Query: 61  MXXXXXXXXXXXXXXXXXXXXXXXPVSILISYSFVGLLVYTVMSCLGEMAAFIPL-DGFT 119
           M                       PV  LI+Y FVG L Y V   LGEMA FIP+   FT
Sbjct: 73  MIALGGTIGTGLFIGISTPLEDSGPVGSLIAYIFVGTLTYAVTQSLGEMATFIPVTSSFT 132

Query: 120 SYASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVNPGVWITIFLALI 179
            +ASR++ P++G AVGY Y F + +    +L+    ++ +W     V    WI+IF  ++
Sbjct: 133 VFASRFLSPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYWTFA--VPIAAWISIFWVIL 190

Query: 180 VLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGFRFWRDPGAFKP 239
             +N   V+F+GE EFW+++VK                         GFR+WR+PG   P
Sbjct: 191 TALNMFPVKFYGEIEFWVAAVKVVAIVGFLIYCLCMVCGAGVTGP-VGFRYWRNPG---P 246

Query: 240 YSEAISGS---------KGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPRAIK 290
           + + ++ +          G+              Y GTEL GI A EA NPR++VPRAIK
Sbjct: 247 WGDGLTSNGVEISKNKNTGRFLGWFNSLINAAFTYQGTELVGITAGEAANPRKTVPRAIK 306

Query: 291 LTLYRIVVFYVITILLLGMTVAYNDPRLLXXXXXXXXXXXXPFVVAIENASIPVLPHIFN 350
             ++RI++FY+ ++  +G+ V ++DP+L             PF++AIEN+   +LP IFN
Sbjct: 307 KVVFRILLFYIGSLFFIGLLVPFDDPKLSSDDSYVSSS---PFIIAIENSGTKILPDIFN 363

Query: 351 VCVLVFVFSACNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCLLAYM 410
             +L+ + SA NS++YV SR L+ LA  G AP+I + T K GVP+ S+  + +F +LAYM
Sbjct: 364 AIILITIISAGNSNIYVGSRILFSLAKTGLAPKILSRTTKKGVPWVSVLATAVFGVLAYM 423

Query: 411 NVSSGSAQVFNYFVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLSYTAAFQPWST 470
             + G   VF++ VN+ +I G  +W+ ILI++IRF + ++ +   +  L + A   P   
Sbjct: 424 ETTQGGQTVFDWLVNITAIAGFWAWLFILISHIRFMQVLKFRGISRDDLPFKANLMPGLA 483

Query: 471 YVALFFCCLIGLIKNYTVFLGHKFDYKTFISGYIGIPVYLICYVGYKVVYRTKLI-KPED 529
           Y A+F   +I + + +T F    FD   F + YI + ++ + +  +++ ++ + I K ED
Sbjct: 484 YYAVFCMVIIIIFQGFTAFT-PTFDVSDFFAAYISVILFFLIWGAFQLWFKCRWIWKLED 542

Query: 530 VDL 532
           VD+
Sbjct: 543 VDI 545

>KLTH0F02420g Chr6 (205827..207692) [1866 bp, 621 aa] {ON} similar
           to uniprot|P32487 Saccharomyces cerevisiae YNL268W LYP1
           Lysine permease one of three amino acid permeases (Alp1p
           Can1p Lyp1p) responsible for uptake of cationic amino
           acids
          Length = 621

 Score =  283 bits (723), Expect = 9e-87,   Method: Compositional matrix adjust.
 Identities = 163/508 (32%), Positives = 263/508 (51%), Gaps = 9/508 (1%)

Query: 36  SVSEGVDGKHEGIRLKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILISYSFV 95
           S +E  +G  +  ++K+ L+ RHVSM                       PV  LI+Y F+
Sbjct: 101 SDTESGEGDMQEGKVKRALKPRHVSMIALGGTIGTGLFVGIASPLSYSGPVGALIAYIFM 160

Query: 96  GLLVYTVMSCLGEMAAFIPL-DGFTSYASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGA 154
           G +VY V   +GEMA FIP+    T ++SR++ PA G A GY Y F + I    +L+   
Sbjct: 161 GTVVYFVTQSMGEMATFIPVTSSITVFSSRFLSPAFGVANGYMYWFNWAITFAVELSVTG 220

Query: 155 MVMQFWVSRDRVNPGVWITIFLALIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXX 214
            V+++W   + V    WI IF  L+ L N   V+F+GE EFW++S+K             
Sbjct: 221 QVIEYWT--EAVPRAAWIAIFWVLVTLANFFPVQFYGEVEFWVASIKVLAIVGYLIYALV 278

Query: 215 XXXXXXPNHDRTGFRFWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIV 274
                       GFR+WR+PG +     +    +G+              Y GTEL GI 
Sbjct: 279 IVCGGS-KQGPIGFRYWRNPGPWGAGIISKDKDEGRFLGWVASLINASFTYQGTELVGIT 337

Query: 275 AAEAKNPRRSVPRAIKLTLYRIVVFYVITILLLGMTVAYNDPRLLXXXXXXXXXXXXPFV 334
           A EA NPRR+VPRAI    +RI+ FY++++  +G+ V YN   L             PFV
Sbjct: 338 AGEAANPRRTVPRAINKVFFRILFFYILSLFFVGLLVPYNHSSL---DKTTTVIASSPFV 394

Query: 335 VAIENASIPVLPHIFNVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVP 394
           ++I+NA    LP IFN  VLV + SA NS++YV SR L+ LA  G AP++F++    GVP
Sbjct: 395 ISIQNAGTRALPDIFNAVVLVTIISAANSNVYVGSRVLFSLAHTGIAPKVFSSVTPQGVP 454

Query: 395 YYSLGLSVLFCLLAYMNVSSGSAQVFNYFVNVVSIFGLLSWITILITYIRFDKAIRVQFG 454
           +  + ++ L  LLA++ V+  + + FN+ +N+ ++ GL +W+ I I++IRF + ++ +  
Sbjct: 455 FMGVIVTSLLGLLAFLVVNHNANEAFNWLINISTLAGLCAWLFISISHIRFMQCLKQRGI 514

Query: 455 DKSSLSYTAAFQPWSTYVALFFCCLIGLIKNYTVFLGHKFDYKTFISGYIGIPVYLICYV 514
            +  L + +   P+  Y A F+  +I  ++ +  F  H F    F + YI + + ++ + 
Sbjct: 515 SRDDLPFKSKLMPYGAYYAAFWVTVIIFVQGFQAFSPH-FKVTEFFTSYISLMLLVVVFC 573

Query: 515 GYKVVYRTKLI-KPEDVDLYTFKDAIDA 541
           G ++ YR +   + ED+D+ + +   DA
Sbjct: 574 GAQLFYRCRFFNRLEDIDIDSDRREADA 601

>Kwal_33.13411 s33 (210461..212143) [1683 bp, 560 aa] {ON} YNL268W
           (LYP1) - lysine permease [contig 117] FULL
          Length = 560

 Score =  279 bits (713), Expect = 6e-86,   Method: Compositional matrix adjust.
 Identities = 175/532 (32%), Positives = 269/532 (50%), Gaps = 22/532 (4%)

Query: 15  LYSNETLEEGIVTLESEGQVRSVSEGVDGKHEGIRLKKELEARHVSMXXXXXXXXXXXXX 74
           +YSNET   G       G   S  +      EG ++K+ L+ RHVSM             
Sbjct: 26  VYSNETQNGG------SGHNSSFEDDEGDLQEG-QVKRALKPRHVSMIALGGTIGTGLFV 78

Query: 75  XXXXXXXXXXPVSILISYSFVGLLVYTVMSCLGEMAAFIPL-DGFTSYASRYVDPAVGFA 133
                     PV  LI+Y F+G +VY V   +GEMA FIP+    T +++R++ PA G A
Sbjct: 79  GIASPLSSAGPVGALIAYIFMGSIVYFVTQSMGEMATFIPVTSSITVFSNRFLSPAFGVA 138

Query: 134 VGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVNPGVWITIFLALIVLINTVGVRFFGEF 193
            GY Y F + I    +++    V+Q+W     V    WI IF   I L N   VRF+GE 
Sbjct: 139 NGYMYWFNWAITYAVEISVIGQVIQYWT--KAVPLAAWIGIFWVAITLANFFPVRFYGEV 196

Query: 194 EFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGFRFWRDPGAFKPYSEAI-SGSK--GK 250
           EFW++S+K                         GFR+WR+PG   P+ + I SG K  G+
Sbjct: 197 EFWVASIKVIAIVGYLLYALIIVCGGS-KQGPIGFRYWRNPG---PWGDGIISGDKDKGR 252

Query: 251 XXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVVFYVITILLLGMT 310
                         Y GTEL GI A EA NPR++VP+AI    +RI+ FY++++  +G+ 
Sbjct: 253 FLGWVASLINASFTYQGTELVGITAGEAANPRKTVPKAINKVFFRILFFYILSLFFVGLL 312

Query: 311 VAYNDPRLLXXXXXXXXXXXXPFVVAIENASIPVLPHIFNVCVLVFVFSACNSDLYVASR 370
           V YN P L             PFV++I++A   +LP IFN  VLV + SA NS++YV SR
Sbjct: 313 VPYNHPGL---DKHTSVIASSPFVISIQSAGTRILPDIFNAVVLVTIISAANSNVYVGSR 369

Query: 371 SLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCLLAYMNVSSGSAQVFNYFVNVVSIF 430
            L+ LA  G AP+ F+     GVPY  +  + L  LLA++ V   + + FN+ +N+ ++ 
Sbjct: 370 ILFSLAHTGIAPKQFSYVTNQGVPYLGVICTALLGLLAFLVVDDNANEGFNWLINISTLA 429

Query: 431 GLLSWITILITYIRFDKAIRVQFGDKSSLSYTAAFQPWSTYVALFFCCLIGLIKNYTVFL 490
           GL +W+ I I++IRF + ++ +   +  L + +   P+  Y A F+  +I  ++ +  F 
Sbjct: 430 GLCAWLFISISHIRFMQCLKQRGISRDDLPFKSKLMPYGAYYAAFWVAVIIFVQGFQAFC 489

Query: 491 GHKFDYKTFISGYIGIPVYLICYVGYKVVYRTKLI-KPEDVDLYTFKDAIDA 541
             KF    F +GYI + +  + +   ++ YR +   + ED+D+ + +  IDA
Sbjct: 490 -PKFKVAEFFTGYISLILLAVVFCLAQLYYRCRFFNRLEDIDIDSDRREIDA 540

>AFR668W Chr6 (1659910..1661580) [1671 bp, 556 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL063C (CAN1) and
           YNL270C (ALP1)
          Length = 556

 Score =  278 bits (710), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 169/526 (32%), Positives = 267/526 (50%), Gaps = 13/526 (2%)

Query: 8   EKKNAGVLYSNETLEEGIVTLESEGQVRSVSEGVDGKHEGIRLKKELEARHVSMXXXXXX 67
           E K  G   S  T + G +  E      S  E +  K     +K+EL+ RHV+M      
Sbjct: 7   EPKGDGSSSSTITAKPGAIKAEVLNHNTSEVESLCEKPNQSDVKRELKPRHVTMISLGGT 66

Query: 68  XXXXXXXXXXXXXXXXXPVSILISYSFVGLLVYTVMSCLGEMAAFIPL-DGFTSYASRYV 126
                            PV  L++Y FV  + Y V   LGEMA FIP+   FT +ASR+V
Sbjct: 67  IGTGLFIGIASPIRNAGPVGSLLAYIFVATMAYCVTQSLGEMATFIPVTSSFTVFASRFV 126

Query: 127 DPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVNPGVWITIFLALIVLINTVG 186
            PA+G A GY Y   + I    +++    ++ +W   D V    W+ IF  L+  IN + 
Sbjct: 127 SPALGAANGYLYWLSWCITFALEISVIGRLILYW--SDAVPITAWMAIFWVLLTAINLIP 184

Query: 187 VRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGFRFWRDPGAFKPYSEAISG 246
           V+F+GEFEFW++S+K                       R GFR+W+DPG   P+   I  
Sbjct: 185 VKFYGEFEFWIASLKVIAILCFLFYGLVVVCGGS-KLGRIGFRYWKDPG---PWGVGIVS 240

Query: 247 SK---GKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVVFYVIT 303
            +    +              + GTEL G+ A E KNPRR+VP+AI    +RI++FY+ +
Sbjct: 241 QEIHTAQFLGWVSSLIKAAFTFQGTELVGVTAGETKNPRRTVPKAINTVFFRILLFYIGS 300

Query: 304 ILLLGMTVAYNDPRLLXXXXXXXXXXXXPFVVAIENASIPVLPHIFNVCVLVFVFSACNS 363
           +L++G+ V Y+DP+L+            PFVVAI  A   VLP I N  ++V + SA NS
Sbjct: 301 LLVIGLLVRYDDPQLIQDGSTTNANAS-PFVVAINAAGTKVLPDIMNGVIMVTIISAGNS 359

Query: 364 DLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCLLAYMNVSSGSAQVFNYF 423
           ++YV SR LYGL   G AP   + T   GVPY ++  + +F  L Y+NVSS S  VF++ 
Sbjct: 360 NIYVGSRVLYGLGRSGLAPAFISRTTSRGVPYVAVLATSMFGALGYLNVSSKSGSVFDWL 419

Query: 424 VNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLSYTAAFQPWSTYVALFFCCLIGLI 483
           +++ ++ G  +W+ I +++IRF + ++ +   +  L + A F P+  Y A FF  +I L+
Sbjct: 420 LSITAVSGFFTWLLISVSHIRFMQCLKKRGISRDDLPFKAKFMPYGAYYAAFFVIVIILV 479

Query: 484 KNYTVFLGHKFDYKTFISGYIGIPVYLICYVGYKVVYRTKLIKPED 529
           + +T F    F    F++ YI   ++++ ++ ++ +++ +     D
Sbjct: 480 QGFTAF--TPFSAVDFVAYYISAFIFVVIWLLFQFLFKGRWFHTVD 523

>SAKL0F16544g Chr6 complement(1364680..1366383) [1704 bp, 567 aa]
           {ON} similar to gnl|GLV|KLLA0B14685g Kluyveromyces
           lactis KLLA0B14685g and weakly similar to YOR348C
           uniprot|P15380 Saccharomyces cerevisiae YOR348C PUT4
           proline- specific permease (also capable of transporting
           alanine and glycine) putative proline-specific permease
          Length = 567

 Score =  278 bits (710), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 168/512 (32%), Positives = 264/512 (51%), Gaps = 14/512 (2%)

Query: 17  SNETLEEGIVTLESEGQVRSVSEGVDGKHEGIRLKKELEARHVSMXXXXXXXXXXXXXXX 76
           ++   E+   ++ S G   S    +D + +   + + L++RHV +               
Sbjct: 18  TDRMKEKTQFSIHSTGDEVSQGSVLDIESQKPGIVRGLKSRHVQLIALGSAIGTGLFIGS 77

Query: 77  XXXXXXXXPVSILISYSFVGLLVYTVMSCLGEMAAFIPLDGFTSYASR---YVDPAVGFA 133
                   P  +LI+Y+ + L V++VM+ + EM   IPL G ++  S    YV+  + F 
Sbjct: 78  GGALSICGPAPLLIAYAVMSLFVWSVMNQMTEMVTLIPLPGESTLYSLLKLYVNKPLSFM 137

Query: 134 VGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVNPGVWITIFLALIVLINTVGVRFFGEF 193
            G++  +   ++ P ++TA A+++Q+W      NP ++I+IFL L V I  + V+ FGE 
Sbjct: 138 CGWNLFYAQAMIAPAEVTACALLVQYWTD---ANPAIFISIFLVLSVAITMLPVKVFGES 194

Query: 194 EFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRT-GFRFWRDPGAFKPYSEAISGSKGKXX 252
           EFW+SS+K                   P  +   GF +W+ PGAFKPY   + G  GK  
Sbjct: 195 EFWVSSIKILTIVGLIIVGVVIFFGGGPAQEHVLGFHYWKKPGAFKPY--LVEGGTGKFL 252

Query: 253 XXXXXXXXXXXXYTGT-ELCGIVAAEAKNPRRSVPRAIKLTLYRIVVFYVITILLLGMTV 311
                       +    E+    AAEA  PRR++PRA K  +YR+ +FYV  IL++G+ V
Sbjct: 253 AFWTAIIKSGFSFVLVPEIVSSCAAEAVAPRRNMPRACKRFIYRLALFYVFGILVVGVIV 312

Query: 312 AYNDPRLL-XXXXXXXXXXXXPFVVAIENASIPVLPHIFNVCVLVFVFSACNSDLYVASR 370
            Y++ RLL             PFV+ I+ A I VLPHI N  +L   +S     LY ASR
Sbjct: 313 GYDNDRLLNAIASGQSSAAASPFVIGIKEAGIRVLPHIINAAILTSAYSCGTGLLYGASR 372

Query: 371 SLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCLLAYMNVSSGSAQVFNYFVNVVSIF 430
           +L+ +A  G APRI  T NK+GVPYY  G++ LFCLLAY+N S+ S+ VFN+  N+ +I 
Sbjct: 373 TLHSMACKGDAPRILTTVNKYGVPYYCTGITSLFCLLAYLNCSNSSSVVFNWLSNIATIS 432

Query: 431 GLLSWITILITYIRFDKAIRV-QFGDKSSLSYTAAFQPWSTYVALFFCCLIGLIKNYTVF 489
           G +SW+ + I YIRF   I V +  D+  + +   +Q    Y+A+ F  ++ L   + VF
Sbjct: 433 GFVSWVLVSIAYIRFRNVIDVLKLNDR--IPFRVPYQKPLAYLAMGFFSILTLTNGFAVF 490

Query: 490 LGHKFDYKTFISGYIGIPVYLICYVGYKVVYR 521
           +   +D   F + YI +   L+ +VG  + Y+
Sbjct: 491 IKGNWDTSNFFAAYITLGFVLVLFVGSTIYYK 522

>TBLA0C01240 Chr3 (270186..272075) [1890 bp, 629 aa] {ON} Anc_1.368
           YOL020W
          Length = 629

 Score =  269 bits (687), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 168/570 (29%), Positives = 289/570 (50%), Gaps = 39/570 (6%)

Query: 2   NSDTSMEKKNAGVLYSNETLEE----------GIVTLESEGQVRSVSEGV---DGKHEGI 48
           +S++S+  +   + +++  LEE           +  +   G    +SE +   DG+    
Sbjct: 43  DSNSSLRIEKETLTFNSSKLEECKIEDKISNFDLSQIGYNGNETIISEELINEDGRKN-- 100

Query: 49  RLKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILISYSFVGLLVYTVMSCLGE 108
           +LK+ L ARH+ +                       P  ++ SY  +  +VY +M+ LGE
Sbjct: 101 KLKQGLNARHIQLIALGGCIGTGLFVGAGITLNKCGPAGLVASYLIISTMVYPIMNVLGE 160

Query: 109 MAAFIPLDGFTSYAS------RYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVS 162
           M  ++P DG  S  S      RY+D ++ FA G++Y + + ++   + TA + V+++W  
Sbjct: 161 MVCYLPGDGSDSAGSVPHLVKRYLDDSLSFAAGWNYYYCFVMLVAAECTAASGVVEYWT- 219

Query: 163 RDRVNPG-VWITIFLALIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXP 221
             +V P   WI +F  +I  +N   VR +GE EFW +  K                   P
Sbjct: 220 --KVVPKPAWIVMFQLIIFGLNMCPVRVYGESEFWFAISKILCIVGLIILSFILFWGGGP 277

Query: 222 NHDRTGFRFWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYT-GTELCGIVAAEAKN 280
           NHDR GFR+W  PG+F   +   +GS G               +  G EL  + ++E  +
Sbjct: 278 NHDRLGFRYWITPGSFA--NTITNGSFGNFLDVYKGIILGAFSFILGPELVVLPSSECSD 335

Query: 281 PRRSVPRAIKLTLYRIVVFYVITILLLGMTVAYNDPRL-LXXXXXXXXXXXXPFVVAIEN 339
           PRR++ +A K  ++R++ FY++  L + + V+YNDP L              PFV+ I+N
Sbjct: 336 PRRNIKKASKRFIWRLMFFYILGTLSISVIVSYNDPILSTALIQDKPGAGSSPFVIGIQN 395

Query: 340 ASIPVLPHIFNVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLG 399
           A I VLPHI NVC+L+  +S+ N+ L+ +SRSL  +AI+ +AP+     N++GVPY ++ 
Sbjct: 396 AGIDVLPHIINVCILISAWSSGNAYLFASSRSLQTMAINSQAPKCLGKINRFGVPYVAVI 455

Query: 400 LSVLFCLLAYMNVSSGSAQVFNYFVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSL 459
           +S++   +AY+N S  ++ VF +F N+ +I G L WI + +TY+RF KAI    G K  L
Sbjct: 456 VSIILSCIAYLNCSKSTSDVFKWFTNLSTISGFLGWIIVSVTYLRFRKAIEYH-GMKDRL 514

Query: 460 SYTAAFQPWSTYVALFFCCLIGLIKNYTVFLGHKFDYKTFISGYIGIPVYLICYVGYKVV 519
            YT   QP+    +L    +I +   + + +   ++   FI+ Y+ +P++L+ ++G+K  
Sbjct: 515 PYTTWGQPYLIIYSLISFIIITITNGFDILIPRNWNVSDFIAAYLTLPIFLMIWIGHKFY 574

Query: 520 -YRTKLI--------KPEDVDLYTFKDAID 540
            YR K+         + ED+D+ T  + I+
Sbjct: 575 KYRFKIFTRQCRWWYQVEDIDVITGLEEIE 604

>KLTH0F04048g Chr6 (359492..361243) [1752 bp, 583 aa] {ON} weakly
           similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348C PUT4 proline-specific permease (also capable of
           transporting alanine and glycine) putative
           proline-specific permease
          Length = 583

 Score =  267 bits (683), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 162/536 (30%), Positives = 266/536 (49%), Gaps = 19/536 (3%)

Query: 4   DTSMEKKNAGVLYSNETLEEGIVTLESEGQVRSVS-EGVDGKHEGIRLKKELEARHVSMX 62
           D S  + N G    +   E+    ++    V   S E ++G+    ++ ++L++RH+ + 
Sbjct: 22  DNSHSRPNYGHSADSWNNEKSAYQVDQIIDVEDASMELIEGQEH--QVARKLKSRHIQLI 79

Query: 63  XXXXXXXXXXXXXXXXXXXXXXPVSILISYSFVGLLVYTVMSCLGEMAAFIPLDGFTSY- 121
                                 P  +LISY  +   V+ +M+ L EM   +P+ G TS  
Sbjct: 80  ALGGAIGTGLFIGSGGALSVCGPAPLLISYMIMSFFVWCIMNFLTEMVCMMPISGETSMF 139

Query: 122 --ASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVNPGVWITIFLALI 179
                Y++  + F  G +  +   ++ P+++TA A+++Q+W      N  ++I+IF+ + 
Sbjct: 140 AMTGTYLNKPLSFMCGINLFYAMSMIAPSEITATAILIQYWTD---ANSAIFISIFIVVT 196

Query: 180 VLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRT-GFRFWRDPGAFK 238
           V +  + V FFGE EFW+S +K                   PN D+  GF +W+ PGAF 
Sbjct: 197 VSLTMLPVHFFGESEFWVSIIKLFCITGLVILGIVIFFGGAPNQDKVLGFHYWKHPGAFN 256

Query: 239 PYSEAISGSKGKXXXXXXXXXXXXXXYTGT-ELCGIVAAEAKNPRRSVPRAIKLTLYRIV 297
           P+   + G+ GK              Y    E+    AAEAK+PRR++PR  +  +YR+ 
Sbjct: 257 PH--LVPGNTGKFLACWTAIIKSGFSYVLVPEVVVSCAAEAKDPRRNMPRVAQRFVYRLA 314

Query: 298 VFYVITILLLGMTVAYNDPRLLXXXXX-XXXXXXXPFVVAIENASIPVLPHIFNVCVLVF 356
           +FYV   L +G+ V Y++ RLL             PFV+ I+   I VLPHI N C+L  
Sbjct: 315 LFYVCGSLTIGIMVGYDNSRLLNAIAAGESNAAASPFVIGIQEVGIRVLPHIINACILTS 374

Query: 357 VFSACNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCLLAYMNVSSGS 416
            +S   S LY ASR L+ +A++G  P+IFATTN++G PYYS   + +FCLLAY+N S  S
Sbjct: 375 AYSCGTSVLYGASRVLHSMAVNGAVPKIFATTNRFGTPYYSTAAASVFCLLAYLNCSDSS 434

Query: 417 AQVFNYFVNVVSIFGLLSWITILITYIRFDKAI-RVQFGDKSSLSYTAAFQPWSTYVALF 475
           + VF +  N+ +I G + W+ + + Y+RF K I      DK  + +   F     Y++  
Sbjct: 435 SVVFTWLSNIATISGFVDWMLVCVVYLRFRKVIEHANLTDK--MPFRKRFMKPLAYLSCG 492

Query: 476 FCCLIGLIKNYTVFLGHKFDYKTFISGYIGIPVYLICYVGYKVVYRTKLIKPEDVD 531
           F  ++ L   Y VF+   ++   F + Y  + +  + Y+G  + Y+T  IK  D+D
Sbjct: 493 FFAILSLTNGYAVFVADNWNVSDFFACYTTLGLAAVLYIGAAIYYKT--IKLRDLD 546

>KAFR0C05160 Chr3 (1025799..1027553) [1755 bp, 584 aa] {ON} Anc_7.44
           YOR348C
          Length = 584

 Score =  256 bits (655), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 163/562 (29%), Positives = 284/562 (50%), Gaps = 29/562 (5%)

Query: 1   MNSDTSMEKKNAGVLYSNE--TLEEGIVTLESEGQVRSVSEGVDGKHEGIR-LKKELEAR 57
           M+  + M   N  V   N+   +++G V+ E       V      K    R LK  L++R
Sbjct: 5   MSESSDMATTNISVYDKNDKNNIKDG-VSFEKPIIYSEVDIESGAKESSSRNLKHGLQSR 63

Query: 58  HVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILISYSFVGLLVYTVMSCLGEMAAFIPLD- 116
           H+ +                       P +++ISY  +  +VY +M+  GEM  ++P + 
Sbjct: 64  HIQLIALGGTIGTGLFVGTSSTLANCGPAALVISYIVISTIVYPIMNMFGEMVCYLPGND 123

Query: 117 ------GFTSY-ASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVNPG 169
                 G+ +Y  S+YVD ++GFA  ++Y + + ++   + TA + ++++W S+  +   
Sbjct: 124 DDDESVGYCAYLVSKYVDESLGFATSWNYYYCFIVLVATECTAASSIVEYWTSK--IPKA 181

Query: 170 VWITIFLALIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRT--- 226
           V I +FL +I L+N + V+F+GE EFW + +K                   PN++     
Sbjct: 182 VLIFLFLGVIFLLNFLPVKFYGEAEFWFAIIKIFCITGLIIVAFVIFCGGAPNNEDNSFV 241

Query: 227 GFRFWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYT-GTELCGIVAAEAKNPRRSV 285
           GF +W++P +F+ Y    +GS G               +  G EL  + ++E  + RR++
Sbjct: 242 GFHYWKNPSSFRDY--VTNGSLGNFLDVYNALIKGAFAFILGPELVSLTSSECVDQRRNI 299

Query: 286 PRAIKLTLYRIVVFYVITILLLGMTVAYNDPRLLXXXXXXX-XXXXXPFVVAIENASIPV 344
            +A +  +YR++ FY+   L + + V YNDP LL             PFV+ I+NA I +
Sbjct: 300 AKASRRFVYRLMFFYIFGALSISVIVPYNDPTLLNALALNKPGAGSSPFVIGIQNAGITI 359

Query: 345 LPHIFNVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLF 404
           LPHI N C+L    SA N+ L+ ++R+L  +  +G APRIF+  N+ GVPY +L LS++ 
Sbjct: 360 LPHIINFCILTSAMSAGNAFLFASTRALLTMGKNGSAPRIFSRINRHGVPYVALSLSIMI 419

Query: 405 CLLAYMNVSSGSAQVFNYFVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLSYTAA 464
             LA++N S+ SA+VF +F N+ +I G + W T  I Y+RF + I    G    L +   
Sbjct: 420 ACLAFLNCSASSAKVFQWFSNISTISGFIGWFTGCIAYLRFRRTIDYN-GLYDRLPFKTK 478

Query: 465 FQPWSTYVALFFCCLIGLIKNYTVFLGHKFDYKTFISGYIGIPVYLICYVGYKVVY---- 520
            Q + T+ +  F  ++ L   Y   +   ++Y+ FI+ YI +PV+L+ Y G+ ++Y    
Sbjct: 479 GQVYLTWYSFVFVGILILTNGYMYIIPKFWNYQDFIAAYITLPVFLVLYFGH-IIYSGRW 537

Query: 521 -RTKLIKP-EDVDLYTFKDAID 540
            + K  KP +++D+ T  + I+
Sbjct: 538 RQRKWWKPVDEIDVVTGLEEIE 559

>TDEL0E05750 Chr5 (1074448..1076094) [1647 bp, 548 aa] {ON} 
          Length = 548

 Score =  254 bits (650), Expect = 8e-77,   Method: Compositional matrix adjust.
 Identities = 164/536 (30%), Positives = 268/536 (50%), Gaps = 20/536 (3%)

Query: 4   DTSMEKKNAGVLYSNETLEEGIVTLESEGQVRSVSEGVDGKHEGIRLKKELEARHVSMXX 63
            +S+ K+   +  +   LEEG VTL+      ++ +GV   ++  +LK+ L+ARH+ M  
Sbjct: 7   SSSLTKEKVAIDEAEVQLEEG-VTLD-----ETIKQGVL-HNDRTKLKQGLKARHIKMLT 59

Query: 64  XXXXXXXXXXXXXXXXXXXXXPVSILISYSFVGLLVYTVMSCLGEMAAFIPLDGFT-SYA 122
                                PV +LI+Y  VG++V      + E+A+F+P  G T  ++
Sbjct: 60  LVGVFGTGLFLSSGGTLKKTGPVGMLIAYVLVGIVVGCNQIAIAEVASFMPATGATIRHS 119

Query: 123 SRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVNPGVWITIFLALIVLI 182
            +++D AVGF  G+  +  Y  + P +L+A A+VM +W     ++P ++ITIF  L +L 
Sbjct: 120 EQFIDEAVGFTFGW--ISTYSSLMPGELSATAVVMTYWTD---LSPAIFITIFGVLFILT 174

Query: 183 NTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGFRFWRDPGAFKPYSE 242
           N   +RF+GE E++   +K                      +R GF +WR+PG F  Y  
Sbjct: 175 NIYTIRFYGEIEYFFGWLKLALIAILIITGLVIDLGGT-KQERLGFHYWRNPGPFAEY-- 231

Query: 243 AISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVVFYVI 302
            + G  GK              Y+G +   I+A E KN R ++    K    RI++ Y+I
Sbjct: 232 LVGGDTGKFVGFWAALSSVVYSYSGIQNIAILAGETKNSRHAIFHGAKNVFVRIILLYLI 291

Query: 303 TILLLGMTVAYNDPRLLXXXXXXXXXXXXPFVVAIENASIPVLPHIFNVCVLVFVFSACN 362
           T+ +L + V YND  +             PFV+A+E A I VLPHI N  +L   +SA N
Sbjct: 292 TVFVLTLIVPYNDKLI---ATGSGNARSSPFVIAMERAGIKVLPHIVNALILTSAWSAGN 348

Query: 363 SDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCLLAYMNVSSGSAQVFNY 422
             +   SR+L+ LA   +AP+IF  T+K G+P+  +     F  LAYM+ S  SA VF++
Sbjct: 349 LAIIEGSRNLFCLATKNQAPKIFLKTSKRGIPWVGVLFISSFLPLAYMSCSESSATVFSW 408

Query: 423 FVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLSYTAAFQPWSTYVALFFCCLIGL 482
           F  +VS   LL WI I   +I  D+A+R Q   +  L Y+    P++ + +     +  L
Sbjct: 409 FQELVSSNTLLRWILISANHIHMDRALRAQGYSRKDLPYSTTIAPYAAWFSGIMSFIFLL 468

Query: 483 IKNYTVFLGHKFDYKTFISGYIGIPVYLICYVGYKVVYRTKLIKPEDVDLYT-FKD 537
              +  F+   FD ++F S Y  IP+ +  +  +K+  +T+ ++P +VDL + F+D
Sbjct: 469 TGGFYNFIHGNFDIESFFSRYFIIPLAIALFTFWKLFKKTRYLRPHEVDLQSIFED 524

>NDAI0D02160 Chr4 (505202..506965) [1764 bp, 587 aa] {ON} Anc_5.158
          Length = 587

 Score =  255 bits (652), Expect = 9e-77,   Method: Compositional matrix adjust.
 Identities = 152/499 (30%), Positives = 249/499 (49%), Gaps = 14/499 (2%)

Query: 48  IRLKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILISYSFVGLLVYTVMSCLG 107
           + L K L  RH+                         P S++I +  +   ++TV++ LG
Sbjct: 68  VNLNKNLSIRHLLTLAVGGAIGVGLFVNSGAALASGGPASLVIDWVIISTCLFTVINALG 127

Query: 108 EMAAFIPL-DGFTSYASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRV 166
           EMAA  P+  GF  Y +R+VDP+VGFAV  +YL ++ ++ P +L A +M +++W   D +
Sbjct: 128 EMAAAFPVVGGFNVYITRFVDPSVGFAVNINYLAQWLVLLPLELVAASMTIKYW--NDTI 185

Query: 167 NPGVWITIFLALIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRT 226
           N   W+ IF A+I   N + V+ FGE EF LS VK                   P     
Sbjct: 186 NSDAWVAIFYAVIAFANMLEVKSFGETEFVLSMVKILAIIGFTILGIVLSCGGGPQGGYL 245

Query: 227 GFRFWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVP 286
           G ++W +PG+F  ++   SG+K K              Y+G E+  + AAE+K+PRR++P
Sbjct: 246 GGKYWHNPGSFVGHT---SGTKFKGLCSVFVTAAFS--YSGIEMTAVSAAESKDPRRTIP 300

Query: 287 RAIKLTLYRIVVFYVITILLLGMTVAYNDPRLLXXXXXXXXXXXXPFVVAIENASIPVLP 346
           +A K T + I   Y+  + L+G  V Y++PRLL            P V+AIEN  I  LP
Sbjct: 301 KAAKRTFWLITASYITILTLIGCLVPYDEPRLLSGSSSVDAASS-PLVIAIENGGIKGLP 359

Query: 347 HIFNVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCL 406
            + N  +L+ + S  NS +Y  SR +  +A  G  P++    +K G P  ++  ++ F L
Sbjct: 360 SLMNAIILISIISVANSAVYACSRCMVAMAHIGNLPQVLKHIDKKGRPVNAILFTLFFGL 419

Query: 407 LAYMNVSSGSAQVFNYFVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLSY---TA 463
           L+++  S   A+VF +   +  +  +  W+ I I++IRF +A++ Q      L Y   T 
Sbjct: 420 LSFVAASDKQAEVFTWLSALSGLSTIFCWMAINISHIRFRQAMKKQRKSLDELPYLSQTG 479

Query: 464 AFQPWSTYVALFFCCLIGLIKNYTVFLGHKFDYKTFISGYIGIPVYLICYVGYKVVYRTK 523
            +  W   + LF   ++    +     G   D ++F  GY+  P+ + CYVG+K+VYR K
Sbjct: 480 VWGSWYGVIVLFLVLIVSFWTSLFPLGGSGADAESFFQGYLSFPILIACYVGHKLVYRKK 539

Query: 524 --LIKPEDVDLYTFKDAID 540
             ++  ED+D+ T +  +D
Sbjct: 540 QIVVALEDMDIDTGRRQVD 558

>Smik_6.482 Chr6 complement(795927..797603) [1677 bp, 558 aa] {ON}
           YPL265W (REAL)
          Length = 558

 Score =  254 bits (648), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 164/540 (30%), Positives = 262/540 (48%), Gaps = 17/540 (3%)

Query: 2   NSDTSMEKKNAGVLYSNETLEEGIVTLESEGQVRSVSEGVDGKHEGIRLKKELEARHVSM 61
            S  S EK    +   +   E  IV++E      +V  GV   ++  +LK+ L+ RH+ M
Sbjct: 7   ESTNSQEKVKPKIYEEDVDEEHDIVSVE-----ETVKRGVL-HNDRTKLKQGLKERHIKM 60

Query: 62  XXXXXXXXXXXXXXXXXXXXXXXPVSILISYSFVGLLVYTVMSCLGEMAAFIPLDGFT-S 120
                                  PV +LI+Y FVG++V      + E+A+F+P  G T  
Sbjct: 61  LTLVGVFGTGLFLSSGGTLKKTGPVGLLIAYLFVGIVVGCNQIAIAEVASFMPATGATIR 120

Query: 121 YASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVNPGVWITIFLALIV 180
           +A +++D +VGF  G+  +  Y  + P +L+A A++M++W     V+P V+IT+F  L V
Sbjct: 121 HAEQFIDESVGFTFGW--ISTYSSLMPGELSATAVIMRYWTD---VSPAVFITVFGILFV 175

Query: 181 LINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGFRFWRDPGAFKPY 240
           + N   +RF+GE E+    +K                      +R GF +WR+PG F  Y
Sbjct: 176 VTNIYTIRFYGELEYIFGWLKLVLIFILIISGLVIDLGGTKGQERLGFHYWREPGPFANY 235

Query: 241 SEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVVFY 300
              + G  GK              Y+G +   I+A E KN R ++    K    RI+V Y
Sbjct: 236 --LVGGHIGKFVGFWAAISSVVYSYSGIQNIAILAGETKNSRHAIFHGAKNVFLRIIVLY 293

Query: 301 VITILLLGMTVAYNDPRLLXXXXXXXXXXXXPFVVAIENASIPVLPHIFNVCVLVFVFSA 360
           ++T+ +L + V YND  +             PFV+A+  A I VLPHI N  +L   +SA
Sbjct: 294 LVTVFILTLIVPYNDKLI---ATGTGTARSSPFVIAMNRAGIKVLPHIVNALILTSAWSA 350

Query: 361 CNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCLLAYMNVSSGSAQVF 420
            N  +   SR+L+ LA   +AP+IF  T+K G+PY  +     F  LAYM+ S  SA VF
Sbjct: 351 GNLAIIEGSRNLFCLATKNQAPKIFLRTSKRGIPYVGVIFISSFLPLAYMSCSKSSATVF 410

Query: 421 NYFVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLSYTAAFQPWSTYVALFFCCLI 480
            +F  +VS   LL WI I   +I  D+A++ Q   +S L Y+    P++ + +     + 
Sbjct: 411 GWFQELVSSNTLLRWILISANHIHMDRALKAQGYSRSDLPYSTPMGPFAAWFSGIMSFIF 470

Query: 481 GLIKNYTVFLGHKFDYKTFISGYIGIPVYLICYVGYKVVYRTKLIKPEDVDLYTFKDAID 540
            L   +  F+   FD ++F + Y  IP+ +  +  +K+  +TK ++P +VDL +  D I 
Sbjct: 471 LLTGGFYNFIHGHFDIESFFTRYFIIPLAIGLFTFWKLFKKTKYLRPHEVDLESIFDDIK 530

>Suva_13.517 Chr13 (904704..906347) [1644 bp, 547 aa] {ON} YPL265W
           (REAL)
          Length = 547

 Score =  251 bits (640), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 159/531 (29%), Positives = 261/531 (49%), Gaps = 28/531 (5%)

Query: 10  KNAGVLYSNETLEEGIVTLESEGQVRSVSEGVDGKHEGIRLKKELEARHVSMXXXXXXXX 69
           ++  +  ++ETL++G++                  ++  +LK+ L+ RH+ M        
Sbjct: 21  EDCDIRSTDETLKQGVL-----------------HNDRTKLKQGLKERHIKMLTLVGVFG 63

Query: 70  XXXXXXXXXXXXXXXPVSILISYSFVGLLVYTVMSCLGEMAAFIPLDGFT-SYASRYVDP 128
                          PV +LI+Y FVG++V      + E+A+F+P  G T  +A +++D 
Sbjct: 64  TGLFLSSGGTLKKTGPVGLLIAYLFVGIVVGCNQIAIAEVASFMPATGATIRHAEQFIDE 123

Query: 129 AVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVNPGVWITIFLALIVLINTVGVR 188
           +VGF  G+  +  Y  + P +L+A A++M++W     ++P V+ITIF  L V+ N   +R
Sbjct: 124 SVGFTFGW--ISTYSSLMPGELSATAVIMRYWTD---ISPAVFITIFGVLFVVTNIYTIR 178

Query: 189 FFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGFRFWRDPGAFKPYSEAISGSK 248
           F+GE E+    +K                      +R GF +WRDPG F  Y   + GS 
Sbjct: 179 FYGEVEYVFGWLKLILIFILIISGLVIDLGGVKGQERLGFHYWRDPGPFAEY--IVGGSI 236

Query: 249 GKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVVFYVITILLLG 308
           GK              Y+G +   I+A E KN R ++    K    RI+V Y++T+ +L 
Sbjct: 237 GKFVGFWSALSSVVYSYSGIQNIAILAGETKNSRHAIYHGAKNVFLRIIVLYLVTVFVLT 296

Query: 309 MTVAYNDPRLLXXXXXXXXXXXXPFVVAIENASIPVLPHIFNVCVLVFVFSACNSDLYVA 368
           + V YND  +             PFV+A+  A I VLPHI N  VL   +SA N  +   
Sbjct: 297 LIVPYNDALI---ASGTGTAKSSPFVIAMNRAGIKVLPHIVNALVLTSAWSAGNLAIIEG 353

Query: 369 SRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCLLAYMNVSSGSAQVFNYFVNVVS 428
           SR+L+ LA   +AP+IF  T+K G+PY  +     F  LAYM+ S  S+ VF +F  +VS
Sbjct: 354 SRNLFCLATKNQAPKIFLKTSKRGIPYVGVIFISCFLPLAYMSCSESSSTVFGWFQELVS 413

Query: 429 IFGLLSWITILITYIRFDKAIRVQFGDKSSLSYTAAFQPWSTYVALFFCCLIGLIKNYTV 488
              LL WI I   +I  D+A++ Q   +S L Y+    P++ + +     +  L   +  
Sbjct: 414 SNTLLRWILISANHIYMDRALKAQGYSRSDLPYSTPIAPYAAWFSGIMSFIFLLTGGFYN 473

Query: 489 FLGHKFDYKTFISGYIGIPVYLICYVGYKVVYRTKLIKPEDVDLYTFKDAI 539
           F+   FD ++F + Y  IP+ +  +  +K+  +T+ ++PE+VDL +  D I
Sbjct: 474 FIHGHFDIESFFTRYFIIPLAIGLFTFWKLFKKTRYLRPEEVDLASIFDDI 524

>KLTH0B00154g Chr2 complement(7385..9055) [1671 bp, 556 aa] {ON}
           weakly similar to uniprot|P38090 Saccharomyces
           cerevisiae YBR132C High affinity polyamine permease,
           preferentially uses spermidine over putrescine;
           expression is down-regulated by osmotic stress; plasma
           membrane carnitine transporter, also functions as a
           low-affinity amino acid permease
          Length = 556

 Score =  249 bits (636), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 156/516 (30%), Positives = 261/516 (50%), Gaps = 16/516 (3%)

Query: 22  EEGIVTLES-EGQVRSVSEGVDGKHEGIRLKKELEARHVSMXXXXXXXXXXXXXXXXXXX 80
           + G  T+ S EGQ  S+ E +         +++L  R VSM                   
Sbjct: 24  DVGAETIRSLEGQAPSLEERIA--------RRKLFPRQVSMIGIGGAIGTALFVSIGTQI 75

Query: 81  XXXXPVSILISYSFVGLLVYTVMSCLGEMAAFIPLDG-FTSYASRYVDPAVGFAVGYSYL 139
               P S+LI++    ++   +  C+  M  ++P+ G F  +  R+VD + GF+VG++Y 
Sbjct: 76  IHGGPGSLLIAFCLWSVVFIGLSQCMCVMVTYLPVTGSFVHFTERFVDSSCGFSVGWTYF 135

Query: 140 FKYFIVTPNQLTAGAMVMQFWVSRDRVNPGVWITIFLALIVLINTVGVRFFGEFEFWLSS 199
                    ++TA  +V++FW   D++     I+I +AL   +N   V  FGE EF+LS 
Sbjct: 136 VCQAANVCFEITAVCLVVEFWT--DKIPKAALISILIALFGSLNLFSVFIFGEGEFYLSI 193

Query: 200 VKXXXXXXXXXXXXXXXXXXXPNHDRTGFRFWRDPGAFKPYSEAISGSKGKXXXXXXXXX 259
            K                   P H   GF+ W +PGAF  Y     GS GK         
Sbjct: 194 GKVILAIGLIFFTIVVMAGGNPQHKVLGFKNWSNPGAFAEYIS--KGSAGKFHGFMSCLI 251

Query: 260 XXXXXYTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVVFYVITILLLGMTVAYNDPRLL 319
                + G +  G  A+EA NPR+ +P + +    R+++FY+   + +G+ V +ND  ++
Sbjct: 252 FALYVFWGVDYLGNAASEAMNPRKVIPSSFRKVFGRLIIFYIGGAICVGILVPFNDHNMI 311

Query: 320 XXXXXXXXXX-XXPFVVAIENASIPVLPHIFNVCVLVFVFSACNSDLYVASRSLYGLAID 378
                        P+V A++   I VLPHI NV +L  + SA NS LY ASR L+ LA++
Sbjct: 312 KAISEGAVGAGASPYVSAMKTLGIGVLPHIVNVLILTSIISAGNSSLYSASRVLHRLALE 371

Query: 379 GKAPRIFATTNKWGVPYYSLGLSVLFCLLAYMNVSSGSAQVFNYFVNVVSIFGLLSWITI 438
           G+AP++F  T + GVP Y     +L C LAY++VS+ +  V  +F+NV +    + +I I
Sbjct: 372 GQAPKLFKITKR-GVPIYCCVAVLLVCGLAYLSVSNSTNNVLTWFLNVETAAMAIVYIFI 430

Query: 439 LITYIRFDKAIRVQFGDKSSLSYTAAFQPWSTYVALFFCCLIGLIKNYTVFLGHKFDYKT 498
            I+Y++F K  + Q  D  +L Y+++F P+  + +LF+  L+  +  Y VFL   +D ++
Sbjct: 431 CISYLQFAKGCKAQNIDLKTLPYSSSFLPYLGWHSLFWLVLMLFMNGYAVFLKDSWDLQS 490

Query: 499 FISGYIGIPVYLICYVGYKVVYRTKLIKPEDVDLYT 534
           FI  Y  IP +++ + G+K+  +T+ +KP ++DL++
Sbjct: 491 FIFSYFMIPFFIVLFAGHKLYKKTRFVKPVEMDLFS 526

>KLLA0B14685g Chr2 complement(1289025..1290740) [1716 bp, 571 aa]
           {ON} weakly similar to uniprot|P15380 Saccharomyces
           cerevisiae YOR348C PUT4 proline-specific permease (also
           capable of transporting alanine and glycine) putative
           proline-specific permease
          Length = 571

 Score =  248 bits (633), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 142/473 (30%), Positives = 240/473 (50%), Gaps = 14/473 (2%)

Query: 49  RLKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILISYSFVGLLVYTVMSCLGE 108
           ++ + L+ RH+ +                       P  +LI+Y  +   V+++M+ + E
Sbjct: 54  KIVRGLKTRHIQLIALGSAIGTGLFIGSGGALSVCGPAPLLIAYIIISFFVWSIMNQMTE 113

Query: 109 MAAFIPLDG---FTSYASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDR 165
           M   IPL G     S A  Y++  + F  G++  +   ++ P ++TA A+++Q+W     
Sbjct: 114 MVCLIPLPGEASLYSLAKTYLNSPISFMCGWNLFYAMAMIVPAEITACALLVQYWTD--- 170

Query: 166 VNPGVWITIFLALIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDR 225
            N  ++I+IF+ + +L+  + V+ FGE EFW+SS+K                   P  D 
Sbjct: 171 ANSAIFISIFIVVSILLTMLPVKVFGESEFWVSSIKILTIVGLIIVGIVIFFGGGPAQDH 230

Query: 226 T-GFRFWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGT-ELCGIVAAEAKNPRR 283
             GF +W++PGAF P+     G+ G+              +    E     +AE   PRR
Sbjct: 231 VLGFHYWKNPGAFNPHLA--EGNTGRFLAVWTAIIKSGFSFVLVPETVTSCSAECIAPRR 288

Query: 284 SVPRAIKLTLYRIVVFYVITILLLGMTVAYNDPRLLXXXXX-XXXXXXXPFVVAIENASI 342
           ++P+A +  +YR+ +FY++  L++G+ V +N+ RL+             PFV+ I+ A I
Sbjct: 289 NMPKACQRFIYRLAIFYIVGTLVVGVIVGFNNDRLINAIQSGKSDAAASPFVIGIQEAGI 348

Query: 343 PVLPHIFNVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSV 402
            +LPHI N C+L   +S     LY +SR+LY +A+ G AP+IFA  N++G PYYS GL+ 
Sbjct: 349 KILPHIINACILTSAYSCGTGLLYGSSRTLYSMALRGDAPKIFAKVNRFGTPYYSTGLAS 408

Query: 403 LFCLLAYMNVSSGSAQVFNYFVNVVSIFGLLSWITILITYIRFDKAIR-VQFGDKSSLSY 461
           LF  LAY+N S  ++ VFN+  N+ +I G +SWI + +TYIRF K I  +   D+  + +
Sbjct: 409 LFSFLAYLNCSKSASVVFNWLSNIATISGFVSWIFVSMTYIRFRKVINALDLNDR--VPF 466

Query: 462 TAAFQPWSTYVALFFCCLIGLIKNYTVFLGHKFDYKTFISGYIGIPVYLICYV 514
              FQ    Y+   F  ++ L   Y VF+   ++   F + Y+ I   +  Y+
Sbjct: 467 RRPFQVPLAYLTCGFFFILSLTNGYAVFVKGNWNVSDFFASYVTIGFVIFLYL 519

>Skud_7.525 Chr7 (856072..857883) [1812 bp, 603 aa] {ON} YGR191W
           (REAL)
          Length = 603

 Score =  249 bits (635), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 152/498 (30%), Positives = 246/498 (49%), Gaps = 14/498 (2%)

Query: 49  RLKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILISYSFVGLLVYTVMSCLGE 108
            L K+L  RH+                         P S++I +  +G  ++TV++ LGE
Sbjct: 85  NLNKDLSVRHLLTLAVGGAIGTGLYVNTGTALSTGGPASLVIDWVIIGTCLFTVINSLGE 144

Query: 109 MAAFIPL-DGFTSYASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVN 167
           ++A  P+  GF  Y  R+V+P+  FAV  +YL ++ ++ P +L A ++ +++W   D++N
Sbjct: 145 LSAAFPVVGGFNVYGMRFVEPSFAFAVNLNYLAQWLVLLPLELVAASITIKYW--NDKIN 202

Query: 168 PGVWITIFLALIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTG 227
              W+ IF A I L N + V+ FGE EF LS +K                   P+    G
Sbjct: 203 SDAWVAIFYATIALANMLDVKSFGETEFVLSMIKILSIIGFSILGIVLSCGGGPHGGYIG 262

Query: 228 FRFWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPR 287
            ++WR+PGAF  ++   SG+K K              Y+G E+  + AAE+KNPR ++P+
Sbjct: 263 GKYWRNPGAFVGHN---SGTKFKGLCSVFVTAAFS--YSGIEMTAVSAAESKNPRETIPK 317

Query: 288 AIKLTLYRIVVFYVITILLLGMTVAYNDPRLLXXXXXXXXXXXXPFVVAIENASIPVLPH 347
           A K T + I   YV  + L+G  V  NDPRLL            P V+AIEN  I  LP 
Sbjct: 318 AAKRTFWLITASYVTILTLIGCLVPSNDPRLLNGSSSVDAASS-PLVIAIENGRIKGLPS 376

Query: 348 IFNVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCLL 407
           + N  +L+ V S  NS +Y  SR +  +A  G  P+     +K G P  ++ L++ F LL
Sbjct: 377 LMNAIILIAVVSVANSAVYACSRCMVAMAHIGNLPKFLNRVDKRGRPMNAILLTLFFGLL 436

Query: 408 AYMNVSSGSAQVFNYFVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSL---SYTAA 464
           +++  S+  A+VF +   +  +  +  W+ I +++IRF KA++VQ      L   S T  
Sbjct: 437 SFVAASNKEAEVFTWLSALSGLSTIFCWMAINLSHIRFRKAMKVQERSLDELPFISQTGV 496

Query: 465 FQPWSTYVALFFCCLIGLIKNYTVFLGHKFDYKTFISGYIGIPVYLICYVGYKVVYR--T 522
              W  +V LF   +     +           ++F  GY+  P+ ++CY G+K+  R  T
Sbjct: 497 LGSWYGFVVLFLVLIASFWTSLFPIGSSGASAESFFEGYLSFPILIVCYFGHKIYTRNWT 556

Query: 523 KLIKPEDVDLYTFKDAID 540
            ++K ED+DL T +  +D
Sbjct: 557 LMVKIEDIDLDTGRKQVD 574

>Kwal_8.590 s8 complement(17220..19109) [1890 bp, 629 aa] {ON}
           YOR348C (PUT4) - putative proline-specific permease
           [contig 311] FULL
          Length = 629

 Score =  249 bits (636), Expect = 5e-74,   Method: Compositional matrix adjust.
 Identities = 159/529 (30%), Positives = 263/529 (49%), Gaps = 17/529 (3%)

Query: 18  NETLEEGIVTLESEGQVRSVSEGV-----DGKHEGIRL-----KKELEARHVSMXXXXXX 67
            E  E  + +LE EG+  ++ + V       K + + L     +++L  R VSM      
Sbjct: 76  KEAFELNVTSLE-EGETATIDDFVLQNRDSPKSQSLSLEERIARRKLLPRQVSMIGIGGA 134

Query: 68  XXXXXXXXXXXXXXXXXPVSILISYSFVGLLVYTVMSCLGEMAAFIPLDG-FTSYASRYV 126
                            P S+LI++    ++   +  C+  M  ++P+ G F  +  R+V
Sbjct: 135 IGTALFVSIGTKIIQGGPGSLLIAFCLWSVVFIGLSKCMCVMVTYLPVTGSFVHFTERFV 194

Query: 127 DPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVNPGVWITIFLALIVLINTVG 186
           D + GFAVG++Y          ++TA  +V+++W   D++     I++ + L   +N   
Sbjct: 195 DQSCGFAVGWTYFVCQAANVCFEITAVCLVVEYWT--DKIPKAALISMLIILFGSLNLYS 252

Query: 187 VRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGFRFWRDPGAFKPYSEAISG 246
           V FFGE EF+LS  K                   P H   GF+ W +PGAF  Y     G
Sbjct: 253 VFFFGEGEFYLSIGKVVLAIGLIIFTVVVMAGGNPQHTVLGFKNWSNPGAFAEYIS--DG 310

Query: 247 SKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVVFYVITILL 306
           S G+              + G +  G  A+EA NPR+ +P + +    R+++FY+   + 
Sbjct: 311 SVGRFHGFMSCLVFALYVFWGVDYLGNAASEAMNPRKVIPSSFRKVFGRLIIFYIGGAIC 370

Query: 307 LGMTVAYNDPRLLXXXXXXXXXX-XXPFVVAIENASIPVLPHIFNVCVLVFVFSACNSDL 365
           +G+ + YNDP ++             P+V A++   I VLPHI N+ +L  + SA NS L
Sbjct: 371 VGILIPYNDPNMIRAIKEGAVGAGASPYVSAMKTLGIRVLPHIVNILILTSIISAGNSSL 430

Query: 366 YVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCLLAYMNVSSGSAQVFNYFVN 425
           Y ASR L+ LA+D +APRIF  T K GVP Y     ++ C LAY++VS+ +  V  +F+N
Sbjct: 431 YSASRVLHRLALDNQAPRIFKVTTKKGVPVYCCIAVLVICGLAYLSVSNSTNNVLTWFLN 490

Query: 426 VVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLSYTAAFQPWSTYVALFFCCLIGLIKN 485
           V +    + +I I ++Y++F K    Q  D  SL Y ++  P+  + +LF+  L+ L+  
Sbjct: 491 VETAAMAIVYIFICVSYLQFRKGCLAQNVDLKSLPYYSSSLPYLAWHSLFWLVLMLLVNG 550

Query: 486 YTVFLGHKFDYKTFISGYIGIPVYLICYVGYKVVYRTKLIKPEDVDLYT 534
           YTVFL   +D ++F+  Y  IP +L+   G+K+   TK ++P ++DL+T
Sbjct: 551 YTVFLKGSWDTQSFVFSYFMIPFFLVFLFGHKLYKGTKSVRPLEMDLFT 599

>TDEL0D00200 Chr4 (32432..34135) [1704 bp, 567 aa] {ON} 
          Length = 567

 Score =  247 bits (631), Expect = 8e-74,   Method: Compositional matrix adjust.
 Identities = 160/511 (31%), Positives = 256/511 (50%), Gaps = 25/511 (4%)

Query: 18  NETLEEGIVTLESEGQVRSVSEGVDGKHEGIRLKKELEARHVSMXXXXXXXXXXXXXXXX 77
           NE ++E   ++ SE +V+  +E V G          L++RH+ +                
Sbjct: 30  NEVIDEEQGSI-SELEVKPQNEMVRG----------LKSRHIQLIALGDAIGTGLFIGSG 78

Query: 78  XXXXXXXPVSILISYSFVGLLVYTVMSCLGEMAAFIPLDG---FTSYASRYVDPAVGFAV 134
                  P  ILISY  +   V+T+++ L EM A IPL G     S A  YV   + F  
Sbjct: 79  GALSTCGPAPILISYIVMSFFVWTIVNQLTEMVALIPLPGEASMYSLARMYVGRPLAFMC 138

Query: 135 GYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVNPGVWITIFLALIVLINTVGVRFFGEFE 194
           G++  +   ++ P+++TA AM++Q+W      N  ++I+IF+   V I  + VR FGE E
Sbjct: 139 GWNLFYAMAMIAPSEITACAMLIQYWTD---ANSAIFISIFIVFSVAITMLPVRVFGESE 195

Query: 195 FWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRT-GFRFWRDPGAFKPYSEAISGSKGKXXX 253
           F +SS+K                   P+ D   GF +W+ PGAFK +   + GS GK   
Sbjct: 196 FCVSSIKLLTIVGLIIVGIVIFFGGGPSQDHILGFHYWKKPGAFKEH--LVPGSTGKFLA 253

Query: 254 XXXXXXXXXXXYTGT-ELCGIVAAEAKNPRRSVPRAIKLTLYRIVVFYVITILLLGMTVA 312
                      +    E     +AE+ +PRR++PRA +  +YR+ +FYV  +L++ + V 
Sbjct: 254 VWTAIIKSGFSFVLVPETVASCSAESASPRRNMPRACQRFVYRLALFYVAGVLVVTVVVG 313

Query: 313 YNDPRLLXXXXX-XXXXXXXPFVVAIENASIPVLPHIFNVCVLVFVFSACNSDLYVASRS 371
            +D  LL             P+V+ I+ A I VLPHI N C+L   +S   ++LY  SR 
Sbjct: 314 SDDANLLNAIHSGASNAAASPYVIGIKEAGIKVLPHIINACILTSAYSCGTAELYGCSRI 373

Query: 372 LYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCLLAYMNVSSGSAQVFNYFVNVVSIFG 431
           L+ +A+ G AP+IFA  N++GVPYYS  ++ LF LLAY+N S  S+ VFN+  N+ +I G
Sbjct: 374 LHSMAMKGDAPQIFAKVNRFGVPYYSTAVACLFTLLAYLNCSKSSSLVFNWLSNIATISG 433

Query: 432 LLSWITILITYIRFDKAI-RVQFGDKSSLSYTAAFQPWSTYVALFFCCLIGLIKNYTVFL 490
            +SW+ + +TY RF   I ++   D+  + +   FQ    Y  + F  L+ L   Y VF+
Sbjct: 434 FISWVFVSVTYTRFRTVIDKLDLNDR--IPFRRRFQKGFAYACIAFFVLLSLTNGYAVFI 491

Query: 491 GHKFDYKTFISGYIGIPVYLICYVGYKVVYR 521
              ++   F + Y+ I    + ++G  + Y+
Sbjct: 492 KGNWNTSDFFASYVTIGFVAVLFIGSTIYYK 522

>KLTH0A00308g Chr1 (23428..25053) [1626 bp, 541 aa] {ON} weakly
           similar to uniprot|P53388 Saccharomyces cerevisiae
           YPL265W Dicarboxylic amino acid permease, mediates
           high-affinity and high-capacity transport of L-
           glutamate and L-aspartate
          Length = 541

 Score =  246 bits (628), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 156/491 (31%), Positives = 250/491 (50%), Gaps = 13/491 (2%)

Query: 49  RLKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILISYSFVGLLVYTVMSCLGE 108
           RLK+ L+ RH+ M                       P  + ++Y  VG++V      + E
Sbjct: 49  RLKQGLKERHIKMLTLVGVFGTGLFLSSGGTLKKAGPAGMFLAYVVVGIVVGCNQIAIAE 108

Query: 109 MAAFIPLDGFT-SYASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVN 167
           +A+F+P  G T  +A +++D +VGF  G+  +  Y  + P +L+A A+VM++W     +N
Sbjct: 109 VASFMPATGATIRHAEQFIDESVGFTFGW--ISTYSSLMPGELSATAVVMRYWTD---IN 163

Query: 168 PGVWITIFLALIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTG 227
           P VWITIF  L VL N   +RF+GE E++   +K                      +R G
Sbjct: 164 PAVWITIFGILFVLTNIYTIRFYGEVEYFFGWMKIILIIILIVTGLVIDLGGA-KQERLG 222

Query: 228 FRFWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPR 287
           F +WR+PG F  Y   + G  GK              Y+G +   I+A E KN R ++  
Sbjct: 223 FHYWREPGPFAEY--IVKGEIGKFVGFWAALSSVVYSYSGIQNIAILAGETKNSRHAIFH 280

Query: 288 AIKLTLYRIVVFYVITILLLGMTVAYNDPRLLXXXXXXXXXXXXPFVVAIENASIPVLPH 347
             +    RI+V Y+I +L+L + V YND  +             P+V+AI+ A+I +LPH
Sbjct: 281 GARNVFLRIIVLYLIAVLVLTLIVPYNDKLI---ATGTGTAKSSPYVIAIQRANIKILPH 337

Query: 348 IFNVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCLL 407
           I N  +L   +SA N  +   SR+L+ LA   +AP+IF TTNK G+PY  +     F  L
Sbjct: 338 IINAIILTSAWSAGNLAIVEGSRNLFALASKNQAPKIFLTTNKRGIPYVGIAFISAFLPL 397

Query: 408 AYMNVSSGSAQVFNYFVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLSYTAAFQP 467
           +YM+VSS SA VF++F  +VS   LL WI I   +I  D+A++ Q   +S L ++    P
Sbjct: 398 SYMSVSSSSANVFSWFQELVSSNTLLRWILISANHIHMDRALKAQGYSRSDLPHSTCLGP 457

Query: 468 WSTYVALFFCCLIGLIKNYTVFLGHKFDYKTFISGYIGIPVYLICYVGYKVVYRTKLIKP 527
           ++ + +     +  L   +  F+   FD ++F + Y  IP+ +I +  +K+  +TK ++P
Sbjct: 458 FAAWFSGIMSLIFLLTGGFYNFIHGHFDIESFFTRYFIIPLAIILFTFWKLFKKTKYLRP 517

Query: 528 EDVDLYT-FKD 537
            +VDL + F+D
Sbjct: 518 AEVDLESIFED 528

>ZYRO0C18502g Chr3 complement(1448075..1449802) [1728 bp, 575 aa]
           {ON} similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348C PUT4 proline-specific permease (also capable of
           transporting alanine and glycine) putative proline-
           specific permease
          Length = 575

 Score =  247 bits (630), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 149/515 (28%), Positives = 257/515 (49%), Gaps = 18/515 (3%)

Query: 17  SNETLEEGIVT---LESEGQVRSVSEGVDGKHEGIRLKKELEARHVSMXXXXXXXXXXXX 73
           S+  ++E  VT    E + +  S+   +D K    ++++ L++RH+ +            
Sbjct: 24  SDMKVKENFVTESIQEDDLERGSIDVLIDEKPSH-QMQRGLKSRHMQLIALGCAIGTGLF 82

Query: 74  XXXXXXXXXXXPVSILISYSFVGLLVYTVMSCLGEMAAFIPLDGFTSY---ASRYVDPAV 130
                      P  +LISY  +   V+T+M  L EM    P+ G  S    A  Y++  +
Sbjct: 83  IGTGGALSTCGPAPLLISYIIMSFFVWTIMHQLTEMVVLTPIPGEASMYALARAYLNRPL 142

Query: 131 GFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVNPGVWITIFLALIVLINTVGVRFF 190
            F  G++  +   ++ P+++TA  +++Q+W      N  ++++IF+ + + +  + V+ F
Sbjct: 143 SFMCGWNLFYAQAMIAPSEITASTLLIQYWTD---ANSAIFVSIFIVITIAVTALPVKVF 199

Query: 191 GEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPN-HDRTGFRFWRDPGAFKPYSEAISGSKG 249
           GE EFW+S +K                   PN H   GF +W+ PGAFKP+    +G+ G
Sbjct: 200 GESEFWVSMIKLITITGLIILGVVIFFGGGPNQHHVLGFHYWKHPGAFKPHIS--TGNTG 257

Query: 250 KXXXXXXXXXXXXXXYT-GTELCGIVAAEAKNPRRSVPRAIKLTLYRIVVFYVITILLLG 308
           K              +    E     +AEA  PRR++PRA    ++R+++FY+   L++G
Sbjct: 258 KFLAVWTAIIKSGFAFILSPETLTSCSAEADRPRRNMPRAANRFVWRLMLFYIGGALVVG 317

Query: 309 MTVAYNDPRLLXXXXX-XXXXXXXPFVVAIENASIPVLPHIFNVCVLVFVFSACNSDLYV 367
           +TV Y++  LL             PFV+ I+   I VLPHI N  +L   +SA  +++Y 
Sbjct: 318 VTVGYDNQNLLSAIASGQSNAAASPFVIGIKEVGIKVLPHIINAAILTGAYSAGTAEMYG 377

Query: 368 ASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCLLAYMNVSSGSAQVFNYFVNVV 427
           ASR L+ +A+ G AP+IFA  N++GVPYYS+ +   FC LAY+N S+ ++QVF +  N+ 
Sbjct: 378 ASRMLHSMALKGNAPKIFARVNRYGVPYYSIIVPSCFCFLAYLNCSNSASQVFTWLTNIS 437

Query: 428 SIFGLLSWITILITYIRFDKAIR-VQFGDKSSLSYTAAFQPWSTYVALFFCCLIGLIKNY 486
           +I G +SW+ + ITY+RF + I  +   D+  + +   FQ    Y +  F  ++ L   Y
Sbjct: 438 TISGFISWVFVSITYVRFRRVIDYLDLNDR--IKFRKPFQRIFAYFSGCFFVILSLTNGY 495

Query: 487 TVFLGHKFDYKTFISGYIGIPVYLICYVGYKVVYR 521
            VF    +    F + YI I   ++ ++     Y+
Sbjct: 496 AVFTKGNWSVSDFFANYITIGFVVVLFIMGTAYYK 530

>Kwal_23.2817 s23 complement(26637..28379) [1743 bp, 580 aa] {ON}
           YOR348C (PUT4) - putative proline-specific permease
           [contig 246] FULL
          Length = 580

 Score =  247 bits (630), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 155/535 (28%), Positives = 258/535 (48%), Gaps = 18/535 (3%)

Query: 3   SDTSMEKKNAGVLYSNETLEEGIVTLESEGQVRSVSEGVDGKHEGIRLKKELEARHVSMX 62
           +D S+  ++    +S    ++ I+T   +   R     +D       + + L++RHV   
Sbjct: 21  TDASLTSRD----HSTNQKKDAIITAVEQDIERGSLSDIDTIKPSTEVSRGLKSRHVQFI 76

Query: 63  XXXXXXXXXXXXXXXXXXXXXXPVSILISYSFVGLLVYTVMSCLGEMAAFIPLDGFTSYA 122
                                 P  +LISYS +   V+ +M+ + EM   IPL G +S A
Sbjct: 77  ALGGAIGTGLFIGSGTALSSCGPAPLLISYSVMSFFVWAIMNQMTEMVVLIPLSGESSMA 136

Query: 123 S---RYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVNPGVWITIFLALI 179
           S    Y++    F  G++  +   +V P ++TA A+++++W      N  +++TIF+ L 
Sbjct: 137 SLAGTYLNRPSSFMCGWNCFYAMSMVVPTEITACALLIEYWTD---ANAAIFVTIFMILA 193

Query: 180 VLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXP-NHDRTGFRFWRDPGAFK 238
            L++ + V+ FGE EF +S +K                   P  H   GF +W  PGAF 
Sbjct: 194 TLLSLLPVKIFGESEFCVSIIKILTILGLILVGVVIFFGGGPAQHKVLGFHYWNTPGAFN 253

Query: 239 PYSEAISGSKGKXXXXXXXXXXXXXXYTGT-ELCGIVAAEAKNPRRSVPRAIKLTLYRIV 297
            Y   + GS G               +    E+    +AEA  PR+++PRA +  +YR+ 
Sbjct: 254 SY--LVKGSTGAFLAVWKAIIKSGFAFVMIPEITSSCSAEAAFPRKNMPRACQRFVYRLA 311

Query: 298 VFYVITILLLGMTVAYNDPRL-LXXXXXXXXXXXXPFVVAIENASIPVLPHIFNVCVLVF 356
           VFYV+  L++G+ V Y++  L              PFV+ I+ A I +LPHI N C+L  
Sbjct: 312 VFYVLGCLVIGVIVGYDNKTLNEAISSGKANAAASPFVIGIQEAGIRILPHIINACILTS 371

Query: 357 VFSACNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCLLAYMNVSSGS 416
            +S   S+LY ASR L+ LA+ G AP+ F+  NK+GVPYYS+  + LF +LAY+N S  S
Sbjct: 372 AYSCSTSELYGASRVLHSLALRGDAPKFFSKVNKYGVPYYSVAATSLFGVLAYLNCSKSS 431

Query: 417 AQVFNYFVNVVSIFGLLSWITILITYIRFDKAIR-VQFGDKSSLSYTAAFQPWSTYVALF 475
             VFN+  N+ +I G ++W+ + ITY+RF K    ++  D+  + Y    Q    Y +  
Sbjct: 432 LVVFNWLSNIATISGFVNWVFVSITYLRFRKITDYLKINDR--VPYRRRGQRALAYASAI 489

Query: 476 FCCLIGLIKNYTVFLGHKFDYKTFISGYIGIPVYLICYVGYKVVYRTKLIKPEDV 530
           F  L+ +   + VF+   ++   F + Y+ I    + ++G  + Y+    +  DV
Sbjct: 490 FFALLAITNGFYVFIAGNWNVSDFFTCYVTIGFVGVLFIGSSIYYKEWTFRDMDV 544

>YGR191W Chr7 (880420..882231) [1812 bp, 603 aa] {ON}
           HIP1High-affinity histidine permease, also involved in
           the transport of manganese ions
          Length = 603

 Score =  248 bits (632), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 153/508 (30%), Positives = 250/508 (49%), Gaps = 17/508 (3%)

Query: 42  DGKHEGIR---LKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILISYSFVGLL 98
           D + E I    L K+L  RH+                         P S++I +  +   
Sbjct: 75  DTEQEDINNTNLSKDLSVRHLLTLAVGGAIGTGLYVNTGAALSTGGPASLVIDWVIISTC 134

Query: 99  VYTVMSCLGEMAAFIPL-DGFTSYASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVM 157
           ++TV++ LGE++A  P+  GF  Y+ R+++P+  FAV  +YL ++ ++ P +L A ++ +
Sbjct: 135 LFTVINSLGELSAAFPVVGGFNVYSMRFIEPSFAFAVNLNYLAQWLVLLPLELVAASITI 194

Query: 158 QFWVSRDRVNPGVWITIFLALIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXX 217
           ++W   D++N   W+ IF A I L N + V+ FGE EF LS +K                
Sbjct: 195 KYW--NDKINSDAWVAIFYATIALANMLDVKSFGETEFVLSMIKILSIIGFTILGIVLSC 252

Query: 218 XXXPNHDRTGFRFWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAE 277
              P+    G ++W DPGAF  +S   SG++ K              Y+G E+  + AAE
Sbjct: 253 GGGPHGGYIGGKYWHDPGAFVGHS---SGTQFKGLCSVFVTAAFS--YSGIEMTAVSAAE 307

Query: 278 AKNPRRSVPRAIKLTLYRIVVFYVITILLLGMTVAYNDPRLLXXXXXXXXXXXXPFVVAI 337
           +KNPR ++P+A K T + I   YV  + L+G  V  NDPRLL            P V+AI
Sbjct: 308 SKNPRETIPKAAKRTFWLITASYVTILTLIGCLVPSNDPRLLNGSSSVDAASS-PLVIAI 366

Query: 338 ENASIPVLPHIFNVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYS 397
           EN  I  LP + N  +L+ V S  NS +Y  SR +  +A  G  P+     +K G P  +
Sbjct: 367 ENGGIKGLPSLMNAIILIAVVSVANSAVYACSRCMVAMAHIGNLPKFLNRVDKRGRPMNA 426

Query: 398 LGLSVLFCLLAYMNVSSGSAQVFNYFVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKS 457
           + L++ F LL+++  S   A+VF +   +  +  +  W+ I +++IRF +A++VQ     
Sbjct: 427 ILLTLFFGLLSFVAASDKQAEVFTWLSALSGLSTIFCWMAINLSHIRFRQAMKVQERSLD 486

Query: 458 SL---SYTAAFQPWSTYVALFFCCLIGLIKNYTVFLGHKFDYKTFISGYIGIPVYLICYV 514
            L   S T     W  ++ LF   +     +     G     ++F  GY+  P+ ++CYV
Sbjct: 487 ELPFISQTGVKGSWYGFIVLFLVLIASFWTSLFPLGGSGASAESFFEGYLSFPILIVCYV 546

Query: 515 GYKVVYR--TKLIKPEDVDLYTFKDAID 540
           G+K+  R  T ++K ED+DL T +  +D
Sbjct: 547 GHKLYTRNWTLMVKLEDMDLDTGRKQVD 574

>Smik_16.115 Chr16 complement(214120..215931) [1812 bp, 603 aa] {ON}
           YGR191W (REAL)
          Length = 603

 Score =  247 bits (631), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 152/510 (29%), Positives = 251/510 (49%), Gaps = 15/510 (2%)

Query: 38  SEGVDGKH-EGIRLKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILISYSFVG 96
           SEG++ +      L K+L  RH+                         P S++I +  + 
Sbjct: 73  SEGIEQEDINNTNLSKDLSVRHLLTLAVGGAIGTGLYVNTGAALSTGGPASLVIDWVIIS 132

Query: 97  LLVYTVMSCLGEMAAFIPL-DGFTSYASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAM 155
             ++TV++ LGE++A  P+  GF  Y+ R+V+P+  FAV  +YL ++ ++ P +L A ++
Sbjct: 133 TCLFTVINSLGELSAAFPVVGGFNVYSMRFVEPSFAFAVNLNYLAQWLVLLPLELVAASI 192

Query: 156 VMQFWVSRDRVNPGVWITIFLALIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXX 215
            +++W   D++N   W+ IF A I L N + V+ FGE EF LS +K              
Sbjct: 193 TIKYW--NDKINSDAWVAIFYATIALANMLDVKSFGETEFVLSMIKILSIIGFTILGIVL 250

Query: 216 XXXXXPNHDRTGFRFWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVA 275
                P+    G ++W DPGAF  +S   SG++ K              Y+G E+  + A
Sbjct: 251 SCGGGPHGGYIGGKYWHDPGAFVGHS---SGTQFKGLCSVFVTAAFS--YSGIEMTAVSA 305

Query: 276 AEAKNPRRSVPRAIKLTLYRIVVFYVITILLLGMTVAYNDPRLLXXXXXXXXXXXXPFVV 335
           AE+KNPR ++P+A K T + I   YV  + L+G  V  NDPRLL            P V+
Sbjct: 306 AESKNPRETIPKAAKRTFWLITASYVAILTLIGCLVPSNDPRLLNGSSSVDAASS-PLVI 364

Query: 336 AIENASIPVLPHIFNVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPY 395
           AIEN  I  LP + N  +L+ V S  NS +Y  SR +  +A  G  P+     +K G P 
Sbjct: 365 AIENGGIKGLPSLMNAIILIAVVSVANSAVYACSRCMVAMAHIGNLPKFLNRVDKRGRPM 424

Query: 396 YSLGLSVLFCLLAYMNVSSGSAQVFNYFVNVVSIFGLLSWITILITYIRFDKAIRVQFGD 455
            ++ L++ F LL+++  S   A+VF +   +  +  +  W+ I +++IRF +A++VQ   
Sbjct: 425 NAILLTLFFGLLSFVAASDKQAEVFTWLSALSGLSTIFCWMAINLSHIRFRQAMKVQERS 484

Query: 456 KSSL---SYTAAFQPWSTYVALFFCCLIGLIKNYTVFLGHKFDYKTFISGYIGIPVYLIC 512
              L   S T     W  ++ LF   +     +         + ++F  GY+  P+ ++C
Sbjct: 485 LDELPFISQTGVKGSWYGFIVLFLVLIASFWTSLFPLGSSGANAESFFEGYLSFPILIVC 544

Query: 513 YVGYKVVYR--TKLIKPEDVDLYTFKDAID 540
           Y G+K+  R  T ++K ED+DL T +  +D
Sbjct: 545 YFGHKIYTRNWTLMVKLEDIDLDTGRKQVD 574

>Suva_7.485 Chr7 (836820..838631) [1812 bp, 603 aa] {ON} YGR191W
           (REAL)
          Length = 603

 Score =  243 bits (619), Expect = 7e-72,   Method: Compositional matrix adjust.
 Identities = 155/538 (28%), Positives = 259/538 (48%), Gaps = 21/538 (3%)

Query: 9   KKNAGVLYSNETLEEGIVTLESEGQVRSVSEGVDGKHEGIRLKKELEARHVSMXXXXXXX 68
           K ++GV   N+T  +    + S G+  S  +          L KEL  RH+         
Sbjct: 52  KGSSGV---NQTTND----ITSSGRFHSDDDVQQEDINNTNLSKELSVRHLLTLAVGGAI 104

Query: 69  XXXXXXXXXXXXXXXXPVSILISYSFVGLLVYTVMSCLGEMAAFIPL-DGFTSYASRYVD 127
                           P S++I +  +   ++TV++ LGE++A  P+  GF  Y+ R+V+
Sbjct: 105 GTGLFVNTGAALSTGGPASLVIDWVIISTCLFTVINSLGELSAAFPVVGGFNVYSMRFVE 164

Query: 128 PAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVNPGVWITIFLALIVLINTVGV 187
           P+  FAV  +YL ++ ++ P +L A ++ +++W   D++N   W+ IF A I + N + V
Sbjct: 165 PSFAFAVNLNYLAQWLVLLPLELVAASITIKYW--NDKINSDAWVAIFYATIAMANMLDV 222

Query: 188 RFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGFRFWRDPGAFKPYSEAISGS 247
           + FGE EF LS +K                   P+    G ++W DPGAF  +    SG+
Sbjct: 223 KSFGETEFVLSMIKILAIIGFTILGIVLSCGGGPHGGYIGGKYWNDPGAFVGHD---SGT 279

Query: 248 KGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVVFYVITILLL 307
           K K              Y+G E+  + AAE+KNPR ++P+A K T + I + YV  + L+
Sbjct: 280 KFKGLCSVFVTAAFS--YSGIEMTAVSAAESKNPRETIPKAAKRTFWLITISYVTILTLI 337

Query: 308 GMTVAYNDPRLLXXXXXXXXXXXXPFVVAIENASIPVLPHIFNVCVLVFVFSACNSDLYV 367
           G  V  NDPRLL            P V+AIEN  I  LP + N  +L+ V S  NS +Y 
Sbjct: 338 GCLVPSNDPRLLNGSSSVDAASS-PLVIAIENGRIKGLPSLMNAIILIAVVSVANSAVYA 396

Query: 368 ASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCLLAYMNVSSGSAQVFNYFVNVV 427
            SR +  +A  G  P+     +K G P  ++ L++ F LL+++  S   A+VF +   + 
Sbjct: 397 CSRCMVAMAHIGNLPKFLRRVDKRGRPINAIVLTLFFGLLSFVAASDKQAEVFTWLSALS 456

Query: 428 SIFGLLSWITILITYIRFDKAIRVQFGDKSSLSYTAAFQPWST---YVALFFCCLIGLIK 484
            +  +  W+ I +++IRF +A++ Q      L + +    W +   +V LF   +     
Sbjct: 457 GLSTIFCWMAINLSHIRFRQAMKFQERSLDELPFISQTGVWGSIYGFVVLFLVLIASFWT 516

Query: 485 NYTVFLGHKFDYKTFISGYIGIPVYLICYVGYKVVYRT--KLIKPEDVDLYTFKDAID 540
           +         + ++F  GY+  P+ ++CY G+K+  R    L+K ED+DL T +  +D
Sbjct: 517 SMFPIGSSGANAESFFEGYLSFPILIVCYFGHKIYTRDWRLLVKLEDMDLDTGRKQVD 574

>ZYRO0D03762g Chr4 complement(304207..306009) [1803 bp, 600 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 600

 Score =  241 bits (616), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 150/496 (30%), Positives = 245/496 (49%), Gaps = 13/496 (2%)

Query: 50  LKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILISYSFVGLLVYTVMSCLGEM 109
           L+ +L+ RH+ M                       P  ILI +   G ++Y ++  + E+
Sbjct: 84  LQHQLKNRHLQMISIGGAIGTGLFVGSGTALRTAGPAGILIGWIIAGSMIYCMVMSVAEL 143

Query: 110 AAFIPL-DGFTSYASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVNP 168
           A   P+  GFT+YA+R++D + GFA  ++Y+ ++ +  P ++ A ++ + +W +  +   
Sbjct: 144 AIAFPVAGGFTTYATRFIDESYGFANNFNYMLQWIVTLPLEIVAASITVNYWHTDKKYRD 203

Query: 169 GVWITIFLALIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGF 228
           G ++ +F  +IV+IN  GVR +GE EF  S  K                   P     G 
Sbjct: 204 G-FVALFWVVIVIINMFGVRGYGEAEFIFSICKILMIVGFIILAIILICGGGPGTGYIGA 262

Query: 229 RFWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPRA 288
           R+W  PGAF     A   S  K              + G+EL G+ AAEA NPR+ VP A
Sbjct: 263 RYWYHPGAF-----AGDTSGRKFKGFCSVFVTAAFSFAGSELVGLAAAEASNPRKDVPGA 317

Query: 289 IKLTLYRIVVFYVITILLLGMTVAYNDPRLLXXXXXXXXXXXXPFVVAIENASIPVLPHI 348
            K   +RI +FYV+ +LL+GM V Y DPRL+            PFV+AI+N  I  LP +
Sbjct: 318 AKQVFWRITMFYVLCLLLIGMLVPYTDPRLIGGSSVDAAAS--PFVIAIKNQGISGLPTL 375

Query: 349 FNVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCLLA 408
            NV +L+ V S  NS +Y  SR+L  LA  G  P+ F+  ++ G P   + ++  F L+A
Sbjct: 376 VNVVILIAVLSVGNSAVYACSRTLSALADQGFLPKCFSYIDRMGRPMVGIAVTSAFGLIA 435

Query: 409 YMNVSSGSAQVFNYFVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLSYTAAFQPW 468
           ++  S    +VF++ + +  +  L +W TI + +IRF +A+  Q    + L++ +    W
Sbjct: 436 FVAQSDKEGEVFDWLMALSGLSSLFTWATICLCHIRFRRALAAQGRSTNELAFASPAGVW 495

Query: 469 STYVALFFCCLIGLIKNYTVF--LGHKFDYKTFISGYIGIPVYLICYVGYKVVYRT-KL- 524
                LF C ++   + Y     LG       F  GY+ +P+ L  ++G+K+  +  KL 
Sbjct: 496 GAAWGLFLCIIMLAAQFYVALFPLGAPPSANDFFQGYLSLPIVLAMWLGHKIWKKNWKLF 555

Query: 525 IKPEDVDLYTFKDAID 540
           IK ED+D+ T +  +D
Sbjct: 556 IKAEDMDIDTGRRELD 571

>NDAI0F04390 Chr6 (1073373..1075376) [2004 bp, 667 aa] {ON} Anc_1.50
          Length = 667

 Score =  242 bits (617), Expect = 7e-71,   Method: Compositional matrix adjust.
 Identities = 158/547 (28%), Positives = 263/547 (48%), Gaps = 24/547 (4%)

Query: 5   TSMEKKNAGVLYSNETLEEGIVTLES-EGQVRSVSEGVDGKHEGIRLKKELEARHVSMXX 63
            S EK  A +  +   ++E I++L + +GQ       ++ K +   LKK ++ RHV M  
Sbjct: 105 NSPEKDTASITSNEMMIDEEILSLSNLDGQRVPPPRKIENKSD--ELKKTIKPRHVLMIS 162

Query: 64  XXXXXXXXXXXXXXXXXXXXXPVSILISYSFVGLLVYTVMSCLGEMA-AFIPL-DGFTSY 121
                                P  +L+ +  +G  +Y ++  +GEMA A+  L  GF +Y
Sbjct: 163 LGTGIGTGLLVGLGSSLVAAGPAGLLLGFGIMGTCLYCIIQAVGEMAVAYSDLVGGFNAY 222

Query: 122 ASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVNPGVWITIFLALIVL 181
            S  VDPA GF+V + Y  ++  V P +L   +M +++W ++  V+P V++ IF  LI+ 
Sbjct: 223 PSFLVDPAFGFSVAWVYALQWLCVCPLELVTASMTIKYWTTK--VDPDVFVIIFYVLILA 280

Query: 182 INTVG-VRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGFRFWRDPGAFKPY 240
           IN VG    + E EF  +S K                    N    G ++W +PGAF+  
Sbjct: 281 INIVGGAAGYAEAEFIFNSCKILMMIGFFILGIIIICGGAGNDGYIGGKYWHEPGAFRG- 339

Query: 241 SEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVVFY 300
             AI   KG               +  +E  G+ A+E  NPR+++P A K  LYRIV  +
Sbjct: 340 EHAIDRFKG----VMATLVNAAFAFGMSEFIGVTASEQSNPRKAIPSAAKKMLYRIVCMF 395

Query: 301 VITILLLGMTVAYNDPRLLXXXXXXXXXXXXPFVVAIENASIPVLPHIFNVCVLVFVFSA 360
           + +I ++G  V Y+  +LL            P+V+A+    + V+PH  N  +L+ V S 
Sbjct: 396 LASITIVGFLVPYDSDQLLGSSGGGVKAS--PYVLAVSTHGVKVVPHFINAVILISVLSV 453

Query: 361 CNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCLLAYMNVSSGSAQVF 420
            NS  Y +SR L  LA  G AP+IF   ++ G P   + ++ LF ++A+   S    +VF
Sbjct: 454 ANSAFYSSSRMLLSLAEQGYAPKIFCYIDREGRPLVGMAMASLFGVIAFCATSPKEDEVF 513

Query: 421 NYFVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLSYTAAFQPW-STYVALFFCCL 479
            + + +  +  L +WI I ++++RF +A+ VQ      L + +    W S+Y A+   C+
Sbjct: 514 VWLLAISGLSQLFTWIAICVSHVRFRRAMHVQGKSIGELGFRSQVGAWGSSYAAIMMVCI 573

Query: 480 IGLIKNYTVFLG----HKFDYKTFISGYIGIPVYLICYVGYKVVYR--TKLIKPEDVDLY 533
             LI  + V +      K D K F   Y+ +P+ L  Y GYK+  +  T  I+ +D+DL 
Sbjct: 574 --LIAQFWVAIAPIGEGKLDAKNFFENYLAMPILLALYFGYKIYTKNWTIFIRAKDIDLV 631

Query: 534 TFKDAID 540
           + ++  D
Sbjct: 632 SHRNIFD 638

>SAKL0G14014g Chr7 (1202476..1204293) [1818 bp, 605 aa] {ON} highly
           similar to uniprot|P06775 Saccharomyces cerevisiae
           YGR191W HIP1 High-affinity histidine permease also
           involved in the transport of manganese ions
          Length = 605

 Score =  239 bits (610), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 143/499 (28%), Positives = 248/499 (49%), Gaps = 16/499 (3%)

Query: 49  RLKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILISYSFVGLLVYTVMSCLGE 108
           +L K+L  RH+                         P S+++++  V   ++T+++ LGE
Sbjct: 87  KLNKDLSVRHLLTLAVGGAIGTGLFVNSGASLNTGGPASLIVAWVIVSTCLFTIVNALGE 146

Query: 109 MAAFIPL-DGFTSYASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVN 167
           +AA  P+  GF  Y +R+V+P+ GFAV  +YL ++ ++ P +L A ++ +++W   + +N
Sbjct: 147 LAAVFPVVGGFNVYITRFVEPSFGFAVNINYLAQWAVLLPLELVAASITIRYW--NNTIN 204

Query: 168 PGVWITIFLALIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTG 227
              W+ IF   I L N + V+ FGE EF LS +K                   P+ +  G
Sbjct: 205 SDAWVAIFYTAIFLANMLDVKSFGETEFVLSMIKILAIIGFTILGIVLACGGGPSGEYIG 264

Query: 228 FRFWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXX-XYTGTELCGIVAAEAKNPRRSVP 286
            R+W DPGAF      +  + G+               Y+GTEL  + AAE+ NPR ++P
Sbjct: 265 GRYWNDPGAF------VGDTPGRRFKGVCAVFVTAAFSYSGTELVAVSAAESHNPRVTLP 318

Query: 287 RAIKLTLYRIVVFYVITILLLGMTVAYNDPRLLXXXXXXXXXXXXPFVVAIENASIPVLP 346
           +A K T + I + Y+  + ++G  V YND RLL            P V+AIEN  I  LP
Sbjct: 319 KASKRTFWLITLCYITVLTIIGCLVPYNDERLLNGNSSVDAAAS-PLVIAIENGGIKGLP 377

Query: 347 HIFNVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCL 406
            + N  +L+ + S  NS +Y  SR +  +A  G  P+     +K G P Y++  +++F L
Sbjct: 378 SLMNAIILIAILSVANSAVYACSRCMVAMAEIGNLPKRLNYIDKRGRPLYAIFATLIFGL 437

Query: 407 LAYMNVSSGSAQVFNYFVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSL---SYTA 463
           L+++  S    +VF +   +  +  L  W +I +++IRF +A++ Q    + L   S T 
Sbjct: 438 LSFIAASDKQEEVFTWLSALSGLSTLFCWFSINLSHIRFRQAMKAQDRSLNELPFVSITG 497

Query: 464 AFQPWSTYVALFFCCLIGLIKNYTVFLGHKFDYKTFISGYIGIPVYLICYVGYKVVYRT- 522
            +  W   + +F   +     +         D ++F  GY+ +P++++CY+G+KV  +  
Sbjct: 498 VYGSWYGCIVIFLVLIASFWTSLFPVGSDGADAESFFEGYLSLPIFIVCYLGHKVYKKDW 557

Query: 523 KL-IKPEDVDLYTFKDAID 540
           +L +K +D+DL T +  ID
Sbjct: 558 RLYVKTKDMDLDTGRREID 576

>Skud_11.275 Chr11 (496787..498595) [1809 bp, 602 aa] {ON} YKR039W
           (REAL)
          Length = 602

 Score =  239 bits (609), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 147/496 (29%), Positives = 249/496 (50%), Gaps = 13/496 (2%)

Query: 50  LKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILISYSFVGLLVYTVMSCLGEM 109
           LK  L+ RH+ M                       P S+LI +   G ++Y+++  LGE+
Sbjct: 86  LKHHLKNRHLQMIAIGGAIGTGLLVGSGTALRTGGPASLLIGWGSTGTMIYSMVMALGEL 145

Query: 110 AAFIPLDG-FTSYASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVNP 168
           A   P+ G FT+YA+R++D + G+A  ++Y+ ++ +V P ++ + ++ + FW +  +   
Sbjct: 146 AVIFPISGGFTTYATRFIDESFGYANNFNYMLQWLVVLPLEIVSASITVNFWGTDPKYRD 205

Query: 169 GVWITIFLALIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGF 228
           G ++ +F  +IV+IN  GV+ +GE EF  S +K                   P     G 
Sbjct: 206 G-FVALFWLVIVIINMFGVKGYGEAEFVFSFIKVITVVGFIILGIILNCGGGPEGGYIGG 264

Query: 229 RFWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPRA 288
           ++W DPGAF     A      K              + G+EL G+ A+E+ +PR+SVP+A
Sbjct: 265 KYWHDPGAF-----AGDTPGAKFKGLCSVFVTSAFSFAGSELVGLAASESVDPRKSVPKA 319

Query: 289 IKLTLYRIVVFYVITILLLGMTVAYNDPRLLXXXXXXXXXXXXPFVVAIENASIPVLPHI 348
            K   +RI +FY++++L++G+ V YNDP L+            PFV+AI+   I  LP +
Sbjct: 320 AKQVFWRITLFYILSLLMVGLLVPYNDPNLIGASSVDAAAS--PFVIAIKTHGIKGLPTV 377

Query: 349 FNVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCLLA 408
            NV +L+ V S  NS +Y  SR++  LA     P+IFA  ++ G P   + ++  F L+A
Sbjct: 378 VNVVILIAVLSVGNSAIYACSRTMVALAEQRFLPQIFAYVDRKGRPLVGIAVTSAFGLIA 437

Query: 409 YMNVSSGSAQVFNYFVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLSYTAAFQPW 468
           ++  S     VFN+ + +  +  L +W  I I +IRF KA+  Q  D   LS+ +    W
Sbjct: 438 FVAASKKEGDVFNWLLALSGLSSLFTWGGICICHIRFRKALTAQGRDLDELSFKSPTGVW 497

Query: 469 STYVALFFCCLIGLIKNYTVF--LGHKFDYKTFISGYIGIPVYLICYVGYKVVYRT-KLI 525
            +Y  LF   ++ + + Y     +G     + F   Y+  P+ +  Y+G+K+  R  KL 
Sbjct: 498 GSYWGLFMVVIMFIAQFYVALFPVGASPSAEGFFEAYLSFPLVVAMYLGHKIYKRNWKLF 557

Query: 526 KP-EDVDLYTFKDAID 540
            P ED+D+ T +  +D
Sbjct: 558 IPAEDMDIDTGRREVD 573

>YCL025C Chr3 complement(76018..77919) [1902 bp, 633 aa] {ON}
           AGP1Low-affinity amino acid permease with broad
           substrate range, involved in uptake of asparagine,
           glutamine, and other amino acids; expression is
           regulated by the SPS plasma membrane amino acid sensor
           system (Ssy1p-Ptr3p-Ssy5p)
          Length = 633

 Score =  239 bits (610), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 151/520 (29%), Positives = 245/520 (47%), Gaps = 18/520 (3%)

Query: 29  ESEGQVRSVSEGVDGKHEGIRLKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSI 88
           E E    S + G +  H+   LKK ++ RHV M                       P  +
Sbjct: 95  ELEKNESSDNIGANTGHKSDSLKKTIQPRHVLMIALGTGIGTGLLVGNGTALVHAGPAGL 154

Query: 89  LISYSFVGLLVYTVMSCLGEMAAFIP--LDGFTSYASRYVDPAVGFAVGYSYLFKYFIVT 146
           LI Y+ +G ++Y ++   GEMA        G+ +Y S  VD   GFAV + Y  ++  V 
Sbjct: 155 LIGYAIMGSILYCIIQACGEMALVYSNLTGGYNAYPSFLVDDGFGFAVAWVYCLQWLCVC 214

Query: 147 PNQLTAGAMVMQFWVSRDRVNPGVWITIFLALIVLINTVGVRFFGEFEFWLSSVKXXXXX 206
           P +L   +M +++W +   VNP V++ IF  L++ IN  G R + E EF+ +  K     
Sbjct: 215 PLELVTASMTIKYWTTS--VNPDVFVIIFYVLVITINIFGARGYAEAEFFFNCCKILMMT 272

Query: 207 XXXXXXXXXXXXXXPNHDRTGFRFWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYT 266
                          N    G ++W DPGAF     AI   KG               + 
Sbjct: 273 GFFILGIIIDVGGAGNDGFIGGKYWHDPGAFNG-KHAIDRFKG----VAATLVTAAFAFG 327

Query: 267 GTELCGIVAAEAKNPRRSVPRAIKLTLYRIVVFYVITILLLGMTVAYNDPRLLXXXXXXX 326
           G+E   I  AE  NPR+++P A K  +YRI+  ++ TI+LLG  V YN  +LL       
Sbjct: 328 GSEFIAITTAEQSNPRKAIPGAAKQMIYRILFLFLATIILLGFLVPYNSDQLLGSTGGGT 387

Query: 327 XXXXXPFVVAIENASIPVLPHIFNVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPRIFA 386
                P+V+A+ +  + V+PH  N  +L+ V S  NS  Y ++R    L+  G AP++F+
Sbjct: 388 KAS--PYVIAVASHGVRVVPHFINAVILLSVLSMANSSFYSSARLFLTLSEQGYAPKVFS 445

Query: 387 TTNKWGVPYYSLGLSVLFCLLAYMNVSSGSAQVFNYFVNVVSIFGLLSWITILITYIRFD 446
             ++ G P  ++G+S LF ++A+   S    QVF + + +  +  L +W  I ++++RF 
Sbjct: 446 YIDRAGRPLIAMGVSALFAVIAFCAASPKEEQVFTWLLAISGLSQLFTWTAICLSHLRFR 505

Query: 447 KAIRVQFGDKSSLSYTAAFQPWSTYVALFFCCLIGLIKNYTVFLG----HKFDYKTFISG 502
           +A++VQ      L + +    W +  A     LI LI  + V +      K D + F   
Sbjct: 506 RAMKVQGRSLGELGFKSQTGVWGSAYACIMMILI-LIAQFWVAIAPIGEGKLDAQAFFEN 564

Query: 503 YIGIPVYLICYVGYKVVYRT-KL-IKPEDVDLYTFKDAID 540
           Y+ +P+ +  YVGYKV ++  KL I+ + +DL + +   D
Sbjct: 565 YLAMPILIALYVGYKVWHKDWKLFIRADKIDLDSHRQIFD 604

>NCAS0A07110 Chr1 (1408106..1409884) [1779 bp, 592 aa] {ON}
           Anc_5.158
          Length = 592

 Score =  237 bits (604), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 158/556 (28%), Positives = 261/556 (46%), Gaps = 28/556 (5%)

Query: 5   TSMEKKNAGVLYSNETLEEG------IVTLESEGQVRSVSEGVDG----KHE----GIRL 50
           T  +   AG + +N  LEE       + +L+S+     +    D      HE     + L
Sbjct: 16  TGSKSSEAGNIDANFALEEKDSTLSPLASLDSKVPHEKIQTTTDFASVISHEDDINNVNL 75

Query: 51  KKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILISYSFVGLLVYTVMSCLGEMA 110
            K L  RH+                         P S++I +  +   ++TV++ LGEMA
Sbjct: 76  NKNLSIRHLLTLAVGGSIGVGLFVNSGAALASGGPASLVIDWIIISTCLFTVINALGEMA 135

Query: 111 AFIPL-DGFTSYASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVNPG 169
           A  P+  GF  Y +R++DP+VGFAV  +YL ++ ++ P +L A +M +++W   + +N  
Sbjct: 136 AAFPVVGGFNVYITRFIDPSVGFAVNINYLAQWLVLLPLELVAASMTIKYW--NETINSD 193

Query: 170 VWITIFLALIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGFR 229
            W+ IF  +I L N + V+ FGE EF LS +K                   P+    G +
Sbjct: 194 AWVAIFYCVIALANMLEVKSFGETEFVLSMIKILAIIGFTILGIVLACGGGPHGGFIGGK 253

Query: 230 FWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPRAI 289
           +W  PG+F  ++   SG+K K              Y+G E+  + AAE+K+PR ++P+A 
Sbjct: 254 YWNHPGSFVGHN---SGTKFKGLCSVFVTAAFS--YSGIEMTAVSAAESKDPRTTIPKAA 308

Query: 290 KLTLYRIVVFYVITILLLGMTVAYNDPRLLXXXXXXXXXXXXPFVVAIENASIPVLPHIF 349
           K T + I   YV  + L+G  V Y+DPRLL            P V+AIEN  I  LP + 
Sbjct: 309 KRTFWLITASYVTILTLIGCLVPYDDPRLLSGTSSVDAASS-PLVIAIENDGIKGLPSLM 367

Query: 350 NVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCLLAY 409
           N  +L+ + S  NS +Y  SR +  +A  G  PRI    +  G P  ++  ++ F LL++
Sbjct: 368 NAIILISIISVANSAVYACSRCMVAMAHIGNVPRILNRVDTKGRPMNAIIFTLFFGLLSF 427

Query: 410 MNVSSGSAQVFNYFVNVVSIFGLLSWITILITYIRFDKAIRVQ---FGDKSSLSYTAAFQ 466
           +  S   A VF +   +  +  +  W+ I +++IRF +++  Q     +   LS T  + 
Sbjct: 428 VAASDRQADVFTWLSALSGLSTIFCWMAINLSHIRFRQSMAKQNRSLDELPFLSQTGVWG 487

Query: 467 PWSTYVALFFCCLIGLIKNYTVFLGHKFDYKTFISGYIGIPVYLICYVGYKVVYRTK--L 524
            W   + LF   +     +     G   D ++F  GY+  P+ L CY G+K+  R +  +
Sbjct: 488 SWYGTIVLFLVLVASFWTSLFPLGGTSADAESFFEGYLSFPILLACYFGHKLYVRKREFM 547

Query: 525 IKPEDVDLYTFKDAID 540
           +   D+DL T +  +D
Sbjct: 548 VGLADMDLDTGRRQVD 563

>Ecym_4789 Chr4 complement(1531864..1533630) [1767 bp, 588 aa] {ON}
           similar to Ashbya gossypii AGR319W
          Length = 588

 Score =  236 bits (603), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 142/502 (28%), Positives = 248/502 (49%), Gaps = 14/502 (2%)

Query: 45  HEGIRLKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILISYSFVGLLVYTVMS 104
              + L ++L  RH+                         P S++I+++ +   ++T+++
Sbjct: 66  KRSLNLNRDLSIRHLLTLAVGGAIGTGLFVNSGSALNIGGPASLVIAWTIISTCLFTIVN 125

Query: 105 CLGEMAAFIPL-DGFTSYASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSR 163
            LGE+AA  P+  GF  Y +R VDP++GFAV  +YL ++ ++ P +L A ++ +++W   
Sbjct: 126 ALGELAAVFPVVGGFNVYVTRLVDPSLGFAVNINYLAQWAVLLPLELVAASITIRYW--N 183

Query: 164 DRVNPGVWITIFLALIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNH 223
           + VN   W+ +F   I L + + V+ FGE EF LS VK                   P +
Sbjct: 184 NSVNSDAWVAVFYVCIFLASLLDVKSFGETEFILSMVKILAIGGFTILGIVLICGGGPKN 243

Query: 224 DRTGFRFWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRR 283
              G ++W DPG+F   S    GS+ K              Y+GTEL G+ AAE+ NPR 
Sbjct: 244 GYIGAKYWNDPGSFVGASP---GSQFKGLCSVFVTAAFS--YSGTELVGVSAAESANPRY 298

Query: 284 SVPRAIKLTLYRIVVFYVITILLLGMTVAYNDPRLLXXXXXXXXXXXXPFVVAIENASIP 343
           ++P+A K T + I + Y++ + ++G  V ++DP+LL            P V+AIEN  I 
Sbjct: 299 TLPKASKRTFWLITLSYLLVLTIIGCLVRHDDPKLLSASSSVDVAAS-PLVIAIENGGIQ 357

Query: 344 VLPHIFNVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVL 403
            LP + N  +L+ + S  NS +Y  SR +  +A  G  PRIF   +  G P  ++  +++
Sbjct: 358 GLPSLMNAIILIAIISVANSSVYACSRCMVSMAEIGNLPRIFTYIDNRGRPIVAIIFTLV 417

Query: 404 FCLLAYMNVSSGSAQVFNYFVNVVSIFGLLSWITILITYIRFDKAIRVQ---FGDKSSLS 460
           F LL+++  S+   ++F +   +  +  L  W+ I I++IRF +A+  Q     +   LS
Sbjct: 418 FGLLSFIAASNKQEEIFVWLSALSGLSTLFCWLAINISHIRFRRALNTQGYSLDELPYLS 477

Query: 461 YTAAFQPWSTYVALFFCCLIGLIKNYTVFLGHKFDYKTFISGYIGIPVYLICYVGYKVVY 520
            T     W   V +    +     +         D+++F  GY+ +P++L C+VG+K+  
Sbjct: 478 MTGVIGSWYGCVVIILVLIASFWTSLFPAGSSGADWESFFKGYLSLPIFLFCFVGHKLYK 537

Query: 521 R--TKLIKPEDVDLYTFKDAID 540
           R  + +I+   +D+ T +  ID
Sbjct: 538 RNWSWMIRSNKIDVNTGRRMID 559

>Kpol_543.79 s543 (197876..199693) [1818 bp, 605 aa] {ON}
           (197876..199693) [1818 nt, 606 aa]
          Length = 605

 Score =  236 bits (603), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 154/530 (29%), Positives = 252/530 (47%), Gaps = 19/530 (3%)

Query: 50  LKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILISYSFVGLLVYTVMSCLGEM 109
           L+ +L++RH+ M                       P  ILI +S  G +++T++  LGE+
Sbjct: 88  LQHKLKSRHLQMIAIGGAIGTGLFVGSGRALRTAGPAGILIGWSITGTMIFTMVMALGEL 147

Query: 110 AAFIPLDG-FTSYASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVNP 168
           A   P+ G FT+YA+R++D + GFA  ++Y+ ++ +V P ++ A ++ + +W +  R   
Sbjct: 148 AVMFPVSGGFTTYATRFIDESFGFACNFNYMLQWLVVLPLEIVAASITVAYWETPVRYTD 207

Query: 169 GVWITIFLALIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGF 228
           G ++ +F  ++V+IN  GVR +GE EF  S +K                   P     G 
Sbjct: 208 G-FVALFWLVVVIINMFGVRGYGEAEFVFSIIKVTAVIGFIILGIVLVCGGGPVGGYVGA 266

Query: 229 RFWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPRA 288
           R+W +PGAF       S S  K              + G+EL G+  +EAKNPR++VP A
Sbjct: 267 RYWHNPGAFVG-----STSGQKFHGFCSVFVTAAFSFAGSELIGLAGSEAKNPRKAVPSA 321

Query: 289 IKLTLYRIVVFYVITILLLGMTVAYNDPRLLXXXXXXXXXXXXPFVVAIENASIPVLPHI 348
            K   +RI++FY+I +LL+G  V YNDPRL+            PFV+AI    I  LP +
Sbjct: 322 AKQVFWRILLFYIICLLLIGFLVPYNDPRLISSSSVDASAS--PFVIAIVTHGISGLPSV 379

Query: 349 FNVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCLLA 408
            NV +L+ V S  NS +Y  SR+L  L+  G  P+I +  ++ G P   + +S  F L+A
Sbjct: 380 INVVILISVLSVGNSAIYSCSRTLVALSEQGFLPKIVSYIDRKGRPLVGIAISSTFGLIA 439

Query: 409 YMNVSSGSAQVFNYFVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLSYTAAFQPW 468
           ++  S+   ++FN+ + +  +    +W  I I +IRF  A++ Q      L + +     
Sbjct: 440 FVAASNKQNEMFNWLLAISGLSSFFTWSAICICHIRFRGALKAQGRGTDELPFVSPAGVI 499

Query: 469 STYVALFFCCLIGLIKNYTVF--LGHKFDYKTFISGYIGIPVYLICYVGYKVVYRTK--L 524
            +Y  LF   L+ + + Y     +G       F S Y+  PV L  Y+ +K+  +    L
Sbjct: 500 GSYWGLFLNILMLIAQFYIALFPIGGSPSAYEFFSAYLAAPVILAFYIAHKLWKKNWKFL 559

Query: 525 IKPEDVDLYTFKDAIDAXXXXXXXXXXXXXXNMENSPKNFKWFYETFLGW 574
           I  EDVD+ T +   D                M        W+Y  ++ W
Sbjct: 560 IPLEDVDIDTGRRDTDVNLLKQEIAEEKAALAMR------PWWYRVYVFW 603

>SAKL0D04664g Chr4 complement(365852..367633) [1782 bp, 593 aa] {ON}
           highly similar to uniprot|P19145 Saccharomyces
           cerevisiae YKR039W GAP1 General amino acid permease;
           localization to the plasma membrane is regulated by
           nitrogen source
          Length = 593

 Score =  236 bits (601), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 146/497 (29%), Positives = 247/497 (49%), Gaps = 15/497 (3%)

Query: 50  LKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILISYSFVGLLVYTVMSCLGEM 109
           LK+ L+ RH+ M                       P  ILI ++  G ++Y ++  +GE+
Sbjct: 77  LKRHLKNRHLQMIAIGGAIGTGLFVGSGKALRTAGPAGILIGWALTGTMIYCMVMAMGEL 136

Query: 110 AAFIPLDG-FTSYASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVNP 168
           A   P+ G FT+YA+R++D + G+A  ++Y+ ++ +V P ++ A ++ + +W +  +   
Sbjct: 137 AVTFPVSGGFTTYATRFIDESFGYANNFNYMLQWLVVLPLEIVAASITVNYWGTDPKYRD 196

Query: 169 GVWITIFLALIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGF 228
           G ++ +F  +IV IN  GV+ +GE EF  S +K                   P     G 
Sbjct: 197 G-FVALFYVVIVSINMFGVKGYGEAEFVFSFIKVITVIGFIILGIILVCGGGPVGGYIGG 255

Query: 229 RFWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXX-XYTGTELCGIVAAEAKNPRRSVPR 287
             W +PGAF      +  + GK               + G+EL G+ +AE  NPR+S+PR
Sbjct: 256 ANWHNPGAF------VGNTAGKRFKGVCSVFVTAAFSFAGSELVGLASAETANPRKSLPR 309

Query: 288 AIKLTLYRIVVFYVITILLLGMTVAYNDPRLLXXXXXXXXXXXXPFVVAIENASIPVLPH 347
           A K   +RI +FY+I++ L+G+ V YND RL+            PFV+AI+N  I  LP 
Sbjct: 310 AAKQVFWRITLFYIISLCLIGLLVPYNDTRLIGASSVDAAAS--PFVLAIKNHGIKGLPS 367

Query: 348 IFNVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCLL 407
           + NV +L+ V S  NS ++  SR+L  LA  G  P+IF   ++ G P   +G +  F LL
Sbjct: 368 VVNVVILIAVLSVGNSAVFGCSRTLTALAEQGFLPKIFGYIDRKGRPLVGIGFTSFFGLL 427

Query: 408 AYMNVSSGSAQVFNYFVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLSYTAAFQP 467
           +++  S    +VF++ + +  +  L +W+ I I ++RF +A+  Q      LS+ +    
Sbjct: 428 SFIAASPKEGEVFDWLLALSGLSSLFTWMAICICHLRFRRALSAQGRSTDELSFVSPAGV 487

Query: 468 WSTYVALFFCCLIGLIKNYTVF--LGHKFDYKTFISGYIGIPVYLICYVGYKVVYRT-KL 524
           W +        LI   + +     +G   D K F   Y+ +PV L+ Y+G+K   R  KL
Sbjct: 488 WGSIYGTVLIMLILAAQFWIALFPIGSPPDAKDFFESYLSLPVVLVMYIGHKCYKRNWKL 547

Query: 525 -IKPEDVDLYTFKDAID 540
            I+ E++D+ T +  +D
Sbjct: 548 FIRAENIDIDTGRREVD 564

>TPHA0E03660 Chr5 (775232..777175) [1944 bp, 647 aa] {ON} Anc_1.50
           YDR508C
          Length = 647

 Score =  237 bits (604), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 158/545 (28%), Positives = 255/545 (46%), Gaps = 28/545 (5%)

Query: 11  NAGVLYSNETLEEGIVT--------LESEGQVRSVSEGVDGKHEGIRLKKELEARHVSMX 62
           +A  L   + LE GI T        L    Q+R+ ++  D K     LK+ +  RHV M 
Sbjct: 87  DAAELDYEQALENGITTSVSPSAPNLRKLNQLRTPTDANDNK----ALKQTIRPRHVVMI 142

Query: 63  XXXXXXXXXXXXXXXXXXXXXXPVSILISYSFVGLLVYTVMSCLGEMA-AFIPL-DGFTS 120
                                 P  ++I YS +G ++Y ++   GEMA A+  L  G+  
Sbjct: 143 SLGTGIGTGLLVGNGTALKNAGPAGLVIGYSIMGSIIYCIIQATGEMAIAYSNLPGGYNV 202

Query: 121 YASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVNPGVWITIFLALIV 180
           Y S  V+   GFA+ + Y  ++  V P +L   ++ +++W +   VN  +++ IF ALI+
Sbjct: 203 YPSFLVEKGFGFAIAWVYCIQWLTVCPLELVTASLTIKYWTTS--VNSDIFVAIFYALII 260

Query: 181 LINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGFRFWRDPGAFKPY 240
           +IN  G + + E EF+ +  K                    N    G  +W  PGAF+  
Sbjct: 261 IINVFGAKGYAEAEFFCNCCKVLMMIGFFILSITITAGGAGNDGYLGGLYWHTPGAFRGD 320

Query: 241 SEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVVFY 300
           S +I   KG               Y GTE   + AAE  NPR ++P A K  LYRI+  Y
Sbjct: 321 S-SIDHFKG----ICGTLVTAAFAYGGTEFLALTAAEQSNPRAAIPSAAKKVLYRIICVY 375

Query: 301 VITILLLGMTVAYNDPRLLXXXXXXXXXXXXPFVVAIENASIPVLPHIFNVCVLVFVFSA 360
           +I+IL++G  V ++  RLL            P+V+A     + V+PH  N  +L+ V S 
Sbjct: 376 LISILMIGFLVPFDSTRLLGSDGSATSAS--PYVLAASLHGVRVVPHFINAVILISVLSV 433

Query: 361 CNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCLLAYMNVSSGSAQVF 420
            NS  Y +SR L  LA  G AP+ F   ++ G P  ++ +S LF ++A+   S    +VF
Sbjct: 434 GNSAFYSSSRLLMSLARQGYAPKWFDYIDREGRPARAMLMSALFGVIAFCAASPKETEVF 493

Query: 421 NYFVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLSYTAAFQPWSTYVALFFCCLI 480
            + + +  +  L +W  I +++IRF  A++VQ      + Y A    W ++ ALF   LI
Sbjct: 494 TWLLAISGLSQLFTWCAICLSHIRFRTAMKVQGRSLGEVGYLAQTGVWGSWYALFMMFLI 553

Query: 481 GLIKNYTVFL---GHKFDYKTFISGYIGIPVYLICYVGYKVVYR--TKLIKPEDVDLYTF 535
            + + +         +   + F   Y+ +P+ ++ Y+GYK+ Y+  T LIK ED+DL + 
Sbjct: 554 YIAQFWVAIAPIGSGELSAQNFFENYLAMPILIVLYLGYKIYYKDWTLLIKAEDIDLQSH 613

Query: 536 KDAID 540
           +   D
Sbjct: 614 RQIFD 618

>KAFR0E01850 Chr5 (381160..382842) [1683 bp, 560 aa] {ON} Anc_5.158
           YGR191W
          Length = 560

 Score =  234 bits (598), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 144/499 (28%), Positives = 244/499 (48%), Gaps = 15/499 (3%)

Query: 49  RLKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILISYSFVGLLVYTVMSCLGE 108
            L K L  RH+                         P S+++ +  +   ++TV++ LGE
Sbjct: 42  NLSKNLSVRHLVTLAVGGSIGTGLFVNSGTALSDGGPASLVVGWVIISTCLFTVINSLGE 101

Query: 109 MAAFIPL-DGFTSYASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVN 167
           +AA  P+  GF  Y +R+VDP+VGFAV  +YL ++ ++ P +L A ++ +++W   D++N
Sbjct: 102 LAAAFPIVGGFNVYITRFVDPSVGFAVNLNYLAQWLVLLPLELVAASLTIKYW--NDKIN 159

Query: 168 PGVWITIFLALIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTG 227
              W+ IF   IVL N + V+ FGE EF LS VK                   P+    G
Sbjct: 160 SDAWVAIFYVTIVLANMLEVKSFGETEFVLSMVKILAIIGFTILGIVLASGGGPSGGYLG 219

Query: 228 FRFWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPR 287
           F++W +PGAF   + A      K              ++G E+  + AAE+KNPR+ +P+
Sbjct: 220 FKYWNNPGAFVGGTNA-----SKFKGLCSVFVTAAFSFSGIEMIAVSAAESKNPRKVIPK 274

Query: 288 AIKLTLYRIVVFYVITILLLGMTVAYNDPRLLXXXXXXXXXXXXPFVVAIENASIPVLPH 347
           A K T + +   YV+ + L+G  V YND RLL            P V+AIEN  I  LP 
Sbjct: 275 AAKRTFWLVTSSYVVILTLVGCLVPYNDSRLLNAATSVDAAAS-PLVIAIENGGIKGLPS 333

Query: 348 IFNVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCLL 407
           + N  +L+ + S  NS +Y  SR +  +A  G  P++ +  +K G P  +L ++++F LL
Sbjct: 334 LMNAIILIAIVSVANSAVYACSRCMVSMAHIGNLPKVLSKVDKKGRPMNALIVTLIFGLL 393

Query: 408 AYMNVSSGSAQVFNYFVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLSYTAAFQP 467
           +++  S    +VF +   +  +  +  W+ I  + IRF +A++VQ      L Y +    
Sbjct: 394 SFIAASDKQNEVFTWLSALSGLSTIFCWMAINYSLIRFRRAMQVQNRSLDELPYLSQTGI 453

Query: 468 WSTYVALFFCCLIGLIKNYTVF--LGHKF-DYKTFISGYIGIPVYLICYVGYKVVYRTK- 523
           W  +  +    L+ +   +T    LG    D ++F   ++ +P+ L+CY G+K+ +    
Sbjct: 454 WGAWYGVLVLFLVIVASFWTSMFPLGSAHADAESFFESFLSLPILLVCYFGHKLYFARNW 513

Query: 524 --LIKPEDVDLYTFKDAID 540
              I  E++D+ + +  ID
Sbjct: 514 RLQIGAEEMDIDSGRKIID 532

>Kwal_27.12681 s27 (1332647..1334428) [1782 bp, 593 aa] {ON} YKR039W
           (GAP1) - 1:1 [contig 260] FULL
          Length = 593

 Score =  235 bits (600), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 151/497 (30%), Positives = 252/497 (50%), Gaps = 15/497 (3%)

Query: 50  LKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILISYSFVGLLVYTVMSCLGEM 109
           L++ L+ RH+ M                       P  +LI +  +GL++Y V+  +GE+
Sbjct: 77  LQRHLKNRHLQMIAIGGAIGTGLFVGSGKALRTGGPAGVLIGWGLIGLMIYCVVMSMGEL 136

Query: 110 AAFIPLDG-FTSYASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVNP 168
           A   P+ G FT+YA+R+VD + GFA+ Y+Y+ ++ +V P ++ A ++ + FW +  +   
Sbjct: 137 AVTFPVSGGFTTYATRFVDESFGFAINYNYMLQWLVVLPLEIVAASITVNFWGTPPKYRD 196

Query: 169 GVWITIFLALIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGF 228
           G ++ +F  +IV+IN  GVR +GE EF  S +K                   P     G 
Sbjct: 197 G-FVALFYIVIVIINFFGVRGYGEAEFVFSFIKVITVIGFIILGIVLVCGGGPVGGYIGG 255

Query: 229 RFWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPRA 288
           ++W +PGAF   S   +GS+ K              + GTEL G+ +AE  NPR+++PRA
Sbjct: 256 KYWHNPGAF---SGDDAGSRFKGVCSVFVTAAFS--FAGTELVGLASAETANPRKALPRA 310

Query: 289 IKLTLYRIVVFYVITILLLGMTVAYNDPRLLXXXXXXXXXXXXPFVVAIENASIPVLPHI 348
            K   +RI++FY+I++ L+G+ V +   RL+            PFV+AI+   I  LP +
Sbjct: 311 AKQVFWRILLFYIISLCLIGLLVPHTSERLIGTSSVDAAAS--PFVLAIQTHGIKGLPSV 368

Query: 349 FNVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCLLA 408
            NV +L+ V S  NS +Y  SRS+  LA  G  P IFA  ++ G P  ++  + +F LL+
Sbjct: 369 INVVILISVLSVGNSAVYACSRSMVALAEQGSLPHIFAYIDRKGRPLVAIITTCVFGLLS 428

Query: 409 YMNVSSGSAQVFNYFVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLSYTAAFQPW 468
           ++  S     VFN+ + +  +  L SW  I I +IRF +A+  Q      L++ +     
Sbjct: 429 FIAQSEKEGDVFNWLLALSGLSTLFSWGAICICHIRFRRALSAQGRSTDELAFVSYAGIA 488

Query: 469 STYVALFFCCLIGLIKNYTVF---LGHKFDYKTFISGYIGIPVYLICYVGYKVVYRT-KL 524
            +Y  +    L+ LI  + V    +G   + + F S Y+  PV L  Y+ +K+  R  KL
Sbjct: 489 GSYFGVILVLLV-LIAQFWVAVWPIGGSPNAEDFFSAYLSFPVLLAFYIFHKIWKRNWKL 547

Query: 525 -IKPEDVDLYTFKDAID 540
             + +D+D+ T +  +D
Sbjct: 548 FTRAKDIDIDTGRREMD 564

>Kpol_1010.32 s1010 (82500..84299) [1800 bp, 599 aa] {ON}
           (82500..84299) [1800 nt, 600 aa]
          Length = 599

 Score =  235 bits (600), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 157/560 (28%), Positives = 269/560 (48%), Gaps = 38/560 (6%)

Query: 1   MNSDTSMEKKNAGVLYSNETLEEGI-VTLESEGQVRSVS-------------EGVDGKHE 46
           MNS    EK+      SN   E+ + +   S G  ++++             E +DG + 
Sbjct: 36  MNSSFITEKR------SNSLKEDNVMIQTTSSGATKNINGTSNPNDSNMLSKEDIDGSN- 88

Query: 47  GIRLKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILISYSFVGLLVYTVMSCL 106
              L K+L  RH+                         P S++I +  V   ++TV++ L
Sbjct: 89  ---LNKDLNIRHLLTLAVGGAIGTGLFVNSGASLNTGGPASLVIGWVIVSTALFTVINSL 145

Query: 107 GEMAAFIPL-DGFTSYASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDR 165
           GE+AA  P+  GF+ Y +R++DP++ F++  +YL ++ ++ P +L A ++ +++W   D+
Sbjct: 146 GELAAAYPVVGGFSVYMTRFIDPSIAFSINLNYLVQWLVLLPLELVAASITIRYW--NDK 203

Query: 166 VNPGVWITIFLALIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDR 225
           +N   W++IF  +I L+N + V+ FGE EF LS +K                   P    
Sbjct: 204 INSDAWVSIFYTVIGLLNMLDVKSFGETEFVLSFIKILAIIGFTILGIVLSCGGGPVGGY 263

Query: 226 TGFRFWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSV 285
            G ++W DPGAF  ++   +GS+ K              Y+G E+  + AAE+ +PR+++
Sbjct: 264 IGGKYWHDPGAFVGHT---AGSQFKGLCSVFVTAAFS--YSGIEMIAVSAAESIDPRKTI 318

Query: 286 PRAIKLTLYRIVVFYVITILLLGMTVAYNDPRLLXXXXXXXXXXXXPFVVAIENASIPVL 345
           P A K T + I   YV  + L+G  V Y+DPRLL            P V+AIEN  I  L
Sbjct: 319 PVAAKRTFWLITASYVTILTLIGCLVPYDDPRLLNGSSSVDVASS-PLVIAIENGGIKGL 377

Query: 346 PHIFNVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFC 405
           P + N  +L+ V S  NS +Y  SR +  +AI G  P+     +K G P  +  +++ F 
Sbjct: 378 PSLMNAIILIAVLSVANSAVYACSRYMVSMAIIGNLPKQLGRIDKKGRPINATLVTLFFG 437

Query: 406 LLAYMNVSSGSAQVFNYFVNVVSIFGLLSWITILITYIRFDKAIRVQ---FGDKSSLSYT 462
           L++++  S   A+VF +   +  +  +  W+ I I++IRF +A+ +Q     +   LS  
Sbjct: 438 LISFVAASDKQAEVFTWLSALSGLSTIFCWMGINISHIRFRRAMDIQGRSLEEMPYLSQV 497

Query: 463 AAFQPWSTYVALFFCCLIGLIKNYTVFLGHKFDYKTFISGYIGIPVYLICYVGYKVVYRT 522
             +  W   + LF   +     +       + +  TF  GY+ +P+ L CYVG+K  ++ 
Sbjct: 498 GVYGSWYGCIILFLVLIAAFWTSLFPVGSSQANATTFFEGYLSLPILLACYVGHKFYFKN 557

Query: 523 -KLIKP-EDVDLYTFKDAID 540
            +L  P  ++DL + K  ID
Sbjct: 558 WRLFTPYNEIDLDSGKRDID 577

>TPHA0A04700 Chr1 (1064463..1066172) [1710 bp, 569 aa] {ON}
           Anc_5.158 YGR191W
          Length = 569

 Score =  234 bits (596), Expect = 8e-69,   Method: Compositional matrix adjust.
 Identities = 147/493 (29%), Positives = 243/493 (49%), Gaps = 16/493 (3%)

Query: 47  GIRLKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILISYSFVGLLVYTVMSCL 106
           G  L K+L+ RH+                         P S++I +  +   ++TV++ L
Sbjct: 75  GENLNKDLDIRHLLTLAIGGSIGTGLFVNSGTSLNTGGPASLIIGWVIISSALFTVINAL 134

Query: 107 GEMAAFIPL-DGFTSYASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDR 165
           GE+AA  P+  GF  Y +R+VDP+  FAV  +YL  + +  P +L A ++ +++W     
Sbjct: 135 GELAATFPIVGGFNVYMTRFVDPSFAFAVNLNYLILWIVSLPLELVAASITIRYW--NRE 192

Query: 166 VNPGVWITIFLALIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDR 225
           +N   W+TIF   I L+N + V+FF E EF +S +K                   P    
Sbjct: 193 INSDAWVTIFFVFIALLNMMDVKFFSEAEFVMSIIKILAIVGFFILGIVLAVGGGPTGGY 252

Query: 226 TGFRFWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSV 285
            G ++W DPGAF   S   +GS+ K              Y+G E+  + AAE+KNPR+++
Sbjct: 253 IGGKYWNDPGAFHGDS---AGSRFKGLCSVFVIAAFS--YSGVEMTAVSAAESKNPRKTI 307

Query: 286 PRAIKLTLYRIVVFYVITILLLGMTVAYNDPRLLXXXXXXXXXXXXPFVVAIENASIPVL 345
           P+A K T + I   Y+  + L+G+ V YND RLL            P V+AIENA I  L
Sbjct: 308 PKATKRTFWVITFSYISILTLIGILVPYNDKRLLSGSSSVDASAS-PLVIAIENAGIKGL 366

Query: 346 PHIFNVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFC 405
           P + N  +L+ + S  NS +YV SR +  +A+    P++F+  +K G P YS+  ++   
Sbjct: 367 PSLMNAIILIALLSVANSCVYVCSRVMVSMALTNTLPKVFSKVDKRGRPLYSIFATLFVG 426

Query: 406 LLAYMNVSSGSAQVFNYFVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLSYTAAF 465
           LL+++  S    +VF +   +  +  +  WI I + +IRF  A++ Q      L+Y +  
Sbjct: 427 LLSFIAASDKQEEVFTWLSAICGLSTIFCWIGINLAHIRFRAALKFQNRSLDELAYISQS 486

Query: 466 QPWSTYVALFFCCLIGLIKNYTVFL----GHKFDYKTFISGYIGIPVYLICYVGYKVVYR 521
             W ++  +    L+ LI ++ V L        D + F  GY+  P+ +  Y+G+KV  +
Sbjct: 487 GIWGSWYGVIILVLV-LIASFWVSLFPVGESSADAEAFFEGYLSFPILIASYIGHKVYIK 545

Query: 522 T-KLIKP-EDVDL 532
             K + P E++D+
Sbjct: 546 NWKWVIPLEEIDI 558

>KLLA0A11770g Chr1 (1014918..1016663) [1746 bp, 581 aa] {ON} similar
           to uniprot|P06775 Saccharomyces cerevisiae YGR191W HIP1
           High-affinity histidine permease also involved in the
           transport of manganese ions
          Length = 581

 Score =  234 bits (596), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 146/502 (29%), Positives = 251/502 (50%), Gaps = 20/502 (3%)

Query: 49  RLKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILISYSFVGLLVYTVMSCLGE 108
           +L K+L  RH+                         P S++I+++ +   ++T+++ LGE
Sbjct: 63  KLNKDLSIRHLLTLAVGGAIGTGLFVNSGDSLSTGGPASLVIAWTIISTCLFTIVNSLGE 122

Query: 109 MAAFIPL-DGFTSYASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVN 167
           ++A  P+  GF  Y +R+V+P+ GFAV ++YL ++ I+ P +L A ++ +++W     +N
Sbjct: 123 LSATFPVVGGFNVYVTRFVEPSFGFAVNFNYLAQWAILLPLELCAASITIRYW--NKSIN 180

Query: 168 PGVWITIFLALIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTG 227
           P  W++IF   I   N + V+ FGE EF LS VK                   P+    G
Sbjct: 181 PDAWVSIFYVAIAFANMLDVKSFGETEFVLSMVKILAIIGFTILGIVLICGGGPSGGFIG 240

Query: 228 FRFWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPR 287
            ++W DPGAF   + A      +              Y+G EL G+ AAE++NPR ++P+
Sbjct: 241 GKYWNDPGAFVGDTPA-----QRFKGLSAVFITAAFSYSGLELVGVSAAESRNPRVTLPK 295

Query: 288 AIKLTLYRIVVFYVITILLLGMTVAYNDPRLLXXXXXXXXXXXXPFVVAIENASIPVLPH 347
           A K T + I + Y++ + L+G  V  NDP LL            P V+AI+N  I  LP 
Sbjct: 296 AAKRTFWLITMSYLVILTLIGCLVPSNDP-LLLNGTSSVDAAASPLVIAIQNGGIKGLPS 354

Query: 348 IFNVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCLL 407
           + N  +L+ + S  NS +Y  SR +  +A  G  PR  A  +K G P Y++ +++L  LL
Sbjct: 355 LMNAIILIALLSVANSAVYACSRCIISMAEIGNLPRSLAHVDKKGRPLYAIAITLLVGLL 414

Query: 408 AYMNVSSGSAQVFNYFVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLSYTAAFQP 467
           +++  S+   +VF +   +  +  L  W  I + ++RF  A++ Q      L Y +    
Sbjct: 415 SFIAASNKRDEVFTWLSALSGLSTLFCWFAINLAHLRFRHAMKHQNRSLEELPYVSMTGE 474

Query: 468 WSTYVALFFCCLIG--LIKNYTVFL----GHKFDYKTFISGYIGIPVYLICYVGYKVVYR 521
           W ++   + C +IG  LI ++   L    G+  D  +F   Y+ +P+++ CY+G+K+  R
Sbjct: 475 WGSW---YGCIVIGLVLIASFWTSLFPAGGNGADATSFFESYLSLPIFIACYLGHKIWKR 531

Query: 522 T-KL-IKPEDVDLYTFKDAIDA 541
             +L IK  +VD+ + +   DA
Sbjct: 532 NLRLYIKLSEVDVDSGRTDTDA 553

>Smik_3.53 Chr3 complement(77146..79047) [1902 bp, 633 aa] {ON}
           YCL025C (REAL)
          Length = 633

 Score =  234 bits (598), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 153/520 (29%), Positives = 242/520 (46%), Gaps = 18/520 (3%)

Query: 29  ESEGQVRSVSEGVDGKHEGIRLKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSI 88
           E E    S + G    ++   LKK ++ RHV M                       P  +
Sbjct: 95  ELEKNESSDNIGARTGNKSDSLKKTIQPRHVLMIALGTGIGTGLLVGNGTALVHAGPAGL 154

Query: 89  LISYSFVGLLVYTVMSCLGEMAAFIP--LDGFTSYASRYVDPAVGFAVGYSYLFKYFIVT 146
           LI Y  +G ++Y ++   GEMA        G+ +Y S  VD   GFAV + Y  ++  V 
Sbjct: 155 LIGYGIMGSILYCIIQACGEMALVYSNLTGGYNAYPSFLVDDGFGFAVAWVYCLQWLCVC 214

Query: 147 PNQLTAGAMVMQFWVSRDRVNPGVWITIFLALIVLINTVGVRFFGEFEFWLSSVKXXXXX 206
           P +L   +M +++W +   VNP V++ IF  L++ IN  G R + E EF+ +  K     
Sbjct: 215 PLELVTASMTIKYWTTS--VNPDVFVIIFYVLVITINIFGARGYAEAEFFFNCCKILMMT 272

Query: 207 XXXXXXXXXXXXXXPNHDRTGFRFWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYT 266
                          N    G ++W DPGAF     +I   KG               + 
Sbjct: 273 GFFILGIIIDVGGAGNDGFIGGKYWHDPGAFNG-KHSIDRFKG----VVATLVTAAFAFG 327

Query: 267 GTELCGIVAAEAKNPRRSVPRAIKLTLYRIVVFYVITILLLGMTVAYNDPRLLXXXXXXX 326
           G+E   I  AE  NPR++VP A K  +YRI+  ++ TI+LLG  V YN  +LL       
Sbjct: 328 GSEFIAITTAEQANPRKAVPGAAKQMIYRILFLFLATIILLGFLVPYNSNQLLGSSGGGT 387

Query: 327 XXXXXPFVVAIENASIPVLPHIFNVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPRIFA 386
                P+V+A+ +  + V+PH  N  +L+ V S  NS  Y ++R L  L+  G APR+F 
Sbjct: 388 KAS--PYVIAVASHGVRVVPHFINAVILLSVLSMANSSFYSSARILLTLSEQGYAPRVFT 445

Query: 387 TTNKWGVPYYSLGLSVLFCLLAYMNVSSGSAQVFNYFVNVVSIFGLLSWITILITYIRFD 446
             +K G P  ++G+S LF ++A+   S    QVF + + +  +  L +W  I +++IRF 
Sbjct: 446 YIDKAGRPLIAMGVSALFGVIAFCAASPKEDQVFTWLLAISGLSQLFTWTAICLSHIRFR 505

Query: 447 KAIRVQFGDKSSLSYTAAFQPWSTYVALFFCCLIGLIKNYTVFLG----HKFDYKTFISG 502
           +A++VQ      L + +    W +  A     LI LI  + V +      K D + F   
Sbjct: 506 RAMKVQGRSLGELGFRSQTGVWGSTYACIMMILI-LIGQFWVAIAPIGEGKLDAQAFFEN 564

Query: 503 YIGIPVYLICYVGYKVVYRT-KL-IKPEDVDLYTFKDAID 540
           Y+ +P+ +  YVGYK+  +  KL I+ + +DL + +   D
Sbjct: 565 YLAMPILIALYVGYKIWKKDWKLFIRADKIDLISHRQIFD 604

>Smik_11.302 Chr11 (505026..506684) [1659 bp, 553 aa] {ON} YKR039W
           (REAL)
          Length = 553

 Score =  232 bits (592), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 155/561 (27%), Positives = 259/561 (46%), Gaps = 47/561 (8%)

Query: 1   MNSDTSMEKKNA------GVLYSNETLEEGIVTLESEGQVRSVSEGVDGKH--------- 45
           M++ +S EK N       G+   +E L +  +T+ S G   S  E   G           
Sbjct: 1   MSNTSSYEKNNPENLKYNGITIDSEFLTQEPITIPSNGSAASAEEAGSGSKWQDFKDSFK 60

Query: 46  --EGIR-------------------LKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXX 84
             E I                    LK  L+ RH+ M                       
Sbjct: 61  RVEPIAVDPNLTEAEKVAIVTAQTPLKHHLKNRHLQMIAIGGAIGTGLLVGSGTALRTGG 120

Query: 85  PVSILISYSFVGLLVYTVMSCLGEMAAFIPLDG-FTSYASRYVDPAVGFAVGYSYLFKYF 143
           P S+LI +   G ++Y ++  LGE+A   P+ G FT+YA+R++D + G+A  ++Y+ ++ 
Sbjct: 121 PASLLIGWGSTGTMIYAMVMALGELAVIFPISGGFTTYATRFIDESFGYANNFNYMLQWL 180

Query: 144 IVTPNQLTAGAMVMQFWVSRDRVNPGVWITIFLALIVLINTVGVRFFGEFEFWLSSVKXX 203
           +V P ++ + ++ + FW +  +   G ++ +F  +IV+IN  GV+ +GE EF  S +K  
Sbjct: 181 VVLPLEIVSASITVNFWGTDPKYRDG-FVALFWVVIVIINMFGVKGYGEAEFVFSFIKVI 239

Query: 204 XXXXXXXXXXXXXXXXXPNHDRTGFRFWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXX 263
                            P     G ++W DPGAF     A      K             
Sbjct: 240 TVVGFIILGIILNCGGGPEGGYIGGKYWHDPGAF-----AGDTPGAKFKGVCSVFVTSAF 294

Query: 264 XYTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVVFYVITILLLGMTVAYNDPRLLXXXX 323
            + G+EL G+ A+E+  PR+SVP+A K   +RI +FY++++L++G+ V YND  L+    
Sbjct: 295 SFAGSELVGLAASESVEPRKSVPKAAKQVFWRITLFYILSLLMIGLLVPYNDKNLIGASS 354

Query: 324 XXXXXXXXPFVVAIENASIPVLPHIFNVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPR 383
                   PFV+AI+   I  LP + NV +L+ V S  NS +Y  SR++  LA     P+
Sbjct: 355 VDAAAS--PFVIAIKTHGIKGLPSVVNVVILIAVLSVGNSAIYACSRTMVALAEQRFLPQ 412

Query: 384 IFATTNKWGVPYYSLGLSVLFCLLAYMNVSSGSAQVFNYFVNVVSIFGLLSWITILITYI 443
           IFA  ++ G P   +G++  F L+A++  S     VFN+ + +  +  L +W  I I +I
Sbjct: 413 IFAYVDRKGRPLVGIGVTSAFGLIAFVAASKKEGDVFNWLLALSGLSSLFTWGGICICHI 472

Query: 444 RFDKAIRVQFGDKSSLSYTAAFQPWSTYVALFFCCLIGLIKNYTVF--LGHKFDYKTFIS 501
           RF KA+  Q  D   LS+ +    W +Y  LF   ++ + + Y     +G     + F  
Sbjct: 473 RFRKALTAQGRDLDELSFKSPTGVWGSYWGLFMVVIMFIAQFYVALFPVGGSPSAEGFFE 532

Query: 502 GYIGIPVYLICYVGYKVVYRT 522
            Y+  P+ +  Y+G+K+  R 
Sbjct: 533 AYLSFPLVMAMYIGHKIYKRN 553

>Ecym_6021 Chr6 (37898..39700) [1803 bp, 600 aa] {ON} similar to
           Ashbya gossypii AFR230C
          Length = 600

 Score =  233 bits (594), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 142/497 (28%), Positives = 249/497 (50%), Gaps = 15/497 (3%)

Query: 50  LKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILISYSFVGLLVYTVMSCLGEM 109
           L+++L+ RH+ M                       P  ILI +  +  ++  +   LGEM
Sbjct: 84  LQRKLKNRHLQMIAIGGAIGTGLFIGSSKALRTAGPAGILIGWGLMATMILCMCLSLGEM 143

Query: 110 AAFIPLDG-FTSYASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVNP 168
           A   P+ G +T+YA+R++D + GFA   +Y+ +  +V P ++ A ++ + +W  + +   
Sbjct: 144 AVTFPVSGGYTTYATRFIDESYGFANNINYMMQALVVLPLEIVAASITVDYWGPKSQYR- 202

Query: 169 GVWITIFLALIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGF 228
             ++ +F   IV IN  GV+ +GE EF  S +K                   P H+  G 
Sbjct: 203 AAFVALFWLCIVSINMFGVKGYGEAEFVFSLIKVVTVIGFIILGVILVCGGGPTHEYIGS 262

Query: 229 RFWRDPGAFKPYSEAISGSKG-KXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPR 287
           +FW +PGAF      +  + G K              +  TEL G+ AAE ++PR+SVP+
Sbjct: 263 KFWSNPGAF------VGDTAGQKFKGICSVFVTAAFSFANTELVGLAAAETEDPRKSVPK 316

Query: 288 AIKLTLYRIVVFYVITILLLGMTVAYNDPRLLXXXXXXXXXXXXPFVVAIENASIPVLPH 347
           A K   +RI +FY++++L++G+ V Y DPRLL            PFV+A++N  I  LP 
Sbjct: 317 AAKQVFWRITLFYILSLLMVGLLVPYTDPRLLGSSIVDAAAS--PFVLALKNHGIKGLPS 374

Query: 348 IFNVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCLL 407
           + NV +L  V S  NS ++  SR L  L+  G  P +F   ++ G P  S+  S  F LL
Sbjct: 375 VINVVILTAVLSVGNSSVFSCSRCLTALSEQGFLPNVFGYIDRKGRPLVSIIFSSAFGLL 434

Query: 408 AYMNVSSGSAQVFNYFVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLSYTAAFQP 467
            ++ VS    ++F++ +++  +  L  W+TI + +IRF KA+  Q      L++ +    
Sbjct: 435 CFLAVSHQVQEIFDWMLSLSGLSSLFIWLTISLCHIRFRKALSAQNRSIDELAFASPIGI 494

Query: 468 WSTYVALFFCCLIGLIKNY-TVFLGH-KFDYKTFISGYIGIPVYLICYVGYKVVYRT--K 523
           W +Y ++F   ++ +++ +  +F GH K     F   Y+ +P+ +  Y+G+K+  +    
Sbjct: 495 WGSYYSVFLIIVVLILQFWIALFPGHQKPSASNFFKAYLSMPIAVAMYLGHKIYTKNWKL 554

Query: 524 LIKPEDVDLYTFKDAID 540
           LI P+ +D+ T +  +D
Sbjct: 555 LIDPKYMDIDTGRRELD 571

>NDAI0C02950 Chr3 (676753..678582) [1830 bp, 609 aa] {ON} Anc_5.158
          Length = 609

 Score =  233 bits (593), Expect = 5e-68,   Method: Compositional matrix adjust.
 Identities = 153/529 (28%), Positives = 253/529 (47%), Gaps = 26/529 (4%)

Query: 22  EEGIVTLESEGQVRSVSEGVDGKHEGIRLKKELEARHVSMXXXXXXXXXXXXXXXXXXXX 81
           E+ I T  SE Q     E ++       L K+L  RH+                      
Sbjct: 70  EKNIETTPSE-QFSIAKEDINE-----NLNKDLSIRHLITLAVGGSIGVGLFVNSGAALA 123

Query: 82  XXXPVSILISYSFVGLLVYTVMSCLGEMAAFIPL-DGFTSYASRYVDPAVGFAVGYSYLF 140
              P S++I +  +   ++TV++ LGE+AA  P+  GF  Y +R+VDP+V FA+  +YL 
Sbjct: 124 SGGPASLVIDWVIISTCLFTVINALGELAAAYPVVGGFNVYITRFVDPSVAFAINLNYLA 183

Query: 141 KYFIVTPNQLTAGAMVMQFWVSRDRVNPGVWITIFLALIVLINTVGVRFFGEFEFWLSSV 200
           ++ ++ P +L A ++ +++W   D +N   W+ IF ++I L N + V+ FGE EF LS V
Sbjct: 184 QWLVLLPLELVAASITIKYW--NDTINSDAWVAIFYSVIALANMLDVKSFGETEFVLSMV 241

Query: 201 KXXXXXXXXXXXXXXXXXXXPNHDRTGFRFWRDPGAF---KPYSEAISGSKGKXXXXXXX 257
           K                   P     G  +W DPG+F   KP ++     KG        
Sbjct: 242 KILAIIGFTILGIVLACGGGPQGGFLGGHYWHDPGSFVGDKPGTQF----KG----LCSV 293

Query: 258 XXXXXXXYTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVVFYVITILLLGMTVAYNDPR 317
                  Y+G EL  + AAE+K+PR+++P+A K T + +   YV  + ++G  V ++DPR
Sbjct: 294 FVTAAFSYSGIELTAVSAAESKDPRKTIPKATKRTFWLVTASYVTILTIIGCLVPFDDPR 353

Query: 318 LLXXXXXXXXXXXXPFVVAIENASIPVLPHIFNVCVLVFVFSACNSDLYVASRSLYGLAI 377
           LL            P V++I+NA I  L  + N  +L+ + S  NS +Y  SR +  +A 
Sbjct: 354 LLNGSSSVDAAAS-PLVISIKNAGIKGLDSLMNAIILISIVSVANSAVYACSRCMVSMAH 412

Query: 378 DGKAPRIFATTNKWGVPYYSLGLSVLFCLLAYMNVSSGSAQVFNYFVNVVSIFGLLSWIT 437
            G  P++ +  +K G P  ++  ++ F LL+++  S   A+VF +   +  +  +  W+ 
Sbjct: 413 IGNLPKVLSRVDKRGRPVNAILSTLFFGLLSFIAASDKQAEVFTWLSALSGLSTIFCWMA 472

Query: 438 ILITYIRFDKAIRVQ---FGDKSSLSYTAAFQPWSTYVALFFCCLIGLIKNYTVFLGHKF 494
           I  ++IRF  A++VQ     +   LS       W   + LF   +     +         
Sbjct: 473 INYSHIRFRAAMKVQNKTLDELPYLSQCGVIGSWYGVIVLFLVLVASFWTSLFPLGSGTA 532

Query: 495 DYKTFISGYIGIPVYLICYVGYKVVYRT--KLIKPEDVDLYTFKDAIDA 541
           D  +F  GY+ +P+ + CYVG+K+  R    L+K ED+DL T +  IDA
Sbjct: 533 DVTSFFEGYLSLPILIACYVGHKLYVRNLQVLVKLEDMDLETGRKHIDA 581

>CAGL0K05753g Chr11 (565111..567093) [1983 bp, 660 aa] {ON} highly
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508c GNP1
          Length = 660

 Score =  234 bits (596), Expect = 5e-68,   Method: Compositional matrix adjust.
 Identities = 153/535 (28%), Positives = 243/535 (45%), Gaps = 23/535 (4%)

Query: 19  ETLEEGIVTLESEGQVRSVSEGVDG----KHEGIRLKKELEARHVSMXXXXXXXXXXXXX 74
           E LE  + T  S   +  V     G    K E   LKK ++ RHV M             
Sbjct: 107 EDLENDLTTAISMNSLDRVQNKPTGNGQMKFEEEALKKSIKPRHVVMISLGTGIGTGLLV 166

Query: 75  XXXXXXXXXXPVSILISYSFVGLLVYTVMSCLGEMAAFIP--LDGFTSYASRYVDPAVGF 132
                     P  ++I Y+ +G  +Y ++   GEMA      L GF +Y S  VDP  GF
Sbjct: 167 GNAKALHNAGPAGLVIGYAIMGSCIYCIIQAAGEMAVVYSNLLGGFNTYPSMLVDPGFGF 226

Query: 133 AVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVNPGVWITIFLALIVLINTVGVRFFGE 192
           AV + Y  ++  V P +L   ++ +++W +   VNP  ++ IF  +I+ I   G R + E
Sbjct: 227 AVAWVYCLQWLCVCPLELVTTSLTIKYWTTT--VNPDAFVVIFYVVIIFIQIFGARGYAE 284

Query: 193 FEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGFRFWRDPGAFKPYSEAISGSKGKXX 252
            EF+ +  K                    N    G ++W DPGAF+  +  I   KG   
Sbjct: 285 AEFFFNCCKILMIIGFYILGIIINAGGAGNDGYLGAKYWHDPGAFRG-TNGIQRFKG--- 340

Query: 253 XXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVVFYVITILLLGMTVA 312
                       +  TE   + AAE  NPR+++P A K  LYR++  +V TI LLG  V 
Sbjct: 341 -IMATFVSAAFAFGATEFIALTAAEQSNPRKAIPSAAKKVLYRVICIFVGTIALLGFLVP 399

Query: 313 YNDPRLLXXXXXXXXXXXXPFVVAIENASIPVLPHIFNVCVLVFVFSACNSDLYVASRSL 372
           ++  +L+            P+V+AI    + V+PH  N  +L+ VFS  NS  Y +SR L
Sbjct: 400 WDSDQLMGAGGSATKAS--PYVLAISIHGVRVVPHFINAVILISVFSVANSAFYSSSRLL 457

Query: 373 YGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCLLAYMNVSSGSAQVFNYFVNVVSIFGL 432
            GLA  G AP+ F   ++ G P+ ++  + LF ++A+   S    QVF + + +  +  L
Sbjct: 458 LGLAQQGYAPKFFDYVDRQGRPFRAMCCAALFGVIAFCAASPKEDQVFTWLLAISGLSQL 517

Query: 433 LSWITILITYIRFDKAIRVQFGDKSSLSYTAAFQPWSTYVALFFCCLIGLIKNYTVFLG- 491
            +WI I +++IRF +A+ VQ      + + A    + +Y A     L  LI  + V +  
Sbjct: 518 FTWIAICVSHIRFRRAMTVQGRSLGEIGFKAQLGVYGSYYATIMMVL-ALIAQFWVAIAP 576

Query: 492 ----HKFDYKTFISGYIGIPVYLICYVGYKVVYRT--KLIKPEDVDLYTFKDAID 540
                  D + F   Y+ +P+ +  Y GYK+  R     I+ +D+DL +++   D
Sbjct: 577 IGNNGDLDAEGFFENYLAMPILIAFYFGYKLWKRDWRLFIRAKDIDLDSYRQVFD 631

>Suva_11.273 Chr11 (498611..500416) [1806 bp, 601 aa] {ON} YKR039W
           (REAL)
          Length = 601

 Score =  232 bits (591), Expect = 9e-68,   Method: Compositional matrix adjust.
 Identities = 155/580 (26%), Positives = 270/580 (46%), Gaps = 48/580 (8%)

Query: 1   MNSDTSMEKKNA------GVLYSNETLEEGIVTLESEGQVRSVSEGVDGKHEGIR----- 49
           M++ +S EK N       G+   +E L +  +T+ S G   S  +G   K +  R     
Sbjct: 1   MSNTSSYEKNNPENLKHNGITIDSEYLTQEPITIPSNGSAVSTEKGSGSKWKDFRDSFKR 60

Query: 50  ------------------------LKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXP 85
                                   LK +L+ RH+ M                       P
Sbjct: 61  VEPVEVDPNLTEAEKVAFITAQTPLKHQLKNRHLQMIAIGGAIGTGLLVGSGKALRTGGP 120

Query: 86  VSILISYSFVGLLVYTVMSCLGEMAAFIPLDG-FTSYASRYVDPAVGFAVGYSYLFKYFI 144
            S+LI +  +G ++Y ++  LGE+A   P+ G FT+YA+R++D + GFA  ++Y+ ++ +
Sbjct: 121 ASLLIGWGSMGTMIYAMVMALGELAVVFPISGGFTTYATRFIDESFGFAANFNYMLQWLV 180

Query: 145 VTPNQLTAGAMVMQFWVSRDRVNPGVWITIFLALIVLINTVGVRFFGEFEFWLSSVKXXX 204
             P ++ + ++ + +W +  +   G ++ +F  +IV IN  GV+ +GE EF  S +K   
Sbjct: 181 TLPLEIVSASITVNYWGTDPKYRDG-FVALFWLVIVCINMFGVKGYGEAEFVFSIIKVIT 239

Query: 205 XXXXXXXXXXXXXXXXPNHDRTGFRFWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXX 264
                           P     G +++ DPGAF     A      K              
Sbjct: 240 IIGFIILGIILNCGGGPEKGYIGGKYFHDPGAF-----AGDTPGAKFKGVCSVFVTAAFS 294

Query: 265 YTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVVFYVITILLLGMTVAYNDPRLLXXXXX 324
           + G+EL G+ A+E+ +PR+SVP+A K   +RI +FY++++L++G+ V YND RL+     
Sbjct: 295 FAGSELVGLAASESVDPRKSVPKAAKQVFWRITLFYILSLLMIGLLVPYNDSRLIGASSV 354

Query: 325 XXXXXXXPFVVAIENASIPVLPHIFNVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPRI 384
                  PFV+AI    I  LP + NV +L+ V S  NS ++  SR+   LA  G  P+I
Sbjct: 355 DAAAS--PFVIAIVTHGIKGLPSVVNVVILIAVLSVGNSAIFACSRTFVALAEQGFLPQI 412

Query: 385 FATTNKWGVPYYSLGLSVLFCLLAYMNVSSGSAQVFNYFVNVVSIFGLLSWITILITYIR 444
           FA  ++ G P   + ++    L+A++  S+    VFN+ + +  +  L +W  I I +IR
Sbjct: 413 FAYVDRKGRPLVGIIITSAVGLIAFVAASNKEEDVFNWLLALSGLSSLFTWGGICICHIR 472

Query: 445 FDKAIRVQFGDKSSLSYTAAFQPWSTYVALFFCCLIGLIKNYTVF--LGHKFDYKTFISG 502
           F KA+  Q      LS+ +    W +Y  LF   ++ + + Y     +      + F   
Sbjct: 473 FRKALTSQGRSVDELSFKSPTGVWGSYWGLFMIVIMFIAQFYVALFPVNGSPSAEGFFEA 532

Query: 503 YIGIPVYLICYVGYKVVYRT-KLIKPE-DVDLYTFKDAID 540
           Y+  P+ L  Y+G+K+  R  KL+ P  ++D+ + +  +D
Sbjct: 533 YLSFPLVLAMYIGHKIYKRNWKLLIPAGEMDIDSGRREVD 572

>KAFR0C00400 Chr3 (83280..85028) [1749 bp, 582 aa] {ON} 
          Length = 582

 Score =  231 bits (589), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 150/499 (30%), Positives = 235/499 (47%), Gaps = 17/499 (3%)

Query: 49  RLKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILISYSFVGLLVYTVMSCLGE 108
            LKK +++RHV M                       P +++I Y  V  + Y ++   GE
Sbjct: 65  HLKKAMKSRHVIMMTLGTGVGTGLLVANAKGLSYGGPGALVIGYILVSFVTYFMIQAAGE 124

Query: 109 MAAFIP-LDG-FTSYASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRV 166
           MA   P L G F +Y S ++   VGFA  + +L ++  V P +L  G M +Q+W   D +
Sbjct: 125 MAVTYPTLPGSFNTYTSTFISKPVGFATVWLFLIQWLTVLPLELITGTMTIQYW--NDSI 182

Query: 167 NPGVWITIFLALIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRT 226
           N  VWI IF   ++ ++  GV+ +GE EF  ++ K                         
Sbjct: 183 NADVWIVIFYVFLLCVHVFGVKAYGELEFIFNTCKILFIGGFIIFSIVVNAGGAGTDGYI 242

Query: 227 GFRFWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVP 286
           G ++W++PG+F     A S S G+              Y GTEL  +   E  NPRRS P
Sbjct: 243 GAKYWKNPGSF-----ASSTSAGRFKDVCYVLVTAYFSYGGTELYVLSVNEQANPRRSTP 297

Query: 287 RAIKLTLYRIVVFYVITILLLGMTVAYNDPRLLXXXXXXXXXXXXPFVVAIENASIPVLP 346
           +A K ++YRI++ Y++T++L+G  V +++ +L+            P+V+A     + V+P
Sbjct: 298 KAAKQSIYRILIIYLLTMILIGFNVPHDNDQLMGAGGSSTHAS--PYVLAASIHGVKVVP 355

Query: 347 HIFNVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCL 406
           HI N  +L+ V S  NS LY A R    LA  G AP+  A  ++ G P  +L    +  +
Sbjct: 356 HIINAVILICVTSMGNSSLYAAQRLFASLAEQGYAPKCLAYIDREGRPIIALAACAVVGV 415

Query: 407 LAYMNVSSGSAQVFNYFVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLSYTAAFQ 466
           +A+   SS   QVF +   + ++  L +W TIL+++IRF  A++VQ  D + L Y A   
Sbjct: 416 IAFAAASSQEEQVFTWLAAIAALSELFTWSTILLSHIRFRMAMKVQGKDLNELGYKALTG 475

Query: 467 PWSTYVALFFCCLIGLIKNYTVFL---GHKFDYKTFISGYIGIPVYLICYVGYKVVYR-- 521
            W +     FC L+  I  + V L   G     + F   Y+  P++L  Y  Y +  R  
Sbjct: 476 VWGSMWGFGFCVLV-FIAQFWVALSPPGGTISAEGFFESYLAFPLWLFFYFAYMLWKRDF 534

Query: 522 TKLIKPEDVDLYTFKDAID 540
           T L K ED+DL   +   D
Sbjct: 535 TFLTKLEDIDLDAHRRIYD 553

>YKR039W Chr11 (515063..516871) [1809 bp, 602 aa] {ON}  GAP1General
           amino acid permease; Gap1p senses the presence of amino
           acid substrates to regulate localization to the plasma
           membrane when needed
          Length = 602

 Score =  232 bits (591), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 160/581 (27%), Positives = 272/581 (46%), Gaps = 49/581 (8%)

Query: 1   MNSDTSMEKKNA------GVLYSNETLEEGIVTLESEGQVRSVSE-GVDGKHEGIR---- 49
           M++ +S EK N       G+   +E L +  +T+ S G   S+ E G   K +  +    
Sbjct: 1   MSNTSSYEKNNPDNLKHNGITIDSEFLTQEPITIPSNGSAVSIDETGSGSKWQDFKDSFK 60

Query: 50  -------------------------LKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXX 84
                                    LK  L+ RH+ M                       
Sbjct: 61  RVKPIEVDPNLSEAEKVAIITAQTPLKHHLKNRHLQMIAIGGAIGTGLLVGSGTALRTGG 120

Query: 85  PVSILISYSFVGLLVYTVMSCLGEMAAFIPLDG-FTSYASRYVDPAVGFAVGYSYLFKYF 143
           P S+LI +   G ++Y ++  LGE+A   P+ G FT+YA+R++D + G+A  ++Y+ ++ 
Sbjct: 121 PASLLIGWGSTGTMIYAMVMALGELAVIFPISGGFTTYATRFIDESFGYANNFNYMLQWL 180

Query: 144 IVTPNQLTAGAMVMQFWVSRDRVNPGVWITIFLALIVLINTVGVRFFGEFEFWLSSVKXX 203
           +V P ++ + ++ + FW +  +   G ++ +F   IV+IN  GV+ +GE EF  S +K  
Sbjct: 181 VVLPLEIVSASITVNFWGTDPKYRDG-FVALFWLAIVIINMFGVKGYGEAEFVFSFIKVI 239

Query: 204 XXXXXXXXXXXXXXXXXPNHDRTGFRFWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXX 263
                            P     G ++W DPGAF     A      K             
Sbjct: 240 TVVGFIILGIILNCGGGPTGGYIGGKYWHDPGAF-----AGDTPGAKFKGVCSVFVTAAF 294

Query: 264 XYTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVVFYVITILLLGMTVAYNDPRLLXXXX 323
            + G+EL G+ A+E+  PR+SVP+A K   +RI +FY++++L++G+ V YND  L+    
Sbjct: 295 SFAGSELVGLAASESVEPRKSVPKAAKQVFWRITLFYILSLLMIGLLVPYNDKSLIGASS 354

Query: 324 XXXXXXXXPFVVAIENASIPVLPHIFNVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPR 383
                   PFV+AI+   I  LP + NV +L+ V S  NS +Y  SR++  LA     P 
Sbjct: 355 VDAAAS--PFVIAIKTHGIKGLPSVVNVVILIAVLSVGNSAIYACSRTMVALAEQRFLPE 412

Query: 384 IFATTNKWGVPYYSLGLSVLFCLLAYMNVSSGSAQVFNYFVNVVSIFGLLSWITILITYI 443
           IF+  ++ G P   + ++  F L+A++  S    +VFN+ + +  +  L +W  I I +I
Sbjct: 413 IFSYVDRKGRPLVGIAVTSAFGLIAFVAASKKEGEVFNWLLALSGLSSLFTWGGICICHI 472

Query: 444 RFDKAIRVQFGDKSSLSYTAAFQPWSTYVALFFCCLIGLIKNY-TVF-LGHKFDYKTFIS 501
           RF KA+  Q      LS+ +    W +Y  LF   ++ + + Y  VF +G     + F  
Sbjct: 473 RFRKALAAQGRGLDELSFKSPTGVWGSYWGLFMVIIMFIAQFYVAVFPVGDSPSAEGFFE 532

Query: 502 GYIGIPVYLICYVGYKVVYRT-KLIKP-EDVDLYTFKDAID 540
            Y+  P+ ++ Y+G+K+  R  KL  P E +D+ T +  +D
Sbjct: 533 AYLSFPLVMVMYIGHKIYKRNWKLFIPAEKMDIDTGRREVD 573

>TDEL0C00930 Chr3 complement(147777..149564) [1788 bp, 595 aa] {ON} 
          Length = 595

 Score =  231 bits (589), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 143/497 (28%), Positives = 239/497 (48%), Gaps = 15/497 (3%)

Query: 50  LKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILISYSFVGLLVYTVMSCLGEM 109
           LK  L+ RH+ M                       P  ILI +   G ++Y+++  +GE+
Sbjct: 79  LKHHLKNRHLQMIAIGGAIGTGLFVGSGTALRTAGPAGILIGWGLTGTMIYSMVMAVGEL 138

Query: 110 AAFIPL-DGFTSYASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVNP 168
           A   P+  GFT+YA+R+VD + GFA  + Y+ ++ +V P ++ A ++ + +W +  +   
Sbjct: 139 AVVFPVAGGFTTYATRFVDESFGFAANFIYMLQWLVVLPLEIVAASITVNYWGTDPKYRD 198

Query: 169 GVWITIFLALIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGF 228
           G ++ +F  +IV+IN  GV+ +GE EF  S +K                    +H   G 
Sbjct: 199 G-FVALFYVVIVIINMFGVKGYGEAEFIFSFIKVITVIGFIIMAIVLICGGGKDHKYIGA 257

Query: 229 RFWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXX-XYTGTELCGIVAAEAKNPRRSVPR 287
           ++W +PGAF      +  + G+               + G+EL G+  +EA+ PR+SVP 
Sbjct: 258 QYWYNPGAF------VGDTAGQQFQGFCTVFVTAAFSFAGSELVGLAGSEAEEPRKSVPG 311

Query: 288 AIKLTLYRIVVFYVITILLLGMTVAYNDPRLLXXXXXXXXXXXXPFVVAIENASIPVLPH 347
           A K   +RI +FY++ +LL+GM V  + PRL+            PFV+AI N  I  LP 
Sbjct: 312 AAKQVFWRITLFYILCLLLIGMLVPSDSPRLIGASSVDAAAS--PFVIAIVNHGIKGLPS 369

Query: 348 IFNVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCLL 407
           + NV +L+ V S  NS +Y  SR+L  LA  G  P I    ++ G P   + +S  F L+
Sbjct: 370 VVNVVILIAVLSVGNSAIYSCSRTLAALADQGFLPSICGYIDRGGRPLVGIAISAFFGLI 429

Query: 408 AYMNVSSGSAQVFNYFVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLSYTAAFQP 467
           A++  S     VFN+ + +  +  L +W  I + +IR+  A+  Q      L + A    
Sbjct: 430 AFVAQSKKEGDVFNWLMALSGLSSLFTWAGICLCHIRYRGALAAQGRSTDELPFQAPAGV 489

Query: 468 WSTYVALFFCCLIGLIKNYTVFL--GHKFDYKTFISGYIGIPVYLICYVGYKVVYRT-KL 524
           W +Y   F C L+ + + Y      G K +   F   Y+   +++  Y  +K+  R  KL
Sbjct: 490 WGSYWGFFMCILMFIAQFYVGLFPPGTKPNAYDFFLAYLSFCIFIALYAFHKIWKRNWKL 549

Query: 525 IKP-EDVDLYTFKDAID 540
             P +D+D+ T +  +D
Sbjct: 550 FIPLKDLDIDTGRREVD 566

>TPHA0A00240 Chr1 complement(28756..30567) [1812 bp, 603 aa] {ON}
           Anc_5.158 YGR191W
          Length = 603

 Score =  231 bits (590), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 142/462 (30%), Positives = 238/462 (51%), Gaps = 14/462 (3%)

Query: 85  PVSILISYSFVGLLVYTVMSCLGEMAAFIPL-DGFTSYASRYVDPAVGFAVGYSYLFKYF 143
           P S++I ++ V   ++TV++ LGE+AA  P+  GF  Y +R+VDP+  F+V  +YL ++ 
Sbjct: 121 PASLVIGWTIVSTALFTVINSLGELAAAYPVVGGFNVYMTRFVDPSFAFSVNLNYLVQWL 180

Query: 144 IVTPNQLTAGAMVMQFWVSRDRVNPGVWITIFLALIVLINTVGVRFFGEFEFWLSSVKXX 203
           ++ P +L A ++ +++W   D +N   W+ IF  LI++ N + V+ FGE EF LS VK  
Sbjct: 181 VLLPLELVAASLTIRYW--DDTINSDAWVAIFYTLILIANLLDVKSFGETEFILSLVKIL 238

Query: 204 XXXXXXXXXXXXXXXXXPNHDRTGFRFWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXX 263
                            P     G ++W DPGAF   S   +G++ K             
Sbjct: 239 AIIGFFILGIVLTCGGGPKGGYIGGKYWHDPGAFVGDS---AGTQFKGLCSVFVTAAFS- 294

Query: 264 XYTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVVFYVITILLLGMTVAYNDPRLLXXXX 323
            Y G E+  + AAE++NPR+++P A K T + I   Y+  + L+G  VAYND RLL    
Sbjct: 295 -YAGIEMIAVSAAESQNPRKTIPTAAKRTFWIITFSYITILTLVGCLVAYNDTRLLNGSS 353

Query: 324 XXXXXXXXPFVVAIENASIPVLPHIFNVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPR 383
                   P V+AIEN  I  LP + N  +L+ + S  NS +Y  SR +  +A+ G  P+
Sbjct: 354 SVDVAAS-PLVIAIENGGIKGLPSLMNAIILIAILSVANSAVYACSRCMVSMALIGNLPK 412

Query: 384 IFATTNKWGVPYYSLGLSVLFCLLAYMNVSSGSAQVFNYFVNVVSIFGLLSWITILITYI 443
             +  +K G P  ++  ++ F LL+++  S    +VF +   +  +  +  W+ I I +I
Sbjct: 413 GLSVVDKRGRPLRAIFTTLFFGLLSFVAASDKQEEVFTWLSALSGLSTIFCWMGINIAHI 472

Query: 444 RFDKAIRVQFGDKSSLSYTAAFQPWSTY--VALFFCCLIGLIKNYTVFL-GHKFDYKTFI 500
           RF +A+ VQ      + Y +    + +Y   A+ F  LI         L G   D + F 
Sbjct: 473 RFRQAMTVQNRSLDEMPYLSQTGIYGSYYGTAILFLVLIASFWTSLFPLGGDGADAEAFF 532

Query: 501 SGYIGIPVYLICYVGYKVVYRT-KLIKP-EDVDLYTFKDAID 540
            GY+  P+ + CY+G+K+ ++  +++ P E++DL T +  +D
Sbjct: 533 EGYLSFPILIACYIGHKLYFKNWRIMTPLEEIDLLTGRKEVD 574

>NCAS0B07900 Chr2 (1500061..1501920) [1860 bp, 619 aa] {ON}
           Anc_1.244
          Length = 619

 Score =  231 bits (590), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 145/496 (29%), Positives = 245/496 (49%), Gaps = 13/496 (2%)

Query: 50  LKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILISYSFVGLLVYTVMSCLGEM 109
           L+  L+ R  +M                       P  ++I +     ++Y+++  LGE+
Sbjct: 103 LQHTLKGRQQTMIAIGGAIGSGLFVGSSTALRTGGPAGLIIGWGLTSTMIYSMVMALGEL 162

Query: 110 AAFIPL-DGFTSYASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVNP 168
           A   P+  GFT+YA+R+VD + G+A  ++Y  ++ +V P ++ + ++ + +W +  R   
Sbjct: 163 AVVFPVAGGFTTYATRFVDESFGYANNFNYALQWLVVLPLEIVSASITVNYWGTPTRYRD 222

Query: 169 GVWITIFLALIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGF 228
           G ++ +F  +IV+IN  GV+ FGE EF  S +K                   P     G 
Sbjct: 223 G-FVALFWLVIVIINMFGVKGFGEAEFVFSIIKVTTVIGFIILGIVLVCGGGPKGGFVGA 281

Query: 229 RFWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPRA 288
           ++W DPGAF  +     GS  +              + G+EL GI AAEA NPR+S+P A
Sbjct: 282 KYWHDPGAFVGH-----GSGAQFKGVCSVFVTAAFSFAGSELIGITAAEAANPRKSIPGA 336

Query: 289 IKLTLYRIVVFYVITILLLGMTVAYNDPRLLXXXXXXXXXXXXPFVVAIENASIPVLPHI 348
            K  ++RIV+FY+ T+ ++G+ V YND RL+            PFV+AI    I  LP +
Sbjct: 337 AKQVVWRIVLFYMGTLTMIGLLVPYNDKRLIGASSVDAAAS--PFVIAIVTHGIKGLPSV 394

Query: 349 FNVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCLLA 408
            NV +L+ V S  NS ++  SR++  L+  G  P++F   ++ G P   + ++  F LLA
Sbjct: 395 INVVILIAVLSVGNSAIFACSRTIAALSDQGFLPKVFGYIDRSGRPLVGIAITSTFGLLA 454

Query: 409 YMNVSSGSAQVFNYFVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLSYTAAFQPW 468
           ++  S    +VFN+ + +  +  L +W  I + +IRF  A++ Q  D + L++ +     
Sbjct: 455 FVAASKKEGEVFNWLLALSGLSSLFTWGGICLCHIRFRMALKAQGRDTNELTFVSPAGVA 514

Query: 469 STYVALFFCCLIGLIKNYTVFL--GHKFDYKTFISGYIGIPVYLICYVGYKVVYRT-KLI 525
            +Y  LF   L+ + + Y      G K D + F   Y+  P+ +  Y G+K+  R  KL 
Sbjct: 515 GSYWGLFMIVLMFIAQFYVALFPPGGKPDAEVFFQSYLSFPIVVATYFGHKIYKRNWKLF 574

Query: 526 KP-EDVDLYTFKDAID 540
            P ED+D+ T +   D
Sbjct: 575 IPLEDMDIDTGRRETD 590

>CAGL0B03773g Chr2 (373956..375773) [1818 bp, 605 aa] {ON} highly
           similar to uniprot|P06775 Saccharomyces cerevisiae
           YGR191w HIP1 Histidine permease
          Length = 605

 Score =  230 bits (586), Expect = 6e-67,   Method: Compositional matrix adjust.
 Identities = 144/499 (28%), Positives = 244/499 (48%), Gaps = 14/499 (2%)

Query: 49  RLKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILISYSFVGLLVYTVMSCLGE 108
            L K+L  RH+                         P S++I +  V   ++TV++ LGE
Sbjct: 87  NLNKDLSVRHLLTLAVGGAIGTGLFVNSGASLTTGGPASLVIGWVIVSTCLFTVINSLGE 146

Query: 109 MAAFIPL-DGFTSYASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVN 167
           +AA  P+  GF  Y +R+++P+  FA+  +YL ++ ++ P +L A ++ +++W   D++N
Sbjct: 147 LAAAFPVVGGFNVYITRFIEPSFAFAINLNYLAQWLVLLPLELVAASITIRYW--NDKIN 204

Query: 168 PGVWITIFLALIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTG 227
              W+ IF   I L N + V+ FGE EF LS VK                   P+    G
Sbjct: 205 SDAWVAIFYTAIALANMLDVKSFGETEFILSMVKILAIIGFGILGIVLTCGGGPHGGYIG 264

Query: 228 FRFWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPR 287
            ++W +PGAF  +S   +GS+ K              Y+G E+  + AAE++NP+ ++P+
Sbjct: 265 GKYWHNPGAFVGHS---AGSQFKGLCSVFVTAAFS--YSGIEMTAVSAAESRNPKETIPK 319

Query: 288 AIKLTLYRIVVFYVITILLLGMTVAYNDPRLLXXXXXXXXXXXXPFVVAIENASIPVLPH 347
           A K T + I V YV  + L+G  V YNDPRLL            P V+AIEN  I  LP 
Sbjct: 320 AAKRTFWLITVSYVGILTLIGCLVPYNDPRLLNGSSSVDAAAS-PLVIAIENGGIKGLPS 378

Query: 348 IFNVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCLL 407
           + N  +L+ + S  NS +Y  SR +  +A  G  P+  +  +K G P  ++ L++ F LL
Sbjct: 379 LMNAIILIAIVSVANSAVYACSRCMVSMAHIGNLPKFLSKVDKRGRPLNAILLTLFFGLL 438

Query: 408 AYMNVSSGSAQVFNYFVNVVSIFGLLSWITILITYIRFDKAIRVQ---FGDKSSLSYTAA 464
           +++  S    +VF +   +  +  +  W+ I ++ IRF  A++ Q     +   LS +  
Sbjct: 439 SFIAASDKQEEVFTWLSALSGLSTIFCWMAINLSLIRFRDAMKAQGRSLDEMPFLSQSGT 498

Query: 465 FQPWSTYVALFFCCLIGLIKNYTVFLGHKFDYKTFISGYIGIPVYLICYVGYKVVYRT-K 523
           +  W   + LF   +     +           K+F  GY+ +P+ + CYVG+K+  R  +
Sbjct: 499 WGAWYGVIVLFLVLVASFWTSLFPVGSSTASAKSFFEGYLSLPILIACYVGHKLWKRDWR 558

Query: 524 LIKP-EDVDLYTFKDAIDA 541
           L+ P  ++DL + +  +DA
Sbjct: 559 LLVPLMEMDLDSGRRVLDA 577

>KLLA0A06886g Chr1 complement(621646..623409) [1764 bp, 587 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 587

 Score =  229 bits (584), Expect = 7e-67,   Method: Compositional matrix adjust.
 Identities = 144/496 (29%), Positives = 246/496 (49%), Gaps = 18/496 (3%)

Query: 50  LKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILISYSFVGLLVYTVMSCLGEM 109
           LK+ L++RH+ M                       P  ILI ++  G ++Y ++  +GE+
Sbjct: 76  LKRTLKSRHLQMIAIGGAIGTGLFVGSGKALATAGPAGILIGWALTGTMIYCMVMAMGEL 135

Query: 110 AAFIPL-DGFTSYASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVNP 168
           A   P+  GFT+YASR+VD + GFA    Y+ ++ +V P ++ A ++ + +W + D+   
Sbjct: 136 AVTFPIAGGFTTYASRFVDESFGFAFNTIYMLQWLVVLPLEIVAASITVNYWGTPDKYRD 195

Query: 169 GVWITIFLALIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGF 228
           G ++ +F  +IV IN  GV+ +GE EF  S +K                   P     G 
Sbjct: 196 G-FVALFYVVIVAINFFGVKGYGEAEFIFSFIKVITVIGYIILGVILVCGGGPQGGYIGG 254

Query: 229 RFWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPRA 288
           R W +PGAF       +G KG               + G+EL G+ AAE  NPR+S+P A
Sbjct: 255 RLWHNPGAFA------NGFKG----VCSVFVTAAFSFAGSELVGLAAAETANPRKSLPSA 304

Query: 289 IKLTLYRIVVFYVITILLLGMTVAYNDPRLLXXXXXXXXXXXXPFVVAIENASIPVLPHI 348
            K   +RI +FY++ +L++G+ V Y   RL+            PFV++I+NA I  LP +
Sbjct: 305 AKQVFWRITLFYILALLMVGLLVPYTSDRLIGQSSVDAAAS--PFVISIQNAGIKGLPSV 362

Query: 349 FNVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCLLA 408
            NV +L+ V S  NS ++  SRS+  LA  G  P+IF   ++ G P   + ++ +F LL+
Sbjct: 363 INVVILIAVLSVGNSAVFACSRSMAALANQGSLPKIFGYIDRTGRPLVGIIVTCVFGLLS 422

Query: 409 YMNVSSGSAQVFNYFVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLSYTAAFQPW 468
           ++  S    +VF++ + +  +  L +W  I++ +IR  +A+  Q    + LS+TA    W
Sbjct: 423 FIAASPKEGEVFDWLLALSGLSSLFTWGGIMLCHIRVRRALAAQNRTTAELSFTAPTGVW 482

Query: 469 STYVALFFCCLIGLIKNYTVF--LGHKFDYKTFISGYIGIPVYLICYVGYKVVYRT-KL- 524
            +        LI + + +     +G K     F   Y+  P+ +  Y+G+K+  +  KL 
Sbjct: 483 GSVYGFVLIILILMAQFWIALFPIGDKPSASAFFEAYLSFPILIAFYIGHKIWKKNWKLF 542

Query: 525 IKPEDVDLYTFKDAID 540
           I+ +++D+ T +   D
Sbjct: 543 IRAKNIDIDTGRRETD 558

>KLTH0E15642g Chr5 (1389937..1391727) [1791 bp, 596 aa] {ON} similar
           to uniprot|P19145 Saccharomyces cerevisiae YKR039W GAP1
           General amino acid permease localization to the plasma
           membrane is regulated by nitrogen source
          Length = 596

 Score =  229 bits (585), Expect = 7e-67,   Method: Compositional matrix adjust.
 Identities = 139/496 (28%), Positives = 243/496 (48%), Gaps = 13/496 (2%)

Query: 50  LKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILISYSFVGLLVYTVMSCLGEM 109
           L++ L+ RH+ M                       P ++LI +  +GL++Y+V+  +GE+
Sbjct: 80  LQRHLKNRHLQMIAIGGAIGTGLFVGSGSALRTGGPAAVLIGWGLIGLMIYSVVMAMGEL 139

Query: 110 AAFIPL-DGFTSYASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVNP 168
           A   P+  GFT+Y  R+VD + GFA+ Y Y+ ++ +V P ++ A ++ + +W +  +   
Sbjct: 140 AVTFPVAGGFTTYIPRFVDDSFGFAINYIYMLQWLVVLPLEIVAASITVNYWGTPAKYRD 199

Query: 169 GVWITIFLALIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGF 228
           G ++ +F  +IV+IN  GV+ +GE EF  S +K                   P     G 
Sbjct: 200 G-FVALFYVVIVIINMFGVKGYGEAEFVFSIIKVTTVVGFIILGIVLICGGGPVGGYVGG 258

Query: 229 RFWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPRA 288
           ++W +PGAF         +  +              + GTEL G+ AAE +NPR+++PRA
Sbjct: 259 KYWHNPGAFNG-----DNAGQRFKAVCSVFVTAAFSFAGTELVGLAAAETENPRKALPRA 313

Query: 289 IKLTLYRIVVFYVITILLLGMTVAYNDPRLLXXXXXXXXXXXXPFVVAIENASIPVLPHI 348
            K   +RI +FY+I++ L+G+ V Y    L+            PFV+AI+   I  LP +
Sbjct: 314 AKQVFWRITLFYIISLCLIGLLVPYTSENLIGSSSVDAAAS--PFVLAIKTHGISGLPSV 371

Query: 349 FNVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCLLA 408
            NV +L+ V S  NS +Y  SR+L  LA  G  P+IF+  ++ G P   +  +  F LL 
Sbjct: 372 INVVILISVLSVGNSSVYACSRTLSALADQGFLPQIFSYIDRKGRPLVGILATCTFGLLC 431

Query: 409 YMNVSSGSAQVFNYFVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLSYTAAFQPW 468
           ++  S     VFN+ + +  +  L +W  I I ++RF +A+  Q      L++T+    W
Sbjct: 432 FIAQSKKEGDVFNWLMALSGLSSLFTWGFICICHLRFRRALAAQGRSTDELAFTSYVGVW 491

Query: 469 STYVALFFCCLIGLIKNYTVF--LGHKFDYKTFISGYIGIPVYLICYVGYKVVYR--TKL 524
            +Y  +   CL+ + + +     +G   +   F   Y+ + V L  Y+ +K+  R  T  
Sbjct: 492 GSYFGVILICLVFIAQFWIAVWPMGGTPNASDFFQAYLSVVVVLFFYLAHKLYTRNWTFA 551

Query: 525 IKPEDVDLYTFKDAID 540
            + +D+D+ T +  +D
Sbjct: 552 KRAKDIDIDTGRRELD 567

>YBR068C Chr2 complement(373861..375690) [1830 bp, 609 aa] {ON}
           BAP2High-affinity leucine permease, functions as a
           branched-chain amino acid permease involved in the
           uptake of leucine, isoleucine and valine; contains 12
           predicted transmembrane domains
          Length = 609

 Score =  229 bits (585), Expect = 7e-67,   Method: Compositional matrix adjust.
 Identities = 148/515 (28%), Positives = 240/515 (46%), Gaps = 19/515 (3%)

Query: 27  TLESEGQVRSVSEGVDGKHEGIRLKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPV 86
           T +       + +GV+      +LKK +++RHV M                       P 
Sbjct: 68  TKQINENTSDLEDGVESITSDSKLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLHYGGPA 127

Query: 87  SILISYSFVGLLVYTVMSCLGEMAAFIPL--DGFTSYASRYVDPAVGFAVGYSYLFKYFI 144
           +++I Y  V  + Y ++   GEMA   P     F +Y+S ++  + GFA  + Y F++  
Sbjct: 128 ALIIGYILVSFVTYFMIQAAGEMAVTYPTLPANFNAYSSIFISKSFGFATVWLYCFQWLT 187

Query: 145 VTPNQLTAGAMVMQFWVSRDRVNPGVWITIFLALIVLINTVGVRFFGEFEFWLSSVKXXX 204
           V P +L   +M +QFW   D++NP ++I IF   +V I+  GV+ +GE EF  +  K   
Sbjct: 188 VLPLELITASMTIQFW--NDKINPDIYILIFYVFLVFIHFFGVKAYGETEFIFNCCKILM 245

Query: 205 XXXXXXXXXXXXXXXXPNHDRTGFRFWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXX 264
                            N    G  +W +PGAF     A   S G+              
Sbjct: 246 IAGFIILSIVINCGGAGNDGYIGATYWHNPGAF-----AGDTSIGRFKNVCYILVTAYFS 300

Query: 265 YTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVVFYVITILLLGMTVAYNDPRLLXXXXX 324
           + G EL  +   E  NPR+S P A K ++YRIVV Y++T++L+G  V YND +L+     
Sbjct: 301 FGGMELFALSVQEQSNPRKSTPVAAKRSIYRIVVIYLLTMILIGFNVPYNDDQLMGAGGS 360

Query: 325 XXXXXXXPFVVAIENASIPVLPHIFNVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPRI 384
                  P+V+A     + ++PHI N  +L+ V S  NS LY   R +  LA  G AP+ 
Sbjct: 361 ATHAS--PYVLAASIHGVKIVPHIINAVILISVVSVANSSLYAGPRLICSLAQQGYAPKF 418

Query: 385 FATTNKWGVPYYSLGLSVLFCLLAYMNVSSGSAQVFNYFVNVVSIFGLLSWITILITYIR 444
               ++ G P  +L +  +F ++A++  SS    VF +   +  +  L +W +I+++++R
Sbjct: 419 LDYVDREGRPLRALIVCCVFGVIAFVAASSKEEIVFTWLAAIAGLSELFTWTSIMLSHLR 478

Query: 445 FDKAIRVQFGDKSSLSYTAAFQPWSTYVALFFCCLIGLIKNYTVFL-----GHKFDYKTF 499
           F +A++VQ      L Y A    W +   +FF  L+  +  + V L     G K D ++F
Sbjct: 479 FRQAMKVQGRSLDELGYKATTGIWGSIYGVFFNILV-FVAQFWVALAPLGNGGKCDAESF 537

Query: 500 ISGYIGIPVYLICYVGYKVVYRT-KLIKPED-VDL 532
              Y+  P++L  Y GY V  R   L+ P D +DL
Sbjct: 538 FQNYLAFPIWLAFYFGYMVYNRDFTLLNPLDKIDL 572

>KNAG0C02140 Chr3 complement(416347..418143) [1797 bp, 598 aa] {ON} 
          Length = 598

 Score =  229 bits (583), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 143/497 (28%), Positives = 239/497 (48%), Gaps = 14/497 (2%)

Query: 50  LKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILISYSFVGLLVYTVMSCLGEM 109
           L+  L+ RH+ M                       P  ILI +   G ++Y+++  LGE+
Sbjct: 81  LQHHLKNRHLQMIAIGGAIGTGLFVGSGTALRTAGPAGILIGWGLTGTMIYSMVMALGEL 140

Query: 110 AAFIPLDG-FTSYASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVNP 168
           A   P+ G FT+YA+R++D + GFA   +Y+ ++ +V P ++ A ++ + +W +  R   
Sbjct: 141 AVLFPVSGGFTTYATRFIDESYGFANNINYMLQWLVVLPLEIVAASITVNYWGTNPRYRD 200

Query: 169 GVWITIFLALIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGF 228
           G ++ +F   I +IN  GV+ +GE EF  S +K                   P     G 
Sbjct: 201 G-FVALFWLAIFIINLFGVKGYGEAEFIFSIIKVITVVGFIILGIILNCGGGPVKGYIGG 259

Query: 229 RFWRDPGAFKPYSEAISGSKG-KXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPR 287
           R+W       PY   +  S G +              + G+EL G+ +AE  NPR+SVP+
Sbjct: 260 RYWH-----HPYGAFVGDSAGARFKGVCSVFVTAAFSFAGSELVGLASAETANPRKSVPK 314

Query: 288 AIKLTLYRIVVFYVITILLLGMTVAYNDPRLLXXXXXXXXXXXXPFVVAIENASIPVLPH 347
           A K   +RI +FY++ + ++G+ V Y + RL+            PFV+AI    I  LP 
Sbjct: 315 AAKQVFWRITLFYLLALGMVGLLVPYTEKRLIGASSVDAAAS--PFVIAITTHGIRGLPS 372

Query: 348 IFNVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCLL 407
           + NV +L+ V S  NS +Y  SR+L  LA     P+ F   ++ G P YS+ ++  F L+
Sbjct: 373 VVNVVILIAVLSVGNSAIYACSRTLCALAEQNFLPKFFGYIDRSGRPLYSILVTSGFGLV 432

Query: 408 AYMNVSSGSAQVFNYFVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLSYTAAFQP 467
           A++  S    +VFN+ + +  +  L +W  I + +IRF KA+  Q      LS+ +    
Sbjct: 433 AFVAQSKKEGEVFNWLLALSGLSSLFTWGGICLCHIRFRKALSAQGRGTDELSFVSPAGV 492

Query: 468 WSTYVALFFCCLIGLIKNYTVFL--GHKFDYKTFISGYIGIPVYLICYVGYKVVYRT--K 523
           + +Y  LF   L+ + + Y      G K + K F   Y+  P+ + CY+G+K+  +    
Sbjct: 493 YGSYWGLFMIILMFIAQFYVALFPPGAKPNAKAFFEAYLSFPIVIACYLGHKIYKKNWKI 552

Query: 524 LIKPEDVDLYTFKDAID 540
            IK ED+D+ T +   D
Sbjct: 553 FIKAEDMDIDTGRKDDD 569

>KLTH0B02046g Chr2 complement(163199..164968) [1770 bp, 589 aa] {ON}
           similar to uniprot|P06775 Saccharomyces cerevisiae
           YGR191W HIP1 High-affinity histidine permease also
           involved in the transport of manganese ions
          Length = 589

 Score =  228 bits (582), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 144/545 (26%), Positives = 265/545 (48%), Gaps = 24/545 (4%)

Query: 2   NSDTSMEKKNAGVLYSNETLEEGIVTLESEGQVRSVSEGVDGKHEGIRLKKELEARHVSM 61
           ++D   + K   ++  +ET  + +  L+S  Q        + + +  R  K+L  RH+  
Sbjct: 34  SADDRADSKQKDLMSGSET--KALENLDSTSQ--------EVEDQDARYNKDLSVRHLLT 83

Query: 62  XXXXXXXXXXXXXXXXXXXXXXXPVSILISYSFVGLLVYTVMSCLGEMAAFIPL-DGFTS 120
                                  P S++I +  +   ++T+++ LGE+++  P+  GF  
Sbjct: 84  LAVGGAIGTGLFVNSGAALTTGGPGSLVIDWVIISTCLFTIVNALGELSSTFPVVGGFNV 143

Query: 121 YASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVNPGVWITIFLALIV 180
           Y SR+V+P+ GFAV  +YL ++ ++ P +L A ++ +++W     +N   W+ IF  +I+
Sbjct: 144 YISRFVEPSFGFAVNLNYLAQWAVLLPLELVAASLTIRYW--NHTINSDAWVAIFYTIIL 201

Query: 181 LINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGFRFWRDPGAFKPY 240
           L N + V+ FGE EF LS VK                   P     G ++W +PGAF  +
Sbjct: 202 LANLLDVKSFGETEFVLSMVKILAIIGFTILGIVLTCGGGPKGGYIGGKYWSNPGAFVGH 261

Query: 241 SEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVVFY 300
           +     +  +              Y+GTEL  + AAE+ NPR ++P+A K T + I V Y
Sbjct: 262 T-----AGDRFHGLCSVFVTAAFSYSGTELIAVSAAESVNPRITLPKACKRTFWLITVCY 316

Query: 301 VITILLLGMTVAYNDPRLLXXXXXXXXXXXXPFVVAIENASIPVLPHIFNVCVLVFVFSA 360
           ++ + L+G  V+ +DPRLL            P V+AIEN  I  LP + N  +L+ V S 
Sbjct: 317 IVVLTLVGCLVSSDDPRLLNGSSSVDVAAS-PLVIAIENGGIKGLPSLMNAIILIAVLSV 375

Query: 361 CNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCLLAYMNVSSGSAQVF 420
            NS +Y  SR +  +A  G  P++F   ++ G P Y++  +++F LL+++  S    +VF
Sbjct: 376 ANSAVYACSRCMASMAQIGNLPKVFTYVDRKGRPLYAIVATLIFGLLSFIAASDKQEEVF 435

Query: 421 NYFVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLSYTAAFQPWSTYVALFFCCLI 480
            +   +  +  L  W  I +++IRF + ++ +      L + +    W +Y       ++
Sbjct: 436 TWLSALSGLSTLFCWFAINVSHIRFRRTMKERGRTLDELPFVSMTGVWGSYYGCIVIFIV 495

Query: 481 GLIKNYTVFL---GHKFDYKTFISGYIGIPVYLICYVGYKVVYRT-KLIKP-EDVDLYTF 535
            ++  +T      G   + ++F   Y+  P+ L CY G+K+  R+ +L+ P +++DL + 
Sbjct: 496 LVVCFWTSLFPGGGEGANAESFFETYLSFPILLACYFGHKLYTRSWRLLTPTKEIDLDSG 555

Query: 536 KDAID 540
           + A+D
Sbjct: 556 RRAVD 560

>Skud_16.2 Chr16 complement(1584..3074) [1491 bp, 496 aa] {ON}
           YPL265W (REAL)
          Length = 496

 Score =  225 bits (573), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 141/453 (31%), Positives = 220/453 (48%), Gaps = 11/453 (2%)

Query: 49  RLKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILISYSFVGLLVYTVMSCLGE 108
           RLK+ L+ RH+ M                       PV +LI+Y FVG++V      + E
Sbjct: 47  RLKQGLKERHIKMLTLVGVFGTGLFLSSGGTLKKIGPVGLLIAYLFVGIVVGCNQIAIAE 106

Query: 109 MAAFIPLDGFT-SYASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVN 167
           +A+F+P  G T  +A +++D +VGF  G+  +  Y  + P +L+A A++M++W     V+
Sbjct: 107 VASFMPATGATIRHAEQFIDESVGFTFGW--ISTYSSLMPGELSATAVIMKYWTD---VS 161

Query: 168 PGVWITIFLALIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTG 227
           P V+IT+F  L V  N   +RF+GE E+    +K                      +R G
Sbjct: 162 PAVFITVFGVLFVATNIYTIRFYGEIEYVFGWLKLVLIFILIISGLVIDLGGVKGQERLG 221

Query: 228 FRFWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPR 287
           F +WRDPG F  Y   ++G  GK              Y+G +   I+A E KN R ++  
Sbjct: 222 FHYWRDPGPFANY--LVAGHIGKFVGFWAAISSVVYSYSGIQNIAILAGETKNSRYAIFH 279

Query: 288 AIKLTLYRIVVFYVITILLLGMTVAYNDPRLLXXXXXXXXXXXXPFVVAIENASIPVLPH 347
             K    RI+V Y++T+ +L + V YND  +             PFV+A+  A I VLPH
Sbjct: 280 GAKNVFLRIIVLYLVTVFVLTLIVPYNDKLI---ATGTGTAKSSPFVIAMNRAGIKVLPH 336

Query: 348 IFNVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCLL 407
           I N  +L   +SA N  +   SR+L+ LA   +AP+IF  T+K G+PY  +     F  L
Sbjct: 337 IVNALILTSAWSAGNLAIIEGSRNLFCLATKNQAPQIFLKTSKRGIPYVGVIFISSFLPL 396

Query: 408 AYMNVSSGSAQVFNYFVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLSYTAAFQP 467
           AYM+ S  SA VF +F  +VS   LL WI I   +I  D+A++ Q   +S L  +    P
Sbjct: 397 AYMSCSESSATVFGWFQELVSSNTLLRWILISANHIHMDRALKAQGYSRSDLPCSTRIAP 456

Query: 468 WSTYVALFFCCLIGLIKNYTVFLGHKFDYKTFI 500
           ++ + +     +      +  F+   FD ++F+
Sbjct: 457 FAAWFSGIMSVIFLFTGGFYNFMHGHFDIESFL 489

>Kpol_2000.92 s2000 (208509..210422) [1914 bp, 637 aa] {ON}
           (208509..210422) [1914 nt, 638 aa]
          Length = 637

 Score =  228 bits (582), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 157/518 (30%), Positives = 255/518 (49%), Gaps = 26/518 (5%)

Query: 36  SVSEGVDGKH--EGIRLKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILISYS 93
           S+SE   G    +   LKK ++ RHV M                       P +++I Y+
Sbjct: 104 SISETNKGHQNEKSEDLKKTIKPRHVIMISLGTGIGTGLLVGNGPVLSKAGPAALVIGYA 163

Query: 94  FVGLLVYTVMSCLGEMAA-FIPLDG-FTSYASRYVDPAVGFAVGYSYLFKYFIVTPNQLT 151
            +G  +Y ++   GE+A  +  L+G F +Y S  VDPA+GF+V + Y  ++  V P +L 
Sbjct: 164 IMGTCLYCIIQAAGELAVVYSDLNGGFNAYPSFLVDPALGFSVAWVYCLQWLCVCPLELV 223

Query: 152 AGAMVMQFWVSRDRVNPGVWITIFLALIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXX 211
             +M +++W ++  V+P V++ IF  LI+ INT G R + E EF+ +  K          
Sbjct: 224 TASMTIKYWTTK--VDPDVFVVIFYVLIIAINTFGARGYAEAEFFFNCCKVLMMTGFFIL 281

Query: 212 XXXXXXXXXPNHDRTGFRFWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELC 271
                     N    G ++W DPGAF    ++I   KG               +  TE  
Sbjct: 282 GIIITAGGAGNDGYLGAKYWHDPGAFNG-DKSIDRFKG----VMDTFVTAAFAFGATEFI 336

Query: 272 GIVAAEAKNPRRSVPRAIKLTLYRIVVFYVITILLLGMTVAYNDPRLLXXXXXXXXXXXX 331
            + AAE  NPR+++P A K  LYRIV  ++ +I L+G  V YN  +LL            
Sbjct: 337 ALTAAEQSNPRKAIPSAAKKVLYRIVCIFLASITLIGFLVPYNSDQLLGSGGSGIKAS-- 394

Query: 332 PFVVAIENASIPVLPHIFNVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPRIFATTNKW 391
           P+V+A+ +  + V+PH  N  +L+ V S  NS  Y +SR L  LA  G AP+ F   ++ 
Sbjct: 395 PYVIAVSSHGVRVVPHFINAVILLSVLSVGNSAFYSSSRLLLSLAQQGYAPKWFDYVDRE 454

Query: 392 GVPYYSLGLSVLFCLLAYMNVSSGSAQVFNYFVNVVSIFGLLSWITILITYIRFDKAIRV 451
           G P+ ++ +S LF ++A+   S    +VF++ + +  +  L +WITI +++IRF +A++V
Sbjct: 455 GRPFRAMLMSALFGVIAFCATSPKETEVFSWLLAISGLSQLFTWITICVSHIRFRRAMQV 514

Query: 452 Q---FGDKSSLSYTAAFQPWSTYVALFFCCLIGLIKNYTVFLG----HKFDYKTFISGYI 504
           Q    G+   LS +  +   S Y A+     + LI  + V +      K D + F   Y+
Sbjct: 515 QGRSLGEVGYLSQSGVYG--SAYAAIML--FLALIAQFWVAIAPIGEGKLDAENFFQNYL 570

Query: 505 GIPVYLICYVGYKVVYRT-KL-IKPEDVDLYTFKDAID 540
            +P+ +  Y GY+V  R  KL I+ +D+DL T +   D
Sbjct: 571 AMPILIAFYFGYRVWKRDWKLFIRAKDIDLDTHRQIFD 608

>Skud_3.38 Chr3 complement(63096..64997) [1902 bp, 633 aa] {ON}
           YCL025C (REAL)
          Length = 633

 Score =  228 bits (581), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 144/499 (28%), Positives = 234/499 (46%), Gaps = 18/499 (3%)

Query: 50  LKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILISYSFVGLLVYTVMSCLGEM 109
           LKK ++ RHV M                       P  +LI Y+ +G ++Y ++   GE+
Sbjct: 116 LKKTIQPRHVLMIALGTGIGTGLLVGNGTALVHAGPAGLLIGYAIMGSILYCIIQACGEL 175

Query: 110 AAFIP--LDGFTSYASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVN 167
           A        G+ +Y S  VD   GFAV + Y  ++  V P +L   +M +++W +   VN
Sbjct: 176 ALVYSNLTGGYNAYPSFLVDDGFGFAVAWVYCLQWLCVCPLELVTASMTIKYWTTS--VN 233

Query: 168 PGVWITIFLALIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTG 227
           P V++ IF  L++ IN  G R + E EF+ +  K                    N    G
Sbjct: 234 PDVFVIIFYVLVITINIFGARGYAEAEFFFNCCKILMMTGFFILSIIIDVGGAGNDGFIG 293

Query: 228 FRFWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPR 287
            ++W DPGAF     +I   KG               + G+E   I  AE  NPR+++P 
Sbjct: 294 GKYWHDPGAFNG-KHSIDRFKG----VVATLVTAAFAFGGSEFIAITTAEQSNPRKAIPG 348

Query: 288 AIKLTLYRIVVFYVITILLLGMTVAYNDPRLLXXXXXXXXXXXXPFVVAIENASIPVLPH 347
           A K  +YRI+  ++ TI++LG  V YN  +LL            P+V+AI +  + V+PH
Sbjct: 349 AAKQMIYRILFLFLATIIMLGFLVPYNSDQLLGSGGGGTKAS--PYVIAIASHGVRVVPH 406

Query: 348 IFNVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCLL 407
             N  +L+ V S  NS  Y ++R    L+  G AP+ F+  ++ G P  ++G+S LF ++
Sbjct: 407 FVNAVILLSVLSMANSSFYSSARLFLTLSEQGYAPKFFSYIDRAGRPLIAMGVSALFAVI 466

Query: 408 AYMNVSSGSAQVFNYFVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLSYTAAFQP 467
           A+   S    QVF + + +  +  L +W  I  ++IRF +A++VQ      L + +    
Sbjct: 467 AFCAASPKEEQVFTWLLAISGLSQLFTWTAICFSHIRFRRAMKVQGRSLGELGFKSQTGV 526

Query: 468 WSTYVALFFCCLIGLIKNYTVFLG----HKFDYKTFISGYIGIPVYLICYVGYKVVYRT- 522
           W +  A     LI LI  + V +      K D + F   Y+ +P+ +  YVGYK+  +  
Sbjct: 527 WGSMYACIMMLLI-LIGQFWVAIAPIGEGKLDAQAFFENYLAMPILIALYVGYKIWTKDW 585

Query: 523 KL-IKPEDVDLYTFKDAID 540
           KL I+ + +DL + +   D
Sbjct: 586 KLFIRADKIDLESHRQIFD 604

>SAKL0D02970g Chr4 (245449..247254) [1806 bp, 601 aa] {ON}
           uniprot|Q875S5 Saccharomyces kluyveri BAP2
          Length = 601

 Score =  227 bits (579), Expect = 5e-66,   Method: Compositional matrix adjust.
 Identities = 156/545 (28%), Positives = 253/545 (46%), Gaps = 33/545 (6%)

Query: 5   TSMEKKNAGVLYSNETLEEGIVTLESEGQVRSVSEGVDGKHEGIRLKKELEARHVSMXXX 64
            S ++ N+    +++ LE   +       VRS S          + K+ +++RHV M   
Sbjct: 52  NSFKRANSDTFDASQDLEGASIN-----SVRSNS----------KFKQSMKSRHVVMMSL 96

Query: 65  XXXXXXXXXXXXXXXXXXXXPVSILISYSFVGLLVYTVMSCLGEMAAFIP-LDG-FTSYA 122
                               P  +LI YS V ++ Y +M   GEMA   P L G F  Y+
Sbjct: 97  GTGIGTGLLVANGKSLHFGGPAGLLIGYSLVSVVAYIMMQAAGEMAVAYPTLPGNFNVYS 156

Query: 123 SRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVNPGVWITIFLALIVLI 182
           S ++  + GFA  + Y  ++  V P +L   ++ +++W S   +NP  +I IF A+IV I
Sbjct: 157 SIFISKSFGFATVWLYCLQWLTVLPLELITASLTIKYWNSS--INPDAFIAIFYAVIVFI 214

Query: 183 NTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGFRFWRDPGAFKPYSE 242
           +  G   +GE EF  S+ K                         G  +WR+PGAF   S 
Sbjct: 215 HFFGAAGYGEAEFIFSTCKVSMIAGFIILSIVINCGGAGTGGYIGGEYWRNPGAFAGGSP 274

Query: 243 AISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVVFYVI 302
                 G               Y G EL  +   E  NPR++VP A K  +YRI++ Y++
Sbjct: 275 I-----GHFKGIAYVLVTAYFSYGGMELFALTVNEQANPRKAVPSATKKCIYRILIIYML 329

Query: 303 TILLLGMTVAYNDPRLLXXXXXXXXXXXXPFVVAIENASIPVLPHIFNVCVLVFVFSACN 362
           T++L+G  V YN   L+            P+V+A+ +  + V+PHI N  +L+ V S  N
Sbjct: 330 TMILIGFLVPYNSDELMGSSGKSATHAS-PYVIAVASHGVKVVPHIINAVILISVVSVGN 388

Query: 363 SDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCLLAYMNVSSGSAQVFNY 422
           S +Y A R L  LA  G AP+IF+  ++ G P  +L    +F LL+++  S    QVF +
Sbjct: 389 SAMYSAPRLLNSLAEQGYAPKIFSYVDRAGRPLVALVGCSIFGLLSFVAASDKEEQVFTW 448

Query: 423 FVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLSYTAAFQPWSTYVALFFCCLIGL 482
              +  +  L +W  I ++++RF  A++ Q    S L Y +    W +  A+FF  ++  
Sbjct: 449 LAAIAGLSELFTWSAICLSHVRFRDAMKYQGYSLSELGYKSKTGYWGSIYAIFFNIIV-F 507

Query: 483 IKNYTVFL-----GHKFDYKTFISGYIGIPVYLICYVGYKVVYRT-KLIKP-EDVDLYTF 535
           +  + V L     G K D + F   Y+  P+++ CYVGYK+  +  KL+ P +++DL + 
Sbjct: 508 VAQFWVALAPIGNGGKADAEAFFQSYLAFPIWISCYVGYKIYSKEWKLLVPLDEIDLNSH 567

Query: 536 KDAID 540
           +   D
Sbjct: 568 RHIFD 572

>Suva_2.716 Chr2 complement(1256781..1258592) [1812 bp, 603 aa] {ON}
           YKR039W (REAL)
          Length = 603

 Score =  226 bits (577), Expect = 8e-66,   Method: Compositional matrix adjust.
 Identities = 150/498 (30%), Positives = 251/498 (50%), Gaps = 17/498 (3%)

Query: 50  LKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILISYSFVGLLVYTVMSCLGEM 109
           LK  L++RH+ M                       P  ILI ++  G ++Y+++  +GE+
Sbjct: 87  LKHTLKSRHLHMIAVGGAIGTGLFVGSGKALRTAGPAGILIGWTVTGTMIYSMVMAVGEL 146

Query: 110 AAFIPLDG-FTSYASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVNP 168
           A   P+ G FT+YA+R++D + GFA+ ++Y+ ++ I  P ++ + ++ + +W    +   
Sbjct: 147 AVVFPVSGGFTTYATRFIDESFGFAINFNYMLQWLITLPLEIVSASITVNYWGVDAKYRD 206

Query: 169 GVWITIFLALIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGF 228
           G ++ +F    V+IN  GV+ +GE EF  + +K                   P     G 
Sbjct: 207 G-FVALFWVFTVIINLFGVKGYGEAEFVFAIIKVVTIIGFIIMAVILICGGGPVGGYIGA 265

Query: 229 RFWRDPGAFKPYSEAISGSKG-KXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPR 287
           ++W  PGAF      +  + G K              + G+E+ G+  +E++NPR+SVP 
Sbjct: 266 KYWHHPGAF------VGDTAGQKFKGFCTVFITASFSFGGSEVVGVAGSESENPRKSVPG 319

Query: 288 AIKLTLYRIVVFYVITILLLGMTVAYNDPRLLXXXXXXXXXXXXPFVVAIENASIPVLPH 347
           A K   +RI +FYV+ +LL+GM V YND RL+            PFV+A+ N  I  LP 
Sbjct: 320 AAKQVFWRITLFYVLCLLLIGMLVPYNDKRLIGASSVDAAAS--PFVIAVVNQGIRGLPS 377

Query: 348 IFNVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCLL 407
           + NV +L+ V S  NS +Y+ SR+L  LA  G  P+I A  ++ G P  ++G++  F L+
Sbjct: 378 VINVVILISVLSVGNSSIYLCSRTLTALAEQGFLPKIVAYIDRNGRPLVAIGIASAFGLI 437

Query: 408 AYMNVSSGSAQVFNYFVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLSYTAAFQP 467
           A++  SS   +VFN+ + +  +  L SW  I I +IRF +A+  Q      L + +    
Sbjct: 438 AFVAESSHEGEVFNWLLALSGLSSLFSWSAICICHIRFRRALVAQGRSTDELPFVSTVGI 497

Query: 468 WSTYVALFFCCLIGLIKNYTVFL---GHKFDYKTFISGYIGIPVYLICYVGYKVVYRT-K 523
             +Y  +F C L+ LI  + V L   G   + K F   Y+  P+ L  Y+ +K+  +  K
Sbjct: 498 AGSYWGIFICVLM-LIAQFYVGLFPAGASPNAKDFFMAYLSFPIVLAFYIFHKIWKKNWK 556

Query: 524 L-IKPEDVDLYTFKDAID 540
           L IK ED+D+ T +  +D
Sbjct: 557 LYIKAEDMDIDTGRREVD 574

>NDAI0B05220 Chr2 (1278386..1280221) [1836 bp, 611 aa] {ON}
           Anc_1.244
          Length = 611

 Score =  227 bits (578), Expect = 9e-66,   Method: Compositional matrix adjust.
 Identities = 146/496 (29%), Positives = 243/496 (48%), Gaps = 13/496 (2%)

Query: 50  LKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILISYSFVGLLVYTVMSCLGEM 109
           LK  L+ RH+ M                       P  I+I +     ++Y ++  LGE+
Sbjct: 95  LKHTLKGRHMQMVAIGGAIGSGLFVGSSTALRTAGPAGIVIGWGLTSTMIYCMVMALGEL 154

Query: 110 AAFIPLDG-FTSYASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVNP 168
           A   P+ G FT+YA+R++D + GFA  ++Y  ++    P ++ + ++ + +W + +R   
Sbjct: 155 AVVFPVSGGFTTYATRFIDESFGFASNFNYALQWLATLPLEIVSASITVNYWQTPERYRD 214

Query: 169 GVWITIFLALIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGF 228
           G ++ +F  +IV+IN  GVR FGE EF  S++K                   P     G 
Sbjct: 215 G-FVALFWLVIVIINLFGVRGFGEAEFVFSTIKVLTVIGFIILGIVLVAGGGPEGGFVGG 273

Query: 229 RFWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPRA 288
           R+W +PGAF   +   +G++ K              + G+EL GI AAEA NPR+SVPRA
Sbjct: 274 RYWHNPGAFVGDN---AGTQFKGVCSVFVTAAFS--FAGSELVGITAAEAANPRKSVPRA 328

Query: 289 IKLTLYRIVVFYVITILLLGMTVAYNDPRLLXXXXXXXXXXXXPFVVAIENASIPVLPHI 348
            K  ++RIV+FY+ +++++G+ V Y DPRL+            PFV+AI    I  LP +
Sbjct: 329 AKQVVWRIVLFYMGSLIMIGLLVPYTDPRLIGASSVDASAS--PFVIAIVTHGIRGLPSV 386

Query: 349 FNVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCLLA 408
            NV +L+ V S  NS ++  SR++  L+  G  P IF   ++ G P   + +   F L+A
Sbjct: 387 INVVILIAVLSVGNSAIFAGSRTIAALSEQGFLPEIFGYIDRKGRPLVGIIVISTFGLIA 446

Query: 409 YMNVSSGSAQVFNYFVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLSYTAAFQPW 468
           ++  S    +VF + + +  +  L +W  I + +IRF  A++ Q    + L + +     
Sbjct: 447 FIAASKKQGEVFAWLMALSGLSSLFTWGGICLCHIRFRMALKAQGRSTNELPFVSPAGII 506

Query: 469 STYVALFFCCLIGLIKNYTVFL--GHKFDYKTFISGYIGIPVYLICYVGYKVVYRT-KL- 524
            +   LF   L+ + + Y      G K   + F   Y+  P+ L  Y G+K+  +  KL 
Sbjct: 507 GSSWGLFMLLLMFIAQFYVALFPPGSKPSAEVFFESYLSFPIVLAFYFGHKIYKKNWKLF 566

Query: 525 IKPEDVDLYTFKDAID 540
           IK ED+D+ T +   D
Sbjct: 567 IKAEDMDIDTGRRETD 582

>Suva_3.189 Chr3 complement(285493..287394) [1902 bp, 633 aa] {ON}
           YCL025C (REAL)
          Length = 633

 Score =  227 bits (578), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 144/504 (28%), Positives = 237/504 (47%), Gaps = 18/504 (3%)

Query: 45  HEGIRLKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILISYSFVGLLVYTVMS 104
           H+   LKK ++ RHV M                       P  +LI Y+ +G ++Y ++ 
Sbjct: 111 HKSDSLKKTIQPRHVLMIALGTGIGTGLLVGNGTALVHAGPAGLLIGYAIMGSILYCIIQ 170

Query: 105 CLGEMAAFIP--LDGFTSYASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVS 162
             GEMA        G+ +Y S  VD   GFAV + Y  ++  V P +L   +M +++W +
Sbjct: 171 ACGEMALVYSNLTGGYNAYPSFLVDDGFGFAVAWVYCLQWLCVCPLELVTASMTIKYWTT 230

Query: 163 RDRVNPGVWITIFLALIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPN 222
              VNP V++ IF  L++ IN  G R + E EF+ +  K                    N
Sbjct: 231 S--VNPDVFVIIFYVLVITINIFGARGYAEAEFFFNCCKILMMTGFFILGIIIDVGGAGN 288

Query: 223 HDRTGFRFWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPR 282
               G ++W +PGAF     AI   KG               + G+E   I  AE  NPR
Sbjct: 289 DGYIGGKYWHEPGAFNGV-HAIDRFKG----VVATLVTAAFAFGGSEFIAITTAEQSNPR 343

Query: 283 RSVPRAIKLTLYRIVVFYVITILLLGMTVAYNDPRLLXXXXXXXXXXXXPFVVAIENASI 342
           +++P A K  +YRI+  ++ TI+++G  V YN  +LL            P+V+AI +  +
Sbjct: 344 KAIPGAAKQMIYRILFLFLATIIIVGFLVPYNSDQLLGSSGGGTKAS--PYVIAIASHGV 401

Query: 343 PVLPHIFNVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSV 402
            V PH  N  +L+ V S  NS  Y ++R    L+  G AP+IF+  ++ G P  ++ +S 
Sbjct: 402 RVAPHFVNAVILLSVLSMANSSFYSSARLFLTLSEQGYAPKIFSYIDRAGRPLIAMCVSA 461

Query: 403 LFCLLAYMNVSSGSAQVFNYFVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLSYT 462
           LF ++A+   S    QVF + + +  +  L +W  I +++IRF +A++VQ      L + 
Sbjct: 462 LFAVIAFCAASPKEDQVFTWLLAISGLSQLFTWTAICLSHIRFRRAMKVQGRSLGELGFK 521

Query: 463 AAFQPWSTYVALFFCCLIGLIKNYTVFLG----HKFDYKTFISGYIGIPVYLICYVGYKV 518
           +    W +  +     LI LI  + V +      K D + F   Y+ +P+ ++ YVGYK+
Sbjct: 522 SQTGVWGSIYSCIMMILI-LIGQFWVAIAPIGEGKLDAQAFFENYLAMPILIVLYVGYKM 580

Query: 519 VYRT-KL-IKPEDVDLYTFKDAID 540
             +  KL I+ + +DL + +   D
Sbjct: 581 WNKDWKLFIRADKIDLTSHRQIFD 604

>NCAS0D01870 Chr4 complement(343416..345203) [1788 bp, 595 aa] {ON}
           Anc_5.158
          Length = 595

 Score =  226 bits (576), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 141/497 (28%), Positives = 245/497 (49%), Gaps = 14/497 (2%)

Query: 50  LKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILISYSFVGLLVYTVMSCLGEM 109
           L K+L  RH+                         P S++I +  +   ++TV++ LGE+
Sbjct: 78  LNKDLSIRHLLTLAVGGAIGVGLFVNSGAALASGGPASLVIDWVIISTCLFTVINSLGEL 137

Query: 110 AAFIPL-DGFTSYASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVNP 168
           AA  P+  GF  Y +R+VDP+  FAV  +YL ++ ++ P +L A ++ +++W S   +N 
Sbjct: 138 AAAFPVVGGFNVYITRFVDPSFAFAVNLNYLAQWLVLLPLELVAASITIKYWNST--INS 195

Query: 169 GVWITIFLALIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGF 228
             W+ IF  +I L N + V+ FGE EF LS VK                   P     G 
Sbjct: 196 DAWVAIFYTVITLANMLDVKSFGETEFVLSMVKILAIIGFTILGIVLSCGGGPKGGYLGG 255

Query: 229 RFWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPRA 288
           ++W +PGAF  ++   SG+K K              Y+G E+  + AAE+K+PR+++P+A
Sbjct: 256 KYWHNPGAFVGHT---SGTKFKGLCSVFVTAAFS--YSGIEMTAVSAAESKDPRKTIPKA 310

Query: 289 IKLTLYRIVVFYVITILLLGMTVAYNDPRLLXXXXXXXXXXXXPFVVAIENASIPVLPHI 348
            K T + I   YV  + L+G  V Y+DPRL+            P V+AIEN  I  L  +
Sbjct: 311 AKRTFWLITASYVTILTLVGCLVPYDDPRLMSGTSSVDAAAS-PLVIAIENGGIKGLDSL 369

Query: 349 FNVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCLLA 408
            N  +L+ + S  NS +Y  SR +  +A  G  P+     +K G P  +  +++ F LL+
Sbjct: 370 MNAIILISIISVANSAVYACSRCMVSMAHIGNLPKKLGKVDKRGRPINATLVTLFFGLLS 429

Query: 409 YMNVSSGSAQVFNYFVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLSYTAAFQPW 468
           ++  S    +VF +   +  +  +  W+ I I++IRF +A+  Q      + Y +    W
Sbjct: 430 FIAASDKQNEVFTWLSALSGLSTIFCWMAINISHIRFRQAMIKQNRSLDEMPYLSQTGVW 489

Query: 469 STYVALFFCCLIGLIKNYTVFL---GHKFDYKTFISGYIGIPVYLICYVGYKVVYR--TK 523
            +   +    L+ +   +T      G   D ++F  GY+ +P+ ++CY+G+K+ ++  + 
Sbjct: 490 GSLYGVVVLFLVLVASFWTSLFPLGGDSADVQSFFEGYLSLPILIVCYIGHKLYFKNWSW 549

Query: 524 LIKPEDVDLYTFKDAID 540
           ++  E++DL T + A+D
Sbjct: 550 VVTLEEMDLDTGRKALD 566

>TPHA0B01090 Chr2 complement(246708..248528) [1821 bp, 606 aa] {ON}
           Anc_1.244 YKR039W
          Length = 606

 Score =  226 bits (576), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 140/496 (28%), Positives = 248/496 (50%), Gaps = 13/496 (2%)

Query: 50  LKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILISYSFVGLLVYTVMSCLGEM 109
           LK  L++RH+ M                       P S++I +S  G ++Y+++  + EM
Sbjct: 89  LKHHLKSRHLQMIAIGGAIGTGLFVGSGTALRTAGPASLIIGWSITGSMIYSMVMAVAEM 148

Query: 110 AAFIPLDG-FTSYASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVNP 168
           A   P+ G FT+YA+R++D + GFA  ++Y+ ++ +V P ++ + ++ + +W +  +   
Sbjct: 149 AVLYPISGGFTTYATRFIDESFGFANNFNYMLQWLVVLPLEIVSASITVNYWGTPTKYRD 208

Query: 169 GVWITIFLALIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGF 228
           G ++ +F  +IV+IN  GV+ +GE EF  S++K                   P     G 
Sbjct: 209 G-FVALFWLVIVIINLFGVKGYGEAEFIFSTIKVITVVGFIILGLVLVCGGGPTGGYVGA 267

Query: 229 RFWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPRA 288
           ++W DPGAF     A +G++ +              ++G+EL GI  +EA+NPR++VP A
Sbjct: 268 KYWHDPGAF---VGATAGAQFQGFCSVFVTAAFS--FSGSELIGIAGSEAENPRKAVPPA 322

Query: 289 IKLTLYRIVVFYVITILLLGMTVAYNDPRLLXXXXXXXXXXXXPFVVAIENASIPVLPHI 348
            K   +RI++FY++++L +G+ V  ND RL+            PFV+AI    I  LP +
Sbjct: 323 AKQVFWRILLFYILSLLFIGLLVPSNDSRLIGSSNVDAAAS--PFVIAITVHGIRGLPSV 380

Query: 349 FNVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCLLA 408
            NV +L+ V S  NS +Y  SR+L  LA  G  P++ +  ++ G P   + +S  F L+A
Sbjct: 381 INVVILIAVLSVGNSAIYTCSRTLVALAEQGFLPKVVSYIDRSGRPLVGIAISSFFGLVA 440

Query: 409 YMNVSSGSAQVFNYFVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLSYTAAFQPW 468
           ++  S     VFN+ + +  +    +W  I + +IRF  A++ Q      L + +    +
Sbjct: 441 FVAQSDKEGDVFNWLLAISGLSSFFTWGAICLCHIRFRAALKAQNRSTDELPFVSPLGVF 500

Query: 469 STYVALFFCCLIGLIKNYTVF--LGHKFDYKTFISGYIGIPVYLICYVGYKVVYRT-KLI 525
            +Y  LF   L+   + Y     +G       F S Y+ +PV L+ Y+ +K+  +  K+ 
Sbjct: 501 GSYWGLFLIVLMLAAQFYVAIFPVGDTPSATNFFSAYLSLPVVLVMYIAHKLWTKNWKIF 560

Query: 526 KP-EDVDLYTFKDAID 540
            P   +DL T +  +D
Sbjct: 561 IPLGQLDLDTGRKQLD 576

>SAKL0C01232g Chr3 (110269..112110) [1842 bp, 613 aa] {ON} similar
           to uniprot|P48813 Saccharomyces cerevisiae YDR508C GNP1
           High-affinity glutamine permease also transports Leu Ser
           Thr Cys Met and Asn expression is fully dependent on
           Grr1p and modulated by the Ssy1p-Ptr3p-Ssy5p (SPS)
           sensor of extracellular amino acids
          Length = 613

 Score =  226 bits (575), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 146/510 (28%), Positives = 241/510 (47%), Gaps = 17/510 (3%)

Query: 39  EGVDGKHEGI-RLKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILISYSFVGL 97
           +G D   +G  +LKK +++RHV M                       P  ++I Y+ +G 
Sbjct: 84  DGSDAGDKGDNKLKKTIKSRHVVMISLGTGIGTGMLVGNGKALRNGGPAGLVIGYAIMGS 143

Query: 98  LVYTVMSCLGEMA-AFIPLDG-FTSYASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAM 155
            +Y ++   GE+A  +  L G F +Y S  +DPA+GF+V + Y  ++  V P +L   ++
Sbjct: 144 CLYCIIQAAGELAVCYTSLSGGFNAYPSLLIDPALGFSVAWVYCLQWLCVMPLELVTASI 203

Query: 156 VMQFWVSRDRVNPGVWITIFLALIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXX 215
            +++W +   VNP +++ IF  +I+ IN  G R + E EF+ ++ K              
Sbjct: 204 TIKYWTTS--VNPDIFVAIFYVVIITINVFGARGYAEAEFFFNTFKVLMISGFLILGIIV 261

Query: 216 XXXXXPNHDRTGFRFWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVA 275
                 N    G ++W DPG+F    + I   KG               +  TE   + A
Sbjct: 262 NCGGAGNDGYIGGKYWNDPGSFSG-DKPIDHFKG----VVSTLVTAAFAFGATEFIALTA 316

Query: 276 AEAKNPRRSVPRAIKLTLYRIVVFYVITILLLGMTVAYNDPRLLXXXXXXXXXXXXPFVV 335
           AE  NPR+S+P A K  LYRI+V YV +I+L+G  V +N   L+            P+V+
Sbjct: 317 AEQANPRKSIPSAAKKILYRILVLYVGSIILIGFLVPHNSEELMGSGGSATHAS--PYVI 374

Query: 336 AIENASIPVLPHIFNVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPY 395
           AI +  + V+PH+ N  +L+ V S  NS  Y +SR L  LA  G AP      ++ G P 
Sbjct: 375 AIASHGVKVVPHLINAVILLSVISMGNSAFYSSSRLLLTLAEQGYAPSFLKYVDREGRPT 434

Query: 396 YSLGLSVLFCLLAYMNVSSGSAQVFNYFVNVVSIFGLLSWITILITYIRFDKAIRVQFGD 455
            ++ +S +F L++++  S     VF + + +  +  L +W  I +++IRF +A++VQ   
Sbjct: 435 LAMVISSVFGLISFVAASPKEETVFTWLLAISGLSQLFTWSAICLSHIRFRRAMKVQGRS 494

Query: 456 KSSLSYTAAFQPWSTYVA--LFFCCLIGLIKNYTVFLGH-KFDYKTFISGYIGIPVYLIC 512
              L + +    W +Y A  +    LIG        +G  K D + F   Y+ +P+ +  
Sbjct: 495 LGELGFKSQVGVWGSYYATGMMLLILIGQFWTAIAPIGEGKLDAEAFFENYLAMPILIAL 554

Query: 513 YVGYKVVYR--TKLIKPEDVDLYTFKDAID 540
           Y GYKV  R  T  I    +DL + +   D
Sbjct: 555 YFGYKVWKRDWTLYIPASKIDLISNRRIFD 584

>NDAI0A00640 Chr1 complement(118100..120025) [1926 bp, 641 aa] {ON}
           Anc_1.50
          Length = 641

 Score =  225 bits (574), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 151/535 (28%), Positives = 252/535 (47%), Gaps = 27/535 (5%)

Query: 20  TLEEGIVTLESEGQVRSVSEG-----VDGKHEGIRLKKELEARHVSMXXXXXXXXXXXXX 74
           TLE  + T   EG +    +G     V GK E   LK  ++ RHV M             
Sbjct: 91  TLEHDL-TKTFEGTLEPSEDGTQPAEVAGKSE--ELKHSIKPRHVIMISLGTGIGTGMLV 147

Query: 75  XXXXXXXXXXPVSILISYSFVGLLVYTVMSCLGEMAAFIP--LDGFTSYASRYVDPAVGF 132
                     P  ++I Y+ +G  +Y ++   GEMA      + GF SY S  ++PA+GF
Sbjct: 148 GNGTSLANSGPAGLVIGYAIMGSCIYCIIQATGEMAVLYSKLIGGFNSYPSFLIEPALGF 207

Query: 133 AVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVNPGVWITIFLALIVLINTVG-VRFFG 191
           +V + Y  ++  V P +L   +M +++W ++  V+P V++ IF  LI+LIN +G    + 
Sbjct: 208 SVAWVYCIQWLCVCPLELVTASMTIKYWTTK--VDPDVFVVIFYVLIILINVLGGAAGYA 265

Query: 192 EFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGFRFWRDPGAFKPYSEAISGSKGKX 251
           E EF+ +S K                    +    G R+W DPGAF+    AI   KG  
Sbjct: 266 EAEFFFNSCKILMLLGFFILGIILICGGAGDDGYIGGRYWHDPGAFRG-EHAIDRFKG-- 322

Query: 252 XXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVVFYVITILLLGMTV 311
                        +  +E+ G+ A+E  NPR+++P A K  +YRIV  Y+ +++++G  V
Sbjct: 323 --VVSTLVNAAFAFGLSEMIGVTASEQSNPRKAIPSAAKKMIYRIVCIYLGSVVIVGFLV 380

Query: 312 AYNDPRLLXXXXXXXXXXXXPFVVAIENASIPVLPHIFNVCVLVFVFSACNSDLYVASRS 371
            +N  +LL            P+V+A+    + V+PH  N  +L+ V S  NS  Y +SR 
Sbjct: 381 PWNSDQLLGSSGGGVKAS--PYVLAVSTHGVRVVPHFINAVILLSVLSVANSAFYSSSRL 438

Query: 372 LYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCLLAYMNVSSGSAQVFNYFVNVVSIFG 431
           L GLA  G AP+IF   ++ G P   + ++ L  ++++   S    QVF + + +  +  
Sbjct: 439 LLGLAEQGYAPKIFKYVDREGRPTMGMCVAALVNVISFCATSPKEDQVFVWLLAISGLSQ 498

Query: 432 LLSWITILITYIRFDKAIRVQFGDKSSLSYTAAFQPWSTYVALFFCCLIGLIKNYTVFLG 491
           L +W  I +++IRF +A+ VQ      + + +    W ++ A     LI LI  + V + 
Sbjct: 499 LFTWSAICLSHIRFRRAMAVQGRSLGEIGFKSQCGVWGSWYAFIMMMLI-LIAQFWVAIA 557

Query: 492 ----HKFDYKTFISGYIGIPVYLICYVGYKVVYRT--KLIKPEDVDLYTFKDAID 540
                + D + F   Y+  P+ +  Y GYK+  +     I+ +D+DL   +D  D
Sbjct: 558 PIGEGRLDVQAFFENYLAAPILIALYFGYKIYTKDWRLFIRAKDIDLDINRDVFD 612

>SAKL0D00836g Chr4 complement(65731..67536) [1806 bp, 601 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 601

 Score =  223 bits (569), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 149/497 (29%), Positives = 238/497 (47%), Gaps = 19/497 (3%)

Query: 50  LKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILISYSFVGLLVYTVMSCLGEM 109
           LK+ L+ RH+ M                       P +++I++   G +VY+V+  LGE+
Sbjct: 89  LKRHLKNRHLQMIAIGGSIGTGLFVGSGKALRIGGPAAVVIAWIMTGSMVYSVVQALGEL 148

Query: 110 AAFIPLDG-FTSYASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVNP 168
           A  +P+ G + SY SR+++P+ GFA+ Y+YL    I  P +L A ++ + +W   D    
Sbjct: 149 AVALPVSGSYLSYVSRFIEPSFGFAIAYNYLIGNLITMPLELIAASITVNYW-DVDSKYA 207

Query: 169 GVWITIFLALIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDR-TG 227
             ++ +F  +IV IN  GV+ +GE EF  S +K                   P+ +   G
Sbjct: 208 DAFVALFYIVIVGINLFGVKGYGEAEFVFSVIKVTAIVGFIILGIVLVCGGGPSDEGYIG 267

Query: 228 FRFWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPR 287
            R+W +PG F        G KG               + G+E+  + AAE +NPR+ +PR
Sbjct: 268 ARYWYNPGGFA------HGFKG----FAAIFVTSAFSFAGSEMFALAAAETENPRKDLPR 317

Query: 288 AIKLTLYRIVVFYVITILLLGMTVAYNDPRLLXXXXXXXXXXXXPFVVAIENASIPVLPH 347
           A K   +RI +FYVI++ L+G  V Y D  L             PFV+AI  A I  LP 
Sbjct: 318 AAKQVFWRITLFYVISLTLIGCLVPYTDKHLFAASSVDASAS--PFVIAIARAGIKGLPS 375

Query: 348 IFNVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCLL 407
           + NV +L+ V S  N  +Y ASR++  LA  G  PR F   ++ G P   + L  +F LL
Sbjct: 376 VVNVVILIAVLSVGNCCVYAASRAVLSLAHYGFLPRRFGYVDRKGRPLVGILLCAIFGLL 435

Query: 408 AYMNVSSGSAQVFNYFVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLSYTAAFQP 467
           ++++ SS   +VF++ + +  +     W +I + ++RF +A+ VQ      LSY A    
Sbjct: 436 SFLSASSNYGEVFDWMLAISGLNSFFIWGSICVCHLRFRRALSVQGRSTDELSYKAQTGI 495

Query: 468 WSTY--VALFFCCLIGLIKNYTVFLGHKFDYKTFISGYIGIPVYLICYVGYKVVYR--TK 523
           W +   + L F  L          +G   +   F S Y+ +PV +  Y  +K+  R  T 
Sbjct: 496 WGSLYGIGLIFIVLCFQFWVALFPIGGSPNANHFFSAYLSLPVVIFFYTCHKLYTRSWTF 555

Query: 524 LIKPEDVDLYTFKDAID 540
           LIK  D+D+ T +  +D
Sbjct: 556 LIKSSDIDIDTGRREMD 572

>Smik_2.272 Chr2 complement(484274..486067) [1794 bp, 597 aa] {ON}
           YBR132C (REAL)
          Length = 597

 Score =  223 bits (568), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 139/523 (26%), Positives = 250/523 (47%), Gaps = 14/523 (2%)

Query: 20  TLEEGIVTLESEGQVRSVSEGVDGKHE---GIRLKKELEARHVSMXXXXXXXXXXXXXXX 76
           T+ EG      E + R  S   D +         +++LE RHV +               
Sbjct: 52  TIPEGGDVHVHEHEDRGSSIDEDSRTHLLFSTETRRKLENRHVQLIAISGVIGTALFVAI 111

Query: 77  XXXXXXXXPVSILISYSFVGLLVYTVMSCLGEMAAFIPLDG-FTSYASRYVDPAVGFAVG 135
                   P S+L++++   + +  +     EM  F P+   F   A++ VD ++     
Sbjct: 112 GKALYRGGPASLLLAFALWCVPILCITVSTAEMVCFFPVSSPFLRLATKCVDDSLAVMAS 171

Query: 136 YSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVNPGVWITIFLALIVLINTVGVRFFGEFEF 195
           +++ F   +  P ++ +   ++ +W  RD  + G+ + + + L +LI+   V+++GE EF
Sbjct: 172 WNFWFLECVQIPFEIVSVNTIIHYW--RDDYSAGIPLAVQVVLYLLISICAVKYYGEMEF 229

Query: 196 WLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGFRFWRDPGAFKPY---SEAISGSKGKXX 252
           WL+S K                   P HDR GFR + +   FK Y      +  S G   
Sbjct: 230 WLASFKIILALGLFIFTFITMLGGNPRHDRYGFRNYGE-SPFKKYFPDGNDVGKSSGYFQ 288

Query: 253 XXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVVFYVITILLLGMTVA 312
                         G E   ++A E K PR+ +P+A K    R+   ++ + L +G+  +
Sbjct: 289 GFLACLIQASFTIAGGEYISMLAGEVKRPRKVLPKAFKQVFVRLTFLFLGSCLCVGIVCS 348

Query: 313 YNDPRLLXXXXXXX-XXXXXPFVVAIENASIPVLPHIFNVCVLVFVFSACNSDLYVASRS 371
            NDP L              P+V+A+ N  I +LP I N+ ++   FSA N+  Y +SR+
Sbjct: 349 PNDPDLTAAINEARPGAGSSPYVIAMNNLKIRILPDIVNIALITAAFSAGNAYTYCSSRT 408

Query: 372 LYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCLLAYMNVSSGSAQVFNYFVNVVSIFG 431
            YG+A+DG AP++F   N+ GVP YS+G+S+++ L++ + ++S SA V N+ +N+++   
Sbjct: 409 FYGMALDGYAPKLFTRCNRHGVPIYSVGISLIWALVSLLQLNSNSAVVLNWLINLITASQ 468

Query: 432 LLSWITILITYIRFDKAIRVQFGDKSSLSYTAAFQPWSTYVALFFCCLIGLIKNYTVFLG 491
           L++++ + I Y+ F +A RVQ      L + +  QP++  + L  C  + LI+ YTVF  
Sbjct: 469 LINFVVLCIIYLFFRRAYRVQQDSLPRLPFRSWGQPYTAIIGLVSCSAMILIQGYTVFFP 528

Query: 492 HKFDYKTFISGYIGIPVYLICYVGYKVVY---RTKLIKPEDVD 531
             +  + F+  Y+ + + +  YVGYK ++   +  L  P D+D
Sbjct: 529 KLWSTQDFLFSYLMVFINIGIYVGYKFIWKRGKDSLKNPHDID 571

>NDAI0G06030 Chr7 complement(1489584..1491383) [1800 bp, 599 aa]
           {ON} 
          Length = 599

 Score =  223 bits (567), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 158/554 (28%), Positives = 256/554 (46%), Gaps = 45/554 (8%)

Query: 34  VRSVSEGVDGKHEGIRLKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILISYS 93
           + S    +DG      LK+ L+ARH+ M                       P++++I +S
Sbjct: 69  IDSFKPPLDGSFHTHNLKRTLKARHLIMIAIGGSIGTGLFIGSGQALASGGPLALIIGWS 128

Query: 94  FVGLLVYTVMSCLGEMAAFIPLDG-FTSYASRYVDPAVGFAVGYSYLFKYFIVTPNQLTA 152
             G  +   +  LGE+    P+ G F +Y++R++DP++ F +   Y+ ++F V P ++ A
Sbjct: 129 IAGTQIVGTIHGLGEITVRFPVVGAFANYSTRFLDPSISFVISTIYVIQWFFVLPLEIIA 188

Query: 153 GAMVMQFWVSRDRVNPGVWITIFLALIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXX 212
            AM +Q+W     ++P VW+ IF  +IV IN  G R FGE EF  SS+K           
Sbjct: 189 SAMTIQYW--NQSIDPVVWVAIFYCVIVSINLFGARGFGEAEFLFSSIKVITIIGFIILC 246

Query: 213 XXXXXXXXPNHDRTGFRFWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCG 272
                   P+HD  G R+W DPG     S    G                    GTE+  
Sbjct: 247 IVLICGGGPDHDFVGARYWHDPGCL---SHGFPG-------VLSVLVVASYSLGGTEMVC 296

Query: 273 IVAAEAKNPRRSVPRAIKLTLYRIVVFYVITILLLGMTVAYNDPRLLXXXXXXXXXXXXP 332
           + + E  NPR  +P AIK T +RI+ F++I++ L+G  V Y +P LL            P
Sbjct: 297 LASGET-NPRE-LPSAIKQTFWRILFFFLISLTLIGFLVPYTNPNLLGGSSVNNS----P 350

Query: 333 FVVAIENASIPVLPHIFNVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPRIFATTNKWG 392
           FV+AI+   I  LP I N  +L+ + S  NS ++ +SR+L  +A  G  P+ F   ++ G
Sbjct: 351 FVIAIKLHHIKALPSIVNAVILISIMSVGNSCIFASSRTLCSMAHQGLIPKFFGYIDRAG 410

Query: 393 VPYYSLGLSVLFCLLAYMNVSSGSAQVFNYFVNVVSIFGLLSWITILITYIRFDKAIRVQ 452
            P   +  + LF LLA++  SS   +VF++ + +  +   + W++I I++IRF  A++ Q
Sbjct: 411 RPLTGILTNSLFGLLAFLVKSSSMGEVFDWLMAIAGLATCIVWLSINISHIRFRLAMKAQ 470

Query: 453 FGDKSSLSYTAAFQPW-STYVAL---------FFCCL--IGLIKNYTVFLGHKFDYKTFI 500
                 L + +A   W S Y AL         F+C L  IG  K+ +         KTF 
Sbjct: 471 GKSLDELEFVSAVGMWGSAYSALINSLILIAQFYCALWPIGGWKDSSE------RAKTFF 524

Query: 501 SGYIGIPVYLICYVGYKVVYRTK------LIKPEDVDLYTFKDAIDAXXXXXXXXXXXXX 554
             Y+   +    +V +KV YR K      ++  + +DL T +  ID              
Sbjct: 525 QSYLCALIMAFLFVCHKVFYRYKTGKWWAIMDLDKIDLETDRKNID--IDVLKQEIAERN 582

Query: 555 XNMENSPKNFKWFY 568
            +++ SP   +W++
Sbjct: 583 RHLQASPWYVRWYH 596

>Suva_4.381 Chr4 complement(668597..670369) [1773 bp, 590 aa] {ON}
           YBR132C (REAL)
          Length = 590

 Score =  222 bits (566), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 130/513 (25%), Positives = 249/513 (48%), Gaps = 8/513 (1%)

Query: 22  EEGIVTLESEGQVRSVSEGVDGKHEGIRLKKELEARHVSMXXXXXXXXXXXXXXXXXXXX 81
           EEG + +  +G+  +  +           +++LE RHV +                    
Sbjct: 50  EEGNMHVHEDGETSTDEDSRTNLLFSTETRRKLENRHVQLIAISGVIGTALFVAIGKALY 109

Query: 82  XXXPVSILISYSFVGLLVYTVMSCLGEMAAFIPLDG-FTSYASRYVDPAVGFAVGYSYLF 140
              P S+L++++   + +  +     EM  F P+   F   A++ VD ++     +++ F
Sbjct: 110 RGGPASLLLAFALWCVPILCITVSTAEMVCFFPVSSPFLRLATKCVDESLAVMASWNFWF 169

Query: 141 KYFIVTPNQLTAGAMVMQFWVSRDRVNPGVWITIFLALIVLINTVGVRFFGEFEFWLSSV 200
              +  P ++ +   ++ +W  RD  + G+ + + + L +LI+   V+++GE EFWL+S 
Sbjct: 170 LECVQIPFEIVSVNTIIHYW--RDDYSAGIPLAVQVVLYLLISICAVKYYGEMEFWLASF 227

Query: 201 KXXXXXXXXXXXXXXXXXXXPNHDRTGFRFWRDPGAFKPY---SEAISGSKGKXXXXXXX 257
           K                   P HDR GFR++ +   FK Y    + +  S G        
Sbjct: 228 KIILALGLFIFTFVTMLGGNPKHDRYGFRYYGE-SPFKQYFPDGKDVGKSSGYFQGFLAC 286

Query: 258 XXXXXXXYTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVVFYVITILLLGMTVAYNDPR 317
                    G E   ++A E K PR+ +P+A K    R+   ++ + L +G+  + NDP 
Sbjct: 287 LIQASFTIAGGEYISMLAGEVKRPRKVLPKAFKQVFVRLTFLFLGSCLCVGIVCSPNDPD 346

Query: 318 LLXXXXXXXXXX-XXPFVVAIENASIPVLPHIFNVCVLVFVFSACNSDLYVASRSLYGLA 376
           L              P+V+A+ N  I +LP + N+ ++   FSA N+  Y +SR+ YG+A
Sbjct: 347 LTAAINEARPGAGSSPYVIAMNNMKIRILPDVVNIALITAAFSAGNAYTYCSSRTFYGMA 406

Query: 377 IDGKAPRIFATTNKWGVPYYSLGLSVLFCLLAYMNVSSGSAQVFNYFVNVVSIFGLLSWI 436
           +DG AP+IF   NK GVP Y++G+S+++ L++ + ++S SA V N+ +N+++   L++++
Sbjct: 407 LDGYAPKIFTKCNKHGVPIYAVGISLIWALVSLLQLNSNSAVVLNWLINLITASQLINFV 466

Query: 437 TILITYIRFDKAIRVQFGDKSSLSYTAAFQPWSTYVALFFCCLIGLIKNYTVFLGHKFDY 496
            + I Y+ F +   +Q      L + +  QP++  + L  C  + +I+ YTVF    ++ 
Sbjct: 467 VLCIIYLFFRRTYSIQQDSLPKLPFRSWGQPYTAIIGLVSCLAMIMIQGYTVFFPKLWNS 526

Query: 497 KTFISGYIGIPVYLICYVGYKVVYRTKLIKPED 529
           + F+  Y+ + + +  YVGYK +++    K +D
Sbjct: 527 QDFLFSYLMVFIDIGIYVGYKFIWKRGKDKVKD 559

>CAGL0B01012g Chr2 (91330..93201) [1872 bp, 623 aa] {ON} similar to
           uniprot|P25376 Saccharomyces cerevisiae YCL025c AGP1
           Asparagine/glutamine permease or uniprot|P48813
           Saccharomyces cerevisiae YDR508c GNP1
          Length = 623

 Score =  223 bits (567), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 151/536 (28%), Positives = 253/536 (47%), Gaps = 26/536 (4%)

Query: 17  SNETLEEG---IVTLE-SEGQVRSVSEGVDGKHEGIRLKKELEARHVSMXXXXXXXXXXX 72
           S+E L++    +  LE  E QV  ++E  + K++   LK+ ++ RHV +           
Sbjct: 73  SSENLDKDGKEVADLEVQENQV--LTEKSNQKNK--ELKQTIKPRHVILISLGTGIGTGL 128

Query: 73  XXXXXXXXXXXXPVSILISYSFVGLLVYTVMSCLGEMA-AFIPLDG-FTSYASRYVDPAV 130
                       P  +LI YS +G  +Y ++   GE+A ++  L G F  Y S  VDPA 
Sbjct: 129 LVGNAKALHNAGPAGLLIGYSIMGTCLYCIIQAAGELAVSYSSLSGGFNVYPSFLVDPAF 188

Query: 131 GFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVNPGVWITIFLALIVLINTVGVRFF 190
           GF+V + Y  ++  V P +L   +M +++W +   VN  +++ IF  LI++INT G R +
Sbjct: 189 GFSVAWVYCIQWLCVCPLELVTASMTIKYWTTT--VNADIFVGIFYVLIIVINTFGARGY 246

Query: 191 GEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGFRFWRDPGAFKPYSEAISGSKGK 250
            E EF+ +  K                    N    G R+W  PGAF      I   KG 
Sbjct: 247 AEAEFFFNCCKILMMIGFFILGIVINTGGAGNDGYIGDRYWHTPGAFAG-DRPIDHFKG- 304

Query: 251 XXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVVFYVITILLLGMT 310
                         +  TE   + AAE  NPR+++P A K  LYRI+  ++ +I L+G  
Sbjct: 305 ---IMATMVTAAFAFGATEFIALTAAEQSNPRKAIPSAAKKVLYRILFIFLGSITLVGFL 361

Query: 311 VAYNDPRLLXXXXXXXXXXXXPFVVAIENASIPVLPHIFNVCVLVFVFSACNSDLYVASR 370
           V Y+  +L+            P+V+A+    + V+PH  N  +L+ V S  NS  Y +SR
Sbjct: 362 VPYDSDQLMGSGGSATKAS--PYVLAVSTHGVKVVPHFINAVILLSVLSVGNSAFYSSSR 419

Query: 371 SLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCLLAYMNVSSGSAQVFNYFVNVVSIF 430
            LY LA  G AP+ F   ++ G P+ ++  + +F ++++   S    QVF + + +  + 
Sbjct: 420 LLYSLAQQGNAPKFFDYVDREGRPFRAMVCAGVFAIISFCAASPKEEQVFTWLLAISGLS 479

Query: 431 GLLSWITILITYIRFDKAIRVQFGDKSSLSYTAAFQPWSTYVALFFCCLIGLIKNYTVFL 490
            + +W  I +++IRF KA+ VQ      + + A    W +Y   F   +I LI  + V +
Sbjct: 480 QVFTWFAICLSHIRFRKAMFVQKRSLGEIGFKAQTGVWGSYYVCFMLVMI-LIAQFWVAI 538

Query: 491 G----HKFDYKTFISGYIGIPVYLICYVGYKVVYR--TKLIKPEDVDLYTFKDAID 540
                 K D + F   Y+ +P+ ++ YVGYK+  +  +  I+  ++DL   +   D
Sbjct: 539 APIGEGKLDAQGFFENYLAMPILILFYVGYKIWKKDWSLFIRANNIDLDKHRQIFD 594

>KNAG0F00270 Chr6 complement(27784..29688) [1905 bp, 634 aa] {ON}
           Anc_1.50 YDR508C
          Length = 634

 Score =  223 bits (567), Expect = 5e-64,   Method: Compositional matrix adjust.
 Identities = 159/568 (27%), Positives = 258/568 (45%), Gaps = 45/568 (7%)

Query: 4   DTSMEKKNAGVLYSNETLEEGIVTLESEGQVRS-------VSEGVDGKH----------- 45
           +T  ++ N  VL   +T EE I    S+G  RS         + VD K            
Sbjct: 52  ETKTDESNNAVLIQEKTQEETI--HNSDGSSRSPFGKFVDSFKRVDEKQTTSDLESGLGE 109

Query: 46  ---EGIRLKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILISYSFVGLLVYTV 102
              E   LK+ ++ RHV +                       P  ++I YS +G  +Y +
Sbjct: 110 VPGENSDLKQTIKKRHVLLISLGTGIGTGLLVGNAKVLRDAGPGGLVIGYSIMGSCLYCI 169

Query: 103 MSCLGEMA---AFIPLDGFTSYASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQF 159
           +   GE+A   + +P   F  Y +  VD A GFAV + Y  ++  V P +L   +M +++
Sbjct: 170 IQACGELAVCYSSLP-SNFNIYPTFLVDKAFGFAVAWVYCLQWLCVCPLELVTASMTIKY 228

Query: 160 WVSRDRVNPGVWITIFLALIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXX 219
           W +   VNP ++++IF  LI++INT G R + E EF+ +S K                  
Sbjct: 229 WTTS--VNPDIFVSIFFVLIIVINTFGARGYAEAEFFFNSCKVLMMAGFFILGIIITCGG 286

Query: 220 XPNHDRTGFRFWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAK 279
                  G ++W  PGAF   +  I   KG               +  +E   + AAE  
Sbjct: 287 AGTSGYIGAKYWHSPGAFNG-NRPIDHFKG----VMATFTTAAFAFGASEFISLTAAEQS 341

Query: 280 NPRRSVPRAIKLTLYRIVVFYVITILLLGMTVAYNDPRLLXXXXXXXXXXXXPFVVAIEN 339
           NPR+++P+A K+ +YRI+  ++ +I L+G  V YN P LL            P+VVA+ +
Sbjct: 342 NPRKAIPKAAKMMIYRILFVFLSSITLIGFLVPYNSPYLLGSGSDATKAS--PYVVAVAS 399

Query: 340 ASIPVLPHIFNVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLG 399
             + V+PH  N  +L+ V S  NS  Y +SR L  LA  G AP++F   +K G P  ++ 
Sbjct: 400 HGVRVVPHFINAVILLSVLSVGNSAFYSSSRLLNSLAQQGYAPKMFTYIDKRGRPLVAMV 459

Query: 400 LSVLFCLLAYMNVSSGSAQVFNYFVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSL 459
            S LF  +A+   S    QVF + + +  +  L +W+ I I+++RF +A++VQ      +
Sbjct: 460 CSTLFMTIAFCAASPKEEQVFTWLLAISGLSQLFTWVAICISHLRFRRALKVQGHSLGEI 519

Query: 460 SYTAAFQPW-STYVALFFCCLIGLIKNYTVFL----GHKFDYKTFISGYIGIPVYLICYV 514
            + +    + S Y A     ++ LI  + V L    G+  D + F   Y+ +P+ L+ Y 
Sbjct: 520 GFKSQVGIYGSLYAATML--ILALIAQFWVALAPIGGNGLDARNFFQNYLAMPILLVLYF 577

Query: 515 GYKVVYRTKL--IKPEDVDLYTFKDAID 540
           GYK+  R     I    +DL + +   D
Sbjct: 578 GYKIRKRDWKFWIPAHRIDLVSHRKVFD 605

>Kpol_1052.16 s1052 (44303..46144) [1842 bp, 613 aa] {ON}
           (44303..46144) [1842 nt, 614 aa]
          Length = 613

 Score =  222 bits (565), Expect = 7e-64,   Method: Compositional matrix adjust.
 Identities = 156/531 (29%), Positives = 247/531 (46%), Gaps = 24/531 (4%)

Query: 17  SNETLEEGIVT--LESEGQVRSVSEGVDG-----KHEGIRLKKELEARHVSMXXXXXXXX 69
           S+E    G +   ++S  +     E +DG       +GI LKK+++ RHV M        
Sbjct: 55  SSEVYRSGRIRRWIDSYKRAEHPREHIDGFEDGESKDGIHLKKQMKTRHVVMMSLGTGIG 114

Query: 70  XXXXXXXXXXXXXXXPVSILISYSFVGLLVYTVMSCLGEMAAFIP-LDG-FTSYASRYVD 127
                          P  ++I Y  V  + Y ++   GE+A   P L G F SY    + 
Sbjct: 115 TGLLIANAKGLHFAGPAPLVIGYGMVSFVTYFMIQAAGELAVAYPTLPGNFNSYFGILIS 174

Query: 128 PAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVNPGVWITIFLALIVLINTVGV 187
              GFA  +    ++  V P +  A ++ +++W   DR++  V++ IF   ++ I+ VGV
Sbjct: 175 KPFGFATVWLAAVQWLTVLPLEFIAASLTIKYW--NDRISGDVFVVIFYVFLLFIHFVGV 232

Query: 188 RFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGFRFWRDPGAFKPYSEAISGS 247
           R +GE EF  +  K                    N    G ++W DPGAF   +   +GS
Sbjct: 233 RAYGETEFIFNLCKVLMIIGFIILSIVINAGGAGNDGYIGGKYWNDPGAF---AGETAGS 289

Query: 248 KGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVVFYVITILLL 307
           + K              Y GTEL  +   E +NPR+S P+A K ++YRIV+ Y++T++L+
Sbjct: 290 RFKGVCYILVTGYFS--YGGTELFVLSVNEQENPRKSTPQAAKHSIYRIVIIYLLTMILI 347

Query: 308 GMTVAYNDPRLLXXXXXXXXXXXXPFVVAIENASIPVLPHIFNVCVLVFVFSACNSDLYV 367
           G  V YNDPRL+            P+V+A     + ++PH  N  VL+ + S  NS LY 
Sbjct: 348 GFNVPYNDPRLMGADDASGSHAS-PYVLAASIHGVKIVPHFINAVVLIALISVGNSALYA 406

Query: 368 ASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCLLAYMNVSSGSAQVFNYFVNVV 427
           A R +  LA  G AP+I A  ++ G P  SLG+  LF L+ +   SS   QVF +   + 
Sbjct: 407 APRMMVSLAEQGFAPKIMAYVDREGRPLVSLGICALFGLIGFAASSSKEEQVFTWLAAIA 466

Query: 428 SIFGLLSWITILITYIRFDKAIRVQFGDKSSLSYTAAFQPWSTYVALFFCCLIGLIKNYT 487
            +  L +W    I++IRF  A+++Q  D   + + A+   + ++  LFF  L+     + 
Sbjct: 467 GLSELFTWSAFFISHIRFRWAMKLQGKDIKEVGFLASTGLYGSFYGLFFNILV-FAAQFW 525

Query: 488 VFL----GHKFDYKTFISGYIGIPVYLICYVGYKVVYR--TKLIKPEDVDL 532
           V L      K   ++F   Y+  P++L  Y GY V  +  T L   E +DL
Sbjct: 526 VALSPIGSKKVGAESFFESYLAFPIWLFFYFGYMVWAKDFTFLNPLESIDL 576

>AAR038W Chr1 (409071..410771) [1701 bp, 566 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBR132C (AGP2)
          Length = 566

 Score =  220 bits (561), Expect = 8e-64,   Method: Compositional matrix adjust.
 Identities = 146/514 (28%), Positives = 253/514 (49%), Gaps = 13/514 (2%)

Query: 29  ESEGQVRSVSEGVDGKHEGIRLKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSI 88
            SE    + S G  GK+      ++LE RHV +                        VS+
Sbjct: 34  SSEVGDEASSAGFAGKYHST--YRKLENRHVQLIGISGVIGTALFVSIGKALYRGGSVSL 91

Query: 89  LISYSFVGLLVYTVMSCLGEMAAFIPLDG-FTSYASRYVDPAVGFAVGYSYLFKYFIVTP 147
           L+ ++   + +  +     EM  ++PL+  F   ASR V+ ++    G+++ F   +  P
Sbjct: 92  LLGFALWCVPILCITVSTAEMVCYLPLNSPFLRLASRCVNDSLTVMAGWNFWFLECVQIP 151

Query: 148 NQLTAGAMVMQFWVSRDRVNPGVWITIFLALIVLINTVGVRFFGEFEFWLSSVKXXXXXX 207
            ++ A   ++ +W  RD  +  + + + + L +LI+   VR++GE EFWL+S K      
Sbjct: 152 FEIVAVNSIIHYW--RDDYSAAITLVVQVMLYLLISLFAVRYYGEIEFWLASFKVLLAVG 209

Query: 208 XXXXXXXXXXXXXPNHDRTGFRFWRDPGAFKPYS---EAISGSKGKXXXXXXXXXXXXXX 264
                        P  DR GFR+  +   FK YS   E IS S G               
Sbjct: 210 LFCFTFVTMVGGNPKRDRYGFRYIGE-APFKQYSPTMEPISSSAGYFQGFLACLIQASFT 268

Query: 265 YTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVVFYVITILLLGMTVAYNDPRLLXXXXX 324
             G +   ++A E K PR+ +P A K    R+ V ++   L +G+  + NDP L      
Sbjct: 269 IAGPDYVSMIAGETKLPRKVLPVAFKQVFIRLTVLFLGGCLCVGIVCSANDPDLTAAINA 328

Query: 325 XX-XXXXXPFVVAIENASIPVLPHIFNVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPR 383
                   P+V+A+ +  I +LP I N  ++   FSA N+  Y +SRSLYGLA+DG AP 
Sbjct: 329 SRPGAGSSPYVIAMNHLGIKILPDIVNAALVTAAFSAGNAYTYCSSRSLYGLALDGYAPA 388

Query: 384 IFATTNKWGVPYYSLGLSVLFCLLAYMNVSSGSAQVFNYFVNVVSIFGLLSWITILITYI 443
           IF   N++GVP Y++ +SV++ +L+ + ++S SA V N+ +++++   L+++  + + Y+
Sbjct: 389 IFKRCNRFGVPIYAVSVSVMWSVLSLLQLNSNSAVVLNWLISLITASQLINFGVLCVVYL 448

Query: 444 RFDKAIRVQFGDKSSLSYTAAFQPWSTYVALFFCCLIGLIKNYTVFLGHKFDYKTFISGY 503
            F +A   Q  +   LS+ + +QP++ YV L    LI +++ YTVF    ++ K F+  Y
Sbjct: 449 YFRRAYLAQQDNLPELSFKSWWQPYTAYVGLTCVLLIVVVQGYTVFYSALWNVKDFLFCY 508

Query: 504 IGIPVYLICYVGYKVVYR---TKLIKPEDVDLYT 534
           + + + +  Y+GY+ ++R     +I P +VDL T
Sbjct: 509 LMVFIDIAIYLGYRYIWRRGKDAVIPPTEVDLTT 542

>KAFR0D00510 Chr4 complement(80174..82027) [1854 bp, 617 aa] {ON} 
          Length = 617

 Score =  221 bits (564), Expect = 8e-64,   Method: Compositional matrix adjust.
 Identities = 137/502 (27%), Positives = 239/502 (47%), Gaps = 21/502 (4%)

Query: 49  RLKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILISYSFVGLLVYTVMSCLGE 108
           +LKK ++ RHV M                       P  ++I Y+ +   +Y ++  +GE
Sbjct: 98  KLKKTIQPRHVVMMSLGTGIGTGLLVGNGTTLAHAGPAGLVIGYAIMASCIYCIIQAVGE 157

Query: 109 MAA--FIPLDGFTSYASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRV 166
           MA      + GF +Y    VDPA+ F++ + Y  ++F V P +L   +M +Q+W ++  V
Sbjct: 158 MAVNYLTLVGGFNAYPGFLVDPALNFSIAWIYCIQWFCVCPLELVTASMTIQYWTTK--V 215

Query: 167 NPGVWITIFLALIVLINTVG-VRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDR 225
           N  +++ IF  L++ IN  G  R + E EF  +S K                    N   
Sbjct: 216 NADIFVLIFYILVLAINIFGGARGYAETEFICNSCKILMMIGFFILGIVIICGGAGNDGF 275

Query: 226 TGFRFWRDPGAFKPYSEAISGSKG--KXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRR 283
            G ++WRDPGAF+       GS G  +              +  TE   I A+E  NPR+
Sbjct: 276 IGGKYWRDPGAFR-------GSDGPNRFKGVVSTLVTAAFSFGQTEFLAITASEQSNPRK 328

Query: 284 SVPRAIKLTLYRIVVFYVITILLLGMTVAYNDPRLLXXXXXXXXXXXXPFVVAIENASIP 343
           ++P A K  +YR ++ Y+ +I+++G+ V Y+   LL            P+V+A+    + 
Sbjct: 329 AIPSAAKKVIYRALLIYLASIIIVGLLVPYDSSELLGSSSAATKAS--PYVLAVSTHGVR 386

Query: 344 VLPHIFNVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVL 403
           V+PH  N  +L+ VFS  +S  Y +SR L  LA  G AP++F   ++ G P     +  +
Sbjct: 387 VVPHFINAVILISVFSVADSAFYSSSRMLLTLARQGYAPKVFTFVDRTGRPSLGFLVGAV 446

Query: 404 FCLLAYMNVSSGSAQVFNYFVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLSYTA 463
             ++A+   SS   +VFN+ + +  +  + +W  I +++IRF +A++VQ      + Y +
Sbjct: 447 IAVMAFCACSSKETEVFNWLLAISGLSQVFTWALICLSHIRFRRAMKVQGRSIDEIGYKS 506

Query: 464 AFQPWSTYVALFFCCLIGLIKNYT--VFLGH-KFDYKTFISGYIGIPVYLICYVGYKVVY 520
               W +  A     LI + + +   V +G    D + F   Y+ +PV+++ Y+GYK+  
Sbjct: 507 QVGVWGSAYAFVMMILIMIGQCWVGIVPVGEGSADVQAFFQDYLAMPVFIVLYLGYKIWK 566

Query: 521 RT--KLIKPEDVDLYTFKDAID 540
           R     I+ +D+DL + +   D
Sbjct: 567 RDWRLFIRAKDIDLISHRHIHD 588

>Kpol_1065.13 s1065 (28709..30499) [1791 bp, 596 aa] {ON}
           (28709..30499) [1791 nt, 597 aa]
          Length = 596

 Score =  221 bits (562), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 148/533 (27%), Positives = 252/533 (47%), Gaps = 36/533 (6%)

Query: 18  NETLEEGIVTLESEGQVRSVSEGVDGKHEGIRLKKELEARHVSMXXXXXXXXXXXXXXXX 77
           +E +E+GI ++ S+ Q                 KK L +RHV M                
Sbjct: 61  SEDVEDGIASIRSDTQ----------------FKKSLSSRHVIMMSLGTGIGTGLLVANA 104

Query: 78  XXXXXXXPVSILISYSFVGLLVYTVMSCLGEMAAFIP-LDG-FTSYASRYVDPAVGFAVG 135
                  P S++I Y  V  + Y ++   GEMA   P L G F +Y S ++  + GFA  
Sbjct: 105 KGLYYGGPGSLIIGYVLVSFVTYFMIQAAGEMAVAYPTLPGNFNAYQSIFISKSWGFATV 164

Query: 136 YSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVNPGVWITIFLALIVLINTVG-VRFFGEFE 194
           + +  ++  V P +L   ++ +++W   D++N  +++ IF   +V I+ VG +R +GE E
Sbjct: 165 WLFCIQWLTVLPLELITSSLTIKYW--NDKINADIFVMIFYVFLVAIHLVGGIRAYGETE 222

Query: 195 FWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGFRFWRDPGAFKPYSEAISGSKGKXXXX 254
           F  +S K                    N    G ++W +PG+F    +A S  KG     
Sbjct: 223 FLFNSCKILMVIGFIILSIVINAGGAGNDGYIGGKYWHEPGSFAE-GDATSRFKG----I 277

Query: 255 XXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVVFYVITILLLGMTVAYN 314
                     Y GTEL  +   E   PR++ P A K ++YRI++ Y++T++L+G  V +N
Sbjct: 278 CLVLVSGYFSYGGTELYVLSVNEQAEPRKATPAAAKKSIYRILIIYLLTMILIGFNVPHN 337

Query: 315 DPRLLXXXXXXXXXXXXPFVVAIENASIPVLPHIFNVCVLVFVFSACNSDLYVASRSLYG 374
           + +L+            P+V+A     + ++PH  N  +L+ V S  NS L+   R L  
Sbjct: 338 NDQLMGAGGSATHAS--PYVLAATIHGVKIVPHFINAVILISVISVANSSLFAGPRLLSS 395

Query: 375 LAIDGKAPRIFATTNKWGVPYYSLGLSVLFCLLAYMNVSSGSAQVFNYFVNVVSIFGLLS 434
           LA  G AP+I +  ++ G P  +LG+S L  L+A+++ +S   +VF +   +  +  + +
Sbjct: 396 LATQGYAPKILSYVDREGRPLVALGISFLIGLIAFVSCTSHEEEVFTWLAAIAGLSEIFT 455

Query: 435 WITILITYIRFDKAIRVQFGDKSSLSYTAAFQPWSTYVALFFCCLIGLIKNYTVFL---- 490
           W  I+ +++RF  A++VQ  D + L Y A    W +    FF  L+ LI  + V L    
Sbjct: 456 WSGIMFSHVRFRAAMKVQGKDINELGYKANTGVWGSAYGAFFGVLV-LIAQFWVALAPIG 514

Query: 491 -GHKFDYKTFISGYIGIPVYLICYVGYKVVYRT-KLIKPED-VDLYTFKDAID 540
            G K D + F   Y+  P+++ CY GY +  +   L+ P D +DL +++   D
Sbjct: 515 NGGKCDAEAFFESYLAFPIWVACYFGYMIYNKDFTLLSPLDKIDLDSYRRIYD 567

>AEL030W Chr5 (577803..579551) [1749 bp, 582 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOL020W (TAT2) Newly
           annotated start codon according to experimentaly
           determined 5' end of mRNA using 5' RACE.
          Length = 582

 Score =  220 bits (561), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 156/550 (28%), Positives = 263/550 (47%), Gaps = 39/550 (7%)

Query: 9   KKNAGVLYSNETLEEGIVTLESEGQVR----SVSEGVDGKHEGIRLKKELEARHVSMXXX 64
           KK + VL  +  LEE        G VR    S    VDG  +   LK+ L++RH+ M   
Sbjct: 25  KKRSSVLEESRLLEES--RTNKRGLVRRCIDSFKPPVDGSFDPDNLKRTLKSRHLIMIAI 82

Query: 65  XXXXXXXXXXXXXXXXXXXXPVSILISYSFVGLLVYTVMSCLGEMAAFIPLDG-FTSYAS 123
                               P+++LI ++  G  +   +  LGE+    P+ G F +Y++
Sbjct: 83  GGSIGTGLFIGSGKALATGGPLAVLIGWTLAGTQMVGTIHGLGEVTVRFPVVGAFANYST 142

Query: 124 RYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVNPGVWITIFLALIVLIN 183
           R++DP+V F V   Y+ ++F V P ++ A A+ M+FW +   V+P VW+ +F  LI+ IN
Sbjct: 143 RFLDPSVSFVVSSIYVLQWFFVLPLEIIASAITMEFWTTS--VDPVVWVAVFYTLIISIN 200

Query: 184 TVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGFRFWRDPGAFKPYSEA 243
             GVR+FG+ +F  S +K                   P H+  G R+W DPGA       
Sbjct: 201 LFGVRWFGKPKFVFSVIKMVPICGFIILCLVLILGGGPTHEFIGARYWHDPGALA----- 255

Query: 244 ISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVVFYVIT 303
            +G KG                 G+E+  + + E  +P+  +P AIK   +RI+ F++++
Sbjct: 256 -NGFKG----VAAVMVTASYSLGGSEMTCLASGET-DPKE-IPHAIKQIFWRIIFFFLVS 308

Query: 304 ILLLGMTVAYNDPRLLXXXXXXXXXXXXPFVVAIENASIPVLPHIFNVCVLVFVFSACNS 363
           + L+G  V Y + +LL            PFV+AI+  +I VLPHI N  +LV + S  NS
Sbjct: 309 LTLVGFLVPYTNDQLLGGSNVNNS----PFVIAIKMHNIRVLPHIINGVILVSILSVGNS 364

Query: 364 DLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCLLAYMNVSSGSAQVFNYF 423
            ++ +SR+L  +A  G  PRIF   ++ G P   +  + LF LLA++  SS +  VF + 
Sbjct: 365 CIFASSRTLCSMAHQGLLPRIFGYVDRAGRPLTGILTNSLFGLLAFLVKSSSTGTVFTWL 424

Query: 424 VNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLSYTAAFQPWSTYVALFFCCLIGLI 483
           + V  +   + W++I +++IRF  A++ Q      L + +A   W +  +     ++ L+
Sbjct: 425 MAVAGLATAVVWLSINVSHIRFRLAMKAQGKSLDELEFVSAVGMWGSVYSGVMNVVV-LV 483

Query: 484 KNYTVFLGHKFDYK-------TFISGYIGIPVYLICYVGYKVVYRT------KLIKPEDV 530
             + V L     +K        F   Y+   + L  +V +K+ YR+      K++   ++
Sbjct: 484 AQFYVSLWPIEGWKDPRGRTEAFFQNYLCALILLFMFVAHKIYYRSTTGQWWKILPLAEI 543

Query: 531 DLYTFKDAID 540
           DL + +  ID
Sbjct: 544 DLESGRKNID 553

>KAFR0D04120 Chr4 (816117..818063) [1947 bp, 648 aa] {ON} Anc_1.50
           YDR508C
          Length = 648

 Score =  221 bits (564), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 146/535 (27%), Positives = 246/535 (45%), Gaps = 21/535 (3%)

Query: 17  SNETLE-EGIVTLESEGQVRSVSEGVDGKHEGIRLKKELEARHVSMXXXXXXXXXXXXXX 75
           +N  +E E   TL      +        + +   L+K ++ RHV +              
Sbjct: 97  TNRDIENELTTTLSPLSATKDPQFAPHAEEKDDHLQKTIKPRHVLLMSLGTGIGTGLLVG 156

Query: 76  XXXXXXXXXPVSILISYSFVGLLVYTVMSCLGEMA-AFIPLDG-FTSYASRYVDPAVGFA 133
                    P  ++I Y+ +G  +Y ++   GEMA A+  L G F +Y S  VD A GF+
Sbjct: 157 NGSALHKAGPGGLVIGYAIMGSCLYCIIQACGEMAVAYSGLPGNFNAYPSFLVDEAFGFS 216

Query: 134 VGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVNPGVWITIFLALIVLINTVGVRFFGEF 193
           V + Y  ++  V P +L   +M +Q+W +   VN  V++ IF  LI+ IN  G + + E 
Sbjct: 217 VAWVYCLQWLCVMPLELVTASMTIQYWTTT--VNADVFVVIFYVLIIFINVFGAKGYAEA 274

Query: 194 EFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGFRFWRDPGAFKPYSEAISGSKGKXXX 253
           EF+ +S K                    N    G ++W +PGAF+        S  +   
Sbjct: 275 EFFFNSCKVLMMAGFFILAIVINTGGAGNDGYIGAKYWHNPGAFRG-----DKSIDRFKD 329

Query: 254 XXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVVFYVITILLLGMTVAY 313
                      +  +E   I A+E  NPRR++P A K  +YRI+  ++ +I L+G  V Y
Sbjct: 330 VMSTFTTAAFAFGASEFIAIGASEQSNPRRAIPSAAKTMIYRILFIFLTSITLVGFLVPY 389

Query: 314 NDPRLLXXXXXXXXXXXXPFVVAIENASIPVLPHIFNVCVLVFVFSACNSDLYVASRSLY 373
           N   L+            P+V+A+ +  + V+PH  N  +L+ V S  NS  Y + R LY
Sbjct: 390 NSTELMGSGSAATKAS--PYVIAVASHGVRVVPHFINAVILLSVLSVANSAFYSSCRILY 447

Query: 374 GLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCLLAYMNVSSGSAQVFNYFVNVVSIFGLL 433
            L+  G AP  F   ++ G P  ++ +S LF ++A+   SS    VF + + +  +  L 
Sbjct: 448 SLSQQGYAPSWFNYIDREGRPARAMIMSALFSVIAFCACSSKEEDVFTWLLAISGLSQLF 507

Query: 434 SWITILITYIRFDKAIRVQFGDKSSLSYTAAFQPW-STYVALFFCCLIGLIKNYTVFLG- 491
           +WI I +++IRF +A++VQ      + + +    W S+Y A+     + LI  + V +  
Sbjct: 508 TWIAICVSHIRFRRAMKVQGRSVDEIGFKSQVGVWGSSYAAIMMT--LALIAEFWVSIAP 565

Query: 492 ---HKFDYKTFISGYIGIPVYLICYVGYKVVYRT-KL-IKPEDVDLYTFKDAIDA 541
                 D + F   Y+ +P+ ++ Y GYK+  R  KL I+ +D+DL + +   D 
Sbjct: 566 IGEDHLDAQNFFENYLAMPILIVLYFGYKICKRDWKLFIRAKDIDLVSHRKIYDG 620

>KNAG0G00900 Chr7 complement(170122..171963) [1842 bp, 613 aa] {ON}
           Anc_5.158 YGR191W
          Length = 613

 Score =  221 bits (562), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 149/510 (29%), Positives = 246/510 (48%), Gaps = 17/510 (3%)

Query: 37  VSEGVDGKHEGIRLKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILISYSFVG 96
           + E VDG  +   + K+L+ RH+                         P S++I +  + 
Sbjct: 86  MKEDVDGHPQ---MNKDLDVRHLLTLAVGGAIGTGLFVNSGAALSSGGPASLVIDWVIIS 142

Query: 97  LLVYTVMSCLGEMAAFIPL-DGFTSYASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAM 155
             ++TV++ LGE+AA  P+  GF  Y +R++DP+ GFAV  +YL ++ ++ P +L A ++
Sbjct: 143 TCLFTVVNSLGELAAAFPVVGGFNVYITRFIDPSFGFAVNINYLAQWLVLLPLELVAASI 202

Query: 156 VMQFWVSRDRVNPGVWITIFLALIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXX 215
            +++W   D++N   W+ IF A I   N + V+ FGE EF LS +K              
Sbjct: 203 TIRYW--NDKINSDAWVAIFYAAIAFANMLDVKSFGETEFILSMIKILAIVGFTILGIVL 260

Query: 216 XXXXXPNHDRTGFRFWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVA 275
                P     G ++W DPGAF   +   SG+K K              Y+G EL  + A
Sbjct: 261 SCGGGPKGGYIGGKYWHDPGAFVGET---SGTKFKGLCSVFVTAAFS--YSGMELTAVSA 315

Query: 276 AEAKNPRRSVPRAIKLTLYRIVVFYVITILLLGMTVAYNDPRLLXXXXXXXXXXXXPFVV 335
           AE+ NPR ++P+A K T + I + YV  + L+G  V YN+P+LL            P V+
Sbjct: 316 AESLNPRETIPKAAKRTFWLITLSYVTILTLIGCLVPYNNPKLLNGSSSVDAASS-PLVI 374

Query: 336 AIENASIPVLPHIFNVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPY 395
           AIEN  I  LP + N  +L+ + S  NS +Y  SR +  +A     PR     ++ G P 
Sbjct: 375 AIENGGIRGLPSLMNAIILIAIVSVANSAVYACSRCMVSMARIRNLPRFLGRVDRKGRPL 434

Query: 396 YSLGLSVLFCLLAYMNVSSGSAQVFNYFVNVVSIFGLLSWITILITYIRFDKAIRVQ--- 452
            +  L++ F LL+++  S    +VF +   +  +  + +W+ I +++IRF +A+  Q   
Sbjct: 435 NATLLTLFFGLLSFIAASDKQEEVFTWLSALSGLSTIFAWMAINLSHIRFRQAMAHQGIS 494

Query: 453 FGDKSSLSYTAAFQPWSTYVALFFCCLIGLIKNYTVFLGHKFDYKTFISGYIGIPVYLIC 512
             +   +S T     W   + LF   +     +     G   D  +F  GY+  P+ ++C
Sbjct: 495 LDELPYISMTGVSGSWYGVIVLFLVLVASFWTSLFPLGGKGADATSFFEGYLSFPILIVC 554

Query: 513 YVGYKVVYRTK--LIKPEDVDLYTFKDAID 540
           YVG+K+  R K  LI   D+DL + +  +D
Sbjct: 555 YVGHKLYIRKKRLLIDVADMDLVSDRKVVD 584

>KAFR0D04130 Chr4 (818573..820507) [1935 bp, 644 aa] {ON} 
          Length = 644

 Score =  221 bits (564), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 146/544 (26%), Positives = 253/544 (46%), Gaps = 17/544 (3%)

Query: 6   SMEKKNAGVLYSNETLEEGIVTLES-EGQVRSVSEGVDGKHEGIRLKKELEARHVSMXXX 64
           S ++   G   +     E   TL      ++     +  K E   L+K ++ RHV M   
Sbjct: 82  SFKRAEEGTEETKHMETELTTTLSPLSAAIKEHDVAITSKEEDAHLRKSIQPRHVLMSSL 141

Query: 65  XXXXXXXXXXXXXXXXXXXXPVSILISYSFVGLLVYTVMSCLGEMA-AFIPLDG-FTSYA 122
                               P  ++I Y+ +G  +Y ++   GEMA ++  L G F +Y 
Sbjct: 142 ATGVGTGLLVGNGSALHKAGPAGLVIGYAIMGTCLYCIIQACGEMAVSYSNLPGNFNAYP 201

Query: 123 SRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVNPGVWITIFLALIVLI 182
           +  VD   GFAV + Y  ++  V P +L   +M + +W ++  VN  +++ IF  LI+LI
Sbjct: 202 TFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYWTTK--VNNDIFVVIFYVLIILI 259

Query: 183 NTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGFRFWRDPGAFKPYSE 242
           N  G + + E +F+ ++ K                         G ++W DPGAF+    
Sbjct: 260 NVFGAKGYAEADFFFNTCKVLMITGFFILAIIINAGGAGTSGYIGAKYWHDPGAFRG--- 316

Query: 243 AISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVVFYVI 302
               S  +              +  +E   I A+E  NPRR++P A K+ +YRI+  ++ 
Sbjct: 317 --DRSIDRFKDVMATFTTAAFAFGASEFIAIGASEQSNPRRAIPSAAKIMIYRILFIFLS 374

Query: 303 TILLLGMTVAYNDPRLLXXXXXXXXXXXXPFVVAIENASIPVLPHIFNVCVLVFVFSACN 362
           +I L+G  V Y+   L+            P+V+AI +  + V+PH  N  +L+ V S  N
Sbjct: 375 SIALVGFLVPYDSSELMGSGSGGTKAS--PYVLAISSHGVRVVPHFINAVILLAVLSVSN 432

Query: 363 SDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCLLAYMNVSSGSAQVFNY 422
           S  Y + R L+ L+  G AP+ F   ++ G P  ++ +S+LF ++A+   SS   +VF +
Sbjct: 433 SAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMIISILFGIIAFCACSSKEEEVFTW 492

Query: 423 FVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLSYTAAFQPW-STYVA-LFFCCLI 480
            + +  +  + +W+ I +++IRF +A+ VQ    S L + +    W S Y A + F  LI
Sbjct: 493 LLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGFRSQLGVWGSVYAATMLFLALI 552

Query: 481 GLIKNYTVFLGH-KFDYKTFISGYIGIPVYLICYVGYKVVYRT-KL-IKPEDVDLYTFKD 537
                    +G    D K+F   Y+ +P+ ++ Y GYK+  R  KL I+ +++DL T ++
Sbjct: 553 AEFWVSIAPIGEDHLDAKSFFENYLAMPILIVFYFGYKIYNRDWKLFIRAKNIDLITHRN 612

Query: 538 AIDA 541
             DA
Sbjct: 613 IFDA 616

>Skud_2.260 Chr2 complement(467322..469118) [1797 bp, 598 aa] {ON}
           YBR132C (REAL)
          Length = 598

 Score =  220 bits (560), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 143/543 (26%), Positives = 259/543 (47%), Gaps = 23/543 (4%)

Query: 8   EKKNAGVLYSNETLEEGIVTLESEGQVRSVSEGVDGK---HEGIRL--------KKELEA 56
           ++ + G L  +E+    I T+   G V  V E  DG+    E  R         +++LE 
Sbjct: 34  DQPSEGWLGPSESSLAHISTIPEGGDVH-VHEHEDGESFIDEDSRTHLLFSTETRRKLEN 92

Query: 57  RHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILISYSFVGLLVYTVMSCLGEMAAFIPLD 116
           RHV +                       P S+L++++   + +  +     EM  F P+ 
Sbjct: 93  RHVQLIAISGVIGTALFVAIGKALYRGGPASLLLAFALWCVPILCITVSTAEMVCFFPVS 152

Query: 117 G-FTSYASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVNPGVWITIF 175
             F   A++ VD +      +++ F   +  P ++ +   ++ +W  RD  + G+ + + 
Sbjct: 153 SPFLRLATKCVDDSFAVMASWNFWFLECVQIPFEIVSVNTIIHYW--RDDYSAGIPLAVQ 210

Query: 176 LALIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGFRFWRDPG 235
           + L +LI+   V+++GE EFWL+S K                   P HDR GFR + +  
Sbjct: 211 VVLYLLISICAVKYYGEMEFWLASFKIILALGLFIFTFITMLGGNPKHDRYGFRNYGE-S 269

Query: 236 AFKPY---SEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPRAIKLT 292
            FK Y    + +  S G                 G E   ++A E K PR+ +P+A K  
Sbjct: 270 PFKKYFPDGKDVGKSSGYFQGFLACLIQASFTIAGGEYISMLAGEVKRPRKVLPKAFKQV 329

Query: 293 LYRIVVFYVITILLLGMTVAYNDPRLLXXXXXXXXXX-XXPFVVAIENASIPVLPHIFNV 351
             R+   ++ + L +G+  + NDP L              P+V+A+ N  I +LP I N+
Sbjct: 330 FVRLTFLFLGSCLCVGIVCSPNDPDLTAAINEARPGAGSSPYVIAMNNLKIRILPDIVNI 389

Query: 352 CVLVFVFSACNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCLLAYMN 411
            ++   FSA N+  Y +SR+ YG+A+DG AP++F   N+ GVP YS+ +S+++ L++ + 
Sbjct: 390 ALITAAFSAGNAYTYCSSRTFYGMALDGYAPKLFTRCNRHGVPIYSVAISLVWALVSLLQ 449

Query: 412 VSSGSAQVFNYFVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLSYTAAFQPWSTY 471
           ++S SA V N+ +N+++   L++++ + ITY+ F +A  VQ      L + +  QP++  
Sbjct: 450 LNSNSAVVLNWLINLITASQLINFVVLCITYLFFRRAYHVQQDSLPKLPFRSWGQPYTAI 509

Query: 472 VALFFCCLIGLIKNYTVFLGHKFDYKTFISGYIGIPVYLICYVGYKVVY---RTKLIKPE 528
           + L  C  + LI+ YTVF    +  + F+  Y+ + + +  YVGYK ++   + K   P 
Sbjct: 510 IGLVSCSAMILIQGYTVFFPKLWSTQDFLFSYLMVFINIGIYVGYKFIWKRGKDKFKNPH 569

Query: 529 DVD 531
           ++D
Sbjct: 570 EID 572

>AGR319W Chr7 (1328425..1330305) [1881 bp, 626 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR191W (HIP1)
          Length = 626

 Score =  221 bits (562), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 143/506 (28%), Positives = 240/506 (47%), Gaps = 16/506 (3%)

Query: 42  DGKHEGIRLKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILISYSFVGLLVYT 101
           D      +L K L  RH+                         P SILI+++ +   ++T
Sbjct: 101 DAARNSSQLSKNLSIRHLLTLAVGGAIGTGLFVNSGASLNTGGPGSILIAWTLISTCLFT 160

Query: 102 VMSCLGEMAAFIPL-DGFTSYASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFW 160
           +++ LGE+A+  P+  GF  Y +R+V+P+ GFAV  SYL ++ ++ P +L A ++ +++W
Sbjct: 161 IVNSLGELASAFPVVGGFNVYITRFVEPSFGFAVNISYLAQWAVLLPLELAAASITIKYW 220

Query: 161 VSRDRVNPGVWITIFLALIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXX 220
              +++N   W+ IF   I L N + V+ FGE EF LS VK                   
Sbjct: 221 --NNKINSDAWVAIFYVCIALANMLDVKSFGETEFVLSMVKILAIFGFAILGTVLICGGG 278

Query: 221 PNHDRTGFRFWRDPGAFKPYSEAISGSKG-KXXXXXXXXXXXXXXYTGTELCGIVAAEAK 279
           P     G ++W DPGAF      +  + G +              Y+GTEL G+ AAE+ 
Sbjct: 279 PVGGFIGAKYWHDPGAF------VGDTPGAQFKGLCSVFVTAAFSYSGTELVGVSAAESI 332

Query: 280 NPRRSVPRAIKLTLYRIVVFYVITILLLGMTVAYNDPRLLXXXXXXXXXXXXPFVVAIEN 339
           NPR ++PRA K + + I   Y++ + + G  V  NDPRLL            P V+AIEN
Sbjct: 333 NPRYTIPRASKRSFWLITSSYLLVLTIAGCLVPSNDPRLLNGMSSVDVAAS-PLVIAIEN 391

Query: 340 ASIPVLPHIFNVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLG 399
             I  +P + N  +L+ + S  NS +Y  SR +  +A  G  P++F   ++ G P  ++ 
Sbjct: 392 GGIRGVPSLMNAIILIAIISVANSSVYACSRCMVSMAQVGNLPKVFNYIDRKGRPLVAIL 451

Query: 400 LSVLFCLLAYMNVSSGSAQVFNYFVNVVSIFGLLSWITILITYIRFDKAIRVQ---FGDK 456
            +++F LL+++  S     +F +   +  +  L  W  I I++IRF +A+  Q     + 
Sbjct: 452 ATLVFGLLSFVAASDKQEAIFTWLSALSGLSTLFCWFAINISHIRFRRAMCAQQRSLDEL 511

Query: 457 SSLSYTAAFQPWSTYVALFFCCLIGLIKNYTVFLGHKFDYKTFISGYIGIPVYLICYVGY 516
             LS T     W     L F  ++    +           ++F  GY+  P++LICY+ +
Sbjct: 512 PYLSLTGVLGSWYGAAVLLFVLVLSFWTSLFPPGSSGPSAESFFEGYLSFPIFLICYISH 571

Query: 517 KVVYRT-KLIKPE-DVDLYTFKDAID 540
           K+  R  +L  P   +D+ + + A+D
Sbjct: 572 KLYKRDWRLFIPAGQIDVDSGRRALD 597

>ZYRO0F13838g Chr6 (1139293..1141803) [2511 bp, 836 aa] {ON} similar
           to uniprot|Q03770 Saccharomyces cerevisiae YDR160W SSY1
           Component of the SPS plasma membrane amino acid sensor
           system (Ssy1p-Ptr3p-Ssy5p) which senses external amino
           acid concentration and transmits intracellular signals
           that result in regulation of expression of amino acid
           permease genes
          Length = 836

 Score =  224 bits (570), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 149/557 (26%), Positives = 254/557 (45%), Gaps = 60/557 (10%)

Query: 43  GKHEGIRLKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILISYSFVGLLVYTV 102
           G  +   ++++L  RH+ M                       P   L+ +S  G +V   
Sbjct: 255 GTGDSHHIQRKLRVRHIQMIGIGACLGVGIFLTSGKAFSIAGPFGTLLGFSLSGSIVLAT 314

Query: 103 MSCLGEMAAFIPLD-GFTSYASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWV 161
           +    E++  IPL  GF+  ASR+V+ A GFA+G++Y F   I  P Q+ A    ++++ 
Sbjct: 315 LLSFTELSTLIPLSSGFSGLASRFVEDAFGFALGWTYWFSCMITMPTQVVACTFYLKYFD 374

Query: 162 SRDRVNPGV---WITIFLALIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXX 218
           S + +N G    + T+F+   VL+N + VR  GE  +    +K                 
Sbjct: 375 SLN-LNKGAIAGFATLFMLYAVLVNLLDVRLMGEIVYITGLIKIIISIIMILAMVILNSG 433

Query: 219 XXPNHDRTGFRFWRDP--------GAFKPY----------SEAISGSKGKXXXXXXXXXX 260
               +DR GFRFW           G F+P           ++ I GS G+          
Sbjct: 434 TGTKYDRVGFRFWDSSKSSSNLTYGLFRPTFDLNDIGDGSTKGIEGSGGRFLALASTMLI 493

Query: 261 XXXXYTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVVFYVITILLLGMTVAYNDPRLL- 319
               YTG E+  + + EA NPR+++P A K T   ++V YV TI  + + +   DPRL  
Sbjct: 494 STFAYTGVEMAFVASGEAINPRKTIPSATKRTFCIVLVIYVFTIFSVSINIYCGDPRLQP 553

Query: 320 --------------------------------XXXXXXXXXXXXPFVVAIENASIPVLPH 347
                                                       P+V+A++N  +     
Sbjct: 554 YFTGSYSARYQAVQRGVGSQWQLSHKCHTNIPYSTKDPVDHNSSPWVLALQNFGLCTFAA 613

Query: 348 IFNVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCLL 407
           +FN  ++ F   A  S L+ +SR+LY +A+  KAP IF   NK GVPY S+  S +F ++
Sbjct: 614 VFNGILIFFTSGAEISSLFSSSRTLYSMAVQRKAPTIFQRCNKRGVPYVSVIFSGMFGVV 673

Query: 408 AYMNVSSGSAQVFNYFVNVVSIFGLLSWITILITYIRFDKAIRVQFG----DKSSLSYTA 463
            Y+ V SG+ + FN   N+ S    + W+ + ++++RF  A++ +      D+ S  Y +
Sbjct: 674 GYLAVDSGAVENFNVLSNMSSASTSIIWMGLNVSFLRFYYALKTRRDIISRDEKSYPYRS 733

Query: 464 AFQPWSTYVALFFCCLIGLIKNYTVFLGHKFDYKTFISGYIGIPVYLICYVGYKVVYRTK 523
            FQP+  +  LF CCL  +   +T F+ H ++ K+F S Y G+ ++++CY+GYK++  +K
Sbjct: 734 PFQPYLAFYGLFGCCLFIIFMGFTNFIHHFWNVKSFFSAYGGLILFVVCYLGYKMIGTSK 793

Query: 524 LIKPEDVDLYTFKDAID 540
           + + + +D+ T +  +D
Sbjct: 794 IQRLDQLDMDTGRREMD 810

>KAFR0D00500 Chr4 complement(77541..79394) [1854 bp, 617 aa] {ON} 
          Length = 617

 Score =  219 bits (559), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 142/500 (28%), Positives = 236/500 (47%), Gaps = 17/500 (3%)

Query: 49  RLKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILISYSFVGLLVYTVMSCLGE 108
           +LKK ++ RHV M                       P  ++I Y+ +   +Y VM  +GE
Sbjct: 98  KLKKTIQPRHVIMITLGTGVGTGLLVGNGTTLSHAGPAGLIIGYAIMSTCIYCVMQAVGE 157

Query: 109 MAA--FIPLDGFTSYASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRV 166
           MA      + GF++Y    +DP + FAV + Y  ++F V P +L   +M +Q+W ++  V
Sbjct: 158 MAVNYLTLIGGFSAYPGFLIDPGLNFAVSWIYCIQWFCVCPLELVTASMTIQYWTTK--V 215

Query: 167 NPGVWITIFLALIVLINTVG-VRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDR 225
           N  +++ IF  L++ IN  G  R + E EF+ +  K                    N   
Sbjct: 216 NADIFVLIFYLLMIGINIFGGARGYAEAEFFCNVCKILMMTGFFILGIILICGGAGNSGF 275

Query: 226 TGFRFWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSV 285
            G R+W  PGAF+     I+  KG               + GTE   I A+E  NPR+++
Sbjct: 276 IGARYWHSPGAFRG-DNGINRFKG----IVSTLVTAAFAFGGTEFLAITASEQANPRKAI 330

Query: 286 PRAIKLTLYRIVVFYVITILLLGMTVAYNDPRLLXXXXXXXXXXXXPFVVAIENASIPVL 345
           P A K  +YR ++ YV +I+++G  V YN   LL            P+V+A+ +  I V+
Sbjct: 331 PSAAKKVIYRALIIYVGSIIIVGFLVPYNSSELLGSSGPATKAS--PYVIAVASHGIRVV 388

Query: 346 PHIFNVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFC 405
           PH  N  +L+ VFS  +S  Y +SR L  LA  G AP+IF   +K G P     +  +  
Sbjct: 389 PHFINAVILISVFSVADSAFYSSSRLLLTLARQGFAPKIFTYVDKRGRPTLGFVVGAIIA 448

Query: 406 LLAYMNVSSGSAQVFNYFVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLSYTAAF 465
           ++++   SS  A VFN+ +++  +  + +W  I +++IRF +A++VQ      + + +  
Sbjct: 449 IISFCACSSKEADVFNWLLSISGLSEVFTWAIISLSHIRFRRAMKVQGRSLDEIGFKSQA 508

Query: 466 QPWSTYVA--LFFCCLIGLIKNYTVFLGH-KFDYKTFISGYIGIPVYLICYVGYKVVYRT 522
             W +  A  +    LIG      V +G    D  +F   Y+ +PV+++ Y GYK+  R 
Sbjct: 509 GVWGSVYAFVMMILVLIGQFWVGIVPVGEDSADAVSFFQAYLAMPVFIVLYFGYKIWNRD 568

Query: 523 --KLIKPEDVDLYTFKDAID 540
               I+ +++DL   +   D
Sbjct: 569 WRLFIRAKNIDLIAHRHIYD 588

>KLLA0F27093g Chr6 (2501049..2502740) [1692 bp, 563 aa] {ON} similar
           to uniprot|P43548 Saccharomyces cerevisiae YFL055W AGP3
           Low-affinity amino acid permease may act to supply the
           cell with amino acids as nitrogen source in
           nitrogen-poor conditions transcription is induced under
           conditions of sulfur limitation
          Length = 563

 Score =  218 bits (555), Expect = 6e-63,   Method: Compositional matrix adjust.
 Identities = 152/523 (29%), Positives = 241/523 (46%), Gaps = 35/523 (6%)

Query: 6   SMEKKNAGVLYSNETLEEG---IVTLESEGQVRSVSEGVDGKHEGI-----RLKKELEAR 57
           S E  + G + SN  L++    +  +E + +    +E      E        +K++L+ R
Sbjct: 4   SYELNHTGEVVSNRGLKDAYNEVTEMEVDPKNNEYAEEQSLNREDTFDPDSGVKRQLKDR 63

Query: 58  HVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILISYSFVGLLVYTVMSCLGEMAAFIPLDG 117
           H+S+                       P+++L+ +  +G+L + +M  +GEM    P  G
Sbjct: 64  HISLLALGGIIGPGCLIGAGNALAIGGPLALLLGFGIIGILAFIMMESIGEMITLYPSGG 123

Query: 118 -FTSYASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVNPGV----WI 172
            FT+   R+   A+    GY+Y   +F V  N+    + +MQFW       P V    +I
Sbjct: 124 GFTTLTRRFHSDALSAVCGYAYAVVFFAVLANEYNTLSSIMQFW------GPQVPLYGYI 177

Query: 173 TIFLALIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGFRFWR 232
            IF A   +   +GV  FGE E+WL+  K                    N    GF++W 
Sbjct: 178 LIFWAAFQVFQLLGVGAFGETEYWLAWFKILGLLTYYIFSIVYISGGVKNRPAFGFQYWN 237

Query: 233 DPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPRAIKLT 292
           DPGA        +G KG               Y+GTE   + A E+KNPRR+VP AI+ T
Sbjct: 238 DPGALS------NGFKG----IANVFVFCSTFYSGTESVALAATESKNPRRAVPIAIRQT 287

Query: 293 LYRIVVFYVITILLLGMTVAYNDPRLLXXXXXXXXXXXXPFVVAIENASIPVLPHIFNVC 352
            +RI++ Y+   +  G+TV YND  L             P  +AI  A  P   H+ N  
Sbjct: 288 FWRILIVYLGISIFYGVTVPYNDENL----NFATKVLKSPIAIAISRAGWPAGVHLVNAF 343

Query: 353 VLVFVFSACNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCLLAYMNV 412
           +L+   SA N  LY+ SR+L  LA +G AP++ A T++ GVP  ++ +     L++ MNV
Sbjct: 344 ILITCISAINGSLYIGSRTLTHLANEGLAPKLLAWTDRRGVPIPAITVFNALGLISLMNV 403

Query: 413 SSGSAQVFNYFVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLSYTAAFQPWSTYV 472
           S  +   +NY VN+  +   + W  I +T++RF KA ++Q   +  L Y A   P    V
Sbjct: 404 SVTAVDAYNYIVNLSGVGVFIVWGIISLTHLRFRKAWKLQGHTRDELPYKAKLFPVFPIV 463

Query: 473 ALFFCCLIGLIKNYTVFLGHKFDYKTFISGYIGIPVYLICYVG 515
           ++     +GL++ ++ F    FD K F+  YI IP  +I Y+G
Sbjct: 464 SIIANIFLGLVQGWSYF--KPFDAKNFVDAYILIPAGIILYLG 504

>Kpol_526.10 s526 complement(18362..20104) [1743 bp, 580 aa] {ON}
           complement(18362..20104) [1743 nt, 581 aa]
          Length = 580

 Score =  218 bits (556), Expect = 7e-63,   Method: Compositional matrix adjust.
 Identities = 142/533 (26%), Positives = 254/533 (47%), Gaps = 15/533 (2%)

Query: 17  SNETLEEGIVTLESEGQVRSVSEGVDGKHEGIRLKKELEARHVSMXXXXXXXXXXXXXXX 76
           S+ +L      +E E +V S +  +       +  ++L  RHV +               
Sbjct: 39  SDSSLTSNTTQIEEE-EVDSTTNLI----YSTKTHRKLLNRHVQLIAISGVIGTALFVAI 93

Query: 77  XXXXXXXXPVSILISYSFVGLLVYTVMSCLGEMAAFIPLDG-FTSYASRYVDPAVGFAVG 135
                   P  +LI+++   + +  +     EM +F+P+   F   AS+  D ++     
Sbjct: 94  GKALYHGGPAFLLIAFALWCIPILCITVSTAEMVSFLPVASPFLRLASKCADESLAVTAS 153

Query: 136 YSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVNPGVWITIFLALIVLINTVGVRFFGEFEF 195
           +++ F   +  P ++ +   ++ +W  RD  N  + + + + L + I+   V+++GE EF
Sbjct: 154 WNFWFLECVQIPFEIVSVNTIIHYW--RDDYNAAIPLVVQVVLYLFISIATVKYYGEMEF 211

Query: 196 WLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGFRFWRDPGAFKPYSEAISG---SKGKXX 252
           WL+S K                   P HDR GFR+W +    K Y +  +    S G   
Sbjct: 212 WLASFKIILAIGLFFFTLVTMLGGNPKHDRYGFRYWGEEPFKKYYPDNNTNGTDSLGYFQ 271

Query: 253 XXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVVFYVITILLLGMTVA 312
                         G E   ++A E K PR+ +P+A K   +R+ + ++ T L LG+  +
Sbjct: 272 GFLTCLIQAAFTIAGGEYISMLAGEIKLPRKVLPKAFKQVFWRLTIIFLGTCLCLGIVCS 331

Query: 313 YNDPRLLXXXXXXXXXX-XXPFVVAIENASIPVLPHIFNVCVLVFVFSACNSDLYVASRS 371
            NDP L              PFV+A+ N  I VLP I N  ++   FSA N+  Y +SR+
Sbjct: 332 PNDPSLTAAINEARPGAGSSPFVIAMNNLRIRVLPDIVNAALITSAFSAGNAYTYCSSRT 391

Query: 372 LYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCLLAYMNVSSGSAQVFNYFVNVVSIFG 431
           LYG+A+DG AP+IF   NK+GVP Y++G+S+L+ L++ + ++S SA V N+ VN+++   
Sbjct: 392 LYGMALDGYAPKIFTRCNKYGVPIYAVGVSLLWALISLLQLNSNSAIVLNWLVNLITASQ 451

Query: 432 LLSWITILITYIRFDKAIRVQFGDKSSLSYTAAFQPWSTYVALFFCCLIGLIKNYTVFLG 491
           L++++ + + Y+ F +A   Q      L + +  QP++    L     +  I+ YTVF+ 
Sbjct: 452 LINFVFLCVIYLFFRRAYNAQKDKLPPLPFRSWGQPYTAIFGLVCAFSMIFIQGYTVFIH 511

Query: 492 HKFDYKTFISGYIGIPVYLICYVGYKVVY---RTKLIKPEDVDLYTFKDAIDA 541
             ++ + F+  Y+ + + +  Y+GYK ++   + K I P  VD  T    I+A
Sbjct: 512 SLWNTRDFLFCYLMVFINVAIYLGYKFIWKRGKDKFIDPHKVDFITDLKEIEA 564

>Smik_2.201 Chr2 complement(355785..357614) [1830 bp, 609 aa] {ON}
           YBR068C (REAL)
          Length = 609

 Score =  219 bits (557), Expect = 8e-63,   Method: Compositional matrix adjust.
 Identities = 146/519 (28%), Positives = 240/519 (46%), Gaps = 26/519 (5%)

Query: 30  SEGQVRSVSEGVDGKHEGI-------RLKKELEARHVSMXXXXXXXXXXXXXXXXXXXXX 82
           S  +++ ++E      +GI       +LKK +++RHV M                     
Sbjct: 64  STTKIKPINENTSDLEDGIQSFTSDSKLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLHY 123

Query: 83  XXPVSILISYSFVGLLVYTVMSCLGEMAAFIPL--DGFTSYASRYVDPAVGFAVGYSYLF 140
             P +++I Y  V  + Y ++   GEMA   P     F +Y+S ++    GFA  + Y F
Sbjct: 124 GGPAALVIGYVLVSFITYFMIQAAGEMAVTYPTLPANFNAYSSIFISKPFGFATVWLYCF 183

Query: 141 KYFIVTPNQLTAGAMVMQFWVSRDRVNPGVWITIFLALIVLINTVGVRFFGEFEFWLSSV 200
           ++  V P +L   +M +QFW   D++NP ++I IF   ++ ++  GV+ +GE EF  +  
Sbjct: 184 QWTTVLPLELITASMTIQFW--NDKINPDIYILIFYVFLLFVHFFGVKAYGETEFIFNCC 241

Query: 201 KXXXXXXXXXXXXXXXXXXXPNHDRTGFRFWRDPGAFKPYSEAISGSKGKXXXXXXXXXX 260
           K                    N    G  +W  PGAF     A   S  +          
Sbjct: 242 KILMIAGFIVLSVVINCGGAGNDGYIGGAYWHKPGAF-----AGDTSIARFKNVCYILVT 296

Query: 261 XXXXYTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVVFYVITILLLGMTVAYNDPRLLX 320
               + G EL  +   E  NPR+S P A K ++YRIVV Y++T++L+G  V YND +LL 
Sbjct: 297 AYFSFGGMELFVLSVQEQTNPRKSTPVAAKRSIYRIVVIYLLTMILIGFNVPYNDDQLLG 356

Query: 321 XXXXXXXXXXXPFVVAIENASIPVLPHIFNVCVLVFVFSACNSDLYVASRSLYGLAIDGK 380
                      P+V+A     + ++PHI N  +L+ V S  NS LY   R +  LA  G 
Sbjct: 357 AGGSATHAS--PYVLAASIHGVRIVPHIINAVILISVVSVANSSLYAGPRLICSLAQQGY 414

Query: 381 APRIFATTNKWGVPYYSLGLSVLFCLLAYMNVSSGSAQVFNYFVNVVSIFGLLSWITILI 440
           AP+     ++ G P  +L +  +  ++A++  SS    VF +   +  +  L +W +I++
Sbjct: 415 APKFLDYVDREGRPLRALIVCCVIGVIAFVAASSKEEIVFTWLAAIAGLSELFTWTSIML 474

Query: 441 TYIRFDKAIRVQFGDKSSLSYTAAFQPWSTYVALFFCCLIGLIKNYTVFL-----GHKFD 495
           +++RF +A++VQ    + L Y A    W +    FF  L+  I  + V L     G K +
Sbjct: 475 SHLRFRQAMKVQGRSLNELGYKATTGIWGSIYGSFFNILV-FIAQFWVALAPLGNGGKCN 533

Query: 496 YKTFISGYIGIPVYLICYVGYKVVYRT-KLIKPED-VDL 532
            + F   Y+  P++LI Y+GY +  R   L+ P D +DL
Sbjct: 534 AEAFFESYLAAPIWLIFYIGYMIYNRDFTLLNPLDKIDL 572

>Suva_4.307 Chr4 complement(540768..542597) [1830 bp, 609 aa] {ON}
           YDR046C (REAL)
          Length = 609

 Score =  218 bits (556), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 149/533 (27%), Positives = 244/533 (45%), Gaps = 28/533 (5%)

Query: 9   KKNAGVLYSNETLEEGIVTLESEGQVRSVSEGVDGKHEGIRLKKELEARHVSMXXXXXXX 68
           K+  G     + + E   T + EG V S +   D K     LKK +++RHV M       
Sbjct: 59  KRAEGSTTHTKQINEN--TSDLEGDVNSFTS--DSK-----LKKSMKSRHVVMMTLGTGI 109

Query: 69  XXXXXXXXXXXXXXXXPVSILISYSFVGLLVYTVMSCLGEMAAFIPL--DGFTSYASRYV 126
                           P +++I Y  V  + Y ++   GEMA   P     F +Y+S ++
Sbjct: 110 GTGLLVANAKGLHYGGPAALVIGYFLVSFVTYFMIQAAGEMAVTYPTLPANFNAYSSIFI 169

Query: 127 DPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVNPGVWITIFLALIVLINTVG 186
               GFA  + Y F++  V P +L   AM ++FW   D +NP ++I IF   ++ I+  G
Sbjct: 170 SKPFGFATVWVYCFQWLTVLPLELITAAMTIKFW--NDTINPDIFILIFFVFLLFIHFFG 227

Query: 187 VRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGFRFWRDPGAFKPYSEAISG 246
           V+ +GE EF  +  K                    N    G ++WR+PGAF     A   
Sbjct: 228 VKGYGETEFIFNCCKILMIAGFIILSVVINCGGAGNDGYIGGKYWRNPGAF-----AGDT 282

Query: 247 SKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVVFYVITILL 306
           S G+              + G EL  +   E  NPR++ P A K ++YRI+V Y++T++L
Sbjct: 283 SAGRFKNVCYILVTAYFSFGGMELFALSVQEQANPRKTTPVAAKRSIYRILVIYLLTMIL 342

Query: 307 LGMTVAYNDPRLLXXXXXXXXXXXXPFVVAIENASIPVLPHIFNVCVLVFVFSACNSDLY 366
           +G  V YND +L+            P+V+A     + V+PHI N  +L+ V S  NS LY
Sbjct: 343 IGFNVPYNDDQLMGAGGSATHAS--PYVLAASIHGVKVVPHIINAVILISVISVANSSLY 400

Query: 367 VASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCLLAYMNVSSGSAQVFNYFVNV 426
              R +  LA  G  P+     ++ G P  +L +  +F ++ ++  SS    VF +   +
Sbjct: 401 AGPRLMCSLAQQGYGPKFLDYVDREGRPLIALIVCSVFGVIGFVAASSKEEVVFAWLAAI 460

Query: 427 VSIFGLLSWITILITYIRFDKAIRVQFGDKSSLSYTAAFQPWSTYVALFFCCLIGLIKNY 486
             +  L +W +I+++++RF +A++VQ      L Y A    W +   +FF  L+  I  +
Sbjct: 461 AGLSELFTWTSIMLSHLRFRQAMKVQGRSLDELGYKATTGIWGSAYGVFFNILV-FIAQF 519

Query: 487 TVFL-----GHKFDYKTFISGYIGIPVYLICYVGYKVVYRT-KLIKPED-VDL 532
            V L     G K   ++F   Y+  P+++  Y+GY +  R    + P D +DL
Sbjct: 520 WVALAPLNNGGKCSAESFFQSYLAFPIWIAFYLGYMIYNRDFTFLNPLDKIDL 572

>Kwal_33.15407 s33 (1092383..1094146) [1764 bp, 587 aa] {ON} YGR191W
           (HIP1) - histidine permease [contig 290] FULL
          Length = 587

 Score =  217 bits (553), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 144/518 (27%), Positives = 248/518 (47%), Gaps = 24/518 (4%)

Query: 33  QVRSVSEGVDGKHEGIRLKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILISY 92
            V S S   D   E  R  K+L  RH+                         P S++I +
Sbjct: 55  NVESTSGTSDA--EDSRYNKDLSVRHLLTLAVGGAIGTGLFVNSGSALTTGGPGSLVIDW 112

Query: 93  SFVGLLVYTVMSCLGEMAAFIPL-DGFTSYASRYVDPAVGFAVGYSYLFKYFIVTPNQLT 151
             +   ++T+++ LGE+++  P+  GF  Y SR+V+P+ GFAV  +YL ++ ++ P +L 
Sbjct: 113 VIISTCLFTIVNALGELSSTFPVVGGFNVYISRFVEPSFGFAVNLNYLAQWAVLLPLELV 172

Query: 152 AGAMVMQFWVSRDRVNPGVWITIFLALIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXX 211
           A ++ +++W S   +N   W+ IF  +I L N + V+ FGE EF LS VK          
Sbjct: 173 AASLTIRYWNST--INSDAWVAIFYTIIFLANLLDVKSFGETEFVLSMVKILAIIGFTIL 230

Query: 212 XXXXXXXXXPNHDRTGFRFWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELC 271
                    P     G ++W +PGAF   +     S  +              Y+GTEL 
Sbjct: 231 GIVLTCGGGPEGGYIGGKYWSNPGAFVGNT-----SSQRFHGLCSVFVTAAFSYSGTELI 285

Query: 272 GIVAAEAKNPRRSVPRAIKLTLYRIVVFYVITILLLGMTVAYNDPRLLXXXXXXXXXXXX 331
            + AAE+ NPR ++P+A K T + I V Y++ + L+G  V  +DPRLL            
Sbjct: 286 AVSAAESVNPRITLPKACKRTFWLITVCYIVVLTLVGCLVPSDDPRLLHGSSSVDVAAS- 344

Query: 332 PFVVAIENASIPVLPHIFNVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPRIFATTNKW 391
           P V+AIEN  I  LP + N  +L+ V S  NS +Y  SR +  +A  G  P+ F+  ++ 
Sbjct: 345 PLVIAIENGGIKGLPSLMNAIILIAVLSVANSAVYACSRCMASMARIGNLPKTFSYVDRK 404

Query: 392 GVPYYSLGLSVLFCLLAYMNVSSGSAQVFNYFVNVVSIFGLLSWITILITYIRFDKAIRV 451
           G P Y++  +++F LL+++  S+    VF +   +  +  L  W  I +++IRF   ++ 
Sbjct: 405 GRPLYAILATLIFGLLSFIAASNKQETVFTWLSALSGLSTLFCWFAINVSHIRFRYTMKQ 464

Query: 452 QFGDKSSLSYTAAFQPWSTYVALFFCCLIGLIKNYTVFLGHKF-------DYKTFISGYI 504
           +      L + +    W +Y    + C+I  +     F    F         ++F   Y+
Sbjct: 465 RGRSLDELPFVSMTGVWGSY----YGCVIIFVVLVVCFWTALFPSTEGVASAESFFETYL 520

Query: 505 GIPVYLICYVGYKVVYRT-KLIKP-EDVDLYTFKDAID 540
             P+ L+CY+G+K+  ++ +L+ P  ++D+ + + A+D
Sbjct: 521 SFPILLVCYIGHKLYTKSWRLLTPTTEIDIDSGRRAVD 558

>TBLA0B07760 Chr2 complement(1834605..1836581) [1977 bp, 658 aa]
           {ON} Anc_5.158 YGR191W
          Length = 658

 Score =  219 bits (557), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 141/497 (28%), Positives = 240/497 (48%), Gaps = 14/497 (2%)

Query: 50  LKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILISYSFVGLLVYTVMSCLGEM 109
           + K+L  RH+                         P S++I +  V   ++TV++ LGE+
Sbjct: 141 MNKDLSVRHLLTLAVGGAIGTGLFVNSGSSLNTGGPASLVIGWVIVSTALFTVINSLGEL 200

Query: 110 AAFIPL-DGFTSYASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVNP 168
           AA  P+  GF+ Y  ++VDP+  FAV  +YL ++ ++ P +L A ++ +++W S   +N 
Sbjct: 201 AAAFPVVGGFSVYMDKFVDPSFAFAVNLNYLLQWLVLLPLELVAASITIRYWNSS--INS 258

Query: 169 GVWITIFLALIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGF 228
             W++IF   I L N + V+ FGE EF LS VK                   P+H+  G 
Sbjct: 259 DAWVSIFYVAIGLANMLDVKSFGETEFVLSLVKILAIIGFFILGIVLDCGGGPSHEYIGG 318

Query: 229 RFWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPRA 288
           ++W DPGAF   +   SGSK K              ++G E+  + AAE++NPR ++P+A
Sbjct: 319 KYWHDPGAFVGTT---SGSKFKGLCSVFVTAAFS--FSGIEMTAVSAAESRNPRETIPKA 373

Query: 289 IKLTLYRIVVFYVITILLLGMTVAYNDPRLLXXXXXXXXXXXXPFVVAIENASIPVLPHI 348
            K T + I   YV  + L+G  V YNDPRL+            P V+AIEN  I  LP +
Sbjct: 374 AKRTFWLITGSYVSILTLVGCLVPYNDPRLMNGSSSVDAASS-PLVIAIENGHIHGLPSL 432

Query: 349 FNVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCLLA 408
            N  +L+ + S  NS +Y  SR +  ++     P++FA  ++ G P  ++   + F LL+
Sbjct: 433 MNAIILIAILSVANSSVYACSRCMVSMSKIETLPKVFAKVDRRGRPIPAICFVLFFGLLS 492

Query: 409 YMNVSSGSAQVFNYFVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLSYTAAFQPW 468
           ++  S   A+VF +   +  +  +  W+ I + +IRF + + VQ      L + +    W
Sbjct: 493 FVAASDKQAEVFTWLSALSGLSTIFCWMGINLCHIRFRQGMHVQQISLDELPFLSQTGIW 552

Query: 469 STYVALFFCCLIGLIKNYTVFL---GHKFDYKTFISGYIGIPVYLICYVGYKVVYRTKL- 524
            +   +    L+ +   +T        K +  +F  GY+  P+ L CY+ +KV ++    
Sbjct: 553 GSIYGIVILFLVLVASFWTSLFPVGSSKANATSFFEGYLSFPILLGCYIAHKVYFKNWRW 612

Query: 525 -IKPEDVDLYTFKDAID 540
            I    +DL++ +  +D
Sbjct: 613 YIPASKMDLHSGRKQVD 629

>KLLA0A06930g Chr1 complement(625498..627261) [1764 bp, 587 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 587

 Score =  217 bits (553), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 144/496 (29%), Positives = 243/496 (48%), Gaps = 18/496 (3%)

Query: 50  LKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILISYSFVGLLVYTVMSCLGEM 109
           LK+ L++RH+ M                       P  ILI ++  G ++Y ++  +GE+
Sbjct: 76  LKRTLKSRHLQMIGIGGAIGTGLFVGSGKSLATAGPAGILIGWALTGTMIYCMVMAMGEL 135

Query: 110 AAFIPL-DGFTSYASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVNP 168
           A   P+  G+T+YASR+VD + GFA    Y   + I  P ++ A ++ + +W +  +   
Sbjct: 136 AVTFPVAGGYTTYASRFVDESFGFAFNTVYAMGWLITLPLEIVAASITVNYWGTPAKYRD 195

Query: 169 GVWITIFLALIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGF 228
             ++ +F  +IV IN  GV+ +GE EF  S +K                   P     G 
Sbjct: 196 A-FVALFYVVIVGINLFGVKGYGEAEFIFSFIKVIAVIGFIILGVILVCGGGPQGGYIGG 254

Query: 229 RFWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPRA 288
           R W +PGAF       +G KG               + G+EL G+ AAE  NPR+S+P A
Sbjct: 255 RLWHNPGAFA------NGFKG----VCSVFVTAAFSFAGSELVGLAAAETANPRKSIPSA 304

Query: 289 IKLTLYRIVVFYVITILLLGMTVAYNDPRLLXXXXXXXXXXXXPFVVAIENASIPVLPHI 348
            K   +RI +FY++ +L++G+ V Y   RL+            PFV++I+NA I  LP +
Sbjct: 305 AKQVFWRITLFYILALLMVGLLVPYTSDRLIGQSSVDAAAS--PFVISIQNAGIKGLPSV 362

Query: 349 FNVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCLLA 408
            NV +L+ V S  N  ++  SRS+  LA  G  P+IF   ++ G P   + ++ +F LL+
Sbjct: 363 INVVILIAVLSVGNCAVFGCSRSMAALANQGSLPKIFGYIDRTGRPLVGIVVTCVFGLLS 422

Query: 409 YMNVSSGSAQVFNYFVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLSYTAAFQPW 468
           ++  S    +VF++ + +  +  L +W  IL+ +IR  +A+  Q    + LS+TA    W
Sbjct: 423 FIAASPKEGEVFDWLLALSGLSSLFTWGGILLCHIRVRRALAAQNRTTAELSFTAPTDVW 482

Query: 469 STYVALFFCCLIGLIKNYTVF--LGHKFDYKTFISGYIGIPVYLICYVGYKVVYRT-KL- 524
            +  +L    LI + + +     +G K     F   Y+  P+Y++ Y+G+K+  +  KL 
Sbjct: 483 GSVYSLILIILILIAQFWIALFPIGGKPSAAAFFEAYLSFPIYIVFYIGHKIWKKNWKLF 542

Query: 525 IKPEDVDLYTFKDAID 540
           IK  D+D+ + +   D
Sbjct: 543 IKASDIDIDSGRRETD 558

>KAFR0D04140 Chr4 (821341..823254) [1914 bp, 637 aa] {ON} 
          Length = 637

 Score =  218 bits (556), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 142/532 (26%), Positives = 247/532 (46%), Gaps = 20/532 (3%)

Query: 19  ETLEEGIVTLESEGQVRSVSEGVDGKHEGIRLKKELEARHVSMXXXXXXXXXXXXXXXXX 78
           E LE  +V+  S  + + +    +G  +   L+K +  RHV M                 
Sbjct: 89  EDLENELVSTLSPSKSKQLHGQKNGDDDA-HLQKSIRPRHVLMMSLGTGIGTGLLVGNGS 147

Query: 79  XXXXXXPVSILISYSFVGLLVYTVMSCLGEMA-AFIPLDG-FTSYASRYVDPAVGFAVGY 136
                 P +++I Y  +G  +Y ++   GEMA  +  L G F +Y S  VD  + F V +
Sbjct: 148 ALSKAGPGALVIGYGIMGSCLYCIIQACGEMAVCYSGLPGNFNAYPSFLVDEGMAFGVAW 207

Query: 137 SYLFKYFIVTPNQLTAGAMVMQFWVSRDRVNPGVWITIFLALIVLINTVGVRFFGEFEFW 196
            Y  ++  V P +L   +M + +W ++  VN  V++ IF  LI LINT G + + E EF+
Sbjct: 208 VYCLQWLCVMPLELVTASMTIDYWTTK--VNSDVFVVIFFVLITLINTFGAKGYAEAEFF 265

Query: 197 LSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGFRFWRDPGAFKPYSEAISGSKGKXXXXXX 256
            +S K                    N    G ++W +PGAF+        S  +      
Sbjct: 266 FNSCKVLMMAGFFILAIVINTGGAGNDGYIGAKYWHNPGAFRG-----DKSIDRFKDVMS 320

Query: 257 XXXXXXXXYTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVVFYVITILLLGMTVAYNDP 316
                   +  +E   I A+E  NPRR++P A K  +YRI+  ++ +I L+G  V Y+  
Sbjct: 321 TFTTAAFAFGASEFIAIGASEQSNPRRAIPSAAKTMIYRILFIFLTSITLVGFLVPYDST 380

Query: 317 RLLXXXXXXXXXXXXPFVVAIENASIPVLPHIFNVCVLVFVFSACNSDLYVASRSLYGLA 376
            LL            P+V+A+ +  + V+PH  N  +L+ V S  NS  Y + R LY LA
Sbjct: 381 ELLGSGGSASSQAS-PYVIAVASHGVRVVPHFINAVILLSVLSVANSAYYSSCRILYSLA 439

Query: 377 IDGKAPRIFATTNKWGVPYYSLGLSVLFCLLAYMNVSSGSAQVFNYFVNVVSIFGLLSWI 436
             G AP+ F   ++ G P  ++ ++ +F ++A+ + S     VF + +++  +  L +W 
Sbjct: 440 QQGYAPKWFEYIDREGRPARAMLVTTIFGVIAFCSCSDKEEDVFAWLLSIAGLSQLFTWT 499

Query: 437 TILITYIRFDKAIRVQFGDKSSLSYTAAFQPW-STYVALFFCCLIGLIKNYTVFLG---- 491
            I +++IRF +A++VQ      + + +    W S Y A+    ++ LI  + V +     
Sbjct: 500 AICLSHIRFRRAMKVQGRSVDEIGFKSQVGVWGSGYAAIMM--ILALIAEFWVSIAPIGE 557

Query: 492 HKFDYKTFISGYIGIPVYLICYVGYKVVYRT-KL-IKPEDVDLYTFKDAIDA 541
              D + F   Y+ +P+ ++ Y GYK+  +  KL I+ +D+DL + +   D 
Sbjct: 558 DHLDAQNFFENYLAMPILIVLYFGYKIYKKDWKLFIRAKDIDLISHRTIFDG 609

>KNAG0C00590 Chr3 complement(100801..102705) [1905 bp, 634 aa] {ON}
           Anc_1.50 YDR508C
          Length = 634

 Score =  218 bits (554), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 145/534 (27%), Positives = 247/534 (46%), Gaps = 24/534 (4%)

Query: 16  YSNETLEEGIVTLESEGQVRSVSEGVDGKHEGIRLKKELEARHVSMXXXXXXXXXXXXXX 75
           ++N  +E   VT E+  Q +      D    G +LKK ++ RHV +              
Sbjct: 87  HTNLDMELVGVTSETIEQHKK-----DEGDTGDKLKKTIQPRHVILISLGTGIGTGLLVG 141

Query: 76  XXXXXXXXXPVSILISYSFVGLLVYTVMSCLGEMAA--FIPLDGFTSYASRYVDPAVGFA 133
                    P  ++I Y  +G L+Y ++   GEMA      + GF +Y +  +DP   FA
Sbjct: 142 NGATLAQAGPAGLVIGYGIMGSLIYCIIQACGEMAVNYLTLVGGFNAYPTFLIDPGFSFA 201

Query: 134 VGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVNPGVWITIFLALIVLINTVG-VRFFGE 192
             + Y  ++  V P +L   +M +++W ++  V+P V++ IF   I+ IN +G  R + E
Sbjct: 202 TAWVYCLQWLCVCPLELVTASMTIKYWTTK--VDPDVFVIIFYVFILGINILGGARGYAE 259

Query: 193 FEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGFRFWRDPGAFKPYSEAISGSKGKXX 252
            EF  +S K                         G R+W DPGAF+    A+   KG   
Sbjct: 260 AEFIFNSCKILMMIGFFILGIIIICGGAGTDGYIGGRYWHDPGAFRG-ERAVDRFKG--- 315

Query: 253 XXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVVFYVITILLLGMTVA 312
                       +  +E   + A+E  NPRR++P A K  +YR +  Y+ +I+LLG  V 
Sbjct: 316 -VVATLVTAAFSFGQSEFIAVTASEQSNPRRAIPSAAKKIIYRALCIYLASIILLGFLVP 374

Query: 313 YNDPRLLXXXXXXXXXXXXPFVVAIENASIPVLPHIFNVCVLVFVFSACNSDLYVASRSL 372
           YN  +LL            P+V+A+ N  + V+PH  N  +++ V S  NS  Y + R L
Sbjct: 375 YNSSQLLGAQSNGIKAS--PYVLAVANHGVRVVPHFINAVIIISVLSVSNSAFYSSPRML 432

Query: 373 YGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCLLAYMNVSSGSAQVFNYFVNVVSIFGL 432
             L+  G AP+IF+  ++ G P   + ++ LF ++A+   S    QVF + + V  +  +
Sbjct: 433 LTLSQQGFAPKIFSYVDRAGRPTMGIIVASLFAVIAFCATSPKEDQVFTWLLAVSGLSQI 492

Query: 433 LSWITILITYIRFDKAIRVQFGDKSSLSYTAAFQPWSTYVALFFCCLIGLIKNYTVFL-- 490
            +W++I ++++RF +A+ VQ        + +    + +  + F   LI L+  + V L  
Sbjct: 493 FTWMSICLSHLRFRRAMTVQGRSLGECGFLSQVGIYGSAYSFFVLALI-LVGQFWVALKP 551

Query: 491 --GHKFDYKTFISGYIGIPVYLICYVGYKVVYRT-KL-IKPEDVDLYTFKDAID 540
               K D  +F   Y+  P+++  Y+GYK   +  +L IK +D+DL   +   D
Sbjct: 552 VGSKKVDANSFFENYLAAPIWIALYIGYKCYTKDWRLYIKSQDIDLVAHRQIYD 605

>YBR132C Chr2 complement(499652..501442) [1791 bp, 596 aa] {ON}
           AGP2High affinity polyamine permease, preferentially
           uses spermidine over putrescine; expression is
           down-regulated by osmotic stress; plasma membrane
           carnitine transporter, also functions as a low-affinity
           amino acid permease
          Length = 596

 Score =  216 bits (551), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 129/489 (26%), Positives = 238/489 (48%), Gaps = 11/489 (2%)

Query: 51  KKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILISYSFVGLLVYTVMSCLGEMA 110
           +++LE RHV +                       P S+L++++   + +  +     EM 
Sbjct: 85  RRKLENRHVQLIAISGVIGTALFVAIGKALYRGGPASLLLAFALWCVPILCITVSTAEMV 144

Query: 111 AFIPLDG-FTSYASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVNPG 169
            F P+   F   A++ VD ++     +++ F   +  P ++ +   ++ +W  RD  + G
Sbjct: 145 CFFPVSSPFLRLATKCVDDSLAVMASWNFWFLECVQIPFEIVSVNTIIHYW--RDDYSAG 202

Query: 170 VWITIFLALIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGFR 229
           + + + + L +LI+   V+++GE EFWL+S K                   P HDR GFR
Sbjct: 203 IPLAVQVVLYLLISICAVKYYGEMEFWLASFKIILALGLFTFTFITMLGGNPEHDRYGFR 262

Query: 230 FWRDPGAFKPY---SEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVP 286
            + +   FK Y      +  S G                 G E   ++A E K PR+ +P
Sbjct: 263 NYGE-SPFKKYFPDGNDVGKSSGYFQGFLACLIQASFTIAGGEYISMLAGEVKRPRKVLP 321

Query: 287 RAIKLTLYRIVVFYVITILLLGMTVAYNDPRLLXXXXXXXXXX-XXPFVVAIENASIPVL 345
           +A K    R+   ++ + L +G+  + NDP L              P+V+A+ N  I +L
Sbjct: 322 KAFKQVFVRLTFLFLGSCLCVGIVCSPNDPDLTAAINEARPGAGSSPYVIAMNNLKIRIL 381

Query: 346 PHIFNVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFC 405
           P I N+ ++   FSA N+  Y +SR+ YG+A+DG AP+IF   N+ GVP YS+ +S+++ 
Sbjct: 382 PDIVNIALITAAFSAGNAYTYCSSRTFYGMALDGYAPKIFTRCNRHGVPIYSVAISLVWA 441

Query: 406 LLAYMNVSSGSAQVFNYFVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLSYTAAF 465
           L++ + ++S SA V N+ +N+++   L++++ + I Y+ F +A  VQ      L + +  
Sbjct: 442 LVSLLQLNSNSAVVLNWLINLITASQLINFVVLCIVYLFFRRAYHVQQDSLPKLPFRSWG 501

Query: 466 QPWSTYVALFFCCLIGLIKNYTVFLGHKFDYKTFISGYIGIPVYLICYVGYKVVY---RT 522
           QP++  + L  C  + LI+ YTVF    ++ + F+  Y+ + + +  YVGYK ++   + 
Sbjct: 502 QPYTAIIGLVSCSAMILIQGYTVFFPKLWNTQDFLFSYLMVFINIGIYVGYKFIWKRGKD 561

Query: 523 KLIKPEDVD 531
               P ++D
Sbjct: 562 HFKNPHEID 570

>Kpol_543.78 s543 (193316..195133) [1818 bp, 605 aa] {ON}
           (193316..195133) [1818 nt, 606 aa]
          Length = 605

 Score =  217 bits (552), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 146/496 (29%), Positives = 246/496 (49%), Gaps = 13/496 (2%)

Query: 50  LKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILISYSFVGLLVYTVMSCLGEM 109
           L+ +L++RH+ M                       P  ILI +   G +++T++  LGE+
Sbjct: 88  LQHKLKSRHLQMIAIGGAIGTGLFVGSGKALRTAGPAGILIGWGITGTMIFTMVMALGEL 147

Query: 110 AAFIPLDG-FTSYASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVNP 168
           A   P+ G F +YA+R++D + GFA  ++Y+F++ +  P ++ A ++ + +W +  R   
Sbjct: 148 AVVFPVSGGFLTYATRFIDESFGFANNFNYMFQWLVALPLEIVAASITVDYWETPVRYTD 207

Query: 169 GVWITIFLALIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGF 228
           G ++ +F  ++V+IN  GVR +GE EF  S +K                   P     G 
Sbjct: 208 G-FVALFWLVVVIINMFGVRGYGEAEFVFSLIKVIAVIGFIILGIILVCGGGPVGGYVGG 266

Query: 229 RFWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPRA 288
           R+W DPGAF  +S        +              + G+EL GI +AE+KNPR+SVP+A
Sbjct: 267 RYWHDPGAFAGHSPG-----RRFKGFCSVFVTAAFSFAGSELVGIASAESKNPRKSVPQA 321

Query: 289 IKLTLYRIVVFYVITILLLGMTVAYNDPRLLXXXXXXXXXXXXPFVVAIENASIPVLPHI 348
            K   +RI++FY++ +LL+G+ V Y DPRLL            PFV+AI    I  LP +
Sbjct: 322 AKQVFWRILLFYILCLLLVGLLVPYTDPRLLGSSGVDASAS--PFVIAIVTHGISGLPSV 379

Query: 349 FNVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCLLA 408
            NV +L+ V S  NS +Y  SR+L  L+  G  P+  A  ++ G P   + +   F L+A
Sbjct: 380 VNVVILISVLSVGNSSIYTCSRTLVALSEQGFLPKTVAYIDRKGRPLVGIAICSGFGLIA 439

Query: 409 YMNVSSGSAQVFNYFVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLSYTAAFQPW 468
           ++  S+   Q+FN+ + +  I   L+W +I   +IRF  A++V       L + +     
Sbjct: 440 FVAASNKKEQMFNWLLAISGISSFLTWGSICFCHIRFRSALKVNGRSDDELPFKSPVGII 499

Query: 469 STYVALFFCCLIGLIKNYTVF--LGHKFDYKTFISGYIGIPVYLICYVGYKVVYRT-KLI 525
            +Y  +    L+ + + Y     +G   +   F S Y+  P+ L  Y+ +K+  R  KL+
Sbjct: 500 GSYWGMCLAVLMLVAQFYNALFPIGSSPNAYDFFSAYLAAPIVLAFYIAHKLWKRNWKLL 559

Query: 526 KP-EDVDLYTFKDAID 540
            P +D+D+ T +   D
Sbjct: 560 IPLKDIDIDTGRRETD 575

>NCAS0A08920 Chr1 (1765699..1767498) [1800 bp, 599 aa] {ON}
           Anc_1.368
          Length = 599

 Score =  216 bits (551), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 148/526 (28%), Positives = 249/526 (47%), Gaps = 43/526 (8%)

Query: 34  VRSVSEGVDGKHEGIRLKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILISYS 93
           + S    +DG  +   LK+ L+ARH+ M                       P++++I ++
Sbjct: 69  IDSFKPPLDGSFDTNNLKRSLKARHLIMIAIGGSIGTGLFVGSGQAIATGGPLAVVIGWA 128

Query: 94  FVGLLVYTVMSCLGEMAAFIPLDG-FTSYASRYVDPAVGFAVGYSYLFKYFIVTPNQLTA 152
             G  +   +  LGE+    P+ G F +Y++R++DP++ F +   Y+ ++F V P ++ +
Sbjct: 129 IAGSQIIGTIHGLGEITVRFPVVGAFANYSTRFLDPSLSFVISTIYVIQWFFVLPLEIIS 188

Query: 153 GAMVMQFWVSRDRVNPGVWITIFLALIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXX 212
            AM +Q+W     ++P VW+ IF   IV IN  G R FGE EF  SSVK           
Sbjct: 189 SAMTVQYW--NQSIDPVVWVAIFYCAIVSINLFGARGFGEAEFVFSSVKVLTICGFIILC 246

Query: 213 XXXXXXXXPNHDRTGFRFWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCG 272
                   P+HD  G ++W DPG          G  G                 GTE+  
Sbjct: 247 IVLICGGGPDHDFVGAKYWHDPGCLA------HGFPG----VLSVLVVASYSLGGTEMVC 296

Query: 273 IVAAEAKNPRRSVPRAIKLTLYRIVVFYVITILLLGMTVAYNDPRLLXXXXXXXXXXXXP 332
           + + E  +P+  +P AIK T +RI+ F+++++ L+G  V Y +  LL            P
Sbjct: 297 LASGET-DPKE-LPSAIKQTFWRILFFFLVSLTLIGFLVPYTNENLLGGSSVNNS----P 350

Query: 333 FVVAIENASIPVLPHIFNVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPRIFATTNKWG 392
           FV+AI+   I VLP I N  +L+ + S  NS ++ +SR+L  +A  G  PR F   ++ G
Sbjct: 351 FVIAIKLHQIKVLPSIVNAVILISILSVGNSCIFASSRTLCSMAHQGLIPRFFGYIDRAG 410

Query: 393 VPYYSLGLSVLFCLLAYMNVSSGSAQVFNYFVNVVSIFGLLSWITILITYIRFDKAIRVQ 452
            P   +  + LF LLA++  SS  ++VF++ + +  +   + W++I I++IRF  A++ Q
Sbjct: 411 RPLTGIITNSLFGLLAFLVKSSSMSEVFDWLMAIAGLATCIVWLSINISHIRFRLAMKAQ 470

Query: 453 FGDKSSLSYTAAFQPWST----------YVALFFCCL--IGLIKNYTVFLGHKFDYKTFI 500
                 L + +A   W +           VA F+C L  IG  +N ++        K F 
Sbjct: 471 GRSLDELEFVSAVGIWGSAYSAVINSLILVAQFYCALWPIGGWENSSI------RAKKFF 524

Query: 501 SGYIGIPVYLICYVGYKVVYRTK------LIKPEDVDLYTFKDAID 540
             Y+   + ++ +VG+K+ YR K      ++    +DL T +  ID
Sbjct: 525 QSYLCALIMIVLFVGHKIFYRYKTGKWWSMLPLNKIDLETDRKNID 570

>TBLA0A05180 Chr1 complement(1267962..1269992) [2031 bp, 676 aa]
           {ON} 
          Length = 676

 Score =  218 bits (555), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 146/519 (28%), Positives = 242/519 (46%), Gaps = 24/519 (4%)

Query: 33  QVRSVSEGVDGKHEGIRLKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILISY 92
           Q   +  G   +     L++ ++ RHV M                       P  ++I Y
Sbjct: 142 QDEELLPGQKKEDSNAELRQTIKPRHVIMMSLGTGIGTGLLVGNAKPLAAAGPAPLVIGY 201

Query: 93  SFVGLLVYTVMSCLGEMA-AFIPLDG-FTSYASRYVDPAVGFAVGYSYLFKYFIVTPNQL 150
             +G  +Y ++   GEMA A+  L G F ++ S  VDP   FAV + Y  ++  V P +L
Sbjct: 202 GIMGTCIYCIIQACGEMAVAYGNLTGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLEL 261

Query: 151 TAGAMVMQFWVSRDRVNPGVWITIFLALIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXX 210
              +M +Q+W ++  V+P V++ IF  LI+LIN  G + + E EF  ++ K         
Sbjct: 262 VTASMTIQYWTTK--VDPDVFVVIFYVLILLINFFGAKGYAEAEFIFNTCKVLMICGFFI 319

Query: 211 XXXXXXXXXXPNHDRTGFRFWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTEL 270
                           G ++W DPGAF+  ++ I   KG               +  TE 
Sbjct: 320 LAICIDTGAAGTDGYIGAKYWNDPGAFRGQTK-IERFKG----VMDTFVTAAFAFGATEF 374

Query: 271 CGIVAAEAKNPRRSVPRAIKLTLYRIVVFYVITILLLGMTVAYNDPRLLXXXXXXXXXXX 330
             + AAE  NPR+++P A K  +YR++V ++ TI+L+G  V Y+  +LL           
Sbjct: 375 IALTAAEQSNPRKAIPSAAKKIIYRVLVIFLNTIILIGFLVPYDSDQLLGSGGSATKAS- 433

Query: 331 XPFVVAIENASIPVLPHIFNVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPRIFATTNK 390
            P+V+AI    + V  H  N  +L+ V S  NS  Y +SR L  LA  G AP+IF   ++
Sbjct: 434 -PYVLAISLHGVRVAQHFVNAVILISVISVGNSAFYSSSRLLMSLAQQGSAPKIFDYVDR 492

Query: 391 WGVPYYSLGLSVLFCLLAYMNVSSGSAQVFNYFVNVVSIFGLLSWITILITYIRFDKAIR 450
            G P  ++  S +  ++A+   S    +VF + + +  +  L +W  I ++++RF +A++
Sbjct: 493 EGRPLIAMCCSAVIAVIAFCATSPKETEVFTWLMAIAGLSQLFTWFAICLSHLRFRRAMK 552

Query: 451 VQ---FGDKSSLSYTAAFQPWSTYVALFFCCLIGLIKNYTVFL----GHKFDYKTFISGY 503
           VQ    G+   LS T      S Y A+    ++ LI  + V L     H  D  +F S Y
Sbjct: 553 VQGRSLGEMGYLSQTGILG--SLYAAIMM--ILALIAQFWVALVPMGTHTPDANSFFSNY 608

Query: 504 IGIPVYLICYVGYKVVYRT--KLIKPEDVDLYTFKDAID 540
           + +P+ ++ Y GYK+  R     I+ +D+DL + +   D
Sbjct: 609 LAMPILIVFYFGYKIWKRDWRLFIRAKDIDLISHRTIYD 647

>KNAG0H01150 Chr8 (193585..195438) [1854 bp, 617 aa] {ON} 
          Length = 617

 Score =  216 bits (550), Expect = 8e-62,   Method: Compositional matrix adjust.
 Identities = 145/538 (26%), Positives = 245/538 (45%), Gaps = 33/538 (6%)

Query: 1   MNSDTSMEKKNAGVLYSNETLEEGIVTLESEGQVRSVSEGVDGKHEGIRLKKELEARHVS 60
           M+S    + + AG  + +  LE G  +  SE                  LKK +++RHV 
Sbjct: 70  MDSFKRADGQRAG--FDDNDLESGTRSFISESH----------------LKKSMKSRHVV 111

Query: 61  MXXXXXXXXXXXXXXXXXXXXXXXPVSILISYSFVGLLVYTVMSCLGEMAAFIP-LDG-F 118
           M                       P  ++++Y  V  + Y ++   GEMA   P L G F
Sbjct: 112 MMTLGTGIGTGLLVANASGLHASGPAPLVLAYGLVSFVTYFMIQAAGEMAVTYPTLPGNF 171

Query: 119 TSYASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVNPGVWITIFLAL 178
            SY S +V    GFA  + +L ++  V P +L   ++ +++W   D++N  V++ IF   
Sbjct: 172 NSYMSLFVSKPFGFATVWLFLLQWLTVLPLELITSSLTIKYW--NDKINSDVFVVIFYVF 229

Query: 179 IVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGFRFWRDPGAFK 238
           ++ I+  GV+ +GE EF  +S K                    +    G ++W DPGAF 
Sbjct: 230 LLFIHFFGVQAYGETEFIFNSCKILMIAGFIIFSIVVNCGGAGHDGYIGGKYWHDPGAFT 289

Query: 239 PYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVV 298
            ++       G+              Y GTEL  +   E +NPR+S P+A K ++YRIVV
Sbjct: 290 SHTNI-----GRFKGICFILVTAYFSYGGTELYVLSVNEQENPRKSTPQAAKQSIYRIVV 344

Query: 299 FYVITILLLGMTVAYNDPRLLXXXXXXXXXXXXPFVVAIENASIPVLPHIFNVCVLVFVF 358
            Y++T++L+G  V +++ +L+            P+V+A     + ++PH  N  +L+ V 
Sbjct: 345 IYLLTMILIGFNVPHDNDQLMGSHGSATHAS--PYVLAASIHGVRIVPHFINAVILISVI 402

Query: 359 SACNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCLLAYMNVSSGSAQ 418
           S  NS LY + R L  LA  G AP+     ++ G P  +L    LF ++ +   S+   Q
Sbjct: 403 SVANSSLYASPRLLCSLAQQGYAPKFLTYIDRQGRPLTALATCSLFGVIGFAAASNQEEQ 462

Query: 419 VFNYFVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLSYTAAFQPWSTYVALFFCC 478
           VF +   +  +  L +W  I+++++RF +A++VQ  D + L Y A    W +   +FF  
Sbjct: 463 VFTWLAAIAGLSELFTWSGIMLSHVRFRQAMKVQGRDLNELGYKAVSGVWGSVYGVFFNI 522

Query: 479 LIGLIKNYTVFL--GHKFDYKTFISGYIGIPVYLICYVGYKVVYR--TKLIKPEDVDL 532
           L+   + +      G K    +F   Y+  P++   Y GY +  +  T LI  E +DL
Sbjct: 523 LVFFAQFWVALAPPGSKPTALSFFESYLAFPIFFTFYFGYMLWNKDFTFLIPLESIDL 580

>YDR508C Chr4 complement(1466453..1468444) [1992 bp, 663 aa] {ON}
           GNP1High-affinity glutamine permease, also transports
           Leu, Ser, Thr, Cys, Met and Asn; expression is fully
           dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p-Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 663

 Score =  217 bits (552), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 144/549 (26%), Positives = 253/549 (46%), Gaps = 25/549 (4%)

Query: 2   NSDTSMEKKNAGVLYSNE-TLEEGIVTLESEGQVRSVSEGVDGKHEGIRLKKELEARHVS 60
           N  T +  K++     NE   +   +T++    ++   +  + K E   LKK ++ RH  
Sbjct: 101 NGTTPISTKDSSSQLDNELNRKSSYITVDG---IKQSPQEQEQKQE--NLKKSIKPRHTV 155

Query: 61  MXXXXXXXXXXXXXXXXXXXXXXXPVSILISYSFVGLLVYTVMSCLGEMAAFIP--LDGF 118
           M                       P  ++I Y+ +G  VY ++   GE+A      + GF
Sbjct: 156 MMSLGTGIGTGLLVGNSKVLNNAGPGGLIIGYAIMGSCVYCIIQACGELAVIYSDLIGGF 215

Query: 119 TSYASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVNPGVWITIFLAL 178
            +Y    VDPA+GF+V + +  ++  V P +L   +M +++W +   VNP V++ IF  L
Sbjct: 216 NTYPLFLVDPALGFSVAWLFCLQWLCVCPLELVTASMTIKYWTTS--VNPDVFVVIFYVL 273

Query: 179 IVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGFRFWRDPGAFK 238
           IV+IN  G + + E +F+ +  K                         G ++WRDPGAF+
Sbjct: 274 IVVINVFGAKGYAEADFFFNCCKILMIVGFFILAIIIDCGGAGTDGYIGSKYWRDPGAFR 333

Query: 239 PYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVV 298
                I   KG               +  +E   + A+E  NPR+++P A K  +YRI+ 
Sbjct: 334 G-DTPIQRFKG----VVATFVTAAFAFGMSEQLAMTASEQSNPRKAIPSAAKKMIYRILF 388

Query: 299 FYVITILLLGMTVAYNDPRLLXXXXXXXXXXXXPFVVAIENASIPVLPHIFNVCVLVFVF 358
            ++ ++ L+G  V Y   +LL            P+V+A+ +  + V+PH  N  +L+ V 
Sbjct: 389 VFLASLTLVGFLVPYTSDQLLGAAGSATKAS--PYVIAVSSHGVRVVPHFINAVILLSVL 446

Query: 359 SACNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCLLAYMNVSSGSAQ 418
           S  N   Y +SR L  LA  G AP+ F   ++ G P  ++ +S LF ++A+   S     
Sbjct: 447 SVANGAFYTSSRILMSLAKQGNAPKCFDYIDREGRPAAAMLVSALFGVIAFCASSKKEED 506

Query: 419 VFNYFVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLSYTAAFQPWSTYVALFFCC 478
           VF + + +  +  L +WITI +++IRF +A++VQ      + Y +    W +  A+    
Sbjct: 507 VFTWLLAISGLSQLFTWITICLSHIRFRRAMKVQGRSLGEVGYKSQVGVWGSAYAVLMMV 566

Query: 479 LIGLIKNYTVFL-----GHKFDYKTFISGYIGIPVYLICYVGYKVVYR--TKLIKPEDVD 531
           L  LI  + V +     G K   ++F   Y+ +P+++  Y+ YKV  +  +  I  + VD
Sbjct: 567 L-ALIAQFWVAIAPIGGGGKLSAQSFFENYLAMPIWIALYIFYKVWKKDWSLFIPADKVD 625

Query: 532 LYTFKDAID 540
           L + ++  D
Sbjct: 626 LVSHRNIFD 634

>KAFR0A01120 Chr1 complement(216442..218220) [1779 bp, 592 aa] {ON}
           Anc_3.284 YDR046C
          Length = 592

 Score =  215 bits (548), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 144/508 (28%), Positives = 231/508 (45%), Gaps = 18/508 (3%)

Query: 33  QVRSVSEGVDGKHEGIRLKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILISY 92
           Q   + E  D      +LKK +++RHV M                       P  ++I+Y
Sbjct: 58  QDSDLEEDTDTIVTDTQLKKTMKSRHVVMMSLGTGIGTGLLVANAQGLHKAGPAPLVIAY 117

Query: 93  SFVGLLVYTVMSCLGEMAAFIP-LDG-FTSYASRYVDPAVGFAVGYSYLFKYFIVTPNQL 150
             V  + Y ++   GEMA   P L G F +Y S ++    GFA  + +  ++  V P +L
Sbjct: 118 GMVSFVTYFMIQAAGEMAVVYPTLPGNFNAYISTFISKPFGFATVWLFFIQWLTVLPLEL 177

Query: 151 TAGAMVMQFWVSRDRVNPGVWITIFLALIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXX 210
              AM +Q+W   D +N  V++ IF   ++ I+  GV+ +GE EF  +  K         
Sbjct: 178 ITAAMTVQYW--NDSINADVYVVIFYVFLLFIHFFGVKAYGETEFIFNLCKILFVGGFII 235

Query: 211 XXXXXXXXXXPNHDRTGFRFWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTEL 270
                      N    G ++W DPGAF   + A     G+              Y G EL
Sbjct: 236 FSIVVNVGGAGNSGYIGAKYWHDPGAFTSDTNA-----GRFKGVCYVLVTAYFSYGGMEL 290

Query: 271 CGIVAAEAKNPRRSVPRAIKLTLYRIVVFYVITILLLGMTVAYNDPRLLXXXXXXXXXXX 330
             +   E +NPRRS P A K ++YRIVV Y++T++L+G  V  N   L+           
Sbjct: 291 FALSVNEQENPRRSTPTAAKQSIYRIVVIYLLTMILVGFNVPSNSNELMGSGGSVTHAS- 349

Query: 331 XPFVVAIENASIPVLPHIFNVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPRIFATTNK 390
            P+V+A     + V+PHI N  +L+ + S  NS LY A R +  LA  G AP+     ++
Sbjct: 350 -PYVLAASIHGVKVVPHIVNAVILISLISVGNSALYAAPRLMCALAQQGFAPKFMDYVDR 408

Query: 391 WGVPYYSLGLSVLFCLLAYMNVSSGSAQVFNYFVNVVSIFGLLSWITILITYIRFDKAIR 450
            G P ++L +  +F ++ ++  SS   QVFN+   +  +  L +W  I+I++IRF +A++
Sbjct: 409 EGRPLFALIVCSVFGVIGFVACSSKEEQVFNWLAAIAGLAELFTWSGIMISHIRFRQAMK 468

Query: 451 VQFGDKSSLSYTAAFQPWSTYVALFFCCLIGLIKNYTVFLG----HKFDYKTFISGYIGI 506
           +Q      + Y + F  + +Y  +FF  L+  +  + V L      +    TF   Y+  
Sbjct: 469 LQNKSLDEVGYKSPFGVYGSYFGVFFNLLV-FVAQFWVALAPPMYTEMSADTFFESYLAF 527

Query: 507 PVYLICYVGYKVVYR--TKLIKPEDVDL 532
           P++   Y GY +  R  T     E VDL
Sbjct: 528 PIFFAFYFGYMIWKRDFTLFSDLESVDL 555

>Ecym_2664 Chr2 complement(1280994..1282721) [1728 bp, 575 aa] {ON}
           similar to Ashbya gossypii AGR040C
          Length = 575

 Score =  214 bits (546), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 141/501 (28%), Positives = 234/501 (46%), Gaps = 26/501 (5%)

Query: 49  RLKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILISYSFVGLLVYTVMSCLGE 108
           ++KK +++RH+ M                       P  ++I Y     ++Y ++   GE
Sbjct: 63  KMKKTIKSRHLLMISLGTGIGTGLLVGNGTALAKAGPGGLIIGYGVASAMLYCIIQAAGE 122

Query: 109 MA-AFIPLDG-FTSYASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRV 166
           +   +  + G +T+Y+S  VDPA+GF+V + Y  ++  V P QL   A+ +++W      
Sbjct: 123 LGICYSGMTGNYTAYSSLLVDPALGFSVSWVYCIQWMTVFPLQLVTAAITIKYWTD---T 179

Query: 167 NPGVWITIFLALIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRT 226
           NP +++ I   LIV IN  G + + E EF  ++ K                    N    
Sbjct: 180 NPDIFVAILYFLIVFINLFGAKGYAEAEFLFNTCKVLMMVGFVILGIIINCGGAGNDGYI 239

Query: 227 GFRFWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVP 286
           G R+W  PGAF       +G KG               Y G E+  + A+E +NPR+S+P
Sbjct: 240 GARYWHTPGAFS------TGFKG----VCYVFCYAAFAYGGIEVMVLTASEQENPRKSIP 289

Query: 287 RAIKLTLYRIVVFYVITILLLGMTVAYNDPRLLXXXXXXXXXXXXPFVVAIENASIPVLP 346
            A K  +YRI++ Y++T L++   V Y+ P L             PFV+AI +  I V+P
Sbjct: 290 SACKKVIYRILLIYMLTTLIVCFLVPYDAPEL---TSTGSASRASPFVIAIASHGISVVP 346

Query: 347 HIFNVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCL 406
           HI N  +LV V S  NS LY A R L  L+  G AP++F   ++ G P     +++   L
Sbjct: 347 HIINAVILVAVVSVGNSSLYSAPRLLLSLSEQGYAPKVFNYVDRQGRPLLCFLVAMFVGL 406

Query: 407 LAYMNVSSGSAQVFNYFVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLSYTAAFQ 466
           LA++  S     VF++ + +  +  L  WI+I ++++RF  A++ Q      + Y +   
Sbjct: 407 LAFIAASDAEEDVFSWLLAISGLSQLFIWISICLSHVRFRDAMKAQGRSLGEVGYKSQTG 466

Query: 467 PWSTYVALFFCCLIGLIKNYTVFL-----GHKFDYKTFISGYIGIPVYLICYVGYKVVYR 521
            W ++ A+     + L+  + V +     G K   K F   Y+  PV +  Y GYK+ Y+
Sbjct: 467 YWGSWFAIIVSLFV-LVAQFWVAIAPIGNGGKLSAKDFFQSYLAAPVLIFIYFGYKIYYK 525

Query: 522 T-KLIKPE-DVDLYTFKDAID 540
             +L  P  +VDL + +   D
Sbjct: 526 DWRLCIPATEVDLNSHRKIFD 546

>Skud_2.191 Chr2 complement(342307..344136) [1830 bp, 609 aa] {ON}
           YBR068C (REAL)
          Length = 609

 Score =  215 bits (548), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 147/548 (26%), Positives = 251/548 (45%), Gaps = 29/548 (5%)

Query: 5   TSMEKKNAGVLYSNETLEEGIVT--LESEGQV---RSVSEGVDGKHEGI-------RLKK 52
           +S EK  +G    +E L   +      +EG +   R ++E      +GI       +LKK
Sbjct: 34  SSREKAYSGQPSKSEKLIHRLANSFKRAEGSITKTRQINENTSDLEDGIESITSDSKLKK 93

Query: 53  ELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILISYSFVGLLVYTVMSCLGEMAAF 112
            +++RHV M                       P +++I Y  V  + Y ++   GEMA  
Sbjct: 94  SMKSRHVVMMSLGTGIGTGLLVANAKGLHYGGPAALVIGYVLVSFVTYFMIQAAGEMAVT 153

Query: 113 IPL--DGFTSYASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVNPGV 170
            P     F +Y+S ++    GFA  + Y F++  V P +L   +M +Q+W   D++NP V
Sbjct: 154 YPTLPANFNAYSSIFISKPFGFATVWLYCFQWLTVLPLELITASMTIQYW--NDKLNPDV 211

Query: 171 WITIFLALIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGFRF 230
           +I IF   ++ I+  GV+ +GE EF  +  K                    +    G  +
Sbjct: 212 YILIFYIFLLFIHVFGVKAYGETEFIFNCCKILMIAGFIILSVVINCGGAGDDGYIGGAY 271

Query: 231 WRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPRAIK 290
           W +PGAF     A   S  +              + G EL  +   E  NPR+S P A K
Sbjct: 272 WHNPGAF-----AGDTSIARFKNVCYILVTGYFSFGGMELFALSVQEQSNPRKSTPVAAK 326

Query: 291 LTLYRIVVFYVITILLLGMTVAYNDPRLLXXXXXXXXXXXXPFVVAIENASIPVLPHIFN 350
            ++YRIV+ Y++T++L+G  V YND +L+            P+V+A     + ++PHI N
Sbjct: 327 RSIYRIVIIYLLTMILIGFNVPYNDDQLMGAGGSATHAS--PYVLAASIHGVKIVPHIIN 384

Query: 351 VCVLVFVFSACNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCLLAYM 410
             +L+ V S  NS LY   R +  L+  G AP+     ++ G P  +L +  +F ++A++
Sbjct: 385 AVILISVVSVANSSLYAGPRLICSLSQQGYAPKFLDYVDREGRPLRALIVCCIFGVIAFV 444

Query: 411 NVSSGSAQVFNYFVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLSYTAAFQPWST 470
             SS    VF +   +  +  L +W +I+++++RF +A++VQ      L Y A    W +
Sbjct: 445 AASSKEEIVFTWLAAIAGLSELFTWTSIMLSHLRFRQAMKVQGRSLDELGYKATTGIWGS 504

Query: 471 YVALFFCCLIGLIKNYTVF--LGH--KFDYKTFISGYIGIPVYLICYVGYKVVYRT-KLI 525
               FF  L+ + + +     LG+  +   ++F   Y+  P++L  + GY +  R   L+
Sbjct: 505 VYGFFFNILVFIAQFWVALAPLGNDGRCSVESFFESYLAAPIWLTFFFGYMIYNRDFTLL 564

Query: 526 KPED-VDL 532
            P D +DL
Sbjct: 565 NPLDKIDL 572

>Suva_2.688 Chr2 complement(1219181..1221166) [1986 bp, 661 aa] {ON}
           YDR508C (REAL)
          Length = 661

 Score =  216 bits (551), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 143/545 (26%), Positives = 252/545 (46%), Gaps = 23/545 (4%)

Query: 5   TSMEKKNAGVLYSNETLEEGIVTLESEGQVRSVSEGVDGKHEGIRLKKELEARHVSMXXX 64
           T +   ++     NE   +G  +  +E  ++  S+  D   E   LKK ++ RH+ M   
Sbjct: 102 TPISTNDSSSQLDNELNPKG--SFVTESGIKQPSQEQDQNQE--NLKKTIKPRHIVMMSL 157

Query: 65  XXXXXXXXXXXXXXXXXXXXPVSILISYSFVGLLVYTVMSCLGEMAAFIP--LDGFTSYA 122
                               P  ++I Y+ +G  +Y ++   GE+A      + GF +Y 
Sbjct: 158 GTGIGTGLLVGNSKVLNNAGPAGLVIGYAIMGSCIYCIIQACGELAVIYSDLIGGFNTYP 217

Query: 123 SRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVNPGVWITIFLALIVLI 182
           S  VDPA+GF+V + Y  ++  V P +L   +M +++W  +  V+P V++ IF  LI++I
Sbjct: 218 SFLVDPALGFSVAWVYCLQWLCVCPLELVTASMTIKYWTVK--VDPDVFVVIFYVLIIVI 275

Query: 183 NTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGFRFWRDPGAFKPYSE 242
           N  G + + E +F+ +  K                         G R+W +PGAF+  + 
Sbjct: 276 NVFGAKGYAEADFFFNCCKILMIIGFFILAIIIDCGGAGTDGYIGSRYWHNPGAFRG-NT 334

Query: 243 AISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVVFYVI 302
            I   KG               +  +E   + A+E  NPR+++P A K  +YRI+  ++ 
Sbjct: 335 GIQRFKG----VVATFVTAAFAFGMSEQLAMTASEQSNPRKAIPSAAKKMIYRILFVFLG 390

Query: 303 TILLLGMTVAYNDPRLLXXXXXXXXXXXXPFVVAIENASIPVLPHIFNVCVLVFVFSACN 362
           +++L+G  V Y   +LL            P+V+A+ +  + V+PH  N  +L+ V S  N
Sbjct: 391 SLVLVGFLVPYTSDQLLGASGSATKAS--PYVIAVASHGVRVVPHFINAVILLSVLSVAN 448

Query: 363 SDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCLLAYMNVSSGSAQVFNY 422
              Y +SR L  LA  G AP+ F   ++ G P  ++ +S +F ++A+   S     VF +
Sbjct: 449 GAFYSSSRILMSLAKQGNAPKCFDYIDREGRPAVAMLVSSIFGIIAFCASSPKEEDVFTW 508

Query: 423 FVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLSYTAAFQPWSTYVALFFCCLIGL 482
            + +  +  L +WITI +++IRF +A++VQ      + Y +    W +  A+    L  L
Sbjct: 509 LLAISGLSQLFTWITICLSHIRFRRAMKVQGRSLGEVGYKSQVGIWGSMYAIVMMVL-AL 567

Query: 483 IKNYTVFL-----GHKFDYKTFISGYIGIPVYLICYVGYKVVYR--TKLIKPEDVDLYTF 535
           I  + V +     G K   ++F   Y+ +P+ +  YV YKV  +  T  I  + +DL T 
Sbjct: 568 IAQFWVAISPIGGGGKLSAQSFFENYLAMPILIALYVFYKVWKKDWTLFIPADKIDLVTD 627

Query: 536 KDAID 540
           +   D
Sbjct: 628 RQIFD 632

>Kwal_26.9612 s26 complement(1291552..1293183) [1632 bp, 543 aa]
           {ON} YFL055W (AGP3) - Amino acid permease [contig 363]
           FULL
          Length = 543

 Score =  214 bits (544), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 145/498 (29%), Positives = 234/498 (46%), Gaps = 22/498 (4%)

Query: 19  ETLEEGIVTLESEGQVRSVSEGVDGKHEGIRLKKELEARHVSMXXXXXXXXXXXXXXXXX 78
           + LE  I  +E + ++ + S      H G+  K+ L+ RH+S+                 
Sbjct: 14  DKLEPKIAEVELQ-RLETDSLNEFDPHSGV--KRALKNRHISLLALGGIIGPGCLIGAGN 70

Query: 79  XXXXXXPVSILISYSFVGLLVYTVMSCLGEMAAFIPLDG-FTSYASRYVDPAVGFAVGYS 137
                 P+++L+ +  +GL+ +++M  +GE+    P  G F + A R+    +    GY+
Sbjct: 71  ALNKGGPLALLLGFGIIGLVCFSIMESIGELVTLYPSGGGFITLARRFHSEGLSAVSGYA 130

Query: 138 YLFKYFIVTPNQLTAGAMVMQFWVSRDRVNPGVWITIFLALIVLINTVGVRFFGEFEFWL 197
           Y+  +F V  N+    + ++QFW  +  +    +  IF    ++   +GV  FGE E+WL
Sbjct: 131 YIVVFFAVLANEYNTISSILQFWGPQVPIYG--YTLIFWFFFLVFQLIGVGAFGECEYWL 188

Query: 198 SSVKXXXXXXXXXXXXXXXXXXXPNHDRTGFRFWRDPGAFKPYSEAISGSKGKXXXXXXX 257
           +  K                   P     GF++W++PGA       I+            
Sbjct: 189 AWFKILGLVAFYIFSIVYMSGGIPGKPPIGFQYWKNPGALSHGFRGIA----------VV 238

Query: 258 XXXXXXXYTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVVFYVITILLLGMTVAYNDPR 317
                  Y+GTE   + A E++NPR++VP A++ T +RI++ Y+      G+TV YNDP 
Sbjct: 239 FVFCSTFYSGTESVALAATESRNPRKAVPLAVRQTFWRILIVYLGISFFYGVTVPYNDPT 298

Query: 318 LLXXXXXXXXXXXXPFVVAIENASIPVLPHIFNVCVLVFVFSACNSDLYVASRSLYGLAI 377
           L             P  +A+  A      H+ N  +L+   SA NS LY+ SR+L  LA 
Sbjct: 299 L----GAQTKSLKSPISIALSRAGWAGGVHLVNAFILMTCISAINSSLYIGSRTLSHLAH 354

Query: 378 DGKAPRIFATTNKWGVPYYSLGLSVLFCLLAYMNVSSGSAQVFNYFVNVVSIFGLLSWIT 437
           +G APRI A T+K GVP  +L +     L++ MNVS G++  +NY VN+  +   + W  
Sbjct: 355 EGLAPRILAWTDKRGVPVPALIVFNALGLISLMNVSVGASNAYNYIVNLSGVGVFIVWSA 414

Query: 438 ILITYIRFDKAIRVQFGDKSSLSYTAAFQPWSTYVALFFCCLIGLIKNYTVFLGHKFDYK 497
           I IT++RF KA   Q    S L Y A F PW+T  +L     + LI+ +T  +   F  K
Sbjct: 415 ISITHLRFRKAWVAQGRSLSELPYRALFYPWTTIFSLAANIFLALIQGWTSLV--PFVAK 472

Query: 498 TFISGYIGIPVYLICYVG 515
            F+  YI +P   + YVG
Sbjct: 473 DFVDAYILLPAAGLLYVG 490

>Skud_4.784 Chr4 complement(1386623..1388614) [1992 bp, 663 aa] {ON}
           YDR508C (REAL)
          Length = 663

 Score =  216 bits (550), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 145/550 (26%), Positives = 254/550 (46%), Gaps = 25/550 (4%)

Query: 1   MNSDTSMEKKNAGVLYSNE-TLEEGIVTLESEGQVRSVSEGVDGKHEGIRLKKELEARHV 59
           +N  T +  K++     NE   +   +T++    ++  S+  + K E   LKK ++ RH 
Sbjct: 100 LNGSTPISTKDSSSRLDNELNPKSSYITVDG---IKQSSQEQEPKQE--NLKKSIKPRHT 154

Query: 60  SMXXXXXXXXXXXXXXXXXXXXXXXPVSILISYSFVGLLVYTVMSCLGEMAAFIP--LDG 117
            M                       P  ++I Y+ +G  VY ++   GE+A      + G
Sbjct: 155 VMMSLGTGIGTGLLVGNSKVLNNAGPGGLIIGYAIMGSCVYCIIQACGELAVIYSDLIGG 214

Query: 118 FTSYASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVNPGVWITIFLA 177
           F +Y S  VDPAVGF+V + +  ++  V P +L   +M +++W  +  VN  V++ IF  
Sbjct: 215 FNTYPSFLVDPAVGFSVAWLFCLQWLCVCPLELVTASMTIKYWTVK--VNADVFVIIFYV 272

Query: 178 LIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGFRFWRDPGAF 237
           LI++IN  G + + E +F+ +  K                         G R+WRDPGAF
Sbjct: 273 LILVINIFGAKGYAEADFFFNCCKILMITGFFILAIIIDCGGAGTDGYIGSRYWRDPGAF 332

Query: 238 KPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIV 297
           +    +I   KG               +  +E   + A+E  NPR+++P A K  +YRI+
Sbjct: 333 RG-DTSIQRFKG----VVATFVTAAFAFGMSEQLAMTASEQSNPRKAIPSAAKKMIYRIL 387

Query: 298 VFYVITILLLGMTVAYNDPRLLXXXXXXXXXXXXPFVVAIENASIPVLPHIFNVCVLVFV 357
             ++ ++ L+G  V Y   +LL            P+V+A+ +  + V+PH  N  +L+ V
Sbjct: 388 FVFLASLALVGFLVPYTSDQLLGAAGSATKAS--PYVIAVSSHGVRVVPHFINAVILLSV 445

Query: 358 FSACNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCLLAYMNVSSGSA 417
            S  NS  Y +SR L  LA  G AP+ F   ++ G P  ++ +S +F ++A+   S    
Sbjct: 446 LSVANSAFYTSSRILMSLAKQGNAPKCFDYIDREGRPAVAMIVSAVFGVIAFCASSKKEE 505

Query: 418 QVFNYFVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLSYTAAFQPWSTYVALFFC 477
            VF + + +  +  L +WITI +++IRF K ++VQ      + Y +    W +  A+   
Sbjct: 506 DVFTWLLAISGLSQLFTWITICLSHIRFRKGMKVQGRSLGEVGYKSQVGVWGSAYAVVLM 565

Query: 478 CLIGLIKNYTVFLG-----HKFDYKTFISGYIGIPVYLICYVGYKVVYR--TKLIKPEDV 530
            L  LI  + V +       K   ++F   Y+ +P+ +  Y+ YKV  R  +  I  + +
Sbjct: 566 VL-ALIGQFWVAISPIGGDKKLSAQSFFENYLAMPILIALYIFYKVWKRDWSLFIPADKI 624

Query: 531 DLYTFKDAID 540
           DL + ++  D
Sbjct: 625 DLVSHRNIFD 634

>SAKL0D02948g Chr4 (243064..244848) [1785 bp, 594 aa] {ON} similar
           to uniprot|P38084 Saccharomyces cerevisiae YBR068C BAP2
           High-affinity leucine permease functions as a
           branched-chain amino acid permease involved in the
           uptake of leucine isoleucine and valine contains 12
           predicted transmembrane domains
          Length = 594

 Score =  214 bits (544), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 155/547 (28%), Positives = 246/547 (44%), Gaps = 29/547 (5%)

Query: 4   DTSMEKKNAGVLYSNETLEEGIVTLESEGQVRSVSEGVDGKHEGIRLKKELEARHVSMXX 63
           D+    +  G     E LE G+ T+ +           D      ++K+ +++RH++M  
Sbjct: 40  DSFKRAEPQGQTIREEKLENGLETVRTN----------DYNATQKKMKQTMKSRHITMIS 89

Query: 64  XXXXXXXXXXXXXXXXXXXXXPVSILISYSFVGLLVYTVMSCLGEMA-AFIPLDG-FTSY 121
                                P  ++I Y     ++Y V+    E+  ++  L G + SY
Sbjct: 90  LGTGIGTGLLVANGKALHFGGPGGLVIGYVTTSTMLYCVIQACCELGVSYATLPGNYNSY 149

Query: 122 ASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVNPGVWITIFLALIVL 181
            S  VD    FAV + Y  ++ IV P +L   +M +++W   D +NP V++ IF   IV 
Sbjct: 150 PSFLVDSGFNFAVAWVYGLQWAIVLPLELVTSSMTIKYW--NDSINPDVFVAIFYCFIVF 207

Query: 182 INTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGFRFWRDPGAFKPYS 241
           I+  G + + E EF  +S K                    +    G ++W  PGAF    
Sbjct: 208 IHFFGSQGYAESEFIFNSCKVLMMVGFIIMGISVNCGASKS-GYIGGKYWHTPGAFVG-E 265

Query: 242 EAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVVFYV 301
           +AI   KG               Y G+E   + AAE  NPR+SVP+A K  LYR+++ ++
Sbjct: 266 KAIDHFKG----ICSVWVQSAFAYGGSEFIALTAAEQTNPRKSVPKATKRWLYRVLIVFL 321

Query: 302 ITILLLGMTVAYNDPRLLXXXXXXXXXXXXPFVVAIENASIPVLPHIFNVCVLVFVFSAC 361
             I+L+G  V Y+ P LL            PFV+A  +  + V+PHI N  +L+ V S  
Sbjct: 322 TPIILVGFLVPYDSP-LLLGSPGQAASHASPFVIAAASHGVKVVPHIINAVILISVISVG 380

Query: 362 NSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCLLAYMNVSSGSAQVFN 421
           NS  Y A R L  LA  G  P++F   ++ G P  ++    +F L++++  S     VF 
Sbjct: 381 NSAFYSAPRILLSLAEQGMGPKVFTYVDRKGRPLVTMLFVAIFGLISFVAASDNEETVFT 440

Query: 422 YFVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLSYTAAFQPWSTYVALFFCCLIG 481
           +   +VS+  L +W  I +++IRF  A++ Q      L Y A    W ++ A+ F  ++ 
Sbjct: 441 WLSAIVSLSQLFTWSAISLSHIRFRDAMKTQGRSLGELGYKANTGYWGSWYAIAFNIIV- 499

Query: 482 LIKNYTVFL-----GHKFDYKTFISGYIGIPVYLICYVGYKVVYRT-KLIKPED-VDLYT 534
           L   + V +     G K D   F   Y+  PV +  Y GYK+ YR  KL  P D VDL +
Sbjct: 500 LAAQFWVAIAPIGNGGKLDVNNFFQNYLAFPVLVFFYFGYKLWYRDWKLFIPADKVDLES 559

Query: 535 FKDAIDA 541
            +   DA
Sbjct: 560 HRKIFDA 566

>NCAS0I01530 Chr9 (286882..288669) [1788 bp, 595 aa] {ON} 
          Length = 595

 Score =  214 bits (544), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 147/514 (28%), Positives = 235/514 (45%), Gaps = 19/514 (3%)

Query: 36  SVSEGVDGKHEGIRLKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILISYSFV 95
            + +G +       LKK +++RHV M                       P S++I Y  V
Sbjct: 63  DLEDGTNSIQSDDNLKKAMKSRHVIMMSLGTGIGTGLLVANAKGLYLAGPASLVIGYFMV 122

Query: 96  GLLVYTVMSCLGEMAAFIPL--DGFTSYASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAG 153
             + Y V+   GEMA   P    GF +YAS +V    GFA  + +  ++  V P +L   
Sbjct: 123 SFITYFVIQAAGEMAVTYPTLPGGFNNYASIFVSKPFGFATVWLFCIQWLTVLPLELITA 182

Query: 154 AMVMQFWVSRDRVNPGVWITIFLALIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXX 213
           +M +++W   D++N  V++ I    ++ I+  GVR +GE EF  +S K            
Sbjct: 183 SMTIKYW--NDKINADVFVVILYVFLLFIHFFGVRAYGEAEFIFNSCKILMIGGFVILSI 240

Query: 214 XXXXXXXPNHDRTGFRFWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGI 273
                        G ++WRDPGAF     A S  KG               Y G EL  +
Sbjct: 241 VVNCGGAGVDGYIGGKYWRDPGAFAS-DNAASRFKG----VAFVLVTAYFSYGGVELFAL 295

Query: 274 VAAEAKNPRRSVPRAIKLTLYRIVVFYVITILLLGMTVAYNDPRLLXXXXXXXXXXXXPF 333
              E +NPRRS P A K ++YRI++ Y++T++L+G  V +N  +L+            P+
Sbjct: 296 SVNEQENPRRSTPAAAKQSIYRILIIYLLTMILIGFNVPHNSDQLMGAGGSATHAS--PY 353

Query: 334 VVAIENASIPVLPHIFNVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPRIFATTNKWGV 393
           V+A+    + V+PHI N  +L+ V S  NS LY + R L  LA  G AP+ F   ++ G 
Sbjct: 354 VLAVSIHGVKVVPHIINAVILISVTSVANSALYASPRLLRSLAEQGYAPKYFNYVDREGR 413

Query: 394 PYYSLGLSVLFCLLAYMNVSSGSAQVFNYFVNVVSIFGLLSWITILITYIRFDKAIRVQF 453
           P  +L L  +F ++A+   S     +F +   +  +  L +W +IL++++RF  A++ Q 
Sbjct: 414 PLRALILCSIFGVIAFCACSDQEEVIFTWLAAIAGLSELFTWSSILLSHVRFRLAMKAQG 473

Query: 454 GDKSSLSYTAAFQPWSTYVALFFCCLIGLIKNYTVFL---GHK--FDYKTFISGYIGIPV 508
              + L Y +    W +    FF  L+  I  + V L   G K  +  + F   Y+  PV
Sbjct: 474 KSLNELGYISITGIWGSLYGCFFNVLV-FIAQFWVALSPPGSKGVYSAEAFFESYLAFPV 532

Query: 509 YLICYVGYKVVYR--TKLIKPEDVDLYTFKDAID 540
           +L  Y+GY +  R  T L   + +DL   +   D
Sbjct: 533 WLFFYLGYMLYSRDFTFLTDLKKIDLDNHRRLYD 566

>SAKL0C01650g Chr3 complement(139480..141321) [1842 bp, 613 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn expression is
           fully dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p-Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 613

 Score =  213 bits (543), Expect = 7e-61,   Method: Compositional matrix adjust.
 Identities = 144/511 (28%), Positives = 238/511 (46%), Gaps = 17/511 (3%)

Query: 38  SEGVDGKHEGI-RLKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILISYSFVG 96
            +G D   +G  +LKK +++RHV M                       P  ++I Y+ +G
Sbjct: 83  EDGSDAGDKGDNKLKKTIKSRHVVMISLGTGIGTGMLVGNGKALRNGGPAGLVIGYAIMG 142

Query: 97  LLVYTVMSCLGEMA-AFIPLDG-FTSYASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGA 154
             +Y ++   GE+A  +  L G F +Y S  +DPA+GF+V + Y  ++  V P +L   +
Sbjct: 143 SCLYCIIQAAGELAVCYTSLSGGFNAYPSLLIDPALGFSVAWVYCLQWLCVMPLELVTAS 202

Query: 155 MVMQFWVSRDRVNPGVWITIFLALIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXX 214
           + +++W +   VNP +++ IF  L + IN  G R + E EF+ ++ K             
Sbjct: 203 ITIKYWTTS--VNPDIFVAIFYVLTIAINVFGARGYAEAEFFFNTCKVLMITGFFILGII 260

Query: 215 XXXXXXPNHDRTGFRFWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIV 274
                  N    G ++W DPG+F    + I   KG               +  TE   + 
Sbjct: 261 VNCGGAGNDGYIGGKYWNDPGSFSG-DKPIDHFKG----VVSTLVTAAFAFGATEFIALT 315

Query: 275 AAEAKNPRRSVPRAIKLTLYRIVVFYVITILLLGMTVAYNDPRLLXXXXXXXXXXXXPFV 334
           AAE  NPR+S+P A K  LYRI+V ++ +I L+G  V +N   L+            P+V
Sbjct: 316 AAEQANPRKSIPSAAKKVLYRIIVIFLGSITLVGFLVPHNSEELMGSGGSATHAS--PYV 373

Query: 335 VAIENASIPVLPHIFNVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVP 394
           +AI +  + V+PH  N  +L+ V S  NS  Y +SR L  LA  G AP      ++ G P
Sbjct: 374 IAIASHGVKVVPHFINAVILLSVLSVGNSAFYSSSRLLLSLAEQGYAPSFLKYVDREGRP 433

Query: 395 YYSLGLSVLFCLLAYMNVSSGSAQVFNYFVNVVSIFGLLSWITILITYIRFDKAIRVQFG 454
             ++ +S +F L++++  S     VF + + +  +  L +W  I +++IRF +A++VQ  
Sbjct: 434 TLAMIISAVFGLISFVAASPKEETVFTWLLAISGLSQLFTWSAICLSHIRFRRAMKVQGR 493

Query: 455 DKSSLSYTAAFQPWSTYVA--LFFCCLIGLIKNYTVFLGH-KFDYKTFISGYIGIPVYLI 511
               L + +    W +Y A  +    LIG        +G  K D + F   Y+ +P+ + 
Sbjct: 494 SLGELGFKSQVGVWGSYYATGMMLLILIGQFWTAIAPIGEGKLDAEAFFENYLAMPILIA 553

Query: 512 CYVGYKVVYR--TKLIKPEDVDLYTFKDAID 540
            Y GYKV  R  T  I    +DL + +   D
Sbjct: 554 LYFGYKVWKRDWTLYIPASKIDLISNRRIFD 584

>YFL055W Chr6 (17004..18680) [1677 bp, 558 aa] {ON}
           AGP3Low-affinity amino acid permease, may act to supply
           the cell with amino acids as nitrogen source in
           nitrogen-poor conditions; transcription is induced under
           conditions of sulfur limitation; plays a role in
           regulating Ty1 transposition
          Length = 558

 Score =  212 bits (539), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 147/497 (29%), Positives = 233/497 (46%), Gaps = 31/497 (6%)

Query: 50  LKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILISYSFVGLLVYTVMSCLGEM 109
           +K+ L+ RH+S+                       P+++L+ +S +G++ ++VM  +GEM
Sbjct: 49  VKRALKNRHISLLALGGVIGPGCLVGAGNALNKGGPLALLLGFSIIGIIAFSVMESIGEM 108

Query: 110 AAFIPLDG-FTSYASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVNP 168
               P  G FT+ A R+   A+    GY+Y+  +F V  N+    + ++QFW       P
Sbjct: 109 ITLYPSGGGFTTLARRFHSDALPAVCGYAYVVVFFAVLANEYNTLSSILQFW------GP 162

Query: 169 GV----WITIFLALIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHD 224
            V    +I IF     +   VGV  FGE E+WL+ +K                    N  
Sbjct: 163 QVPLYGYILIFWFAFEIFQLVGVGLFGETEYWLAWLKIVGLVAYYIFSIVYISGDIRNRP 222

Query: 225 RTGFRFWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRS 284
             GF +W  PGA         G KG               Y+GTE   + A E+KNP ++
Sbjct: 223 AFGFHYWNSPGALS------HGFKG----IAIVFVFCSTFYSGTESVALAATESKNPGKA 272

Query: 285 VPRAIKLTLYRIVVFYVITILLLGMTVAYNDPRLLXXXXXXXXXXXXPFVVAIENASIPV 344
           VP A++ TL+RI+V Y+   +  G TV ++DP L             P  +AI  A    
Sbjct: 273 VPLAVRQTLWRILVVYIGIAVFYGATVPFDDPNL----SASTKVLKSPIAIAISRAGWAG 328

Query: 345 LPHIFNVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLF 404
             H+ N  +L+   SA N  LY+ SR+L  LA +G AP+I A T++ GVP  ++ +    
Sbjct: 329 GAHLVNAFILITCISAINGSLYIGSRTLTHLAHEGLAPKILAWTDRRGVPIPAITVFNAL 388

Query: 405 CLLAYMNVSSGSAQVFNYFVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLSYTAA 464
            L++ MNVS G+A  ++Y VN+  +   + W  I  T++R  KA   Q      L Y A 
Sbjct: 389 GLISLMNVSVGAANAYSYIVNLSGVGVFIVWGVISYTHLRIRKAWVAQGRSIEELPYEAL 448

Query: 465 FQPWSTYVALFFCCLIGLIKNYTVFLGHKFDYKTFISGYIGIPVYLICYVGYKVV----Y 520
           F PW+  ++L     + LI+ ++ F+   FD   F+  YI +PV ++ Y+G  V     +
Sbjct: 449 FYPWTPVLSLAANIFLALIQGWSYFV--PFDAGNFVDAYILLPVGILLYIGICVFKSNHF 506

Query: 521 RTKLIKPEDVDLYTFKD 537
           RT  ++  ++D    KD
Sbjct: 507 RTVDLRSINLDEGRRKD 523

>TBLA0A05190 Chr1 complement(1271605..1273608) [2004 bp, 667 aa]
           {ON} Anc_1.50 YDR508C
          Length = 667

 Score =  214 bits (544), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 142/545 (26%), Positives = 251/545 (46%), Gaps = 26/545 (4%)

Query: 4   DTSMEKKNAGVLYSNETLEEGIVTLESEGQVRSVSEGVDGKHEGIRLKKELEARHVSMXX 63
           D  +E K + +   ++ L+   V ++S+         V+ + E  +LK+ ++ RHV M  
Sbjct: 112 DNDLENKKSNLHIRDDELDYATVNVDSQP--------VEQQDENAQLKQTIKPRHVIMMS 163

Query: 64  XXXXXXXXXXXXXXXXXXXXXPVSILISYSFVGLLVYTVMSCLGEMA-AFIPLDG-FTSY 121
                                P  ++I Y  +G  +Y ++   GE+A A+  ++G F ++
Sbjct: 164 LGTGIGTGLLVGNGTPLAQAGPAPLVIGYGIMGTCLYCIIQACGELAVAYSKVNGSFNTF 223

Query: 122 ASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVNPGVWITIFLALIVL 181
            S  VDP   FAV + Y  ++  V P +L   +M +++W ++  V+P V++ IF  LI+L
Sbjct: 224 PSFLVDPGFNFAVAWVYCIQWLCVCPLELVTSSMTIKYWTTK--VDPDVFVVIFYVLILL 281

Query: 182 INTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGFRFWRDPGAFKPYS 241
           IN  G + + E EF+ +  K                         G ++W DPGAF+  +
Sbjct: 282 INFFGAKGYAEAEFFFNCCKVMMMIGFFIMAICINTGAAGTDGYIGAKYWNDPGAFRGQT 341

Query: 242 EAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVVFYV 301
           + I   KG               +  TE   + AAE  NPR+++P A K   YRI++ ++
Sbjct: 342 K-IERFKG----VMDTFVTAAFAFGATEFIALTAAEQSNPRKAIPSAAKKVAYRILLIFL 396

Query: 302 ITILLLGMTVAYNDPRLLXXXXXXXXXXXXPFVVAIENASIPVLPHIFNVCVLVFVFSAC 361
            +I+L+G  V YN  +L+            P+V+A     + V+ H  N  +L+ V S  
Sbjct: 397 TSIILIGFLVPYNSDQLMGSSSGGNSAS--PYVLAASLHGVHVVQHFINAVILLSVLSVA 454

Query: 362 NSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCLLAYMNVSSGSAQVFN 421
           NS  Y +SR L GLA  G AP+ F   ++ G P  S+  + +  ++A+   S     VF 
Sbjct: 455 NSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSMLCAAIIAVIAFCATSPKETDVFT 514

Query: 422 YFVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLSYTAAFQPWSTYVALFFCCLIG 481
           + + +  +  + +W  I +++IRF + ++VQ      L + A      +Y A      + 
Sbjct: 515 WLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGELGFRAQTGVLGSYYAAIM-LFLA 573

Query: 482 LIKNYTVFL----GHKFDYKTFISGYIGIPVYLICYVGYKVVYRT--KLIKPEDVDLYTF 535
           L+  + V L     H  D + F   Y+ +P+ L  YVG+K+  R     I+ +++DL + 
Sbjct: 574 LVAQFWVALVPMNTHTLDAENFFQNYLAMPILLALYVGFKLWRRDFRLFIRAKNIDLISH 633

Query: 536 KDAID 540
           +   D
Sbjct: 634 RIIFD 638

>CAGL0L03267g Chr12 (374784..376577) [1794 bp, 597 aa] {ON} highly
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039w GAP1 general amino acid permease
          Length = 597

 Score =  212 bits (540), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 148/530 (27%), Positives = 251/530 (47%), Gaps = 20/530 (3%)

Query: 17  SNETLEEGIVTLESEGQVRSVSEGVDGKHEGIRLKKELEARHVSMXXXXXXXXXXXXXXX 76
           S + L+E +VT +      S  E +  +     LK  L+ RH+ M               
Sbjct: 53  SFKPLDEAVVTDD-----MSDIEKIAHRTAHAPLKHHLKNRHLQMIAIGGAIGTGLFVGS 107

Query: 77  XXXXXXXXPVSILISYSFVGLLVYTVMSCLGEMAAFIPLDG-FTSYASRYVDPAVGFAVG 135
                   P  ILI +   G ++Y ++  +GE++   P+ G FT+YA+R++D + GFA  
Sbjct: 108 GTALRTAGPAGILIGWGLTGTMIYCMVMAMGELSVVFPISGGFTTYATRFIDESFGFANN 167

Query: 136 YSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVNPGVWITIFLALIVLINTVGVRFFGEFEF 195
           ++Y+ ++  V P ++ A ++ + +W +  +   G ++ +F  +IV+IN  GV+ +GE EF
Sbjct: 168 FNYMLQWLCVLPLEIVAASITVNYWGTDPKYRDG-FVALFWVVIVIINLFGVKGYGEAEF 226

Query: 196 WLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGFRFWRDPGAFKPYSEAISGSKG-KXXXX 254
             S +K                   P     G +++ DPGAF      +  + G +    
Sbjct: 227 VFSIIKVLTVIGFIIMGIVLNCGGGPEGGYIGGKYFHDPGAF------VGDTAGARFQGV 280

Query: 255 XXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVVFYVITILLLGMTVAYN 314
                     + G+EL GI AAE+  PR+SVP+A K   +RI +FY++++L++G+ V Y 
Sbjct: 281 CSVFVTAAFSFAGSELIGIAAAESAEPRKSVPKAAKQVFWRITLFYMLSLLMVGLLVPYT 340

Query: 315 DPRLLXXXXXXXXXXXXPFVVAIENASIPVLPHIFNVCVLVFVFSACNSDLYVASRSLYG 374
           D RL+            PFV+AI +  I  LP + NV +L+ V S  NS +Y  SR+L  
Sbjct: 341 DERLIGASSVDAAAS--PFVIAITSHGIRGLPSVVNVVILIAVLSVGNSAVYGCSRTLCA 398

Query: 375 LAIDGKAPRIFATTNKWGVPYYSLGLSVLFCLLAYMNVSSGSAQVFNYFVNVVSIFGLLS 434
           LA     P+IF   ++ G P + +  +  F L+A++  S    +VF + + +  +  L +
Sbjct: 399 LAQQNFLPKIFGYIDRSGRPLFGIAFTSAFGLVAFVAQSKKEGEVFAWLLALSGLSSLFT 458

Query: 435 WITILITYIRFDKAIRVQFGDKSSLSYTAAFQPWSTYVALFFCCLIGLIKNYTVFL--GH 492
           W  I   +IRF  A+  Q      L + A    + +   LF   L+ + + Y      G 
Sbjct: 459 WGGICFCHIRFRAALTAQGRSTDELPFKAPAGIYGSMWGLFMIVLMFMAQFYVALFPPGG 518

Query: 493 KFDYKTFISGYIGIPVYLICYVGYKVVYRT-KLIKP-EDVDLYTFKDAID 540
           K   + F   Y+  PV L  Y G+K+  R  KL+ P   +D+ T +  +D
Sbjct: 519 KPSAEVFFQSYLSFPVVLAFYFGHKLYARNWKLLIPLSKLDIDTGRREMD 568

>Kwal_33.14276 s33 complement(596760..598550) [1791 bp, 596 aa] {ON}
           YKR039W (GAP1) - general amino acid permease [contig
           104] FULL
          Length = 596

 Score =  212 bits (540), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 136/497 (27%), Positives = 243/497 (48%), Gaps = 19/497 (3%)

Query: 50  LKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILISYSFVGLLVYTVMSCLGEM 109
           LK+ L+ RH+ M                       P ++++++   G +VY+V+  +GE+
Sbjct: 84  LKRHLKNRHLQMIAIGGSIGTGLFVGSGKALRIGGPAAVILAWILTGSMVYSVVQAIGEL 143

Query: 110 AAFIPLDG-FTSYASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVNP 168
              +P+ G + SY SR++DP+ GFA+ Y+YL    +  P ++ A ++ + +W    +   
Sbjct: 144 CVALPVSGSYLSYVSRFIDPSFGFAIAYNYLVGNLVTMPLEIVAASITVDYWNVDHKYAD 203

Query: 169 GVWITIFLALIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDR-TG 227
           G ++ +F   ++LIN +GV+ +GE EF  S +K                    N+    G
Sbjct: 204 G-FVALFYVTVLLINFLGVKGYGEAEFVFSIIKVLAIVGFIILGIVLVCGGGSNNTGYIG 262

Query: 228 FRFWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPR 287
            ++W +PG F        G KG               ++G+E+  + AAE+KNPRR +P+
Sbjct: 263 TKYWHNPGGFA------HGFKG----FAAIFVTSAFSFSGSEMFALGAAESKNPRRDLPK 312

Query: 288 AIKLTLYRIVVFYVITILLLGMTVAYNDPRLLXXXXXXXXXXXXPFVVAIENASIPVLPH 347
           A K   +RI +FY+I++ L+G  V Y +  L             PFV+AI+ A I  LP 
Sbjct: 313 AAKQVFWRITLFYLISLTLIGCLVPYTNKHLFASSSVDASAS--PFVIAIKEAGISGLPS 370

Query: 348 IFNVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCLL 407
           + NV +LV V S  N+ ++ +SR+   LA  G  P+ FA  ++ G P   L LS++F LL
Sbjct: 371 VINVVILVAVLSVGNTCVFASSRATLSLAHYGYLPKKFAYVDRKGRPLAGLILSMVFGLL 430

Query: 408 AYMNVSSGSAQVFNYFVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLSYTAAFQP 467
           ++++ S     VF + + V  +    +W +I + ++RF + +R Q      L++ A    
Sbjct: 431 SFLSSSKHKGVVFEWMLAVSGLCSFFTWGSICVCHLRFRQGLRAQGRSTDELAFKAQTGI 490

Query: 468 WSTYVALFFCCLIGLIKNYTVF--LGHKFDYKTFISGYIGIPVYLICYVGYKVVYRT-KL 524
           W +   +    ++   + +     L        F   Y+ +PV ++ Y+G+KV  R  +L
Sbjct: 491 WGSIYGITLISVVLCFQFWVALFPLSKSPSAYHFFEQYLSLPVVIVFYMGHKVYSRNWRL 550

Query: 525 IKP-EDVDLYTFKDAID 540
           + P +++DL T +  +D
Sbjct: 551 VIPAKELDLDTGRREVD 567

>Kwal_33.13204 s33 complement(120622..122445) [1824 bp, 607 aa] {ON}
           YDR508C (GNP1) - high-affinity glutamine permease
           [contig 121] FULL
          Length = 607

 Score =  212 bits (540), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 140/499 (28%), Positives = 237/499 (47%), Gaps = 16/499 (3%)

Query: 49  RLKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILISYSFVGLLVYTVMSCLGE 108
           +LK+ +  RHV M                       P  ++I Y+ +G  +Y ++   GE
Sbjct: 89  KLKQTITFRHVFMMSLGTGIGTGMLVGNGKALHNGGPAGLVIGYAIMGSCLYCIIQAAGE 148

Query: 109 MA-AFIPLDG-FTSYASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRV 166
           +A ++  L G F +Y S  ++ A GF+V + Y  ++  V P +L   ++ +++W +   V
Sbjct: 149 LAVSYSSLSGNFNAYPSMLIEQAFGFSVAWIYCLQWLCVLPLELVTASITIKYWTTS--V 206

Query: 167 NPGVWITIFLALIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRT 226
           NP +++ IF  LI+L+N  G R + E EF+ +  K                    N    
Sbjct: 207 NPDIFVAIFYVLIILVNMFGARGYAEAEFFFNCCKVLMIIGFFILGIIVNCGGAGNDGYI 266

Query: 227 GFRFWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVP 286
           G R+W +PGAF   ++ I   KG               +  TE   + AAE  NPRR++P
Sbjct: 267 GGRYWNNPGAFYG-TKPIHHFKG----IISTMVTAAFAFGATEFIALTAAEQANPRRAIP 321

Query: 287 RAIKLTLYRIVVFYVITILLLGMTVAYNDPRLLXXXXXXXXXXXXPFVVAIENASIPVLP 346
            A K  +YRI++ ++  I+L+G  V +N P L+            P+V+A+ +  + V+P
Sbjct: 322 SAAKKVVYRILLIFLAPIVLIGFLVPHNSPELMGSGSSATHAS--PYVIAVASHGVRVVP 379

Query: 347 HIFNVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCL 406
           H  N  +L+ V S  NS  Y +SR L  LA    AP      ++ G P  ++ +S +F L
Sbjct: 380 HFINAVILLSVLSVGNSAFYSSSRLLLALADQHYAPAWLKFIDRSGRPMRAMLVSCVFGL 439

Query: 407 LAYMNVSSGSAQVFNYFVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLSYTAAFQ 466
           ++++  S     VF + + +  +  L +WI+I +++IRF KA+ VQ      L Y +   
Sbjct: 440 ISFVAASPKEETVFTWLLAISGLSQLFTWISICVSHIRFRKALIVQGKPIGELGYKSQTG 499

Query: 467 PWSTYVALFF--CCLIGLIKNYTVFLGH-KFDYKTFISGYIGIPVYLICYVGYKVVYRT- 522
              +Y A F   C LIG        +G  K D  +F   Y+ +P++++ Y G+K+  R  
Sbjct: 500 VAGSYYATFIMGCILIGQFWVAIAPMGSAKLDANSFFENYLALPLFVVLYFGFKIWKRDW 559

Query: 523 KLIKP-EDVDLYTFKDAID 540
           +L  P E +DL + +   D
Sbjct: 560 RLYIPLEQIDLDSHRKTFD 578

>TBLA0I02010 Chr9 complement(455681..457567) [1887 bp, 628 aa] {ON}
           Anc_3.285 YBR069C
          Length = 628

 Score =  212 bits (540), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 139/495 (28%), Positives = 231/495 (46%), Gaps = 23/495 (4%)

Query: 49  RLKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILISYSFVGLLVYTVMSCLGE 108
           +L K ++ RH+ M                       P  ++I Y    +++Y V+   GE
Sbjct: 105 QLNKTMKPRHIVMISLGTGIGTGLLVGNGQVLSKSGPAGLVIGYGVASIMIYCVVQAAGE 164

Query: 109 MA-AFIPLDG-FTSYASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRV 166
           +   +  L G +T+Y +  +DPAVGFAV   Y  ++  V P QL   AM +++W +   V
Sbjct: 165 LGLVYSRLTGNYTTYPTYLIDPAVGFAVSMLYTLQWLTVLPLQLVTAAMTIRYWTTN--V 222

Query: 167 NPGVWITIFLALIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRT 226
           NP +++   L L++ IN  G + + E EF+ +  K                    + +  
Sbjct: 223 NPDIFVAAILVLVIAINMFGAKGYAEAEFFCNCCKLLMMAGFVILGIVINCGGAGDKEYI 282

Query: 227 GFRFWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVP 286
           G ++W+ PGAF       +G KG               Y G E+  + A E  NPR+++P
Sbjct: 283 GVKYWQTPGAFA------NGFKG----VAAVFCYAAFSYGGIEVLVLTANEQANPRKAIP 332

Query: 287 RAIKLTLYRIVVFYVITILLLGMTVAYNDPRLLXXXXXXXXXXXXPFVVAIENASIPVLP 346
            A +  +YR++  Y++T +++   V YN P LL            PFV+A+ +  + V+P
Sbjct: 333 DACRKVVYRVLFLYMLTTIIVCFLVPYNSPALLGSNNDGSGSDASPFVIAVASHGVQVVP 392

Query: 347 HIFNVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCL 406
           HI N  +L+ V S  NS LY   R L  L+  G AP+ F   ++ G P   + +SV   L
Sbjct: 393 HIINAAILISVISVANSSLYSGPRLLLSLSQQGYAPKCFNYIDRRGRPIICVLVSVAMGL 452

Query: 407 LAYMNVSSGSAQVFNYFVNVVSIFGLLSWITILITYIRFDKAIRVQFGD---KSSLSYTA 463
           +A++       +VF + + V  +  +  W++I I+++RF  AIR Q G    +  + YTA
Sbjct: 453 IAFLAAIPAREEVFTWLLAVSGLSQIFIWMSITISHLRFRDAIRSQLGGLRARDVVEYTA 512

Query: 464 AFQPWSTYVALFFCCLIGLIKNYTVF--LGH--KFDYKTFISGYIGIPVYLICYVGYKVV 519
                 + VAL     I + + +     LGH  + D + F   Y+  PV L  Y+ YK+ 
Sbjct: 513 QTGYVGSLVALAISIFILVCQFWVAIAPLGHNGQLDVQIFFENYLAAPVLLGGYLAYKIW 572

Query: 520 YRT-KLIKP-EDVDL 532
           +R  +L  P  ++DL
Sbjct: 573 HRDWRLCIPANEIDL 587

>CAGL0H08393g Chr8 (821998..823836) [1839 bp, 612 aa] {ON} highly
           similar to uniprot|P41815 Saccharomyces cerevisiae
           YDR046c PAP1
          Length = 612

 Score =  211 bits (538), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 141/498 (28%), Positives = 226/498 (45%), Gaps = 16/498 (3%)

Query: 51  KKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILISYSFVGLLVYTVMSCLGEMA 110
           KK +++RHV M                       P S++I+Y  V  + Y ++   GEMA
Sbjct: 94  KKTMKSRHVIMMSLGTGIGTGLLVSNGKGLSLAGPASLVIAYGLVSFVTYFMIQAAGEMA 153

Query: 111 AFIP-LDG-FTSYASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVNP 168
              P L G F +Y S ++    GFA  + +  ++  V P +L   AM +++W     ++P
Sbjct: 154 VTYPTLPGSFNAYTSFFISKPFGFATTWLFCIQWLTVLPLELITAAMTIKYW--NTSIDP 211

Query: 169 GVWITIFLALIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGF 228
            V++ IF   ++ I+  GV+ +GE EF  ++ K                         G 
Sbjct: 212 DVFVIIFYVFLMFIHFFGVQAYGETEFIFNACKILMIGGFIIFAIVVNCGGAGKDGYIGG 271

Query: 229 RFWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPRA 288
           ++W DPGAF     A S    +              Y G EL  +   + KNPR+S P A
Sbjct: 272 KYWHDPGAF-----ASSNGASRFKGICYNLVNAYFSYGGNELFVLSVNDQKNPRKSTPAA 326

Query: 289 IKLTLYRIVVFYVITILLLGMTVAYNDPRLLXXXXXXXXXXXXPFVVAIENASIPVLPHI 348
            K  +YRIVV Y++T++L+G  V +N   LL            P+V+A     I V+PHI
Sbjct: 327 AKSNVYRIVVIYLLTMILIGFVVPHNSSELLGASGGNGLHAS-PYVLAASIHGIKVVPHI 385

Query: 349 FNVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCLLA 408
            N  +L+ + S  NS LY   R L  LA  G APR  +  ++ G P  +L LS L  ++ 
Sbjct: 386 INAVILIALISVANSSLYAGPRLLSSLAQQGYAPRFLSYVDRRGRPLTALLLSALVGVIG 445

Query: 409 YMNVSSGSAQVFNYFVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLSYTAAFQPW 468
           +   S    +VF +   +  +  L +W +I+ ++IRF +A+++Q     +L Y A    W
Sbjct: 446 FAATSPREEEVFTWLAAISGLSELFTWTSIMFSHIRFRRAMKLQNKSLDTLGYKANTGLW 505

Query: 469 STYVALFFCCLIGLIKNYTVF----LGHKFDYKTFISGYIGIPVYLICYVGYKVVYR--T 522
            +Y  + F  L+   + +        G K D  +F + Y+ +P++L+ Y GY   Y+  T
Sbjct: 506 GSYFGVGFNILVFAAQFWVALSPPNSGGKCDANSFFASYLAMPIWLVFYFGYMCWYKDFT 565

Query: 523 KLIKPEDVDLYTFKDAID 540
            L     VDL   +   D
Sbjct: 566 VLTDLNQVDLDNHRKVYD 583

>Smik_12.2 Chr12 (2207..3958) [1752 bp, 583 aa] {ON} YLL061W (REAL)
          Length = 583

 Score =  211 bits (536), Expect = 5e-60,   Method: Compositional matrix adjust.
 Identities = 138/459 (30%), Positives = 219/459 (47%), Gaps = 26/459 (5%)

Query: 85  PVSILISYSFVGLLVYTVMSCLGEMAAFIPLDG-FTSYASRYVDPAVGFAVGYSYLFKYF 143
           P S+LI +  VG  +  V+ C  E++   P+ G +  +ASR++DP+VGF++G +YL  + 
Sbjct: 103 PASLLIGFLLVGASMLCVVQCGAELSCQYPVSGSYALHASRFIDPSVGFSIGINYLLMWL 162

Query: 144 IVTPNQLTAGAMVMQFWVSRDRVNPGVWITIFLALIVLINTVGVRFFGEFEFWLSSVKXX 203
           I  P++L   ++ + +W     VNP  W+ I   L +L+N  G R F E EF++S  K  
Sbjct: 163 ISYPSELVGCSLTISYWA--PSVNPAAWVAIAFVLSMLLNMFGARGFAESEFYMSIFKIV 220

Query: 204 XXXXXXXXXXXXXXXXXPNHDRTGF---RFWRDPGAFKPYSEAISGSKGKXXXXXXXXXX 260
                            P  D TG+   ++W DPG+F P                     
Sbjct: 221 ALFIFIIIGIILIAGGGP--DSTGYIGTKYWHDPGSFAP---------PVFKNLCNTFVS 269

Query: 261 XXXXYTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVVFYVITILLLGMTVAYNDPRLLX 320
               ++GTE+  + + EA+N   SV RA K T +RIV+FY++T++++G  V YND RL+ 
Sbjct: 270 AAYSFSGTEMVVLTSTEARNVS-SVSRAAKGTFWRIVIFYIVTVIIIGCLVPYNDSRLIN 328

Query: 321 XXXXXXXXXXXPFVVAIENASI--PVLPHIFNVCVLVFVFSACNSDLYVASRSLYGLAID 378
                      PFV+A+ N       + H  N  +L+ VFS CNS +Y +SR + GLA  
Sbjct: 329 GSSSEDITAS-PFVIALSNTGTMGKRVSHFMNAVILIAVFSVCNSCVYASSRLIQGLATA 387

Query: 379 GKAPRIFATTNKWGVPYYSLGLSVLFCLLAYMNVSSGSAQVFNYFVNVVSIFGLLSWITI 438
           G+ PRI A  ++ G P   + +   F LL ++ VS     VF +   + SI    +W  I
Sbjct: 388 GQLPRICAYMDRNGRPLVGMAICGAFGLLGFLVVSKNQGTVFTWLFALCSISFFTTWFCI 447

Query: 439 LITYIRFDKAIRVQFGDKSSLSYTAAFQPWSTYVALFFCCL--IGLIKNYTVFLGHKFDY 496
               +RF  A++ Q   K  + Y ++   +   V      L  IG I      +G     
Sbjct: 448 CFCQVRFRMAMKAQGRSKDDIIYRSSLGIYGGIVGCILNVLLVIGEIYVSAAPVGSPSSA 507

Query: 497 KTFISGYIGIPVYLICYVGYKVV---YRTKLIKPEDVDL 532
             F    + IP+ +  Y+G+++    +R   IK  D+DL
Sbjct: 508 ANFFEYCMSIPIMIAVYIGHRIYRKDWRHWYIKRRDIDL 546

>TPHA0B04750 Chr2 (1119282..1121201) [1920 bp, 639 aa] {ON} Anc_1.50
           YDR508C
          Length = 639

 Score =  211 bits (538), Expect = 6e-60,   Method: Compositional matrix adjust.
 Identities = 152/551 (27%), Positives = 260/551 (47%), Gaps = 27/551 (4%)

Query: 1   MNSDTSMEKKNAGVLYSNETLEEGIVTLESEGQVRSVSEGVDGKHEGIRLKKELEARHVS 60
           + +D +    +A ++++     E    ++S   V S         E   L+K ++ RHV 
Sbjct: 76  LENDITTSISHASLVHAVSKAREDDEIMQS---VASAEHRKVNNTESDDLQKTIKPRHVI 132

Query: 61  MXXXXXXXXXXXXXXXXXXXXXXXPVSILISYSFVGLLVYTVMSCLGEMAA-FIPLDG-F 118
           M                       P  ++I YS +G  +Y ++   GEMA  +  L+G F
Sbjct: 133 MISLGTGIGTGLLVGNSSVLSAAGPAPLVIGYSIMGSCLYCIIQAAGEMAVVYSDLNGGF 192

Query: 119 TSYASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVNPGVWITIFLAL 178
            +Y S  +DPA+GF+V + Y  ++  V P +L   ++ +++W ++  V+P V++ IF  L
Sbjct: 193 NNYPSFLLDPALGFSVAWVYCLQWLCVCPLELVTASLTIKYWTTK--VDPDVFVIIFYVL 250

Query: 179 IVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGFRFWRDPGAFK 238
           I+ IN  G R + E EF+ +  K                    N    G ++W +PGAF+
Sbjct: 251 IISINVFGARGYAEAEFFFNVCKVLMMIGFFILGIIITAGGAGNDGYLGAKYWHEPGAFR 310

Query: 239 PYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVV 298
               A+   KG               +  TE   + AAE  NPR+++P A K  LYRIV+
Sbjct: 311 G-EHAVDRFKG----VMDTFVAAAFAFGATEFIALTAAEQSNPRKAIPSAAKKVLYRIVL 365

Query: 299 FYVITILLLGMTVAYNDPRLLXXXXXXXXXXXXPFVVAIENASIPVLPHIFNVCVLVFVF 358
            ++++I++LG  V Y+  +LL            P+V+A+    + V+PH  N  +L+ V 
Sbjct: 366 IFLVSIIMLGFLVPYDSDQLLGSSGSGVKAS--PYVLAVSLHGVRVVPHFINAVILLSVL 423

Query: 359 SACNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCLLAYMNVSSGSAQ 418
           S  NS  Y +SR L  L+  G AP+ F   ++ G P  ++ +S LF ++A+   S     
Sbjct: 424 SVGNSAFYSSSRLLLSLSQQGYAPKWFDYVDRQGRPARAMLMSALFGVIAFCATSPKETD 483

Query: 419 VFNYFVNVVSIFGLLSWITILITYIRFDKAIRVQ---FGDKSSLSYTAAFQPWSTYVALF 475
           VFN+ + +  +  L +W  I ++++RF  A++VQ    G+    S T  +   S Y A  
Sbjct: 484 VFNWLLAISGLSQLFTWFAICMSHVRFRYAMKVQGRSIGEVGFHSQTGVYG--SLYAATM 541

Query: 476 FCCLIGLIKNYTVFLG----HKFDYKTFISGYIGIPVYLICYVGYKVVYRT-KL-IKPED 529
              ++ L+  + V +      K D + F   Y+ +P+ +  Y GYK+ YR  KL IK + 
Sbjct: 542 M--ILALMAQFWVAIAPLNEGKLDAQNFFQSYLAMPILIALYFGYKLYYRDWKLYIKADK 599

Query: 530 VDLYTFKDAID 540
           +DL + +   D
Sbjct: 600 IDLISHRQIFD 610

>KNAG0J02210 Chr10 complement(409847..411592) [1746 bp, 581 aa] {ON}
           
          Length = 581

 Score =  210 bits (535), Expect = 7e-60,   Method: Compositional matrix adjust.
 Identities = 145/490 (29%), Positives = 227/490 (46%), Gaps = 25/490 (5%)

Query: 50  LKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILISYSFVGLLVYTVMSCLGEM 109
           L K + +RH+ M                       P+ ++I Y    L+V+ ++   GE+
Sbjct: 84  LNKAIRSRHLIMISLGTGIGTGLLVGTGSVLSQSGPLGLIIGYIVSSLMVFLIIQAAGEL 143

Query: 110 AAFIP--LDGFTSYASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVN 167
                  +  FT Y +  VDPA GFA+ + Y  ++ IV P QL   AM +QFW     VN
Sbjct: 144 GIVYSNVVGNFTRYPTILVDPAFGFAISFLYTIQWMIVLPLQLVTAAMTIQFW--NVGVN 201

Query: 168 PGVWITIFLALIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDR-- 225
             V++     ++VLIN  G R + E EF+ +  K                   PN     
Sbjct: 202 LDVFVLASFVVVVLINLGGARGYVEAEFFCNLCKIVMLTGFVILGIIITAGGIPNGPDGY 261

Query: 226 TGFRFWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSV 285
            G ++WR+PG F       +G KG               Y G E   + AAE KNP +S+
Sbjct: 262 IGGKYWRNPGLFA------NGFKG----VCSVFCYAAFSYGGVETLVLSAAEQKNPLKSI 311

Query: 286 PRAIKLTLYRIVVFYVITILLLGMTVAYNDPRLLXXXXXXXXXXXXPFVVAIENASIPVL 345
           P A K  +YRI+  Y+++++++   V Y  P L+            PFV+AI +  + V+
Sbjct: 312 PSATKKVMYRILFIYLLSLIIVCFLVPYTSPDLMGSSGSGSHSS--PFVIAIASHGVSVV 369

Query: 346 PHIFNVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFC 405
           PH+ N  +L+ V S  NS LYVA R L  LA  G AP+     +K G P     + VLF 
Sbjct: 370 PHLINAVILISVLSVANSALYVAPRLLLSLAQGGSAPKFLNYIDKRGRPTTCTLVVVLFG 429

Query: 406 LLAYMNVSSGSAQVFNYFVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLSYTAAF 465
           ++ ++  S     VF + +++  +  +  WI+I +++IRF  A+RVQ    + ++Y A  
Sbjct: 430 MIGFVAASDKREVVFTWLLSISGLGQIFIWISICVSHIRFRDAMRVQGHPLTEIAYKAQT 489

Query: 466 QPWSTYVALFFCCLIGLIKNYTVFLG-----HKFDYKTFISGYIGIPVYLICYVGYKVVY 520
             W +YVA+     + L+  + V +       K D   F   Y+  PV L  Y+G+KV Y
Sbjct: 490 GYWGSYVAIALALFV-LVCQFWVAIAPVGAHGKLDATNFFQNYLAFPVVLCAYLGFKVYY 548

Query: 521 RT-KLIKPED 529
           +  +L+ P D
Sbjct: 549 KQWQLLIPAD 558

>ZYRO0C17182g Chr3 complement(1334883..1336619) [1737 bp, 578 aa]
           {ON} similar to uniprot|P38090 Saccharomyces cerevisiae
           YBR132C AGP2 Plasma membrane carnitine transporter
           expression is down-regulated by osmotic stress also
           functions as a low-affinity amino acid permease
          Length = 578

 Score =  210 bits (534), Expect = 8e-60,   Method: Compositional matrix adjust.
 Identities = 134/526 (25%), Positives = 244/526 (46%), Gaps = 10/526 (1%)

Query: 23  EGIVTLESEGQVRSVSEGVDGKHEGIRLKKELEARHVSMXXXXXXXXXXXXXXXXXXXXX 82
           E + T  SE         V+ +     ++++L+ RHV +                     
Sbjct: 21  ETVNTEASESSEVENGGVVNFERSTRHVQRKLKNRHVQLISISGVIGTALFVSIGKALYH 80

Query: 83  XXPVSILISYSFVGLLVYTVMSCLGEMAAFIPLDG-FTSYASRYVDPAVGFAVGYSYLFK 141
               ++L+ ++   + +  +  C  EM  F+P+   F   A   VD ++G    +++ F 
Sbjct: 81  GGAANLLLGFAIWCIPIMCITVCTAEMVCFLPVSSPFLRLAHMCVDDSLGVMASWNFWFL 140

Query: 142 YFIVTPNQLTAGAMVMQFWVSRDRVNPGVWITIFLALIVLINTVGVRFFGEFEFWLSSVK 201
             +  P ++ +   ++ +W  RD  N  + + + L L   I+   VR++GE EFWL+S K
Sbjct: 141 ECVQIPYEIVSVNTIIHYW--RDDYNAAIPLVVQLVLYGFISLCTVRYYGEAEFWLASFK 198

Query: 202 XXXXXXXXXXXXXXXXXXXPNHDRTGFRFWRDPGAFKPYSEAISGSKGKXXXXXXXXXXX 261
                              P HDR GFR++ +   FK Y     GS              
Sbjct: 199 IVLAIGLYFFTFVTMLGGNPRHDRYGFRYYGE-APFKKYWPNGHGSNASGHFQGFLACVI 257

Query: 262 XXXYT--GTELCGIVAAEAKNPRRSVPRAIKLTLYRIVVFYVITILLLGMTVAYNDPRLL 319
              +T  G E   ++A E   PR+ +PRA K    R+ V ++ + L +G+  + NDP L 
Sbjct: 258 QAAFTVAGGEYVSMLAGEVVLPRKVMPRAFKQVFIRLTVLFLGSCLCVGILCSPNDPDLT 317

Query: 320 XXXXXXX-XXXXXPFVVAIENASIPVLPHIFNVCVLVFVFSACNSDLYVASRSLYGLAID 378
                        P+V+A+++  I VLP I N  ++   FS+ N+  Y +SR+LYG+A+D
Sbjct: 318 AAINESRPGAGSSPYVIAMKHLHIHVLPDIVNAALITAAFSSGNAYTYCSSRTLYGMALD 377

Query: 379 GKAPRIFATTNKWGVPYYSLGLSVLFCLLAYMNVSSGSAQVFNYFVNVVSIFGLLSWITI 438
           G AP+IFA     G P +++ +S+ +  L+ + +   SA V N+ +N+++   L++++ +
Sbjct: 378 GYAPKIFARCTPQGTPIFAMAVSMCWGFLSLLQLGDNSAVVLNWLINLITTSQLINFVIL 437

Query: 439 LITYIRFDKAIRVQFGDKSSLSYTAAFQPWSTYVALFFCCLIGLIKNYTVFLGHKFDYKT 498
            +TY+ F +  +V   +   L + + +QPW  Y+ +     +  I+ Y VF    +  K 
Sbjct: 438 CVTYLFFRRVYKVNEHNLPRLPFKSWWQPWPAYIGIICAGSMTFIQGYAVFFSSLWSTKQ 497

Query: 499 FISGYIGIPVYLICYVGYKVVYR---TKLIKPEDVDLYTFKDAIDA 541
           F+  Y+ + + +  Y+GYK ++R    KL  P +V+ +     IDA
Sbjct: 498 FLFSYLMLFIDIGLYLGYKFIWRRGKDKLRNPTEVNFFPLLAEIDA 543

>KLTH0F01606g Chr6 complement(122821..124635) [1815 bp, 604 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn expression is
           fully dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p- Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 604

 Score =  210 bits (535), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 149/506 (29%), Positives = 241/506 (47%), Gaps = 20/506 (3%)

Query: 44  KHEGIRLKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILISYSFVGLLVYTVM 103
           KH+   LK+ ++ RHV M                       P S+LI Y+ V  ++Y V+
Sbjct: 83  KHK--TLKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLYCVI 140

Query: 104 SCLGEMAA-FIPLDG-FTSYASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWV 161
               E+A  +  L G F +Y +  VD A  F+V + Y  ++  + P +L   +M +++W 
Sbjct: 141 QSASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLELVTASMTIKYW- 199

Query: 162 SRDRVNPGVWITIFLALIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXP 221
             D +NP  ++ IF  ++++IN +G   + E EF+ ++ K                    
Sbjct: 200 -NDSINPDAFVVIFYVVLIVINFIGAAGYAEAEFFFNTCKVLMLIGFFILGIIVNCGGAG 258

Query: 222 NHDRTGFRFWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNP 281
           N    G  +W DPGAF+  +  I+  KG               Y G E   + AAE +NP
Sbjct: 259 NDGYLGSVYWHDPGAFRG-NNGINRFKG----LVAVLVNAAFAYGGAEFSVLTAAEQQNP 313

Query: 282 RRSVPRAIKLTLYRIVVFYVITILLLGMTVAYNDPRLLXXXXXXXXXXXXPFVVAIENAS 341
           ++S+  A K  +YRI+  Y++T  LLG  V YN P LL            PFV+AI +  
Sbjct: 314 QKSIRSASKKLVYRIIGIYLMTAALLGFLVPYNSPELLGSGSAATHAS--PFVIAIASHG 371

Query: 342 IPVLPHIFNVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLS 401
           + V+PHI N  +L+ V S  NS LY +SR L  L+  G AP++F   ++ G P   L +S
Sbjct: 372 VKVVPHIINAVILLSVLSVANSALYSSSRILLSLSEQGFAPKLFNYVDRRGRPVRCLLVS 431

Query: 402 VLFCLLAYMNVSSGSAQVFNYFVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLSY 461
            +F LL ++  S     VF + + +  +  L +W +I ++++RF +++ VQ      L Y
Sbjct: 432 CVFGLLCFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRFRRSMIVQGRSLDELGY 491

Query: 462 TAAFQPWSTYVALFFCCLIGLIKNYTVFL----GHKFDYKTFISGYIGIPVYLICYVGYK 517
            +    W  Y A+    LI LI  + V +     +K D   F   Y+ +P+ +  Y+GYK
Sbjct: 492 QSWTGVWGAYYAMIMILLI-LIGQFWVAISPVGSNKLDANNFFENYLAMPILIGLYLGYK 550

Query: 518 VVYRT--KLIKPEDVDLYTFKDAIDA 541
           + YR    +I   +VDL + +   DA
Sbjct: 551 LWYRDWRVIIPANEVDLVSHRKIFDA 576

>Skud_4.300 Chr4 complement(525086..526900) [1815 bp, 604 aa] {ON}
           YBR068C (REAL)
          Length = 604

 Score =  210 bits (534), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 143/535 (26%), Positives = 240/535 (44%), Gaps = 33/535 (6%)

Query: 6   SMEKKNAGVLYSNETLEEGIVTLESEGQVRSVSEGVDGKHEGIRLKKELEARHVSMXXXX 65
           S  +  +  L  N  LE+G   ++S                   LKK +++RHV M    
Sbjct: 58  SFRRAESQCLEENNDLEDGTRPMKSNNH----------------LKKSMKSRHVVMMSLG 101

Query: 66  XXXXXXXXXXXXXXXXXXXPVSILISYSFVGLLVYTVMSCLGEMA-AFIPLDG-FTSYAS 123
                              P S++I Y  V  + Y ++   GEM  A+  L G F +Y S
Sbjct: 102 TGIGTGLLVANAKGLKLAGPGSLVIGYVLVSFITYFMVQAAGEMGVAYATLPGNFNAYNS 161

Query: 124 RYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVNPGVWITIFLALIVLIN 183
            ++  + GFA  + +  ++  V P +L   +M +++W   D +N  V+I IF   ++ I+
Sbjct: 162 IFISKSFGFATTWLFCIQWLTVLPLELITSSMTIKYW--NDSINADVFIVIFYVFLLFIH 219

Query: 184 TVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGFRFWRDPGAFKPYSEA 243
             GV+ +GE EF  +S K                         G ++WRDPG+F   S A
Sbjct: 220 FFGVKAYGETEFIFNSCKILMVAGFIILSVVINCGGAGVDGYIGGKYWRDPGSFADGSNA 279

Query: 244 ISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVVFYVIT 303
                 +              + G EL  +   E  N R+S P A K ++YRI++ Y++T
Sbjct: 280 T-----RFKGICFILVTAYFSFGGIELFVLSINEQSNARKSTPLAAKRSVYRILIIYLLT 334

Query: 304 ILLLGMTVAYNDPRLLXXXXXXXXXXXXPFVVAIENASIPVLPHIFNVCVLVFVFSACNS 363
           ++L+G  V +N+ +L+            P+V+A     + V+PHI N  +L+ V S  NS
Sbjct: 335 MILIGFNVPHNNDQLMGSGSAATHAS--PYVLAASIHKVRVIPHIINAVILISVISVANS 392

Query: 364 DLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCLLAYMNVSSGSAQVFNYF 423
            LY A R +  LA  G APR     ++ G P  +L +  L  ++ ++  S    Q F + 
Sbjct: 393 ALYAAPRLMCSLAQQGYAPRFLNYIDREGRPLRALAVCALVGVVGFVACSPQEEQAFTWL 452

Query: 424 VNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLSYTAAFQPWSTYVALFFCCLIGLI 483
             +  +  + +W  I++++IRF KA++VQ      L Y A    W +Y  +FF  L+ + 
Sbjct: 453 AAIAGLSEIFTWSGIMLSHIRFRKAMKVQGRSLGELGYKANTGIWGSYYGVFFNILVFMA 512

Query: 484 KNYTVFL----GHKFDYKTFISGYIGIPVYLICYVGYKVVYRT-KLIKPED-VDL 532
           + +        G K D + F  GY+  P+++  Y+GY +  +   L+ P D +DL
Sbjct: 513 QFWVALSPIGNGGKCDVQAFFEGYLAAPLWIFMYLGYMLYNKDFTLLNPLDKIDL 567

>NDAI0A07490 Chr1 complement(1713048..1714838) [1791 bp, 596 aa]
           {ON} 
          Length = 596

 Score =  210 bits (534), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 145/532 (27%), Positives = 240/532 (45%), Gaps = 34/532 (6%)

Query: 10  KNAGVLYSNETLEEGIVTLESEGQVRSVSEGVDGKHEGIRLKKELEARHVSMXXXXXXXX 69
           + A   +++  LE+G  ++ S           D  H    +KK +++RHV M        
Sbjct: 53  RRAEDKHADSDLEDGSKSITS-----------DDDH----MKKAMKSRHVIMMTLGTGIG 97

Query: 70  XXXXXXXXXXXXXXXPVSILISYSFVGLLVYTVMSCLGEMAAFIPL--DGFTSYASRYVD 127
                          P  +++ Y  V  + Y ++   GEMA   P     F +YAS +V 
Sbjct: 98  TGLLVANGKGLALAGPAPLVLGYGLVSFVTYFMIQAAGEMAVTYPTMPASFNTYASIFVS 157

Query: 128 PAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVNPGVWITIFLALIVLINTVGV 187
              GFA  + +  ++  V P +L   +M +++W   D +NP V+I IF   ++ I+  GV
Sbjct: 158 KPFGFATVWLFCIQWLTVLPLELITASMTIKYW--NDTINPDVFIVIFYVFLLFIHFFGV 215

Query: 188 RFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGFRFWRDPGAFKPYSEAISGS 247
           + +GE EF  +S K                         G ++W +PGAF   S A    
Sbjct: 216 KAYGETEFIFNSCKILMIAGFIILSIVINCGGAGRDGYIGNKYWINPGAFASESPA---- 271

Query: 248 KGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVVFYVITILLL 307
             +              Y GTEL  +   E KNPR+S P A K ++YRI++ Y++T++L+
Sbjct: 272 -ARFKGVAYILVTGYFSYGGTELFSLSVNEQKNPRKSTPAAAKQSIYRILIIYLLTMILI 330

Query: 308 GMTVAYNDPRLLXXXXXXXXXXXXPFVVAIENASIPVLPHIFNVCVLVFVFSACNSDLYV 367
           G  V ++  +L+            P+V+A     + V+PH  N  +L+ V S  NS LY 
Sbjct: 331 GFNVPHDSDQLMGAGGSATHAS--PYVLAASLHGVKVVPHFINAVILISVVSVANSALYA 388

Query: 368 ASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCLLAYMNVSSGSAQVFNYFVNVV 427
           + R +  LA  G AP+ F   ++ G P  +L +  LF ++ ++  S    Q F +   + 
Sbjct: 389 SPRLMRSLAEQGYAPKWFNYVDREGRPLRALCICGLFGVIGFVACSPQEEQAFTWLAAIA 448

Query: 428 SIFGLLSWITILITYIRFDKAIRVQFGDKSSLSYTAAFQPWSTYVALFFCCLIGLIKNYT 487
            +  L +W +I I++IRF  A++VQ      L Y A    W +  ++FF  L+  I  + 
Sbjct: 449 GLSELFTWSSIFISHIRFRMAMKVQGKSLEELGYRATTGIWGSVYSVFFNMLV-FIAQFW 507

Query: 488 VFL-----GHKFDYKTFISGYIGIPVYLICYVGYKVVYR--TKLIKPEDVDL 532
           V L       K+D + F   Y+  P++L+ Y GY +  R  T L   + +DL
Sbjct: 508 VALSPPKSNGKYDAEGFFESYLAAPLWLVFYFGYMIYSRDFTFLTPLDKIDL 559

>Smik_4.790 Chr4 complement(1389278..1391269) [1992 bp, 663 aa] {ON}
           YDR508C (REAL)
          Length = 663

 Score =  211 bits (537), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 135/516 (26%), Positives = 239/516 (46%), Gaps = 21/516 (4%)

Query: 34  VRSVSEGVDGKHEGIRLKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILISYS 93
           ++   +  + K E   LKK ++ RH  M                       P  ++I Y+
Sbjct: 131 IKQAPQEQEQKQE--NLKKSIKPRHTVMMSLGTGIGTGLLVGNSKVLNNAGPGGLIIGYA 188

Query: 94  FVGLLVYTVMSCLGEMAAFIP--LDGFTSYASRYVDPAVGFAVGYSYLFKYFIVTPNQLT 151
            +G  VY ++   GE+A      + GF +Y    VDPA+GF+V + +  ++  V P +L 
Sbjct: 189 IMGSCVYCIIQACGELAVIYSDLIGGFNTYPLFLVDPALGFSVAWLFCLQWLCVCPLELV 248

Query: 152 AGAMVMQFWVSRDRVNPGVWITIFLALIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXX 211
             +M +++W  +  V+P V++ IF  LI++IN  G + + E +F+ +  K          
Sbjct: 249 TASMTIKYWTVK--VDPDVFVVIFYVLIIVINVFGAKGYAEADFFFNCCKILMIIGFFIL 306

Query: 212 XXXXXXXXXPNHDRTGFRFWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELC 271
                          G ++WRDPGAF+     I   KG               +  +E  
Sbjct: 307 AIIIDCGGAGTDGYIGSKYWRDPGAFRG-DTPIQRFKG----IVATFVTAAFAFGMSEQL 361

Query: 272 GIVAAEAKNPRRSVPRAIKLTLYRIVVFYVITILLLGMTVAYNDPRLLXXXXXXXXXXXX 331
            + A+E  NPR+++P A K  +YRI+  ++ ++ L+G  V Y   +LL            
Sbjct: 362 AMTASEQSNPRKAIPSAAKKMIYRILFVFLASLTLVGFLVPYTSDQLLGAAGSATKAS-- 419

Query: 332 PFVVAIENASIPVLPHIFNVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPRIFATTNKW 391
           P+V+A+ +  + V+PH  N  +L+ V S  NS  Y +SR L  LA  G AP+ F   ++ 
Sbjct: 420 PYVIAVSSHGVRVVPHFINAVILLSVLSVANSAFYTSSRILMSLAKQGNAPKCFDYIDRE 479

Query: 392 GVPYYSLGLSVLFCLLAYMNVSSGSAQVFNYFVNVVSIFGLLSWITILITYIRFDKAIRV 451
           G P  ++ +S LF ++A+   S     VF + + +  +  L +WITI +++IRF +A++V
Sbjct: 480 GRPAVAMLVSALFGVIAFCASSKKEEDVFTWLLAISGLSQLFTWITICLSHIRFRRAMKV 539

Query: 452 QFGDKSSLSYTAAFQPWSTYVALFFCCLIGLIKNYTVFL-----GHKFDYKTFISGYIGI 506
           Q      + Y +    W +  A+    ++ LI  + V +     G K   ++F   Y+ +
Sbjct: 540 QGRSLGEVGYKSQVGVWGSAYAVLM-MMLALIAQFWVAIAPIGGGGKLSAQSFFENYLAM 598

Query: 507 PVYLICYVGYKVVYR--TKLIKPEDVDLYTFKDAID 540
           P+ +  Y+ +KV     +  I    VDL + ++  D
Sbjct: 599 PILIALYIFFKVWKNDWSLFIPANKVDLVSHRNIFD 634

>NDAI0A05620 Chr1 (1268907..1270622) [1716 bp, 571 aa] {ON} 
          Length = 571

 Score =  209 bits (531), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 143/511 (27%), Positives = 231/511 (45%), Gaps = 19/511 (3%)

Query: 31  EGQVRSVSEGVDGKHEGIRLKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILI 90
           E +   + +G         LKK +++RHV M                       P S++I
Sbjct: 34  ELEENDLEDGTRSIVTKTHLKKAMKSRHVVMMSIGTGIGTGLLVANAKGLYFSGPASLII 93

Query: 91  SYSFVGLLVYTVMSCLGEMAAFIP-LDG-FTSYASRYVDPAVGFAVGYSYLFKYFIVTPN 148
            Y  V  + Y ++   GEMA   P L G F SY S ++    GFA  + +  ++  V P 
Sbjct: 94  GYVLVSFVTYFMIQAAGEMAVAYPTLPGSFNSYTSTFISKPFGFATVWLFFIQWLTVFPL 153

Query: 149 QLTAGAMVMQFWVSRDRVNPGVWITIFLALIVLINTVGVRFFGEFEFWLSSVKXXXXXXX 208
           +L   ++ +++W   D++N  V+I IF A ++ I+  GV+ +GE EF  +S K       
Sbjct: 154 ELITASLTVKYW--NDKINADVFIIIFYAFLLFIHFFGVKAYGETEFIFNSCKVLMVAGF 211

Query: 209 XXXXXXXXXXXXPNHDRTGFRFWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGT 268
                             G ++W DPG+F      I+  KG               Y G 
Sbjct: 212 IILSIVINCGGAGTDGYIGAKYWHDPGSFAD-GPPITRFKG----VCFILVSAYFSYGGA 266

Query: 269 ELCGIVAAEAKNPRRSVPRAIKLTLYRIVVFYVITILLLGMTVAYNDPRLLXXXXXXXXX 328
           EL  +   E +NPR+S P A K ++YRI++ Y+ T++L+G  V +N   L+         
Sbjct: 267 ELFSLSVNEQENPRKSTPAAAKQSIYRILIIYLATMILIGFNVPHNSDELMGAGSAATHA 326

Query: 329 XXXPFVVAIENASIPVLPHIFNVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPRIFATT 388
              P+V+A    S+ V+PH  N  +L+ V S  NS LY A R +  LA  G AP+     
Sbjct: 327 S--PYVLAASLHSVKVVPHFINAVILISVISVANSALYAAPRLMCSLAEQGYAPKFLNYV 384

Query: 389 NKWGVPYYSLGLSVLFCLLAYMNVSSGSAQVFNYFVNVVSIFGLLSWITILITYIRFDKA 448
           ++ G P   L L  LF ++ +++ SS   +VF +   +  +  L +W  I++++IRF +A
Sbjct: 385 DREGRPLRGLILCALFGVIGFVSASSKEEEVFTWLAAIAGLSELFTWSGIMLSHIRFRQA 444

Query: 449 IRVQFGDKSSLSYTAAFQPWSTYVALFFCCLIGLIKNYTVFL-----GHKFDYKTFISGY 503
           ++        + + A    W +Y    F  L+  I  + V L     G K D + F   Y
Sbjct: 445 MKFNGKSTDEIGFKAVTGIWGSYYGCAFNILV-FIAQFWVALSPPGSGGKCDAEAFFQSY 503

Query: 504 IGIPVYLICYVGYKVVYR--TKLIKPEDVDL 532
           +  P++L+ Y GY +  R  T L   E +DL
Sbjct: 504 LAAPIWLVFYFGYMIYKRDFTILNPLEKIDL 534

>Suva_16.18 Chr16 (17108..18859) [1752 bp, 583 aa] {ON} YLL061W
           (REAL)
          Length = 583

 Score =  209 bits (531), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 156/540 (28%), Positives = 244/540 (45%), Gaps = 40/540 (7%)

Query: 5   TSMEKKNAGVLYSNETLEEGIVTLESEGQVRSVSEGVDGKHEGIRLKKELEARHVSMXXX 64
            S ++K+A V+      +EG++  E      S  E V         KK L+ RH++M   
Sbjct: 35  NSFKRKDASVI------QEGLLYSE-----LSEEEKVQWDLANQPYKKVLDQRHLTMIAI 83

Query: 65  XXXXXXXXXXXXXXXXXXXXPVSILISYSFVGLLVYTVMSCLGEMAAFIPLDG-FTSYAS 123
                               P S+LI +  VG  +  V+ C  E++   P+ G +  +AS
Sbjct: 84  GGTLGTGLFIGLGESLASG-PASLLIGFLLVGASMLCVVQCGAELSCQYPVSGSYALHAS 142

Query: 124 RYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVNPGVWITIFLALIVLIN 183
           R++DP+ GF+VG +YL  + I  P++L   ++ M +W     VNP VW+ I   L +L+N
Sbjct: 143 RFIDPSAGFSVGINYLLMWLISFPSELVGCSLTMTYWAPS--VNPAVWVAIAFTLSMLLN 200

Query: 184 TVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDR-TGFRFWRDPGAFKPYSE 242
             G R F E EF++S  K                   P      G ++W DPG+F P + 
Sbjct: 201 LFGARGFAESEFYMSIFKIVALFIFIIIGIILIAGGGPESTGYIGTKYWYDPGSFAPPA- 259

Query: 243 AISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVVFYVI 302
                                 ++GTE+  + +AEA++   SV RA K T +RI VFY++
Sbjct: 260 --------FKNFCNTFVSAAYSFSGTEMVVLTSAEARDVS-SVSRAAKGTFWRIAVFYIV 310

Query: 303 TILLLGMTVAYNDPRLLXXXXXXXXXXXXPFVVAIEN--ASIPVLPHIFNVCVLVFVFSA 360
           T++++G  V YNDPRL+            PFV+A+ N  A    +    N  +L+ VFS 
Sbjct: 311 TVIIIGCLVPYNDPRLINGSSSEDITAS-PFVIALSNTGAMGTRVSQFMNAVILIAVFSV 369

Query: 361 CNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCLLAYMNVSSGSAQVF 420
           CNS +Y +SR + GLA  G+ P+I    ++ G P   + +   F LL ++ VS     VF
Sbjct: 370 CNSCVYASSRLIQGLATAGQLPKICGYMDRNGRPLVGMAICGAFGLLGFLVVSKDQGTVF 429

Query: 421 NYFVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLSYTAAFQPWSTYVALFFCCL- 479
            +   + SI    +W  I    IRF  A++ Q      + Y +   P   Y  +  C L 
Sbjct: 430 TWLFALCSISFFTTWFCICFCQIRFRMAMKAQGKPDDDIIYKS---PLGIYGGVVGCTLN 486

Query: 480 ----IGLIKNYTVFLGHKFDYKTFISGYIGIPVYLICYVGYKVV---YRTKLIKPEDVDL 532
               IG I      +G       F    + IP+ +  Y+G+++    +R   IK ED+DL
Sbjct: 487 VLLVIGEIYVSAAPVGMPSSAANFFEYCMSIPIMIAVYIGHRIYRRDWRHWYIKREDIDL 546

>KNAG0L00110 Chr12 complement(8543..10258) [1716 bp, 571 aa] {ON}
           YFL055W
          Length = 571

 Score =  208 bits (530), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 145/527 (27%), Positives = 239/527 (45%), Gaps = 29/527 (5%)

Query: 15  LYSNETLEEGIVTLESEGQVRSVSEGVDGKHEGIR--LKKELEARHVSMXXXXXXXXXXX 72
           +YS  ++ EG+ +LES      +          IR  LK++L  RH++M           
Sbjct: 37  VYSTHSVLEGVHSLES------IESASFDPESNIREDLKRDLSPRHINMISIAGVIGTGL 90

Query: 73  XXXXXXXXXXXXPVSILISYSFVGLLVYTVMSCLGEMAAFIPLDG-FTSYASRYVDPAVG 131
                       P S+ ++YS  G +VY  M CLGEM+ ++P+ G F SYA ++   +  
Sbjct: 91  YLSTSKSLHVGGPASLFMNYSIFGGVVYLTMMCLGEMSTYMPISGSFCSYAKKFGSESFA 150

Query: 132 FAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVNPGVWIT--IFLALIVLINTVGVRF 189
            A+ ++Y F   +   + LTA  +V+ +W ++D   P  W    +F   ++L+N + VR 
Sbjct: 151 CALMWNYWFNDAVSVASDLTALQLVLDYWKTKDHHFP-YWAASLLFWVFVLLLNVISVRL 209

Query: 190 FGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGFRFWRDPGAFKPYSEAISGSKG 249
           +GE E+WL+ +K                   P H   GF  W    A  P+   ++G KG
Sbjct: 210 YGEAEYWLALLKVIAIIIFFILSIVVNVGHNPEHKYIGFHNWNHGDA--PF---VNGFKG 264

Query: 250 KXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVVFYVITILLLGM 309
                          Y GTE   +   EA NP R+ P+ IK   +RI++FYV +   + M
Sbjct: 265 ----FASLFVSASFAYGGTESITLTNGEATNPVRNTPKVIKTVFWRILIFYVFSAFFIAM 320

Query: 310 TVAYNDPRLLXXXXXXXXXXXXPFVVAIENASIPVLPHIFNVCVLVFVFSACNSDLYVAS 369
            V Y+ P L             PF +  + A         N  ++  V SACN  L+  S
Sbjct: 321 NVPYDYPGL-----ATKSVMTSPFTIVFQMAGSKGAGSFMNAVIMTSVISACNHALFAGS 375

Query: 370 RSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCLLAYMNVSSGSAQVFNYFVNVVSI 429
           R +Y +++DG  P+    TN++  PY ++ ++     L +     G+  V+ +  N+V +
Sbjct: 376 RVMYNMSLDGYLPKWVTKTNRYKAPYVAVAITWAVGGLCFGASFIGAGTVWIWLQNIVGV 435

Query: 430 FGLLSWITILITYIRFDKAIRVQFGDKSSLSYTAAFQPWSTYVALFFCCLIGLIKNYTVF 489
              ++W+ I IT IRF + + +Q G    L +     PW  Y  + F   + LI+ ++ F
Sbjct: 436 SNQIAWLCIAITSIRFRRGLELQ-GKTHELKFKNWTYPWGPYFLVVFVSFVILIQGWSAF 494

Query: 490 LGHKFDYKTFISGYIGIPVYLICYVGYKVVYRTKLIKPEDVDLYTFK 536
               +    F S Y+ + V+  CY+ + +  R K IK ED+D  T K
Sbjct: 495 --DPWSTSNFFSVYLELFVFPACYLIWWLYKRDKFIKYEDMDFVTDK 539

>Smik_13.1 Chr13 (1838..3409) [1572 bp, 523 aa] {ON} YFL055W (REAL)
          Length = 523

 Score =  207 bits (526), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 139/467 (29%), Positives = 216/467 (46%), Gaps = 19/467 (4%)

Query: 50  LKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILISYSFVGLLVYTVMSCLGEM 109
           +K+ L+ RH+S+                       P+++L+ +  +G++ + VM  +GEM
Sbjct: 32  VKRALKNRHISLLALGGIIGPGCLVGAGNALQKGGPLALLLGFVIIGIIAFAVMESIGEM 91

Query: 110 AAFIPLDG-FTSYASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVNP 168
               P  G FT+ A R+   A+    GY+Y+  +F V  N+    + ++QFW    +V  
Sbjct: 92  ITLYPSGGGFTTLARRFHSDALSAVCGYAYVIVFFAVLANEYNTLSSILQFW--GPQVPL 149

Query: 169 GVWITIFLALIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGF 228
             +  IF  +  +   +GV  FGE E+WLS +K                    N    GF
Sbjct: 150 YAYTLIFWIVFEIFQLIGVGVFGETEYWLSLLKILGLIVYYIFSIIYMSGGVRNKPAFGF 209

Query: 229 RFWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPRA 288
            +W+DPG+         G KG               Y+GTE   + A E+KNP +SVP A
Sbjct: 210 HYWKDPGSLS------HGFKG----IAVVFVFCSSFYSGTESVALTATESKNPTKSVPYA 259

Query: 289 IKLTLYRIVVFYVITILLLGMTVAYNDPRLLXXXXXXXXXXXXPFVVAIENASIPVLPHI 348
           ++ TL+RIVV Y+   +  G TV +NDP L             P  +AI  A      H+
Sbjct: 260 VRQTLWRIVVVYIGIAIFYGSTVPFNDPNL----SVNTKVLKSPIAIAISRAGWAGGSHL 315

Query: 349 FNVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCLLA 408
            N  +L    SA N  LY+ SR+L  LA +G AP+  A T+K GVP  ++ +     L++
Sbjct: 316 VNAFILFSCISAINGSLYIGSRTLTNLAYEGLAPKFLAWTDKRGVPIPAITIFNALGLIS 375

Query: 409 YMNVSSGSAQVFNYFVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLSYTAAFQPW 468
            MN+S G++  ++Y VN+  +   + W  I  T++R  KA   Q      L Y A F PW
Sbjct: 376 LMNMSVGASNAYSYIVNLSGVGVFIVWGVISYTHLRLRKAWVAQGRLLEELPYKALFYPW 435

Query: 469 STYVALFFCCLIGLIKNYTVFLGHKFDYKTFISGYIGIPVYLICYVG 515
           +   +L     + LI+ +T  +   F    F+  YI +P  +I YVG
Sbjct: 436 TPIFSLISNIFLALIQGWTSLV--PFKAPEFVDAYILLPAAIILYVG 480

>YLL061W Chr12 (17956..19707) [1752 bp, 583 aa] {ON}
           MMP1High-affinity S-methylmethionine permease, required
           for utilization of S-methylmethionine as a sulfur
           source; has similarity to S-adenosylmethionine permease
           Sam3p
          Length = 583

 Score =  208 bits (530), Expect = 4e-59,   Method: Compositional matrix adjust.
 Identities = 145/497 (29%), Positives = 234/497 (47%), Gaps = 35/497 (7%)

Query: 51  KKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILISYSFVGLLVYTVMSCLGEMA 110
           KK L+ RH++M                       P S+LI +  VG  +  V+ C  E++
Sbjct: 70  KKVLDQRHLTMIAIGGTLGTGLFIGLGESLASG-PASLLIGFLLVGASMLCVVQCGAELS 128

Query: 111 AFIPLDG-FTSYASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVNPG 169
              P+ G +  +ASR++DP+VGF++G +YL  + I  P++L   ++ + +W     VNP 
Sbjct: 129 CQYPVSGSYALHASRFIDPSVGFSIGINYLLMWLISYPSELVGCSLTISYWA--PSVNPA 186

Query: 170 VWITIFLALIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGF- 228
            W+ I   L +L+N  G R F E EF++S  K                   P  D TG+ 
Sbjct: 187 AWVAIAFVLSMLLNLFGARGFAESEFYMSIFKIVALFIFIIIGIVLIAGGGP--DSTGYI 244

Query: 229 --RFWRDPGAFK-PYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSV 285
             ++W DPG+F  P  + +  +                 ++GTE+  + + EA++   SV
Sbjct: 245 GTKYWHDPGSFAVPVFKNLCNT----------FVSAAYSFSGTEMVVLTSTEARSVS-SV 293

Query: 286 PRAIKLTLYRIVVFYVITILLLGMTVAYNDPRLLXXXXXXXXXXXXPFVVAIEN--ASIP 343
            RA K T +RI++FY++T++++G  V YNDPRL+            PFV+A+ N  A   
Sbjct: 294 SRAAKGTFWRIIIFYIVTVIIIGCLVPYNDPRLISGSSSEDITAS-PFVIALSNTGAMGT 352

Query: 344 VLPHIFNVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVL 403
            + H  N  +L+ VFS CNS +Y +SR + GLA  G+ P+I A  ++ G P   + +   
Sbjct: 353 RVSHFMNAVILIAVFSVCNSCVYASSRLIQGLATAGQLPKICAYMDRNGRPLVGMAICGA 412

Query: 404 FCLLAYMNVSSGSAQVFNYFVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLSYTA 463
           F LL ++ VS     VF +   + SI    +W  I    +RF  A++ Q   K  + Y +
Sbjct: 413 FGLLGFLVVSKNQGTVFTWLFALCSISFFTTWFCICFCQVRFRMAMKAQGRSKDDIIYRS 472

Query: 464 AFQPWSTYVALFFCCL-----IGLIKNYTVFLGHKFDYKTFISGYIGIPVYLICYVGYKV 518
                  Y  +F C L     IG I      +G       F    + IP+ +  Y+G+++
Sbjct: 473 TL---GIYGGIFGCILNVLLVIGEIYVSAAPVGSPSSAANFFEYCMSIPIMIAVYIGHRI 529

Query: 519 V---YRTKLIKPEDVDL 532
               +R   IK  D+DL
Sbjct: 530 YRRDWRHWYIKRMDIDL 546

>AFR698C Chr6 complement(1726387..1728216) [1830 bp, 609 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR508C
           (GNP1) and YCL025C (AGP1)
          Length = 609

 Score =  209 bits (531), Expect = 4e-59,   Method: Compositional matrix adjust.
 Identities = 139/510 (27%), Positives = 239/510 (46%), Gaps = 22/510 (4%)

Query: 42  DGKHEGIRLKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILISYSFVGLLVYT 101
           + KHE   LK+ +++RH+ M                       P    I +  +GL VY 
Sbjct: 84  NAKHE--NLKQTIKSRHMIMISLGTGIGTGLLVGSGTALHDGGPAGSAIGFLIMGLCVYC 141

Query: 102 VMSCLGEMA-AFIPL-DGFTSYASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQF 159
           V+   GE+A  +  L  GF +Y S  +DPA+GFA  + Y  ++  V P +L   ++ ++F
Sbjct: 142 VIQAAGELAVCYTSLAGGFNAYPSFLIDPALGFATAWVYCLQWLCVFPLELVTASITIKF 201

Query: 160 WVSRDRVNPGVWITIFLALIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXX 219
           W     VNP +++ IF  LI++IN  G R + E EF+ +S K                  
Sbjct: 202 WPGSRSVNPDIYVAIFYVLIIVINFFGARGYAEAEFFFNSCKVLMMIGFFIVGILINTGA 261

Query: 220 XPNHDRTGFRFWRDPGAF--KPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAE 277
                  G ++WRDPG+   + + +   G                     +E   + AAE
Sbjct: 262 VGTSGYIGGKYWRDPGSLGGRTHFDHFKG-------IVATLVNAAFSLGCSEFVALTAAE 314

Query: 278 AKNPRRSVPRAIKLTLYRIVVFYVITILLLGMTVAYNDPRLLXXXXXXXXXXXXPFVVAI 337
             NPR+S+P A K  +Y+I V ++ +++L+G  V  +   L+            P+V+A+
Sbjct: 315 QANPRKSIPAAAKKMIYKIFVVFLGSVILIGFLVPKDSHELMGSNDSDLHVS--PYVIAV 372

Query: 338 ENASIPVLPHIFNVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYS 397
               + V+P   N  +L+ V S  NS  Y +SR L+ LA    AP+IF   ++ G P  +
Sbjct: 373 RMHGVNVVPSFINAVILLSVLSVGNSAFYSSSRLLHSLAEQNYAPKIFKYIDRAGRPLMA 432

Query: 398 LGLSVLFCLLAYMNVSSGSAQVFNYFVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKS 457
           + +S+LF  + ++  S    +VF + + +  +  L +W TI +++IRF +A+ VQ     
Sbjct: 433 MIISILFGTICFVAASPKEEEVFKWLLAISGLSQLFTWSTICLSHIRFRRALAVQGYSTD 492

Query: 458 SLSYTAAFQPWSTYVALFFCCLIGLIKNYTVFL----GHKFDYKTFISGYIGIPVYLICY 513
            L + A      +YV+     L  LI  + V L      + D ++F +GY+ +P++L+ Y
Sbjct: 493 ELGFKAQTGIIGSYVSAIMMVL-ALIGQFWVSLVPMGATEPDAESFFTGYLAMPMFLLFY 551

Query: 514 VGYKVVYRT--KLIKPEDVDLYTFKDAIDA 541
            GYK+  +     I+ + +DL + +   DA
Sbjct: 552 FGYKIWNKDWRLFIRADQIDLVSHRRIFDA 581

>KLLA0C01606g Chr3 complement(123485..125347) [1863 bp, 620 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn expression is
           fully dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p-Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 620

 Score =  209 bits (531), Expect = 4e-59,   Method: Compositional matrix adjust.
 Identities = 136/507 (26%), Positives = 234/507 (46%), Gaps = 23/507 (4%)

Query: 45  HEGIRLKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILISYSFVGLLVYTVMS 104
            +G  LK++++ RHV M                       P  + I Y+ +G  +Y+++ 
Sbjct: 97  EKGASLKRDIKPRHVVMMSLATGIGTGLLVGNGKALATGGPAGLTIGYAIMGSCLYSIIQ 156

Query: 105 CLGEMAAFIP-LDG-FTSYASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVS 162
             GE+A   P L G F +Y S  VDPA+ FA    Y  ++  V P ++ + A+ +++W  
Sbjct: 157 AAGELAVAYPTLTGNFNNYPSFLVDPAMCFATAALYCIQWLCVFPLEVISAAITIKYW-- 214

Query: 163 RDRVNPGVWITIFLALIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPN 222
              +NP VW  IF  +I+ IN  G   + E +F+ ++ K                    +
Sbjct: 215 NTSINPNVWCVIFYVMIIGINMCGSAGYAEADFFFNTCKILMFAGFFILGIIINCGGAGD 274

Query: 223 HDRTGFRFWRDPGAFKPYSEAISGSKG--KXXXXXXXXXXXXXXYTGTELCGIVAAEAKN 280
               G ++W DPGAF       +G  G  +              +  +E   + A+E  N
Sbjct: 275 SVYIGGKYWNDPGAF-------NGDTGISRFKAIVSTLVTAAFAFGASEAVALTASEQAN 327

Query: 281 PRRSVPRAIKLTLYRIVVFYVITILLLGMTVAYNDPRLLXXXXXXXXXXXXPFVVAIENA 340
           PR+++P A K  LYRI+  Y+ +I+L+G  V YN P L+            P+V+A+ + 
Sbjct: 328 PRKAIPSAAKQVLYRIIAIYLASIILVGFLVPYNSPELMGSGSSSVHSS--PYVIAVASH 385

Query: 341 SIPVLPHIFNVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGL 400
            + V+P   N  +L+ V S  N   Y +SR L  L+  G AP+ F   ++ G P Y++ +
Sbjct: 386 GVKVVPSFINAVILISVLSVGNFSFYSSSRILLCLSEIGYAPKFFQYVDRQGRPLYAMIV 445

Query: 401 SVLFCLLAYMNVSSGSAQVFNYFVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLS 460
             L   + +++ SS    VF + + V  +  L +W  I I+++RF KA++VQ      L 
Sbjct: 446 GALVGCICFVSASSAEESVFTWLMAVSGLSQLFTWTNICISHVRFRKAMQVQNRSIGELG 505

Query: 461 YTAAFQPWSTYVALFFCCLIGLIKNYTVFL-----GHKFDYKTFISGYIGIPVYLICYVG 515
           + +    W +Y  +F   L+  I  + V L         D + F + Y+ +PV+L  Y G
Sbjct: 506 FRSQVGVWGSYYGIFMMILV-FIGQFWVALFPVGGTDGADAENFFANYLAMPVFLALYFG 564

Query: 516 YKVVYRT-KLIKP-EDVDLYTFKDAID 540
           +K+  +  +L  P  ++DL + +   D
Sbjct: 565 FKIWKKDWRLYIPASEIDLISHRKIFD 591

>TDEL0F02830 Chr6 complement(513358..515043) [1686 bp, 561 aa] {ON} 
          Length = 561

 Score =  207 bits (528), Expect = 4e-59,   Method: Compositional matrix adjust.
 Identities = 145/546 (26%), Positives = 251/546 (45%), Gaps = 32/546 (5%)

Query: 1   MNSDTSMEKKNAGVLYS--NETLEEGIVTLESEGQVRSVSEGVDG--KHEGIR--LKKEL 54
           ++S  S + ++ G+L +   +     +V       + S+S+ V     H+ IR  L + L
Sbjct: 2   VSSKQSFDSRDTGLLKNVVKDPKSAPVVQNYEVTPLDSISDAVTDLEDHDKIRESLNRSL 61

Query: 55  EARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILISYSFVGLLVYTVMSCLGEMAAFIP 114
             RH++M                       P S+ I+Y+ +G +VY  M CLGEM+ F+P
Sbjct: 62  SPRHINMISVAGVIGTGLYLSTAKSLHVGGPGSLFINYTIMGGVVYLTMLCLGEMSTFMP 121

Query: 115 LDG-FTSYASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVNPGVWIT 173
           + G F SYA ++   +  FA+  +Y F   +   + LTA  +V+ +W S     P  W  
Sbjct: 122 ISGSFCSYAKKFGCESFAFALMCNYWFNDAVSVASDLTALQLVLDYWKSSQHNFP-YWAA 180

Query: 174 --IFLALIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGFRFW 231
             +F   ++ +N + VR +GE E+WL+ +K                   P+H+  GF++W
Sbjct: 181 SLLFWVFLLGLNVIHVRVYGEAEYWLALLKVIAIVIFFILAIVVNVGHNPDHEYIGFKYW 240

Query: 232 RDPGAFKPYSEA--ISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPRAI 289
                   Y EA  ++G KG               Y GTE   + A EA+NP R+ PR +
Sbjct: 241 S-------YKEAPFVNGFKG----FVTIFVSSAFSYGGTESITLTAGEARNPIRNTPRIV 289

Query: 290 KLTLYRIVVFYVITILLLGMTVAYNDPRLLXXXXXXXXXXXXPFVVAIENASIPVLPHIF 349
           K   +RI++FYV T+  + M + Y+ P L             PF +  + A         
Sbjct: 290 KTVFWRILIFYVATMFFISMNIPYDYPNL-----STKSVMTSPFTIIFQMAGTKAAGSFM 344

Query: 350 NVCVLVFVFSACNSDLYVASRSLYGLAIDGKA-PRIFATTNKWGVPYYSLGLSVLFCLLA 408
           N  +L  + SA N  L+  SR LY + ++G   P++   TN++  PY ++ L+     L 
Sbjct: 345 NAVILTSIVSAGNHALFAGSRVLYNMGLEGFVFPKLITKTNRYRAPYVAVILTWAVGGLC 404

Query: 409 YMNVSSGSAQVFNYFVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLSYTAAFQPW 468
           +     G+  ++ +  N+V +   ++W++I +T IRF K +  Q G    L +     P+
Sbjct: 405 FGASFIGAGTLWTWLQNIVGVSNQVAWLSIAVTSIRFRKGLAQQ-GKTQELQFKNWTYPY 463

Query: 469 STYVALFFCCLIGLIKNYTVFLGHKFDYKTFISGYIGIPVYLICYVGYKVVYRTKLIKPE 528
             Y  + F  LI L++ ++ F    +    F S Y+ + V+  C++ + +  R + +KPE
Sbjct: 464 GPYFLVIFVTLIILVQGWSAF--DPWSTSDFFSYYLELFVFPTCWLIWWIFKRDRFVKPE 521

Query: 529 DVDLYT 534
           D+D  T
Sbjct: 522 DMDFIT 527

>TDEL0C06510 Chr3 (1196039..1197967) [1929 bp, 642 aa] {ON} Anc_1.50
           YDR508C
          Length = 642

 Score =  209 bits (532), Expect = 5e-59,   Method: Compositional matrix adjust.
 Identities = 146/520 (28%), Positives = 247/520 (47%), Gaps = 19/520 (3%)

Query: 29  ESEGQVRSVSEGVDGKHEGIRLKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSI 88
           +  G   SV E ++GK +   LKK ++ RHV M                       P  +
Sbjct: 105 KKSGDSGSVDE-LEGKTKEEHLKKSIKPRHVVMISLGTGIGTGLLVGNAKALNDAGPAGL 163

Query: 89  LISYSFVGLLVYTVMSCLGEMAAFIP--LDGFTSYASRYVDPAVGFAVGYSYLFKYFIVT 146
            I Y+ +G  +Y ++   GEMA      + GF +Y S  V P +GFAV + Y  ++  V 
Sbjct: 164 AIGYAIMGSCIYCIIQAAGEMAVTYSNLVGGFNAYPSFLVSPKLGFAVAWVYWLQWACVC 223

Query: 147 PNQLTAGAMVMQFWVSRDRVNPGVWITIFLALIVLINTVGVRFFGEFEFWLSSVKXXXXX 206
           P +L   +M +++W ++  VNP V++ IF  LI++IN  G R + E EF+ +  K     
Sbjct: 224 PLELVTASMTIKYWTTK--VNPDVFVVIFYFLIIVINVFGARGYAEAEFFFNCCKVLMIT 281

Query: 207 XXXXXXXXXXXXXXPNHDRTGFRFWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYT 266
                          N    G ++W DPGAF+   +AI   KG               + 
Sbjct: 282 GFFILGIIINCGGAGNDGYIGGKYWHDPGAFRG-DKAIDRFKG----VAATLVTAAFAFG 336

Query: 267 GTELCGIVAAEAKNPRRSVPRAIKLTLYRIVVFYVITILLLGMTVAYNDPRLLXXXXXXX 326
           G+E   + A+E  NPR+++P A K  LYRI++ ++ +I+++G  V +N  +L+       
Sbjct: 337 GSEFIALTASEQSNPRKAIPAAAKKILYRIIIIFLGSIIMVGFLVPWNSDQLMGSDSSKT 396

Query: 327 XXXXXPFVVAIENASIPVLPHIFNVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPRIFA 386
                P+V+AI +  + V+PH  N  +L+ V S  NS  Y +SR L  L+  G AP+ F 
Sbjct: 397 KAS--PYVIAISSHGVRVVPHFVNAVILLSVLSVGNSAFYSSSRILISLSQQGYAPKFFN 454

Query: 387 TTNKWGVPYYSLGLSVLFCLLAYMNVSSGSAQVFNYFVNVVSIFGLLSWITILITYIRFD 446
             ++ G P  ++ +  LF ++A+   SS    VF + + +  +  + +W  I +++IRF 
Sbjct: 455 YIDREGRPARAMVIGALFAVIAFCAASSKEEDVFTWLLAISGLSQIFTWAAICLSHIRFR 514

Query: 447 KAIRVQFGDKSSLSYTAAFQPWSTYVALFFCCLIGLIKNYTVFLG----HKFDYKTFISG 502
           +A+ VQ      + + +    W +Y A     L+ LI  + V L     +K D ++F   
Sbjct: 515 RAMHVQGRSLGEIGFKSELGVWGSYYAAGMMFLV-LIAQFWVGLAPIGMNKLDAQSFFES 573

Query: 503 YIGIPVYLICYVGYKVVYR--TKLIKPEDVDLYTFKDAID 540
           Y+ + + +  YVGY    +  T  I+ +D+DL   +   D
Sbjct: 574 YLAMLMLIAFYVGYMFWKKDWTLFIRAKDIDLDHHRQIFD 613

>KAFR0D00520 Chr4 complement(82977..84773) [1797 bp, 598 aa] {ON}
           Anc_1.50 YDR508C
          Length = 598

 Score =  208 bits (530), Expect = 5e-59,   Method: Compositional matrix adjust.
 Identities = 139/501 (27%), Positives = 232/501 (46%), Gaps = 19/501 (3%)

Query: 49  RLKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILISYSFVGLLVYTVMSCLGE 108
           +L+K ++ RHV M                       P  +LI Y  +   +Y ++   GE
Sbjct: 79  QLQKTIQPRHVIMISLGTGIGTGLLVGNGATLHNAGPAGLLIGYIIMASCIYCIIQACGE 138

Query: 109 MAA--FIPLDGFTSYASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRV 166
           MA      + GF +Y S  VD A  FAV + Y  ++  V P +L   +M +++W   ++V
Sbjct: 139 MAVNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYW--NEKV 196

Query: 167 NPGVWITIFLALIVLINTVG-VRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDR 225
           +P V++TIF  LI+ IN  G  R + E EF+ +  K                        
Sbjct: 197 DPDVFVTIFYLLIIAINLFGGARGYAEAEFFFNLCKILMIAGFFILGIILICGGAGTSGY 256

Query: 226 TGFRFWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSV 285
            G  +W +PGAF+ ++    G++ K              +  TE   I A+E  NPR+++
Sbjct: 257 IGVSYWNNPGAFRGHTP---GTRFKGIVSTLVTAAFS--FGQTEFLAITASEQSNPRKAI 311

Query: 286 PRAIKLTLYRIVVFYVITILLLGMTVAYNDPRLLXXXXXXXXXXXXPFVVAIENASIPVL 345
           P A K  +YR +  YV +I+++G  V YN P LL            P+V+A+ +  I + 
Sbjct: 312 PSAAKKVIYRALFIYVGSIIIVGFLVPYNSPELLGSKSSQTKAS--PYVIAVASHGIRIA 369

Query: 346 PHIFNVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFC 405
           PH  N  +L+ V S  NS  Y +SR L  LA  G AP+IF   ++ G P + +  + L  
Sbjct: 370 PHFINAVILISVLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASLLA 429

Query: 406 LLAYMNVSSGSAQVFNYFVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLSYTAAF 465
            +A+   S    +VF++ + +  +  + +W TI +++IRF +A+++Q    + L Y +  
Sbjct: 430 TIAFCASSPKETEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELGYKSQV 489

Query: 466 QPWSTYVALFFCCLIGLIKNYTVFL----GHKFDYKTFISGYIGIPVYLICYVGYKVVYR 521
             W +  A     LI LI  + V L     +  +   F   Y+ +P+ L+ Y GYK   +
Sbjct: 490 GVWGSIYAATVMFLI-LIGQFWVALWPLNSNGANITNFFKEYLAMPILLLFYFGYKTWKK 548

Query: 522 --TKLIKPEDVDLYTFKDAID 540
                I+ +D+DL + +   D
Sbjct: 549 DWNLFIRAKDIDLISHRHIYD 569

>KNAG0J02200 Chr10 complement(407267..409090) [1824 bp, 607 aa] {ON}
           
          Length = 607

 Score =  208 bits (530), Expect = 5e-59,   Method: Compositional matrix adjust.
 Identities = 141/546 (25%), Positives = 245/546 (44%), Gaps = 15/546 (2%)

Query: 29  ESEGQVRSVSEGVDGKHEGIRLKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSI 88
           E +  V    +     +    LKK ++ RHV M                       P ++
Sbjct: 70  EVDSDVERNGDAAYSVNTDTHLKKAMKTRHVIMMTLGTGIGTGLLVANAKGLHFGGPAAL 129

Query: 89  LISYSFVGLLVYTVMSCLGEMAAFIP-LDG-FTSYASRYVDPAVGFAVGYSYLFKYFIVT 146
           +I Y  V ++ Y ++   GEMA   P L G F +YAS +V    GFA  + +  ++  V 
Sbjct: 130 VIGYGLVSMVTYIMIQAAGEMAVAYPTLPGNFNTYASIFVSKPFGFATVWLFCIQWLTVL 189

Query: 147 PNQLTAGAMVMQFWVSRDRVNPGVWITIFLALIVLINTVGVRFFGEFEFWLSSVKXXXXX 206
           P +L   ++++++W   ++VN  V++ IF   ++ I+ +GV+ +GE EF  +  K     
Sbjct: 190 PLELITASLIIKYWT--EKVNADVFVVIFYVFLLFIHFIGVKAYGETEFVFNLCKILMIA 247

Query: 207 XXXXXXXXXXXXXXPNHDRTGFRFWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYT 266
                          +    G ++W  PGAF     A + +  +              Y 
Sbjct: 248 GFIIFSIVVNCGGAGHDGYIGGKYWHSPGAF-----AGTNAAERFKGVCYVLVSGYFSYG 302

Query: 267 GTELCGIVAAEAKNPRRSVPRAIKLTLYRIVVFYVITILLLGMTVAYNDPRLLXXXXXXX 326
           GTEL  +   E +NPR+S P A K ++YRI+V Y++T++L+G TV +ND +L+       
Sbjct: 303 GTELYVLSVNEQENPRKSTPIAAKQSIYRILVIYLLTMILIGFTVPFNDDQLMGAGGSAT 362

Query: 327 XXXXXPFVVAIENASIPVLPHIFNVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPRIFA 386
                P+V+A     + V+PHI N  +L+ V S  NS LY A R L  LA  G AP+   
Sbjct: 363 HAS--PYVLAASIHGVRVVPHIINAVILIAVISVANSSLYAAPRLLCSLAEQGYAPKFMT 420

Query: 387 TTNKWGVPYYSLGLSVLFCLLAYMNVSSGSAQVFNYFVNVVSIFGLLSWITILITYIRFD 446
             ++ G P Y+L    +F ++A+   S    QVF +   +  +  L +W +I+++++RF 
Sbjct: 421 YVDREGRPLYALLACAVFGVIAFSACSDQEEQVFTWLAAIAGLSELFTWSSIMLSHVRFR 480

Query: 447 KAIRVQFGDKSSLSYTAAFQPWSTYVALFFCCLIGLIKNYTVFLGHK--FDYKTFISGYI 504
           +A+++Q  D + + Y A    W +   + F  L+ + + +      K     ++F   Y+
Sbjct: 481 QAMKLQGRDLNEVGYIANTGYWGSVYGVVFNILVFIAQFWVALAPPKSPITAQSFFESYL 540

Query: 505 GIPVYLICYVGYKVVYRT-KLIKPED-VDLYTFKDAIDAXXXXXXXXXXXXXXNMENSPK 562
             P+++  Y GY +  +    + P D +DL   +   D                  N   
Sbjct: 541 AFPIWIAFYFGYMIWNKDYTFLNPLDKIDLDHHRRIYDPEVLKQEDMENKERVRNGNIWT 600

Query: 563 NFKWFY 568
             KWF+
Sbjct: 601 KLKWFW 606

>TDEL0E05700 Chr5 complement(1059079..1060833) [1755 bp, 584 aa]
           {ON} 
          Length = 584

 Score =  207 bits (528), Expect = 7e-59,   Method: Compositional matrix adjust.
 Identities = 134/469 (28%), Positives = 230/469 (49%), Gaps = 42/469 (8%)

Query: 85  PVSILISYSFVGLLVYTVMSCLGEMAAFIPLDG-FTSYASRYVDPAVGFAVGYSYLFKYF 143
           P ++LI Y  VG  ++ V+    E+A   P+ G + S+ SR+VD ++GF V  +Y   + 
Sbjct: 104 PAALLIGYLLVGTSMFCVIQSAAELACQFPVSGSYASHVSRFVDESLGFTVATNYTLAWL 163

Query: 144 IVTPNQLTAGAMVMQFWVSRDRVNPGVWITIFLALIVLINTVGVRFFGEFEFWLSSVKXX 203
           ++ P++L   ++ + +W S   +NP VW++IFL  ++ IN  GVR F E EF LS +K  
Sbjct: 164 VLFPSELIGCSLTISYWNSS--INPAVWVSIFLVFVLWINLFGVRIFAETEFILSIIKVL 221

Query: 204 XXXXXXXXXXXXXXXXXPNHDR-TGFRFWRDPGAF-KPYSEAISGSKGKXXXXXXXXXXX 261
                            P+     G ++W DPG F KP  + +  +              
Sbjct: 222 AIIIFIIIGIVLIAGGGPDPGGYIGTKYWHDPGPFAKPVFKNLCQT----------FVAA 271

Query: 262 XXXYTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVVFYVITILLLGMTVAYNDPRLLXX 321
              + GTE+  +   E+KN   S+ RA K T YRI +FYV T++++G  V YNDPRLL  
Sbjct: 272 AFSFGGTEMVLLTGTESKNVS-SIARAAKGTFYRIAIFYVTTVVVIGCLVPYNDPRLLSA 330

Query: 322 XXXXXXXXXXPFVVAIENASI--PVLPHIFNVCVLVFVFSACNSDLYVASRSLYGLAIDG 379
                     PFV+A+ N       + H  N  +LV V S CNS +Y +SR +  L   G
Sbjct: 331 SSSEDISAS-PFVIALSNTGSMGAKVSHFMNAVILVAVVSVCNSTVYASSRLIQALGTAG 389

Query: 380 KAPRIFATTNKWGVPYYSLGLSVLFCLLAYMNVSSGSAQVFNYFVNVVSIFGLLSWITIL 439
           + P+IF   ++ G P   + +S  F LL ++  +   ++VF +   + S+   ++W +I 
Sbjct: 390 QLPKIFGYMDRKGRPLVGIAVSATFGLLGFLVATKKQSEVFTWLFALCSVAAFVTWFSIC 449

Query: 440 ITYIRFDKAIRVQFGDKSSLSYTAAFQPWSTYVALFFCCLIGLIKNYTVFLGHKF----- 494
           +  +R+  A+R +     S++Y +    W          ++G I N+ +  G  +     
Sbjct: 450 LAQVRYRMAMRARKRSLDSIAYKSILGIWGG--------VVGCIVNFLLVAGEVYVSAFP 501

Query: 495 -DYKTFISGY----IGIPVYLICYVGYKVVYRTK----LIKPEDVDLYT 534
            + K+   G+    + IP+ ++ ++G+K ++R       +K +D+DL T
Sbjct: 502 ANAKSSAEGFFKYTLSIPIMIVVFLGHK-IHRNDWGNWYVKRKDMDLDT 549

>AGR038C Chr7 complement(777529..779271) [1743 bp, 580 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR046C
           (BAP3) and YBR068C (BAP2); Tandem gene duplication in
           this genome
          Length = 580

 Score =  207 bits (527), Expect = 9e-59,   Method: Compositional matrix adjust.
 Identities = 142/520 (27%), Positives = 240/520 (46%), Gaps = 18/520 (3%)

Query: 29  ESEGQVRSVSEGVDGKHEGIRLKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSI 88
           E   +   + +G     +  +L++ +  RHV M                       P  +
Sbjct: 42  EDTSRSGDLEDGEINSTDTTKLQQRMRTRHVVMMSLGTGIGTGLLVANAASLHYGGPAGL 101

Query: 89  LISYSFVGLLVYTVMSCLGEMAAFIP-LDG-FTSYASRYVDPAVGFAVGYSYLFKYFIVT 146
           LI Y  V ++ Y +M   GEMA   P L G F +Y+S ++    GFA  + +  ++  V 
Sbjct: 102 LIGYLLVSIVSYIMMHAAGEMAVAYPTLPGNFNAYSSIFISKPFGFATVWLFCLQWLTVF 161

Query: 147 PNQLTAGAMVMQFWVSRDRVNPGVWITIFLALIVLINTVGVRFFGEFEFWLSSVKXXXXX 206
           P +L    +V+++W  +  VN  V++ IF   I+ I+  G R +GE EF  +  K     
Sbjct: 162 PLELITATIVIKYW--KVSVNANVFVVIFYLFIICIHFFGARGYGETEFIFNMCKVLMIV 219

Query: 207 XXXXXXXXXXXXXXPNHDRTGFRFWRDPGAFKPYSEAISGSK-GKXXXXXXXXXXXXXXY 265
                          +    G R+WR+PG+F      +SG+   K              +
Sbjct: 220 GFVIVGILINVGAIGDTGYIGDRYWRNPGSF------VSGTPLDKLKGTAYVLVTAYFSF 273

Query: 266 TGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVVFYVITILLLGMTVAYNDPRLLXXXXXX 325
            G EL  +   E  NP+ ++P A K  +YRI++ Y++T++++G  V ++  RL+      
Sbjct: 274 GGMELYALSVNELPNPKTAIPSACKKGVYRILLVYLLTMIMIGFLVPHDSDRLMGSGSND 333

Query: 326 XXXXXXPFVVAIENASIPVLPHIFNVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPRIF 385
                 P+V+AIE   + VLPHI N  +L+ V S  NS +Y A R L  LA  G AP+  
Sbjct: 334 VHPS--PYVLAIEMHGVKVLPHIVNAVILISVISVGNSAMYSAPRLLCALAQQGYAPKQL 391

Query: 386 ATTNKWGVPYYSLGLSVLFCLLAYMNVSSGSAQVFNYFVNVVSIFGLLSWITILITYIRF 445
              ++ G P  SL L  +F L+A+   S    ++F +   +  +  L +W +I +++ RF
Sbjct: 392 DYIDREGRPLISLILCAIFGLIAFSAASDNQEKIFIWLAAIAGLSELFTWTSICLSHFRF 451

Query: 446 DKAIRVQFGDKSSLSYTAAFQPWSTYVALFFCCLIGLIKNYTVFL---GHKFDYKTFISG 502
            +A+++Q     +L Y A    W +  A+FF  L+ + + +   +     K D  +F   
Sbjct: 452 RQAMKLQGRSLETLGYRAITGQWGSLYAVFFNLLVFIAQFWVALVPIAKKKVDVLSFFQN 511

Query: 503 YIGIPVYLICYVGYKVVYRT-KLIKPED-VDLYTFKDAID 540
           Y+  P++LI ++GY V  R   L+ P D +DL T +   D
Sbjct: 512 YMAFPLWLIMFLGYMVYSRNWTLLNPLDKMDLDTHRRVYD 551

>AGR039C Chr7 complement(779720..781480) [1761 bp, 586 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR046C
           (BAP3) and YBR068C (BAP2); Tandem gene duplication in
           this genome
          Length = 586

 Score =  207 bits (527), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 146/500 (29%), Positives = 231/500 (46%), Gaps = 19/500 (3%)

Query: 50  LKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILISYSFVGLLVYTVMSCLGEM 109
           LK  ++ RH++M                       P  ++I Y     ++Y V+    E+
Sbjct: 68  LKHNIKTRHLTMISLGTGIGTGLLVASGKALHFGGPAGLVIGYVTTSTMLYCVVQACCEL 127

Query: 110 A-AFIPLDG-FTSYASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVN 167
             A+  L G + +Y +  VD   GFAV   Y  ++  V P +L   +M +++W S   VN
Sbjct: 128 GVAYATLPGNYNAYPTFLVDKGFGFAVALVYGLQWATVLPLELVTASMTVKYWTSS--VN 185

Query: 168 PGVWITIFLALIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTG 227
           P V++ IF   ++ I+  G R + E EF  +S+K                         G
Sbjct: 186 PDVFVAIFYVFLLFIHFFGSRGYAEAEFIFNSLKVLLMAGFIIMAISLTAGAS-EQGYIG 244

Query: 228 FRFWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPR 287
            ++W DPGAF     AI   KG               Y G+E   + AAE  NPR SVP+
Sbjct: 245 GQYWHDPGAFGG-DRAIDRFKG----ICSVWVQAAFAYGGSEFIALTAAEQANPRESVPK 299

Query: 288 AIKLTLYRIVVFYVITILLLGMTVAYNDPRLLXXXXXXXXXXXXPFVVAIENASIPVLPH 347
           A K  LYR+VV +++ ++L+G  V +N  +LL            PFV+A     + V+PH
Sbjct: 300 ATKRWLYRVVVVFLLPVILIGFLVPHNSDQLLSAEGGSGSRAS-PFVIAAALHGVRVVPH 358

Query: 348 IFNVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCLL 407
           I N  +L  V S  NS +Y A R L  LA  G  P+IF   ++ G P  +L    LF L+
Sbjct: 359 IINFIILTSVISVGNSAMYSAPRILLSLAEHGMCPKIFTYVDRQGRPLVTLIFVSLFGLI 418

Query: 408 AYMNVSSGSAQVFNYFVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLSYTAAFQP 467
           A++  S+    VF +   +  +  L +W  I ++++RF +A+RVQ      L Y A    
Sbjct: 419 AFVAASNQEENVFTWLSAIAGLSQLFTWTAIAVSHVRFRRAMRVQGRSLGELGYRANTGA 478

Query: 468 WSTYVALFFCCLIGLIKNYTVFLG-----HKFDYKTFISGYIGIPVYLICYVGYKVVYRT 522
             +Y A+FF  ++ LI  + + +       + D + F   Y+  PV ++ Y+GYK+  R 
Sbjct: 479 LGSYYAIFFNVIV-LIAQFWIAIAPIPKHGELDVEFFFQNYLAFPVLVVFYLGYKLWKRD 537

Query: 523 -KLIKP-EDVDLYTFKDAID 540
            +L+ P  +VDL + +   D
Sbjct: 538 FRLVIPSSEVDLLSHRQIFD 557

>CAGL0D02178g Chr4 (222597..224330) [1734 bp, 577 aa] {ON} highly
           similar to uniprot|P38967 Saccharomyces cerevisiae
           YOL020w SCM2 high affinity tryptophan transport protein
          Length = 577

 Score =  207 bits (526), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 150/540 (27%), Positives = 254/540 (47%), Gaps = 33/540 (6%)

Query: 16  YSNETLEEGIVTLESEGQ--VRSVSEGVDGKHEGIRLKKELEARHVSMXXXXXXXXXXXX 73
           YS+    E +VT  +  Q  V S    VDG  +   LK+ L++RH+ M            
Sbjct: 27  YSSGESPEPVVTKRNIFQRCVDSFKPPVDGSFDTSNLKRTLKSRHLIMIAIGGSIGTGLF 86

Query: 74  XXXXXXXXXXXPVSILISYSFVGLLVYTVMSCLGEMAAFIPLDG-FTSYASRYVDPAVGF 132
                      P++++I ++  G  +   +  LGE+    P+ G F  Y++R++DP++ F
Sbjct: 87  IGSGQALATGGPLAVIIGWTIAGSQIVGTIHGLGEITVRFPVVGAFADYSTRFLDPSISF 146

Query: 133 AVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVNPGVWITIFLALIVLINTVGVRFFGE 192
            V   Y+ ++F V P ++ A A+ +Q+W S   ++P VW+ IF  +IV IN  G R FGE
Sbjct: 147 VVSTIYVIQWFFVLPLEIIASAITIQYWNS--SIDPVVWVAIFYGVIVSINLFGARGFGE 204

Query: 193 FEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGFRFWRDPGAFKPYSEAISGSKGKXX 252
            EF  S++K                   P+H+  G ++W DPGA         G  G   
Sbjct: 205 AEFVFSTIKAITICGFIILCIVLICGGGPDHEFIGAKYWHDPGALA------HGFPG--- 255

Query: 253 XXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVVFYVITILLLGMTVA 312
                         GTE+  + + E  +P+  +P AIK   +RI+ F++ ++ L+G  V 
Sbjct: 256 -VLSVLVVASYSLGGTEMTCLASGET-DPKE-LPSAIKQVFWRILFFFLASLTLVGFLVP 312

Query: 313 YNDPRLLXXXXXXXXXXXXPFVVAIENASIPVLPHIFNVCVLVFVFSACNSDLYVASRSL 372
           Y +  LL            PFV+AI+   I  LP I N  +L+ + S  NS ++ +SR+L
Sbjct: 313 YTNENLL----GGSSVDNSPFVIAIKLHHIKALPSIVNAVILISILSVGNSCIFASSRTL 368

Query: 373 YGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCLLAYMNVSSGSAQVFNYFVNVVSIFGL 432
             +A  G  PR F   ++ G P   +  + LF LLA++  SS  ++VF++ + +  +   
Sbjct: 369 CSMAHQGLIPRFFGYIDRAGRPLAGIVTNSLFGLLAFLVKSSSVSEVFDWLMAIAGLATC 428

Query: 433 LSWITILITYIRFDKAIRVQFGDKSSLSYTAAFQPWSTYVALFFCCLIGLIKNYTVF--L 490
           + W++I +++IRF  A++ Q      L + +A   W +  +     LI + + Y     +
Sbjct: 429 IVWLSINLSHIRFRLAMKAQNKTLDELEFVSAVGIWGSAYSALINVLILIAQFYISLWPI 488

Query: 491 GHKFD----YKTFISGYIGIPVYLICYVGYKVVYRTKL-----IKP-EDVDLYTFKDAID 540
           G   D     K F   Y+   + L+ +  +KV YR        +KP +D+DL T +  +D
Sbjct: 489 GGWTDSSQRAKKFFQSYLCALIMLLIFCIHKVYYRVSFGKWWDVKPLKDIDLETGRKNVD 548

>SAKL0C13992g Chr3 complement(1242080..1243738) [1659 bp, 552 aa]
           {ON} similar to uniprot|P43548 Saccharomyces cerevisiae
           YFL055W AGP3 Low-affinity amino acid permease may act to
           supply the cell with amino acids as nitrogen source in
           nitrogen-poor conditions transcription is induced under
           conditions of sulfur limitation
          Length = 552

 Score =  206 bits (524), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 145/490 (29%), Positives = 225/490 (45%), Gaps = 29/490 (5%)

Query: 50  LKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILISYSFVGLLVYTVMSCLGEM 109
           +K+ L+ RH+S+                       P+S+L+ +  +G++ + VM  +GEM
Sbjct: 44  VKRALKNRHISLLALGGIIGPGCLVGAGNALSKGGPLSLLLGFGIIGIVAFAVMESIGEM 103

Query: 110 AAFIPL-DGFTSYASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVNP 168
               P   GF++ + R+   A+    GY+Y+  +F V  N+    + ++QFW       P
Sbjct: 104 ITLYPSGSGFSTLSRRFHSDALSAVSGYAYVVVFFAVLANEYNTLSSILQFW------GP 157

Query: 169 GV----WITIFLALIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHD 224
            V    +I IF     +   +GV  FGEFE+WL+  K                    N  
Sbjct: 158 QVPLYGYILIFSVAFQVFQMLGVGIFGEFEYWLAWFKIIGLIAYYIFSIIYISGGIKNRP 217

Query: 225 RTGFRFWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRS 284
             GF +W +PGA         G KG               Y+GTE   + A E++NP ++
Sbjct: 218 AFGFHYWNNPGALA------DGFKG----IAVVFVFCSSFYSGTESVALAATESRNPGKA 267

Query: 285 VPRAIKLTLYRIVVFYVITILLLGMTVAYNDPRLLXXXXXXXXXXXXPFVVAIENASIPV 344
           VP AIK T +RI++ Y+   +  G TV YND  L             P  +AI  A    
Sbjct: 268 VPIAIKQTFWRIIIVYLGIAVFYGATVPYNDTSL----GAHTKALKSPIAIAITRAGWEG 323

Query: 345 LPHIFNVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLF 404
             H+ N  +L+   SA N  LY+ SR+L  LA +G AP+    T+K GVP  ++ L    
Sbjct: 324 GVHLVNAFILITCVSAINGSLYIGSRTLIYLAHEGLAPKFLKWTDKRGVPIPAITLFNAL 383

Query: 405 CLLAYMNVSSGSAQVFNYFVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLSYTAA 464
            L++ MNVS G++  ++Y VN+  +   + W  I +T++RF KA  +Q    S L Y + 
Sbjct: 384 GLVSLMNVSVGASNAYSYIVNLSGVGVFIVWGIISLTHLRFRKAWDLQGRSASELPYKSL 443

Query: 465 FQPWSTYVALFFCCLIGLIKNYTVFLGHKFDYKTFISGYIGIPVYLICYVGYKVVYRT-- 522
             PW    +L     +GLI+ +T F+   F  K F+  YI +P  +I Y+   +V     
Sbjct: 444 LFPWGPIFSLAANIFLGLIQGWTTFV--PFSAKDFVDAYILLPAAVILYIVISLVKIGGF 501

Query: 523 KLIKPEDVDL 532
           KL+    VDL
Sbjct: 502 KLVDLRTVDL 511

>Kwal_33.13215 s33 complement(123154..124950) [1797 bp, 598 aa] {ON}
           YDR508C (GNP1) - high-affinity glutamine permease
           [contig 121] FULL
          Length = 598

 Score =  207 bits (526), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 149/506 (29%), Positives = 234/506 (46%), Gaps = 20/506 (3%)

Query: 44  KHEGIRLKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILISYSFVGLLVYTVM 103
           KH+   LK+ +  RHV M                       P S++I Y+ V  ++Y V+
Sbjct: 77  KHK--TLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYCVI 134

Query: 104 SCLGEMAAFIP--LDGFTSYASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWV 161
               E+A        GF +Y S  VD A GF+V + Y  ++  V P +L   +M +++W 
Sbjct: 135 QSASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKYW- 193

Query: 162 SRDRVNPGVWITIFLALIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXP 221
               +NP  ++TIF  ++V IN VG   + E EF+ +  K                    
Sbjct: 194 -NQTINPDAFVTIFYVVLVAINFVGAAGYAEAEFFFNCCKVLMIIGFFILGIIINCGGAG 252

Query: 222 NHDRTGFRFWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNP 281
           N    G R+W DPGAF+  S++I+  KG               Y G E   + AAE +NP
Sbjct: 253 NDGYLGARYWHDPGAFRG-SDSINRFKG----IVAVLVNAAFAYGGAEFSVLTAAEQQNP 307

Query: 282 RRSVPRAIKLTLYRIVVFYVITILLLGMTVAYNDPRLLXXXXXXXXXXXXPFVVAIENAS 341
           ++S+  A K  +YRI+  Y++T +LLG  V +N   LL            PFV+A+ +  
Sbjct: 308 QKSIRSASKKLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSATHAS--PFVIAVASHG 365

Query: 342 IPVLPHIFNVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLS 401
           + V+PH  N  +L+ V S  NS LY +SR L  L+  G APR     ++ G P   L +S
Sbjct: 366 VRVVPHFINAVILLSVLSVANSALYSSSRILLSLSEQGFAPRFLNYVDRCGRPVLCLLVS 425

Query: 402 VLFCLLAYMNVSSGSAQVFNYFVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLSY 461
            +F LL+++  S     VF + + +  +  L +W +I ++++R  +A+ VQ      L Y
Sbjct: 426 CVFGLLSFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGY 485

Query: 462 TAAFQPWSTYVALFFCCLIGLIKNYTVFL----GHKFDYKTFISGYIGIPVYLICYVGYK 517
            A    W  Y A+     I L+  + V +     +K D   F   Y+ +P+ +  Y+GYK
Sbjct: 486 VAWTGVWGAYYAMAMIVAI-LVGQFWVAISPVGSNKLDANNFFENYLAMPILIFLYLGYK 544

Query: 518 VVYRT--KLIKPEDVDLYTFKDAIDA 541
           +  R    LI   +VDL   +   DA
Sbjct: 545 IWTRDWRLLIPSSEVDLVAHRKIFDA 570

>Skud_6.2 Chr6 (1506..3182) [1677 bp, 558 aa] {ON} YFL055W (REAL)
          Length = 558

 Score =  206 bits (523), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 156/548 (28%), Positives = 244/548 (44%), Gaps = 40/548 (7%)

Query: 4   DTS-MEKKNAGVLYSNETLEEGIVTLESEGQVRSVSEGVDGKHEGIRLKKELEARHVSMX 62
           DT+ +EK + G   S   L    V +  E  V               +K+ L+ RH+S+ 
Sbjct: 9   DTANVEKTDKGDAKSPSALIIKAVDISEEPDVSKFDPNTG-------VKRALKNRHISLL 61

Query: 63  XXXXXXXXXXXXXXXXXXXXXXPVSILISYSFVGLLVYTVMSCLGEMAAFIPLDG-FTSY 121
                                 P+++L+ +S +G++ + VM  +GE+    P  G FT+ 
Sbjct: 62  ALGGVIGPGCLVGAGNALNKGGPLALLLGFSIIGVIAFAVMESIGEIITLYPSGGGFTTL 121

Query: 122 ASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVNPGV----WITIFLA 177
           A R+   A+    GY+Y+  +F V  N+    + ++QFW       P V    +I IF  
Sbjct: 122 ARRFHGDALSAVCGYAYVVVFFAVLANEYNTLSSILQFW------GPQVPLYGYILIFWF 175

Query: 178 LIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGFRFWRDPGAF 237
              +   +GV  FGE E+WLS  K                    +    GF +W  PG+ 
Sbjct: 176 AFEIFQLIGVSLFGETEYWLSWFKIVGLVAYYIFSIIYISGGIKDRPAFGFHYWNSPGSL 235

Query: 238 KPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIV 297
                   G KG               Y+GTE   + A E+KNP ++VP A++ TL+R++
Sbjct: 236 S------HGFKG----IAVVFVFCSTFYSGTECVALAATESKNPGKAVPLAVRQTLWRVL 285

Query: 298 VFYVITILLLGMTVAYNDPRLLXXXXXXXXXXXXPFVVAIENASIPVLPHIFNVCVLVFV 357
           + Y+   +  G TV ++DP L             P  +AI  A      H+ N  +LV  
Sbjct: 286 IVYIGIAVFYGATVPFDDPNL----SATTKVLKSPISIAISRAGWAGGAHLVNAFILVTC 341

Query: 358 FSACNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCLLAYMNVSSGSA 417
            SA N  LY+ SR+L  LA +G AP+I A T++ GVP  ++ +     L++ MNVS G++
Sbjct: 342 ISAINGSLYIGSRTLTNLAHEGLAPKILAWTDRRGVPIPAITVFNALGLISLMNVSVGAS 401

Query: 418 QVFNYFVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLSYTAAFQPWSTYVALFFC 477
             ++Y VN+  +   + W  I  T++R  KA   Q      L Y A   PW+   +L   
Sbjct: 402 DAYSYIVNLSGVGVFIVWGVISYTHLRVRKAWVTQGRSLEELPYKALLYPWTPIFSLIAN 461

Query: 478 CLIGLIKNYTVFLGHKFDYKTFISGYIGIPVYLICYVGYKVV----YRTKLIKPEDVDLY 533
             + LI+ +T F+   FD   F+  YI +PV ++ YV   V     +R   +K  D+D  
Sbjct: 462 VFLALIQGWTSFV--PFDAGNFVDAYILLPVAIVLYVAICVFKNHHFRIVDLKSVDLDEG 519

Query: 534 TFKDAIDA 541
             KD IDA
Sbjct: 520 RRKD-IDA 526

>Smik_4.284 Chr4 complement(515341..517155) [1815 bp, 604 aa] {ON}
           YBR068C (REAL)
          Length = 604

 Score =  206 bits (525), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 140/535 (26%), Positives = 240/535 (44%), Gaps = 33/535 (6%)

Query: 6   SMEKKNAGVLYSNETLEEGIVTLESEGQVRSVSEGVDGKHEGIRLKKELEARHVSMXXXX 65
           S ++  +  L  +  LE+G  +++S                  RLKK +++RHV M    
Sbjct: 58  SFKRAESQHLEDDNDLEDGTRSMKSNN----------------RLKKSMKSRHVVMMSLG 101

Query: 66  XXXXXXXXXXXXXXXXXXXPVSILISYSFVGLLVYTVMSCLGEMAAFIPL--DGFTSYAS 123
                              P S++I Y  V  + Y ++   GEM    P     F +Y S
Sbjct: 102 TGIGTGLLVANAKGLKLAGPGSLVIGYVMVSFVTYFMVQAAGEMGVTYPTLPGNFNAYNS 161

Query: 124 RYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVNPGVWITIFLALIVLIN 183
            ++  + GFA  + +  ++  V P +L   +M +++W   D++N  V+I IF   ++ I+
Sbjct: 162 IFISKSFGFATTWIFCIQWLTVLPLELITSSMTIKYW--NDKINSDVFIVIFYVFLLFIH 219

Query: 184 TVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGFRFWRDPGAFKPYSEA 243
             GV+ +GE EF  SS K                         G ++WRDPG+F   + A
Sbjct: 220 FFGVKAYGETEFIFSSCKILMIAGFIILSVVINCGGAGVDGYIGGKYWRDPGSFAEGNGA 279

Query: 244 ISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVVFYVIT 303
                 +              + G EL  +   E  NPR+S P A K ++YRI++ Y++T
Sbjct: 280 T-----RFKGICFILVTAYFSFGGIELFVLSINEQSNPRKSTPVAAKRSVYRILIIYLLT 334

Query: 304 ILLLGMTVAYNDPRLLXXXXXXXXXXXXPFVVAIENASIPVLPHIFNVCVLVFVFSACNS 363
           ++L+G  V +N+ +L+            P+V+A     + V+PHI N  +L+ V S  NS
Sbjct: 335 MILIGFNVPHNNDQLMGSGSAATHAS--PYVLAASIHKVRVVPHIINAVILISVISVANS 392

Query: 364 DLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCLLAYMNVSSGSAQVFNYF 423
            LY A R +  LA  G AP+     ++ G P  +L +  L  ++ ++  S    Q F + 
Sbjct: 393 ALYAAPRLMCSLAQQGYAPKFLDYIDREGRPLRALFVCCLVGVIGFVACSPQEEQAFTWL 452

Query: 424 VNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLSYTAAFQPWSTYVALFFCCLIGLI 483
             +  +  L +W  I++++IRF KA++VQ      + Y A    W +Y  +FF  L+ + 
Sbjct: 453 AAIAGLSELFTWSGIMLSHIRFRKAMKVQGRSLDEVGYKANTGIWGSYYGVFFNILVFMA 512

Query: 484 KNYTVFL----GHKFDYKTFISGYIGIPVYLICYVGYKVVYRT-KLIKPED-VDL 532
           + +        G K + + F   Y+  P++L  Y+GY +  R    + P D +DL
Sbjct: 513 QFWVALSPIGNGGKCNAQAFFESYLAAPLWLCMYLGYMLYERDFTFLNPLDKIDL 567

>AER405C Chr5 complement(1413790..1415283) [1494 bp, 497 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YPL274W
           (SAM3)
          Length = 497

 Score =  204 bits (519), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 135/472 (28%), Positives = 224/472 (47%), Gaps = 43/472 (9%)

Query: 85  PVSILISYSFVGLLVYTVMSCLGEMAAFIPLDG-FTSYASRYVDPAVGFAVGYSYLFKYF 143
           P ++LI +  VG+ ++ V+    E++   P+ G F+S+ SR+++P++GF V  +Y   + 
Sbjct: 24  PGTLLIGFLIVGVSIFCVIQSAAELSCQYPVSGSFSSHVSRFIEPSLGFTVSCAYALSWL 83

Query: 144 IVTPNQLTAGAMVMQFWVSRDRVNPGVWITIFLALIVLINTVGVRFFGEFEFWLSSVKXX 203
           I  PN+L   AM + +W   + + P VW+ I   L++ +N   VR F E EFWLS +K  
Sbjct: 84  ISFPNELVGLAMTIGYW--NEDIPPAVWVLIGYLLVIGLNLFAVRGFAESEFWLSIIKVL 141

Query: 204 XXXXXXXXXXXXXXXXXPNHDR--TGFRFWRDPGAFKP--YSEAISGSKGKXXXXXXXXX 259
                            PN+     G ++W DPGAF+P  +S                  
Sbjct: 142 AIIIFLIIGIVIICGGGPNNKEGYLGGKYWHDPGAFRPPFFSSLCQ-----------TFV 190

Query: 260 XXXXXYTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVVFYVITILLLGMTVAYNDPRLL 319
                + G EL  + A E++    S+ RA K T +RI +FY+ T++++G  V Y  P L 
Sbjct: 191 SAAFTFGGAELVLLTANESRK-IESISRAAKGTFWRIAIFYISTVIVIGCLVPYTSPAL- 248

Query: 320 XXXXXXXXXXXXPFVVAIENASI--PVLPHIFNVCVLVFVFSACNSDLYVASRSLYGLAI 377
                       PFV+A+ N       + H  N  ++  V S CNS +Y ASR +  L  
Sbjct: 249 ----DGESIRASPFVIALSNTGSFGTNVSHFMNAVIVAAVLSVCNSCVYAASRVIQSLGA 304

Query: 378 DGKAPRIFATTNKWGVPYYSLGLSVLFCLLAYMNVSSGSAQVFNYFVNVVSIFGLLSWIT 437
            G+ P IF   +K G P   +G+  +F LLA++  ++    VFN+   + SI     W  
Sbjct: 305 CGQLPEIFGYIDKKGRPLVGIGVCAVFGLLAFLVETTKVKDVFNWLFALCSIAAFFVWFC 364

Query: 438 ILITYIRFDKAIRVQFGDKSSLSYTAAFQPWSTYVALFFCCLIGLIKNYTVFLGHKF--- 494
           I ++ +R+ +A++VQ      ++Y +    WS         +IG + N+ +  G  +   
Sbjct: 365 ICVSQLRYRRALKVQGFPTEEIAYQSMLGKWSG--------VIGTLLNFLLICGEIYVSV 416

Query: 495 ---DYKTFISGYIGIPVYLI---CYVGYKVVYRTKLIKPEDVDLYTFKDAID 540
              D +TF    + IP+ +I   C+  Y+  ++T LI   D+DL T +   D
Sbjct: 417 KDGDVETFFQNCMSIPLLIIFYFCHRLYRRDWKTWLIPARDLDLNTGRKPED 468

>SAKL0D02926g Chr4 (240708..242459) [1752 bp, 583 aa] {ON}
           uniprot|Q875S6 Saccharomyces kluyveri TAT1
          Length = 583

 Score =  206 bits (524), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 132/529 (24%), Positives = 247/529 (46%), Gaps = 29/529 (5%)

Query: 25  IVTLESEGQVRSVSEGVDGKHE----GIRLKKELEARHVSMXXXXXXXXXXXXXXXXXXX 80
           I +   +G+   V E + G++E      ++KK +++RH+ M                   
Sbjct: 42  INSFRRKGESEDVKE-LKGENEECGAATKMKKSIKSRHLLMISLGTGIGTGLLVGNGKAL 100

Query: 81  XXXXPVSILISYSFVGLLVYTVMSCLGEMA-AFIPLDG-FTSYASRYVDPAVGFAVGYSY 138
               P  ++I Y+   +++Y ++   GE+   +  + G +T+Y+S  VDPA+GF+V + Y
Sbjct: 101 AKAGPAGLVIGYAVASIMLYCIIQAAGELGICYSGMAGNYTAYSSLLVDPALGFSVSWVY 160

Query: 139 LFKYFIVTPNQLTAGAMVMQFWVSRDRVNPGVWITIFLALIVLINTVGVRFFGEFEFWLS 198
             ++  V P QL   AM +++W +    NP +++ +F  +I++IN  G + + E EF  +
Sbjct: 161 CVQWMTVLPLQLVTAAMTVRYWTN---ANPDIFVAVFFVVIMVINMFGAKGYAEAEFLFN 217

Query: 199 SVKXXXXXXXXXXXXXXXXXXXPNHDRTGFRFWRDPGAFKPYSEAISGSKGKXXXXXXXX 258
             K                         G ++W  PG+F       +G KG         
Sbjct: 218 ICKVLMIAGFVILGIAINCGGAGTSGYIGAKYWHSPGSFA------AGFKG----VCYVF 267

Query: 259 XXXXXXYTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVVFYVITILLLGMTVAYNDPRL 318
                 Y G E+  + A+E +NPR+S+P A K  +YRI++ Y++T +++   V YN   L
Sbjct: 268 CYAAFSYGGIEVMVLTASEQENPRKSIPNACKKVIYRILMIYMLTTIIVCFLVPYNSSEL 327

Query: 319 LXXXXXXXXXXXXPFVVAIENASIPVLPHIFNVCVLVFVFSACNSDLYVASRSLYGLAID 378
           +            P V+A+ +  + ++PHI N  +L+ V S  NS +Y A R L  L+  
Sbjct: 328 MGSSGESASHAS-PLVIAVASHGVKIVPHIINAVILISVISVGNSSMYSAPRLLLSLSEQ 386

Query: 379 GKAPRIFATTNKWGVPYYSLGLSVLFCLLAYMNVSSGSAQVFNYFVNVVSIFGLLSWITI 438
           G AP+     ++ G P     +++L  L+A++  S     +F + + +  +  +  W +I
Sbjct: 387 GYAPKFLNYVDRQGRPLICFAITLLVALIAFVAASDAEEDIFAWLLAISGLSQIFIWTSI 446

Query: 439 LITYIRFDKAIRVQFGDKSSLSYTAAFQPWSTYVALFFCCLIGLIKNYTVFLG-----HK 493
            ++++RF  A+  Q      + Y +    W ++ A+    L+ LI  + V +       +
Sbjct: 447 CLSHVRFRDAMHAQGLSLGQIGYKSQTGYWGSWFAIVISVLV-LIAQFWVAIAPIGEEGR 505

Query: 494 FDYKTFISGYIGIPVYLICYVGYKVVYRT-KLIKP-EDVDLYTFKDAID 540
            + +TF   Y+  P+ L  Y GYKV ++  +L  P  +VDL + ++  D
Sbjct: 506 LNAETFFQNYLAFPILLGAYFGYKVYHKDWRLCIPASEVDLSSHRNISD 554

>AFR230C Chr6 complement(855413..857227) [1815 bp, 604 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YKR039W
           (GAP1)
          Length = 604

 Score =  206 bits (525), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 131/502 (26%), Positives = 240/502 (47%), Gaps = 20/502 (3%)

Query: 50  LKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILISYSFVGLLVYTVMSCLGEM 109
           L + L+ RH+ M                       P  +LI +     ++  +   LGE+
Sbjct: 83  LSRRLKNRHLQMIAIGGAIGVGLFVGSGKALATAGPAGVLIGWGLTATMILIMCLSLGEL 142

Query: 110 AAFIPLDG-FTSYASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVNP 168
           A   P+ G + +YA+R++D + GFA  ++Y+ +  +V P ++ A ++ + +W +  +   
Sbjct: 143 AVTFPVSGGYITYAARFIDESWGFANNFNYMMQAMVVMPLEIVAASVTVGYWDTDPKYKL 202

Query: 169 GVWITIFLALIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGF 228
             ++ +F  +IV IN  GVR FGE E   S +K                   P+H+  G 
Sbjct: 203 A-FVALFWVVIVSINLFGVRGFGEAESIFSLIKVITIIGFIIMGVVLISGGGPDHEVIGG 261

Query: 229 RFWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPRA 288
           ++W DPG F       +    K              + G+EL G+ AAE + PR+S+P+A
Sbjct: 262 KYWNDPGPF-----VGNAPSDKFKGVCSVFVTAAFSFAGSELIGLAAAETREPRKSIPKA 316

Query: 289 IKLTLYRIVVFYVITILLLGMTVAYNDPRLLXXXXXXXXXXXXPFVVAIENASIPVLPHI 348
            K   +RI +FY++++L++G+ V  N+  LL            PFV+A++   I VLP I
Sbjct: 317 AKQVFWRITLFYILSLLIVGLLVPSNNEHLLAPQQIDAAHS--PFVIAMDMHRIRVLPSI 374

Query: 349 FNVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCLLA 408
            NV +L  V S  NS +Y +SR++  LA  G  P+IF   ++ G P +++  + LF LL 
Sbjct: 375 INVVILTAVISVGNSSVYSSSRTMCALAEHGFLPKIFGYIDRKGRPLFAICFTSLFGLLC 434

Query: 409 YMNVSSGSAQVFNYFVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLSYTAAFQPW 468
           ++  +    ++F++ + +  +    +W+TI + ++RF  A++ Q    + LS+T+     
Sbjct: 435 FVAGAKEEGEIFDWLLAISGLSSFFTWLTINLAHMRFRMALKAQGRTTNELSFTSPTGFI 494

Query: 469 STYVALFFCCLIGLIKNYTVFL--------GHKFDYKTFISGYIGIPVYLICYVGYKVVY 520
            +  A+   C++ L+  + V L          K     F   Y+   V ++ Y+ +K+  
Sbjct: 495 GSCYAVGLICVV-LVAQFWVALYPPSPDGTSAKPSPILFFKQYLSFAVAIVMYLAHKIWS 553

Query: 521 RTK--LIKPEDVDLYTFKDAID 540
           R     IK +++D+ T +  +D
Sbjct: 554 RNWKFFIKAKEMDIDTGRRELD 575

>NCAS0A10680 Chr1 complement(2127039..2128820) [1782 bp, 593 aa]
           {ON} 
          Length = 593

 Score =  206 bits (524), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 137/539 (25%), Positives = 248/539 (46%), Gaps = 22/539 (4%)

Query: 2   NSDTSMEKKNAGVLYSNETLEEGIVTLESEGQVRSVSEGVDGKHEGIRLKKELEARHVSM 61
           N D + E ++  V    ++ +    + E++     + +G     +   LKK +++RHV M
Sbjct: 32  NLDATEESRSGLVHRFVDSFKRAQDSTEND-----LEDGTKPLGDASHLKKAMKSRHVIM 86

Query: 62  XXXXXXXXXXXXXXXXXXXXXXXPVSILISYSFVGLLVYTVMSCLGEMAAFIP-LDG-FT 119
                                  P S++I Y  V  + Y ++   GEMA   P L G F 
Sbjct: 87  MCVGTGIGTGLLVANASGLSYGGPGSLVIGYVLVSFVTYFMIQAAGEMAVAYPTLPGNFN 146

Query: 120 SYASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVNPGVWITIFLALI 179
           SY S ++    GFA  + +  ++  V P +L   ++ +++W   D++N  V+I IF   +
Sbjct: 147 SYTSMFISKPFGFATVWLFFIQWLTVFPLELITASLTIKYW--NDKINADVFIVIFYVFL 204

Query: 180 VLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGFRFWRDPGAFKP 239
           + I+  GV+ +GE EF  +S K                         G ++WRDPG+F  
Sbjct: 205 LFIHFFGVKAYGEAEFIFNSCKVLMIAGFIILSIVINCGGAGKDGYIGAKYWRDPGSF-- 262

Query: 240 YSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVVF 299
              A   S  K              Y G EL  +   E +NPR+S P+A K ++YRI++ 
Sbjct: 263 ---AEGDSVEKFKGICYILVTAYFSYGGAELFSLSVNEQENPRKSTPQAAKQSIYRILII 319

Query: 300 YVITILLLGMTVAYNDPRLLXXXXXXXXXXXXPFVVAIENASIPVLPHIFNVCVLVFVFS 359
           Y++T++L+G  V +N+ +L+            P+V+A     + V+PH  N  +L+ V S
Sbjct: 320 YLLTMILIGFNVPHNNDQLMGSGGSATHAS--PYVLAASIHGVKVVPHFINAVILISVIS 377

Query: 360 ACNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCLLAYMNVSSGSAQV 419
             NS LY + R +  LA  G AP+     ++ G P  +L L  +F ++ +++ SS   +V
Sbjct: 378 VANSALYASPRLMCSLAEQGYAPKFLDYVDREGRPLRALILCAVFGVIGFVSASSKEEEV 437

Query: 420 FNYFVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLSYTAAFQPWSTYVALFFCCL 479
           F +   +  +  L +W  I+++++RF + +++    +  + + A    W +   + F  L
Sbjct: 438 FTWLAAIAGLSELFTWSGIMLSHVRFRQCMKLHGRSEEEIGFRAVTGIWGSMYGISFNML 497

Query: 480 IGLIKNYTVF----LGHKFDYKTFISGYIGIPVYLICYVGYKVVYR--TKLIKPEDVDL 532
           + + + +       L  K D ++F   Y+  P++L  Y GY +  R  T L+  + +DL
Sbjct: 498 VFIAQFWVALAPPSLHGKVDAESFFQSYLAAPIWLFFYFGYMLYKRDFTFLVPLDKIDL 556

>Ecym_8297 Chr8 complement(602984..604693) [1710 bp, 569 aa] {ON}
           similar to Ashbya gossypii ADL272W
          Length = 569

 Score =  205 bits (522), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 141/521 (27%), Positives = 241/521 (46%), Gaps = 23/521 (4%)

Query: 27  TLESEGQVRSVSEGVDGKHEGIRLKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPV 86
           ++ES  +      GV GK E   L++ +  RHV M                         
Sbjct: 20  SVESVAEDVEAGAGVQGKKE--VLRQSIRPRHVFMISMATGIGTGLLVGNGKSIACAGIG 77

Query: 87  SILISYSFVGLLVYTVMSCLGEMAAFIPL--DGFTSYASRYVDPAVGFAVGYSYLFKYFI 144
             LI Y  +G+++   M  +GE+    P    GF SY  R++DP++GF+V + +  ++ I
Sbjct: 78  GTLIGYGIIGVMLVCCMQSVGELVVAFPSLSGGFNSYGKRFIDPSLGFSVSWLFCLQWMI 137

Query: 145 VTPNQLTAGAMVMQFWVSRDRVNPGVWITIFLALIVLINTVGVRFFGEFEFWLSSVKXXX 204
           V P +L  G+M +++W     ++P +++++F ALI ++N+ G   + E EF  +S+K   
Sbjct: 138 VLPLELVTGSMTIKYW--NASLSPSLFVSVFYALICVVNSFGSGGYAEAEFIFNSLKVVV 195

Query: 205 XXXXXXXXXXXXXXXXPNHDRTGFRFWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXX 264
                                 GFR+  DPG F      I  + G               
Sbjct: 196 IIGFIILGVLIDTGCVGTSGTIGFRYLIDPGMFNKNYNIIKATAGTLVNAAFSCG----- 250

Query: 265 YTGTELCGIVAAEAK--NPRRSVPRAIKLTLYRIVVFYVITILLLGMTVAYNDPRLLXXX 322
             G E   + AAE    N  +S+ RA      RI VFY+++I ++G+ V +N P L+   
Sbjct: 251 --GVEFLALSAAEQNRDNMPKSIGRACNQVSIRIFVFYLLSISVVGLLVPHNSPILMGSG 308

Query: 323 XXXXXXXXXPFVVAIENASIPVLPHIFNVCVLVFVFSACNSDLYVASRSLYGLAIDGKAP 382
                    P+V A+    I V+PHI N  +L+ V S  NS +Y +SR+L+ LA    AP
Sbjct: 309 SNMIHSS--PYVAAVAMNGITVVPHIINAVILIAVISVANSAMYSSSRTLHSLAEQNFAP 366

Query: 383 RIFATTNKWGVPYYSLGLSVLFCLLAYMNVSSGSAQVFNYFVNVVSIFGLLSWITILITY 442
           + F   NK G P   L +S LF L++++        +F + +++  +  + +W TI I +
Sbjct: 367 KYFTKLNKHGQPMRCLFISALFGLISFVAEYRDQEAIFIWLLSISGLSTIFTWTTICIAH 426

Query: 443 IRFDKAIRVQFGDKSSLSYTAAFQPWSTYVALFFCCLIGLIKNYTVFLGHKFDYK----T 498
           IRF  AI+ +     +L Y +      +Y+A     +I +++ +      + + K     
Sbjct: 427 IRFRDAIKSRGQSLETLGYKSITGVAGSYIATVINLVILVVQFWVSLFPLESNGKPNIVQ 486

Query: 499 FISGYIGIPVYLICYVGYKVVYR--TKLIKPEDVDLYTFKD 537
           F   Y+ +PV L+ Y+G+KV  +  + LI+  +VD+ T +D
Sbjct: 487 FFQNYMAVPVALLFYIGHKVYTKNWSLLIRASNVDITTDRD 527

>YOL020W Chr15 (286172..287950) [1779 bp, 592 aa] {ON}  TAT2High
           affinity tryptophan and tyrosine permease,
           overexpression confers FK506 and FTY720 resistance
          Length = 592

 Score =  205 bits (522), Expect = 5e-58,   Method: Compositional matrix adjust.
 Identities = 142/520 (27%), Positives = 242/520 (46%), Gaps = 31/520 (5%)

Query: 34  VRSVSEGVDGKHEGIRLKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILISYS 93
           V S    +DG  +   LK+ L+ RH+ M                       P+ ++I ++
Sbjct: 62  VDSFKSPLDGSFDTSNLKRTLKPRHLIMIAIGGSIGTGLFVGSGKAIAEGGPLGVVIGWA 121

Query: 94  FVGLLVYTVMSCLGEMAAFIPLDG-FTSYASRYVDPAVGFAVGYSYLFKYFIVTPNQLTA 152
             G  +   +  LGE+    P+ G F +Y +R++DP++ F V   Y+ ++F V P ++ A
Sbjct: 122 IAGSQIIGTIHGLGEITVRFPVVGAFANYGTRFLDPSISFVVSTIYVLQWFFVLPLEIIA 181

Query: 153 GAMVMQFWVSRDRVNPGVWITIFLALIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXX 212
            AM +Q+W S   ++P +W+ IF A+IV IN  GVR FGE EF  S++K           
Sbjct: 182 AAMTVQYWNS--SIDPVIWVAIFYAVIVSINLFGVRGFGEAEFAFSTIKAITVCGFIILC 239

Query: 213 XXXXXXXXPNHDRTGFRFWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCG 272
                   P+H+  G ++W DPG         +G  G                 G E+  
Sbjct: 240 VVLICGGGPDHEFIGAKYWHDPGCLA------NGFPG----VLSVLVVASYSLGGIEMTC 289

Query: 273 IVAAEAKNPRRSVPRAIKLTLYRIVVFYVITILLLGMTVAYNDPRLLXXXXXXXXXXXXP 332
           + + E  +P + +P AIK   +RI+ F++I++ L+G  V Y +  LL            P
Sbjct: 290 LASGET-DP-KGLPSAIKQVFWRILFFFLISLTLVGFLVPYTNQNLL----GGSSVDNSP 343

Query: 333 FVVAIENASIPVLPHIFNVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPRIFATTNKWG 392
           FV+AI+   I  LP I N  +L+ V S  NS ++ +SR+L  +A  G  P  F   ++ G
Sbjct: 344 FVIAIKLHHIKALPSIVNAVILISVLSVGNSCIFASSRTLCSMAHQGLIPWWFGYIDRAG 403

Query: 393 VPYYSLGLSVLFCLLAYMNVSSGSAQVFNYFVNVVSIFGLLSWITILITYIRFDKAIRVQ 452
            P   +  + LF LLA++  S   ++VFN+ + +  +   + W++I +++IRF  A++ Q
Sbjct: 404 RPLVGIMANSLFGLLAFLVKSGSMSEVFNWLMAIAGLATCIVWLSINLSHIRFRLAMKAQ 463

Query: 453 FGDKSSLSYTAAFQPWSTYVALFFCCLIGLIKNYTV------FLGHKFDYKTFISGYIGI 506
                 L + +A   W +  +    CLI + + Y        +   K   K F   Y+  
Sbjct: 464 GKSLDELEFVSAVGIWGSAYSALINCLILIAQFYCSLWPIGGWTSGKERAKIFFQNYLCA 523

Query: 507 PVYLICYVGYKVVYRTKLIK------PEDVDLYTFKDAID 540
            + L  ++ +K+ Y+ +  K       +D+DL T +  ID
Sbjct: 524 LIMLFIFIVHKIYYKCQTGKWWGVKALKDIDLETDRKDID 563

>Skud_15.138 Chr15 (245592..247370) [1779 bp, 592 aa] {ON} YOL020W
           (REAL)
          Length = 592

 Score =  205 bits (522), Expect = 6e-58,   Method: Compositional matrix adjust.
 Identities = 141/520 (27%), Positives = 242/520 (46%), Gaps = 31/520 (5%)

Query: 34  VRSVSEGVDGKHEGIRLKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILISYS 93
           V S    +DG  +   LK+ L+ RH+ M                       P+ +++ ++
Sbjct: 62  VDSFKPPLDGSFDTSNLKRTLKPRHLIMIAIGGSIGTGLFVGSGKAIAEGGPLGVVLGWT 121

Query: 94  FVGLLVYTVMSCLGEMAAFIPLDG-FTSYASRYVDPAVGFAVGYSYLFKYFIVTPNQLTA 152
             G  +   +  LGE+    P+ G F +Y +R++DP++ F V   Y+ ++F V P ++ A
Sbjct: 122 IAGSQIIGTVHGLGEITVRFPVVGAFANYGTRFLDPSISFVVSTIYVLQWFFVLPLEIIA 181

Query: 153 GAMVMQFWVSRDRVNPGVWITIFLALIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXX 212
            AM +Q+W S   ++P +W+ IF A+IV IN  G R FGE EF  S+VK           
Sbjct: 182 AAMTVQYWNSS--IDPVIWVAIFYAVIVSINLFGARGFGEAEFAFSTVKAITVGGFIILC 239

Query: 213 XXXXXXXXPNHDRTGFRFWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCG 272
                   P+H+  G ++W DPG          G  G                 G E+  
Sbjct: 240 IVLICGGGPDHEFIGAKYWHDPGCLA------HGFPG----VLSVLVVASYSLGGIEMTC 289

Query: 273 IVAAEAKNPRRSVPRAIKLTLYRIVVFYVITILLLGMTVAYNDPRLLXXXXXXXXXXXXP 332
           + + E  +P+  +P AIK   +RI+ F+++++ L+G  V Y +  LL            P
Sbjct: 290 LASGET-DPK-GLPSAIKQVFWRIIFFFLVSLTLVGFLVPYTNQNLLGGSSVDNS----P 343

Query: 333 FVVAIENASIPVLPHIFNVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPRIFATTNKWG 392
           FV+AI+   I VLP I N  +L+ V S  NS ++ +SR+L  +A  G  P  F   ++ G
Sbjct: 344 FVIAIKLHHIKVLPSIVNAVILISVLSVGNSCIFASSRTLCSMAHQGLIPWWFGYIDRAG 403

Query: 393 VPYYSLGLSVLFCLLAYMNVSSGSAQVFNYFVNVVSIFGLLSWITILITYIRFDKAIRVQ 452
            P   +  + LF LLA++  S   ++VFN+ + +  +   + W++I ++++RF  A++ Q
Sbjct: 404 RPLVGIMANSLFGLLAFLVKSGSMSEVFNWLMAIAGLATCIVWLSINLSHVRFRLAMKAQ 463

Query: 453 FGDKSSLSYTAAFQPWSTYVALFFCCLIGLIKNYTV------FLGHKFDYKTFISGYIGI 506
                 L + +A   W +  +    CLI + + Y        +   K   K F   Y+  
Sbjct: 464 GKSLDELEFVSAVGIWGSVYSALINCLILIAQFYCSLWPIGGWTSSKERAKIFFQNYLCA 523

Query: 507 PVYLICYVGYKVVYRTKLIK------PEDVDLYTFKDAID 540
            + +  +V +K+ YR ++ K       +D+DL T +  ID
Sbjct: 524 LIMVFIFVIHKIYYRCQMGKWWGVKELKDIDLETDRKDID 563

>YDR046C Chr4 complement(548762..550576) [1815 bp, 604 aa] {ON}
           BAP3Amino acid permease involved in the uptake of
           cysteine, leucine, isoleucine and valine
          Length = 604

 Score =  205 bits (522), Expect = 6e-58,   Method: Compositional matrix adjust.
 Identities = 141/535 (26%), Positives = 237/535 (44%), Gaps = 33/535 (6%)

Query: 6   SMEKKNAGVLYSNETLEEGIVTLESEGQVRSVSEGVDGKHEGIRLKKELEARHVSMXXXX 65
           S  +  +  L  +  LE+G  +++S                   LKK +++RHV M    
Sbjct: 58  SFRRAESQRLEEDNDLEDGTKSMKSNNH----------------LKKSMKSRHVVMMSLG 101

Query: 66  XXXXXXXXXXXXXXXXXXXPVSILISYSFVGLLVYTVMSCLGEMAAFIPL--DGFTSYAS 123
                              P S++I Y  V  + Y ++   GEM    P     F +Y S
Sbjct: 102 TGIGTGLLVANAKGLSLAGPGSLVIGYVMVSFVTYFMVQAAGEMGVTYPTLPGNFNAYNS 161

Query: 124 RYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVNPGVWITIFLALIVLIN 183
            ++  + GFA  + +  ++  V P +L   +M +++W   D +N  V+I IF   ++ I+
Sbjct: 162 IFISKSFGFATTWLFCIQWLTVLPLELITSSMTVKYW--NDTINADVFIVIFYVFLLFIH 219

Query: 184 TVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGFRFWRDPGAFKPYSEA 243
             GV+ +GE EF  +S K                         G ++WRDPG+F   S A
Sbjct: 220 FFGVKAYGETEFIFNSCKILMVAGFIILSVVINCGGAGVDGYIGGKYWRDPGSFAEGSGA 279

Query: 244 ISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVVFYVIT 303
                 +              + G EL  +   E  NPR+S P A K ++YRI++ Y++T
Sbjct: 280 T-----RFKGICYILVSAYFSFGGIELFVLSINEQSNPRKSTPVAAKRSVYRILIIYLLT 334

Query: 304 ILLLGMTVAYNDPRLLXXXXXXXXXXXXPFVVAIENASIPVLPHIFNVCVLVFVFSACNS 363
           ++L+G  V +N+ +L+            P+V+A     + V+PHI N  +L+ V S  NS
Sbjct: 335 MILIGFNVPHNNDQLMGSGGSATHAS--PYVLAASIHKVRVIPHIINAVILISVISVANS 392

Query: 364 DLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCLLAYMNVSSGSAQVFNYF 423
            LY A R +  LA  G AP+     ++ G P  +L +  L  ++ ++  S    Q F + 
Sbjct: 393 ALYAAPRLMCSLAQQGYAPKFLNYIDREGRPLRALVVCSLVGVVGFVACSPQEEQAFTWL 452

Query: 424 VNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLSYTAAFQPWSTYVALFFCCLIGLI 483
             +  +  L +W  I++++IRF KA++VQ      + Y A    W +Y  +FF  L+ + 
Sbjct: 453 AAIAGLSELFTWSGIMLSHIRFRKAMKVQGRSLDEVGYKANTGIWGSYYGVFFNMLVFMA 512

Query: 484 KNYTVFL----GHKFDYKTFISGYIGIPVYLICYVGYKVVYRT-KLIKPED-VDL 532
           + +        G K D + F   Y+  P+++  YVGY V  R    + P D +DL
Sbjct: 513 QFWVALSPIGNGGKCDAQAFFESYLAAPLWIFMYVGYMVYKRDFTFLNPLDKIDL 567

>KNAG0B01270 Chr2 (240862..242640) [1779 bp, 592 aa] {ON} Anc_3.397
           YBR132C
          Length = 592

 Score =  204 bits (519), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 126/458 (27%), Positives = 229/458 (50%), Gaps = 9/458 (1%)

Query: 88  ILISYSFVGLLVYTVMSCLGEMAAFIPLDG-FTSYASRYVDPAVGFAVGYSYLFKYFIVT 146
           +LI+++   + +  +     EM +F P+   F   A + VD ++     +++ F   +  
Sbjct: 118 LLIAFAMWCVPILAITVSTAEMVSFFPVSSPFLRLAKKCVDESLAVMASWNFWFLECVQI 177

Query: 147 PNQLTAGAMVMQFWVSRDRVNPGVWITIFLALIVLINTVGVRFFGEFEFWLSSVKXXXXX 206
           P ++ +   V+ +W  RD  NP + + +   + +LI+   V+++GE EFWL+S K     
Sbjct: 178 PYEIVSVNTVIHYW--RDDYNPAIPLVVQSVMYILISVCAVKYYGEMEFWLASFKIVLAV 235

Query: 207 XXXXXXXXXXXXXXPNHDRTGFRFWRDPGAFKPY----SEAISGSKGKXXXXXXXXXXXX 262
                         P HD  GFR +R   +FK Y    ++A S S G             
Sbjct: 236 GLFFFTLVTMVGGNPKHDVYGFRNFR-IDSFKKYYPDGNDAHSRSVGYFQGFLVCLIRAA 294

Query: 263 XXYTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVVFYVITILLLGMTVAYNDPRLLXXX 322
               G E   ++A E K PR+ +P+A +    R+ V ++ + L +G+  + NDP L    
Sbjct: 295 ATIAGGEYIAMLAGEVKEPRKVLPKAFRQVFVRLTVLFLGSCLCVGIVCSSNDPALTAAI 354

Query: 323 XXXX-XXXXXPFVVAIENASIPVLPHIFNVCVLVFVFSACNSDLYVASRSLYGLAIDGKA 381
                     P+V+A+ N  I VLP I N+ ++   FSA N+  Y +SR+LYG+A+DG A
Sbjct: 355 SESRPGAGSSPYVIAMNNLGIRVLPDIVNIALITAAFSAGNAYTYCSSRTLYGMALDGYA 414

Query: 382 PRIFATTNKWGVPYYSLGLSVLFCLLAYMNVSSGSAQVFNYFVNVVSIFGLLSWITILIT 441
           P+IF   NK GVP +++ +S+ + L++ + ++S SA V N+ +N++    L++++ + I 
Sbjct: 415 PKIFKKCNKQGVPMFAVAVSLCWALISLLQLNSNSAVVLNWLINIIVSSQLINFVALCII 474

Query: 442 YIRFDKAIRVQFGDKSSLSYTAAFQPWSTYVALFFCCLIGLIKNYTVFLGHKFDYKTFIS 501
           Y+ F +A  +Q  +   L + + +QPW+    +     + LI+ YTVF    +  + F+ 
Sbjct: 475 YLHFRRAYLLQQDNLPGLPFKSWWQPWTAIFGMSCSVAMILIQGYTVFFPKLWKARDFLF 534

Query: 502 GYIGIPVYLICYVGYKVVYRTKLIKPEDVDLYTFKDAI 539
            Y+ + + +  Y+ YK V+     K +D  L  F + +
Sbjct: 535 YYLMVFIDVGIYLFYKFVWTHGKDKVKDPTLIDFSEDL 572

>Suva_15.148 Chr15 (258987..260765) [1779 bp, 592 aa] {ON} YOL020W
           (REAL)
          Length = 592

 Score =  204 bits (519), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 145/520 (27%), Positives = 242/520 (46%), Gaps = 31/520 (5%)

Query: 34  VRSVSEGVDGKHEGIRLKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILISYS 93
           V S    +DG  +   LK+ L+ RH+ M                       P+ +++ ++
Sbjct: 62  VDSFKPPLDGSFDTSNLKRTLKPRHLIMIAIGGSIGTGLFVGSGKAIAEGGPLGVVLGWT 121

Query: 94  FVGLLVYTVMSCLGEMAAFIPLDG-FTSYASRYVDPAVGFAVGYSYLFKYFIVTPNQLTA 152
             G  +   +  LGE+    P+ G F +Y +R++DP++ F V   Y+ ++F V P ++ A
Sbjct: 122 IAGSQIIGTIHGLGEITVRFPVVGAFANYGTRFLDPSISFVVSTIYVLQWFFVLPLEIIA 181

Query: 153 GAMVMQFWVSRDRVNPGVWITIFLALIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXX 212
            AM +Q+W S   ++P VW+ IF  +IV IN  GVR FGE EF  S++K           
Sbjct: 182 AAMTVQYWNS--SIDPVVWVAIFYVIIVSINLFGVRGFGEAEFAFSTIKAITVCGFIILC 239

Query: 213 XXXXXXXXPNHDRTGFRFWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCG 272
                   P+H+  G ++W DPG         +G  G                 G E+  
Sbjct: 240 IVLIFGGGPDHEYVGAKYWYDPGCLA------NGFPG----ILSVLVVASYSLGGIEMTC 289

Query: 273 IVAAEAKNPRRSVPRAIKLTLYRIVVFYVITILLLGMTVAYNDPRLLXXXXXXXXXXXXP 332
           + + E  +P + +P AIK   +RI+ F+++++ L+G  V Y +  LL            P
Sbjct: 290 LASGET-DP-KGLPSAIKQVFWRILFFFLVSLTLVGFLVPYTNQNLL----GGSSVDNSP 343

Query: 333 FVVAIENASIPVLPHIFNVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPRIFATTNKWG 392
           FV+AI+   I VLP I NV +L+ V S  NS ++ +SR+L  +A  G  P  F   ++ G
Sbjct: 344 FVIAIKLHHIKVLPSIVNVVILISVLSVGNSCIFASSRTLCSMAHQGLIPWWFGYIDRAG 403

Query: 393 VPYYSLGLSVLFCLLAYMNVSSGSAQVFNYFVNVVSIFGLLSWITILITYIRFDKAIRVQ 452
            P   +  + LF LLA++  S     VFN+ + +  +   + W++I +++IRF  A++ Q
Sbjct: 404 RPLVGIMANSLFGLLAFLVKSGSMGDVFNWLMAIAGLATCIVWLSINVSHIRFRMAMKAQ 463

Query: 453 FGDKSSLSYTAAFQPWSTYVALFFCCLIGLIKNYTVFL---GHKFD---YKTFISGYIGI 506
                 L + +A   W +  +    CLI L + Y       G K      K F   Y+  
Sbjct: 464 GKKLDELEFVSAVGIWGSAYSALINCLILLAQFYCSLWPIGGWKNSSDRAKIFFQNYLCA 523

Query: 507 PVYLICYVGYKVVYRTKL-----IKP-EDVDLYTFKDAID 540
            + L  ++ +K+ Y+ +      IK  +D+DL T +  ID
Sbjct: 524 LIVLFIFIAHKIYYKCQTGQWWGIKALKDIDLETDRKNID 563

>AGR040C Chr7 complement(782283..784004) [1722 bp, 573 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR069C
           (TAT1)
          Length = 573

 Score =  204 bits (518), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 134/500 (26%), Positives = 234/500 (46%), Gaps = 27/500 (5%)

Query: 49  RLKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILISYSFVGLLVYTVMSCLGE 108
           ++KK ++ RH+ M                       P  +++ Y     ++Y ++   GE
Sbjct: 64  KMKKTIKTRHLLMITLGTGIGTGLLVGNGSALAKAGPAGLILGYVVSSAMLYLIVEAAGE 123

Query: 109 MA-AFIPLDG-FTSYASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRV 166
           +   +  + G +T+Y+S  VDPA+GF+V + Y  ++  V P QL   AM++Q+W     +
Sbjct: 124 LGICYSGMTGNYTAYSSLLVDPAMGFSVSWVYCIQWMTVFPLQLVTAAMIIQYWTD---I 180

Query: 167 NPGVWITIFLALIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRT 226
           NP +++ I  A+IV IN  G + + E EF+ +  K                         
Sbjct: 181 NPDIFVAIIYAVIVFINLFGAKGYAEAEFFFNLCKVLMIIGFVILGVVINCGGAGTSGYI 240

Query: 227 GFRFWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVP 286
           G ++W +P  F      ++G KG               Y G E+  + A+E +NPR+S+ 
Sbjct: 241 GDKYWHEPRPF------MNGFKG----LCFVFCYAAFAYGGIEVMVLSASEQENPRKSIS 290

Query: 287 RAIKLTLYRIVVFYVITILLLGMTVAYNDPRLLXXXXXXXXXXXXPFVVAIENASIPVLP 346
            A K  +YRIV+ Y++T +++   V  + P L             P V+A+    + ++P
Sbjct: 291 SACKKVIYRIVLIYLLTTVIVCFLVPADHPSL-----ASEGSRASPLVIAVSFHGVKIVP 345

Query: 347 HIFNVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCL 406
           HI N  +L+ V S  NS LY A R L  LA  G AP+IF   ++ G P  +  ++++F L
Sbjct: 346 HIINAVILIAVVSVGNSSLYSAPRLLLSLAEQGYAPKIFTYIDRQGRPLPAFFVAMVFGL 405

Query: 407 LAYMNVSSGSAQVFNYFVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLSYTAAFQ 466
           LA++  S     VF + + +  +  +  W++I I++IRF  A++ Q      + Y A   
Sbjct: 406 LAFLAASPAQDDVFGWLLAISGLSQMFIWMSICISHIRFRDAMKAQGRSMGEVGYKARTG 465

Query: 467 PWSTYVALFFCCLIGLIKNYTVFLG----HKFDYKTFISGYIGIPVYLICYVGYKVVYRT 522
            W +++A+    LI LI  + V +        D ++F   Y+  P+ L+ Y GYK+ ++ 
Sbjct: 466 YWGSWIAVVTAFLI-LIAQFWVAISPVETKGVDARSFFQSYLAFPILLLAYFGYKIYHKD 524

Query: 523 --KLIKPEDVDLYTFKDAID 540
               I   +VDL + +   D
Sbjct: 525 WRICIPASEVDLISHRQVFD 544

>Kwal_27.10538 s27 (380769..382577) [1809 bp, 602 aa] {ON} YBR068C
           (BAP2) - probable amino acid permease for leucine,
           valine, and isoleucine [contig 35] FULL
          Length = 602

 Score =  204 bits (519), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 138/500 (27%), Positives = 229/500 (45%), Gaps = 18/500 (3%)

Query: 50  LKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILISYSFVGLLVYTVMSCLGEM 109
           LK+ ++ RHV+M                       P  ++I Y+ V ++ Y +M   GEM
Sbjct: 83  LKRSIKPRHVAMMSICTGIGTGLLVANGKSLRFGGPAGLIIGYAAVSVVAYIMMQAAGEM 142

Query: 110 AAFIP-LDG-FTSYASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVN 167
           A   P L G F +Y+S+ +    GFA  + Y  ++  V P +L   ++ +++W   D +N
Sbjct: 143 AVAYPSLPGNFNAYSSQLISRPFGFATVWLYCIQWLTVLPLELITASLTIKYW--NDSIN 200

Query: 168 PGVWITIFLALIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTG 227
             V+I IF   I+ I+  G R +GE EF     K                    +    G
Sbjct: 201 ADVFIAIFYVFILFIHFFGSRGYGESEFIFGICKVLMIIGFVILSIVINCGGAGDRKYIG 260

Query: 228 FRFWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPR 287
            ++W DPGAF     A+     K              Y GTEL  +   E  NPRR++  
Sbjct: 261 AKYWYDPGAF-----AVGSGATKFKGVAYVLVTGYFSYGGTELYAMTVNEQSNPRRAIQS 315

Query: 288 AIKLTLYRIVVFYVITILLLGMTVAYNDPRLLXXXXXXXXXXXXPFVVAIENASIPVLPH 347
             K  +YRI++ Y++T++L+G  V +    L+            P+V+A+    + ++PH
Sbjct: 316 ITKQCIYRILLIYMLTMILIGFLVPHTSSELMGSSGKSATHAS-PYVLAVSLHGVKIVPH 374

Query: 348 IFNVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCLL 407
           I N  +L+ V S  NS +Y   R L  LA  G APR  A  ++ G P  +L    +F LL
Sbjct: 375 IINAVILIAVISVGNSAMYSGPRILNTLAEQGYAPRFLAYVDRAGRPLVALIACSVFGLL 434

Query: 408 AYMNVSSGSAQVFNYFVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLSYTAAFQP 467
           A++  S     VF +   +  +  L +W  I+++++RF +A+R      S L Y A    
Sbjct: 435 AFVAASDCEEDVFTWLAAIAGLSELFTWSAIMLSHVRFRQAMRYNNRPLSELGYKANTGV 494

Query: 468 WSTYVALFFCCLIGLIKNYTVFLG-----HKFDYKTFISGYIGIPVYLICYVGYKVVYRT 522
             + + L F  L+  I  + V +       K D  +F   Y+  P++++ + GY +V+R 
Sbjct: 495 LGSVLGLSFNILV-FIAQFWVSIAPFGKDGKLDVLSFFQSYLAFPLWVVLFFGYMIVFRN 553

Query: 523 -KLIKP-EDVDLYTFKDAID 540
            ++IKP +D+DL  ++   D
Sbjct: 554 WEIIKPLKDIDLDHYRSIYD 573

>Kpol_534.22 s534 (50849..52627) [1779 bp, 592 aa] {ON}
           (50849..52627) [1779 nt, 593 aa]
          Length = 592

 Score =  204 bits (519), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 141/512 (27%), Positives = 244/512 (47%), Gaps = 31/512 (6%)

Query: 42  DGKHEGIRLKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILISYSFVGLLVYT 101
           DG      LKK L++RH+ M                       P++++I ++  G  +  
Sbjct: 70  DGSFHTGNLKKSLKSRHLIMIAIGGSIGTGLFIGSGQALATGGPLAVIIGWAVAGSQIVG 129

Query: 102 VMSCLGEMAAFIPLDG-FTSYASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFW 160
            +  LGE+    P+ G F SY +R++DP++ F V   Y+ ++F V P ++ A A+ +Q+W
Sbjct: 130 TIHGLGEITVRFPVVGAFASYTTRFLDPSISFVVSTIYVLQWFFVLPLEIIASAITVQYW 189

Query: 161 VSRDRVNPGVWITIFLALIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXX 220
              D ++P V++ IF  +IV IN  G R FGE EF  S+VK                   
Sbjct: 190 --NDSIDPVVFVAIFYCVIVSINLFGARGFGEAEFIFSTVKIITICGFIILCIVLIAGGG 247

Query: 221 PNHDRTGFRFWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKN 280
           P+H+  G ++W +PG+         G KG                 GTE+  + + E  +
Sbjct: 248 PDHEYIGAKYWHNPGSLA------HGFKG----VLSVLVVASYSLGGTEMTCLASGET-D 296

Query: 281 PRRSVPRAIKLTLYRIVVFYVITILLLGMTVAYNDPRLLXXXXXXXXXXXXPFVVAIENA 340
           P+  +P AIK   +RI+ F+++++ L+G  V Y +P LL            PFV+AI+  
Sbjct: 297 PKE-LPSAIKQVFWRILFFFLVSLTLVGFLVPYTNPNLLGGSSVDNS----PFVIAIKIH 351

Query: 341 SIPVLPHIFNVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGL 400
           +I VLP I N  +LV + S  NS ++ +SR+L  +A     P  F   ++ G P   + +
Sbjct: 352 NIKVLPSIVNAVILVSILSVGNSCIFASSRTLCSMAHQHLIPWWFGYIDRAGRPLTGIII 411

Query: 401 SVLFCLLAYMNVSSGSAQVFNYFVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLS 460
           + LF LLA++  SS   +VF++ + +  +   + W++I I ++RF  A++ Q      L 
Sbjct: 412 NSLFGLLAFLVKSSSVTEVFDWLMAIAGLATCIVWLSINICHVRFRLAMKAQNRTLDELE 471

Query: 461 YTAAFQPWSTYVALFFCCLIGLIKNYTVF--LGHKFD----YKTFISGYIGIPVYLICYV 514
           + +A   W +  +     LI + + Y     +G   D     K F   Y+   + ++ ++
Sbjct: 472 FVSAVGIWGSVYSGIVNALILVAQFYIALWPIGGWTDSGTRAKKFFQNYLCALILIVLFI 531

Query: 515 GYKVVYRT------KLIKPEDVDLYTFKDAID 540
           G+K+ YR       + I  +D+DL T +  +D
Sbjct: 532 GHKIYYRVTTGHWWEYIALKDIDLDTDRKNVD 563

>TDEL0C05340 Chr3 complement(951770..953497) [1728 bp, 575 aa] {ON}
           Anc_3.397 YBR132C
          Length = 575

 Score =  203 bits (517), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 133/489 (27%), Positives = 231/489 (47%), Gaps = 12/489 (2%)

Query: 52  KELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILISYSFVGLLVYTVMSCLGEMAA 111
           + L+ RHV +                       P  +LI+++   + +  +     EM  
Sbjct: 64  RRLKNRHVQLIAISGVIGTALFVAIGKALYKGGPAFLLIAFALWCVPILCITVSTAEMVC 123

Query: 112 FIPLDG-FTSYASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVNPGV 170
           F+P+   F   A+R  D ++     +++ F   +  P ++ +   ++ +W  RD  +  +
Sbjct: 124 FLPVSSPFLRLAARCADDSLAVMASWNFWFLQCVQIPFEIVSVNTIIHYW--RDDYSAAI 181

Query: 171 WITIFLALIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGFRF 230
            + + + L  LI+   V+++GE EFWL+S K                   P HDR GFR+
Sbjct: 182 PLVVQIVLYFLISICAVKYYGETEFWLASFKIILALGLFLFTFITMLGGNPKHDRYGFRY 241

Query: 231 WRDPGAFKPY----SEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVP 286
           + +   FK Y     +    S G                 G E   ++A E K PR+ +P
Sbjct: 242 YGET-PFKKYYPNGDKDAGASVGYFQGFLACLIQASFTIAGGEYISMLAGEVKLPRKVLP 300

Query: 287 RAIKLTLYRIVVFYVITILLLGMTVAYNDPRLLXXXXXXXXXX-XXPFVVAIENASIPVL 345
           RA K   YR+   ++ + L +G+  + NDP L              P+V+A+ N  I VL
Sbjct: 301 RAFKQVFYRLTFLFLGSCLCVGIICSANDPALTAAIDESRPGAGSSPYVIAMNNLGIKVL 360

Query: 346 PHIFNVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFC 405
           P I N  ++   FSA N+  Y +SR+LYG+A+DG APRIF   NK GVP YS+ +S+L+ 
Sbjct: 361 PDIVNAALITAAFSAGNAYTYCSSRTLYGMALDGYAPRIFTRCNKHGVPIYSVLISLLWG 420

Query: 406 LLAYMNVSSGSAQVFNYFVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLSYTAAF 465
           L++ + ++  SA V N+ +N+++   L+++  + I Y+ F +A  +       L + +  
Sbjct: 421 LISLLQLNDNSAVVLNWLINLITASQLINFTVLCIIYLFFRRAYLLHKDILPKLPFKSWG 480

Query: 466 QPWSTYVALFFCCLIGLIKNYTVFLGHKFDYKTFISGYIGIPVYLICYVGYKVVY---RT 522
           QP++  V L     + LI+ YTVF    +  + F+  Y+ + + +  Y+GYK ++   R 
Sbjct: 481 QPYTAIVGLVSATAMILIQGYTVFFPSLWTVRDFLFCYLMVFIDIGIYIGYKFIWRRGRD 540

Query: 523 KLIKPEDVD 531
           K   P+ VD
Sbjct: 541 KFKDPKTVD 549

>NCAS0I00850 Chr9 (156277..158031) [1755 bp, 584 aa] {ON} Anc_3.397
           YBR132C
          Length = 584

 Score =  203 bits (517), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 134/542 (24%), Positives = 251/542 (46%), Gaps = 9/542 (1%)

Query: 5   TSMEKKNAGVLYSNETLEEGIVTLESEGQVRSVSEGVDGKH---EGIRLKKELEARHVSM 61
           T       G + ++   ++  +   S G     S+  D K         K+ L  RHV +
Sbjct: 25  TPFADNKGGKVDTDLDSDDFFIPTTSRGTTSVSSQDNDSKTFLVASHTTKRNLVNRHVQL 84

Query: 62  XXXXXXXXXXXXXXXXXXXXXXXPVSILISYSFVGLLVYTVMSCLGEMAAFIPLDG-FTS 120
                                  P  +L++++   + +  +     EM  F+P+   F  
Sbjct: 85  IAISGVIGTAIFVAIGKPLYRGGPAFLLLAFAIWCIPILCITVSTAEMVCFMPVSSPFLR 144

Query: 121 YASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVNPGVWITIFLALIV 180
            A++ VD ++     +++ F   +  P ++     ++ +W  RD  +  + + I   L +
Sbjct: 145 LATKCVDDSLAVMASWNFWFLECVQIPYEIVTVNTIIHYW--RDDYSAAIPLVIQSLLYL 202

Query: 181 LINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGFRFWRDPGAFKPY 240
           LI+   V+++GE EFWL+S K                   P  DR GFR++ D    K +
Sbjct: 203 LISLAAVKWYGEMEFWLASFKIVLAMGLFCFTFITMLGGNPKKDRFGFRYFHDTPFKKYF 262

Query: 241 SEAIS--GSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVV 298
            + I    S G                 G E   ++A E + PRR +PRA K    R+ +
Sbjct: 263 PDGIDRGSSAGYFQGFFICLIQASFTIAGGEYISMLAGEIEIPRRVLPRAFKQVFMRLTI 322

Query: 299 FYVITILLLGMTVAYNDPRLLXXXXXXXXXX-XXPFVVAIENASIPVLPHIFNVCVLVFV 357
            ++ + L +G+  + ND  L              P+V+A+ N  I +LP I N+ ++   
Sbjct: 323 LFLGSCLCVGILCSPNDSSLTAAINEARPGAGSSPYVIAMNNLGIRILPDIVNITLITAA 382

Query: 358 FSACNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCLLAYMNVSSGSA 417
           FS+ N+  Y +SR+LYG+A+DG AP+IF   NK GVP Y++G+S+L+  ++ + ++S SA
Sbjct: 383 FSSGNAYTYCSSRTLYGMALDGYAPKIFTRCNKQGVPIYAVGVSLLWAFISLLQLNSNSA 442

Query: 418 QVFNYFVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLSYTAAFQPWSTYVALFFC 477
            V N+ +N+++   L+++  + ITY+ F +A  +Q      L + + +QP++    L   
Sbjct: 443 IVLNWLINIITASQLINFAILCITYLFFRRAYLLQKDKLPELPFKSWWQPYTAIFGLVCA 502

Query: 478 CLIGLIKNYTVFLGHKFDYKTFISGYIGIPVYLICYVGYKVVYRTKLIKPEDVDLYTFKD 537
            ++ +++ YTVF    ++ + F+  Y+ I + +  Y+ YK ++R    K +D    +F+D
Sbjct: 503 MVMMIVQGYTVFFPKNWNVQDFLFCYLMIFINIGIYIFYKFIWRLGKDKIKDPATISFED 562

Query: 538 AI 539
            +
Sbjct: 563 EL 564

>CAGL0C00539g Chr3 (57175..57177,57724..59502) [1782 bp, 593 aa]
           {ON} highly similar to uniprot|P38090 Saccharomyces
           cerevisiae YBR132c AGP2 amino-acid permease
          Length = 593

 Score =  204 bits (518), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 149/572 (26%), Positives = 265/572 (46%), Gaps = 36/572 (6%)

Query: 17  SNETLEEGIVT--LESEGQVRSVSEGVDGKH---------EGIRLKKELEARHVSMXXXX 65
            N   EEGI     ES+   RS+S   D +          E     ++L  RHV      
Sbjct: 34  KNSAFEEGIEERFFESDDVTRSISFDEDERSSNDSRTQLIESTSTHRKLLNRHVQFIAIS 93

Query: 66  XXXXXXXXXXXXXXXXXXXPVSILISYSFVGLLVYTVMSCLGEMAAFIPLDG-FTSYASR 124
                              P ++L++++   + +  +     EM +F+P+   F   A +
Sbjct: 94  GVIGTALFVAIGKPLYRGGPANLLLAFALWCIPILCITVSTAEMVSFMPVSSPFLRLAKK 153

Query: 125 YVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVNPGVWITIFLALIVLINT 184
            VD ++G    +++ F   +  P ++ +   ++ +W  RD  +P + + I + L VLI+ 
Sbjct: 154 CVDESLGVTASWNFWFLECVQIPYEIVSVNTIIHYW--RDDYSPAIPLVIQVVLYVLISV 211

Query: 185 VGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGFRFWRDPGAFKPY---- 240
             V+++GE EFWL+S K                   P HDR GFR++ +   FK Y    
Sbjct: 212 CAVKYYGEMEFWLASFKIILAVGLFCFTFITMLGGNPKHDRYGFRYYGE-SPFKKYFPDG 270

Query: 241 SEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVVFY 300
           +E    S G                 G E   ++A E K PR+ +P+A K    R+ V +
Sbjct: 271 NEGAGKSAGYFQGFLTCLIQAAFTIAGGEYISMLAGEVKLPRKVLPKAFKQVFVRLTVIF 330

Query: 301 VITILLLGMTVAYNDPRLLXXXXXXXXXX-XXPFVVAIENASIPVLPHIFNVCVLVFVFS 359
           + + L +G+  + ND  L              P+V+A+ N  I VLP I N+ ++   FS
Sbjct: 331 LGSCLCVGIVCSPNDSALTAAINEARPGAGSSPYVIAMNNLQIRVLPDIVNIALITAAFS 390

Query: 360 ACNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCLLAYMNVSSGSAQV 419
           A N+  Y +SR+LYG+A+DG AP+IF   NK+GVP Y++G+S+ + LL+ + ++S SA V
Sbjct: 391 AGNAYTYCSSRTLYGMALDGYAPKIFTKCNKYGVPIYAVGVSLCWALLSLLQLNSNSAVV 450

Query: 420 FNYFVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLSYTAAFQPWSTYVALFFCCL 479
            N+ +N+++   L++++ + + Y+ F +A   Q      L + + +QP++  V L    +
Sbjct: 451 LNWLINLITASQLINFVFLCVIYLFFRRAYMTQKERLPELPFKSWWQPYTVIVGLVSVLI 510

Query: 480 IGLIKNYTVFLGHKFDYKTFISGYIGIPVYLICYVGYKVVY---RTKLIKPEDVDLYTFK 536
           + L++ YTVF    ++ + FI  Y+ + + +  YV  K ++   +  +  P  +D     
Sbjct: 511 MILLQGYTVFFPKLWNGRDFIFCYLMVFLDIGIYVFTKFIWYKGKDPVKSPNSIDFVPEL 570

Query: 537 DAIDAXXXXXXXXXXXXXXNMENSPKNFKWFY 568
             I+                +E+S   FK++Y
Sbjct: 571 KEIEQ-------------HELEHSFDKFKYYY 589

>KLTH0F01584g Chr6 complement(120227..122017) [1791 bp, 596 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn expression is
           fully dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p- Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 596

 Score =  203 bits (517), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 147/520 (28%), Positives = 239/520 (45%), Gaps = 24/520 (4%)

Query: 28  LESEGQVRSVSEGVDGKHEGIRLKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVS 87
           +++EGQ  +  E         +LK+ + +RH+ M                       P  
Sbjct: 65  VDAEGQPVAPRE--------TKLKQTISSRHLFMISLGTGIGTGMLVGNGKALHNGGPAG 116

Query: 88  ILISYSFVGLLVYTVMSCLGEMA-AFIPLDG-FTSYASRYVDPAVGFAVGYSYLFKYFIV 145
           + I Y+ +G  +Y ++   GEMA ++  L G F +Y S  +DPA+GF+V + Y  ++  V
Sbjct: 117 LAIGYAIMGSCIYCIIQAAGEMAVSYSSLSGNFNAYPSMLIDPALGFSVAWVYCLQWLCV 176

Query: 146 TPNQLTAGAMVMQFWVSRDRVNPGVWITIFLALIVLINTVGVRFFGEFEFWLSSVKXXXX 205
            P +L    + +++W +   VNP V++ IF  L VL+N  G R + E EF+ ++ K    
Sbjct: 177 LPLELVTATITIKYWTTA--VNPDVFVVIFYVLTVLVNLFGARGYAEAEFFFNTCKVLMI 234

Query: 206 XXXXXXXXXXXXXXXPNHDRTGFRFWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXY 265
                           N    G ++W DPGA    ++ I   KG               +
Sbjct: 235 TGFFILGIIVNCGGAGNDGYLGGKYWHDPGALYG-TKPIHHFKG----IIATMVTAAFAF 289

Query: 266 TGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVVFYVITILLLGMTVAYNDPRLLXXXXXX 325
             TE   + AAE  NPRR++P A K  +YR+++ ++  I+LLG  V YN   L+      
Sbjct: 290 GATEFIALTAAEQANPRRAIPSAAKKIVYRVLLIFLAPIILLGFLVPYNSDELMGSGGSA 349

Query: 326 XXXXXXPFVVAIENASIPVLPHIFNVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPRIF 385
                 P+V+AI +  + V+PH  N  +L+ V S  NS  Y +SR L  L+    AP   
Sbjct: 350 THAS--PYVIAIASHGVKVVPHFINAVILLSVLSVGNSAFYSSSRLLLSLSEQHYAPSWL 407

Query: 386 ATTNKWGVPYYSLGLSVLFCLLAYMNVSSGSAQVFNYFVNVVSIFGLLSWITILITYIRF 445
              ++ G P  ++ +S +F L+A++  S     VF + + +  +  L +WI I +++IRF
Sbjct: 408 NYIDREGRPIRAMLVSCIFGLIAFVAASPKEETVFTWLLAISGLSQLFTWICICVSHIRF 467

Query: 446 DKAIRVQFGDKSSLSYTAAFQPWSTYVA--LFFCCLIGLIKNYTVFLG-HKFDYKTFISG 502
            KA+ VQ      L Y +      +Y A  +  C L G        +G  K D   F   
Sbjct: 468 RKALVVQGKSLGELGYKSQTGVVGSYYATVIMACVLTGQFWVAIAPVGTDKLDANNFFEN 527

Query: 503 YIGIPVYLICYVGYKVVYRT-KLIKP-EDVDLYTFKDAID 540
           Y+ +P+ +  Y GY+V  R  KL  P E +DL + +   D
Sbjct: 528 YLAMPILIALYFGYRVWKRDWKLYIPLEQIDLVSHRKVFD 567

>Ecym_2663 Chr2 complement(1278309..1280078) [1770 bp, 589 aa] {ON}
           similar to Ashbya gossypii AGR039C
          Length = 589

 Score =  203 bits (516), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 150/521 (28%), Positives = 240/521 (46%), Gaps = 22/521 (4%)

Query: 29  ESEGQVRSVSEGVDGKHEGIRLKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSI 88
           E EGQ    + G++   +  +LK  ++ RH++M                       P  +
Sbjct: 53  EKEGQ-EEYATGLNKTQQ--KLKHNIKTRHLTMISLGTGIGTGLLVASGKALHYGGPGGL 109

Query: 89  LISYSFVGLLVYTVMSCLGEMA-AFIPLDG-FTSYASRYVDPAVGFAVGYSYLFKYFIVT 146
           LI Y     ++Y V+    E+  A+  L G + +Y +  VD   GFAV   Y  ++ IV 
Sbjct: 110 LIGYLTTSTMLYCVVQACCELGVAYATLPGNYNAYPTFLVDRGFGFAVALVYGLQWAIVL 169

Query: 147 PNQLTAGAMVMQFWVSRDRVNPGVWITIFLALIVLINTVGVRFFGEFEFWLSSVKXXXXX 206
           P +L   +M +++W   + VNP V++ IF   IV I+  G R + E EF  +++K     
Sbjct: 170 PLELVTASMTIKYWT--ESVNPDVFVAIFYLFIVFIHFFGSRGYAESEFIFNTLKVLLMA 227

Query: 207 XXXXXXXXXXXXXXPNHDRTGFRFWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYT 266
                               G ++W +PG F     +I+  KG               Y 
Sbjct: 228 GFIIMGISLNCGAS-KLGYIGAKYWSNPGTFAG-ERSINHLKG----ICSVWVQSAFAYG 281

Query: 267 GTELCGIVAAEAKNPRRSVPRAIKLTLYRIVVFYVITILLLGMTVAYNDPRLLXXXXXXX 326
           G+E   + AAE  NPR SVP A K  LYR+VV ++I I L+   V Y   +LL       
Sbjct: 282 GSEFIALTAAEQANPRESVPSATKRWLYRVVVVFLIPIALICFLVPYTSDQLLSSSGASA 341

Query: 327 XXXXXPFVVAIENASIPVLPHIFNVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPRIFA 386
                PFV+A     + ++PHI N  +L  V S  NS +Y A R L  LA +G  P+IF 
Sbjct: 342 SHAS-PFVIAAAYHGVKIVPHIINAIILTSVISVGNSGMYSAPRILLSLAENGLCPKIFT 400

Query: 387 TTNKWGVPYYSLGLSVLFCLLAYMNVSSGSAQVFNYFVNVVSIFGLLSWITILITYIRFD 446
             ++ G P  +L    +F LL+++  S     VF +   +  +  L +W +I +++IRF 
Sbjct: 401 YVDRAGRPLATLLFVCVFGLLSFVAASKNQESVFTWLTAIAGLSQLFTWTSIALSHIRFR 460

Query: 447 KAIRVQFGDKSSLSYTAAFQPWSTYVALFFCCLIGLIKNYTVFLG-----HKFDYKTFIS 501
            A++VQ      L YT+      +Y A+FF  ++ L+  + + +       + D ++F  
Sbjct: 461 AAMKVQGRSLGELGYTSTTGAIGSYYAVFFNIVV-LVAQFWIAIAPIDKHGELDAESFFK 519

Query: 502 GYIGIPVYLICYVGYKVVYR-TKLIKPED-VDLYTFKDAID 540
            Y+   V ++ YVGYK+ YR  +L+ P D +DL T +   D
Sbjct: 520 NYLAFAVLVLFYVGYKIWYREVQLLIPVDKIDLETHRQIFD 560

>NCAS0B08580 Chr2 complement(1646220..1648103) [1884 bp, 627 aa]
           {ON} Anc_1.50
          Length = 627

 Score =  204 bits (518), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 140/531 (26%), Positives = 249/531 (46%), Gaps = 22/531 (4%)

Query: 20  TLEEGIVTLES--EGQVRSVSEGVDGKHEGIRLKKELEARHVSMXXXXXXXXXXXXXXXX 77
           +L+  ++  +S  EG+ R+  E  D   E   LKK ++ RHV M                
Sbjct: 80  SLDHDVLAGDSDIEGKPRTEPEKDDDARE---LKKTIKPRHVVMISLGTGIGTGMLVGNG 136

Query: 78  XXXXXXXPVSILISYSFVGLLVYTVMSCLGEMAAFIP--LDGFTSYASRYVDPAVGFAVG 135
                  P  ++I Y+ +G  +Y ++   GE+A        GF +Y S  +DPA GFAV 
Sbjct: 137 TSLANSGPAGLVIGYAIMGSCIYCIIQATGELAVLYTKLTGGFNAYPSMLIDPAFGFAVA 196

Query: 136 YSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVNPGVWITIFLALIVLINTVG-VRFFGEFE 194
           + Y  ++  V P +L   +M +++W ++  V+P V++ IF  LI+ IN +G    + E E
Sbjct: 197 WVYCIQWLCVCPLELVTASMTIKYWTTK--VDPDVFVVIFYCLILCINVLGGAAGYAEAE 254

Query: 195 FWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGFRFWRDPGAFKPYSEAISGSKGKXXXX 254
           F+ +S K                    N    G R W +PG+F+   + +   KG     
Sbjct: 255 FFFNSFKILMLTGFFILGIVVICGGAGNDGYIGTRLWHNPGSFRG-DKPVDRFKG----V 309

Query: 255 XXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVVFYVITILLLGMTVAYN 314
                     +  +E  G+ A+E  NPR+++P A K  LYRI+  Y+ ++ ++G  V Y+
Sbjct: 310 VSTLVNAAFAFGMSEFLGVTASEQSNPRKAIPSAAKKMLYRIICIYLGSVTIVGFLVPYD 369

Query: 315 DPRLLXXXXXXXXXXXXPFVVAIENASIPVLPHIFNVCVLVFVFSACNSDLYVASRSLYG 374
             +LL            P+V+AI    + V+PH  N  +L+ V S  NS  Y +SR L  
Sbjct: 370 SDQLLGSSGAATKAS--PYVLAISLHGVRVVPHFINAVILLSVLSVGNSAFYSSSRQLLS 427

Query: 375 LAIDGKAPRIFATTNKWGVPYYSLGLSVLFCLLAYMNVSSGSAQVFNYFVNVVSIFGLLS 434
           L+  G AP      ++ G P  +  +S L  ++A+   S    QVF + + +  +  L +
Sbjct: 428 LSQLGYAPSFLNYVDRNGRPLKAYCVSALVGVIAFCATSPKEDQVFVWLLAISGLSQLFT 487

Query: 435 WITILITYIRFDKAIRVQFGDKSSLSYTAAFQPWSTYVALFFCCLIGLIKNYTVFL---G 491
           W +I ++++RF +A+RVQ      + + +    + +  +     LI + + +T  +    
Sbjct: 488 WFSICLSHLRFRRAMRVQGRSMGEVGFKSQVGIYGSLYSCVMMVLILIAQFWTALVPVGE 547

Query: 492 HKFDYKTFISGYIGIPVYLICYVGYKVVYRT--KLIKPEDVDLYTFKDAID 540
            K D + F   Y+ +P++++ Y G+K+  +     I+ ED+DL + ++  D
Sbjct: 548 GKPDVQAFFENYLAMPIFIVLYFGFKIWKKDWRLFIRAEDIDLVSHREIFD 598

>Ecym_1056 Chr1 (102260..104080) [1821 bp, 606 aa] {ON} similar to
           Ashbya gossypii AFR698C
          Length = 606

 Score =  203 bits (516), Expect = 5e-57,   Method: Compositional matrix adjust.
 Identities = 142/514 (27%), Positives = 234/514 (45%), Gaps = 32/514 (6%)

Query: 42  DGKHEGIRLKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILISYSFVGLLVYT 101
           + KHE  +LK+ +  RHV M                       P  + + +  +G  VY 
Sbjct: 83  NNKHE--KLKQTIRPRHVVMISLGTGIGTGLLVGTGKALYNGGPGGLAVGFFVMGTCVYC 140

Query: 102 VMSCLGEMAAFIPL--DGFTSYASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQF 159
           V+   GEMA   P    GF +Y S  VDP  GFA  + Y  ++  V P +L   ++ +++
Sbjct: 141 VIQAAGEMAVNYPALSGGFNAYPSFLVDPGFGFATAWLYCIQWLCVFPLELVTASITIKY 200

Query: 160 WVSRDRVNPGVWITIFLALIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXX 219
           W +   +NP +++ +F  LI++IN  G R + E EF+ ++ K                  
Sbjct: 201 WTTA--INPDIFVAVFYLLIIVINFFGARGYAEAEFFFNTCKVLMIIGFFIVGILVNTGA 258

Query: 220 XPNHDRTGFRFWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAK 279
             N    G ++WR+PG+F  ++ AI   KG                  +E   + AAE  
Sbjct: 259 AGNDGYIGAKYWREPGSFGGHT-AIDHFKG----VVSTLVNAAFSLGCSEFVALTAAEQA 313

Query: 280 NPRRSVPRAIKLTLYRIVVFYVITILLLGMTVAYNDPRLLXXXXXXXXXXXXPFVVAIEN 339
           NPR+SVP A K  LY++ V ++ ++ L+G  V  N   L+            P+V+A+ +
Sbjct: 314 NPRKSVPSAAKKMLYKVFVVFLGSVTLIGFLVPKNSSELMGSTDSSVHVS--PYVIAVAS 371

Query: 340 ASIPVLPHIFNVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLG 399
             + V+PH  N  +L+ V S  NS  Y +SR L  LA  G AP +F   ++ G P  ++ 
Sbjct: 372 HGVRVVPHFINAVILLSVLSVGNSAFYSSSRLLLSLAEQGYAPPVFKYIDRQGRPLMAMM 431

Query: 400 LSVLFCLLAYMNVSSGSAQVFNYFVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSL 459
           +S+    L ++  S     VF + + +  +  L +W +I I++IRF KA+ VQ      L
Sbjct: 432 VSITMGCLCFVAASPKEETVFIWLLAISGLSQLFTWTSICISHIRFRKALLVQGRGWDGL 491

Query: 460 SYTAAFQPWSTY----------VALFFCCLIGLIKNYTVFLGHKFDYKTFISGYIGIPVY 509
            + A    W +Y          +A F+ CLI +  +       K + ++F  GY+  P++
Sbjct: 492 GFKAQTGVWGSYYSAVIMILTFIAQFWTCLIPMGSS-------KPNAESFFEGYLAFPIF 544

Query: 510 LICYVGYKVVYRT--KLIKPEDVDLYTFKDAIDA 541
           +  Y GYK+  +     I  E +DL   +   DA
Sbjct: 545 VALYFGYKIYNKNWQLFIPAEKIDLDLHRKIFDA 578

>Smik_15.146 Chr15 (252586..254367) [1782 bp, 593 aa] {ON} YOL020W
           (REAL)
          Length = 593

 Score =  202 bits (514), Expect = 9e-57,   Method: Compositional matrix adjust.
 Identities = 142/520 (27%), Positives = 239/520 (45%), Gaps = 31/520 (5%)

Query: 34  VRSVSEGVDGKHEGIRLKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILISYS 93
           V S    +DG  +   LK+ L+ RH+ M                       P+ +++ ++
Sbjct: 63  VDSFKPPLDGSFDTSNLKRTLKPRHLIMIAIGGSIGTGLFVGSGKAIAEGGPLGVVLGWT 122

Query: 94  FVGLLVYTVMSCLGEMAAFIPLDG-FTSYASRYVDPAVGFAVGYSYLFKYFIVTPNQLTA 152
             G  +   +  LGE+    P+ G F +Y +R++DP++ F V   Y+ ++F V P ++ A
Sbjct: 123 IAGSQIIGTIHGLGEITVRFPVVGAFANYGTRFLDPSISFVVSTIYVLQWFFVLPLEIIA 182

Query: 153 GAMVMQFWVSRDRVNPGVWITIFLALIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXX 212
            AM +Q+W S   ++P +W+ IF A+IV IN  G R FGE EF  S+VK           
Sbjct: 183 AAMTVQYWNS--SIDPVIWVAIFYAVIVCINLFGARGFGEAEFAFSTVKAITVCGFIILS 240

Query: 213 XXXXXXXXPNHDRTGFRFWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCG 272
                   P+H+  G ++W DPG         +G  G                 G E+  
Sbjct: 241 IVLICGGGPDHEFIGAKYWHDPGCLA------NGFPG----VLAVLVVASYSLGGIEMTC 290

Query: 273 IVAAEAKNPRRSVPRAIKLTLYRIVVFYVITILLLGMTVAYNDPRLLXXXXXXXXXXXXP 332
           + + E  +P + +P AIK   +RI+ F++ ++ L+G  V Y +  LL            P
Sbjct: 291 LASGET-DP-KGLPGAIKQVFWRILFFFLASLTLVGFLVPYTNQNLL----GGSSVDNSP 344

Query: 333 FVVAIENASIPVLPHIFNVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPRIFATTNKWG 392
           FV+A++   I VLP I N  +L+ V S  NS ++ +SR+L  +A  G  P  F   ++ G
Sbjct: 345 FVIAMKLHHIKVLPTIVNAVILISVLSVGNSCIFASSRTLCSMAHQGLIPWWFGYIDRAG 404

Query: 393 VPYYSLGLSVLFCLLAYMNVSSGSAQVFNYFVNVVSIFGLLSWITILITYIRFDKAIRVQ 452
            P   +  + LF LLA++  S   A VFN+ + +  +   + W++I +++IRF  A++ Q
Sbjct: 405 RPLVGIMANSLFGLLAFLVKSGSMADVFNWLMAIAGLATCIVWLSINLSHIRFRLAMKAQ 464

Query: 453 FGDKSSLSYTAAFQPWSTYVALFFCCLIGLIKNYTVFL------GHKFDYKTFISGYIGI 506
                 L + +A   W +  +    CLI + + Y            K   K F   Y+  
Sbjct: 465 GKSLDELEFVSAVGIWGSAYSALINCLILIAQFYCSLWPIGGWSSGKERAKLFFQNYLCA 524

Query: 507 PVYLICYVGYKVVYRTKLIK------PEDVDLYTFKDAID 540
            + L  +V +K+ Y+ +  K       +D+DL T +  ID
Sbjct: 525 LIMLFIFVVHKIYYKCQTGKWWGVKSLKDIDLETDRKDID 564

>ZYRO0A00308g Chr1 complement(16982..18676) [1695 bp, 564 aa] {ON}
           similar to uniprot|P43548 Saccharomyces cerevisiae
           YFL055W AGP3 Low-affinity amino acid permease may act to
           supply the cell with amino acids as nitrogen source in
           nitrogen-poor conditions transcription is induced under
           conditions of sulfur limitation
          Length = 564

 Score =  201 bits (510), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 142/490 (28%), Positives = 224/490 (45%), Gaps = 30/490 (6%)

Query: 50  LKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILISYSFVGLLVYTVMSCLGEM 109
           +K+ L+ RH+S+                       P+++L+ +S +G++ +T+M  +GEM
Sbjct: 51  VKRALKDRHISLLALGGIIGPGCLVGAGNALAKGGPLALLLGFSIIGIIAFTIMESIGEM 110

Query: 110 AAFIPLDG-FTSYASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVNP 168
               P  G FT+ A R+   ++    GY+Y+  +F V  N+    + + QFW       P
Sbjct: 111 ITLYPSGGGFTTLARRFHSDSLSAVCGYAYIVVFFAVMANEYNTLSSIFQFW------GP 164

Query: 169 GV----WITIFLALIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHD 224
            V    +I IF A        GV  FGE E+WLS  K                    +  
Sbjct: 165 QVPLYGYILIFWAAFQAFQMAGVGAFGEIEYWLSWFKILGLVAFYIFSTIYISGGIKDRP 224

Query: 225 RTGFRFWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRS 284
             GF +W +PGA         G KG               Y+GTE     A+E+KNP R+
Sbjct: 225 AFGFHYWNNPGALS------HGFKG----IAEVFVFCSTFYSGTESVAYSASESKNPNRA 274

Query: 285 VPRAIKLTLYRIVVFYVITILLLGMTVAYNDPRLLXXXXXXXXXXXXPFVVAIENASIPV 344
           +P AI+ T +RI+V Y+      G+TV YND  L             P  +AI  A    
Sbjct: 275 IPLAIRQTFWRILVVYIGIGFFYGVTVPYNDHNL----NAGTKALKSPISIAITRAGWEG 330

Query: 345 LPHIFNVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLF 404
             H+ N  +LV   SA N  L++ SR++  LA +G AP+  A T++ GVP  ++ L    
Sbjct: 331 GTHLVNAFILVTCISAINGSLFIGSRTITNLAHEGLAPKFLAWTDRRGVPIPAITLFNAL 390

Query: 405 CLLAYMNVSSGSAQVFNYFVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLSYTAA 464
            L++ MNVS G++  ++Y VN+  +   + W TI +T++RF KA   Q      L Y A 
Sbjct: 391 GLVSLMNVSVGASTAYSYIVNLSGVGVFIVWGTIGLTHLRFRKAWIKQGRTVKELPYKAL 450

Query: 465 FQPWSTYVALFFCCLIGLIKNYTVFLGHKFDYKTFISGYIGIPVYLICYVGYKVVYRTKL 524
           F P++  + +     + LI+ +T F+   F    F+  Y+ +P   + Y+G  ++   K 
Sbjct: 451 FYPYTQIIGIAANIFLALIQGWTSFV--PFKAGDFVDAYVLLPAAAVLYIGISLL---KT 505

Query: 525 IKPEDVDLYT 534
              + VDL T
Sbjct: 506 HSFKTVDLLT 515

>CAGL0L07546g Chr12 complement(833821..835725) [1905 bp, 634 aa]
           {ON} highly similar to uniprot|P38084 Saccharomyces
           cerevisiae YBR068c BAP2 or uniprot|P41815 Saccharomyces
           cerevisiae YDR046c PAP1
          Length = 634

 Score =  202 bits (513), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 141/507 (27%), Positives = 236/507 (46%), Gaps = 24/507 (4%)

Query: 39  EGVDGKHEGI----RLKKELEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSILISYSF 94
           EG D  H+ I     LKK +++RHV M                       P +++I Y  
Sbjct: 102 EGSD--HDSIITNTHLKKAMKSRHVMMMSLGTGIGTGLLVANAKGLHFGGPAALVIGYVL 159

Query: 95  VGLLVYTVMSCLGEMAAFIPL--DGFTSYASRYVDPAVGFAVGYSYLFKYFIVTPNQLTA 152
           V  + Y ++   GEMA   P     F +Y+S +V  A GFA  + +  ++  V P +L  
Sbjct: 160 VSFVTYFMIQAAGEMAVTYPTLPGNFNAYSSIFVSNAFGFATVWIFCIQWLTVLPLELIT 219

Query: 153 GAMVMQFWVSRDRVNPGVWITIFLALIVLINTVG-VRFFGEFEFWLSSVKXXXXXXXXXX 211
            ++ +++W   D++N  V+I IF   ++ I+  G V  +GE EF  +  K          
Sbjct: 220 ASLTIKYW--NDKINADVFIVIFYVFLLCIHLFGGVIAYGETEFLFNLCKILMVIGFIIM 277

Query: 212 XXXXXXXXXPNHDRTGFRFWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELC 271
                     N +  G +FW DPGAF   +   +GS+ K              Y GTEL 
Sbjct: 278 SIVINAGGAGNREYIGGKFWHDPGAF---AGKTAGSRFKGICYVLVSGYFS--YGGTELF 332

Query: 272 GIVAAEAKNPRRSVPRAIKLTLYRIVVFYVITILLLGMTVAYNDPRLLXXXXXXXXXXXX 331
            +   E  NPRRS P+A K +LYRI++ Y++T++L+G  V Y+   L+            
Sbjct: 333 ALSVNEQSNPRRSTPQASKSSLYRILIIYLLTMILIGFNVPYDSDELMGSGGSATHAS-- 390

Query: 332 PFVVAIENASIPVLPHIFNVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPRIFATTNKW 391
           P+V+A     + + PH  N  +L+ V S  NS LY A R +  LA  G AP+     ++ 
Sbjct: 391 PYVLAASLNGVKIAPHFINAVILISVISVANSSLYAAPRLMCSLAQQGYAPKFLDYVDRQ 450

Query: 392 GVPYYSLGLSVLFCLLAYMNVSSGSAQVFNYFVNVVSIFGLLSWITILITYIRFDKAIRV 451
           G P  +L   +L  ++ ++  S    +VF +   +  +  L +W +I+++++RF  A+++
Sbjct: 451 GRPLLALIACLLVGVIGFVAASPKEEEVFTWLAAIAGLSELFTWSSIMLSHVRFRMAMKL 510

Query: 452 QFGDKSSLSYTAAFQPWSTYVALFFCCLIGLIKNYTVFLGHKFDYK----TFISGYIGIP 507
           Q      L Y A    + +   + F  L+   + +T       D K    +F + Y+ +P
Sbjct: 511 QNRSLEELGYKATTGIYGSIYGVCFNLLVFAAQFWTALFPFGGDGKANANSFFANYLAMP 570

Query: 508 VYLICYVGYKVVYRT-KLIKPED-VDL 532
           ++L+ Y GY +  R  +L+KP D +DL
Sbjct: 571 IWLVFYFGYMLWTRDFQLLKPLDKIDL 597

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.326    0.141    0.437 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 49,615,209
Number of extensions: 1820628
Number of successful extensions: 7107
Number of sequences better than 10.0: 357
Number of HSP's gapped: 5405
Number of HSP's successfully gapped: 384
Length of query: 576
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 461
Effective length of database: 40,294,809
Effective search space: 18575906949
Effective search space used: 18575906949
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 68 (30.8 bits)