Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_33.155405.122ON56456427480.0
KLTH0B01188g5.122ON59356425930.0
TDEL0E050805.122ON56356324390.0
SAKL0G14894g5.122ON56456224250.0
SAKL0G10164gna 1ON56456223920.0
ACL134C5.122ON58656223700.0
Suva_10.1285.122ON56356223620.0
YLR044C (PDC1)5.122ON56356223600.0
Smik_12.1065.122ON56356223590.0
Skud_12.1105.122ON56356223560.0
NDAI0C031105.122ON56456223500.0
KLLA0E16303g5.122ON56356323470.0
ZYRO0F01606g5.122ON56356223330.0
CAGL0M07920g5.122ON56456223320.0
NCAS0D016605.122ON56456223270.0
Suva_10.227na 2ON56356223160.0
Kpol_1010.485.122ON56356223120.0
NDAI0A01400na 3ON56356223000.0
TPHA0H009505.122ON56356222980.0
Ecym_24795.122ON56456222820.0
KAFR0E020205.122ON56456222760.0
YLR134W (PDC5)na 2ON56356222740.0
Skud_12.203na 2ON56356222720.0
TPHA0Q00120singletonON56356222700.0
TBLA0B075205.122ON56356222660.0
AAL073Wna 1ON56356222570.0
Smik_12.197na 2ON56356222510.0
SAKL0F04334gsingletonON56456222310.0
NCAS0A14630na 3ON56356322260.0
Suva_7.369na 4ON56356222150.0
TBLA0B10060singletonON56456222150.0
YGR087C (PDC6)na 4ON56356221820.0
TBLA0D02840singletonON56356221800.0
KNAG0J01330singletonON56456221750.0
KAFR0E01520singletonON56356221660.0
KLTH0D08272gsingletonON56356321610.0
NDAI0A02510singletonON56356221340.0
TBLA0E03070singletonON56356121280.0
KNAG0M012505.122ON56356221270.0
KNAG0J01340singletonON56556521210.0
NCAS0A14240singletonON56556521200.0
NDAI0D03270singletonON52152120380.0
CAGL0G02937gna 4ON56456419600.0
Ecym_3185na 1ON56356219240.0
SAKL0E04972g2.390ON61155017660.0
KLTH0E09702g2.390ON60755115170.0
Kwal_47.178782.390ON61055115030.0
ZYRO0A08426g2.390ON58454614860.0
YDL080C (THI3)2.390ON60955614760.0
Suva_4.1672.390ON62055614700.0
TDEL0G032102.390ON60656814370.0
Skud_4.1752.390ON62055614310.0
Smik_4.1562.390ON62155614270.0
KNAG0A059002.390ON62055814070.0
CAGL0L06842g2.390ON63858214020.0
NCAS0A040002.390ON62556813880.0
NDAI0E017002.390ON62156413580.0
TPHA0G026202.390ON68859313590.0
KAFR0F029902.390ON60855813461e-180
TBLA0B088202.390ON63558713281e-177
Ecym_60552.390ON59256212431e-165
ADR254W2.390ON58156012071e-159
Kpol_1046.92.390ON5985629791e-125
KLLA0F16962g2.390ON5785558025e-99
SAKL0G03036g5.456ON6376017492e-90
CAGL0A03102g5.456ON6496017413e-89
NCAS0A118305.456ON6376117221e-86
ZYRO0G04378g5.456ON6136057061e-84
KLTH0F15510g5.456ON6256067072e-84
KAFR0E037305.456ON6356147002e-83
Kpol_440.45.456ON6366006993e-83
Suva_2.5545.456ON6356096923e-82
Kpol_1062.125.456ON6305986906e-82
YDR380W (ARO10)5.456ON6356136899e-82
KNAG0C047905.456ON6375976853e-81
Skud_4.6515.456ON6356036854e-81
ACR211W5.456ON6296116741e-79
TPHA0J026805.456ON6486276672e-78
Smik_4.6495.456ON6356176653e-78
TBLA0A026705.456ON6406226653e-78
TDEL0D024505.456ON6756136631e-77
KLLA0E02707g5.456ON6315986418e-75
TBLA0A064205.456ON6386136391e-74
TPHA0E016005.456ON6516006149e-71
SAKL0D00220gsingletonON5775826054e-70
NDAI0A044505.456ON5615495764e-66
KLTH0D00418gsingletonON5615645494e-62
TDEL0C07020singletonON5605665292e-59
TDEL0F00150singletonON5605665274e-59
Skud_7.383na 4ON86921535e-12
CAGL0K03465g2.441ON6773101592e-10
YMR108W (ILV2)2.441ON6873101545e-10
NDAI0H023802.441ON6853051474e-09
Smik_13.2972.441ON6873101474e-09
KAFR0A005702.441ON6823101474e-09
SAKL0E03740g2.441ON6793111474e-09
Kwal_26.75822.441ON6793011466e-09
NCAS0F015002.441ON6843091421e-08
TBLA0I014002.441ON7103151412e-08
Kpol_297.122.441ON6713101393e-08
KNAG0E023602.441ON6933091393e-08
KLLA0B12584g2.441ON6913051385e-08
KLTH0D04532g2.441ON6783011376e-08
Ecym_61072.441ON6893101377e-08
Suva_13.2872.441ON6873041369e-08
ZYRO0G19954g2.441ON7003111332e-07
KNAG0A062502.441ON6803091322e-07
Skud_13.2672.441ON6873031313e-07
TPHA0G024402.441ON6913031296e-07
TDEL0A021602.441ON6823041242e-06
NCAS0A043202.441ON6893141233e-06
AEL305C2.441ON6683071233e-06
NDAI0E020502.441ON6903101234e-06
TPHA0G028852.441ON6883031207e-06
SAKL0D10934g1.450ON5503611198e-06
TDEL0B055201.450ON5552901143e-05
ZYRO0E03454g1.450ON5494931082e-04
NCAS0G039601.450ON5775221072e-04
Smik_5.871.450ON5605151010.001
YEL020C1.450ON5604401000.001
Kwal_34.161161.450ON553130980.003
KLTH0H14102g1.450ON551130940.007
KAFR0K012905.660ON47188900.027
Skud_5.761.450ON560153880.041
KNAG0H015801.450ON56096840.13
Suva_5.681.450ON561154810.29
Ecym_13601.450ON544345810.30
CAGL0M03245g1.450ON56293751.8
TBLA0A02835singletonON31158732.2
NDAI0G005201.450ON575127742.3
TPHA0B039401.450ON575537732.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_33.15540
         (564 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_33.15540 s33 (1147974..1149668) [1695 bp, 564 aa] {ON} YLR0...  1063   0.0  
KLTH0B01188g Chr2 complement(104224..106005) [1782 bp, 593 aa] {...  1003   0.0  
TDEL0E05080 Chr5 (936841..938532) [1692 bp, 563 aa] {ON} Anc_5.1...   944   0.0  
SAKL0G14894g Chr7 (1275005..1276699) [1695 bp, 564 aa] {ON} unip...   938   0.0  
SAKL0G10164g Chr7 complement(867445..869139) [1695 bp, 564 aa] {...   926   0.0  
ACL134C Chr3 complement(117344..119104) [1761 bp, 586 aa] {ON} S...   917   0.0  
Suva_10.128 Chr10 complement(233880..235571) [1692 bp, 563 aa] {...   914   0.0  
YLR044C Chr12 complement(232390..234081) [1692 bp, 563 aa] {ON} ...   913   0.0  
Smik_12.106 Chr12 complement(213431..215122) [1692 bp, 563 aa] {...   913   0.0  
Skud_12.110 Chr12 complement(217239..218930) [1692 bp, 563 aa] {...   912   0.0  
NDAI0C03110 Chr3 (707463..709157) [1695 bp, 564 aa] {ON} Anc_5.122    909   0.0  
KLLA0E16303g Chr5 complement(1457903..1459594) [1692 bp, 563 aa]...   908   0.0  
ZYRO0F01606g Chr6 complement(130346..132037) [1692 bp, 563 aa] {...   903   0.0  
CAGL0M07920g Chr13 complement(789467..791161) [1695 bp, 564 aa] ...   902   0.0  
NCAS0D01660 Chr4 complement(313684..315378) [1695 bp, 564 aa] {O...   900   0.0  
Suva_10.227 Chr10 (419251..420942) [1692 bp, 563 aa] {ON} YLR134...   896   0.0  
Kpol_1010.48 s1010 (110999..112690) [1692 bp, 563 aa] {ON} (1109...   895   0.0  
NDAI0A01400 Chr1 (313925..315616) [1692 bp, 563 aa] {ON}              890   0.0  
TPHA0H00950 Chr8 (199181..200872) [1692 bp, 563 aa] {ON} Anc_5.1...   889   0.0  
Ecym_2479 Chr2 (938295..939989) [1695 bp, 564 aa] {ON} similar t...   883   0.0  
KAFR0E02020 Chr5 (400911..402605) [1695 bp, 564 aa] {ON} Anc_5.1...   881   0.0  
YLR134W Chr12 (410723..412414) [1692 bp, 563 aa] {ON}  PDC5Minor...   880   0.0  
Skud_12.203 Chr12 (393390..395081) [1692 bp, 563 aa] {ON} YLR134...   879   0.0  
TPHA0Q00120 Chr17 complement(8844..10535) [1692 bp, 563 aa] {ON}      879   0.0  
TBLA0B07520 Chr2 complement(1789035..1790726) [1692 bp, 563 aa] ...   877   0.0  
AAL073W Chr1 (216809..218500) [1692 bp, 563 aa] {ON} Non-synteni...   874   0.0  
Smik_12.197 Chr12 (392030..393721) [1692 bp, 563 aa] {ON} YLR134...   871   0.0  
SAKL0F04334g Chr6 complement(347639..349333) [1695 bp, 564 aa] {...   863   0.0  
NCAS0A14630 Chr1 complement(2878338..2880029) [1692 bp, 563 aa] ...   862   0.0  
Suva_7.369 Chr7 complement(627739..629430) [1692 bp, 563 aa] {ON...   857   0.0  
TBLA0B10060 Chr2 complement(2418979..2420673) [1695 bp, 564 aa] ...   857   0.0  
YGR087C Chr7 complement(651290..652981) [1692 bp, 563 aa] {ON}  ...   845   0.0  
TBLA0D02840 Chr4 complement(694649..696340) [1692 bp, 563 aa] {O...   844   0.0  
KNAG0J01330 Chr10 complement(240650..242344) [1695 bp, 564 aa] {...   842   0.0  
KAFR0E01520 Chr5 complement(306988..308679) [1692 bp, 563 aa] {O...   838   0.0  
KLTH0D08272g Chr4 complement(695296..696987) [1692 bp, 563 aa] {...   837   0.0  
NDAI0A02510 Chr1 complement(562483..564174) [1692 bp, 563 aa] {O...   826   0.0  
TBLA0E03070 Chr5 (771183..772874) [1692 bp, 563 aa] {ON}              824   0.0  
KNAG0M01250 Chr13 complement(229749..231440) [1692 bp, 563 aa] {...   823   0.0  
KNAG0J01340 Chr10 complement(243186..244883) [1698 bp, 565 aa] {...   821   0.0  
NCAS0A14240 Chr1 (2804135..2805832) [1698 bp, 565 aa] {ON}            821   0.0  
NDAI0D03270 Chr4 (778452..780017) [1566 bp, 521 aa] {ON}              789   0.0  
CAGL0G02937g Chr7 complement(268985..270679) [1695 bp, 564 aa] {...   759   0.0  
Ecym_3185 Chr3 (352629..354320) [1692 bp, 563 aa] {ON} similar t...   745   0.0  
SAKL0E04972g Chr5 (403578..405413) [1836 bp, 611 aa] {ON} simila...   684   0.0  
KLTH0E09702g Chr5 (874177..876000) [1824 bp, 607 aa] {ON} simila...   588   0.0  
Kwal_47.17878 s47 (590664..592496) [1833 bp, 610 aa] {ON} YDL080...   583   0.0  
ZYRO0A08426g Chr1 complement(675104..676858) [1755 bp, 584 aa] {...   577   0.0  
YDL080C Chr4 complement(310642..312471) [1830 bp, 609 aa] {ON}  ...   573   0.0  
Suva_4.167 Chr4 complement(300197..302059) [1863 bp, 620 aa] {ON...   570   0.0  
TDEL0G03210 Chr7 complement(597217..599037) [1821 bp, 606 aa] {O...   558   0.0  
Skud_4.175 Chr4 complement(306124..307986) [1863 bp, 620 aa] {ON...   555   0.0  
Smik_4.156 Chr4 complement(287087..288952) [1866 bp, 621 aa] {ON...   554   0.0  
KNAG0A05900 Chr1 complement(880996..882858) [1863 bp, 620 aa] {O...   546   0.0  
CAGL0L06842g Chr12 (771870..773786) [1917 bp, 638 aa] {ON} simil...   544   0.0  
NCAS0A04000 Chr1 complement(806883..808760) [1878 bp, 625 aa] {O...   539   0.0  
NDAI0E01700 Chr5 (337856..339721) [1866 bp, 621 aa] {ON} Anc_2.390    527   0.0  
TPHA0G02620 Chr7 complement(547384..549450) [2067 bp, 688 aa] {O...   528   0.0  
KAFR0F02990 Chr6 complement(589562..591388) [1827 bp, 608 aa] {O...   523   e-180
TBLA0B08820 Chr2 (2097075..2098982) [1908 bp, 635 aa] {ON} Anc_2...   516   e-177
Ecym_6055 Chr6 complement(105018..106796) [1779 bp, 592 aa] {ON}...   483   e-165
ADR254W Chr4 (1143623..1145368) [1746 bp, 581 aa] {ON} Syntenic ...   469   e-159
Kpol_1046.9 s1046 (18301..18855,18984..18992,19556..19693,19697....   381   e-125
KLLA0F16962g Chr6 complement(1559454..1561190) [1737 bp, 578 aa]...   313   5e-99
SAKL0G03036g Chr7 (250012..251925) [1914 bp, 637 aa] {ON} simila...   293   2e-90
CAGL0A03102g Chr1 (317961..319910) [1950 bp, 649 aa] {ON} simila...   290   3e-89
NCAS0A11830 Chr1 (2347016..2348929) [1914 bp, 637 aa] {ON} Anc_5...   282   1e-86
ZYRO0G04378g Chr7 complement(350070..351911) [1842 bp, 613 aa] {...   276   1e-84
KLTH0F15510g Chr6 complement(1265767..1267644) [1878 bp, 625 aa]...   276   2e-84
KAFR0E03730 Chr5 complement(746616..748523) [1908 bp, 635 aa] {O...   274   2e-83
Kpol_440.4 s440 (9465..11375) [1911 bp, 636 aa] {ON} (9465..1137...   273   3e-83
Suva_2.554 Chr2 (984966..986873) [1908 bp, 635 aa] {ON} YDR380W ...   271   3e-82
Kpol_1062.12 s1062 complement(31361..33253) [1893 bp, 630 aa] {O...   270   6e-82
YDR380W Chr4 (1234218..1236125) [1908 bp, 635 aa] {ON}  ARO10Phe...   270   9e-82
KNAG0C04790 Chr3 complement(932051..933964) [1914 bp, 637 aa] {O...   268   3e-81
Skud_4.651 Chr4 (1157087..1158994) [1908 bp, 635 aa] {ON} YDR380...   268   4e-81
ACR211W Chr3 (716693..718582) [1890 bp, 629 aa] {ON} Syntenic ho...   264   1e-79
TPHA0J02680 Chr10 (593893..595839) [1947 bp, 648 aa] {ON} Anc_5....   261   2e-78
Smik_4.649 Chr4 (1154670..1156577) [1908 bp, 635 aa] {ON} YDR380...   260   3e-78
TBLA0A02670 Chr1 complement(648495..650417) [1923 bp, 640 aa] {O...   260   3e-78
TDEL0D02450 Chr4 complement(477063..479090) [2028 bp, 675 aa] {O...   259   1e-77
KLLA0E02707g Chr5 (251220..253115) [1896 bp, 631 aa] {ON} simila...   251   8e-75
TBLA0A06420 Chr1 complement(1577160..1579076) [1917 bp, 638 aa] ...   250   1e-74
TPHA0E01600 Chr5 complement(325811..327766) [1956 bp, 651 aa] {O...   241   9e-71
SAKL0D00220g Chr4 complement(18466..20199) [1734 bp, 577 aa] {ON...   237   4e-70
NDAI0A04450 Chr1 complement(1006559..1008244) [1686 bp, 561 aa] ...   226   4e-66
KLTH0D00418g Chr4 complement(37778..39463) [1686 bp, 561 aa] {ON...   216   4e-62
TDEL0C07020 Chr3 complement(1283600..1285282) [1683 bp, 560 aa] ...   208   2e-59
TDEL0F00150 Chr6 (12055..13737) [1683 bp, 560 aa] {ON}                207   4e-59
Skud_7.383 Chr7 complement(638760..638846,638850..638882,638886....    64   5e-12
CAGL0K03465g Chr11 (320030..322063) [2034 bp, 677 aa] {ON} highl...    66   2e-10
YMR108W Chr13 (484084..486147) [2064 bp, 687 aa] {ON}  ILV2Aceto...    64   5e-10
NDAI0H02380 Chr8 (578157..580214) [2058 bp, 685 aa] {ON} Anc_2.441     61   4e-09
Smik_13.297 Chr13 (467578..469641) [2064 bp, 687 aa] {ON} YMR108...    61   4e-09
KAFR0A00570 Chr1 complement(101898..103946) [2049 bp, 682 aa] {O...    61   4e-09
SAKL0E03740g Chr5 (302160..304199) [2040 bp, 679 aa] {ON} highly...    61   4e-09
Kwal_26.7582 s26 (427437..429476) [2040 bp, 679 aa] {ON} YMR108W...    61   6e-09
NCAS0F01500 Chr6 (299388..301442) [2055 bp, 684 aa] {ON} Anc_2.4...    59   1e-08
TBLA0I01400 Chr9 (303028..305160) [2133 bp, 710 aa] {ON} Anc_2.4...    59   2e-08
Kpol_297.12 s297 complement(20788..22803) [2016 bp, 671 aa] {ON}...    58   3e-08
KNAG0E02360 Chr5 complement(470361..472442) [2082 bp, 693 aa] {O...    58   3e-08
KLLA0B12584g Chr2 complement(1100489..1102564) [2076 bp, 691 aa]...    58   5e-08
KLTH0D04532g Chr4 (417085..419121) [2037 bp, 678 aa] {ON} highly...    57   6e-08
Ecym_6107 Chr6 complement(201133..203202) [2070 bp, 689 aa] {ON}...    57   7e-08
Suva_13.287 Chr13 (465217..467280) [2064 bp, 687 aa] {ON} YMR108...    57   9e-08
ZYRO0G19954g Chr7 (1653353..1655455) [2103 bp, 700 aa] {ON} high...    56   2e-07
KNAG0A06250 Chr1 complement(948840..950882) [2043 bp, 680 aa] {O...    55   2e-07
Skud_13.267 Chr13 (459466..461529) [2064 bp, 687 aa] {ON} YMR108...    55   3e-07
TPHA0G02440 Chr7 complement(498107..500182) [2076 bp, 691 aa] {O...    54   6e-07
TDEL0A02160 Chr1 complement(389068..391116) [2049 bp, 682 aa] {O...    52   2e-06
NCAS0A04320 Chr1 complement(873722..875791) [2070 bp, 689 aa] {O...    52   3e-06
AEL305C Chr5 complement(69381..71387) [2007 bp, 668 aa] {ON} Syn...    52   3e-06
NDAI0E02050 Chr5 complement(414418..416490) [2073 bp, 690 aa] {O...    52   4e-06
TPHA0G02885 Chr7 complement(616977..619043) [2067 bp, 688 aa] {ON}     51   7e-06
SAKL0D10934g Chr4 (907649..909301) [1653 bp, 550 aa] {ON} simila...    50   8e-06
TDEL0B05520 Chr2 complement(980893..982560) [1668 bp, 555 aa] {O...    49   3e-05
ZYRO0E03454g Chr5 complement(270926..272575) [1650 bp, 549 aa] {...    46   2e-04
NCAS0G03960 Chr7 (733213..734946) [1734 bp, 577 aa] {ON} Anc_1.4...    46   2e-04
Smik_5.87 Chr5 complement(124637..126319) [1683 bp, 560 aa] {ON}...    44   0.001
YEL020C Chr5 complement(118617..120299) [1683 bp, 560 aa] {ON} P...    43   0.001
Kwal_34.16116 s34 complement(208847..210508) [1662 bp, 553 aa] {...    42   0.003
KLTH0H14102g Chr8 (1226474..1228129) [1656 bp, 551 aa] {ON} simi...    41   0.007
KAFR0K01290 Chr11 complement(267309..268724) [1416 bp, 471 aa] {...    39   0.027
Skud_5.76 Chr5 complement(117925..119607) [1683 bp, 560 aa] {ON}...    39   0.041
KNAG0H01580 Chr8 complement(279178..280860) [1683 bp, 560 aa] {O...    37   0.13 
Suva_5.68 Chr5 (108954..110639) [1686 bp, 561 aa] {ON} YEL020C (...    36   0.29 
Ecym_1360 Chr1 (739963..741597) [1635 bp, 544 aa] {ON} similar t...    36   0.30 
CAGL0M03245g Chr13 complement(372122..373810) [1689 bp, 562 aa] ...    33   1.8  
TBLA0A02835 Chr1 complement(683118..684053) [936 bp, 311 aa] {ON}      33   2.2  
NDAI0G00520 Chr7 complement(112068..113795) [1728 bp, 575 aa] {O...    33   2.3  
TPHA0B03940 Chr2 (928983..930710) [1728 bp, 575 aa] {ON} Anc_1.4...    33   2.5  

>Kwal_33.15540 s33 (1147974..1149668) [1695 bp, 564 aa] {ON} YLR044C
           (PDC1) - pyruvate decarboxylase [contig 290] FULL
          Length = 564

 Score = 1063 bits (2748), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 530/564 (93%), Positives = 530/564 (93%)

Query: 1   MSEITLGRYLFERLRQVECNTIFGLPGDFNLRLLDEIYETEGMRWXXXXXXXXXXXXXXX 60
           MSEITLGRYLFERLRQVECNTIFGLPGDFNLRLLDEIYETEGMRW               
Sbjct: 1   MSEITLGRYLFERLRQVECNTIFGLPGDFNLRLLDEIYETEGMRWAGNANELNAAYAADA 60

Query: 61  XXRIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120
             RIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG
Sbjct: 61  YARIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMISDLATAPAEIDRCIRTTYVRQRPVYLGLPSNFVDQMVPASL 180
           DFTVFHRMSANISETTAMISDLATAPAEIDRCIRTTYVRQRPVYLGLPSNFVDQMVPASL
Sbjct: 121 DFTVFHRMSANISETTAMISDLATAPAEIDRCIRTTYVRQRPVYLGLPSNFVDQMVPASL 180

Query: 181 LETPIDLSLKPNDAAAEQEVVSTVLDLIKNAKNPVILADACASRHDVKAETKKLIDVTQF 240
           LETPIDLSLKPNDAAAEQEVVSTVLDLIKNAKNPVILADACASRHDVKAETKKLIDVTQF
Sbjct: 181 LETPIDLSLKPNDAAAEQEVVSTVLDLIKNAKNPVILADACASRHDVKAETKKLIDVTQF 240

Query: 241 PSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESSDLILSVGALLSDFNTGSFSYS 300
           PSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESSDLILSVGALLSDFNTGSFSYS
Sbjct: 241 PSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESSDLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDHIKIRNATFPGVQMKFVLQKLLTQVGDVVKDYKPVAIPEIPGPNAAVD 360
           YKTKNIVEFHSDHIKIRNATFPGVQMKFVLQKLLTQVGDVVKDYKPVAIPEIPGPNAAVD
Sbjct: 301 YKTKNIVEFHSDHIKIRNATFPGVQMKFVLQKLLTQVGDVVKDYKPVAIPEIPGPNAAVD 360

Query: 361 DSTPLKQQWLWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIXXXXX 420
           DSTPLKQQWLWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSI     
Sbjct: 361 DSTPLKQQWLWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTG 420

Query: 421 XXXXXXXXXXXXDKNKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNNGYTIEKLI 480
                       DKNKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNNGYTIEKLI
Sbjct: 421 ATLGAAFAAEELDKNKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNNGYTIEKLI 480

Query: 481 HGEFAQYNEIQPWNHLDLLPTFGAKDYETVRVATTGEWNKLAEDQEFNKNSKIRMIEVML 540
           HGEFAQYNEIQPWNHLDLLPTFGAKDYETVRVATTGEWNKLAEDQEFNKNSKIRMIEVML
Sbjct: 481 HGEFAQYNEIQPWNHLDLLPTFGAKDYETVRVATTGEWNKLAEDQEFNKNSKIRMIEVML 540

Query: 541 PVMDAPESLVKQAQLTAATNAKSA 564
           PVMDAPESLVKQAQLTAATNAKSA
Sbjct: 541 PVMDAPESLVKQAQLTAATNAKSA 564

>KLTH0B01188g Chr2 complement(104224..106005) [1782 bp, 593 aa] {ON}
           highly similar to uniprot|P06169 Saccharomyces
           cerevisiae YLR044C PDC1 Major of three pyruvate
           decarboxylase isozymes key enzyme in alcoholic
           fermentation decarboxylates pyruvate to acetaldehyde
           subject to glucose- ethanol- and autoregulation involved
           in amino acid catabolism and to YLR134W uniprot|P16467
           Saccharomyces cerevisiae YLR134W PDC5 Minor isoform of
           pyruvate decarboxylase, key enzyme in alcoholic
           fermentation, decarboxylates pyruvate to acetaldehyde,
           regulation is glucose- and ethanol-dependent, repressed
           by thiamine, involved in amino acid catabolism
          Length = 593

 Score = 1003 bits (2593), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 474/564 (84%), Positives = 511/564 (90%)

Query: 1   MSEITLGRYLFERLRQVECNTIFGLPGDFNLRLLDEIYETEGMRWXXXXXXXXXXXXXXX 60
           MSEITLGRY+FERL+QV+  T+FGLPGDFNLRLLDEIYE EGMRW               
Sbjct: 30  MSEITLGRYVFERLKQVDVTTVFGLPGDFNLRLLDEIYEVEGMRWAGNCNELNASYAADA 89

Query: 61  XXRIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120
             RIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLH+VGVPS+SAQAKQLLLHHTLGNG
Sbjct: 90  YARIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHIVGVPSVSAQAKQLLLHHTLGNG 149

Query: 121 DFTVFHRMSANISETTAMISDLATAPAEIDRCIRTTYVRQRPVYLGLPSNFVDQMVPASL 180
           DFTVFHRMSANISETTAMI+DLATAP+EIDRCIRTTY+RQRPVYLGLPSNFVDQMVPASL
Sbjct: 150 DFTVFHRMSANISETTAMITDLATAPSEIDRCIRTTYIRQRPVYLGLPSNFVDQMVPASL 209

Query: 181 LETPIDLSLKPNDAAAEQEVVSTVLDLIKNAKNPVILADACASRHDVKAETKKLIDVTQF 240
           L+TPIDL+LKPND  AE+EV+ST+L++IK+AKNPVILADACASRHDVKAETKKLID+TQF
Sbjct: 210 LDTPIDLALKPNDQQAEEEVISTLLEMIKDAKNPVILADACASRHDVKAETKKLIDITQF 269

Query: 241 PSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESSDLILSVGALLSDFNTGSFSYS 300
           PSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVES+DL+LSVGALLSDFNTGSFSYS
Sbjct: 270 PSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESADLVLSVGALLSDFNTGSFSYS 329

Query: 301 YKTKNIVEFHSDHIKIRNATFPGVQMKFVLQKLLTQVGDVVKDYKPVAIPEIPGPNAAVD 360
           YKTKN+VEFHSDHIKIRNATFPGVQMKFVLQ LL +VG VVKDYKPV +PE+P PNAAVD
Sbjct: 330 YKTKNVVEFHSDHIKIRNATFPGVQMKFVLQSLLNKVGAVVKDYKPVPVPELPAPNAAVD 389

Query: 361 DSTPLKQQWLWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIXXXXX 420
            STPLKQQWLWNQVG+FLQEGD+V+TETGTSAFGINQTHFPNNTYGISQVLWGSI     
Sbjct: 390 PSTPLKQQWLWNQVGQFLQEGDIVLTETGTSAFGINQTHFPNNTYGISQVLWGSIGYATG 449

Query: 421 XXXXXXXXXXXXDKNKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNNGYTIEKLI 480
                       DK+KRVILF G+GSLQLT QEISTM+RW LKPYLFVLNN GYTIEKLI
Sbjct: 450 ACLGAVMAAEELDKSKRVILFTGEGSLQLTAQEISTMVRWNLKPYLFVLNNKGYTIEKLI 509

Query: 481 HGEFAQYNEIQPWNHLDLLPTFGAKDYETVRVATTGEWNKLAEDQEFNKNSKIRMIEVML 540
           HG  A+YNEIQ WNHLDLLPTFGAKDYE +RV+TTGEWNKLAED++FNKNSKIR+IE+ML
Sbjct: 510 HGPTAEYNEIQNWNHLDLLPTFGAKDYEAIRVSTTGEWNKLAEDKDFNKNSKIRLIELML 569

Query: 541 PVMDAPESLVKQAQLTAATNAKSA 564
           PVMDAPESLVKQAQLTAATNAKSA
Sbjct: 570 PVMDAPESLVKQAQLTAATNAKSA 593

>TDEL0E05080 Chr5 (936841..938532) [1692 bp, 563 aa] {ON} Anc_5.122
           YLR044C
          Length = 563

 Score =  944 bits (2439), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 456/563 (80%), Positives = 487/563 (86%)

Query: 1   MSEITLGRYLFERLRQVECNTIFGLPGDFNLRLLDEIYETEGMRWXXXXXXXXXXXXXXX 60
           MSEITLGRYLFERL+QV+ NTIFGLPGDFNL LLD+IYE  GMRW               
Sbjct: 1   MSEITLGRYLFERLKQVDTNTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60

Query: 61  XXRIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120
             R+KGM+ L+TTFGVGELSALNGIAGSYAEHVGVLH+VGVPSIS+QAKQLLLHHTLGNG
Sbjct: 61  YARVKGMAALVTTFGVGELSALNGIAGSYAEHVGVLHIVGVPSISSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMISDLATAPAEIDRCIRTTYVRQRPVYLGLPSNFVDQMVPASL 180
           DFTVFHRMSANISETTAMI+D+ +APAEIDRCIRTTYV QRPVYLGLP+N VD  VPASL
Sbjct: 121 DFTVFHRMSANISETTAMITDINSAPAEIDRCIRTTYVSQRPVYLGLPANLVDLKVPASL 180

Query: 181 LETPIDLSLKPNDAAAEQEVVSTVLDLIKNAKNPVILADACASRHDVKAETKKLIDVTQF 240
           L+TPIDLSLK NDA AEQEVV  VL LIK AKNPVILADAC SRHDVK ET+KLID+TQF
Sbjct: 181 LDTPIDLSLKANDAEAEQEVVDDVLALIKAAKNPVILADACCSRHDVKDETRKLIDITQF 240

Query: 241 PSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESSDLILSVGALLSDFNTGSFSYS 300
           PSFVTPMGKGSIDE++PRFGGVYVGTLSSP VKEAVES+DLILSVGALLSDFNTGSFSYS
Sbjct: 241 PSFVTPMGKGSIDEQNPRFGGVYVGTLSSPEVKEAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDHIKIRNATFPGVQMKFVLQKLLTQVGDVVKDYKPVAIPEIPGPNAAVD 360
           YKTKNIVEFHSD+IKIRNATFPGVQMKF LQKLL +VGDV KDYKPV +P     NAA  
Sbjct: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLAKVGDVAKDYKPVQVPARTPENAATA 360

Query: 361 DSTPLKQQWLWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIXXXXX 420
           DSTPLKQQW+WNQVGKFLQEGDVVITETGTSAFGINQ+HFPN TYGISQVLWGSI     
Sbjct: 361 DSTPLKQQWIWNQVGKFLQEGDVVITETGTSAFGINQSHFPNKTYGISQVLWGSIGFTTG 420

Query: 421 XXXXXXXXXXXXDKNKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNNGYTIEKLI 480
                       D  KRVILFIGDGSLQLTVQEISTM+RWGLKPYLFVLNN+GYTIE+LI
Sbjct: 421 ATLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMVRWGLKPYLFVLNNDGYTIERLI 480

Query: 481 HGEFAQYNEIQPWNHLDLLPTFGAKDYETVRVATTGEWNKLAEDQEFNKNSKIRMIEVML 540
           HGE AQYN+IQPW +LDLLPTFGAKDYET RV+TTGEWNKL  D EFNKNSKIRMIEVML
Sbjct: 481 HGEKAQYNDIQPWKNLDLLPTFGAKDYETHRVSTTGEWNKLTTDSEFNKNSKIRMIEVML 540

Query: 541 PVMDAPESLVKQAQLTAATNAKS 563
           PVMDAP SLV QAQLTA+ NAK+
Sbjct: 541 PVMDAPSSLVAQAQLTASINAKN 563

>SAKL0G14894g Chr7 (1275005..1276699) [1695 bp, 564 aa] {ON}
           uniprot|Q6XAF0 Saccharomyces kluyveri PDC12 Pyruvate
           decarboxylase
          Length = 564

 Score =  938 bits (2425), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 462/562 (82%), Positives = 500/562 (88%)

Query: 1   MSEITLGRYLFERLRQVECNTIFGLPGDFNLRLLDEIYETEGMRWXXXXXXXXXXXXXXX 60
           MSEITLGRYLFERL QVE  TIFGLPGDFNL LLD+IYE  GMRW               
Sbjct: 1   MSEITLGRYLFERLNQVEVQTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60

Query: 61  XXRIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120
             RIKGMSC+ITTFGVGELSALNGIAGSYAEHVGVLHVVGVPS+S+QAKQLLLHHTLGNG
Sbjct: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSVSSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMISDLATAPAEIDRCIRTTYVRQRPVYLGLPSNFVDQMVPASL 180
           DFTVFHRMSANISETTA ++D+ATAPAEIDRCIRTTYV QRPVYLGLP+N VD MVPASL
Sbjct: 121 DFTVFHRMSANISETTAWVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLMVPASL 180

Query: 181 LETPIDLSLKPNDAAAEQEVVSTVLDLIKNAKNPVILADACASRHDVKAETKKLIDVTQF 240
           L+TPIDLSLKPND  AE EVV+TVL+LIK+AKNPVILADACASRH+VK+ETK+LID+TQF
Sbjct: 181 LDTPIDLSLKPNDPEAEAEVVNTVLELIKDAKNPVILADACASRHNVKSETKQLIDITQF 240

Query: 241 PSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESSDLILSVGALLSDFNTGSFSYS 300
           P+FVTP+GKGSIDE+HPRFGGVYVGTLS+  VKEAVES+DLILSVGALLSDFNTGSFSYS
Sbjct: 241 PAFVTPLGKGSIDEQHPRFGGVYVGTLSNDDVKEAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDHIKIRNATFPGVQMKFVLQKLLTQVGDVVKDYKPVAIPEIPGPNAAVD 360
           YKTKNIVEFHSD+IKIRNATFPGVQMKF LQKLL+QVG+VVKDYKPVA+P  P PN A D
Sbjct: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLSQVGEVVKDYKPVAVPAKPTPNPACD 360

Query: 361 DSTPLKQQWLWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIXXXXX 420
            STPLKQ+W+WNQVG+FLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSI     
Sbjct: 361 PSTPLKQEWVWNQVGRFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTG 420

Query: 421 XXXXXXXXXXXXDKNKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNNGYTIEKLI 480
                       DKNKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNN+GYTIE+LI
Sbjct: 421 ACLGAACAAEELDKNKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIERLI 480

Query: 481 HGEFAQYNEIQPWNHLDLLPTFGAKDYETVRVATTGEWNKLAEDQEFNKNSKIRMIEVML 540
           HGE AQYNEIQPW +LDLLPTFGAKDYET RVATTGEW+KLA+D+ FNKNS+IRM+EVML
Sbjct: 481 HGENAQYNEIQPWKNLDLLPTFGAKDYETYRVATTGEWDKLAQDEAFNKNSRIRMVEVML 540

Query: 541 PVMDAPESLVKQAQLTAATNAK 562
           PVMDAP +LVKQAQLTA+ NAK
Sbjct: 541 PVMDAPSNLVKQAQLTASINAK 562

>SAKL0G10164g Chr7 complement(867445..869139) [1695 bp, 564 aa] {ON}
           uniprot|Q6W9G6 Saccharomyces kluyveri PDC11 Pyruvate
           decarboxylase
          Length = 564

 Score =  926 bits (2392), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 455/562 (80%), Positives = 497/562 (88%)

Query: 1   MSEITLGRYLFERLRQVECNTIFGLPGDFNLRLLDEIYETEGMRWXXXXXXXXXXXXXXX 60
           MSEITLG YLFERL QV+  TIFGLPGDFNL LLD+IYE  GMRW               
Sbjct: 1   MSEITLGLYLFERLNQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60

Query: 61  XXRIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120
             R+KGMSC+ITTFGVGELSALNGIAGSYAEHVGVLHVVGVPS+S+QAKQLLLHHTLGNG
Sbjct: 61  YARVKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSVSSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMISDLATAPAEIDRCIRTTYVRQRPVYLGLPSNFVDQMVPASL 180
           DFTVFHRMSANISETTA ++D+ATAPAEIDRCIRTTYV QRPVYLGLP+N VD MVPASL
Sbjct: 121 DFTVFHRMSANISETTAWVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLMVPASL 180

Query: 181 LETPIDLSLKPNDAAAEQEVVSTVLDLIKNAKNPVILADACASRHDVKAETKKLIDVTQF 240
           L+TPIDLSLKPND  AE EVV++VL+LIK+AKNP+ILADACASRHDVK ETK+LID+TQF
Sbjct: 181 LDTPIDLSLKPNDPEAEAEVVNSVLELIKDAKNPIILADACASRHDVKPETKQLIDITQF 240

Query: 241 PSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESSDLILSVGALLSDFNTGSFSYS 300
           P+FVTP+GKGSIDE+HPRFGGVYVGTLS+  VKEAVES+DLILSVGALLSDFNTGSFSYS
Sbjct: 241 PAFVTPLGKGSIDEQHPRFGGVYVGTLSNDDVKEAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDHIKIRNATFPGVQMKFVLQKLLTQVGDVVKDYKPVAIPEIPGPNAAVD 360
           YKTKNIVEFHSD+IKIRNATFPGVQMKF LQKLL+++G VVKDYKPVA+P  P PN A D
Sbjct: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLSEIGAVVKDYKPVAVPPKPTPNPACD 360

Query: 361 DSTPLKQQWLWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIXXXXX 420
            STPLKQ+W+WNQVG+FLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSI     
Sbjct: 361 PSTPLKQEWVWNQVGRFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTG 420

Query: 421 XXXXXXXXXXXXDKNKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNNGYTIEKLI 480
                       DKNKRVILFIGDGSLQLTVQEISTMIRWGL+PYLFVLNN+GYTIE+LI
Sbjct: 421 ACLGAACAAEELDKNKRVILFIGDGSLQLTVQEISTMIRWGLRPYLFVLNNDGYTIERLI 480

Query: 481 HGEFAQYNEIQPWNHLDLLPTFGAKDYETVRVATTGEWNKLAEDQEFNKNSKIRMIEVML 540
           HGE AQYNEIQPW +LDLLPTFGAKDYET RVATTGEW+KLA+D+ FNKNS+IRM+EVML
Sbjct: 481 HGENAQYNEIQPWKNLDLLPTFGAKDYETYRVATTGEWDKLAQDEAFNKNSRIRMVEVML 540

Query: 541 PVMDAPESLVKQAQLTAATNAK 562
           PVMDAP +LVKQAQLTA+ NAK
Sbjct: 541 PVMDAPSNLVKQAQLTASINAK 562

>ACL134C Chr3 complement(117344..119104) [1761 bp, 586 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR044C
           (PDC1) and Non-syntenic homolog of Saccharomyces
           cerevisiae YLR134W (PDC5) and YGR087C (PDC6)
          Length = 586

 Score =  917 bits (2370), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 448/562 (79%), Positives = 487/562 (86%)

Query: 1   MSEITLGRYLFERLRQVECNTIFGLPGDFNLRLLDEIYETEGMRWXXXXXXXXXXXXXXX 60
           MSEITLGRYLFERLRQ+E  TIFGLPGDFNL LLD+IYE EGMRW               
Sbjct: 23  MSEITLGRYLFERLRQIEVQTIFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 82

Query: 61  XXRIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120
             R+KGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG
Sbjct: 83  YARLKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 142

Query: 121 DFTVFHRMSANISETTAMISDLATAPAEIDRCIRTTYVRQRPVYLGLPSNFVDQMVPASL 180
           DFTVFHRMSANIS TTAMISD+ +APAEIDRCIRT Y+ QRPVYLGLP+N VD  VPASL
Sbjct: 143 DFTVFHRMSANISGTTAMISDITSAPAEIDRCIRTCYITQRPVYLGLPANMVDLKVPASL 202

Query: 181 LETPIDLSLKPNDAAAEQEVVSTVLDLIKNAKNPVILADACASRHDVKAETKKLIDVTQF 240
           LETPIDL+LKPND  AE EVV TVL++I  AKNPVIL+DACASRHDVKAET KLIDVTQF
Sbjct: 203 LETPIDLNLKPNDPEAEAEVVETVLEMIAAAKNPVILSDACASRHDVKAETMKLIDVTQF 262

Query: 241 PSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESSDLILSVGALLSDFNTGSFSYS 300
           P+FVTPMGKGSI E+HPRFGGVYVGTLSSP VKEAVES+DL+LSVGALLSDFNTGSFSYS
Sbjct: 263 PAFVTPMGKGSIYEQHPRFGGVYVGTLSSPEVKEAVESADLVLSVGALLSDFNTGSFSYS 322

Query: 301 YKTKNIVEFHSDHIKIRNATFPGVQMKFVLQKLLTQVGDVVKDYKPVAIPEIPGPNAAVD 360
           YKTKN+VEFHSDHIKIRNATFPGVQMK+VL+KL+  V +V+K Y PV +P  P  N  +D
Sbjct: 323 YKTKNVVEFHSDHIKIRNATFPGVQMKYVLRKLVDNVAEVIKSYVPVPVPSKPANNEEID 382

Query: 361 DSTPLKQQWLWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIXXXXX 420
            +TPLKQ+WLWNQVGKFL+EGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSI     
Sbjct: 383 SATPLKQEWLWNQVGKFLREGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTG 442

Query: 421 XXXXXXXXXXXXDKNKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNNGYTIEKLI 480
                       D N+RVILFIGDGSLQLTVQEISTM+RWGLKPYLFVLNN+GYTIE+LI
Sbjct: 443 ACLGAAFAAEELDPNRRVILFIGDGSLQLTVQEISTMVRWGLKPYLFVLNNDGYTIERLI 502

Query: 481 HGEFAQYNEIQPWNHLDLLPTFGAKDYETVRVATTGEWNKLAEDQEFNKNSKIRMIEVML 540
           HGE AQYN+IQPW HL+LLPTFGAKDYE VRV+TTGEW+ L +D+ FN+NSKIRMIEVML
Sbjct: 503 HGETAQYNDIQPWQHLNLLPTFGAKDYEAVRVSTTGEWDALTQDKAFNENSKIRMIEVML 562

Query: 541 PVMDAPESLVKQAQLTAATNAK 562
           PVMDAP +LVKQA+LTAATNAK
Sbjct: 563 PVMDAPSNLVKQAELTAATNAK 584

>Suva_10.128 Chr10 complement(233880..235571) [1692 bp, 563 aa] {ON}
           YLR044C (REAL)
          Length = 563

 Score =  914 bits (2362), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 451/562 (80%), Positives = 487/562 (86%)

Query: 1   MSEITLGRYLFERLRQVECNTIFGLPGDFNLRLLDEIYETEGMRWXXXXXXXXXXXXXXX 60
           MSEITLG+YLFERL QV  NT+FGLPGDFNL LLD+IYE EGMRW               
Sbjct: 1   MSEITLGKYLFERLNQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60

Query: 61  XXRIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120
             RIKGMSC+ITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG
Sbjct: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMISDLATAPAEIDRCIRTTYVRQRPVYLGLPSNFVDQMVPASL 180
           DFTVFHRMSANISETTAMI+D+ATAPAEIDRCIRTTYV QRPVYLGLP+N VD  VPA L
Sbjct: 121 DFTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVPAKL 180

Query: 181 LETPIDLSLKPNDAAAEQEVVSTVLDLIKNAKNPVILADACASRHDVKAETKKLIDVTQF 240
           LETPID+SLKPNDA +E+EV+ T+L L+K+AKNP+ILADAC SRHDVKAETKKLID+TQF
Sbjct: 181 LETPIDMSLKPNDAESEKEVIDTILALVKDAKNPIILADACCSRHDVKAETKKLIDLTQF 240

Query: 241 PSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESSDLILSVGALLSDFNTGSFSYS 300
           PSFVTPMGKGSIDEKHPR+GGVYVGTLS P VK+AVES+DLILSVGALLSDFNTGSFSYS
Sbjct: 241 PSFVTPMGKGSIDEKHPRYGGVYVGTLSKPEVKKAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDHIKIRNATFPGVQMKFVLQKLLTQVGDVVKDYKPVAIPEIPGPNAAVD 360
           YKTKNIVEFHSDH+KIRNATFPGVQMKFVLQKLLT V D  K YKPVA+P     NAAV 
Sbjct: 301 YKTKNIVEFHSDHMKIRNATFPGVQMKFVLQKLLTTVADAAKGYKPVAVPAPTPANAAVP 360

Query: 361 DSTPLKQQWLWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIXXXXX 420
            STPLKQ+W+WNQ+G+FLQEGDVVI ETGTSAFGINQ  FPNNTYGISQVLWGSI     
Sbjct: 361 ASTPLKQEWMWNQLGEFLQEGDVVIAETGTSAFGINQVAFPNNTYGISQVLWGSIGFTTG 420

Query: 421 XXXXXXXXXXXXDKNKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNNGYTIEKLI 480
                       D  KRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNN+GYTIEKLI
Sbjct: 421 ATLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIEKLI 480

Query: 481 HGEFAQYNEIQPWNHLDLLPTFGAKDYETVRVATTGEWNKLAEDQEFNKNSKIRMIEVML 540
           HG  AQYNEIQ W+HL LLPTFGAKDYET RVATTGEW+KL +D+ FN+NSKIRMIE+ML
Sbjct: 481 HGPKAQYNEIQNWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNENSKIRMIEIML 540

Query: 541 PVMDAPESLVKQAQLTAATNAK 562
           PV DAP++LV+QA+LTAATNAK
Sbjct: 541 PVFDAPQNLVEQAKLTAATNAK 562

>YLR044C Chr12 complement(232390..234081) [1692 bp, 563 aa] {ON}
           PDC1Major of three pyruvate decarboxylase isozymes, key
           enzyme in alcoholic fermentation, decarboxylates
           pyruvate to acetaldehyde; subject to glucose-, ethanol-,
           and autoregulation; involved in amino acid catabolism
          Length = 563

 Score =  913 bits (2360), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 450/562 (80%), Positives = 487/562 (86%)

Query: 1   MSEITLGRYLFERLRQVECNTIFGLPGDFNLRLLDEIYETEGMRWXXXXXXXXXXXXXXX 60
           MSEITLG+YLFERL+QV  NT+FGLPGDFNL LLD+IYE EGMRW               
Sbjct: 1   MSEITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60

Query: 61  XXRIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120
             RIKGMSC+ITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG
Sbjct: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMISDLATAPAEIDRCIRTTYVRQRPVYLGLPSNFVDQMVPASL 180
           DFTVFHRMSANISETTAMI+D+ATAPAEIDRCIRTTYV QRPVYLGLP+N VD  VPA L
Sbjct: 121 DFTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVPAKL 180

Query: 181 LETPIDLSLKPNDAAAEQEVVSTVLDLIKNAKNPVILADACASRHDVKAETKKLIDVTQF 240
           L+TPID+SLKPNDA +E+EV+ T+L L+K+AKNPVILADAC SRHDVKAETKKLID+TQF
Sbjct: 181 LQTPIDMSLKPNDAESEKEVIDTILALVKDAKNPVILADACCSRHDVKAETKKLIDLTQF 240

Query: 241 PSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESSDLILSVGALLSDFNTGSFSYS 300
           P+FVTPMGKGSIDE+HPR+GGVYVGTLS P VKEAVES+DLILSVGALLSDFNTGSFSYS
Sbjct: 241 PAFVTPMGKGSIDEQHPRYGGVYVGTLSKPEVKEAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDHIKIRNATFPGVQMKFVLQKLLTQVGDVVKDYKPVAIPEIPGPNAAVD 360
           YKTKNIVEFHSDH+KIRNATFPGVQMKFVLQKLLT + D  K YKPVA+P     NAAV 
Sbjct: 301 YKTKNIVEFHSDHMKIRNATFPGVQMKFVLQKLLTTIADAAKGYKPVAVPARTPANAAVP 360

Query: 361 DSTPLKQQWLWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIXXXXX 420
            STPLKQ+W+WNQ+G FLQEGDVVI ETGTSAFGINQT FPNNTYGISQVLWGSI     
Sbjct: 361 ASTPLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIGFTTG 420

Query: 421 XXXXXXXXXXXXDKNKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNNGYTIEKLI 480
                       D  KRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNN+GYTIEKLI
Sbjct: 421 ATLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIEKLI 480

Query: 481 HGEFAQYNEIQPWNHLDLLPTFGAKDYETVRVATTGEWNKLAEDQEFNKNSKIRMIEVML 540
           HG  AQYNEIQ W+HL LLPTFGAKDYET RVATTGEW+KL +D+ FN NSKIRMIE+ML
Sbjct: 481 HGPKAQYNEIQGWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNDNSKIRMIEIML 540

Query: 541 PVMDAPESLVKQAQLTAATNAK 562
           PV DAP++LV+QA+LTAATNAK
Sbjct: 541 PVFDAPQNLVEQAKLTAATNAK 562

>Smik_12.106 Chr12 complement(213431..215122) [1692 bp, 563 aa] {ON}
           YLR044C (REAL)
          Length = 563

 Score =  913 bits (2359), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 451/562 (80%), Positives = 486/562 (86%)

Query: 1   MSEITLGRYLFERLRQVECNTIFGLPGDFNLRLLDEIYETEGMRWXXXXXXXXXXXXXXX 60
           MSEITLG+YLFERL+QV  NT+FGLPGDFNL LLD+IYE EGMRW               
Sbjct: 1   MSEITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60

Query: 61  XXRIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120
             RIKGMSC+ITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG
Sbjct: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMISDLATAPAEIDRCIRTTYVRQRPVYLGLPSNFVDQMVPASL 180
           DFTVFHRMSANISETTAMI+D+ATAPAEIDRCIRTTYV QRPVYLGLP+N VD  VPA L
Sbjct: 121 DFTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVPAKL 180

Query: 181 LETPIDLSLKPNDAAAEQEVVSTVLDLIKNAKNPVILADACASRHDVKAETKKLIDVTQF 240
           LETPID+SLK NDA +E+EV+ T+L L+K+AKNPVILADAC SRHDVKAETKKLID+TQF
Sbjct: 181 LETPIDMSLKANDAESEKEVIDTILSLVKDAKNPVILADACCSRHDVKAETKKLIDLTQF 240

Query: 241 PSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESSDLILSVGALLSDFNTGSFSYS 300
           P+FVTPMGKGSIDE+HPR+GGVYVGTLS P VKEAVES+DLILSVGALLSDFNTGSFSYS
Sbjct: 241 PAFVTPMGKGSIDEQHPRYGGVYVGTLSKPEVKEAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDHIKIRNATFPGVQMKFVLQKLLTQVGDVVKDYKPVAIPEIPGPNAAVD 360
           YKTKNIVEFHSDH+KIRNATFPGVQMKFVLQKLLT + D  K YKPVA+P     NAAV 
Sbjct: 301 YKTKNIVEFHSDHMKIRNATFPGVQMKFVLQKLLTVIADAAKGYKPVAVPANTPANAAVP 360

Query: 361 DSTPLKQQWLWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIXXXXX 420
            STPLKQ+W+WNQ+G FLQEGDVVI ETGTSAFGINQT FPNNTYGISQVLWGSI     
Sbjct: 361 ASTPLKQEWMWNQLGSFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIGFTTG 420

Query: 421 XXXXXXXXXXXXDKNKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNNGYTIEKLI 480
                       D  KRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNN+GYTIEKLI
Sbjct: 421 ATLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIEKLI 480

Query: 481 HGEFAQYNEIQPWNHLDLLPTFGAKDYETVRVATTGEWNKLAEDQEFNKNSKIRMIEVML 540
           HG  AQYNEIQ W+HL LLPTFGAKDYET RVATTGEW+KL +D+ FN NSKIRMIEVML
Sbjct: 481 HGPKAQYNEIQNWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNDNSKIRMIEVML 540

Query: 541 PVMDAPESLVKQAQLTAATNAK 562
           PV DAP++LV+QA+LTAATNAK
Sbjct: 541 PVFDAPQNLVEQAKLTAATNAK 562

>Skud_12.110 Chr12 complement(217239..218930) [1692 bp, 563 aa] {ON}
           YLR044C (REAL)
          Length = 563

 Score =  912 bits (2356), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 448/562 (79%), Positives = 487/562 (86%)

Query: 1   MSEITLGRYLFERLRQVECNTIFGLPGDFNLRLLDEIYETEGMRWXXXXXXXXXXXXXXX 60
           MSE+TLG+YLFERL+QV  NT+FGLPGDFNL LLD+IYE EGMRW               
Sbjct: 1   MSELTLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60

Query: 61  XXRIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120
             RIKGMSC+ITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG
Sbjct: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMISDLATAPAEIDRCIRTTYVRQRPVYLGLPSNFVDQMVPASL 180
           DFTVFHRMSANISETTAMI+D+ATAPAEIDRCIRTTYV QRPVYLGLP+N VD  V A L
Sbjct: 121 DFTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVDAKL 180

Query: 181 LETPIDLSLKPNDAAAEQEVVSTVLDLIKNAKNPVILADACASRHDVKAETKKLIDVTQF 240
           L+TPID+SLKPNDA +E+EV+ T++ L+K+AKNPVILADAC SRHDVKAETKKLID+TQF
Sbjct: 181 LDTPIDMSLKPNDAESEKEVIDTIMALVKDAKNPVILADACCSRHDVKAETKKLIDLTQF 240

Query: 241 PSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESSDLILSVGALLSDFNTGSFSYS 300
           P+FVTPMGKGSIDE+HPR+GGVYVGTLS PAVKEAVES+DLILSVGALLSDFNTGSFSYS
Sbjct: 241 PAFVTPMGKGSIDEQHPRYGGVYVGTLSKPAVKEAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDHIKIRNATFPGVQMKFVLQKLLTQVGDVVKDYKPVAIPEIPGPNAAVD 360
           YKTKNIVEFHSDHIKIRNATFPGVQMKFVLQKLLT + D  K YKPVA+P     NAAV 
Sbjct: 301 YKTKNIVEFHSDHIKIRNATFPGVQMKFVLQKLLTTIADAAKGYKPVAVPAGTPANAAVA 360

Query: 361 DSTPLKQQWLWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIXXXXX 420
            STPLKQ+W+WNQ+G FLQEGDVVI ETGTSAFGINQT FPNNTYGISQVLWGSI     
Sbjct: 361 ASTPLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIGFTTG 420

Query: 421 XXXXXXXXXXXXDKNKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNNGYTIEKLI 480
                       D  KRVILFIGDGSLQLTVQEISTMIRWGLKPYLF+LNN+GYTIEKLI
Sbjct: 421 ATLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFILNNDGYTIEKLI 480

Query: 481 HGEFAQYNEIQPWNHLDLLPTFGAKDYETVRVATTGEWNKLAEDQEFNKNSKIRMIEVML 540
           HG  AQYNEIQ W+HL LLPTFGAKDYET RVATTGEW+KL +D+ FN NSKIRMIE+ML
Sbjct: 481 HGPKAQYNEIQNWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNDNSKIRMIEIML 540

Query: 541 PVMDAPESLVKQAQLTAATNAK 562
           PV DAP++LV+QA+LTAATNAK
Sbjct: 541 PVFDAPQNLVEQAKLTAATNAK 562

>NDAI0C03110 Chr3 (707463..709157) [1695 bp, 564 aa] {ON} Anc_5.122
          Length = 564

 Score =  909 bits (2350), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 456/562 (81%), Positives = 488/562 (86%)

Query: 1   MSEITLGRYLFERLRQVECNTIFGLPGDFNLRLLDEIYETEGMRWXXXXXXXXXXXXXXX 60
           MSEITLGRYLFERL QV+  TIFGLPGDFNL LLD+IYET GMRW               
Sbjct: 1   MSEITLGRYLFERLSQVDVKTIFGLPGDFNLSLLDKIYETPGMRWAGNANELNAAYAADG 60

Query: 61  XXRIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120
             RIKGMSC+ITTFGVGELSALNGIAGSYAEHVGVLHVVGVPS+S+QAKQLLLHHTLGNG
Sbjct: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSVSSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMISDLATAPAEIDRCIRTTYVRQRPVYLGLPSNFVDQMVPASL 180
           DFTVFHRMSANISETTAM++D+ATAPAEIDRCIRTTYV QRPVYLGLP+N VD  VPASL
Sbjct: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASL 180

Query: 181 LETPIDLSLKPNDAAAEQEVVSTVLDLIKNAKNPVILADACASRHDVKAETKKLIDVTQF 240
           LETPIDLSLK ND  AE EVV+T+L+LIK+AKNPVILADACASRHDVKAETKKLID+TQF
Sbjct: 181 LETPIDLSLKANDVEAETEVVNTILELIKDAKNPVILADACASRHDVKAETKKLIDITQF 240

Query: 241 PSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESSDLILSVGALLSDFNTGSFSYS 300
           PSFVTPMGKGSIDE+HPRFGGVYVGTLSSPAVKEAVES+DLILSVGALLSDFNTGSFSYS
Sbjct: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAVKEAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDHIKIRNATFPGVQMKFVLQKLLTQVGDVVKDYKPVAIPEIPGPNAAVD 360
           YKTKNIVEFHSD+IKI+NATFPGVQMKF LQKLL  V +  K YKPVA+P  P  NAAVD
Sbjct: 301 YKTKNIVEFHSDYIKIKNATFPGVQMKFALQKLLGSVAEAAKGYKPVAVPAKPAANAAVD 360

Query: 361 DSTPLKQQWLWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIXXXXX 420
            +TPLKQ+W+WNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSI     
Sbjct: 361 AATPLKQEWMWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTG 420

Query: 421 XXXXXXXXXXXXDKNKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNNGYTIEKLI 480
                       D  KRVILFIGDGSLQLTVQEISTM+RW LKPYLFVLNNNGYTIEKLI
Sbjct: 421 ACLGAAFAAEEVDPKKRVILFIGDGSLQLTVQEISTMVRWNLKPYLFVLNNNGYTIEKLI 480

Query: 481 HGEFAQYNEIQPWNHLDLLPTFGAKDYETVRVATTGEWNKLAEDQEFNKNSKIRMIEVML 540
           HG  AQYNEIQ W+HL LLPTFGAKDYE  RVATTGEW KL E++EFN+NS+IR+IE+ML
Sbjct: 481 HGPTAQYNEIQSWDHLSLLPTFGAKDYENHRVATTGEWIKLTENKEFNQNSRIRLIEIML 540

Query: 541 PVMDAPESLVKQAQLTAATNAK 562
           PVMDAP +LV QAQLTA  NAK
Sbjct: 541 PVMDAPSNLVAQAQLTAKINAK 562

>KLLA0E16303g Chr5 complement(1457903..1459594) [1692 bp, 563 aa]
           {ON} highly similar to uniprot|P06169 Saccharomyces
           cerevisiae YLR044C PDC1 Major of three pyruvate
           decarboxylase isozymes key enzyme in alcoholic
           fermentation decarboxylates pyruvate to acetaldehyde
           subject to glucose- ethanol- and autoregulation involved
           in amino acid catabolism
          Length = 563

 Score =  908 bits (2347), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 448/563 (79%), Positives = 483/563 (85%)

Query: 1   MSEITLGRYLFERLRQVECNTIFGLPGDFNLRLLDEIYETEGMRWXXXXXXXXXXXXXXX 60
           MSEITLGRYLFERL+QVE  TIFGLPGDFNL LLD IYE  GMRW               
Sbjct: 1   MSEITLGRYLFERLKQVEVQTIFGLPGDFNLSLLDNIYEVPGMRWAGNANELNAAYAADG 60

Query: 61  XXRIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120
             R+KGMSC+ITTFGVGELSALNGIAGSYAEHVGVLHVVGVPS+S+QAKQLLLHHTLGNG
Sbjct: 61  YARLKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSVSSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMISDLATAPAEIDRCIRTTYVRQRPVYLGLPSNFVDQMVPASL 180
           DFTVFHRMS+NISETTAMI+D+ TAPAEIDRCIRTTYV QRPVYLGLP+N VD  VPASL
Sbjct: 121 DFTVFHRMSSNISETTAMITDINTAPAEIDRCIRTTYVSQRPVYLGLPANLVDLTVPASL 180

Query: 181 LETPIDLSLKPNDAAAEQEVVSTVLDLIKNAKNPVILADACASRHDVKAETKKLIDVTQF 240
           L+TPIDLSLKPND  AE+EV+  VL LIK AKNPVILADAC SRHD KAETKKLID+TQF
Sbjct: 181 LDTPIDLSLKPNDPEAEEEVIENVLQLIKEAKNPVILADACCSRHDAKAETKKLIDLTQF 240

Query: 241 PSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESSDLILSVGALLSDFNTGSFSYS 300
           P+FVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVES+DL+LSVGALLSDFNTGSFSYS
Sbjct: 241 PAFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESADLVLSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDHIKIRNATFPGVQMKFVLQKLLTQVGDVVKDYKPVAIPEIPGPNAAVD 360
           YKTKNIVEFHSD+ KIR+ATFPGVQMKF LQKLLT+V D  K YKPV +P  P  N AV 
Sbjct: 301 YKTKNIVEFHSDYTKIRSATFPGVQMKFALQKLLTKVADAAKGYKPVPVPSEPEHNEAVA 360

Query: 361 DSTPLKQQWLWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIXXXXX 420
           DSTPLKQ+W+W QVG+FL+EGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSI     
Sbjct: 361 DSTPLKQEWVWTQVGEFLREGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTG 420

Query: 421 XXXXXXXXXXXXDKNKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNNGYTIEKLI 480
                       D  KRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNN+GYTIE+LI
Sbjct: 421 ATLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIERLI 480

Query: 481 HGEFAQYNEIQPWNHLDLLPTFGAKDYETVRVATTGEWNKLAEDQEFNKNSKIRMIEVML 540
           HGE AQYN IQ W HL+LLPTFGAKDYE VRV+TTGEWNKL  D++F  N++IR+IEVML
Sbjct: 481 HGETAQYNCIQNWQHLELLPTFGAKDYEAVRVSTTGEWNKLTTDEKFQDNTRIRLIEVML 540

Query: 541 PVMDAPESLVKQAQLTAATNAKS 563
           P MDAP +LVKQAQLTAATNAK+
Sbjct: 541 PTMDAPSNLVKQAQLTAATNAKN 563

>ZYRO0F01606g Chr6 complement(130346..132037) [1692 bp, 563 aa] {ON}
           highly similar to uniprot|P06169 Saccharomyces
           cerevisiae YLR044C PDC1 Major of three pyruvate
           decarboxylase isozymes key enzyme in alcoholic
           fermentation decarboxylates pyruvate to acetaldehyde
           subject to glucose- ethanol- and autoregulation involved
           in amino acid catabolism and to YLR134W uniprot|P16467
           Saccharomyces cerevisiae YLR134W PDC5 Minor isoform of
           pyruvate decarboxylase, key enzyme in alcoholic
           fermentation, decarboxylates pyruvate to acetaldehyde,
           regulation is glucose- and ethanol-dependent, repressed
           by thiamine, involved in amino acid catabolism
          Length = 563

 Score =  903 bits (2333), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 440/562 (78%), Positives = 479/562 (85%)

Query: 1   MSEITLGRYLFERLRQVECNTIFGLPGDFNLRLLDEIYETEGMRWXXXXXXXXXXXXXXX 60
           MSEITLGRYLFERL+QV+ NTIFG+PGDFNL LLD++YE +G+RW               
Sbjct: 1   MSEITLGRYLFERLKQVDTNTIFGVPGDFNLSLLDKVYEVQGLRWAGNANELNAAYAADG 60

Query: 61  XXRIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120
             R+KG++ LITTFGVGELSALNGIAGSYAEHVGVLH+VGVPS+S+QAKQLLLHHTLGNG
Sbjct: 61  YARVKGLAALITTFGVGELSALNGIAGSYAEHVGVLHIVGVPSVSSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMISDLATAPAEIDRCIRTTYVRQRPVYLGLPSNFVDQMVPASL 180
           DFTVFHRMSANISETTAM++D+  APAEIDRCIR  YV QRPVYLGLP+N VDQ VPASL
Sbjct: 121 DFTVFHRMSANISETTAMLTDITAAPAEIDRCIRVAYVNQRPVYLGLPANLVDQKVPASL 180

Query: 181 LETPIDLSLKPNDAAAEQEVVSTVLDLIKNAKNPVILADACASRHDVKAETKKLIDVTQF 240
           L TPIDLSLK ND  AE EVV TVL+LIK AKNPVILADAC SRHDVKAETKKLID+TQF
Sbjct: 181 LNTPIDLSLKENDPEAETEVVDTVLELIKEAKNPVILADACCSRHDVKAETKKLIDLTQF 240

Query: 241 PSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESSDLILSVGALLSDFNTGSFSYS 300
           PSFVTPMGKGSIDE++PRFGGVYVGTLSSP VKEAVES+DL+LSVGALLSDFNTGSFSYS
Sbjct: 241 PSFVTPMGKGSIDEQNPRFGGVYVGTLSSPEVKEAVESADLVLSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDHIKIRNATFPGVQMKFVLQKLLTQVGDVVKDYKPVAIPEIPGPNAAVD 360
           YKTKN+VEFHSDHIKIRNATFPGVQMKFVL+KLL  V + VK+YKP  +P  P PNA V 
Sbjct: 301 YKTKNVVEFHSDHIKIRNATFPGVQMKFVLKKLLQAVPEAVKNYKPGPVPAPPSPNAEVA 360

Query: 361 DSTPLKQQWLWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIXXXXX 420
           DST LKQ+WLW QVG FL+EGDVVITETGTSAFGINQTHFPN TYGISQVLWGSI     
Sbjct: 361 DSTTLKQEWLWRQVGSFLREGDVVITETGTSAFGINQTHFPNQTYGISQVLWGSIGYTTG 420

Query: 421 XXXXXXXXXXXXDKNKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNNGYTIEKLI 480
                       D  KRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNN+GYTIE+LI
Sbjct: 421 STLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIERLI 480

Query: 481 HGEFAQYNEIQPWNHLDLLPTFGAKDYETVRVATTGEWNKLAEDQEFNKNSKIRMIEVML 540
           HGE A+YN IQPW HL+LL TFGAKDYE  RV+T GEWNKL +D +FN+NS+IRMIEVML
Sbjct: 481 HGETAEYNCIQPWKHLELLNTFGAKDYENHRVSTVGEWNKLTQDPKFNENSRIRMIEVML 540

Query: 541 PVMDAPESLVKQAQLTAATNAK 562
            VMDAP SLV QAQLTAATNAK
Sbjct: 541 EVMDAPSSLVAQAQLTAATNAK 562

>CAGL0M07920g Chr13 complement(789467..791161) [1695 bp, 564 aa]
           {ON} highly similar to uniprot|P06169 Saccharomyces
           cerevisiae YLR044c PDC1 pyruvate decarboxylase or
           uniprot|P16467 Saccharomyces cerevisiae YLR134w PDC5
          Length = 564

 Score =  902 bits (2332), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 450/562 (80%), Positives = 481/562 (85%)

Query: 1   MSEITLGRYLFERLRQVECNTIFGLPGDFNLRLLDEIYETEGMRWXXXXXXXXXXXXXXX 60
           MSEITLGRYLFERL QV+  TIFGLPGDFNL LLD+IYE EGMRW               
Sbjct: 1   MSEITLGRYLFERLNQVDVKTIFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60

Query: 61  XXRIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120
             RIKGMSC+ITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSIS+QAKQLLLHHTLGNG
Sbjct: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMISDLATAPAEIDRCIRTTYVRQRPVYLGLPSNFVDQMVPASL 180
           DFTVFHRMSANISETTAM++D+ATAPAEIDRCIRTTY+ QRPVYLGLP+N VD  VPA L
Sbjct: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYITQRPVYLGLPANLVDLKVPAKL 180

Query: 181 LETPIDLSLKPNDAAAEQEVVSTVLDLIKNAKNPVILADACASRHDVKAETKKLIDVTQF 240
           LETPIDLSLKPND  AE EVV TVL+LIK AKNPVILADACASRHDVKAETKKLID TQF
Sbjct: 181 LETPIDLSLKPNDPEAETEVVDTVLELIKAAKNPVILADACASRHDVKAETKKLIDATQF 240

Query: 241 PSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESSDLILSVGALLSDFNTGSFSYS 300
           PSFVTPMGKGSIDE+HPRFGGVYVGTLS P VKEAVES+DLILSVGALLSDFNTGSFSYS
Sbjct: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDHIKIRNATFPGVQMKFVLQKLLTQVGDVVKDYKPVAIPEIPGPNAAVD 360
           YKTKNIVEFHSD+IKIRNATFPGVQMKF LQKLL  V + +K YKPV +P     N + D
Sbjct: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLNAVPEAIKGYKPVPVPARVPENKSCD 360

Query: 361 DSTPLKQQWLWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIXXXXX 420
            +TPLKQ+W+WNQV KFLQEGDVVITETGTSAFGINQT FPNN YGISQVLWGSI     
Sbjct: 361 PATPLKQEWMWNQVSKFLQEGDVVITETGTSAFGINQTPFPNNAYGISQVLWGSIGFTTG 420

Query: 421 XXXXXXXXXXXXDKNKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNNGYTIEKLI 480
                       D  KRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNN+GYTIE+LI
Sbjct: 421 ACLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIERLI 480

Query: 481 HGEFAQYNEIQPWNHLDLLPTFGAKDYETVRVATTGEWNKLAEDQEFNKNSKIRMIEVML 540
           HGE A YN+IQ W+HL LLPTFGAKDYE  RVATTGEW+KL +D+EFNKNSKIRMIEVML
Sbjct: 481 HGEKAGYNDIQNWDHLALLPTFGAKDYENHRVATTGEWDKLTQDKEFNKNSKIRMIEVML 540

Query: 541 PVMDAPESLVKQAQLTAATNAK 562
           PVMDAP SL++QA+LTA+ NAK
Sbjct: 541 PVMDAPTSLIEQAKLTASINAK 562

>NCAS0D01660 Chr4 complement(313684..315378) [1695 bp, 564 aa] {ON}
           Anc_5.122
          Length = 564

 Score =  900 bits (2327), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 438/562 (77%), Positives = 485/562 (86%)

Query: 1   MSEITLGRYLFERLRQVECNTIFGLPGDFNLRLLDEIYETEGMRWXXXXXXXXXXXXXXX 60
           MSEITLG+YLFERL Q++  TIFGLPGDFNL LLD+IYE  GMRW               
Sbjct: 1   MSEITLGKYLFERLNQIDVKTIFGLPGDFNLSLLDKIYEIPGMRWAGNANELNAAYAADG 60

Query: 61  XXRIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120
             R+KGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSIS+QAKQLLLHHTLGNG
Sbjct: 61  YARLKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMISDLATAPAEIDRCIRTTYVRQRPVYLGLPSNFVDQMVPASL 180
           DFTVFHRMSANISETTAM++D+ATAPAEIDRCIRTTYV QRPVYLGLP+N VD  VPASL
Sbjct: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASL 180

Query: 181 LETPIDLSLKPNDAAAEQEVVSTVLDLIKNAKNPVILADACASRHDVKAETKKLIDVTQF 240
           L+TPIDLSLK NDA AE EV+ T+LDL+K+AKNP+ILADACASRHDVKAET+KLID+TQF
Sbjct: 181 LDTPIDLSLKANDAEAEAEVIETILDLVKSAKNPIILADACASRHDVKAETRKLIDITQF 240

Query: 241 PSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESSDLILSVGALLSDFNTGSFSYS 300
           PSFVTPMGKGSIDE+HPRFGGVYVGTLSSPA+K++VES+DLILSVGALLSDFNTGSFSYS
Sbjct: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAIKQSVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDHIKIRNATFPGVQMKFVLQKLLTQVGDVVKDYKPVAIPEIPGPNAAVD 360
           YKTKN+VEFHSD+IKI+NATFPGVQMKFVLQKLLT +    K YKPVA+P  P  N A  
Sbjct: 301 YKTKNVVEFHSDYIKIKNATFPGVQMKFVLQKLLTVIAAAAKGYKPVAVPAKPAANPATA 360

Query: 361 DSTPLKQQWLWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIXXXXX 420
            STPLKQ+WLWNQVGKFLQEGDVVI+ETGTSAFGINQTHFPNNTYGISQVLWGSI     
Sbjct: 361 ASTPLKQEWLWNQVGKFLQEGDVVISETGTSAFGINQTHFPNNTYGISQVLWGSIGFATG 420

Query: 421 XXXXXXXXXXXXDKNKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNNGYTIEKLI 480
                       D  KRVILF G+GSLQLTVQEISTM+RW LKPYLFVLNN+GYTIE+LI
Sbjct: 421 CTLGAAFAAEEIDPKKRVILFTGEGSLQLTVQEISTMVRWNLKPYLFVLNNDGYTIERLI 480

Query: 481 HGEFAQYNEIQPWNHLDLLPTFGAKDYETVRVATTGEWNKLAEDQEFNKNSKIRMIEVML 540
           HGE A YN+IQ W HL+LLPTFGAKDYE  RV+TTGEW+KL  ++EFN+N++IRMIE+ML
Sbjct: 481 HGEKADYNDIQNWEHLNLLPTFGAKDYENHRVSTTGEWDKLTSNKEFNQNTRIRMIEIML 540

Query: 541 PVMDAPESLVKQAQLTAATNAK 562
           PVMDAP +LV QA+LTA+ NAK
Sbjct: 541 PVMDAPSNLVAQAKLTASINAK 562

>Suva_10.227 Chr10 (419251..420942) [1692 bp, 563 aa] {ON} YLR134W
           (REAL)
          Length = 563

 Score =  896 bits (2316), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 436/562 (77%), Positives = 483/562 (85%)

Query: 1   MSEITLGRYLFERLRQVECNTIFGLPGDFNLRLLDEIYETEGMRWXXXXXXXXXXXXXXX 60
           MSEITLG+YLFERL QV+CNT+FGLPGDFNL LLD++YE EGMRW               
Sbjct: 1   MSEITLGKYLFERLSQVDCNTVFGLPGDFNLSLLDKLYEVEGMRWAGNANELNAAYAADG 60

Query: 61  XXRIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120
             RIKGMSC+ITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSIS+QAKQLLLHHTLGNG
Sbjct: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMISDLATAPAEIDRCIRTTYVRQRPVYLGLPSNFVDQMVPASL 180
           DFTVFHRMSANISETTAMI+D+A APAEIDRCIRTT+  QRPVYLGLP+N VD  VPA L
Sbjct: 121 DFTVFHRMSANISETTAMITDIANAPAEIDRCIRTTFTTQRPVYLGLPANLVDLNVPAKL 180

Query: 181 LETPIDLSLKPNDAAAEQEVVSTVLDLIKNAKNPVILADACASRHDVKAETKKLIDVTQF 240
           LETPID++LKPNDA AE EVV TV+++I++AKNPVILADACASRHDVKAETKKLID+TQF
Sbjct: 181 LETPIDMALKPNDAEAEAEVVRTVIEMIQDAKNPVILADACASRHDVKAETKKLIDLTQF 240

Query: 241 PSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESSDLILSVGALLSDFNTGSFSYS 300
           P+FVTPMGKGSIDE+HPR+GGVYVGTLS P VK+AVES+DLILSVGALLSDFNTGSFSYS
Sbjct: 241 PTFVTPMGKGSIDEQHPRYGGVYVGTLSKPEVKKAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDHIKIRNATFPGVQMKFVLQKLLTQVGDVVKDYKPVAIPEIPGPNAAVD 360
           Y+TKNIVEFHSDHIKIRNATFPGVQMKF LQ+LL+ + +VVKDYKPVA+P     N A+ 
Sbjct: 301 YRTKNIVEFHSDHIKIRNATFPGVQMKFALQRLLSAIPEVVKDYKPVAVPARTPANKALP 360

Query: 361 DSTPLKQQWLWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIXXXXX 420
            STP+KQ+W+WNQ+  FLQEGD+VI ETGTSAFGINQT FP + Y I QVLWGSI     
Sbjct: 361 ASTPMKQEWMWNQLSTFLQEGDIVIAETGTSAFGINQTTFPTDVYAIVQVLWGSIGFTVG 420

Query: 421 XXXXXXXXXXXXDKNKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNNGYTIEKLI 480
                       D  KRVILFIGDGSLQLTVQEISTMIRWGLKPY+FVLNNNGYTIEKLI
Sbjct: 421 ALLGATMAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYIFVLNNNGYTIEKLI 480

Query: 481 HGEFAQYNEIQPWNHLDLLPTFGAKDYETVRVATTGEWNKLAEDQEFNKNSKIRMIEVML 540
           HG  A+YNE+QPW+HL LLPTFGAKDYET RV TTGEW+KL +D+EF  NS+IRMIEVML
Sbjct: 481 HGPHAEYNEVQPWDHLALLPTFGAKDYETHRVVTTGEWDKLTQDKEFQDNSRIRMIEVML 540

Query: 541 PVMDAPESLVKQAQLTAATNAK 562
           PV DAP++LVKQAQLTAATNAK
Sbjct: 541 PVFDAPQNLVKQAQLTAATNAK 562

>Kpol_1010.48 s1010 (110999..112690) [1692 bp, 563 aa] {ON}
           (110999..112690) [1692 nt, 564 aa]
          Length = 563

 Score =  895 bits (2312), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 437/562 (77%), Positives = 478/562 (85%)

Query: 1   MSEITLGRYLFERLRQVECNTIFGLPGDFNLRLLDEIYETEGMRWXXXXXXXXXXXXXXX 60
           MSEITLGRYLFERL+QV+  TIFGLPGDFNL LLD+IYE  GMRW               
Sbjct: 1   MSEITLGRYLFERLKQVQVQTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60

Query: 61  XXRIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120
             RIKGM+CLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPS+S+QAKQLLLHHTLGNG
Sbjct: 61  YARIKGMACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSLSSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMISDLATAPAEIDRCIRTTYVRQRPVYLGLPSNFVDQMVPASL 180
           DFTVFHRMSA ISETTAMI+D+A APAEIDRCIRTTY+ QR VYLGLP+N VD MVPA L
Sbjct: 121 DFTVFHRMSACISETTAMITDIANAPAEIDRCIRTTYITQRTVYLGLPANMVDLMVPADL 180

Query: 181 LETPIDLSLKPNDAAAEQEVVSTVLDLIKNAKNPVILADACASRHDVKAETKKLIDVTQF 240
           L+TPIDLSLKPND  AE EV+ T+L ++K AKNP+ILADACASRHDVKAETK+LID TQF
Sbjct: 181 LKTPIDLSLKPNDPEAETEVLDTILAMVKEAKNPIILADACASRHDVKAETKQLIDTTQF 240

Query: 241 PSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESSDLILSVGALLSDFNTGSFSYS 300
           P FVTPMGKGSIDE+HPRFGGVYVGTLS P VK AVES+DLILSVGALLSDFNTGSFSYS
Sbjct: 241 PCFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKAAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDHIKIRNATFPGVQMKFVLQKLLTQVGDVVKDYKPVAIPEIPGPNAAVD 360
           Y+TKN+VEFHSDH KI+ A+FPGVQMKFVLQKL+ Q+G  VKDYKPVA P +P  NA   
Sbjct: 301 YQTKNVVEFHSDHTKIKKASFPGVQMKFVLQKLVAQIGAAVKDYKPVAAPALPASNAECP 360

Query: 361 DSTPLKQQWLWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIXXXXX 420
            STPLKQ+WLWNQVGKFLQEGD+V+TETGTSAFGINQTHFPNNTYGISQVLWGSI     
Sbjct: 361 ASTPLKQEWLWNQVGKFLQEGDIVLTETGTSAFGINQTHFPNNTYGISQVLWGSIGFTGG 420

Query: 421 XXXXXXXXXXXXDKNKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNNGYTIEKLI 480
                       D  KR I+FIGDGSLQLTVQEISTMIRW LKPY+FVLNN+GYTIEKLI
Sbjct: 421 ATLGAAFAAEEIDPKKRTIVFIGDGSLQLTVQEISTMIRWNLKPYIFVLNNDGYTIEKLI 480

Query: 481 HGEFAQYNEIQPWNHLDLLPTFGAKDYETVRVATTGEWNKLAEDQEFNKNSKIRMIEVML 540
           HG  AQYNEIQ W HLD+LPTFGAKDYE +RVATTGE+NKL ED+ FN+NSKIRMIE+ML
Sbjct: 481 HGPTAQYNEIQNWKHLDILPTFGAKDYEAIRVATTGEFNKLCEDKAFNENSKIRMIEIML 540

Query: 541 PVMDAPESLVKQAQLTAATNAK 562
           PVMDAP +LV QA+LTA+ NAK
Sbjct: 541 PVMDAPSNLVAQAKLTASINAK 562

>NDAI0A01400 Chr1 (313925..315616) [1692 bp, 563 aa] {ON} 
          Length = 563

 Score =  890 bits (2300), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 451/562 (80%), Positives = 479/562 (85%)

Query: 1   MSEITLGRYLFERLRQVECNTIFGLPGDFNLRLLDEIYETEGMRWXXXXXXXXXXXXXXX 60
           MSEITLGRYLFERL QV  NTIFGLPGDFNL LLD+IYET GMRW               
Sbjct: 1   MSEITLGRYLFERLSQVNVNTIFGLPGDFNLSLLDKIYETPGMRWAGNANELNAAYAADG 60

Query: 61  XXRIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120
             RIKGMSC+ITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSIS+QAKQLLLHHTLGNG
Sbjct: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMISDLATAPAEIDRCIRTTYVRQRPVYLGLPSNFVDQMVPASL 180
           DFTVFHRMSANISETTAM++D+ATAPAEIDRCIRTTYV QRPVYLGLP+N VD  VPASL
Sbjct: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASL 180

Query: 181 LETPIDLSLKPNDAAAEQEVVSTVLDLIKNAKNPVILADACASRHDVKAETKKLIDVTQF 240
           LETPIDLSLKPNDA AE EV+  VL LIKNAKNPVILADAC SRHDVK ET+KLID+TQF
Sbjct: 181 LETPIDLSLKPNDAEAEAEVLEEVLSLIKNAKNPVILADACCSRHDVKVETRKLIDITQF 240

Query: 241 PSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESSDLILSVGALLSDFNTGSFSYS 300
           PSFVTPMGKGSIDE++PRFGGVYVGTLS P VKEAVES+DLILSVGALLSDFNTGSFSYS
Sbjct: 241 PSFVTPMGKGSIDEQNPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDHIKIRNATFPGVQMKFVLQKLLTQVGDVVKDYKPVAIPEIPGPNAAVD 360
           YKTKNIVEFHSDHIKIRNATFPGVQMKFVLQKLL  V   VK YKPV +P     N  V 
Sbjct: 301 YKTKNIVEFHSDHIKIRNATFPGVQMKFVLQKLLKSVPAAVKGYKPVPVPAGIPANKKVA 360

Query: 361 DSTPLKQQWLWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIXXXXX 420
           DSTPLKQ+W+WNQVGKFLQEGD+VITETGTSAFGINQTHFPNNTYGISQVLWGSI     
Sbjct: 361 DSTPLKQEWMWNQVGKFLQEGDIVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTG 420

Query: 421 XXXXXXXXXXXXDKNKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNNGYTIEKLI 480
                       D  +RVILFIGDGSLQLTVQEISTM+RW LKPYLF+LNNNGYTIEKLI
Sbjct: 421 ATLGAAFAAEEIDPKRRVILFIGDGSLQLTVQEISTMVRWNLKPYLFILNNNGYTIEKLI 480

Query: 481 HGEFAQYNEIQPWNHLDLLPTFGAKDYETVRVATTGEWNKLAEDQEFNKNSKIRMIEVML 540
           HG  AQYNEIQ W HL LL TFGAKDYE  RVATTGEWNKL E++EFN NS+IR+IEVML
Sbjct: 481 HGPTAQYNEIQSWEHLKLLETFGAKDYENHRVATTGEWNKLCENKEFNVNSRIRVIEVML 540

Query: 541 PVMDAPESLVKQAQLTAATNAK 562
           PVMDAP+SL+KQ +LTA  NA+
Sbjct: 541 PVMDAPQSLIKQGELTAQINAR 562

>TPHA0H00950 Chr8 (199181..200872) [1692 bp, 563 aa] {ON} Anc_5.122
           YLR044C
          Length = 563

 Score =  889 bits (2298), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 437/562 (77%), Positives = 478/562 (85%)

Query: 1   MSEITLGRYLFERLRQVECNTIFGLPGDFNLRLLDEIYETEGMRWXXXXXXXXXXXXXXX 60
           MS+ITLG+YLFERL+QV+C TIFGLPGDFNL LLD+IYE  GMRW               
Sbjct: 1   MSQITLGKYLFERLKQVQCQTIFGLPGDFNLSLLDKIYEVPGMRWAGNCNELNAAYAADG 60

Query: 61  XXRIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120
             RIKGM+CLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPS+SAQAKQLLLHHTLGNG
Sbjct: 61  YARIKGMACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSLSAQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMISDLATAPAEIDRCIRTTYVRQRPVYLGLPSNFVDQMVPASL 180
           DFTVFHRMSA ISETT+MI+D+A+A AEIDRCI+ TY+ QR VYLGLP+N VD MVPA +
Sbjct: 121 DFTVFHRMSACISETTSMITDIASAQAEIDRCIKATYISQRTVYLGLPANMVDLMVPADV 180

Query: 181 LETPIDLSLKPNDAAAEQEVVSTVLDLIKNAKNPVILADACASRHDVKAETKKLIDVTQF 240
           L TPIDLSLKPND  AE EV+  +L+LIK+AKNP+ILADACASRHDVKAETK LID TQF
Sbjct: 181 LNTPIDLSLKPNDVDAETEVLGAILELIKDAKNPIILADACASRHDVKAETKALIDATQF 240

Query: 241 PSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESSDLILSVGALLSDFNTGSFSYS 300
           PSFVTPMGKGSIDE+HPRFGGVYVGTLS P VK+AVES+DLILSVGALLSDFNTGSFSYS
Sbjct: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKKAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDHIKIRNATFPGVQMKFVLQKLLTQVGDVVKDYKPVAIPEIPGPNAAVD 360
           Y TKNIVEFHSDHIKIR A+FPGVQMKFVL+KL+ QVG VVK YKPVAIP     N A  
Sbjct: 301 YNTKNIVEFHSDHIKIRKASFPGVQMKFVLEKLVAQVGSVVKGYKPVAIPAPVPANPATP 360

Query: 361 DSTPLKQQWLWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIXXXXX 420
             TPLKQ+WLWNQVGKFL+EGD+V+TETGTSAFGINQTHFP NTYGISQVLWGSI     
Sbjct: 361 AETPLKQEWLWNQVGKFLKEGDIVLTETGTSAFGINQTHFPTNTYGISQVLWGSIGFTGG 420

Query: 421 XXXXXXXXXXXXDKNKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNNGYTIEKLI 480
                       D  KR I+FIGDGSLQLTVQEISTMIRW LKPY+FVLNNNGYTIEKLI
Sbjct: 421 ATLGAAFAAEEIDPKKRTIVFIGDGSLQLTVQEISTMIRWNLKPYIFVLNNNGYTIEKLI 480

Query: 481 HGEFAQYNEIQPWNHLDLLPTFGAKDYETVRVATTGEWNKLAEDQEFNKNSKIRMIEVML 540
           HG  AQYNEIQ W HLD+LPTFGAKDYET+RVATTGEW+KLA D+ FN+NSKIRMIE+ML
Sbjct: 481 HGPTAQYNEIQNWKHLDILPTFGAKDYETIRVATTGEWDKLASDKAFNENSKIRMIEIML 540

Query: 541 PVMDAPESLVKQAQLTAATNAK 562
           PVMDAP +L+ QA+LTAATNAK
Sbjct: 541 PVMDAPSNLIAQAKLTAATNAK 562

>Ecym_2479 Chr2 (938295..939989) [1695 bp, 564 aa] {ON} similar to
           Ashbya gossypii ACL134C
          Length = 564

 Score =  883 bits (2282), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 439/562 (78%), Positives = 483/562 (85%)

Query: 1   MSEITLGRYLFERLRQVECNTIFGLPGDFNLRLLDEIYETEGMRWXXXXXXXXXXXXXXX 60
           MSEIT+G YLF+RL+QVE  TIFGLPGDFNL LLD+IYE  GMRW               
Sbjct: 1   MSEITIGHYLFQRLKQVEVQTIFGLPGDFNLTLLDKIYEVPGMRWAGNANELNAAYAADG 60

Query: 61  XXRIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120
             R+KGMSC+ITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG
Sbjct: 61  YARLKGMSCVITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMISDLATAPAEIDRCIRTTYVRQRPVYLGLPSNFVDQMVPASL 180
           DFTVFHRMSANISE+TAMI+D+ATA  EIDRCIRT Y+ QRPVYLGLP+N VD  VPASL
Sbjct: 121 DFTVFHRMSANISESTAMITDVATAAREIDRCIRTCYISQRPVYLGLPANLVDAKVPASL 180

Query: 181 LETPIDLSLKPNDAAAEQEVVSTVLDLIKNAKNPVILADACASRHDVKAETKKLIDVTQF 240
           LETPID SLKPNDA AE EVV TVL++I N+KNPVIL+DACASRHDVK ETK+LIDVTQF
Sbjct: 181 LETPIDFSLKPNDAEAENEVVGTVLEMIANSKNPVILSDACASRHDVKEETKRLIDVTQF 240

Query: 241 PSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESSDLILSVGALLSDFNTGSFSYS 300
           P+FVTPMGKGSIDE+HPRFGGVYVGTLSSP VKEAVES+DLILSVGALLSDFNTGSFSYS
Sbjct: 241 PAFVTPMGKGSIDEQHPRFGGVYVGTLSSPEVKEAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDHIKIRNATFPGVQMKFVLQKLLTQVGDVVKDYKPVAIPEIPGPNAAVD 360
           YKTKNIVEFHSDH K+RNATFPGVQMKFVL+KL+  VGDV K+Y PV +P  P   + VD
Sbjct: 301 YKTKNIVEFHSDHTKVRNATFPGVQMKFVLKKLVDVVGDVAKNYVPVPVPTQPVHGSDVD 360

Query: 361 DSTPLKQQWLWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIXXXXX 420
            +TPL+Q+W+W +V +FL+EGDVVITETGTSAFGINQTHFPN+TYGISQVLWGSI     
Sbjct: 361 PATPLRQEWIWREVARFLREGDVVITETGTSAFGINQTHFPNDTYGISQVLWGSIGFTTG 420

Query: 421 XXXXXXXXXXXXDKNKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNNGYTIEKLI 480
                       D  KRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNN+GYTIE+LI
Sbjct: 421 ACLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIERLI 480

Query: 481 HGEFAQYNEIQPWNHLDLLPTFGAKDYETVRVATTGEWNKLAEDQEFNKNSKIRMIEVML 540
           HGE AQYN+IQPW+HL LLPTFGAKDYE VRV+T GEW +L +D+ F++NSKIRMIEVML
Sbjct: 481 HGETAQYNDIQPWDHLKLLPTFGAKDYEAVRVSTAGEWQQLTQDKAFSENSKIRMIEVML 540

Query: 541 PVMDAPESLVKQAQLTAATNAK 562
           PVMDAP +LVKQAQLTAATNAK
Sbjct: 541 PVMDAPSNLVKQAQLTAATNAK 562

>KAFR0E02020 Chr5 (400911..402605) [1695 bp, 564 aa] {ON} Anc_5.122
           YLR044C
          Length = 564

 Score =  881 bits (2276), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 437/562 (77%), Positives = 474/562 (84%)

Query: 1   MSEITLGRYLFERLRQVECNTIFGLPGDFNLRLLDEIYETEGMRWXXXXXXXXXXXXXXX 60
           M+EITLG+YLFERL QV+  TIFGLPGDFNL LLD+IYE  GMRW               
Sbjct: 1   MAEITLGKYLFERLAQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60

Query: 61  XXRIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120
             RIKGMSC+ITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSIS+QAKQLLLHHTLGNG
Sbjct: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMISDLATAPAEIDRCIRTTYVRQRPVYLGLPSNFVDQMVPASL 180
           DFTVFHRMSANISETTAM++D+ATAPAEIDRCIRTTYV QRPVYLGLP+N VD  VPA L
Sbjct: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPAKL 180

Query: 181 LETPIDLSLKPNDAAAEQEVVSTVLDLIKNAKNPVILADACASRHDVKAETKKLIDVTQF 240
           LETPIDLSLKPNDA AE+EVV T+L LIK+AKNPVIL+DACASRHDVKAETK+LID TQF
Sbjct: 181 LETPIDLSLKPNDAEAEKEVVDTILSLIKDAKNPVILSDACASRHDVKAETKQLIDATQF 240

Query: 241 PSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESSDLILSVGALLSDFNTGSFSYS 300
           P+F TPMGKGSIDE+HPRFGGVYVGTLS P VKEAVES+DLILSVGALLSDFNTGSFSYS
Sbjct: 241 PAFTTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDHIKIRNATFPGVQMKFVLQKLLTQVGDVVKDYKPVAIPEIPGPNAAVD 360
           YKTKNI+EFHSD+ KIRNATFPGVQMKFVL+KLL  V D  K YKPVA+P     N A D
Sbjct: 301 YKTKNIIEFHSDYTKIRNATFPGVQMKFVLRKLLASVADAAKGYKPVAVPARVPENKACD 360

Query: 361 DSTPLKQQWLWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIXXXXX 420
            STPL Q+W+WNQ  KF QEGDV+ITETGTSAFGINQ+ FPNN+ GISQVLWGSI     
Sbjct: 361 PSTPLAQEWMWNQCAKFFQEGDVIITETGTSAFGINQSLFPNNSVGISQVLWGSIGFTGG 420

Query: 421 XXXXXXXXXXXXDKNKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNNGYTIEKLI 480
                       D  KRVILFIGDGSLQLTVQEISTMIRW LKPYLFVLNN+GYTIE+LI
Sbjct: 421 AVLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWNLKPYLFVLNNDGYTIERLI 480

Query: 481 HGEFAQYNEIQPWNHLDLLPTFGAKDYETVRVATTGEWNKLAEDQEFNKNSKIRMIEVML 540
           HGE A YN+IQ W HL LL TFGAKDYE  RVATTGEW+ L  D+EFNKNS+IRMIEVML
Sbjct: 481 HGEKAGYNDIQNWKHLMLLETFGAKDYENHRVATTGEWDALMGDKEFNKNSRIRMIEVML 540

Query: 541 PVMDAPESLVKQAQLTAATNAK 562
           PVMDAP +LV+QA++TAATNAK
Sbjct: 541 PVMDAPSNLVQQAKITAATNAK 562

>YLR134W Chr12 (410723..412414) [1692 bp, 563 aa] {ON}  PDC5Minor
           isoform of pyruvate decarboxylase, key enzyme in
           alcoholic fermentation, decarboxylates pyruvate to
           acetaldehyde, regulation is glucose- and
           ethanol-dependent, repressed by thiamine, involved in
           amino acid catabolism
          Length = 563

 Score =  880 bits (2274), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 433/562 (77%), Positives = 477/562 (84%)

Query: 1   MSEITLGRYLFERLRQVECNTIFGLPGDFNLRLLDEIYETEGMRWXXXXXXXXXXXXXXX 60
           MSEITLG+YLFERL QV CNT+FGLPGDFNL LLD++YE +GMRW               
Sbjct: 1   MSEITLGKYLFERLSQVNCNTVFGLPGDFNLSLLDKLYEVKGMRWAGNANELNAAYAADG 60

Query: 61  XXRIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120
             RIKGMSC+ITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSIS+QAKQLLLHHTLGNG
Sbjct: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMISDLATAPAEIDRCIRTTYVRQRPVYLGLPSNFVDQMVPASL 180
           DFTVFHRMSANISETTAMI+D+A APAEIDRCIRTTY  QRPVYLGLP+N VD  VPA L
Sbjct: 121 DFTVFHRMSANISETTAMITDIANAPAEIDRCIRTTYTTQRPVYLGLPANLVDLNVPAKL 180

Query: 181 LETPIDLSLKPNDAAAEQEVVSTVLDLIKNAKNPVILADACASRHDVKAETKKLIDVTQF 240
           LETPIDLSLKPNDA AE EVV TV++LIK+AKNPVILADACASRHDVKAETKKL+D+TQF
Sbjct: 181 LETPIDLSLKPNDAEAEAEVVRTVVELIKDAKNPVILADACASRHDVKAETKKLMDLTQF 240

Query: 241 PSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESSDLILSVGALLSDFNTGSFSYS 300
           P +VTPMGKG+IDE+HPR+GGVYVGTLS P VK+AVES+DLILS+GALLSDFNTGSFSYS
Sbjct: 241 PVYVTPMGKGAIDEQHPRYGGVYVGTLSRPEVKKAVESADLILSIGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDHIKIRNATFPGVQMKFVLQKLLTQVGDVVKDYKPVAIPEIPGPNAAVD 360
           YKTKNIVEFHSDHIKIRNATFPGVQMKF LQKLL  + +VVKDYKPVA+P       +  
Sbjct: 301 YKTKNIVEFHSDHIKIRNATFPGVQMKFALQKLLDAIPEVVKDYKPVAVPARVPITKSTP 360

Query: 361 DSTPLKQQWLWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIXXXXX 420
            +TP+KQ+W+WN +G FL+EGD+VI ETGTSAFGINQT FP + Y I QVLWGSI     
Sbjct: 361 ANTPMKQEWMWNHLGNFLREGDIVIAETGTSAFGINQTTFPTDVYAIVQVLWGSIGFTVG 420

Query: 421 XXXXXXXXXXXXDKNKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNNGYTIEKLI 480
                       D  KRVILFIGDGSLQLTVQEISTMIRWGLKPY+FVLNNNGYTIEKLI
Sbjct: 421 ALLGATMAAEELDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYIFVLNNNGYTIEKLI 480

Query: 481 HGEFAQYNEIQPWNHLDLLPTFGAKDYETVRVATTGEWNKLAEDQEFNKNSKIRMIEVML 540
           HG  A+YNEIQ W+HL LLPTFGA++YET RVATTGEW KL +D++F  NSKIRMIEVML
Sbjct: 481 HGPHAEYNEIQGWDHLALLPTFGARNYETHRVATTGEWEKLTQDKDFQDNSKIRMIEVML 540

Query: 541 PVMDAPESLVKQAQLTAATNAK 562
           PV DAP++LVKQAQLTAATNAK
Sbjct: 541 PVFDAPQNLVKQAQLTAATNAK 562

>Skud_12.203 Chr12 (393390..395081) [1692 bp, 563 aa] {ON} YLR134W
           (REAL)
          Length = 563

 Score =  879 bits (2272), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 429/562 (76%), Positives = 478/562 (85%)

Query: 1   MSEITLGRYLFERLRQVECNTIFGLPGDFNLRLLDEIYETEGMRWXXXXXXXXXXXXXXX 60
           MSEITLG+YLFERL QV CNT+FGLPGDFNL LLD++YE EGMRW               
Sbjct: 1   MSEITLGKYLFERLSQVNCNTVFGLPGDFNLSLLDKLYEVEGMRWAGNANELNAAYAADG 60

Query: 61  XXRIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120
             RIKGMSC+ITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSIS+QAK LLLHHTLGNG
Sbjct: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKHLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMISDLATAPAEIDRCIRTTYVRQRPVYLGLPSNFVDQMVPASL 180
           DFTVFHRMSANISETTAMI+D+A+AP+EIDRCIRTT+  QRPVYLGLP+N VD  VPA L
Sbjct: 121 DFTVFHRMSANISETTAMITDIASAPSEIDRCIRTTFTTQRPVYLGLPANLVDLNVPAKL 180

Query: 181 LETPIDLSLKPNDAAAEQEVVSTVLDLIKNAKNPVILADACASRHDVKAETKKLIDVTQF 240
           L+TPID+SLKPNDA AE EVV TV+++IK+AKNPVILADACASRHDVKAETKKLI++TQF
Sbjct: 181 LDTPIDMSLKPNDAEAEAEVVRTVIEMIKDAKNPVILADACASRHDVKAETKKLIELTQF 240

Query: 241 PSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESSDLILSVGALLSDFNTGSFSYS 300
           P FVTPMGKG+IDE+HPR+GGVYVGTLS P VK+AVES+DLILSVGALLSDFNTGSFSYS
Sbjct: 241 PIFVTPMGKGAIDEQHPRYGGVYVGTLSRPEVKKAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDHIKIRNATFPGVQMKFVLQKLLTQVGDVVKDYKPVAIPEIPGPNAAVD 360
           YKTKN+VEFHSDHIKIRNATFPGVQMKF LQKLL  + +VVKDYKPVA+P     N A  
Sbjct: 301 YKTKNVVEFHSDHIKIRNATFPGVQMKFTLQKLLNAIPEVVKDYKPVAVPARVPINKATP 360

Query: 361 DSTPLKQQWLWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIXXXXX 420
            +T +KQ+W+WNQ+G FLQEGD+VI ETGTSAFGINQT FP + Y I QVLWGSI     
Sbjct: 361 ANTSMKQEWMWNQLGNFLQEGDIVIAETGTSAFGINQTTFPTDVYAIVQVLWGSIGFTVG 420

Query: 421 XXXXXXXXXXXXDKNKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNNGYTIEKLI 480
                       D  KRVILFIGDGSLQLTVQEISTMIRWGLKPY+FVLNNNGYTIEKLI
Sbjct: 421 ALLGATMAAEELDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYIFVLNNNGYTIEKLI 480

Query: 481 HGEFAQYNEIQPWNHLDLLPTFGAKDYETVRVATTGEWNKLAEDQEFNKNSKIRMIEVML 540
           HG  A+YNE+Q W+HL LLPTFGA+DYET R+ TTGEW+KL +D++F  NS+IRMIEVML
Sbjct: 481 HGPHAEYNEVQSWDHLSLLPTFGARDYETHRITTTGEWDKLTQDKDFQDNSRIRMIEVML 540

Query: 541 PVMDAPESLVKQAQLTAATNAK 562
           PV DAP++LVKQAQLTAATNAK
Sbjct: 541 PVFDAPQNLVKQAQLTAATNAK 562

>TPHA0Q00120 Chr17 complement(8844..10535) [1692 bp, 563 aa] {ON} 
          Length = 563

 Score =  879 bits (2270), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 432/562 (76%), Positives = 475/562 (84%)

Query: 1   MSEITLGRYLFERLRQVECNTIFGLPGDFNLRLLDEIYETEGMRWXXXXXXXXXXXXXXX 60
           MS+ITLG+YLFERL+QV+CNTIFGLPGDFNL LLD+IYE  GMRW               
Sbjct: 1   MSQITLGKYLFERLKQVQCNTIFGLPGDFNLSLLDKIYEVPGMRWAGNCNELNAAYAADG 60

Query: 61  XXRIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120
             RIKGM+CLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPS+SAQAKQLLLHHTLGNG
Sbjct: 61  YARIKGMACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSLSAQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMISDLATAPAEIDRCIRTTYVRQRPVYLGLPSNFVDQMVPASL 180
           DFTVFHRMSA ISETT+MI+D+A+A AEIDRCI+ TY+ QR VYLGLP+N VD MVPA +
Sbjct: 121 DFTVFHRMSACISETTSMITDIASAQAEIDRCIKATYISQRTVYLGLPANMVDLMVPADV 180

Query: 181 LETPIDLSLKPNDAAAEQEVVSTVLDLIKNAKNPVILADACASRHDVKAETKKLIDVTQF 240
           L TPIDLSLKPND  AE EV+  +L+LIK+AKNP+ILADACASRHDVKAETK LID TQF
Sbjct: 181 LNTPIDLSLKPNDVDAETEVLGAILELIKDAKNPIILADACASRHDVKAETKALIDTTQF 240

Query: 241 PSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESSDLILSVGALLSDFNTGSFSYS 300
           PSFVTPMGKGSIDE+HPRFGGVYVGTLS P VK+AVES+DLILSVGALLSDFNTGSFSYS
Sbjct: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKKAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDHIKIRNATFPGVQMKFVLQKLLTQVGDVVKDYKPVAIPEIPGPNAAVD 360
           Y TKNIVEFHSDHIKIR A+FPGVQMKFVL+KL+ QVG V+K YKPVAIP     N A  
Sbjct: 301 YNTKNIVEFHSDHIKIRKASFPGVQMKFVLEKLVAQVGSVIKGYKPVAIPAPVPANPATP 360

Query: 361 DSTPLKQQWLWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIXXXXX 420
             TPLKQ+WLWNQVGKFL+EGD+V+TETGTSAFGINQTHFP NTYGISQVLWGSI     
Sbjct: 361 AETPLKQEWLWNQVGKFLKEGDIVLTETGTSAFGINQTHFPTNTYGISQVLWGSIGFTGG 420

Query: 421 XXXXXXXXXXXXDKNKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNNGYTIEKLI 480
                       D  KR I+FIGDGSLQLTVQEISTMIRW LKPY+FVLNNNGYTIEKLI
Sbjct: 421 ATLGAAFAAEEIDPKKRTIVFIGDGSLQLTVQEISTMIRWNLKPYIFVLNNNGYTIEKLI 480

Query: 481 HGEFAQYNEIQPWNHLDLLPTFGAKDYETVRVATTGEWNKLAEDQEFNKNSKIRMIEVML 540
           HG  A+YNEIQ W HLD+L TFGAKDYE  RVATTGEW+KLA D+ FN+NSKIR+IE+ML
Sbjct: 481 HGPTAEYNEIQNWKHLDILSTFGAKDYENHRVATTGEWDKLASDRAFNENSKIRLIEIML 540

Query: 541 PVMDAPESLVKQAQLTAATNAK 562
           PVMDAP +L+ QA+LT ATNAK
Sbjct: 541 PVMDAPSNLIAQAKLTEATNAK 562

>TBLA0B07520 Chr2 complement(1789035..1790726) [1692 bp, 563 aa]
           {ON} Anc_5.122 YLR044C
          Length = 563

 Score =  877 bits (2266), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 429/562 (76%), Positives = 477/562 (84%)

Query: 1   MSEITLGRYLFERLRQVECNTIFGLPGDFNLRLLDEIYETEGMRWXXXXXXXXXXXXXXX 60
           M+EITLG+YLFERL QV+  TIFGLPGDFNL LLD+IYE  GMRW               
Sbjct: 1   MAEITLGKYLFERLNQVKVQTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60

Query: 61  XXRIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120
             RIKGM+CLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPS+S+QAKQLLLHHTLGNG
Sbjct: 61  YARIKGMACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSLSSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMISDLATAPAEIDRCIRTTYVRQRPVYLGLPSNFVDQMVPASL 180
           DFTVFHRMSA ISETTAMI+D+ATAPAEIDRCIRTTYV+QR VYLGLP+N VD  VPASL
Sbjct: 121 DFTVFHRMSAEISETTAMITDIATAPAEIDRCIRTTYVKQRTVYLGLPANLVDLTVPASL 180

Query: 181 LETPIDLSLKPNDAAAEQEVVSTVLDLIKNAKNPVILADACASRHDVKAETKKLIDVTQF 240
           LETPIDLSLKPNDA AE EV+ TVL+L++ AKNP+I+ADAC SRHDVK+ET++LI+ TQF
Sbjct: 181 LETPIDLSLKPNDAEAENEVIETVLELVREAKNPIIIADACCSRHDVKSETEELINATQF 240

Query: 241 PSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESSDLILSVGALLSDFNTGSFSYS 300
           PSF TPMGKGSI+E+HPRFGGVYVGTLS P VK AVES+DL+LSVGALLSDFNTGSFSY+
Sbjct: 241 PSFTTPMGKGSINERHPRFGGVYVGTLSRPEVKAAVESADLVLSVGALLSDFNTGSFSYA 300

Query: 301 YKTKNIVEFHSDHIKIRNATFPGVQMKFVLQKLLTQVGDVVKDYKPVAIPEIPGPNAAVD 360
           YKTKNIVEFHSDHIK++NATFPGVQMKFVLQKL++++G  +K YKPVA+P     N  V 
Sbjct: 301 YKTKNIVEFHSDHIKVKNATFPGVQMKFVLQKLVSKIGAAIKGYKPVAVPAGIPANKEVP 360

Query: 361 DSTPLKQQWLWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIXXXXX 420
            +TPLKQ+WLWNQ+G FLQEGD+V+TETGTSAFGINQT FP +TYGISQVLWGSI     
Sbjct: 361 ANTPLKQEWLWNQLGNFLQEGDIVLTETGTSAFGINQTTFPKDTYGISQVLWGSIGFTGG 420

Query: 421 XXXXXXXXXXXXDKNKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNNGYTIEKLI 480
                       + NKR ILFIGDGSLQLTVQEIST+IRW LKPYLFVLNNNGYTIEKLI
Sbjct: 421 CVLGAAFAAEEINPNKRTILFIGDGSLQLTVQEISTLIRWNLKPYLFVLNNNGYTIEKLI 480

Query: 481 HGEFAQYNEIQPWNHLDLLPTFGAKDYETVRVATTGEWNKLAEDQEFNKNSKIRMIEVML 540
           HG  AQYNEIQ WNHL +LPTFGAKDYE +RVATTGEW KL  D+ F KNSKIRMIE+ML
Sbjct: 481 HGPTAQYNEIQGWNHLQILPTFGAKDYEALRVATTGEWIKLTTDKAFQKNSKIRMIEIML 540

Query: 541 PVMDAPESLVKQAQLTAATNAK 562
           PVMDAP +LV QA+LTAATNAK
Sbjct: 541 PVMDAPSNLVAQAKLTAATNAK 562

>AAL073W Chr1 (216809..218500) [1692 bp, 563 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YGR087C (PDC6) and
           YLR134W (PDC5)
          Length = 563

 Score =  874 bits (2257), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 428/562 (76%), Positives = 475/562 (84%)

Query: 1   MSEITLGRYLFERLRQVECNTIFGLPGDFNLRLLDEIYETEGMRWXXXXXXXXXXXXXXX 60
           MSEITLGRYLFERL+QVE  TIFG+PGDFNL LLD++YE +GMRW               
Sbjct: 1   MSEITLGRYLFERLKQVEVRTIFGVPGDFNLSLLDKVYEVDGMRWAGNANELNASYAADG 60

Query: 61  XXRIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120
             R+K +SCL+TTFGVGELSALNGIAGSYAEHVGVLHVVGVPS SAQAKQLLLHHTLGNG
Sbjct: 61  YARVKKISCLVTTFGVGELSALNGIAGSYAEHVGVLHVVGVPSTSAQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMISDLATAPAEIDRCIRTTYVRQRPVYLGLPSNFVDQMVPASL 180
           DFTVFHRMSANIS+TTA+I+D+++APAEIDRCIR  YV QRPVYLGLP+N VD  VPASL
Sbjct: 121 DFTVFHRMSANISDTTAVITDISSAPAEIDRCIRACYVHQRPVYLGLPANMVDLTVPASL 180

Query: 181 LETPIDLSLKPNDAAAEQEVVSTVLDLIKNAKNPVILADACASRHDVKAETKKLIDVTQF 240
           L T IDLSLKPND  AE+EVVSTVL+L+ NAK+PVIL+DACASRHDVK ETK+LIDVTQF
Sbjct: 181 LNTEIDLSLKPNDPEAEEEVVSTVLELVANAKHPVILSDACASRHDVKQETKQLIDVTQF 240

Query: 241 PSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESSDLILSVGALLSDFNTGSFSYS 300
           P+FVTPMGKGSIDE+HPRFGGVYVGTLS+P VKEAVES+DLILSVGALLSDFNTGSFSYS
Sbjct: 241 PAFVTPMGKGSIDEQHPRFGGVYVGTLSAPDVKEAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDHIKIRNATFPGVQMKFVLQKLLTQVGDVVKDYKPVAIPEIPGPNAAVD 360
           YKTKNIVEFHSDH KIR+ATFPG++MK VLQ L+ ++G+  K Y+P  +P    PN   D
Sbjct: 301 YKTKNIVEFHSDHTKIRSATFPGIKMKTVLQNLVKRIGEAAKGYQPSPVPTYAAPNEDAD 360

Query: 361 DSTPLKQQWLWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIXXXXX 420
             TPLKQ+WLWNQV  FL+EGD+VITETGT+AFGINQT FP++T GISQVLWGSI     
Sbjct: 361 PKTPLKQEWLWNQVSSFLKEGDIVITETGTAAFGINQTRFPSSTIGISQVLWGSIGFTTG 420

Query: 421 XXXXXXXXXXXXDKNKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNNGYTIEKLI 480
                       D NKRVILFIGDGSLQLTVQEISTM+RWGLKPYLFVLNN+GYTIE+LI
Sbjct: 421 ACLGAAFAAEEIDPNKRVILFIGDGSLQLTVQEISTMVRWGLKPYLFVLNNDGYTIERLI 480

Query: 481 HGEFAQYNEIQPWNHLDLLPTFGAKDYETVRVATTGEWNKLAEDQEFNKNSKIRMIEVML 540
           HGE AQYN IQPW HLDLLPTFGAKDYET RVATTGEW  L E QEFNKNS IRMIE+ML
Sbjct: 481 HGETAQYNCIQPWKHLDLLPTFGAKDYETHRVATTGEWRALTEKQEFNKNSSIRMIEIML 540

Query: 541 PVMDAPESLVKQAQLTAATNAK 562
            VMDAP SL+KQA+LTAATNA+
Sbjct: 541 DVMDAPSSLIKQAKLTAATNAQ 562

>Smik_12.197 Chr12 (392030..393721) [1692 bp, 563 aa] {ON} YLR134W
           (REAL)
          Length = 563

 Score =  871 bits (2251), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 427/562 (75%), Positives = 475/562 (84%)

Query: 1   MSEITLGRYLFERLRQVECNTIFGLPGDFNLRLLDEIYETEGMRWXXXXXXXXXXXXXXX 60
           MSEITLG+YLFERL QV+CNT+FGLPGDFNL LLD++YE EGMRW               
Sbjct: 1   MSEITLGKYLFERLSQVKCNTVFGLPGDFNLSLLDKLYEVEGMRWAGNANELNAAYAADG 60

Query: 61  XXRIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120
             RIKG++C+ITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSIS+QAKQLLLHHTLGNG
Sbjct: 61  YARIKGIACIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMISDLATAPAEIDRCIRTTYVRQRPVYLGLPSNFVDQMVPASL 180
           DFTVFHRMSANISETTAM++D+A APAEIDRCIRTT+  QRPVYLGLP+N VD  VPA L
Sbjct: 121 DFTVFHRMSANISETTAMVTDIANAPAEIDRCIRTTFTTQRPVYLGLPANLVDLNVPAKL 180

Query: 181 LETPIDLSLKPNDAAAEQEVVSTVLDLIKNAKNPVILADACASRHDVKAETKKLIDVTQF 240
           LETPIDLSLKPNDA AE EVV TV+++IK+AKNPVILADACASRHDVKAETKKLI++TQF
Sbjct: 181 LETPIDLSLKPNDAEAEAEVVRTVIEMIKDAKNPVILADACASRHDVKAETKKLIELTQF 240

Query: 241 PSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESSDLILSVGALLSDFNTGSFSYS 300
           P +VTPMGKG+IDE+HPR+GGVYVGTLS P VKE VE++DLILSVGALLSDFNTGSFSYS
Sbjct: 241 PVYVTPMGKGAIDEQHPRYGGVYVGTLSRPEVKEGVENADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDHIKIRNATFPGVQMKFVLQKLLTQVGDVVKDYKPVAIPEIPGPNAAVD 360
           YKTKNIVEFHSDHIKIRNATFPGVQMKF LQKLL  +  VVKDYKPVA+P     N    
Sbjct: 301 YKTKNIVEFHSDHIKIRNATFPGVQMKFALQKLLGAIPAVVKDYKPVAVPARVPLNKPSP 360

Query: 361 DSTPLKQQWLWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIXXXXX 420
            +TP+KQ+W+WNQ+  FLQEGD+VI ETGTSAFGINQT FP + Y I QVLWGSI     
Sbjct: 361 ANTPMKQEWMWNQLSNFLQEGDIVIAETGTSAFGINQTTFPTDVYAIVQVLWGSIGFTVG 420

Query: 421 XXXXXXXXXXXXDKNKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNNGYTIEKLI 480
                       D  KRVILFIGDGSLQLTVQEISTMIRWGLKPY+FVLNNNGYTIEKLI
Sbjct: 421 ALLGATMAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYIFVLNNNGYTIEKLI 480

Query: 481 HGEFAQYNEIQPWNHLDLLPTFGAKDYETVRVATTGEWNKLAEDQEFNKNSKIRMIEVML 540
           HG +A YNEIQ W+HL LLPTFGAKDYE  R+ATTGEW+KL +D++F  NS+IR+IEVML
Sbjct: 481 HGPYADYNEIQGWDHLALLPTFGAKDYENHRIATTGEWDKLTQDKDFQDNSRIRLIEVML 540

Query: 541 PVMDAPESLVKQAQLTAATNAK 562
           PV DAPE+LV+QAQLTA+ NAK
Sbjct: 541 PVFDAPENLVQQAQLTASINAK 562

>SAKL0F04334g Chr6 complement(347639..349333) [1695 bp, 564 aa] {ON}
           uniprot|Q6XAE9 Saccharomyces kluyveri PDC13 Pyruvate
           decarboxylase
          Length = 564

 Score =  863 bits (2231), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 418/562 (74%), Positives = 476/562 (84%)

Query: 1   MSEITLGRYLFERLRQVECNTIFGLPGDFNLRLLDEIYETEGMRWXXXXXXXXXXXXXXX 60
           MSEITLGRYLFERL+QV+  TIFGLPGDFNL LLD+IYE  G+RW               
Sbjct: 1   MSEITLGRYLFERLKQVQVQTIFGLPGDFNLSLLDKIYEVPGLRWAGNANELNAAYAADG 60

Query: 61  XXRIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120
             R+KGMSC++TTFGVGELSALNGIAGSYAEHVGVLHVVGVPS+S+QA+QLLLHHTLGNG
Sbjct: 61  YARVKGMSCIVTTFGVGELSALNGIAGSYAEHVGVLHVVGVPSVSSQAQQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMISDLATAPAEIDRCIRTTYVRQRPVYLGLPSNFVDQMVPASL 180
           DFTVFHRMS+ ISETTA+I+D+  AP EIDRCI+ TY +QRPVYLGLP+N VD  V ASL
Sbjct: 121 DFTVFHRMSSEISETTAVITDIKDAPKEIDRCIKVTYSKQRPVYLGLPANLVDLKVSASL 180

Query: 181 LETPIDLSLKPNDAAAEQEVVSTVLDLIKNAKNPVILADACASRHDVKAETKKLIDVTQF 240
           L+TPIDLS+ PNDA AE EVV TVL ++  AKNPVILADAC +RHDVK ETKKLID+TQF
Sbjct: 181 LDTPIDLSMTPNDADAEDEVVETVLAMVSKAKNPVILADACCTRHDVKRETKKLIDLTQF 240

Query: 241 PSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESSDLILSVGALLSDFNTGSFSYS 300
           P+FVTPMGKGSIDE HPRFGGVYVGTLS P VKEAVES+DL+LSVGALLSDFNTGSFSYS
Sbjct: 241 PAFVTPMGKGSIDEDHPRFGGVYVGTLSDPEVKEAVESADLVLSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDHIKIRNATFPGVQMKFVLQKLLTQVGDVVKDYKPVAIPEIPGPNAAVD 360
           YKTKNIVEFHSD+ K+RNATFPGVQMK VLQKLL++V D    YKPV +P+    N  V+
Sbjct: 301 YKTKNIVEFHSDYTKVRNATFPGVQMKLVLQKLLSKVSDAASGYKPVPVPKGTRSNPGVE 360

Query: 361 DSTPLKQQWLWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIXXXXX 420
            STPLKQ+W+WN +  +L+EGDVVITETGTSAFGINQ+ FPN+TYGISQVLWGSI     
Sbjct: 361 SSTPLKQEWIWNHISDWLEEGDVVITETGTSAFGINQSRFPNSTYGISQVLWGSIGYSVG 420

Query: 421 XXXXXXXXXXXXDKNKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNNGYTIEKLI 480
                       DKN+RVILF+GDGSLQLTVQEISTM+RWGLKPYLFVLNN+GYTIE+LI
Sbjct: 421 SCLGAAFAAEELDKNRRVILFVGDGSLQLTVQEISTMVRWGLKPYLFVLNNDGYTIERLI 480

Query: 481 HGEFAQYNEIQPWNHLDLLPTFGAKDYETVRVATTGEWNKLAEDQEFNKNSKIRMIEVML 540
           HGE AQYN++QPW HL+LLPTFGAKDY+++R++TTGE+ KL EDQ F++NSKIR+IEVML
Sbjct: 481 HGETAQYNDVQPWLHLNLLPTFGAKDYDSIRISTTGEFLKLTEDQAFSRNSKIRLIEVML 540

Query: 541 PVMDAPESLVKQAQLTAATNAK 562
           PVMDAP +LVKQAQLTAATNAK
Sbjct: 541 PVMDAPSTLVKQAQLTAATNAK 562

>NCAS0A14630 Chr1 complement(2878338..2880029) [1692 bp, 563 aa]
           {ON} 
          Length = 563

 Score =  862 bits (2226), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 423/563 (75%), Positives = 473/563 (84%)

Query: 1   MSEITLGRYLFERLRQVECNTIFGLPGDFNLRLLDEIYETEGMRWXXXXXXXXXXXXXXX 60
           MSEITLGRYLFERL+QV  NTIFGLPGDFNL LLD+IYE  GMRW               
Sbjct: 1   MSEITLGRYLFERLKQVNVNTIFGLPGDFNLALLDKIYEVPGMRWAGNANELNASYAADG 60

Query: 61  XXRIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120
             R+KGM+CLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPS S+QAKQLLLHHTLGNG
Sbjct: 61  YARVKGMACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSTSSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMISDLATAPAEIDRCIRTTYVRQRPVYLGLPSNFVDQMVPASL 180
           DFTVFHRMS+NISETTAM++DLA A +EIDRCIRTTYV QR VYLGLP+N  D  V ASL
Sbjct: 121 DFTVFHRMSSNISETTAMVTDLANATSEIDRCIRTTYVTQRTVYLGLPANMFDLKVKASL 180

Query: 181 LETPIDLSLKPNDAAAEQEVVSTVLDLIKNAKNPVILADACASRHDVKAETKKLIDVTQF 240
           L+TPIDLSLKPNDAAAE EVV T+L L+K+AKNP+ILADAC SRHDVKAETKKLID+TQF
Sbjct: 181 LDTPIDLSLKPNDAAAENEVVETILSLVKDAKNPIILADACCSRHDVKAETKKLIDITQF 240

Query: 241 PSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESSDLILSVGALLSDFNTGSFSYS 300
           PSFVTPMGKGSIDE++PR+GGVYVGTLS+P VK+AVES+DLILSVGALLSDFNTGSFSYS
Sbjct: 241 PSFVTPMGKGSIDEQNPRYGGVYVGTLSNPDVKQAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDHIKIRNATFPGVQMKFVLQKLLTQVGDVVKDYKPVAIPEIPGPNAAVD 360
           YKTKN+VEFHSDHIKI++ATFPGVQMKFVLQKLL  +  V K YKPVA+P  P PN    
Sbjct: 301 YKTKNVVEFHSDHIKIKSATFPGVQMKFVLQKLLKVIPSVAKGYKPVAVPGRPAPNKPSP 360

Query: 361 DSTPLKQQWLWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIXXXXX 420
            +TP+KQ+W+WN++ KF QEGDV+ITETGTSAFGINQT FP N YGISQVLWGSI     
Sbjct: 361 ANTPMKQEWMWNELAKFFQEGDVIITETGTSAFGINQTPFPKNAYGISQVLWGSIGFATG 420

Query: 421 XXXXXXXXXXXXDKNKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNNGYTIEKLI 480
                       D  KRVILF G+GSLQLTVQEISTM+RW LKPYLFVLNN GYTIE+LI
Sbjct: 421 CTLGAAFAAEEIDPKKRVILFTGEGSLQLTVQEISTMVRWNLKPYLFVLNNAGYTIERLI 480

Query: 481 HGEFAQYNEIQPWNHLDLLPTFGAKDYETVRVATTGEWNKLAEDQEFNKNSKIRMIEVML 540
           HGE A YN+IQPWNHL+LL TFGAKDYE  RV+TTGEW KL  +++FN+NS+IR+IE+ML
Sbjct: 481 HGEKAGYNDIQPWNHLNLLETFGAKDYENHRVSTTGEWEKLTTNKDFNQNSRIRLIEIML 540

Query: 541 PVMDAPESLVKQAQLTAATNAKS 563
            VMDAP +LV QAQLTA+ NAK+
Sbjct: 541 EVMDAPSNLVAQAQLTASINAKN 563

>Suva_7.369 Chr7 complement(627739..629430) [1692 bp, 563 aa] {ON}
           YLR134W (REAL)
          Length = 563

 Score =  857 bits (2215), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 419/562 (74%), Positives = 473/562 (84%)

Query: 1   MSEITLGRYLFERLRQVECNTIFGLPGDFNLRLLDEIYETEGMRWXXXXXXXXXXXXXXX 60
           MSEITLGRYLFERL+QV  NTIFGLPGDFNL LLD+IYE +G+RW               
Sbjct: 1   MSEITLGRYLFERLKQVNVNTIFGLPGDFNLSLLDKIYEVDGLRWAGNANELNAAYAADG 60

Query: 61  XXRIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120
             RIKG+S LITTFGVGELSALNGIAGSYAEHVGVLHVVGVPS+SAQAKQLLLHHTLGNG
Sbjct: 61  YARIKGLSALITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSVSAQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMISDLATAPAEIDRCIRTTYVRQRPVYLGLPSNFVDQMVPASL 180
           DFTVFHRMS NISETT+MI+D+ATAP+EIDR IRTT+V QRP YLGLP+N VD  VPASL
Sbjct: 121 DFTVFHRMSTNISETTSMITDIATAPSEIDRLIRTTFVTQRPSYLGLPANLVDLKVPASL 180

Query: 181 LETPIDLSLKPNDAAAEQEVVSTVLDLIKNAKNPVILADACASRHDVKAETKKLIDVTQF 240
           L  PIDLSLKPND  AE+EV+ TVL+LI+ +KNP+IL+DACASRH VK ET+KLID+TQF
Sbjct: 181 LNKPIDLSLKPNDPEAEKEVIDTVLELIQKSKNPIILSDACASRHHVKKETQKLIDLTQF 240

Query: 241 PSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESSDLILSVGALLSDFNTGSFSYS 300
           P+FVTP+GKGSIDE+HPR+GGVYVGTLS P VK+AVES+DLILSVGALLSDFNTGSFSYS
Sbjct: 241 PAFVTPLGKGSIDEQHPRYGGVYVGTLSKPDVKQAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDHIKIRNATFPGVQMKFVLQKLLTQVGDVVKDYKPVAIPEIPGPNAAVD 360
           YKTKN+VEFHSD+IK++NATFPGVQMKF LQKLL+ +  V+K YK V +P    PN  V 
Sbjct: 301 YKTKNVVEFHSDYIKVKNATFPGVQMKFALQKLLSVIPSVIKSYKAVPVPTKTAPNKEVA 360

Query: 361 DSTPLKQQWLWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIXXXXX 420
            STPLKQ+WLWN++ KFLQEGDV+++ETGTSAFGINQT FP + YGISQVLWGSI     
Sbjct: 361 ASTPLKQEWLWNELSKFLQEGDVIVSETGTSAFGINQTSFPKDAYGISQVLWGSIGFTTG 420

Query: 421 XXXXXXXXXXXXDKNKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNNGYTIEKLI 480
                       D N+RVILFIGDGSLQLTVQEISTM+RWGLKPYLFVLNN+GYTIEKLI
Sbjct: 421 ATLGAAFAAEELDPNRRVILFIGDGSLQLTVQEISTMVRWGLKPYLFVLNNDGYTIEKLI 480

Query: 481 HGEFAQYNEIQPWNHLDLLPTFGAKDYETVRVATTGEWNKLAEDQEFNKNSKIRMIEVML 540
           HG +A+YNEIQ W+HL LLPTFGAK YE  +VATTGEW+KL  D EF KNS IR+IE+ L
Sbjct: 481 HGPYAEYNEIQTWDHLALLPTFGAKKYENHKVATTGEWDKLTHDPEFQKNSVIRLIELKL 540

Query: 541 PVMDAPESLVKQAQLTAATNAK 562
           PV DAPESL+KQA+LTAATNAK
Sbjct: 541 PVFDAPESLIKQAELTAATNAK 562

>TBLA0B10060 Chr2 complement(2418979..2420673) [1695 bp, 564 aa]
           {ON} 
          Length = 564

 Score =  857 bits (2215), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 423/562 (75%), Positives = 475/562 (84%)

Query: 1   MSEITLGRYLFERLRQVECNTIFGLPGDFNLRLLDEIYETEGMRWXXXXXXXXXXXXXXX 60
           MS+ITLG+YLFERL QV+  TIFGLPGDFNL LLD+IYE  GMRW               
Sbjct: 1   MSQITLGKYLFERLNQVKVQTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60

Query: 61  XXRIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120
             RIKGM+CLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPS+++QAK+LLLHHTLGNG
Sbjct: 61  YARIKGMACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSVASQAKKLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMISDLATAPAEIDRCIRTTYVRQRPVYLGLPSNFVDQMVPASL 180
           DF  FHRMSA ISETTAMI+D+A APAEIDRCIRTTYV QR VYLGLP+N VD MVPASL
Sbjct: 121 DFDAFHRMSAEISETTAMITDIANAPAEIDRCIRTTYVTQRTVYLGLPANLVDLMVPASL 180

Query: 181 LETPIDLSLKPNDAAAEQEVVSTVLDLIKNAKNPVILADACASRHDVKAETKKLIDVTQF 240
           LETPIDL+LKPN   +E EV+ T+LD++KNAKNP+I+ADACASRH+VK ET++LID+TQF
Sbjct: 181 LETPIDLALKPNCPESESEVIETILDMVKNAKNPIIIADACASRHNVKKETEQLIDITQF 240

Query: 241 PSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESSDLILSVGALLSDFNTGSFSYS 300
           P+F TPMGKGSI+EKHPRFGGVYVGTLS P +K+AVES+DLILSVGALLSDFNTGSFSY+
Sbjct: 241 PAFTTPMGKGSINEKHPRFGGVYVGTLSRPEIKQAVESADLILSVGALLSDFNTGSFSYA 300

Query: 301 YKTKNIVEFHSDHIKIRNATFPGVQMKFVLQKLLTQVGDVVKDYKPVAIPEIPGPNAAVD 360
           Y+TKNIVEFHSDH+KI+NATF GVQMKFVL+KL+ ++GD +KDYKPVA+P     N  V 
Sbjct: 301 YQTKNIVEFHSDHMKIKNATFQGVQMKFVLEKLIAKIGDYIKDYKPVAVPAAVPANKPVP 360

Query: 361 DSTPLKQQWLWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIXXXXX 420
             TPLKQ+WLWNQ+G FLQEGD+V+TETGTSAFGINQT FP +TYGISQVLWGSI     
Sbjct: 361 AETPLKQEWLWNQLGNFLQEGDIVLTETGTSAFGINQTTFPKDTYGISQVLWGSIGFTGG 420

Query: 421 XXXXXXXXXXXXDKNKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNNGYTIEKLI 480
                       + +KR ILFIGDGSLQLTVQEIST+IRW LKPYLFVLNNNGYTIEKLI
Sbjct: 421 CVLGAAFAAEEINPDKRTILFIGDGSLQLTVQEISTLIRWNLKPYLFVLNNNGYTIEKLI 480

Query: 481 HGEFAQYNEIQPWNHLDLLPTFGAKDYETVRVATTGEWNKLAEDQEFNKNSKIRMIEVML 540
           HG  AQYNEIQ WNHL +LPTFGAKDYE VRVATTGEW+KL  D+ FNKNSKIRMIE+ML
Sbjct: 481 HGPTAQYNEIQGWNHLQILPTFGAKDYEAVRVATTGEWDKLTTDKAFNKNSKIRMIEIML 540

Query: 541 PVMDAPESLVKQAQLTAATNAK 562
           PVMDAP +LV QAQLTAA NAK
Sbjct: 541 PVMDAPSNLVAQAQLTAAINAK 562

>YGR087C Chr7 complement(651290..652981) [1692 bp, 563 aa] {ON}
           PDC6Minor isoform of pyruvate decarboxylase,
           decarboxylates pyruvate to acetaldehyde, involved in
           amino acid catabolism; transcription is glucose- and
           ethanol-dependent, and is strongly induced during sulfur
           limitation
          Length = 563

 Score =  845 bits (2182), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 418/562 (74%), Positives = 469/562 (83%)

Query: 1   MSEITLGRYLFERLRQVECNTIFGLPGDFNLRLLDEIYETEGMRWXXXXXXXXXXXXXXX 60
           MSEITLG+YLFERL+QV  NTIFGLPGDFNL LLD+IYE +G+RW               
Sbjct: 1   MSEITLGKYLFERLKQVNVNTIFGLPGDFNLSLLDKIYEVDGLRWAGNANELNAAYAADG 60

Query: 61  XXRIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120
             RIKG+S L+TTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG
Sbjct: 61  YARIKGLSVLVTTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMISDLATAPAEIDRCIRTTYVRQRPVYLGLPSNFVDQMVPASL 180
           DFTVFHRMSANISETT+MI+D+ATAP+EIDR IRTT++ QRP YLGLP+N VD  VP SL
Sbjct: 121 DFTVFHRMSANISETTSMITDIATAPSEIDRLIRTTFITQRPSYLGLPANLVDLKVPGSL 180

Query: 181 LETPIDLSLKPNDAAAEQEVVSTVLDLIKNAKNPVILADACASRHDVKAETKKLIDVTQF 240
           LE PIDLSLKPND  AE+EV+ TVL+LI+N+KNPVIL+DACASRH+VK ET+KLID+TQF
Sbjct: 181 LEKPIDLSLKPNDPEAEKEVIDTVLELIQNSKNPVILSDACASRHNVKKETQKLIDLTQF 240

Query: 241 PSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESSDLILSVGALLSDFNTGSFSYS 300
           P+FVTP+GKGSIDE+HPR+GGVYVGTLS   VK+AVES+DLILSVGALLSDFNTGSFSYS
Sbjct: 241 PAFVTPLGKGSIDEQHPRYGGVYVGTLSKQDVKQAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDHIKIRNATFPGVQMKFVLQKLLTQVGDVVKDYKPVAIPEIPGPNAAVD 360
           YKTKN+VEFHSD++K++NATF GVQMKF LQ LL  + DVVK YK V +P     N  V 
Sbjct: 301 YKTKNVVEFHSDYVKVKNATFLGVQMKFALQNLLKVIPDVVKGYKSVPVPTKTPANKGVP 360

Query: 361 DSTPLKQQWLWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIXXXXX 420
            STPLKQ+WLWN++ KFLQEGDV+I+ETGTSAFGINQT FP + YGISQVLWGSI     
Sbjct: 361 ASTPLKQEWLWNELSKFLQEGDVIISETGTSAFGINQTIFPKDAYGISQVLWGSIGFTTG 420

Query: 421 XXXXXXXXXXXXDKNKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNNGYTIEKLI 480
                       D NKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNN+GYTIEKLI
Sbjct: 421 ATLGAAFAAEEIDPNKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIEKLI 480

Query: 481 HGEFAQYNEIQPWNHLDLLPTFGAKDYETVRVATTGEWNKLAEDQEFNKNSKIRMIEVML 540
           HG  A+YNEIQ W+HL LLP FGAK YE  ++ATTGEW+ L  D EF KNS IR+IE+ L
Sbjct: 481 HGPHAEYNEIQTWDHLALLPAFGAKKYENHKIATTGEWDALTTDSEFQKNSVIRLIELKL 540

Query: 541 PVMDAPESLVKQAQLTAATNAK 562
           PV DAPESL+KQAQLTAATNAK
Sbjct: 541 PVFDAPESLIKQAQLTAATNAK 562

>TBLA0D02840 Chr4 complement(694649..696340) [1692 bp, 563 aa] {ON}
           Anc_2.390 YDL080C
          Length = 563

 Score =  844 bits (2180), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 405/562 (72%), Positives = 470/562 (83%)

Query: 1   MSEITLGRYLFERLRQVECNTIFGLPGDFNLRLLDEIYETEGMRWXXXXXXXXXXXXXXX 60
           MS++TLGRYLFERL Q++  TIFGLPGDFNL LLD+IYE  GMRW               
Sbjct: 1   MSQVTLGRYLFERLNQIKIQTIFGLPGDFNLPLLDKIYEIPGMRWVGNANELNAAYAADG 60

Query: 61  XXRIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120
             RIKGMSC+ITTFGVGELSALNGIAGSYAEHVGVLHVVGVPS+ AQAK+LLLHHTLG+G
Sbjct: 61  YARIKGMSCMITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSLEAQAKKLLLHHTLGDG 120

Query: 121 DFTVFHRMSANISETTAMISDLATAPAEIDRCIRTTYVRQRPVYLGLPSNFVDQMVPASL 180
           DF  F+RMS+ ISET  MI D+ TAPAEIDRCI+T YV QRPVYLGLP N V+ MVP SL
Sbjct: 121 DFNAFYRMSSEISETAVMIKDVTTAPAEIDRCIKTAYVMQRPVYLGLPVNLVNAMVPVSL 180

Query: 181 LETPIDLSLKPNDAAAEQEVVSTVLDLIKNAKNPVILADACASRHDVKAETKKLIDVTQF 240
           L+TPIDLSL+PNDA +E EV+ T+L+++K AKNP+I+ADACASRHDVKAET+KLID+TQF
Sbjct: 181 LQTPIDLSLRPNDADSESEVIQTILEMVKQAKNPIIIADACASRHDVKAETEKLIDITQF 240

Query: 241 PSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESSDLILSVGALLSDFNTGSFSYS 300
           PSFVTPMGKGSI+E+HPRFGGVYVGTL+ P VK+AVES+DLILS+GALLSDFNTGSFSY+
Sbjct: 241 PSFVTPMGKGSINEQHPRFGGVYVGTLTRPEVKKAVESADLILSIGALLSDFNTGSFSYN 300

Query: 301 YKTKNIVEFHSDHIKIRNATFPGVQMKFVLQKLLTQVGDVVKDYKPVAIPEIPGPNAAVD 360
           Y+TKN++EFHSDH KI+NA + G+QMKFVL KL+T++G+VVK+YKPVA+P     N    
Sbjct: 301 YETKNVIEFHSDHTKIKNAVYEGIQMKFVLSKLITKIGEVVKNYKPVAVPAPILANPKTS 360

Query: 361 DSTPLKQQWLWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIXXXXX 420
             TPL+Q+WLWNQ+G FLQEGD+V+TETGTSAFGINQT+FP NTYGISQVLWGSI     
Sbjct: 361 PETPLRQEWLWNQLGNFLQEGDIVLTETGTSAFGINQTYFPKNTYGISQVLWGSIGFTGG 420

Query: 421 XXXXXXXXXXXXDKNKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNNGYTIEKLI 480
                       D  KRV+LFIGDGSLQLTVQEISTM+ W LKPYLFVLNN+GYTIE+LI
Sbjct: 421 CVLGAAFAAEEIDPKKRVVLFIGDGSLQLTVQEISTMVNWNLKPYLFVLNNDGYTIERLI 480

Query: 481 HGEFAQYNEIQPWNHLDLLPTFGAKDYETVRVATTGEWNKLAEDQEFNKNSKIRMIEVML 540
           HG  AQYNEIQPWN+L+LL TFGAKDY+ VRVATTGEWN L ++ EFN+NSKIRMIEVML
Sbjct: 481 HGPTAQYNEIQPWNNLELLSTFGAKDYQAVRVATTGEWNILTQNPEFNQNSKIRMIEVML 540

Query: 541 PVMDAPESLVKQAQLTAATNAK 562
           P MDAP +L+ QA+LTA+ NAK
Sbjct: 541 PTMDAPSNLISQAELTASINAK 562

>KNAG0J01330 Chr10 complement(240650..242344) [1695 bp, 564 aa] {ON}
           
          Length = 564

 Score =  842 bits (2175), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 413/562 (73%), Positives = 466/562 (82%)

Query: 1   MSEITLGRYLFERLRQVECNTIFGLPGDFNLRLLDEIYETEGMRWXXXXXXXXXXXXXXX 60
           MS ++LG YLFERL+QV  NTIFGLPGDFNL LLD+IY+  GMRW               
Sbjct: 1   MSTVSLGHYLFERLKQVGVNTIFGLPGDFNLVLLDKIYDIPGMRWVGNANELNASYAADG 60

Query: 61  XXRIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120
             RIKGM+CL+TTFGVGELSALNGIAGSYAEHVGVLHVVGVPS  +QAK LLLHHTLGNG
Sbjct: 61  YARIKGMACLLTTFGVGELSALNGIAGSYAEHVGVLHVVGVPSTLSQAKGLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMISDLATAPAEIDRCIRTTYVRQRPVYLGLPSNFVDQMVPASL 180
           DF VFHRMSA ISETTA+I+DL+ A +EIDRCIRTTYV+QR VYLG+P+N  D  +P SL
Sbjct: 121 DFDVFHRMSAEISETTAVITDLSKAASEIDRCIRTTYVKQRTVYLGIPANMFDYEMPRSL 180

Query: 181 LETPIDLSLKPNDAAAEQEVVSTVLDLIKNAKNPVILADACASRHDVKAETKKLIDVTQF 240
           L+TPIDLSLK N+  +E EV+ T+LDL+  AKNP+ILADACASRHDVK ET++LID TQF
Sbjct: 181 LDTPIDLSLKANNPESESEVLDTILDLVSKAKNPIILADACASRHDVKKETQQLIDATQF 240

Query: 241 PSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESSDLILSVGALLSDFNTGSFSYS 300
           P+FVTPMGKGSIDE HPR+GG+YVGTLSSPAVK+AVES+DL+LSVGALLSDFNTGSFSYS
Sbjct: 241 PAFVTPMGKGSIDETHPRYGGIYVGTLSSPAVKKAVESADLVLSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDHIKIRNATFPGVQMKFVLQKLLTQVGDVVKDYKPVAIPEIPGPNAAVD 360
           Y+TKNIVEFHSDHIKIRNA FP +QMK +LQKL+TQ+  V+ +Y PVA+P     NAAVD
Sbjct: 301 YQTKNIVEFHSDHIKIRNALFPDMQMKSILQKLITQIKPVIANYSPVAVPARAPANAAVD 360

Query: 361 DSTPLKQQWLWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIXXXXX 420
            STPLKQ+W+W ++G FLQEGD+VITETGTSAFGIN T FP NT GISQVLWGSI     
Sbjct: 361 PSTPLKQEWMWKELGNFLQEGDIVITETGTSAFGINGTTFPKNTVGISQVLWGSIGFTGG 420

Query: 421 XXXXXXXXXXXXDKNKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNNGYTIEKLI 480
                       D N+RVILFIGDGSLQLTVQEIST I+W LKPYLF+LNNNGYTIEKLI
Sbjct: 421 AVLGAAFAAEEIDPNRRVILFIGDGSLQLTVQEISTCIKWNLKPYLFILNNNGYTIEKLI 480

Query: 481 HGEFAQYNEIQPWNHLDLLPTFGAKDYETVRVATTGEWNKLAEDQEFNKNSKIRMIEVML 540
           HG  AQYNEIQ W HL LLPTFGAKDYE VR+AT GEWNKL +D+EFNKNS+IR+IEVML
Sbjct: 481 HGPTAQYNEIQSWEHLQLLPTFGAKDYEAVRIATVGEWNKLTQDKEFNKNSRIRLIEVML 540

Query: 541 PVMDAPESLVKQAQLTAATNAK 562
           PVMDAPESL+KQ QLTAA NAK
Sbjct: 541 PVMDAPESLIKQGQLTAAINAK 562

>KAFR0E01520 Chr5 complement(306988..308679) [1692 bp, 563 aa] {ON} 
          Length = 563

 Score =  838 bits (2166), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 409/562 (72%), Positives = 463/562 (82%)

Query: 1   MSEITLGRYLFERLRQVECNTIFGLPGDFNLRLLDEIYETEGMRWXXXXXXXXXXXXXXX 60
           MSEITLGRYLFERL QV+  TIFGLPGDFNL LLD+IYE  GMRW               
Sbjct: 1   MSEITLGRYLFERLSQVDVKTIFGLPGDFNLALLDKIYEVPGMRWAGNANELNAAYAADG 60

Query: 61  XXRIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120
             RIKGMSC+ITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSIS+QAKQLLLHH+LGNG
Sbjct: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHSLGNG 120

Query: 121 DFTVFHRMSANISETTAMISDLATAPAEIDRCIRTTYVRQRPVYLGLPSNFVDQMVPASL 180
           DFTVFHRMSANISETTA+++D+ATA AEIDRCI+TTY+ QRPVYLG+P+N  D  +PA L
Sbjct: 121 DFTVFHRMSANISETTAVLTDIATAAAEIDRCIKTTYITQRPVYLGIPANMFDFKLPAKL 180

Query: 181 LETPIDLSLKPNDAAAEQEVVSTVLDLIKNAKNPVILADACASRHDVKAETKKLIDVTQF 240
           LETPIDLSLKPND  AE EV+  +L L+K AKNPVIL+DACASRH+V+ ET++LID TQF
Sbjct: 181 LETPIDLSLKPNDPEAEDEVIDAILSLVKAAKNPVILSDACASRHNVRKETRQLIDATQF 240

Query: 241 PSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESSDLILSVGALLSDFNTGSFSYS 300
           P+F TPMGKGSIDE+HPR+GGVYVGTLS P VK+AVESSDLILSVGALLSDFNTGSFSYS
Sbjct: 241 PAFTTPMGKGSIDEQHPRYGGVYVGTLSRPEVKKAVESSDLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDHIKIRNATFPGVQMKFVLQKLLTQVGDVVKDYKPVAIPEIPGPNAAVD 360
           YKTKN+VEFHSD+ KI+NATFPGVQMKFVLQKL   +   VK YKP+ +P     N    
Sbjct: 301 YKTKNVVEFHSDYTKIKNATFPGVQMKFVLQKLSKVIDQTVKGYKPIPVPAKVPSNKPCS 360

Query: 361 DSTPLKQQWLWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIXXXXX 420
            STPL Q+W+WNQ  KF QEGD++ITETGT+AFGINQ+ FP +  GISQVLWGSI     
Sbjct: 361 PSTPLSQEWMWNQASKFFQEGDIIITETGTAAFGINQSEFPTHAVGISQVLWGSIGFTGG 420

Query: 421 XXXXXXXXXXXXDKNKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNNGYTIEKLI 480
                       D N+RVILFIGDGSLQLTVQEISTMIRW L+PYLFVLNNNGYTIEKLI
Sbjct: 421 AVLGAAFAAEELDINRRVILFIGDGSLQLTVQEISTMIRWNLRPYLFVLNNNGYTIEKLI 480

Query: 481 HGEFAQYNEIQPWNHLDLLPTFGAKDYETVRVATTGEWNKLAEDQEFNKNSKIRMIEVML 540
           HGE AQYNEIQ W HL LL TFGAKDYE  R+ATTGEW+ L  +++FNKNS+IR+IE+ML
Sbjct: 481 HGENAQYNEIQNWKHLKLLETFGAKDYENHRIATTGEWDALLSNKDFNKNSRIRLIEIML 540

Query: 541 PVMDAPESLVKQAQLTAATNAK 562
           PVMDAP +LV+QA++TAATNA+
Sbjct: 541 PVMDAPSNLVQQAKITAATNAQ 562

>KLTH0D08272g Chr4 complement(695296..696987) [1692 bp, 563 aa] {ON}
           highly similar to uniprot|P06169 Saccharomyces
           cerevisiae YLR044C PDC1 Major of three pyruvate
           decarboxylase isozymes key enzyme in alcoholic
           fermentation decarboxylates pyruvate to acetaldehyde
           subject to glucose- ethanol- and autoregulation involved
           in amino acid catabolism and to YLR134W uniprot|P16467
           Saccharomyces cerevisiae YLR134W PDC5 Minor isoform of
           pyruvate decarboxylase, key enzyme in alcoholic
           fermentation, decarboxylates pyruvate to acetaldehyde,
           regulation is glucose- and ethanol-dependent, repressed
           by thiamine, involved in amino acid catabolism
          Length = 563

 Score =  837 bits (2161), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 407/563 (72%), Positives = 461/563 (81%)

Query: 1   MSEITLGRYLFERLRQVECNTIFGLPGDFNLRLLDEIYETEGMRWXXXXXXXXXXXXXXX 60
           MS ITLGRYLFERLRQVEC TIFGLPGDFNLRLLDEIYE EGMRW               
Sbjct: 1   MSSITLGRYLFERLRQVECFTIFGLPGDFNLRLLDEIYEVEGMRWAGNTNELNAAYAADG 60

Query: 61  XXRIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120
             R+KG++CLITTFGVGELSALNG+ GSYAEHVGVLHVVGVPS+++QAKQ LLHHTLG+G
Sbjct: 61  YARLKGIACLITTFGVGELSALNGVVGSYAEHVGVLHVVGVPSLASQAKQQLLHHTLGDG 120

Query: 121 DFTVFHRMSANISETTAMISDLATAPAEIDRCIRTTYVRQRPVYLGLPSNFVDQMVPASL 180
           DF VFHRMSANIS+TTAM++DLATAP EIDRCIRTTYV QRPVYLGLP+N V+QMV   L
Sbjct: 121 DFAVFHRMSANISQTTAMVTDLATAPQEIDRCIRTTYVTQRPVYLGLPANIVNQMVDRRL 180

Query: 181 LETPIDLSLKPNDAAAEQEVVSTVLDLIKNAKNPVILADACASRHDVKAETKKLIDVTQF 240
           L+TPIDLSL+PND   E+EV++ VL L++ A+NP+ILADAC SRHD K E  +L D TQF
Sbjct: 181 LDTPIDLSLEPNDEDTEEEVLTQVLALVQKAQNPIILADACCSRHDAKKEAWQLTDATQF 240

Query: 241 PSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESSDLILSVGALLSDFNTGSFSYS 300
           P FVTPMGKGS+ EKHPRFGGVYVGTLSSP VK AVE++DLILS+GALLSDFNTGSFSYS
Sbjct: 241 PCFVTPMGKGSVPEKHPRFGGVYVGTLSSPDVKSAVEAADLILSLGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDHIKIRNATFPGVQMKFVLQKLLTQVGDVVKDYKPVAIPEIPGPNAAVD 360
           Y T+N+VEFHSDH K+RNA FP V MKFVLQKL+ ++   ++ Y P  +P  P  NA   
Sbjct: 301 YGTRNVVEFHSDHTKVRNAIFPRVGMKFVLQKLIQRIPAAIQHYSPRPVPTRPARNAPTP 360

Query: 361 DSTPLKQQWLWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIXXXXX 420
             TPL Q+WLW Q+G+FL+EGDVV+TETGTSAFGINQT FPNNTYGISQVLWGSI     
Sbjct: 361 RDTPLTQEWLWTQIGEFLREGDVVVTETGTSAFGINQTRFPNNTYGISQVLWGSIGFTTG 420

Query: 421 XXXXXXXXXXXXDKNKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNNGYTIEKLI 480
                       DKNKRVILFIGDGSLQLTVQEIS+M+RWGL+PYLFV NN+GYTIEKLI
Sbjct: 421 ATLGAAMAAEELDKNKRVILFIGDGSLQLTVQEISSMVRWGLRPYLFVPNNDGYTIEKLI 480

Query: 481 HGEFAQYNEIQPWNHLDLLPTFGAKDYETVRVATTGEWNKLAEDQEFNKNSKIRMIEVML 540
           HG  AQYNEIQ W+HL LLPTFGA DYE VRVATTGEW+ L  D  FN+NS+IR++EVML
Sbjct: 481 HGPTAQYNEIQNWHHLRLLPTFGATDYEAVRVATTGEWDALTNDPAFNRNSRIRLVEVML 540

Query: 541 PVMDAPESLVKQAQLTAATNAKS 563
            VMDAP SLV+QAQLTAATNA++
Sbjct: 541 EVMDAPSSLVRQAQLTAATNAQN 563

>NDAI0A02510 Chr1 complement(562483..564174) [1692 bp, 563 aa] {ON} 
          Length = 563

 Score =  826 bits (2134), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 395/562 (70%), Positives = 451/562 (80%)

Query: 1   MSEITLGRYLFERLRQVECNTIFGLPGDFNLRLLDEIYETEGMRWXXXXXXXXXXXXXXX 60
           MSEITLGRYLFERL QV  +TIFGLPGDFNL LLD++YE  GMRW               
Sbjct: 1   MSEITLGRYLFERLHQVSVDTIFGLPGDFNLTLLDKVYEVAGMRWAGNANELNAAYAADG 60

Query: 61  XXRIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120
             RIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVG PS ++QAK LLLHHTLGNG
Sbjct: 61  YARIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGTPSTTSQAKGLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMISDLATAPAEIDRCIRTTYVRQRPVYLGLPSNFVDQMVPASL 180
           DFTVFHRMS+NISETTAM++D+  APAEIDRCIRTTY+ QRPVYLG+P+NF D  VPA+L
Sbjct: 121 DFTVFHRMSSNISETTAMLTDITAAPAEIDRCIRTTYIAQRPVYLGIPANFFDLKVPANL 180

Query: 181 LETPIDLSLKPNDAAAEQEVVSTVLDLIKNAKNPVILADACASRHDVKAETKKLIDVTQF 240
           L TPIDLSL  N+  AE+E +  VL+L+K +KNP+I+ DACASRHDVKAET KLI++TQF
Sbjct: 181 LNTPIDLSLHENEPEAEKEALGMVLELVKKSKNPIIVVDACASRHDVKAETNKLIELTQF 240

Query: 241 PSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESSDLILSVGALLSDFNTGSFSYS 300
           P+FVTPMGKG+I+E+HPR+GGVYVGTLS P VKEAVES+DLILS+GALLSDFNTGSFSYS
Sbjct: 241 PTFVTPMGKGAINEQHPRYGGVYVGTLSRPEVKEAVESADLILSIGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDHIKIRNATFPGVQMKFVLQKLLTQVGDVVKDYKPVAIPEIPGPNAAVD 360
           Y TK++VEFHSD+++I+ ATFPGVQMKF+L KL   + + V+ YKP  +P     NA + 
Sbjct: 301 YDTKSVVEFHSDYVRIKKATFPGVQMKFLLDKLNYIIPNYVQSYKPRPVPTRVPDNAPIG 360

Query: 361 DSTPLKQQWLWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIXXXXX 420
            ST LKQ WLWNQ+ KFL+EGD+VI ETGTS FGIN+T FP N   ISQVLWGSI     
Sbjct: 361 PSTSLKQAWLWNQLSKFLKEGDIVIVETGTSGFGINETTFPKNVTCISQVLWGSIGFATG 420

Query: 421 XXXXXXXXXXXXDKNKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNNGYTIEKLI 480
                       D  +RVILF GDGSLQLTVQEISTMIRW LKPYLFVLNN GYTIEKLI
Sbjct: 421 CTLGATMAAEELDPKRRVILFTGDGSLQLTVQEISTMIRWNLKPYLFVLNNKGYTIEKLI 480

Query: 481 HGEFAQYNEIQPWNHLDLLPTFGAKDYETVRVATTGEWNKLAEDQEFNKNSKIRMIEVML 540
           HG  A YNEIQ W HL LL TFGAKDYE  RV+TTG WN++  D++FN+NSKIRMIEVML
Sbjct: 481 HGPTAAYNEIQHWEHLKLLETFGAKDYENYRVSTTGAWNEMTGDKKFNENSKIRMIEVML 540

Query: 541 PVMDAPESLVKQAQLTAATNAK 562
           PVMDAPESL+KQ +LTA  N+K
Sbjct: 541 PVMDAPESLIKQGELTAQINSK 562

>TBLA0E03070 Chr5 (771183..772874) [1692 bp, 563 aa] {ON} 
          Length = 563

 Score =  824 bits (2128), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 404/561 (72%), Positives = 454/561 (80%)

Query: 1   MSEITLGRYLFERLRQVECNTIFGLPGDFNLRLLDEIYETEGMRWXXXXXXXXXXXXXXX 60
           MSEITLG+YLFERL+QV  NTIFGLPGDFNL LLD+IYE  GMRW               
Sbjct: 1   MSEITLGKYLFERLKQVNVNTIFGLPGDFNLALLDKIYEVPGMRWAGNANELNAAYAADG 60

Query: 61  XXRIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120
             RIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPS ++QAK+LLLHHTLGNG
Sbjct: 61  YARIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSTTSQAKKLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMISDLATAPAEIDRCIRTTYVRQRPVYLGLPSNFVDQMVPASL 180
           DF VFHRMS  ISETTAMI+DL+ A ++ID CIR TY  QRPVYLG+P+N  D  +PA L
Sbjct: 121 DFDVFHRMSTEISETTAMITDLSKAASQIDNCIRVTYTTQRPVYLGIPANMFDFTLPAKL 180

Query: 181 LETPIDLSLKPNDAAAEQEVVSTVLDLIKNAKNPVILADACASRHDVKAETKKLIDVTQF 240
           LETPI++ L PN+  +E EVV T+L ++K AKNPVI+ADAC SRH+VKAET+KLID TQF
Sbjct: 181 LETPINMKLSPNNQESEDEVVETILRMVKGAKNPVIIADACCSRHNVKAETEKLIDATQF 240

Query: 241 PSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESSDLILSVGALLSDFNTGSFSYS 300
           P+F TPMGKGSI+E HPRFGGVYVGTL+ P VK+AVES+DLILSVGALLSDFNTG+FSY 
Sbjct: 241 PAFTTPMGKGSINEHHPRFGGVYVGTLTRPEVKKAVESADLILSVGALLSDFNTGTFSYD 300

Query: 301 YKTKNIVEFHSDHIKIRNATFPGVQMKFVLQKLLTQVGDVVKDYKPVAIPEIPGPNAAVD 360
           Y+TKNIVEFHSDHIKI+NATF GVQMKFVL +L+ ++GD VKDYKPV +P     N    
Sbjct: 301 YETKNIVEFHSDHIKIKNATFQGVQMKFVLDRLIKEIGDYVKDYKPVPVPAGIPDNKPCP 360

Query: 361 DSTPLKQQWLWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIXXXXX 420
           D TPL+Q+WLWNQ+G FLQEGD+V+TETGTSAFGIN T FP NTYGI+QVLWGSI     
Sbjct: 361 DETPLQQEWLWNQLGNFLQEGDIVLTETGTSAFGINHTKFPKNTYGINQVLWGSIGFTGG 420

Query: 421 XXXXXXXXXXXXDKNKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNNGYTIEKLI 480
                       D  KRV LFIGDGSLQLTVQEISTMIRW LKPYLFVLNNNGYTIEKLI
Sbjct: 421 CVLGAAFAAEEIDPKKRVHLFIGDGSLQLTVQEISTMIRWNLKPYLFVLNNNGYTIEKLI 480

Query: 481 HGEFAQYNEIQPWNHLDLLPTFGAKDYETVRVATTGEWNKLAEDQEFNKNSKIRMIEVML 540
           HG  AQYNEIQ W+HL +LPTFGA DYE +RVAT GEWNKL  D +FNKNSKIRMIE+ML
Sbjct: 481 HGPTAQYNEIQGWDHLSILPTFGATDYEAIRVATIGEWNKLTTDDKFNKNSKIRMIEIML 540

Query: 541 PVMDAPESLVKQAQLTAATNA 561
           PVMDAP +L+ Q +LT A NA
Sbjct: 541 PVMDAPSNLIAQGKLTEAINA 561

>KNAG0M01250 Chr13 complement(229749..231440) [1692 bp, 563 aa] {ON}
           Anc_5.122 YLR044C
          Length = 563

 Score =  823 bits (2127), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 407/562 (72%), Positives = 457/562 (81%)

Query: 1   MSEITLGRYLFERLRQVECNTIFGLPGDFNLRLLDEIYETEGMRWXXXXXXXXXXXXXXX 60
           M ++TLGRYLFERL QV+  TIFGLPGDFNL LLD+IYE  GMRW               
Sbjct: 1   MPDLTLGRYLFERLYQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60

Query: 61  XXRIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120
             R+KGM+C+ITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSIS+QAKQLLLHHTLGNG
Sbjct: 61  YARVKGMACIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMISDLATAPAEIDRCIRTTYVRQRPVYLGLPSNFVDQMVPASL 180
           DFTVFHRMSANISETTAM++D+ TAPAEIDRCIRTTYV QRPVYLGLP+N VD  VP  L
Sbjct: 121 DFTVFHRMSANISETTAMVTDIGTAPAEIDRCIRTTYVTQRPVYLGLPANLVDLPVPTHL 180

Query: 181 LETPIDLSLKPNDAAAEQEVVSTVLDLIKNAKNPVILADACASRHDVKAETKKLIDVTQF 240
           LETPIDL+LKPND  AE EV+ TVL+LI+ A NPVILADACA RHDVK ET KLID+TQF
Sbjct: 181 LETPIDLTLKPNDQEAENEVIETVLELIEEASNPVILADACAGRHDVKVETNKLIDMTQF 240

Query: 241 PSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESSDLILSVGALLSDFNTGSFSYS 300
           P+FVTPMGKG+IDE++PRFGGVYVGTLS+  V+ AVES+DLILSVGALLSDFNTGSFSYS
Sbjct: 241 PAFVTPMGKGTIDERNPRFGGVYVGTLSNENVRNAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDHIKIRNATFPGVQMKFVLQKLLTQVGDVVKDYKPVAIPEIPGPNAAVD 360
           YKTKNIVEFHSD+IKIRNATFPGVQMKFVL KLL  VG  VK Y PV +P    PN    
Sbjct: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFVLNKLLAVVGSAVKGYTPVPLPPRLTPNEPCP 360

Query: 361 DSTPLKQQWLWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIXXXXX 420
             T L+Q+W+WN+V KF ++GD+++TETGT+AFGINQ+ FPNNT GISQVLWGSI     
Sbjct: 361 PDTILRQEWMWNEVSKFFRDGDIILTETGTAAFGINQSLFPNNTIGISQVLWGSIGFTGG 420

Query: 421 XXXXXXXXXXXXDKNKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNNGYTIEKLI 480
                       D +KRVILFIGDGSLQLTVQEIST+IRW LKPYLFVLNNNGYTIE+LI
Sbjct: 421 AVLGASFAAEEIDPSKRVILFIGDGSLQLTVQEISTLIRWDLKPYLFVLNNNGYTIERLI 480

Query: 481 HGEFAQYNEIQPWNHLDLLPTFGAKDYETVRVATTGEWNKLAEDQEFNKNSKIRMIEVML 540
           HG  A YN IQPW H  LL  FGA DYE V++ TTGEW  L +D++FN+ SKIRMIEVML
Sbjct: 481 HGPNAGYNAIQPWRHTKLLEAFGANDYENVKITTTGEWQTLTQDKQFNEPSKIRMIEVML 540

Query: 541 PVMDAPESLVKQAQLTAATNAK 562
           PVMDAP +L+ QA+LTA  N+K
Sbjct: 541 PVMDAPSNLIAQAKLTACINSK 562

>KNAG0J01340 Chr10 complement(243186..244883) [1698 bp, 565 aa] {ON}
           
          Length = 565

 Score =  821 bits (2121), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 389/565 (68%), Positives = 458/565 (81%), Gaps = 1/565 (0%)

Query: 1   MSEITLGRYLFERLRQVECNTIFGLPGDFNLRLLDEIYETEGMRWXXXXXXXXXXXXXXX 60
           MS I+LG YLFERL+QV  NTIFGLPGDFNL LLD+IY+  G+RW               
Sbjct: 1   MSTISLGHYLFERLKQVGVNTIFGLPGDFNLVLLDKIYDVPGIRWAGNANELNAAYAADG 60

Query: 61  XXRIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120
             RIKGM+CL+TTFGVGELSALNGIAGSYAEHVGVLHVVG PS  +QA  LLLHHTLGNG
Sbjct: 61  YARIKGMACLLTTFGVGELSALNGIAGSYAEHVGVLHVVGTPSTHSQANGLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMISDLATAPAEIDRCIRTTYVRQRPVYLGLPSNFVDQMVPASL 180
           DF VFHRMSA ISETT MI+D   A  +IDRCIRTTYV+QR VYLG+P+N  D  +P SL
Sbjct: 121 DFDVFHRMSAQISETTEMITDPHKAADQIDRCIRTTYVKQRTVYLGIPANMFDYEMPRSL 180

Query: 181 LETPIDLSLKPNDAAAEQEVVSTVLDLIKNAKNPVILADACASRHDVKAETKKLIDVTQF 240
           L+TPIDLSLK N+  +E++V+ T+L  +K+AKNP+I++DACASRHDVK ET++LI++TQF
Sbjct: 181 LDTPIDLSLKANNPTSERQVLDTILQSVKDAKNPIIISDACASRHDVKEETQQLINITQF 240

Query: 241 PSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESSDLILSVGALLSDFNTGSFSYS 300
           P+FVTP+GKGSIDE HPR+GG+YVGTLS P VKEAVES+DLILSVGALLSDFNTGSFSYS
Sbjct: 241 PAFVTPLGKGSIDETHPRYGGIYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDHIKIRNATFPGVQMKFVLQKLLTQVGDVVKDYKPVAIP-EIPGPNAAV 359
           Y+TKN+VEFHSDH+KI+NA FPGVQM+ +L+KLL ++  VVK Y PVA+P +IP  + ++
Sbjct: 301 YETKNVVEFHSDHMKIKNAVFPGVQMEPLLRKLLKEIPAVVKGYNPVAVPAKIPANDKSI 360

Query: 360 DDSTPLKQQWLWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIXXXX 419
             + PL+Q+W+WNQ+ +FLQEGD++ITETGTSAFGIN T FP N  GISQVLWGSI    
Sbjct: 361 SATAPLRQEWMWNQLSEFLQEGDIIITETGTSAFGINGTTFPKNAVGISQVLWGSIGFTV 420

Query: 420 XXXXXXXXXXXXXDKNKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNNGYTIEKL 479
                        D  KRVILFIGDGSLQLTVQEISTMI+W LKPYLF+LNNNGYTIEKL
Sbjct: 421 GALLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIKWNLKPYLFILNNNGYTIEKL 480

Query: 480 IHGEFAQYNEIQPWNHLDLLPTFGAKDYETVRVATTGEWNKLAEDQEFNKNSKIRMIEVM 539
           IHG  A+YNEIQ W+HL LLPT GAKDYE VRVAT GEWNKL +D+EFNKNS+IR+IEVM
Sbjct: 481 IHGPTAEYNEIQSWDHLKLLPTLGAKDYEAVRVATVGEWNKLTQDKEFNKNSRIRVIEVM 540

Query: 540 LPVMDAPESLVKQAQLTAATNAKSA 564
           LPVMDAP+SL++Q +LT   NA S 
Sbjct: 541 LPVMDAPQSLIEQGKLTEKINANSG 565

>NCAS0A14240 Chr1 (2804135..2805832) [1698 bp, 565 aa] {ON} 
          Length = 565

 Score =  821 bits (2120), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 402/565 (71%), Positives = 459/565 (81%), Gaps = 2/565 (0%)

Query: 1   MSEITLGRYLFERLRQVECNTIFGLPGDFNLRLLDEIYETEGMRWXXXXXXXXXXXXXXX 60
           MS I+LGRYLFERL QV  +TIFGLPGDFNL LLD+IYE  GMRW               
Sbjct: 1   MSTISLGRYLFERLHQVSVDTIFGLPGDFNLTLLDKIYEVPGMRWAGNANELNAAYAADG 60

Query: 61  XXRIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120
             R+KGM+CL+TTFGVGELSALNGIAGSYAEHVGVLHVVGVPS S+QAK LLLHHTLGNG
Sbjct: 61  YARVKGMACLLTTFGVGELSALNGIAGSYAEHVGVLHVVGVPSTSSQAKNLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMISDLATAPAEIDRCIRTTYVRQRPVYLGLPSNFVDQMVPASL 180
           DFTVFHRMS+NISETT++++D+A APAEIDRCIR TY++QRPVYLG+P+NF D  + A L
Sbjct: 121 DFTVFHRMSSNISETTSIVTDVAQAPAEIDRCIRETYIKQRPVYLGIPANFFDLPISAKL 180

Query: 181 LETPIDLSLKPNDAAAEQEVVSTVLDLIKNAKNPVILADACASRHDVKAETKKLIDVTQF 240
           L TPIDLSL  ND  AE E +  VL L+K+A NP+IL DACASRHDVK ETKKLID+TQ+
Sbjct: 181 LNTPIDLSLHENDEEAETEAIDLVLGLVKDAVNPIILVDACASRHDVKEETKKLIDITQY 240

Query: 241 PSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESSDLILSVGALLSDFNTGSFSYS 300
           P+FVTPMGKG+I+E+HPR+GGVYVG L+ PA+KEAVES+DLILSVGALLSDFNTGSFSY 
Sbjct: 241 PTFVTPMGKGAINEQHPRYGGVYVGNLTDPAIKEAVESADLILSVGALLSDFNTGSFSYG 300

Query: 301 YKTKNIVEFHSDHIKIRNATFPGVQMKFVLQKLLTQVGDVVKDYKPVAIPEIPGPNAAVD 360
            KTKN+VEFHSD++KIRNA+FPGVQMKFVLQKL  Q+    K+YKPV +P     N  V 
Sbjct: 301 LKTKNVVEFHSDYVKIRNASFPGVQMKFVLQKLNRQLPPYTKNYKPVPVPTKTASNKNVA 360

Query: 361 DSTPLKQQWLWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIXXXXX 420
            STP+KQ+W+WNQ+ KFLQEGD+VI+ETGTS FGINQT FPNNT GISQVLWGSI     
Sbjct: 361 ASTPMKQEWMWNQLAKFLQEGDIVISETGTSGFGINQTSFPNNTTGISQVLWGSIGFATG 420

Query: 421 XXXXXXXXXXXXDKNKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNNGYTIEKLI 480
                       D  KRVILF GDGSLQLTVQEISTM+RW LKPYLFVLNNNGYTIEKLI
Sbjct: 421 CTLGATMAAEEIDPKKRVILFTGDGSLQLTVQEISTMVRWNLKPYLFVLNNNGYTIEKLI 480

Query: 481 HGEFAQYNEIQPWNHLDLLPTFGAKD--YETVRVATTGEWNKLAEDQEFNKNSKIRMIEV 538
           HGE A YNEIQPWNHL+L   FGAK+  +E  RV+TTGEWNKL E ++F  N+KIRMIEV
Sbjct: 481 HGEHAGYNEIQPWNHLELFHAFGAKEGTFENHRVSTTGEWNKLTESKQFQDNTKIRMIEV 540

Query: 539 MLPVMDAPESLVKQAQLTAATNAKS 563
           MLPVMDAP SL+KQA+LTA+ NAK+
Sbjct: 541 MLPVMDAPTSLIKQAKLTASINAKN 565

>NDAI0D03270 Chr4 (778452..780017) [1566 bp, 521 aa] {ON} 
          Length = 521

 Score =  789 bits (2038), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 376/521 (72%), Positives = 425/521 (81%)

Query: 43  MRWXXXXXXXXXXXXXXXXXRIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVP 102
           MRW                 R+KGMSC+ITTFGVGELSALNGIAGSYAEHVGVLHVVG P
Sbjct: 1   MRWAGNANELNAAYAADGYARVKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGTP 60

Query: 103 SISAQAKQLLLHHTLGNGDFTVFHRMSANISETTAMISDLATAPAEIDRCIRTTYVRQRP 162
           S ++QAK LLLHHTLGNGDFTVFHRMS+N+SETTAMI+D+ TAPAEIDRCIRTTY+ QRP
Sbjct: 61  STTSQAKNLLLHHTLGNGDFTVFHRMSSNLSETTAMITDVTTAPAEIDRCIRTTYIAQRP 120

Query: 163 VYLGLPSNFVDQMVPASLLETPIDLSLKPNDAAAEQEVVSTVLDLIKNAKNPVILADACA 222
           VYLG+P+N+ D  VPA+LL TPIDL L PN+  AE+E +  +L+LIK++KNP IL DACA
Sbjct: 121 VYLGIPANYFDLKVPAALLNTPIDLELHPNEPEAEKEALDMILELIKDSKNPAILVDACA 180

Query: 223 SRHDVKAETKKLIDVTQFPSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESSDLI 282
           SRHDVKAET KLI++TQFP FVTPMGKG+I+E+HPR+GGVYVGTLS P VK+AVES+DLI
Sbjct: 181 SRHDVKAETNKLIELTQFPHFVTPMGKGAINEQHPRYGGVYVGTLSKPEVKKAVESADLI 240

Query: 283 LSVGALLSDFNTGSFSYSYKTKNIVEFHSDHIKIRNATFPGVQMKFVLQKLLTQVGDVVK 342
           LSVGALLSDFNTGSFSYSYKTKNIVEFHSD+IKIRNATFPGVQMKFVL KL   + +VV 
Sbjct: 241 LSVGALLSDFNTGSFSYSYKTKNIVEFHSDYIKIRNATFPGVQMKFVLDKLNAIIPEVVT 300

Query: 343 DYKPVAIPEIPGPNAAVDDSTPLKQQWLWNQVGKFLQEGDVVITETGTSAFGINQTHFPN 402
            YKP A+P     N AV  +TPLKQ W+WNQ+ KFL+EGDVVI ETGT  FGIN+T FP 
Sbjct: 301 GYKPTAVPARAPANKAVSGTTPLKQAWMWNQLSKFLKEGDVVIVETGTPGFGINETTFPK 360

Query: 403 NTYGISQVLWGSIXXXXXXXXXXXXXXXXXDKNKRVILFIGDGSLQLTVQEISTMIRWGL 462
           N  GISQVLWGSI                 D +KRVILF GDGSLQLTVQEISTMIRW L
Sbjct: 361 NVIGISQVLWGSIGYATGCTLGATMAAEELDPHKRVILFTGDGSLQLTVQEISTMIRWNL 420

Query: 463 KPYLFVLNNNGYTIEKLIHGEFAQYNEIQPWNHLDLLPTFGAKDYETVRVATTGEWNKLA 522
           +PYLF+LNNNGYTIEKLIHG  AQYNEIQ W+HL LL TFGAKDYE  RVATTGEW KL 
Sbjct: 421 RPYLFILNNNGYTIEKLIHGPTAQYNEIQSWDHLKLLETFGAKDYENHRVATTGEWTKLT 480

Query: 523 EDQEFNKNSKIRMIEVMLPVMDAPESLVKQAQLTAATNAKS 563
           E+++FNKNS+IR+IEVMLPVMDAPESL+KQ +LTA  NAK+
Sbjct: 481 ENKDFNKNSRIRVIEVMLPVMDAPESLIKQGELTAKINAKN 521

>CAGL0G02937g Chr7 complement(268985..270679) [1695 bp, 564 aa] {ON}
           highly similar to uniprot|P06169 Saccharomyces
           cerevisiae YLR044c PDC1 or uniprot|P16467 Saccharomyces
           cerevisiae YLR134w PDC5 or uniprot|P26263 Saccharomyces
           cerevisiae YGR087c PDC6
          Length = 564

 Score =  759 bits (1960), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 375/564 (66%), Positives = 437/564 (77%), Gaps = 1/564 (0%)

Query: 1   MSEITLGRYLFERLRQVECNTIFGLPGDFNLRLLDEIYETEGMRWXXXXXXXXXXXXXXX 60
           M+EITLGRYLFERL Q+  +TIFGLPGDFNL LLD+IYE EG+RW               
Sbjct: 1   MTEITLGRYLFERLHQIHIDTIFGLPGDFNLTLLDKIYEVEGLRWAGNANELNAAYAADG 60

Query: 61  XXRIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120
             R+KGM+CL+TTFGVGELSALNGIAGSYAEHVGVLHVVGVPS  ++AKQLLLHHTLGNG
Sbjct: 61  YARLKGMACLLTTFGVGELSALNGIAGSYAEHVGVLHVVGVPSTVSRAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMISDLATAPAEIDRCIRTTYVRQRPVYLGLPSNFVDQMVPASL 180
           DF  FHRMS+ ISETT ++SD  TAPAEIDRCIR  Y+ QRPVYLG+P+N  D  V + L
Sbjct: 121 DFDAFHRMSSVISETTFIVSDPQTAPAEIDRCIRVCYLTQRPVYLGIPANMFDSKVSSKL 180

Query: 181 LETPIDLSLKPNDAAAEQEVVSTVLDLIKNAKNPVILADACASRHDVKAETKKLIDVTQF 240
           L+TPIDL+L+PN   AE+EV+  ++ +IK +K P+ILADAC SRHDVK ETK+LI+VTQF
Sbjct: 181 LDTPIDLALRPNLPDAEREVLDEIITMIKASKRPIILADACTSRHDVKKETKRLIEVTQF 240

Query: 241 PSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESSDLILSVGALLSDFNTGSFSYS 300
           PSF TPMGKGSIDE  PRFGGVYVG LS P VK  VE SDL+LSVGALLSDFNTGSFSYS
Sbjct: 241 PSFTTPMGKGSIDEDTPRFGGVYVGNLSDPEVKTFVEESDLVLSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDHIKIRNATFPGVQMKFVLQKLLTQVGDVVKDYKP-VAIPEIPGPNAAV 359
             T+N++EFHSDH+KIRNATFPGVQMKFVL+KLL ++  VVK       +P    P+  +
Sbjct: 301 LNTRNVIEFHSDHMKIRNATFPGVQMKFVLEKLLEELPAVVKGRTDNRVVPRQKEPSTTL 360

Query: 360 DDSTPLKQQWLWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIXXXX 419
           +    +KQ+W+W  VGKFLQEGDVV+TETGTS FGI ++ FP NT GISQVLWGSI    
Sbjct: 361 NGKDAIKQEWMWKHVGKFLQEGDVVVTETGTSGFGIVESKFPRNTVGISQVLWGSIGYAL 420

Query: 420 XXXXXXXXXXXXXDKNKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNNGYTIEKL 479
                        D  KRVILFIGDGSLQLTVQE+ST  RWGL PY+FVLNNNGYTIE+L
Sbjct: 421 GSTVGAAFAAQEIDPKKRVILFIGDGSLQLTVQELSTAARWGLTPYIFVLNNNGYTIERL 480

Query: 480 IHGEFAQYNEIQPWNHLDLLPTFGAKDYETVRVATTGEWNKLAEDQEFNKNSKIRMIEVM 539
           IHGE   YN+IQ W+H  +LP FGAK+YE  RVAT GEWN +  D++FNKN K+RMIEVM
Sbjct: 481 IHGETQGYNDIQSWDHSLILPAFGAKNYENKRVATYGEWNDMVNDKQFNKNDKLRMIEVM 540

Query: 540 LPVMDAPESLVKQAQLTAATNAKS 563
           LP MD PE+L KQA+LTA+ NAK+
Sbjct: 541 LPTMDGPENLKKQAKLTASINAKN 564

>Ecym_3185 Chr3 (352629..354320) [1692 bp, 563 aa] {ON} similar to
           Ashbya gossypii AAL073W
          Length = 563

 Score =  745 bits (1924), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 352/562 (62%), Positives = 432/562 (76%)

Query: 1   MSEITLGRYLFERLRQVECNTIFGLPGDFNLRLLDEIYETEGMRWXXXXXXXXXXXXXXX 60
           MSEI++GRYLFERL QV   TIFGLPGDFNL LLD++YE  G+RW               
Sbjct: 1   MSEISIGRYLFERLNQVGVKTIFGLPGDFNLSLLDKLYEVPGLRWAGNANELNAAYAADG 60

Query: 61  XXRIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120
             R+ GM CL+TTFGVGELSA+NGIAGSYAE + VLHVVGVPS   QAK+LLLHHTLG+G
Sbjct: 61  YARVNGMGCLVTTFGVGELSAINGIAGSYAECISVLHVVGVPSTMVQAKRLLLHHTLGDG 120

Query: 121 DFTVFHRMSANISETTAMISDLATAPAEIDRCIRTTYVRQRPVYLGLPSNFVDQMVPASL 180
           DFT FHRM   I++TTA++SD ATA +EIDRCI+T  +   PVYLG+P+N     + ASL
Sbjct: 121 DFTAFHRMYQRITKTTAILSDDATAASEIDRCIKTCIMTHGPVYLGVPANMATATIDASL 180

Query: 181 LETPIDLSLKPNDAAAEQEVVSTVLDLIKNAKNPVILADACASRHDVKAETKKLIDVTQF 240
           LETPIDLS + ND  AE EV+  VL LI+NA+NP+IL+DACASR+D+K E K LID+TQF
Sbjct: 181 LETPIDLSPELNDQDAENEVIDAVLHLIQNARNPIILSDACASRYDIKEEIKTLIDITQF 240

Query: 241 PSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESSDLILSVGALLSDFNTGSFSYS 300
           P++VTPMGK S++E+HPR+GGVY G++S P VK+AVES+DLILS+G+LL+D NTG+FS S
Sbjct: 241 PTYVTPMGKSSVNEQHPRYGGVYAGSISKPEVKKAVESADLILSIGSLLADMNTGNFSQS 300

Query: 301 YKTKNIVEFHSDHIKIRNATFPGVQMKFVLQKLLTQVGDVVKDYKPVAIPEIPGPNAAVD 360
           Y TK+IVEFHS    I+NATF GVQMKFVLQKL  +VGDVV++Y PV I   P PN  +D
Sbjct: 301 YSTKDIVEFHSTFTMIKNATFNGVQMKFVLQKLAEKVGDVVQNYVPVPIASKPSPNKPLD 360

Query: 361 DSTPLKQQWLWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIXXXXX 420
             TPL QQWLW +V  FL+EGD+VI E+GT AFGIN+   P  T  ISQ+LWGSI     
Sbjct: 361 PLTPLAQQWLWKEVSTFLKEGDIVIAESGTPAFGINEVTLPTGTRCISQLLWGSIGYTVG 420

Query: 421 XXXXXXXXXXXXDKNKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNNGYTIEKLI 480
                       D ++RVILFIGDGSLQL VQE+STMIRWGLKPYLFVLNN+GYTIE+LI
Sbjct: 421 ACLGICLATQEIDPSRRVILFIGDGSLQLAVQELSTMIRWGLKPYLFVLNNDGYTIERLI 480

Query: 481 HGEFAQYNEIQPWNHLDLLPTFGAKDYETVRVATTGEWNKLAEDQEFNKNSKIRMIEVML 540
           HG  AQYN+IQPWNHL LLP FGAK+YE VR++T G W++L +D EFN++SKIR+IE++L
Sbjct: 481 HGPEAQYNDIQPWNHLQLLPDFGAKNYEAVRISTVGGWSQLTQDPEFNESSKIRLIELIL 540

Query: 541 PVMDAPESLVKQAQLTAATNAK 562
           P +D+ ++LVKQA++    N+K
Sbjct: 541 PRLDSTDALVKQAKMITDINSK 562

>SAKL0E04972g Chr5 (403578..405413) [1836 bp, 611 aa] {ON} similar
           to uniprot|Q07471 Saccharomyces cerevisiae YDL080C THI3
           Probable decarboxylase required for expression of
           enzymes involved in thiamine biosynthesis may have a
           role in catabolism of amino acids to long-chain and
           complex alcohols
          Length = 611

 Score =  684 bits (1766), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/550 (56%), Positives = 412/550 (74%), Gaps = 1/550 (0%)

Query: 4   ITLGRYLFERLRQVECNTIFGLPGDFNLRLLDEIYETEGMRWXXXXXXXXXXXXXXXXXR 63
           I+LG YLF+RLRQ++  TIFGLPGDFN+ LLD+IYE  G+RW                 R
Sbjct: 14  ISLGHYLFQRLRQLQVQTIFGLPGDFNMALLDKIYEVPGLRWAGNTNELNAAYAADGYAR 73

Query: 64  IKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNGDFT 123
           IKG+ CL+TTFGVGELSA+NGIAGS+AEHV VLHVVG+P+  AQ K+LLLHHTLGNGD+ 
Sbjct: 74  IKGLGCLVTTFGVGELSAINGIAGSFAEHVAVLHVVGMPASHAQVKKLLLHHTLGNGDYA 133

Query: 124 VFHRMSANISETTAMISDLATAPAEIDRCIRTTYVRQRPVYLGLPSNFVDQMVPASLLET 183
           VFHRM+AN++  T ++SD  TA  EID+C++  + RQRPVYLG+P N  + +V  S+L+ 
Sbjct: 134 VFHRMAANMAAYTTVLSDSETATKEIDKCLKIAWKRQRPVYLGIPMNLANMIVDGSMLQI 193

Query: 184 PIDLSLKPNDAAAEQEVVSTVLDLIKNAKNPVILADACASRHDVKAETKKLIDVTQFPSF 243
           P+DLSLK ND   E++VV++++  +K AKNPVI+ADAC +RHDV  ET++L+D+TQFP F
Sbjct: 194 PLDLSLKRNDPEVEKDVVNSIVQEMKRAKNPVIIADACVTRHDVIQETRRLVDLTQFPVF 253

Query: 244 VTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESSDLILSVGALLSDFNTGSFSYSYKT 303
           VTPMGKG+IDE+HPRFGGVYVG++SSP V+E V+ +D IL  G +LSDFNT SF++SYK 
Sbjct: 254 VTPMGKGAIDEQHPRFGGVYVGSMSSPEVREVVDFADFILVAGTVLSDFNTSSFNFSYKA 313

Query: 304 KNIVEFHSDHIKIRNATFPGVQMKFVLQKLLTQVGDVVKDYKPVAIPEIPGPNAAVDDST 363
           KN+V  +++H K++NA +P +++KFVLQ LL  + ++   YKP  +PE+  P   + D+ 
Sbjct: 314 KNVVLLYANHAKLKNAMYPDMKLKFVLQSLLQSLSNITLPYKPQPVPEMIKPRVTLQDNV 373

Query: 364 PLKQQWLWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIXXXXXXXX 423
           PL+Q+W+WNQ+  +  EGD+VITETGTSAFGINQT FPNNT  ISQVLWGSI        
Sbjct: 374 PLRQEWVWNQISHWFHEGDIVITETGTSAFGINQTRFPNNTRAISQVLWGSIGYSLGACL 433

Query: 424 XXXXXXXXXDKNKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNNGYTIEKLIH-G 482
                        RVILF+GDG+LQLTVQEISTMIRWGLKPYLFV+NN GYTI++L+H  
Sbjct: 434 GASFAVEELGTKNRVILFVGDGALQLTVQEISTMIRWGLKPYLFVMNNKGYTIDRLLHKS 493

Query: 483 EFAQYNEIQPWNHLDLLPTFGAKDYETVRVATTGEWNKLAEDQEFNKNSKIRMIEVMLPV 542
             A Y++IQPW++L LLP FGA +Y+  +V T G++ KL  D +F  + K++MIEV+LP 
Sbjct: 494 STAGYHDIQPWDNLKLLPAFGAVNYDARKVTTVGDFLKLVHDPQFAIDDKLKMIEVVLPS 553

Query: 543 MDAPESLVKQ 552
           MDAP +L+ +
Sbjct: 554 MDAPPALLNK 563

>KLTH0E09702g Chr5 (874177..876000) [1824 bp, 607 aa] {ON} similar
           to uniprot|Q07471 Saccharomyces cerevisiae YDL080C THI3
           Probable decarboxylase required for expression of
           enzymes involved in thiamine biosynthesis may have a
           role in catabolism of amino acids to long-chain and
           complex alcohols
          Length = 607

 Score =  588 bits (1517), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 268/551 (48%), Positives = 386/551 (70%), Gaps = 1/551 (0%)

Query: 3   EITLGRYLFERLRQVECNTIFGLPGDFNLRLLDEIYETEGMRWXXXXXXXXXXXXXXXXX 62
           EI L +Y+  RLRQ+   TIFG+PG FN+ LL EI     M+W                 
Sbjct: 14  EIPLAQYMLHRLRQLGIATIFGVPGGFNVPLLREICNVPQMKWAGNTNELNAAYAADGYS 73

Query: 63  RIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNGDF 122
           RIK ++CL+TTFGVGELSA+NG+AGS+AEHVG+LH VG+P ++AQ ++LLLHHTLGNG++
Sbjct: 74  RIKHLACLVTTFGVGELSAVNGVAGSFAEHVGLLHFVGMPPLAAQRRRLLLHHTLGNGNY 133

Query: 123 TVFHRMSANISETTAMISDLATAPAEIDRCIRTTYVRQRPVYLGLPSNFVDQMVPASLLE 182
            VFHR+ +++++ T++++D  T   E+D+CI   + +QRPVYLG+P+N  D +V ++LL 
Sbjct: 134 KVFHRLGSDVTQYTSVLTDTETCSKEVDKCISIAFTKQRPVYLGVPTNISDTLVSSALLN 193

Query: 183 TPIDLSLKPNDAAAEQEVVSTVLDLIKNAKNPVILADACASRHDVKAETKKLIDVTQFPS 242
            P+DLS    +   +++ V+ +L  +   ++P I+ DAC SRH+V AE ++L+++TQFP 
Sbjct: 194 IPLDLSAHEGNTEVQEDFVNAILSAMYKCRSPAIVVDACVSRHNVVAEVRQLVELTQFPV 253

Query: 243 FVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESSDLILSVGALLSDFNTGSFSYSYK 302
           F TPMGKG+I+E HPRFGG +VG++S P V+E V+ SD +L VGALLSDFN+ SF ++YK
Sbjct: 254 FCTPMGKGAINEHHPRFGGTFVGSISPPQVREVVDFSDFVLVVGALLSDFNSSSFHFAYK 313

Query: 303 TKNIVEFHSDHIKIRNATFPGVQMKFVLQKLLTQVGDVVKDYKPVAIPEIPGPNAAVDDS 362
            KN     S + +++NA +P +++K  L+ LLT++      Y+P  +PE+  P   +  +
Sbjct: 314 AKNTALLFSSYARLKNAMYPDLELKTALRVLLTKLDPSKLRYRPEEVPEVIRPKIKLMSN 373

Query: 363 TPLKQQWLWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIXXXXXXX 422
            PL+Q+W+WNQ+  + +EGD+VITETGTSAFG+NQ+ FPNNT  I+Q LWGS+       
Sbjct: 374 VPLRQEWVWNQISNWFREGDIVITETGTSAFGVNQSKFPNNTRCITQALWGSVGYSVGAC 433

Query: 423 XXXXXXXXXXDKNKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNNGYTIEKLIHG 482
                       N RVILF+GDG+LQLTVQE+STMIRWGLKP +FV+NN+GYTI++L+H 
Sbjct: 434 LGASFAAREEGNNSRVILFVGDGALQLTVQELSTMIRWGLKPIIFVMNNSGYTIDRLLHR 493

Query: 483 EF-AQYNEIQPWNHLDLLPTFGAKDYETVRVATTGEWNKLAEDQEFNKNSKIRMIEVMLP 541
           +  A Y++IQ W++L LLP FGA DY+T  V T G++  L  D  F  N+KI+M+EV+LP
Sbjct: 494 KSNAGYHDIQAWDNLKLLPLFGALDYDTRVVKTVGDFLGLVSDPGFALNNKIKMVEVVLP 553

Query: 542 VMDAPESLVKQ 552
            MDAP +L+ +
Sbjct: 554 PMDAPPALMDK 564

>Kwal_47.17878 s47 (590664..592496) [1833 bp, 610 aa] {ON} YDL080C
           (THI3) - alpha-ketoisocaproate decarboxylase [contig
           204] FULL
          Length = 610

 Score =  583 bits (1503), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 270/551 (49%), Positives = 381/551 (69%), Gaps = 1/551 (0%)

Query: 3   EITLGRYLFERLRQVECNTIFGLPGDFNLRLLDEIYETEGMRWXXXXXXXXXXXXXXXXX 62
           +ITL ++L  RLRQ+   TIF +PG F++  + +IY+T  M+W                 
Sbjct: 14  DITLAQFLVHRLRQLGITTIFAVPGGFSMPFIMQIYQTPQMQWAGNTNELNAAYAADGYS 73

Query: 63  RIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNGDF 122
           RIK + CL TTFGVGELSA+NG+AG++AEHVG+LHVVG+P ++AQ KQLL HHTLGNGD+
Sbjct: 74  RIKRLGCLATTFGVGELSAVNGVAGAFAEHVGLLHVVGMPPVAAQVKQLLWHHTLGNGDY 133

Query: 123 TVFHRMSANISETTAMISDLATAPAEIDRCIRTTYVRQRPVYLGLPSNFVDQMVPASLLE 182
            VFHR+ +++++   ++ D      E+D+CI     +QRPVYLG+P N  + +V + LL 
Sbjct: 134 QVFHRLGSDVAQYATVLRDAEACAQEVDKCIIIALTKQRPVYLGVPVNMNNVLVSSVLLN 193

Query: 183 TPIDLSLKPNDAAAEQEVVSTVLDLIKNAKNPVILADACASRHDVKAETKKLIDVTQFPS 242
            P+DL     +   E+  V+TVL+ I    NP I+ADAC SRH+V+AE K L+D+TQFP 
Sbjct: 194 VPLDLEPHATNPDTERRFVNTVLNAIYKCSNPAIIADACVSRHEVEAELKHLVDLTQFPV 253

Query: 243 FVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESSDLILSVGALLSDFNTGSFSYSYK 302
           F TPMGKGSIDE+HPRFGG +VG++SSP V+E V+ SD +L VGALLS+FNT SF ++Y+
Sbjct: 254 FCTPMGKGSIDEQHPRFGGTFVGSISSPQVREVVDFSDFVLVVGALLSEFNTSSFHFAYR 313

Query: 303 TKNIVEFHSDHIKIRNATFPGVQMKFVLQKLLTQVGDVVKDYKPVAIPEIPGPNAAVDDS 362
           TKN V   SD+ K++NA +P + +K VL+ +L ++      Y+P  +P++  P   +  +
Sbjct: 314 TKNSVLLFSDYAKLKNAIYPDLNLKTVLRAILAKLDPSKITYRPEQVPDVIKPRIKLMSN 373

Query: 363 TPLKQQWLWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIXXXXXXX 422
            PL+Q+W+W Q+ ++ +EGD+VITETGTSAFG+NQ  FP++T  I+Q LWGS+       
Sbjct: 374 VPLRQEWVWGQISRWFREGDIVITETGTSAFGVNQAKFPSHTRCIAQALWGSVGYSVGAC 433

Query: 423 XXXXXXXXXXDKNKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNNGYTIEKLIHG 482
                       N RVILF+GDG+LQLTVQEISTMIRWGL P +F++NN+GYTI++L+H 
Sbjct: 434 LGASFAAREEGCNSRVILFVGDGALQLTVQEISTMIRWGLTPIIFLMNNSGYTIDRLLHK 493

Query: 483 EF-AQYNEIQPWNHLDLLPTFGAKDYETVRVATTGEWNKLAEDQEFNKNSKIRMIEVMLP 541
           +  A Y++IQ W++L +LPTFGA +YE   V T G++  L  D +F  N KI+M+EV+LP
Sbjct: 494 KSNAAYHDIQTWDNLRILPTFGALNYEARAVRTVGDFLHLIHDTQFAVNDKIKMVEVVLP 553

Query: 542 VMDAPESLVKQ 552
            MDAP +L+ +
Sbjct: 554 PMDAPPALMDK 564

>ZYRO0A08426g Chr1 complement(675104..676858) [1755 bp, 584 aa] {ON}
           similar to uniprot|Q07471 Saccharomyces cerevisiae
           YDL080C THI3 Probable decarboxylase required for
           expression of enzymes involved in thiamine biosynthesis
           may have a role in catabolism of amino acids to
           long-chain and complex alcohols
          Length = 584

 Score =  577 bits (1486), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 263/546 (48%), Positives = 371/546 (67%), Gaps = 1/546 (0%)

Query: 4   ITLGRYLFERLRQVECNTIFGLPGDFNLRLLDEIYETEGMRWXXXXXXXXXXXXXXXXXR 63
           IT+  Y F RL+Q+E  TIFGLPG+FN  L+D++Y  EG+RW                 R
Sbjct: 12  ITIADYFFHRLKQLEVLTIFGLPGEFNAPLIDKLYGIEGLRWAGNTNELNAAYAADGYAR 71

Query: 64  IKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNGDFT 123
           +KG+ C+I+TFGVGELSA+NGIAGSYAEHVG+LHVVG+P  SAQ +QLLLHHTLGNGD+T
Sbjct: 72  LKGLGCIISTFGVGELSAINGIAGSYAEHVGLLHVVGMPPTSAQTRQLLLHHTLGNGDYT 131

Query: 124 VFHRMSANISETTAMISDLATAPAEIDRCIRTTYVRQRPVYLGLPSNFVDQMVPASLLET 183
           VFHRM+  +S  +A+I D      E+D CIR  Y+ QRPVY+G+P N V   V +  L  
Sbjct: 132 VFHRMATEVSCHSAVIIDTELCAQEVDECIRNAYIFQRPVYMGIPVNLVSMPVDSDRLNE 191

Query: 184 PIDLSLKPNDAAAEQEVVSTVLDLIKNAKNPVILADACASRHDVKAETKKLIDVTQFPSF 243
           PIDLS+ PND + E EV+  +L     A NPVI+ADAC +RH ++AET++L   T+FP F
Sbjct: 192 PIDLSVPPNDTSKENEVIDQILTHFYKATNPVIVADACVTRHRIEAETEELCRRTKFPLF 251

Query: 244 VTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESSDLILSVGALLSDFNTGSFSYSYKT 303
           VTPMGKGS+DE  P+FGGVY G++SSP+V+E V+ +D ++ +G +L+DF T +F ++Y+ 
Sbjct: 252 VTPMGKGSVDEGLPQFGGVYTGSISSPSVREVVDFADCLIVIGCMLADFETTTFHFNYRA 311

Query: 304 KNIVEFHSDHIKIRNATFPGVQMKFVLQKLLTQVGDVVKDYKPVAIPEIPGPNAAVDDST 363
             +V  +   +K ++AT+P + +K +L  LL  + +    Y+    P +  P   +  + 
Sbjct: 312 NELVLLYPTSVKFKHATYPDLSIKPLLHSLLANLQERQLSYQWQPRPRMVIPKLELPTTH 371

Query: 364 PLKQQWLWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIXXXXXXXX 423
           PL+Q+W+WNQ+ ++  EGDV+ITETGTSAFGINQT+FP +T GISQ LWGS+        
Sbjct: 372 PLRQEWVWNQISQWFMEGDVIITETGTSAFGINQTNFPPHTLGISQALWGSVGYSLGACL 431

Query: 424 XXXXXXXXXDKNKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNNGYTIEKLIHGE 483
                     +  RV+LF+GDG+ QLT QE+ST+IRWGL PY+F++NN GY++++ +H  
Sbjct: 432 GAAMAVDEKPRTHRVVLFVGDGAFQLTAQELSTVIRWGLTPYIFIMNNQGYSVDRFLHSN 491

Query: 484 FAQYNEIQPWNHLDLLPTFGAKDYETVRVATTGEWNKLAEDQEFNKNSKIRMIEVMLPVM 543
            A Y +IQ WN+  L   FGAKDYE+ ++ T G++  +  D  F+   +IR++E+MLP M
Sbjct: 492 -ASYYDIQQWNYSTLPSVFGAKDYESRKIITVGDFQSMVNDPAFSVGDRIRILEIMLPPM 550

Query: 544 DAPESL 549
           D P++L
Sbjct: 551 DVPQAL 556

>YDL080C Chr4 complement(310642..312471) [1830 bp, 609 aa] {ON}
           THI3Probable alpha-ketoisocaproate decarboxylase, may
           have a role in catabolism of amino acids to long-chain
           and complex alcohols; required for expression of enzymes
           involved in thiamine biosynthesis
          Length = 609

 Score =  573 bits (1476), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 261/556 (46%), Positives = 376/556 (67%), Gaps = 7/556 (1%)

Query: 4   ITLGRYLFERLRQVECNTIFGLPGDFNLRLLDEIYETEGMRWXXXXXXXXXXXXXXXXXR 63
           I +  YLF RL Q+  +TIFGL G+F++ LLD++Y    +RW                 R
Sbjct: 15  IAISDYLFHRLNQLNIHTIFGLSGEFSMPLLDKLYNIPNLRWAGNSNELNAAYAADGYSR 74

Query: 64  IKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNGDFT 123
           +KG+ CLITTFGVGELSA+NG+AGSYAEHVG+LH+VG+P  SAQ KQLLLHHTLGNGDFT
Sbjct: 75  LKGLGCLITTFGVGELSAINGVAGSYAEHVGILHIVGMPPTSAQTKQLLLHHTLGNGDFT 134

Query: 124 VFHRMSANISETTAMISDLATAPAEIDRCIRTTYVRQRPVYLGLPSNFVDQMVPASLLET 183
           VFHR++++++  T +I D      E+D+CI+  ++ QRPVY+G+P N V+  + ++ L T
Sbjct: 135 VFHRIASDVACYTTLIIDSELCADEVDKCIKKAWIEQRPVYMGMPVNQVNLPIESARLNT 194

Query: 184 PIDLSLKPNDAAAEQEVVSTVLDLIKNAKNPVILADACASRHDVKAETKKLIDVTQFPSF 243
           P+DL L  ND   E+EV+S +L  I  ++NP I+ DAC SR ++  ETK+L +  +FP F
Sbjct: 195 PLDLQLHKNDPDVEKEVISRILSFIYKSQNPAIIVDACTSRQNLIEETKELCNRLKFPVF 254

Query: 244 VTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESSDLILSVGALLSDFNTGSFSYSYKT 303
           VTPMGKG+++E  P+FGGV+ G++S+P V+E V+ +D I+ +G +LS+F+T +F + YKT
Sbjct: 255 VTPMGKGTVNETDPQFGGVFTGSISAPEVREVVDFADFIIVIGCMLSEFSTSTFHFQYKT 314

Query: 304 KNIVEFHSDHIKIRNATFPGVQMKFVLQKLLTQVGDVVKDYKPVAIPEIPGPNAAVDDST 363
           KN    +S  +K++NAT+P + +K +LQK+L  + +    Y+P   P +  P      + 
Sbjct: 315 KNCALLYSTSVKLKNATYPDLSIKLLLQKILANLDESKLSYQPSEQPSMMVPRPYPAGNV 374

Query: 364 PLKQQWLWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIXXXXXXXX 423
            L+Q+W+WN++  + Q GD++ITETG SAFG+NQT FP NT GISQ LWGS+        
Sbjct: 375 LLRQEWVWNEISHWFQPGDIIITETGASAFGVNQTRFPVNTLGISQALWGSVGYTMGACL 434

Query: 424 XXXXXXXXXDKNK------RVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNNGYTIE 477
                    +K+K      RVILF+GDG+ QLTVQE+ST+++WGL PY+FV+NN GY+++
Sbjct: 435 GAEFAVQEINKDKFPATKHRVILFMGDGAFQLTVQELSTIVKWGLTPYIFVMNNQGYSVD 494

Query: 478 KLIHGEF-AQYNEIQPWNHLDLLPTFGAKDYETVRVATTGEWNKLAEDQEFNKNSKIRMI 536
           + +H    A Y +IQPWN+L LL  FG  +YET ++ T GE+  +  D  F  N KIRMI
Sbjct: 495 RFLHHRSDASYYDIQPWNYLGLLRVFGCTNYETKKIITVGEFRSMISDPNFATNDKIRMI 554

Query: 537 EVMLPVMDAPESLVKQ 552
           E+MLP  D P++L+ +
Sbjct: 555 EIMLPPRDVPQALLDR 570

>Suva_4.167 Chr4 complement(300197..302059) [1863 bp, 620 aa] {ON}
           YDL080C (REAL)
          Length = 620

 Score =  570 bits (1470), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 261/556 (46%), Positives = 375/556 (67%), Gaps = 7/556 (1%)

Query: 4   ITLGRYLFERLRQVECNTIFGLPGDFNLRLLDEIYETEGMRWXXXXXXXXXXXXXXXXXR 63
           I +  YLF RL Q+  +TIFGL G+F++ LLD++Y+   +RW                 R
Sbjct: 15  IAISDYLFHRLNQLNIHTIFGLSGEFSMPLLDKLYDIPNLRWAGNSNELNAAYAADGYSR 74

Query: 64  IKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNGDFT 123
           +KG+ CLITTFGVGELSA+NG+AGSYAEHVG+LH+VG+P  SAQ KQLLLHHTLGNGDFT
Sbjct: 75  LKGLGCLITTFGVGELSAINGVAGSYAEHVGILHIVGMPPTSAQTKQLLLHHTLGNGDFT 134

Query: 124 VFHRMSANISETTAMISDLATAPAEIDRCIRTTYVRQRPVYLGLPSNFVDQMVPASLLET 183
           VFHR++++++  T +I D      E+D+CI+  ++ QRPVY+G+P N V+  + +  L T
Sbjct: 135 VFHRIASDVACYTTLIVDSDLCADEVDKCIQKAWIEQRPVYMGMPVNQVNLPIESERLNT 194

Query: 184 PIDLSLKPNDAAAEQEVVSTVLDLIKNAKNPVILADACASRHDVKAETKKLIDVTQFPSF 243
           P+DL L  ND   E+EV++ +L  I  +KNP I+ DAC SR ++  E K+L    +FP F
Sbjct: 195 PLDLQLHKNDPDVEKEVITRILSFIYKSKNPAIIVDACTSRQNLIEEAKELCSRLKFPIF 254

Query: 244 VTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESSDLILSVGALLSDFNTGSFSYSYKT 303
           VTPMGKG+++E  P+FGGV+ G++S+P V+E V+ +D I+ +G +LS+F+T +F + YKT
Sbjct: 255 VTPMGKGTVNETDPQFGGVFTGSISAPEVREVVDFADFIIVIGCMLSEFSTSTFHFQYKT 314

Query: 304 KNIVEFHSDHIKIRNATFPGVQMKFVLQKLLTQVGDVVKDYKPVAIPEIPGPNAAVDDST 363
           KN    +S  +K++NAT+P + +K +LQKLL  + +    Y+P   P +  P      + 
Sbjct: 315 KNCALLYSTSVKLKNATYPDLSVKILLQKLLATLDESKLSYRPDEQPSMMVPRPYPAGNV 374

Query: 364 PLKQQWLWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIXXXXXXXX 423
            L+Q+W+WN++ ++ Q GD++ITETG SAFG+NQT FP NT GISQ LWGS+        
Sbjct: 375 LLRQEWVWNEISRWFQPGDIIITETGASAFGVNQTRFPVNTLGISQALWGSVGYTMGACL 434

Query: 424 XXXXXXXXXDKNK------RVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNNGYTIE 477
                    +K+K      RVILF+GDG+ QLTVQE+ST+++WGL PY+FV+NN GY+++
Sbjct: 435 GAEFAVQEINKDKFPATKHRVILFMGDGAFQLTVQELSTIVKWGLTPYIFVMNNQGYSVD 494

Query: 478 KLIHGEF-AQYNEIQPWNHLDLLPTFGAKDYETVRVATTGEWNKLAEDQEFNKNSKIRMI 536
           + +H    A Y +IQPWN+L LL  FG  +YET ++ T GE+  +  D  F  N KIRMI
Sbjct: 495 RFLHHRSDASYYDIQPWNYLGLLRVFGCTNYETKKIITVGEFRSMINDANFAVNDKIRMI 554

Query: 537 EVMLPVMDAPESLVKQ 552
           E+MLP  D P++L+ +
Sbjct: 555 EIMLPPRDVPQALLDR 570

>TDEL0G03210 Chr7 complement(597217..599037) [1821 bp, 606 aa] {ON}
           Anc_2.390 YDL080C
          Length = 606

 Score =  558 bits (1437), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 263/568 (46%), Positives = 374/568 (65%), Gaps = 8/568 (1%)

Query: 4   ITLGRYLFERLRQVECNTIFGLPGDFNLRLLDEIYETEGMRWXXXXXXXXXXXXXXXXXR 63
           I++  YLF RL+Q+   TIFGLPG FN  LLD++ E  G+RW                 R
Sbjct: 13  ISIAEYLFHRLKQLHIETIFGLPGAFNATLLDKLNEIPGLRWAGNTNELNAAYAADGYSR 72

Query: 64  IKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNGDFT 123
           +KG+ C+ITTFGVGELSA+NG+AGS+AEHVG+LHVVG+P  SAQ KQLLLHHTLGNGD+ 
Sbjct: 73  LKGLGCIITTFGVGELSAINGVAGSFAEHVGLLHVVGMPPTSAQTKQLLLHHTLGNGDYK 132

Query: 124 VFHRMSANISETTAMISDLATAPAEIDRCIRTTYVRQRPVYLGLPSNFVDQMVPASLLET 183
           VFHRM++ ++  + +I+D      E+D CI   +  Q+PVY+G+P N VD  V +  L T
Sbjct: 133 VFHRMASEVTCYSTVINDKDLCGDEVDDCIAKAWTLQKPVYMGIPVNLVDTSVNSQRLNT 192

Query: 184 PIDLSLKPNDAAAEQEVVSTVLDLIKNAKNPVILADACASRHDVKAETKKLIDVTQFPSF 243
            ++L+L  ND   E E+V  +L  +  +KNPVI+ADAC +RH +  ET +L   T FP F
Sbjct: 193 ALNLNLPSNDEQTENELVKQILQQLYKSKNPVIIADACVTRHRIVPETVELCQRTNFPIF 252

Query: 244 VTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESSDLILSVGALLSDFNTGSFSYSYKT 303
            TPM KG+IDE  P FGGV++G++SSP V+E V  +D ++ +G +LSDF+T SF ++YKT
Sbjct: 253 ATPMSKGAIDETLPNFGGVFMGSISSPEVREVVNFADFLIVIGCMLSDFSTSSFHFNYKT 312

Query: 304 KNIVEFHSDHIKIRNATFPGVQMKFVLQKLLTQVGDVVKDYKPVAIPEIPGPNAAVDDST 363
           K  V  +   +K ++A +P +++K ++  LL  + +    Y+    P++  P + +    
Sbjct: 313 KECVLLYPTSVKFKHAIYPDLRIKSLMANLLRNLNESKIKYQSQPTPQMIIPRSELPSRH 372

Query: 364 PLKQQWLWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIXXXXXXXX 423
            L+ +W+WNQ+  + QEGD++ITETGTSAFGINQTHFP+++ GISQ LWGS+        
Sbjct: 373 SLRHEWVWNQMSHWFQEGDIIITETGTSAFGINQTHFPHSSRGISQALWGSVGYTLGACL 432

Query: 424 XXXXXXXXXDKNK------RVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNNGYTIE 477
                     +++      RVILF+GDG+ QLTVQE+STMIRWGL PY+FV+NN GY+++
Sbjct: 433 GASFAANEMARDQVTAVPHRVILFVGDGAFQLTVQEVSTMIRWGLTPYIFVMNNQGYSVD 492

Query: 478 KLIHGEF-AQYNEIQPWNHLDLLPTFGAKDYETVRVATTGEWNKLAEDQEFNKNSKIRMI 536
           + +H    A Y +IQ W +L L+P FGA+ YET ++ T G++ ++  D  F  N KIRM+
Sbjct: 493 RFLHHRSNASYYDIQTWEYLRLIPLFGARHYETRKIVTVGDFLEMIHDPLFATNDKIRML 552

Query: 537 EVMLPVMDAPESLVKQAQLTAATNAKSA 564
           E+MLP MD P++L+ +  LT   N K A
Sbjct: 553 EIMLPPMDVPQALMDR-WLTEQENKKRA 579

>Skud_4.175 Chr4 complement(306124..307986) [1863 bp, 620 aa] {ON}
           YDL080C (REAL)
          Length = 620

 Score =  555 bits (1431), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 261/556 (46%), Positives = 378/556 (67%), Gaps = 7/556 (1%)

Query: 4   ITLGRYLFERLRQVECNTIFGLPGDFNLRLLDEIYETEGMRWXXXXXXXXXXXXXXXXXR 63
           I +  YLF RL Q+  +TIFGL G+F++ LLD++Y+   +RW                 R
Sbjct: 15  IAISDYLFHRLNQLNIHTIFGLSGEFSMPLLDKLYDIPNLRWAGNSNELNAAYAADGYSR 74

Query: 64  IKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNGDFT 123
           +KG+ CLITTFGVGELSA+NG+AGSYAEHVG+LH+VG+P  SAQ KQLLLHHTLGNGDFT
Sbjct: 75  LKGLGCLITTFGVGELSAINGVAGSYAEHVGILHIVGMPPTSAQTKQLLLHHTLGNGDFT 134

Query: 124 VFHRMSANISETTAMISDLATAPAEIDRCIRTTYVRQRPVYLGLPSNFVDQMVPASLLET 183
           VFHR++++++  T +I D      E+D+CI+  ++ QRPVY+G+P N V+  + ++ L T
Sbjct: 135 VFHRIASDVACYTTLIVDSELCADEVDKCIKMAWIEQRPVYMGMPVNQVNLPIESARLNT 194

Query: 184 PIDLSLKPNDAAAEQEVVSTVLDLIKNAKNPVILADACASRHDVKAETKKLIDVTQFPSF 243
           P+DL L  ND   E+EV++ +L ++  ++NP I+ DAC SR ++  ETK+L    +FP F
Sbjct: 195 PLDLQLHKNDPDVEKEVITRILSIMYKSQNPAIIVDACTSRQNLIEETKELCSRLKFPIF 254

Query: 244 VTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESSDLILSVGALLSDFNTGSFSYSYKT 303
           VTPMGKG+++E  P+FGGV+ G++S+P V+E V+ +D I+ +G +LS+F+T +F + YKT
Sbjct: 255 VTPMGKGTVNETDPQFGGVFTGSISAPEVREVVDFADFIIVIGCMLSEFSTSTFHFQYKT 314

Query: 304 KNIVEFHSDHIKIRNATFPGVQMKFVLQKLLTQVGDVVKDYKPVAIPEIPGPNAAVDDST 363
           KN    +S  +K++NAT+P + +K +LQKLL  + +    Y+P   P +  P      + 
Sbjct: 315 KNCALLYSTSVKLKNATYPDLSVKLLLQKLLASLDESKLSYRPSEQPNMMVPRPYPAGNV 374

Query: 364 PLKQQWLWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIXXXXXXXX 423
            L+Q+W+WN++ ++ Q GD++ITETG SAFG+NQT FP NT GISQ LWGS+        
Sbjct: 375 LLRQEWVWNEISRWFQPGDIIITETGASAFGVNQTRFPVNTLGISQALWGSVGYTMGACL 434

Query: 424 XXXXXXXXXDKNK------RVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNNGYTIE 477
                    +KN+      RVILF+GDG+ QLTVQE+ST+++WGL PY+FV+NN GY+++
Sbjct: 435 GAEFAVQEINKNEFPPTKHRVILFMGDGAFQLTVQELSTIVKWGLTPYIFVMNNQGYSVD 494

Query: 478 KLIHGEF-AQYNEIQPWNHLDLLPTFGAKDYETVRVATTGEWNKLAEDQEFNKNSKIRMI 536
           + +H    A Y +IQPWN+L LL  FG  +YET ++ T GE+  L  D  F  N KIRMI
Sbjct: 495 RFLHHRSDASYYDIQPWNYLGLLRVFGCANYETKKIITVGEFRSLINDPNFAINDKIRMI 554

Query: 537 EVMLPVMDAPESLVKQ 552
           E+MLP  D P++L+ +
Sbjct: 555 EIMLPPRDVPQALLDR 570

>Smik_4.156 Chr4 complement(287087..288952) [1866 bp, 621 aa] {ON}
           YDL080C (REAL)
          Length = 621

 Score =  554 bits (1427), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 262/556 (47%), Positives = 376/556 (67%), Gaps = 7/556 (1%)

Query: 4   ITLGRYLFERLRQVECNTIFGLPGDFNLRLLDEIYETEGMRWXXXXXXXXXXXXXXXXXR 63
           I++  YLF RL Q+  +TIFGL G+F++ LLD++Y    +RW                 R
Sbjct: 15  ISISDYLFHRLNQLNIHTIFGLSGEFSMPLLDKLYNIPNLRWAGNSNELNAAYAADGYSR 74

Query: 64  IKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNGDFT 123
           +KG+ CLITTFGVGELSA+NG+AGSYAEHVG+LH+VG+P  SAQ KQLLLHHTLGNGDFT
Sbjct: 75  LKGLGCLITTFGVGELSAINGVAGSYAEHVGILHIVGMPPTSAQTKQLLLHHTLGNGDFT 134

Query: 124 VFHRMSANISETTAMISDLATAPAEIDRCIRTTYVRQRPVYLGLPSNFVDQMVPASLLET 183
           VFHR++++++  T +I D      E+D+CIR  ++ QRPVY+G+P N V+  + ++ L T
Sbjct: 135 VFHRIASDVACYTTLIVDSELCADEVDKCIRKAWIEQRPVYMGMPVNQVNLPIESARLNT 194

Query: 184 PIDLSLKPNDAAAEQEVVSTVLDLIKNAKNPVILADACASRHDVKAETKKLIDVTQFPSF 243
           P+DL L  ND   E+EV+S +L  +  ++NP I+ DAC SR ++  E+K+L    +FP F
Sbjct: 195 PLDLQLPKNDPDVEKEVISRILSFMYKSQNPAIIVDACTSRQNLIEESKELCSRLKFPVF 254

Query: 244 VTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESSDLILSVGALLSDFNTGSFSYSYKT 303
           VTPMGKG+++E  P+FGGV+ G++S+P V+E V+ +D I+ +G +LS+F+T +F + YKT
Sbjct: 255 VTPMGKGTVNETIPQFGGVFTGSISAPEVREVVDFADFIIVIGCMLSEFSTSTFHFQYKT 314

Query: 304 KNIVEFHSDHIKIRNATFPGVQMKFVLQKLLTQVGDVVKDYKPVAIPEIPGPNAAVDDST 363
           KN    +S  +K++NAT+P + +K +LQKLL  + +    Y+P   P +  P      + 
Sbjct: 315 KNCALLYSTSVKLKNATYPDLSIKLLLQKLLASLDESKLSYRPNEQPSMMVPRPYPAGNV 374

Query: 364 PLKQQWLWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIXXXXXXXX 423
            L+Q+W+WN++  + Q GD++ITETG SAFG+NQT FP NT GISQ LWGS+        
Sbjct: 375 LLRQEWVWNEISHWFQPGDIIITETGASAFGVNQTRFPVNTLGISQALWGSVGYTMGACL 434

Query: 424 XXXXXXXXXDKNK------RVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNNGYTIE 477
                     K+K      RVILF+GDG+ QLTVQE+ST+++WGL PY+FV+NN GY+++
Sbjct: 435 GAEFAVQEIKKDKFPVTKHRVILFMGDGAFQLTVQELSTIVKWGLTPYIFVMNNQGYSVD 494

Query: 478 KLIHGEF-AQYNEIQPWNHLDLLPTFGAKDYETVRVATTGEWNKLAEDQEFNKNSKIRMI 536
           + +H    A Y +IQPWN+L LL  FG  +YET ++ T GE+  + +D EF  N KIRMI
Sbjct: 495 RFLHHRSDASYYDIQPWNYLGLLRVFGCTNYETKKIITVGEFRSMIDDPEFAINDKIRMI 554

Query: 537 EVMLPVMDAPESLVKQ 552
           E+MLP  D P+ L+ +
Sbjct: 555 EIMLPPRDVPQVLLDR 570

>KNAG0A05900 Chr1 complement(880996..882858) [1863 bp, 620 aa] {ON} 
          Length = 620

 Score =  546 bits (1407), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 256/558 (45%), Positives = 364/558 (65%), Gaps = 9/558 (1%)

Query: 3   EITLGRYLFERLRQVECNTIFGLPGDFNLRLLDEIYETEGMRWXXXXXXXXXXXXXXXXX 62
           +IT+  YLF RLRQ++  TIFGLPG+FN+ LLD+IY    MRW                 
Sbjct: 16  QITITDYLFHRLRQLKVKTIFGLPGEFNMPLLDKIYRIPDMRWAGNANELNAAYAADGYS 75

Query: 63  RIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNGDF 122
           RIK + CL+TTFGVGELSA+NG+AGS+AEHVG+LHVVG+P  SAQ KQLLLHHTLGNGD+
Sbjct: 76  RIKRLGCLVTTFGVGELSAINGVAGSFAEHVGLLHVVGMPPTSAQTKQLLLHHTLGNGDY 135

Query: 123 TVFHRMSANISETTAMISDLATAPAEIDRCIRTTYVRQRPVYLGLPSNFVDQMVPASLLE 182
            VF+RM+ +++  T +++D      E+D+C+   +  Q+P YLG+P N VD  V +  L+
Sbjct: 136 NVFYRMANDVTCHTGLVADSDLCCMEVDKCVEMAWREQKPAYLGIPVNQVDLTVDSVRLD 195

Query: 183 TPIDLSLKPNDAAAEQEVVSTVLDLIKNAKNPVILADACASRHDVKAETKKLIDVTQFPS 242
           TP++L  +PN+   E +VV T+L  +   +NP I+ DAC  RHD+  ETK+   +T FP+
Sbjct: 196 TPLNLESEPNNQEIENDVVKTILKKLYTCENPAIIVDACVIRHDLVEETKQFRQMTNFPT 255

Query: 243 FVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESSDLILSVGALLSDFNTGSFSYSYK 302
           FVTPMGKG++DE    FGGV+ G+LSSP+V+E V+ +D I+ +G+LL++F+T +F + YK
Sbjct: 256 FVTPMGKGAVDESLSNFGGVFTGSLSSPSVREVVDFADFIIVIGSLLAEFSTPTFHFFYK 315

Query: 303 TKNIVEFHSDHIKIRNATFPGVQMKFVLQKLLTQVGDVVKDYKPVAIPEIPGPNAAVDDS 362
           TKN    HS  +K++NAT+P + +K ++Q LL+++            P I      +  +
Sbjct: 316 TKNYALIHSSSVKLKNATYPDIHIKHLMQVLLSRLDTSKISCTFRNTPPINVSRPKLSGN 375

Query: 363 TPLKQQWLWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGS-------- 414
             LKQ+W+WN++  + Q+GD++ITE GTSAFGINQT FP  T GISQ LW S        
Sbjct: 376 QLLKQEWVWNELSHWFQQGDIIITEIGTSAFGINQTRFPPRTKGISQALWASSGYSVGAC 435

Query: 415 IXXXXXXXXXXXXXXXXXDKNKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNNGY 474
           +                     RV+LF+GDG+ Q+T+QEISTMIRW L PY+F+LNN GY
Sbjct: 436 LGASFAAQELQEENPGDASLQHRVLLFVGDGAFQITMQEISTMIRWKLTPYIFLLNNQGY 495

Query: 475 TIEKLIHGEF-AQYNEIQPWNHLDLLPTFGAKDYETVRVATTGEWNKLAEDQEFNKNSKI 533
           ++++ +H    A Y ++QPW++L     FGA DYET ++ T G+   +  D+ F K+ KI
Sbjct: 496 SVDRFLHHRSKASYYDVQPWHYLKFFDAFGADDYETRKIVTLGDLRDVMNDKHFCKDDKI 555

Query: 534 RMIEVMLPVMDAPESLVK 551
           RM+E+MLP  D P+ LV+
Sbjct: 556 RMLEIMLPSTDVPQVLVE 573

>CAGL0L06842g Chr12 (771870..773786) [1917 bp, 638 aa] {ON} similar
           to uniprot|Q07471 Saccharomyces cerevisiae YDL080c THI3
           or uniprot|P06169 Saccharomyces cerevisiae YLR044c PDC1
           or uniprot|P16467 Saccharomyces cerevisiae YLR134w PDC5
           or uniprot|P26263 Saccharomyces cerevisiae YGR087c PDC6
          Length = 638

 Score =  544 bits (1402), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 265/582 (45%), Positives = 368/582 (63%), Gaps = 19/582 (3%)

Query: 2   SEITLGRYLFERLRQVECNTIFGLPGDFNLRLLDEIYETEGMRWXXXXXXXXXXXXXXXX 61
           S+I++  YLF RL Q++  TIFGLPGDFN+ LLD++Y    MRW                
Sbjct: 11  SQISISEYLFHRLNQLKIWTIFGLPGDFNMPLLDKLYSIPTMRWAGNTNELNAAYAADGY 70

Query: 62  XRIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNGD 121
            R+K + CLITTFGVGELSA+NG+AGSYAEHVG+LH+VG+P  SAQ KQLLLHHTLGNGD
Sbjct: 71  SRLKHLGCLITTFGVGELSAINGVAGSYAEHVGILHIVGMPPTSAQTKQLLLHHTLGNGD 130

Query: 122 FTVFHRMSANISETTAMISDLATAPAEIDRCIRTTYVRQRPVYLGLPSNFVDQMVPASLL 181
           ++VF+R++ +I+  TA+I+D      E+D CIR  +  Q+PVYLG+P N VD  V +S L
Sbjct: 131 YSVFYRIANDIACHTAIINDTDLCADEVDNCIRAAWGYQKPVYLGVPVNQVDIPVDSSRL 190

Query: 182 ETPIDLSLKPNDAAAEQEVVSTVLDLIKNAKNPVILADACASRHDVKAETKKLIDVTQFP 241
             PIDLS+       + +V+  +L  + +A  P+I+ DAC  RHD   ET  L ++T FP
Sbjct: 191 NNPIDLSILKKTKETDAQVIDLLLKQMYSASKPIIVVDACVRRHDALKETHALCELTNFP 250

Query: 242 SFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESSDLILSVGALLSDFNTGSFSYSY 301
            FVTPMGKG+IDE +  FGGVY G+LSSP V+E  + +D +L +GA+L +F+T +F + +
Sbjct: 251 VFVTPMGKGTIDESYKNFGGVYSGSLSSPEVREVTDFADFVLFIGAILPEFSTSTFHFGF 310

Query: 302 KTKNIVEFHSDHIKIRNATFPGVQMKFVLQKLLTQVGDVVKDYKPVAIPEIPGPNAAVDD 361
           K KN        +KI+ ATFP + +K  LQ L+  +      YK  A  +I  P     D
Sbjct: 311 KKKNCCILFPTSVKIKKATFPDMLLKGTLQSLVDTIEPSKITYKHQAKVDIIAPKMEPSD 370

Query: 362 STPLKQQWLWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSI------ 415
           S  L+Q+W+WN++  + +E D++ITETG+SAFGINQT FP NT GI+Q LWGS+      
Sbjct: 371 SNLLRQEWVWNEISHWFKENDIIITETGSSAFGINQTRFPTNTIGINQALWGSVGFALCS 430

Query: 416 --------XXXXXXXXXXXXXXXXXDKN----KRVILFIGDGSLQLTVQEISTMIRWGLK 463
                                    ++N     R ILF+GDG+ QLTVQE+ST+IRW LK
Sbjct: 431 CLGALFAVEEKTVVKHNLEIKLRNYNRNIFTENRTILFVGDGAFQLTVQELSTIIRWKLK 490

Query: 464 PYLFVLNNNGYTIEKLIHGEF-AQYNEIQPWNHLDLLPTFGAKDYETVRVATTGEWNKLA 522
           PY+F++NNNGY++++ +H    A Y ++QPWN+L LL  FG   +ET ++ T  ++ +L 
Sbjct: 491 PYIFIMNNNGYSVDRFLHHRSDASYYDVQPWNYLYLLELFGCTSFETRKIVTVSDFKELL 550

Query: 523 EDQEFNKNSKIRMIEVMLPVMDAPESLVKQAQLTAATNAKSA 564
            D+ F K  KIRMIE+MLP  D P++L+ + Q     + K A
Sbjct: 551 ADESFAKPDKIRMIEIMLPQSDVPKTLIARWQAEKELSNKRA 592

>NCAS0A04000 Chr1 complement(806883..808760) [1878 bp, 625 aa] {ON}
           Anc_2.390
          Length = 625

 Score =  539 bits (1388), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 251/568 (44%), Positives = 368/568 (64%), Gaps = 15/568 (2%)

Query: 3   EITLGRYLFERLRQVECNTIFGLPGDFNLRLLDEIYETEGMRWXXXXXXXXXXXXXXXXX 62
           +IT+  YLF RL+Q+   TIFGL G++N+ L+D++Y+   +RW                 
Sbjct: 12  QITISEYLFHRLKQLHIETIFGLSGEYNMPLIDKLYQVHNLRWAGNANELNAAYAADGYA 71

Query: 63  RIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNGDF 122
           R+KG+  LITTFGVGELSALNG+AGS+AEHVG+LH+VG+P  SAQ KQLLLHHTLGNGD+
Sbjct: 72  RLKGLGVLITTFGVGELSALNGVAGSFAEHVGLLHIVGMPPTSAQTKQLLLHHTLGNGDY 131

Query: 123 TVFHRMSANISETTAMISDLATAPAEIDRCIRTTYVRQRPVYLGLPSNFVDQMVPASLLE 182
           +VFHR++++I+    +I D      E+D+CI   ++ QRPVY+G+P N V+ +V +  L+
Sbjct: 132 SVFHRIASDIAVYNTVIDDTDLCFQEVDKCITLAWMEQRPVYMGMPVNQVNLLVDSKFLD 191

Query: 183 TPIDLSLKPNDAAAEQEVVSTVLDLIKNAKNPVILADACASRHDVKAETKKLIDVTQFPS 242
            P+DL +  N      E+ + +L  I   K+P I+ DAC  RH+   E ++    T+FP 
Sbjct: 192 IPLDLDMFENATEVNSEITNKILQKIYKCKHPAIVVDACTIRHECIDEVEEFCRRTKFPV 251

Query: 243 FVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESSDLILSVGALLSDFNTGSFSYSYK 302
           FVTPMGKG+I+E  P FGGV++G+LSSP+V+E V+ +D I+ +G++LS+F+T +F + +K
Sbjct: 252 FVTPMGKGAINENTPHFGGVFMGSLSSPSVREVVDFADFIIVIGSMLSEFSTSTFHFVFK 311

Query: 303 TKNIVEFHSDHIKIRNATFPGVQMKFVLQKLLTQVGDVVKDYKPVAIPEIPGPNAAVDDS 362
            K+ V   SD +KI+N+ +  + +K +++ LL  + +    Y     P +  P   + D 
Sbjct: 312 VKDSVLLFSDLVKIKNSVYANIHIKPLMKSLLHSLDESKIKYIFEEAPSMILPKTKIPDD 371

Query: 363 TPLKQQWLWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGS-------- 414
             L+Q+W+WN++  + +EGD++ITE GTSAFGINQT FPN   GISQ LWGS        
Sbjct: 372 VLLRQEWVWNEISHWFREGDIIITEIGTSAFGINQTRFPNEAQGISQSLWGSSGYSLGAC 431

Query: 415 ------IXXXXXXXXXXXXXXXXXDKNKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFV 468
                 I                  +  RVILF+GDG+ QLT+QE+ST+IRW L PY+FV
Sbjct: 432 LGTSFAIQEFEREHNHNFHRHTQNVEKHRVILFVGDGAFQLTMQELSTIIRWNLTPYIFV 491

Query: 469 LNNNGYTIEKLIHGEF-AQYNEIQPWNHLDLLPTFGAKDYETVRVATTGEWNKLAEDQEF 527
           LNN GY++++ +H E  A Y +IQPWN+LDL+ TF AK+YET ++ T G++  + +D  F
Sbjct: 492 LNNEGYSVDRFLHPEANASYYDIQPWNYLDLMATFNAKNYETKKIVTVGDFRDMVQDPLF 551

Query: 528 NKNSKIRMIEVMLPVMDAPESLVKQAQL 555
             N KIRM+E++LP  D P++LV   +L
Sbjct: 552 AINDKIRMVEILLPSTDVPQALVDTWKL 579

>NDAI0E01700 Chr5 (337856..339721) [1866 bp, 621 aa] {ON} Anc_2.390
          Length = 621

 Score =  527 bits (1358), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 253/564 (44%), Positives = 366/564 (64%), Gaps = 15/564 (2%)

Query: 2   SEITLGRYLFERLRQVECNTIFGLPGDFNLRLLDEIYETEGMRWXXXXXXXXXXXXXXXX 61
           S IT+  Y+F RL+Q++  TIFGLPG+FN+ L+D++Y+   +RW                
Sbjct: 11  SYITIAEYIFHRLKQLKIETIFGLPGEFNMPLIDKLYKIPQLRWAGDANELNAAYAADGY 70

Query: 62  XRIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNGD 121
            R+KG+  L+TTFGVGELSA+NG+AGS+AEHVG+LH+VG+P  SAQ KQLLLHHTLGNGD
Sbjct: 71  SRLKGLGVLVTTFGVGELSAINGVAGSFAEHVGLLHIVGMPPTSAQTKQLLLHHTLGNGD 130

Query: 122 FTVFHRMSANISETTAMISDLATAPAEIDRCIRTTYVRQRPVYLGLPSNFVDQMVPASLL 181
           + VF R+++ ++  T +I+D      E+D+CI   + RQ+PVY+G+P N VD  V +  L
Sbjct: 131 YNVFWRIASEVACHTVIINDTDLCFMEVDKCIEIAWKRQKPVYIGIPVNQVDIPVRSLHL 190

Query: 182 ETPIDLSLKPNDAAAEQEVVSTVLDLIKNAKNPVILADACASRHDVKAETKKLIDVTQFP 241
             P+ LS   N      +VV  +L  I  + +PVI+ D C  RH    E ++ I  T+FP
Sbjct: 191 NVPLTLSPDMNLNDIGNDVVQLLLQKIYKSTHPVIIVDGCIIRHGCIDEMEEFIQRTKFP 250

Query: 242 SFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESSDLILSVGALLSDFNTGSFSYSY 301
            FVTPMGKG+IDE +P F GV+ G++SSP+V+E V+ +D ++ +G +L+ FNT +F + Y
Sbjct: 251 VFVTPMGKGAIDENNPNFKGVFTGSISSPSVREVVDFADFLMVMGCMLAAFNTSTFHFGY 310

Query: 302 KTKNIVEFHSDHIKIRNATFPGVQMKFVLQKLLTQVGDVVKDYKPVAIPEIPGPNAAVDD 361
           K+KN    +SD IK  NAT+P V +K +LQ LL  + +   +Y P   P++  P   + D
Sbjct: 311 KSKNRALLYSDSIKFNNATYPDVYLKPLLQSLLQNLDESQINYVPKETPKMIIPKRELPD 370

Query: 362 STPLKQQWLWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIXXXXXX 421
              L+Q+W+WN++  + QEGD++ITETGTSAFGINQT FPN   GISQ LWGS+      
Sbjct: 371 DELLRQEWVWNEISHWFQEGDIIITETGTSAFGINQTRFPNEAQGISQALWGSVGYSLGA 430

Query: 422 XXXXXXXXXXXDKNK--------------RVILFIGDGSLQLTVQEISTMIRWGLKPYLF 467
                       ++               RVILF+GDG+ QLT+QE+ST++RW L PY+F
Sbjct: 431 CLGSLFAVQEFQRDHNHDFHHHTQKSEKHRVILFVGDGAFQLTMQELSTIVRWKLTPYIF 490

Query: 468 VLNNNGYTIEKLIHGEF-AQYNEIQPWNHLDLLPTFGAKDYETVRVATTGEWNKLAEDQE 526
           +LNN+GY++++++H    A Y +IQ W++L+L+ TF A D +T ++ T G+   +  D E
Sbjct: 491 ILNNHGYSVDRILHHRSDASYYDIQQWDYLNLMNTFNATDADTRKIITVGDMKDMLRDPE 550

Query: 527 FNKNSKIRMIEVMLPVMDAPESLV 550
           F  +++IRMIEVMLP MD P++LV
Sbjct: 551 FAVDNRIRMIEVMLPSMDVPKALV 574

>TPHA0G02620 Chr7 complement(547384..549450) [2067 bp, 688 aa] {ON}
           Anc_2.390 YDL080C
          Length = 688

 Score =  528 bits (1359), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 256/593 (43%), Positives = 369/593 (62%), Gaps = 43/593 (7%)

Query: 3   EITLGRYLFERLRQVECNTIFGLPGDFNLRLLDEIYETEGMRWXXXXXXXXXXXXXXXXX 62
           E+T+  YLF RL+Q+  NTIFGLPG+FN+ LLD++Y  EGMRW                 
Sbjct: 18  ELTVSEYLFHRLKQLNVNTIFGLPGEFNMSLLDKLYNVEGMRWAGNANELNASYAADGYS 77

Query: 63  RIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNGDF 122
           R+K + CL+TTFGVGELS +NGIAGS++E+VG++H+VG+P I  Q  QLL+HHTLGNGD+
Sbjct: 78  RLKKLGCLMTTFGVGELSVINGIAGSFSENVGIIHIVGMPPIQIQRSQLLMHHTLGNGDY 137

Query: 123 TVFHRMSANISETTAMISDLATAPAEIDRCIRTTYVRQRPVYLGLPSNFVDQMVPASLLE 182
            +FHR+S +I   +A+++       EID+C+   ++ Q+PVYLGLP N V   V ++LL 
Sbjct: 138 NIFHRLSDDIYCYSAVVTHPNLCIQEIDKCLSKAWLSQKPVYLGLPENLVSVKVKSTLLN 197

Query: 183 TPIDLSLKPNDAAAEQEVVSTVLDLIKNAKNPVILADACASRHDVKAETKKLIDVTQFPS 242
           TP+DL L  ND   E   +  +L  I +AKNP I+ADAC +RH V+ ET+ LI+ T+FP 
Sbjct: 198 TPLDLKLPNNDKDNENIAIDQILKKIYSAKNPAIIADACVTRHSVEKETQMLIEKTKFPY 257

Query: 243 FVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESSDLILSVGALLSDFNTGSFSYSYK 302
           FVTPMGKG +DE   +FGGV+VG++SS  V+E V+ +DLI+ +G L SDF T SF ++YK
Sbjct: 258 FVTPMGKGGVDEYSKQFGGVFVGSISSAKVREIVDFADLIIVIGNLQSDFKTTSFHFTYK 317

Query: 303 TKNIVEFHSDHIKIRNATFPGVQMKFVLQKLLTQVGDVVKDYKPVAIP------------ 350
           TK+IV   S  +K++N  +P + +K  L KL+  +      YKP+  P            
Sbjct: 318 TKDIVMISSSCVKLKNGLYPELHIKEFLGKLVDNIVTTKITYKPIISPIMNIPNNITSEE 377

Query: 351 ---------EIPGPNAAVDDSTPLKQQWLWNQVGKFLQEGDVVITETGTSAFGINQTHFP 401
                    + P  N +  + T LKQ+W+WN+   + +EGD++ITETGTSAFGINQT FP
Sbjct: 378 SFESLTNYSKTPDKNDSNVNKTLLKQEWVWNEFSLWFREGDIIITETGTSAFGINQTKFP 437

Query: 402 NNTYGISQVLWGSIXXXXXXXXXXXXXXXXXDKNK------RVILFIGDGSLQLTVQEIS 455
           N T GISQ LWGS                   ++       RVILF+GDG+ QLT+QE+S
Sbjct: 438 NRTIGISQTLWGSTGYSVGACLGASFAAEEIHQSNPNIEKPRVILFVGDGAFQLTMQELS 497

Query: 456 TMIRWGLKPYLFVLNNNGYTIEKLIHGE----------------FAQYNEIQPWNHLDLL 499
           TM++W L PY+F++NN GY++++ +  +                   Y +IQ W++L+L 
Sbjct: 498 TMVKWNLDPYIFLMNNQGYSVDRFLTHQSRRNNSNANNILKSNNNNDYFDIQLWDYLNLF 557

Query: 500 PTFGAKDYETVRVATTGEWNKLAEDQEFNKNSKIRMIEVMLPVMDAPESLVKQ 552
             F A +YET +V +  +  K+   + F+   +IRM+E++LP MD P+SL+++
Sbjct: 558 NLFNAMNYETYKVLSCNDLLKILNSKSFSNEHRIRMVEIILPPMDVPKSLMER 610

>KAFR0F02990 Chr6 complement(589562..591388) [1827 bp, 608 aa] {ON}
           Anc_2.390 YDL080C
          Length = 608

 Score =  523 bits (1346), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 244/558 (43%), Positives = 363/558 (65%), Gaps = 8/558 (1%)

Query: 3   EITLGRYLFERLRQVECNTIFGLPGDFNLRLLDEIYETEGMRWXXXXXXXXXXXXXXXXX 62
           EIT+  YLF RL+Q+   TIFGLPG+FN+ LLD +Y   G++W                 
Sbjct: 12  EITIADYLFHRLKQLHVETIFGLPGEFNMPLLDRLYNIPGLKWAGNANELNATYAADGYA 71

Query: 63  RIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNGDF 122
           R+KG+ C+ITTFGVGELSA+NGIAG++AEHVGVLHVVG+P  SAQ KQLLLHHTLGNGD+
Sbjct: 72  RLKGLGCIITTFGVGELSAINGIAGAFAEHVGVLHVVGMPPTSAQTKQLLLHHTLGNGDY 131

Query: 123 TVFHRMSANISETTAMISDLATAPAEIDRCIRTTYVRQRPVYLGLPSNFVDQMVPASLLE 182
            VFHRM+ ++S  + +I+D      E+D+CI   Y++Q+PVYLG+P N V+  V ++ L 
Sbjct: 132 RVFHRMANDVSFYSRIINDTDLCSNEVDKCIELAYLKQKPVYLGVPVNQVNLKVNSAKLN 191

Query: 183 TPIDLSLKPNDAAAEQEVVSTVLDLIKNAKNPVILADACASRHDVKAETKKLIDVTQFPS 242
             +   +  N+   E E ++ +L  I   ++P I+ DAC +R D   ET++ I +T FP 
Sbjct: 192 KELRFRVLKNNLDMENEAINLILKKIYTCESPAIVVDACVNRQDTVKETEQFIRLTNFPV 251

Query: 243 FVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESSDLILSVGALLSDFNTGSFSYSYK 302
           FVTPMGKGSIDE  P FGGV+ G++SSP V+E V+ +D ++ +G+LL++F+T +F + YK
Sbjct: 252 FVTPMGKGSIDENIPTFGGVFSGSISSPNVREVVDFADFVIVIGSLLTEFSTSAFHFFYK 311

Query: 303 TKNIVEFHSDHIKIRNATFPGVQMKFVLQKLLTQVGDVVKDYKPVAIPEIPG--PNAAVD 360
           +KN V    D ++ + + +P + +K +++ +L+++      ++P +    P   P +   
Sbjct: 312 SKNCVLLFDDCVRFKGSIYPDLFLKPLMKNILSRLDPGKISFRPTSDCNNPMIVPKSKPS 371

Query: 361 DSTPLKQQWLWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIXXXX- 419
           D   L+Q+W+W++   + QEGD++ITE GTS+FGINQ  FP++T GISQ LWGS      
Sbjct: 372 DDQLLRQEWVWHEFSHWFQEGDIIITELGTSSFGINQIRFPSHTKGISQALWGSSGYSMG 431

Query: 420 ----XXXXXXXXXXXXXDKNKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNNGYT 475
                               +RVILFIGDG+ Q+T+QEISTMIRW L PY+F+LNN GY+
Sbjct: 432 SCLGACFATLESQSASTSTRQRVILFIGDGAFQITMQEISTMIRWNLTPYIFLLNNQGYS 491

Query: 476 IEKLIHG-EFAQYNEIQPWNHLDLLPTFGAKDYETVRVATTGEWNKLAEDQEFNKNSKIR 534
           I++ +H  +     ++Q WN+L     FGA DYET ++ T G+  ++  +++F++  +IR
Sbjct: 492 IDRFLHHRKNTTLYDVQQWNYLSFFKVFGATDYETRKIVTLGDLRQMLGNEDFSRADRIR 551

Query: 535 MIEVMLPVMDAPESLVKQ 552
           M E+MLP MD P+++V +
Sbjct: 552 MAEIMLPSMDVPKAIVDK 569

>TBLA0B08820 Chr2 (2097075..2098982) [1908 bp, 635 aa] {ON}
           Anc_2.390 YDL080C
          Length = 635

 Score =  516 bits (1328), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 256/587 (43%), Positives = 374/587 (63%), Gaps = 28/587 (4%)

Query: 2   SEITLGRYLFERLRQVECNTIFGLPGDFNLRLLDEIYETEGMRWXXXXXXXXXXXXXXXX 61
           ++ITL  YLF RL Q + +T+FGLPG+FN+ L+D++     ++W                
Sbjct: 11  NDITLADYLFHRLNQFKIHTVFGLPGEFNMPLIDKLLTIPDLKWAGNANELNAAYAADGY 70

Query: 62  XRIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNGD 121
            RIKG+ CL+TTFGVGELS++NGIAGSYAEHVGVLH++G+P  S Q  QLLLHHTLGNGD
Sbjct: 71  ARIKGIGCLLTTFGVGELSSINGIAGSYAEHVGVLHIIGMPPSSIQTSQLLLHHTLGNGD 130

Query: 122 FTVFHRMSANISETTAMISDLATAPAEIDRCIRTTYVRQRPVYLGLPSNFVDQMVPASLL 181
           +TVFHR+++ ++  + +++D      EID  I   +  QRPVYLG+P NF+   + ++LL
Sbjct: 131 YTVFHRIASELACYSTVLNDTDYLTKEIDLSIVKAWTLQRPVYLGIPMNFISYPIKSNLL 190

Query: 182 ETPIDLSLKPNDAAAEQEVVSTVLDLIKNAKNPVILADACASRHDVKAETKKLIDVTQFP 241
              +D +L+ N+  ++ +V+  +L  I   K PVI+ DAC +RH+++ ET++L   T+FP
Sbjct: 191 NKDLDFTLESNNEISQDDVIELILKNIYRCKKPVIVVDACVTRHNIEKETEELFRRTKFP 250

Query: 242 SFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESSDLILSVGALLSDFNTGSFSYSY 301
             VTPM KGS+DE  P F GV+ G++SSP V+E ++S DL+L +G  L +F T SF +SY
Sbjct: 251 VLVTPMAKGSVDESLPEFAGVFCGSISSPQVREVLDSVDLLLVIGCTLPEFTTSSFHFSY 310

Query: 302 KTKNIVEFHSDHIKIRNATFPGVQMKFVLQKLLTQVGDVVKDYKPVAIPE-----IPGPN 356
           K+K+ +   SD+IK RN TF  + +K +++KLL  + DV K  K   + E     I  PN
Sbjct: 311 KSKHCIFIFSDYIKYRNTTFADLNIKQLIKKLLLAL-DVSK-IKNFQLQENNNGNIYIPN 368

Query: 357 AAVDDSTPLKQQWLWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIX 416
             ++ +  L+Q+W+WNQ+  + Q+GD++ITETGT+AFGINQT FP+N  GISQ LWGS  
Sbjct: 369 IKLNPTLLLRQEWVWNQLSHWFQDGDIIITETGTTAFGINQTKFPHNARGISQSLWGSTG 428

Query: 417 XXXXXXXXXXXXXXXXDKNK--------------------RVILFIGDGSLQLTVQEIST 456
                            K +                    RVILFIGDG+ QLTVQE+ST
Sbjct: 429 YSLGACLGASFALSEIRKEQQVINNITQNVFPLFKDPPKHRVILFIGDGAFQLTVQELST 488

Query: 457 MIRWGLKPYLFVLNNNGYTIEKLIHGEF-AQYNEIQPWNHLDLLPTFGAKDYETVRVATT 515
           +IRWGL PY+F++NN+GY+ ++ +H    A Y +I  W++L LL  FGAK YE+ ++ T 
Sbjct: 489 IIRWGLTPYIFIMNNHGYSGDRFLHHRSDAGYYDIPQWDYLGLLEVFGAKIYESKKIITV 548

Query: 516 GEWNKLAEDQEFNKNSKIRMIEVMLPVMDAPESLVKQAQLTAATNAK 562
           G++ K+  +  F  +S +RMIE++LP MD P++L+ + +L      K
Sbjct: 549 GDFEKMVNNPNFAIDSVLRMIEIVLPPMDVPQALMDKWRLEQEEEKK 595

>Ecym_6055 Chr6 complement(105018..106796) [1779 bp, 592 aa] {ON}
           similar to Ashbya gossypii ADR254W
          Length = 592

 Score =  483 bits (1243), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 252/562 (44%), Positives = 357/562 (63%), Gaps = 14/562 (2%)

Query: 3   EITLGRYLFERLRQVECNTIFGLPGDFNLRLLDEIYETEGMRWXXXXXXXXXXXXXXXXX 62
           +I LG+YLF RL Q+   TIFGLP +FN  LLD+IY+   MRW                 
Sbjct: 13  QIPLGKYLFHRLNQLNVTTIFGLPSEFNSPLLDQIYQIPSMRWCGNANELNASYAADGYS 72

Query: 63  RIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNGDF 122
           RIK +SCL+TTFGVGE+S LNGIAGS++EHV VLHVVG+P  SAQ K+LLLHHTLGN D+
Sbjct: 73  RIKRLSCLVTTFGVGEMSVLNGIAGSFSEHVAVLHVVGMPPSSAQLKKLLLHHTLGNSDY 132

Query: 123 TVFHRMSANISETTAMISDLATAPAEIDRCIRTTYVRQRPVYLGLPSNFVDQMVPASLLE 182
            +FHR++++I   TA++ +       ID CI   Y +Q+PVY G+P N    +V +  L+
Sbjct: 133 DIFHRLASDICVHTAVLKESDNICDVIDNCIVRCYNQQQPVYCGIPVNLAGHLVDSKSLD 192

Query: 183 TPIDLSLKPND--AAAEQEVVSTVLDLIKNAKNPVILADACASRHDVKAETKKLIDVTQF 240
           +P+ L    N   + A +E+V  +L+ I +A++PVI+AD CASRHD   E  ++   T F
Sbjct: 193 SPLHLMRGFNQPISDAVEELVDILLEKIYSAQHPVIVADGCASRHDCIEELTEIAQKTGF 252

Query: 241 PSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESSDLILSVGALLSDFNTGSFSYS 300
           P   TPMGKGS DE+  R+ GVY+G++SSP V+E V+ +D +L  GAL +D+ T S+ + 
Sbjct: 253 PLCCTPMGKGSFDEQSKRYVGVYMGSISSPQVREVVDFADFVLVAGALTADYATSSYHFC 312

Query: 301 YKTKNIVEFHSDHIKIRNA-TFPGVQMKFVLQKLLTQVGDVVK-DYKPVAIPEIPGPNAA 358
           YK KNIV     + K+    T+P V++K VLQ LL +  D  K  Y    IPE       
Sbjct: 313 YKPKNIVLLFDKYAKVSGTKTYPDVRLKDVLQ-LLARCLDPTKLQYIQEEIPESSCLRVK 371

Query: 359 VDDSTPLKQQWLWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIXXX 418
            D +TPL+Q+W+W ++  + + GDV++TE GTS  G+NQ  FP+ T  +SQ LWGS+   
Sbjct: 372 PDANTPLRQEWMWARLSHWFRPGDVIVTEMGTSGLGVNQIKFPSGTKVVSQPLWGSLGYS 431

Query: 419 XXXXXXXXXXXXXXD-----KNKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNNG 473
                               K+ R+ILF+GDG+LQLTVQEIST+I+WGL PY+FV+NN G
Sbjct: 432 VGACLGVLIAVQEESRGNRLKDNRIILFVGDGALQLTVQEISTIIKWGLAPYIFVINNQG 491

Query: 474 YTIEKLI----HGEFAQYNEIQPWNHLDLLPTFGAKDYETVRVATTGEWNKLAEDQEFNK 529
           YTI++L+    H   A Y  IQPWN+L ++P FG  +Y+  +V   G+ ++L +DQ F+ 
Sbjct: 492 YTIDRLLSRDTHHATADYYNIQPWNNLSIIPAFGGTNYDVRKVVKVGQLDQLLKDQRFSN 551

Query: 530 NSKIRMIEVMLPVMDAPESLVK 551
              ++M+E++LP MDAP++L++
Sbjct: 552 QDILKMVEIILPSMDAPQALLE 573

>ADR254W Chr4 (1143623..1145368) [1746 bp, 581 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDL080C (THI3)
          Length = 581

 Score =  469 bits (1207), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 234/560 (41%), Positives = 339/560 (60%), Gaps = 20/560 (3%)

Query: 2   SEITLGRYLFERLRQVECNTIFGLPGDFNLRLLDEIYETEGMRWXXXXXXXXXXXXXXXX 61
           S I L  YLF RLRQ+   T FGLP D+N+ LLD +     M                  
Sbjct: 12  SSIPLAEYLFHRLRQLGVTTGFGLPSDYNMFLLDGLENVADMHLCCNTNELNASYAADGY 71

Query: 62  XRIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNGD 121
            R++ +SCL++TFGVGELS +NGIAGS+AEHV VL +VG+P  SAQ ++LLLHHTLGNGD
Sbjct: 72  ARMQRLSCLVSTFGVGELSVVNGIAGSFAEHVAVLLIVGMPPASAQRRKLLLHHTLGNGD 131

Query: 122 FTVFHRMSANISETTAMISDLATAPAEIDRCIRTTYVRQRPVYLGLPSNFVDQMVPASLL 181
           + VF R++++I   + ++    TA   +D CI   Y  Q+PVY G+P N  + M+P++ L
Sbjct: 132 YDVFRRLASDICTYSTVVRSAHTAAEVLDHCIARCYRDQKPVYCGVPINLAEAMLPSAPL 191

Query: 182 ETPIDLSLKPNDAAAEQEVVSTVLDLIKNAKNPVILADACASRHDVKAETKKLIDVTQFP 241
           + P+ L  +P   A   E+V+ +LD I  AK+PV++ DAC +RH    + ++L   T FP
Sbjct: 192 DVPLPLLDEP--CAPLDELVALLLDKIYAAKHPVLVVDACVARHGCMQQLQRLAQATDFP 249

Query: 242 SFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESSDLILSVGALLSDFNTGSFSYSY 301
              TPMGKG +DE+  RF GVYVG+LS+P V+E V+ +D +L VGAL ++F T +F ++Y
Sbjct: 250 VCCTPMGKGIVDEQGARFAGVYVGSLSAPQVREVVDFADFVLVVGALTAEFCTFAFHFAY 309

Query: 302 KTKNIVEFHSDHIKIRNATFPGVQMKFVLQKLLTQVGDVVKDYKPVA-------IPEIPG 354
           K KNI   H+ H ++    FP   ++ +L       G +V+ + P A       +PE   
Sbjct: 310 KPKNIGLVHARHARVGARGFPDAPLRALL-------GLLVQRWTPRASANAREPVPEPSA 362

Query: 355 PNAAVDDSTPLKQQWLWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGS 414
              A + +TPL+ +WLW ++ ++   GD++++ETGTSAFG+ QT  P     +SQ LWGS
Sbjct: 363 LRVAPNPATPLRHEWLWARLSRWFAPGDILVSETGTSAFGVLQTRLPPGVCVVSQPLWGS 422

Query: 415 IXXXXXXXXXXXXXXXXXDKNKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNNGY 474
           +                    +RV+LF+GDG+LQLTVQE+STM+R  L P +FVLNN GY
Sbjct: 423 VGYSVGACLGVLVATRAAAPPRRVVLFVGDGALQLTVQELSTMVRLRLAPLIFVLNNRGY 482

Query: 475 TIEKLI----HGEFAQYNEIQPWNHLDLLPTFGAKDYETVRVATTGEWNKLAEDQEFNKN 530
           + ++L+    H   A+Y ++QPW++L L P FGA  Y+   V T GE + L  D  F + 
Sbjct: 483 SADRLLNRARHRANARYYDVQPWHNLALAPAFGASAYDPRAVTTVGELDALLSDPAFAQP 542

Query: 531 SKIRMIEVMLPVMDAPESLV 550
           S ++M+EV LP MD P +L+
Sbjct: 543 SVLKMVEVALPSMDGPPALL 562

>Kpol_1046.9 s1046
           (18301..18855,18984..18992,19556..19693,19697..19987,
           19994..20797) [1797 bp, 598 aa] {ON}
           (18301..18855,18984..18992,19556..19693,19697..19987,
           19994..20797) [1797 nt, 599 aa]
          Length = 598

 Score =  381 bits (979), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 210/562 (37%), Positives = 316/562 (56%), Gaps = 44/562 (7%)

Query: 2   SEITLGRYLFERLRQVECNTIFGLPGDFNLRLLDEIYETEGMRWXXXXXXXXXXXXXXXX 61
           S IT+  YLF RL+Q++  TIFGLPG+FN+ L+D++Y+   +RW                
Sbjct: 12  SSITVAEYLFHRLKQMDIRTIFGLPGEFNMPLIDKLYKIPSLRWAGNANELNAAYAADGY 71

Query: 62  XRIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNGD 121
            R+K + CLITTFGVGELSALNGIAGS++EH+G+LHVV +P +      +L+     NGD
Sbjct: 72  ARLKRLGCLITTFGVGELSALNGIAGSFSEHLGILHVVRMPPLRLNHSIVLI--LFRNGD 129

Query: 122 FTVFHRMSANISETTAMISDLATAPAEIDRCIRTTYVRQRPVYLGLPSNFVDQMVPASLL 181
           +     M A          D+   P    R +    ++    ++        +    S +
Sbjct: 130 YKF--PMKAR---------DILVTPRISHRNLWDEMIKPNQAWISSAGILAYRYWRGSKI 178

Query: 182 ETPIDLSLKPNDAAAEQEVVSTVLDLIKNAKNPVILADACASRHDVKAETKKLIDVTQFP 241
                      +       +S+     K           C S + V+ +        +FP
Sbjct: 179 PKGKGADXXXKNLQCRTSYLSSRSLRFKEQ------CRRCNSDYSVRKQ--------KFP 224

Query: 242 SFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESSDLILSVGALLSDFNTGSFSYSY 301
            FV P  +    E + +FGGV+ G++SSP V+E V+ +DL++ +G  L DF+T SF +SY
Sbjct: 225 YFV-PQWERVQHENNDQFGGVFSGSISSPHVREVVDFADLVIVIGCTLPDFHTSSFHFSY 283

Query: 302 KTKNIVEFHSDHIKIRNATFPGVQMKFVLQKLLTQVGDVVKDY---KPVAIPEIPGPNAA 358
           + K++V   S ++KIRN  +P + +K +L  LL++V   +  Y   KP+ +P    P+ +
Sbjct: 284 RAKDVVLITSTYVKIRNRLYPDLNIKPLLNTLLSRVDSSLIKYDSIKPMVVPTSKLPSKS 343

Query: 359 VDDSTPLKQQWLWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIXXX 418
           V     L+Q+W+WN++  + QE DV+ITETGTSAFGINQT FP  ++GISQ LWGS+   
Sbjct: 344 V-----LRQEWVWNEISHWFQEKDVIITETGTSAFGINQTRFPKQSHGISQCLWGSVGYS 398

Query: 419 XXXXXXXXXXXXXXDKN-------KRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNN 471
                          ++        RVILF+GDG+ QLT+QE+STMI+W LKPY+F++NN
Sbjct: 399 LGACLGASFAVDELYESGKTNGIMPRVILFVGDGAFQLTMQEVSTMIKWNLKPYIFLMNN 458

Query: 472 NGYTIEKLI-HGEFAQYNEIQPWNHLDLLPTFGAKDYETVRVATTGEWNKLAEDQEFNKN 530
            GY+I++ + H   A+Y +IQ W +L+LL  FGA DYE  ++ T  ++  + +D  F +N
Sbjct: 459 QGYSIDRFLSHRSNAKYYDIQQWEYLNLLQVFGAIDYEAKKIVTVEDFQNILKDANFARN 518

Query: 531 SKIRMIEVMLPVMDAPESLVKQ 552
            KIRMIE+MLP MD P+SL++Q
Sbjct: 519 DKIRMIEIMLPPMDVPQSLMEQ 540

>KLLA0F16962g Chr6 complement(1559454..1561190) [1737 bp, 578 aa]
           {ON} uniprot|O74722 Kluyveromyces lactis PDC Pyruvate
           decarboxylase
          Length = 578

 Score =  313 bits (802), Expect = 5e-99,   Method: Compositional matrix adjust.
 Identities = 184/555 (33%), Positives = 297/555 (53%), Gaps = 38/555 (6%)

Query: 4   ITLGRYLFERLRQVECNTIFGLPGDFNLRLLDEIYETEGMRWXXXXXXXXXXXXXXXXXR 63
           I L  YLF RL Q+ C T+FG+  +++   L +     G++W                 R
Sbjct: 27  IPLPEYLFHRLFQLNCRTVFGV-ANYSTAKLYQAIAASGIQWIQTINQLNTSFAVDAYGR 85

Query: 64  IKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNGDFT 123
             G+SC +T+    EL  +NG  GS+ E+V +L VV V   S   ++L+       GD +
Sbjct: 86  AIGVSCYVTSES-AELGHVNGFFGSFCEYVPILQVV-VLEQSHDLERLI-------GDVS 136

Query: 124 VFHRMSANISETTAMISDLATAPAEIDRCIRTTYVRQRPVYLGLPSNFVDQMVPASLLET 183
           +FH              D+   P+EID C+RT +  +RPVY+GL S    ++VP+S L  
Sbjct: 137 IFH--------------DVVDDPSEIDSCVRTLFWGKRPVYMGLRSKDATKLVPSSSLNG 182

Query: 184 PIDLSLKPNDAAAEQEVVSTVLDLI----KNAKNPVILADACASRHDVKAETKKLIDVTQ 239
            I   +   +   + + +  V+D I      +  P+I+ DA   R++  +  +  +  T 
Sbjct: 183 NIADKMGIKNTFFQTDTIKRVIDKIIAEVYASSRPLIVVDALIDRYNYNSTIQNFLTETG 242

Query: 240 FPSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESSDLILSVGALLSDFNTGSFSY 299
            P   T M KGSIDE  P F G ++GT+S P V+E + ++D  L +G ++ +F      +
Sbjct: 243 IPFVTTLMSKGSIDESLPNFVGTFLGTMSQPIVREYMNNADCTLILGCMIENFKNSYCRF 302

Query: 300 SYKTKNIVEFHSDHIKIRNATFPGVQMKFVLQKLLTQVGDV-VKDYKPVAIPEIPGPNAA 358
           +YK+KN +   +D +KI N   P + +  +L +L+  +    + + +PV IP +  P   
Sbjct: 303 NYKSKNQILLWNDRVKIENNIIPDILLHELLPQLIASLDTTKIVNSRPVTIPNMI-PRVE 361

Query: 359 VDDSTPLKQQWLWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLW---GSI 415
               T L+Q++LW ++  +L++GDV+I+E+GTSA G+ Q  FP+NT  +SQ +W   G  
Sbjct: 362 PQPVTFLRQEYLWFKMSTWLKQGDVIISESGTSAIGLLQQKFPDNTRLVSQAIWNSSGYS 421

Query: 416 XXXXXXXXXXXXXXXXXDKNKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNNGYT 475
                            DK+ R+IL +GDGSLQ T QE+ST++  G KPY+FV+NN GYT
Sbjct: 422 IGACLGILAAYRDMGTLDKH-RIILMVGDGSLQFTFQELSTILTHGFKPYIFVINNQGYT 480

Query: 476 IEKLIHGEF----AQYNEIQPWNHLDLLPTFGAKDYETVRVATTGEWNKLAEDQEFNKNS 531
           +++ ++ E     A Y +IQPW  L L   F +++Y   R  + GE N L  D+EFNK+ 
Sbjct: 481 VDRTLNREKTHLNATYFDIQPWELLKLPSLFYSQEYFKRRCMSVGELNSLLSDKEFNKSD 540

Query: 532 KIRMIEVMLPVMDAP 546
           +++++E++LP MD P
Sbjct: 541 QLKIVELILPSMDVP 555

>SAKL0G03036g Chr7 (250012..251925) [1914 bp, 637 aa] {ON} similar
           to uniprot|Q06408 Saccharomyces cerevisiae YDR380W ARO10
           Phenylpyruvate decarboxylase catalyzes decarboxylation
           of phenylpyruvate to phenylacetaldehyde which is the
           first specific step in the Ehrlich pathway
          Length = 637

 Score =  293 bits (749), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 188/601 (31%), Positives = 300/601 (49%), Gaps = 52/601 (8%)

Query: 4   ITLGRYLFERLRQVECNTIFGLPGDFNLRLLDEIY----ETEGMRWXXXXXXXXXXXXXX 59
           I  G+Y+FERL      ++FG+PGDFNL LL+ +Y    + + ++W              
Sbjct: 32  IPFGQYVFERLISAGTKSVFGVPGDFNLSLLEHMYSRTVQRKDLKWFGTCNELNAAYAAD 91

Query: 60  XXXRIKG-MSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHT-- 116
              R    + C+ITT+GVGELSA+NG+AG++AE+V VLH+VGV     +  +  +HH   
Sbjct: 92  GYSRYTNKIGCVITTYGVGELSAINGVAGAFAENVKVLHIVGVTPSKFRNDETFIHHNVH 151

Query: 117 -----LGNGDFT-----VFHRM-SANISETTAMISDLATAPAEIDRCIRTTYVRQRPVYL 165
                + N +F       +H M    IS +T  + ++  A  ++D+ +   Y   +P Y+
Sbjct: 152 HLIPAMDNPNFRGPNHRSYHDMIDGRISCSTEFVDNVDQACDQLDKVVNDIYKYSKPGYI 211

Query: 166 GLPSNFVDQMVPA-SLLETPIDLSLKPNDAAAEQEVVST----VLDLIKNAKNPVILADA 220
            +P++F D+MV A +L+ TP             QEVV +    ++DL+  +K P ++ D 
Sbjct: 212 FIPADFADKMVNAQNLITTPTITLENVISQGFNQEVVDSMATKIIDLLYKSKTPAVIGDV 271

Query: 221 CASRHDVKAETKKLIDVTQFPSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESSD 280
              R     E +  + +T+  +F + MG+  +DE  P F GVY G  SSP + +A+ S D
Sbjct: 272 LCDRFGCVNEIRNFVRITKMWAFSSFMGRSILDESEPNFHGVYNGAESSPHIIQAIGSCD 331

Query: 281 LILSVGALLSDFNTGSFSYSYKTKNI-VEFHSDHIKI------RNATFPGVQMKFVLQKL 333
           LIL  G L ++ N G +S+S+      VE HSD++              GV    VL ++
Sbjct: 332 LILHFGVLKNEINNGHYSFSFNANATEVELHSDYLNFVDYKSGNEVLVKGVHFVSVLNRI 391

Query: 334 LTQVGDVVK---DYKPVAI-PEIPGPNAAVDDSTPLKQQWLWNQVGKFLQEGDVVITETG 389
           + Q+ DV K    Y  + + PE+  P       + + Q++L N + ++L  GDV + ETG
Sbjct: 392 I-QLIDVTKINLKYPDLTVNPEMATPAGIHSPESQITQKFLQNAMSEYLSPGDVFVVETG 450

Query: 390 TSAFGINQTHFPNNTYGISQVLWGSIXXXXXX-------------XXXXXXXXXXXDKNK 436
           +  F +    FP N   ISQ  + SI                              D   
Sbjct: 451 SFQFVVRDFQFPTNVKYISQGFYLSIGMALPSCLGIGCAMKDYPGSHICDAGVSTLDYTP 510

Query: 437 RVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNNGYTIEKLIHGEFAQYNEIQPWNHL 496
           ++IL  GDG+ Q+T+QE+++ +R+ +   +F+ NN+GYT+E+ I G    YN+I  W   
Sbjct: 511 KLILCEGDGAAQMTIQELTSFLRYQIPVEIFLWNNHGYTVERAIRGPTRSYNDIMEWKWT 570

Query: 497 DLLPTFGAKD---YETVRVATTGEWNKLAEDQEFNK-NSKIRMIEVMLPVMDAPESLVKQ 552
            LL  FG  D    E  +V   GE+  +    + +K  SK+R+IEVML +MD P+ L+  
Sbjct: 571 KLLEAFGDFDGSISEACKVKNVGEFKDVVGSLKHSKERSKVRLIEVMLGMMDIPKQLLAM 630

Query: 553 A 553
           A
Sbjct: 631 A 631

>CAGL0A03102g Chr1 (317961..319910) [1950 bp, 649 aa] {ON} similar
           to uniprot|Q06408 Saccharomyces cerevisiae YDR380w
          Length = 649

 Score =  290 bits (741), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 194/601 (32%), Positives = 291/601 (48%), Gaps = 54/601 (8%)

Query: 3   EITLGRYLFERLRQVECNTIFGLPGDFNLRLLDEIYE---TEGMRWXXXXXXXXXXXXXX 59
           EIT G Y+F RL      ++FG+PGDFNL LL+ +Y+    + +RW              
Sbjct: 30  EITFGEYVFRRLLSCGTKSVFGVPGDFNLALLEHLYDDSVADALRWVGNCNELNAAYAAD 89

Query: 60  XXXRIKG-MSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQL---LLHH 115
              R    + CLITT+GVGELSALNG+AGS+AE V VLH+VGV S     K      +HH
Sbjct: 90  GYSRYTNKIGCLITTYGVGELSALNGVAGSFAEDVKVLHIVGVASSQTSCKNTDNKNVHH 149

Query: 116 ---TLGNGDF------TVFHRMSANISETTAMISDLATAPAEIDRCIRTTYVRQRPVYLG 166
               L + +F      T +  +   +      + D+  A   +D+ I   Y   +P YL 
Sbjct: 150 LIPALNDSNFVSPNHKTYYEMVKDRVCCAAEYLEDIDVACDMLDKVIEDMYRYSKPGYLF 209

Query: 167 LPSNFVDQMVPA-SLLETP---IDLSLKPNDAAAEQE---VVSTVLDLIKNAKNPVILAD 219
           +P++F D MV   +L+  P   ++ ++ P     E +   +V+ V  LI N+ NP IL D
Sbjct: 210 IPADFADMMVSTRNLVARPTITLEQAIAPLVGCGESQLEAIVAKVAQLIYNSSNPCILGD 269

Query: 220 ACASRHDVKAETKKLIDVTQFPSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESS 279
               R+ V  +   LI   Q  +F T MGK  IDE +P + G+Y G   S +V E     
Sbjct: 270 VLTDRYGVSQQLNSLISHCQMWNFSTVMGKSVIDESNPYYKGLYNGRECSSSVIEDFSKC 329

Query: 280 DLILSVGALLSDFNTGSFSYSYKTK---NIVEFHSDHIKIRNAT------FPGVQMKFVL 330
           DLIL  G   ++ N G ++  Y      N+VEFHSD+I+  N+         GV    VL
Sbjct: 330 DLILHFGIERNEINNGHYTIDYNEHIGANVVEFHSDYIRFFNSKTKEEDMIRGVNFVHVL 389

Query: 331 QKL--LTQVGDVVKDYKPVAIPEIPGPNAAVDDSTPLKQQWLWNQVGKFLQEGDVVITET 388
            +L    Q   +  +Y+  +             S  + Q++L + + ++L  GDV++ ET
Sbjct: 390 NRLQPAIQADKLSFNYQECSTTSNADSKIDSQSSNEITQEFLQDIMPQYLNPGDVLVCET 449

Query: 389 GTSAFGINQTHFPNNTYGISQVLWGSIXXXXXXX-----------XXXXXXXXXXDKNKR 437
           G+  FG+    FP+N   +SQ  + SI                            +   +
Sbjct: 450 GSVQFGVRDYRFPSNVKYVSQGFYLSIGMALPASLGVGIGMQDYPMSHIPNPEEIEYEPK 509

Query: 438 VILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNNGYTIEKLIHGEFAQYNEIQPWNHLD 497
           +ILF GDGS Q+T+QE+STM+   +K  +F+ NN+GYTIE+ I G    YN+I PWN   
Sbjct: 510 LILFEGDGSAQMTIQELSTMLHNNVKMEIFLWNNDGYTIERAIKGPTRSYNDIAPWNWTK 569

Query: 498 LLPTF----GAKDYETVRVATTGE--WNKLAEDQEFNKN---SKIRMIEVMLPVMDAPES 548
           +   F    G+K     +V +T E    +L E ++   N    +I ++EV + V+D PE 
Sbjct: 570 MFEAFGDGLGSKHKTRNQVYSTREEFLTRLREKKDTKHNDPACQIELLEVKMGVLDFPEQ 629

Query: 549 L 549
           L
Sbjct: 630 L 630

>NCAS0A11830 Chr1 (2347016..2348929) [1914 bp, 637 aa] {ON}
           Anc_5.456
          Length = 637

 Score =  282 bits (722), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 197/611 (32%), Positives = 312/611 (51%), Gaps = 54/611 (8%)

Query: 4   ITLGRYLFERLRQVECNTIFGLPGDFNLRLLDEIYE----TEGMRWXXXXXXXXXXXXXX 59
           I  G YL +R+      +IFG+PGDFNL LL+ +Y     ++G+RW              
Sbjct: 28  IPFGEYLLQRILTAGTKSIFGVPGDFNLSLLEYLYTPSLISQGLRWIGTCNELNAAYAAD 87

Query: 60  XXXRIKG-MSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVP-SISAQAKQLL---LH 114
              R    MSCLITT+GVGELSA+NG+AG++AE V VLH+VGV  S+ +++       +H
Sbjct: 88  GYSRYSNKMSCLITTYGVGELSAMNGVAGAFAEDVKVLHIVGVTRSVDSRSDDYHTRNIH 147

Query: 115 H---TLGNGDFT-----VFHRMSAN-ISETTAMISDLATAPAEIDRCIRTTYVRQRPVYL 165
           H    L + +F      V+  M  + ++ + A + ++ TA  E+D+ I   Y   +P Y+
Sbjct: 148 HLVPKLKDSNFIGPNHRVYSEMVRDKLACSVAYLDNIETACDEVDKVIFDIYKYSKPGYI 207

Query: 166 GLPSNFVDQMV-PASLLETPIDLSLK---PNDAAAE-QEVVSTVLDLIKNAKNPVILADA 220
            +P++F D +V P++L+  P+ ++L+   P   + E +EV   +L  I ++K P I+ D 
Sbjct: 208 FVPADFSDMLVNPSNLVSNPV-ITLENAIPEVPSLELEEVTQLLLQCIYDSKTPAIIGDV 266

Query: 221 CASRHDVKAETKKLIDVTQFPSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESSD 280
              R     E  KLI +T   +F T MGK  IDE +P++ G+Y G     +V E     D
Sbjct: 267 LTDRFGCAPELNKLIKMTSMWNFSTVMGKSVIDESNPKYMGLYNGNEGICSVTERFLQCD 326

Query: 281 LILSVGALLSDFNTGSFSYSY-KTKNIVEFHSDHIKI------RNATFPGVQMKFVLQKL 333
           L+L  G  +++ N G ++Y Y +   IVE H ++++           F GV    +L++L
Sbjct: 327 LVLHFGINVNEINNGHYTYKYNENAKIVELHPEYVRFFDFKINEEKLFKGVHFVPILKRL 386

Query: 334 LTQVGDVVKDYK-PVAIPEIPGPNAAV--DDSTPLK--QQWLWNQVGKFLQEGDVVITET 388
           L ++     ++  P  +         +  + S+ LK  Q  L N++  +  +GDVV+ ET
Sbjct: 387 LEKLEPTNLNFNYPTNVARFSQEEICLPQESSSELKVTQTHLQNKIPSYFNDGDVVVCET 446

Query: 389 GTSAFGINQTHFPNNTYGISQVLWGSIXXXXXXXXXXXXXXXXXDKNK------------ 436
           G+  F +    FP+    ISQ  + SI                  K+             
Sbjct: 447 GSFQFALRDFIFPSQLKYISQGFFLSIGMALPASMGVGIAMQDFPKSHLIANGKEHSYQP 506

Query: 437 RVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNNGYTIEKLIHGEFAQYNEIQPWNHL 496
           R+ILF GDG+ Q+TVQE++TM+R  +   + +LNNNGYTIE+ I G    YN+I PW   
Sbjct: 507 RLILFEGDGAAQMTVQELTTMLRNKIPIEIILLNNNGYTIERAIKGPTRSYNDIMPWKWT 566

Query: 497 DLLPTFGAKDYE---TVRVATTGEWNKLAEDQEFNK-NSKIRMIEVMLPVMDAPESLVKQ 552
            L   FG  D +      V T  E +++ ED ++ K ++ I ++EV L VMD P+ L  Q
Sbjct: 567 KLFEAFGDFDNKYTMNTLVETRSELDRILEDLKYKKRDNLIELLEVKLDVMDFPKQL--Q 624

Query: 553 AQLTAATNAKS 563
           + + AA   +S
Sbjct: 625 SMVDAAAFKRS 635

>ZYRO0G04378g Chr7 complement(350070..351911) [1842 bp, 613 aa] {ON}
           similar to uniprot|Q06408 Saccharomyces cerevisiae
           YDR380W ARO10 Phenylpyruvate decarboxylase catalyzes
           decarboxylation of phenylpyruvate to phenylacetaldehyde
           which is the first specific step in the Ehrlich pathway
          Length = 613

 Score =  276 bits (706), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 191/605 (31%), Positives = 299/605 (49%), Gaps = 52/605 (8%)

Query: 3   EITLGRYLFERLRQVECNTIFGLPGDFNLRLLDEIYETE----GMRWXXXXXXXXXXXXX 58
            I  G YLF++L Q    +IFG+PGD+NL LL+ +Y+      G RW             
Sbjct: 15  RIPFGEYLFKKLVQSGSKSIFGVPGDYNLPLLEHLYDDSVKDIGCRWIACCNELNAAYAA 74

Query: 59  XXXXRIKG-MSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTL 117
               R    ++ LITT+GVGELSA+NG+AGS AE+V VLH+VGV  + + A +   HH +
Sbjct: 75  DGYSRYTNKLATLITTYGVGELSAINGVAGSSAENVKVLHIVGV--VKSDAPECNYHHLI 132

Query: 118 ---------GNGDFTVFHRMSANISETTAMISDLATAPAEIDRCIRTTYVRQRPVYLGLP 168
                    G      +  +   ++ +   + D+ TAP ++D+ I   Y   +P YL +P
Sbjct: 133 PQLQHSNFIGPNRKICYDMVKDRVACSAEYLEDIETAPEKVDKVITEIYKHSKPGYLFVP 192

Query: 169 SNFVDQMVPASLLETPIDL--SLKPNDAAAEQEVVSTVLDLIKNAKNPVILADACASRHD 226
           ++F D++V  + L   I+L  S++   +     +V  VL  I  ++ P ILAD    R  
Sbjct: 193 ADFADKLVDTTCLNNEINLCNSIERTPSEKLDSIVDGVLQWIYQSQTPAILADGNVDRFG 252

Query: 227 VKAETKKLIDVTQFPSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESSDLILSVG 286
           + ++  + I+ TQ  +F T MGK  IDE +PR+ G+Y G   +  V+    S DLIL  G
Sbjct: 253 LISQLNQFIERTQMVNFTTIMGKSIIDETNPRYQGLYAGKSCTDLVRSKFLSCDLILHFG 312

Query: 287 ALLSDFNTGSFSYSYKTK-NIVEFHSDHIKIRNA------TFPGVQMKFVLQKLLTQVGD 339
              ++ N  +  + Y  +  ++EFH  +I++ +        F  V    VL  L  ++ D
Sbjct: 313 VEKNEVNYCAQGFPYGPQAKVIEFHQSYIRLFDTLNGDEQLFENVNFVDVLTALHQRI-D 371

Query: 340 VVK-----DYKPVAIPEIPGPNAAVDDSTPLKQQWLWNQVGKFLQEGDVVITETGTSAFG 394
           + K     D       E    N   +D++ + Q +L  +  + L  GD+++++TG+  FG
Sbjct: 372 ISKLNLQYDKAIFTTYEPSQLNLPEEDTSDVTQIYLQKKFPEILAPGDILVSDTGSFQFG 431

Query: 395 INQTHFPNNTYGISQVLWGSIXXXXXXX------XXXXXXXXXXDKNK-------RVILF 441
           +     P  +  ++Q  W SI                       D++K       +++L 
Sbjct: 432 VRDYKLPTQSKFMAQSTWLSIGMGLPAALGVGIGMQDYPRIHICDQSKVPAGYKPKLVLG 491

Query: 442 IGDGSLQLTVQEISTMIRWGLKPYLFVLNNNGYTIEKLIHGEFAQYNEIQPWNHLDLLPT 501
           +GDG+ Q+TVQE++TM+R+ +   +FV NNNGYTIE+ I GE + YN+I PW    L   
Sbjct: 492 VGDGAAQMTVQELTTMLRYHVDINVFVWNNNGYTIERAIMGENSDYNDIMPWRWTKLFEA 551

Query: 502 FG---AKDYETVRVATTGEWNKLAEDQEFNKNSK-IRMIEVMLPVMDAPESLVKQAQLTA 557
           FG    K   +  V T  E ++  ED   NK  K I ++EV L VMD P  L  Q  L+ 
Sbjct: 552 FGDFDGKYSNSSLVKTRQELDQKIED--INKGGKGIELVEVKLGVMDYPAQL--QMMLSN 607

Query: 558 ATNAK 562
             NAK
Sbjct: 608 MKNAK 612

>KLTH0F15510g Chr6 complement(1265767..1267644) [1878 bp, 625 aa]
           {ON} similar to uniprot|Q06408 Saccharomyces cerevisiae
           YDR380W ARO10 Phenylpyruvate decarboxylase catalyzes
           decarboxylation of phenylpyruvate to phenylacetaldehyde
           which is the first specific step in the Ehrlich pathway
          Length = 625

 Score =  276 bits (707), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 194/606 (32%), Positives = 302/606 (49%), Gaps = 61/606 (10%)

Query: 3   EITLGRYLFERLRQVECNTIFGLPGDFNLRLLDEIYETE----GMRWXXXXXXXXXXXXX 58
            I LG+Y+FER+      TIFG+PGDFNL LL+ IY  E    G++W             
Sbjct: 21  RIPLGQYIFERIVSSGTRTIFGVPGDFNLSLLEHIYNPEVALKGIKWIGTCNELNAAYAA 80

Query: 59  XXXXRIKG-MSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGV-PSI----SAQAKQLL 112
               R    + CLITT GVGELSALNGIAG++AE V +LH+VGV PS     SAQ+   +
Sbjct: 81  DGYSRYTNKIGCLITTLGVGELSALNGIAGAFAEDVKILHIVGVAPSQFYEGSAQSSHNV 140

Query: 113 LHHTLGNGDFTVF---HRM-----SANISETTAMISDLATAPAEIDRCIRTTYVRQRPVY 164
            H      D  +    HR+        +S ++  + D+++A  +ID  I   Y   +P Y
Sbjct: 141 HHLVPAVFDSNIHAPNHRVYRDMVDKRVSCSSLFLDDISSACDQIDTVISDIYRYSKPGY 200

Query: 165 LGLPSNFVDQMVPASLLETPIDLSLKP-------NDAAAEQEVVSTVLDLIKNAKNPVIL 217
           + +P++F D++V A  LE    + L+        ND    QE+   +L+ + ++  P I+
Sbjct: 201 IFIPADFTDKLVDARNLEKRPAILLRDVVSGFCINDHKC-QELAEYILESMYSSSRPAII 259

Query: 218 ADACASRHDVKAETKKLIDVTQFPSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVE 277
           AD    R+D+ +  ++L++ T   +F + MGK  +DE +  F GVY G+ S   V +  +
Sbjct: 260 ADILCDRYDLTSSLRELVNKTHVWNFASSMGKSILDENNLGFRGVYNGSESQDQVLKDFQ 319

Query: 278 SSDLILSVGALLSDFNTGSFSYSYKT-KNIVEFHSDHIKIRNA-----TFPGVQMKFVLQ 331
           + D +L VG + ++ NTG +SY +    NIVE H  ++   +A      +   Q  F + 
Sbjct: 320 TCDFLLHVGVVKNEMNTGHYSYKFSNHSNIVELHPSYVNFIDADTGKNRYVTGQYFFKVL 379

Query: 332 KLLTQVGDVVK------DYKPVAIPEIPGPNAAVDDSTPLKQQWLWNQVGKFLQEGDVVI 385
            ++TQ+ D  K      +  P    E  GP       + +   +L     KFL  GDV +
Sbjct: 380 DMMTQMIDPTKLHLGYQESIPSRTQEYCGP-----PHSSVTHSYLQTHFPKFLSSGDVFV 434

Query: 386 TETGTSAFGINQTHFPNNTYGISQVLWGSIXXXXXXXXXXXXXXXXXDKNK--------- 436
            +TG+  FG+    FP++   ISQ  + SI                   N          
Sbjct: 435 VDTGSFQFGVRDYRFPSDLKYISQSFYLSIGMALPCALGVGLGMQDYPSNHIISSALVQR 494

Query: 437 ----RVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNNGYTIEKLIHGEFAQYNEIQP 492
               R+IL  GDG+ Q+T+QE+++ +R+ +   LF+ NN GYT+E+ I G    YN+I  
Sbjct: 495 NYQPRLILCEGDGAAQMTIQELTSFLRYKVPIDLFIWNNGGYTVERAIKGPNRPYNDIMA 554

Query: 493 WNHLDLLPTFGAKDYE---TVRVATTGEWNKLAED-QEFNKNSK-IRMIEVMLPVMDAPE 547
           W   +LL  FG    E   + +V++  + ++L +  +  +K SK +R++EVML VMD PE
Sbjct: 555 WEWTELLRVFGDPKLENSVSQKVSSADQMSELLKTFRSSDKRSKLVRLVEVMLGVMDFPE 614

Query: 548 SLVKQA 553
            L   A
Sbjct: 615 QLKAMA 620

>KAFR0E03730 Chr5 complement(746616..748523) [1908 bp, 635 aa] {ON}
           Anc_5.456 YDR380W
          Length = 635

 Score =  274 bits (700), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 187/614 (30%), Positives = 309/614 (50%), Gaps = 55/614 (8%)

Query: 3   EITLGRYLFERLRQVECNTIFGLPGDFNLRLLDEIYE----TEGMRWXXXXXXXXXXXXX 58
           +I  G Y+F+R+      ++FG+PGDFNL LL+ +Y+     +G+RW             
Sbjct: 24  QIRFGEYIFQRILSCGTKSVFGVPGDFNLPLLEYLYDDSIINQGLRWIGTCNELNAAYAA 83

Query: 59  XXXXRI-KGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVP-SISAQA---KQLLL 113
               R  +G+ CLITT+GVGELSA+NGIAG++AE+V +LH+VGV  SI +Q    KQ  L
Sbjct: 84  DGYSRYSQGIGCLITTYGVGELSAMNGIAGAFAENVKLLHIVGVARSIDSQHDDFKQRNL 143

Query: 114 HH---TLGNGDFT-----VFHRMSAN-ISETTAMISDLATAPAEIDRCIRTTYVRQRPVY 164
           HH    L + +F+     +++ M  + IS +T  + ++ TA  ++D+ I   Y   +P Y
Sbjct: 144 HHLVPQLNDSNFSGPNHKIYYEMVKDRISCSTEYLENIDTACDQVDKVIMDIYRYSKPGY 203

Query: 165 LGLPSNFVDQMVPA-SLLETPI----DLSLKPNDAAAEQEVVSTVLDLIKNAKNPVILAD 219
           + +P +FV+ MV   +LL+ P     D  L+ +      ++ + +LD I ++K+P I+ D
Sbjct: 204 IFVPCDFVNMMVDTKNLLQRPKITFQDCILQDDKLNQIDQITNLILDQIYSSKSPAIIGD 263

Query: 220 ACASRHDVKAETKKLIDVTQFPSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESS 279
               R+       + I +T+  +F T  GK  I+E++P + G+Y G   +  V +     
Sbjct: 264 VLTDRYHGNKLLNEFITLTKIWNFTTFNGKSIINEQNPYYMGLYNGNEGAETVIDRFLKC 323

Query: 280 DLILSVGALLSDFNTGSFSYSYK-TKNIVEFHSDHIKIRNA------TFPGVQMKFVLQK 332
           DLI++VG  +++ N G +++SY+    ++E H  +I++ +        F G+    VL++
Sbjct: 324 DLIINVGIDINEINHGHYTFSYRQNAKLIEMHPTYIRLYDTGSHEETLFKGINFIHVLKR 383

Query: 333 LLTQVGDVVK---DYKPVAIP-----EIPGPNAAVDDSTPLKQQWLWNQVGKFLQEGDVV 384
           +L ++ D+ +   DY P         E+  P+A   DS  + Q +L   V  +L +GDV+
Sbjct: 384 MLIKI-DIKRFDFDYDPSVTKFDPTIELKFPSAD-PDSNKITQNFLAQNVPDYLNDGDVL 441

Query: 385 ITETGTSAFGINQTHFPNNTYGISQVLWGSIXXXXXXXXXXXXXXXXXDK---------- 434
           + ETG   F       P+    I+Q  + SI                  +          
Sbjct: 442 VVETGAFQFATRDFLLPDQLKYITQGFYLSIGTALPAALGVGIAMQDYPRCHLYGKIPET 501

Query: 435 -NKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNNGYTIEKLIHGEFAQYNEIQPW 493
            N R+IL  GDG+ Q+TVQE+S+ IR+ +   + +LNN+GYTIE+ I G    YN+I  W
Sbjct: 502 YNPRLILMEGDGAAQMTVQELSSFIRYNIPIEIILLNNDGYTIERAILGPTRSYNDIMAW 561

Query: 494 NHLDLLPTFGAKDYETVRVATTGE----WNKLAEDQEFNKNSKIRMIEVMLPVMDAPESL 549
           N   +    G  D +     T        NK  + +   + +KI  IEV+L V+D PE L
Sbjct: 562 NWTKIFEALGDFDNKATVNTTIKSPSKLLNKFKQLKNETERNKIEFIEVILGVLDYPEQL 621

Query: 550 VKQAQLTAATNAKS 563
               +       K+
Sbjct: 622 KSMVEAAKVKKPKA 635

>Kpol_440.4 s440 (9465..11375) [1911 bp, 636 aa] {ON} (9465..11375)
           [1911 nt, 637 aa]
          Length = 636

 Score =  273 bits (699), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 187/600 (31%), Positives = 299/600 (49%), Gaps = 54/600 (9%)

Query: 3   EITLGRYLFERLRQVECNTIFGLPGDFNLRLLDEIYETEG---MRWXXXXXXXXXXXXXX 59
           +I LG YL  RL  +   + FG+PGDFNL LL+ +Y  +G   + W              
Sbjct: 16  KIPLGEYLVRRLLSIGSKSAFGVPGDFNLPLLEFLYNKDGDEIINWIGCCNELNASYAAD 75

Query: 60  XXXRIKG-MSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGV-PSISAQAKQLL---LH 114
              R    + CLITT+GVGELSA+NGI GSYAE++ +LH+VGV P+  ++ + L    LH
Sbjct: 76  GYSRYTNKIGCLITTYGVGELSAINGITGSYAENIKILHIVGVAPTFISEDENLKYKNLH 135

Query: 115 H--------TLGNGDFTVFHRMSAN-ISETTAMISDLATAPAEIDRCIRTTYVRQRPVYL 165
           H         + + +F ++++M  + IS  +  ++D+ T+  +ID  I   +   +P Y+
Sbjct: 136 HLIPDKEFPNINSPNFKIYYQMVKDKISCASEYLTDIETSCDKIDDVIVQIFKHSKPGYI 195

Query: 166 GLPSNFVDQMVPA-SLLETP-IDLSLKPNDAAAEQ--EVVSTVLDLIKNAKNPVILADAC 221
            +PS+F +++V + +L+  P I+LS   N    E+   + + ++DLI N+++P I+ D  
Sbjct: 196 FIPSDFSNKLVSSKNLINVPSINLSDCLNKTPMEKIDNLTNEIIDLIGNSQSPAIIGDVL 255

Query: 222 ASRHDVKAETKKLIDVTQFPSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESSDL 281
             R          I +T+F +F T MGK  IDE    + G Y+G      V   +   D+
Sbjct: 256 TDRFGCTKLLNDFIQMTKFWNFSTMMGKSVIDESGQAYMGTYIGLGGLTTVYNKILKCDI 315

Query: 282 ILSVGALLSDFNTGSFSYSY-KTKNIVEFHSDHIKIRNAT---------FPGVQMKFVLQ 331
            L  G  +++ N+G++S+ + K   I+E + +++KI             +P V M  +L+
Sbjct: 316 FLIFGLEMNEMNSGNYSFKFPKGSQIIEINPNYLKITKCHDTENQIVDFYPNVSMTHILE 375

Query: 332 KLLTQVG------DVVKDYKPVAIPEIPGPNAAVDDSTPLKQQWLWNQVGKFLQEGDVVI 385
            L+ +V       +  K  K     E+  P    +D   + Q  L  ++  FL  GDV++
Sbjct: 376 GLIAKVNIHDANTNYDKSVKSYDTSELVLP-LQQEDEEKITQVHLQRELPNFLNPGDVLV 434

Query: 386 TETGTSAFGINQTHFPNNTYGISQVLWGSIXXXXXXXXXXXXXXXXXDK----------- 434
            ETG+  F +    FP+N   ISQ  + SI                  K           
Sbjct: 435 CETGSFQFAVQDFKFPSNLKYISQGFYLSIGMALPAALGVGIAMKDYPKFHLNDHSLARN 494

Query: 435 -NKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNNGYTIEKLIHGEFAQYNEIQPW 493
              R+IL  GDG+ Q+TVQE++TM+R  +   +F+ NNNGYT+E+ I G F  YN+I PW
Sbjct: 495 YTPRLILLEGDGAAQMTVQELTTMLRHKIPMEIFLWNNNGYTVERAIEGPFRSYNDIMPW 554

Query: 494 NHLDLLPTFGAKDYETVRVATTGEWNKLAED----QEFNKNSKIRMIEVMLPVMDAPESL 549
           N   LL   G  + E  R  T  + ++L+E     +E   N+ I++IEV L   D P  L
Sbjct: 555 NWTKLLNVLGDPNNEFNRCVTIDKKSQLSEKFKELKEGKDNNCIQLIEVQLDTHDIPRQL 614

>Suva_2.554 Chr2 (984966..986873) [1908 bp, 635 aa] {ON} YDR380W
           (REAL)
          Length = 635

 Score =  271 bits (692), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 199/609 (32%), Positives = 291/609 (47%), Gaps = 53/609 (8%)

Query: 6   LGRYLFERLRQVECNTIFGLPGDFNLRLLDEIY----ETEGMRWXXXXXXXXXXXXXXXX 61
            G Y+F RL  +   ++FG+PGDFNL LL+ +Y    E++G++W                
Sbjct: 27  FGEYIFRRLFSIGTKSVFGVPGDFNLSLLEYLYAPSVESDGLQWVGTCNELNAAYAADGY 86

Query: 62  XRIKG-MSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVP----SISAQAKQLLLHH- 115
            R    + CLITT+GVGELSALNGIAGS+AE+V VLH+VGV     S S   K+  LHH 
Sbjct: 87  SRYSNKIGCLITTYGVGELSALNGIAGSFAENVKVLHIVGVAKSTDSRSNNFKERNLHHL 146

Query: 116 --TLGNGDFT-----VFHRM-SANISETTAMISDLATAPAEIDRCIRTTYVRQRPVYLGL 167
              L + +F      V+H M   N++ + A + D+ TA  ++D  IR  Y   +P Y+ +
Sbjct: 147 VPRLHDSNFKGPNHKVYHDMIKDNVACSVAYLEDIETACDQVDAVIRDIYRYSKPGYVFV 206

Query: 168 PSNFVDQMVPASLLETPIDLSLKPNDAAAEQEVVSTVLDLIK----NAKNPVILADACAS 223
           P++F D  V    L     +S +    ++ +  +  ++D I     +++ P IL D    
Sbjct: 207 PADFPDMSVRLDNLINVPHISQQDCITSSSETQLFNIIDKITTWMYSSRTPAILGDVLTD 266

Query: 224 RHDVKAETKKLIDVTQFPSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESSDLIL 283
           R+ V     KLI  ++  +F T MGK  IDE +P + G+Y G      V E  ES DLIL
Sbjct: 267 RYGVSDILNKLIYASKIWNFTTVMGKSVIDESNPSYMGLYNGKEGLKQVYEHFESCDLIL 326

Query: 284 SVGALLSDFNTGSFSYSYK-TKNIVEFHSDHIKI------RNATFPGVQMKFVLQKLLTQ 336
             G  +++ N G +S++YK    I++FH ++I+           F GV    VLQ+L  Q
Sbjct: 327 HFGVDINEINNGHYSFTYKPNAKIIQFHPNYIRFVDTRYGEEQIFEGVNFVPVLQELY-Q 385

Query: 337 VGDVVK---DYKPVAIP----EIPGPNAAVDDSTPLKQQWLWNQVGKFLQEGDVVITETG 389
             DV K    Y     P     +   +   D ST + Q  L   + KFL  GDVV+ ETG
Sbjct: 386 CIDVSKLSLQYDSRVTPYTNETMKLEDPTNDQSTDITQIHLQKVIPKFLNPGDVVVCETG 445

Query: 390 TSAFGINQTHFPNNTYGISQVLWGSIXXXXXXXXXXXXXXXXXDKNK------------R 437
           +  F +    FP     ISQ  + SI                                 R
Sbjct: 446 SFQFSVRDFAFPTQLKYISQGFFLSIGMALPAALGVGIAMQDHPNTHINGGNINEGYKPR 505

Query: 438 VILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNNGYTIEKLIHGEFAQYNEIQPWNHLD 497
           +ILF GDG+ Q+T+QE+ST++++ +   + + NNNGYTIE+ I G    YN+I  W    
Sbjct: 506 LILFEGDGAAQMTIQELSTILKFHIPIEIVIWNNNGYTIERAIMGPTRSYNDIMSWKWTK 565

Query: 498 LLPTFGAKD--YETVRVATTGEWNKLAEDQEFNKNS--KIRMIEVMLPVMDAPESLVKQA 553
           L   FG  D  Y    +  T     L      N ++  +I ++EV L V+D PE L    
Sbjct: 566 LFEAFGDFDGKYTNNTIIETTSKLALKLKDLKNSSTRDRIELLEVKLGVLDFPEQLRCMV 625

Query: 554 QLTAATNAK 562
           +  A    K
Sbjct: 626 EAAALKRNK 634

>Kpol_1062.12 s1062 complement(31361..33253) [1893 bp, 630 aa] {ON}
           complement(31361..33253) [1893 nt, 631 aa]
          Length = 630

 Score =  270 bits (690), Expect = 6e-82,   Method: Compositional matrix adjust.
 Identities = 181/598 (30%), Positives = 287/598 (47%), Gaps = 55/598 (9%)

Query: 4   ITLGRYLFERLRQVECNTIFGLPGDFNLRLLDEIY------ETEGMRWXXXXXXXXXXXX 57
           +  G Y+F+RL      +IFG+PGD+NL LL+ +Y      +T  + W            
Sbjct: 24  LRFGDYIFKRLNSCGTKSIFGVPGDYNLNLLELMYPNGTANKTSEINWIGCCNELNAAYA 83

Query: 58  XXXXXRIKG-MSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHT 116
                R    + C++TT GVGELSA+NGI+GS+AEHV VLH+VG+PS          HH 
Sbjct: 84  ADGYSRYTNKLGCIVTTCGVGELSAMNGISGSFAEHVKVLHIVGIPSTEKFKTGGNFHHL 143

Query: 117 LGN--------GDFTVFHRM-SANISETTAMISDLATAPAEIDRCIRTTYVRQRPVYLGL 167
           L N         ++ VF  M   ++S +T  I +L TA  E D  IR  Y   +P Y+ +
Sbjct: 144 LPNFKESNLNKPNYKVFAEMVQGSVSCSTKFIENLDTACQEFDDLIRDIYKYSKPGYMFV 203

Query: 168 PSNFVDQMV-PASLLETPI-----DLSLKPNDAAAEQEVVSTVLDLIKNAKNPVILADAC 221
           P N+    V P +L ETP       +++ P+       +   +   + +A+ P I+AD  
Sbjct: 204 PENYFKLYVNPKNLYETPSITLQDCITMSPDKMEMADGLTDFIFSYLYHAEKPAIIADTL 263

Query: 222 ASRHDVKAETKKLIDVTQFPSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESSDL 281
             R+   +   + I  T   +F T MGK  +DE    + GVY G      V++A+ + DL
Sbjct: 264 TDRYSGSSLLNEFIQKTNIWNFSTLMGKSILDESTETYKGVYNGKDGCEKVQKAISTCDL 323

Query: 282 ILSVGALLSDFNTGSFS---YSYKTKNIVEFHSDHIKI------RNATFPGVQMKFVLQK 332
           IL  G   ++ N+G+++   Y  K   I+EFH  +I++          F GV+  ++L++
Sbjct: 324 ILHFGVEKNEVNSGTYTFEDYYSKVSFIIEFHPQYIRMIDMQSKSTQLFGGVEFTYILKR 383

Query: 333 LLTQVG--DVVKDYKPVAIPEIPGPNAAVDDSTPLKQQWLWNQVGKFLQEGDVVITETGT 390
           +L  V   ++  +Y P +       +     +  + Q  +   +  +++ GDVV+ +TGT
Sbjct: 384 MLKMVNPSNLHLNY-PTSDESSTKTDQEAVANNQITQDHISTTMESYIKPGDVVLCDTGT 442

Query: 391 SAFGINQTHFPNNTYGISQVLWGSI------------XXXXXXXXXXXXXXXXXDKNKRV 438
             F +    F +    +SQ  + SI                             +   R+
Sbjct: 443 FQFSLRDFKFSSQVKLVSQFFYLSIGYALPSALGVGIAMRDYPNSHIKDEQLKENTKPRL 502

Query: 439 ILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNNGYTIEKLIHGEFAQYNEIQPWNHLDL 498
           ILF GDG+ Q+TVQE+STM+R+ +   +F+ NN+GYTIE+ I G    YN+IQPWN   L
Sbjct: 503 ILFEGDGAAQMTVQELSTMLRYEVPMDIFLWNNDGYTIERAIQGPTRSYNDIQPWNWTYL 562

Query: 499 LPTFG------AKDYETVRVATTGEWNKLAEDQEFNKNSKIRMIEVMLPVMDAPESLV 550
              FG      AK++   +V TT E + +  +      + I  +EV L +MD P+ L 
Sbjct: 563 FKAFGDAKENFAKNH---KVETTKELDNILTELRSKDQNNINFVEVTLGIMDMPKILT 617

>YDR380W Chr4 (1234218..1236125) [1908 bp, 635 aa] {ON}
           ARO10Phenylpyruvate decarboxylase, catalyzes
           decarboxylation of phenylpyruvate to phenylacetaldehyde,
           which is the first specific step in the Ehrlich pathway
          Length = 635

 Score =  270 bits (689), Expect = 9e-82,   Method: Compositional matrix adjust.
 Identities = 195/613 (31%), Positives = 300/613 (48%), Gaps = 57/613 (9%)

Query: 4   ITLGRYLFERLRQVECNTIFGLPGDFNLRLLDEIY----ETEGMRWXXXXXXXXXXXXXX 59
           I  G Y+F+RL  ++  ++FG+PGDFNL LL+ +Y    E+ G+RW              
Sbjct: 25  IPFGEYIFKRLLSIDTKSVFGVPGDFNLSLLEYLYSPSVESAGLRWVGTCNELNAAYAAD 84

Query: 60  XXXRIKG-MSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVP-SISAQAKQLL---LH 114
              R    + CLITT+GVGELSALNGIAGS+AE+V VLH+VGV  SI +++       LH
Sbjct: 85  GYSRYSNKIGCLITTYGVGELSALNGIAGSFAENVKVLHIVGVAKSIDSRSSNFSDRNLH 144

Query: 115 H---TLGNGDFT-----VFHRMSAN-ISETTAMISDLATAPAEIDRCIRTTYVRQRPVYL 165
           H    L + +F      V+H M  + ++ + A + D+ TA  ++D  IR  Y   +P Y+
Sbjct: 145 HLVPQLHDSNFKGPNHKVYHDMVKDRVACSVAYLEDIETACDQVDNVIRDIYKYSKPGYI 204

Query: 166 GLPSNFVDQMVPA-SLLETPI----DLSLKPNDAAAEQEVVSTVLDLIKNAKNPVILADA 220
            +P++F D  V   +L+  P     D  + P++     ++++ +   I ++K P IL D 
Sbjct: 205 FVPADFADMSVTCDNLVNVPRISQQDCIVYPSENQL-SDIINKITSWIYSSKTPAILGDV 263

Query: 221 CASRHDVKAETKKLIDVTQFPSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESSD 280
              R+ V     KLI  T   +F T MGK  IDE +P + G Y G      V E  E  D
Sbjct: 264 LTDRYGVSNFLNKLICKTGIWNFSTVMGKSVIDESNPTYMGQYNGKEGLKQVYEHFELCD 323

Query: 281 LILSVGALLSDFNTGSFSYSYK-TKNIVEFHSDHIKIRNA------TFPGVQMKFVLQKL 333
           L+L  G  +++ N G ++++YK    I++FH ++I++ +        F G+    +L++L
Sbjct: 324 LVLHFGVDINEINNGHYTFTYKPNAKIIQFHPNYIRLVDTRQGNEQMFKGINFAPILKEL 383

Query: 334 LTQVGDVVK---DYKPVAIPEIPGPNAAVDD-----STPLKQQWLWNQVGKFLQEGDVVI 385
             ++ DV K    Y    + +       ++D     S+ + Q  L   + KFL  GDVV+
Sbjct: 384 YKRI-DVSKLSLQYDS-NVTQYTNETMRLEDPTNGQSSIITQVHLQKTMPKFLNPGDVVV 441

Query: 386 TETGTSAFGINQTHFPNNTYGISQVLWGSI------------XXXXXXXXXXXXXXXXXD 433
            ETG+  F +    FP+    ISQ  + SI                             D
Sbjct: 442 CETGSFQFSVRDFAFPSQLKYISQGFFLSIGMALPAALGVGIAMQDHSNAHINGGNVKED 501

Query: 434 KNKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNNGYTIEKLIHGEFAQYNEIQPW 493
              R+ILF GDG+ Q+T+QE+ST+++  +   + + NNNGYTIE+ I G    YN++  W
Sbjct: 502 YKPRLILFEGDGAAQMTIQELSTILKCNIPLEVIIWNNNGYTIERAIMGPTRSYNDVMSW 561

Query: 494 NHLDLLPTFGAKDYETVRVATTGEWNKLA----EDQEFNKNSKIRMIEVMLPVMDAPESL 549
               L   FG  D +          +KLA    E +  NK S I ++EV L  +D PE L
Sbjct: 562 KWTKLFEAFGDFDGKYTNSTLIQCPSKLALKLEELKNSNKRSGIELLEVKLGELDFPEQL 621

Query: 550 VKQAQLTAATNAK 562
               +  A    K
Sbjct: 622 KCMVEAAALKRNK 634

>KNAG0C04790 Chr3 complement(932051..933964) [1914 bp, 637 aa] {ON}
           Anc_5.456 YDR380W
          Length = 637

 Score =  268 bits (685), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 187/597 (31%), Positives = 289/597 (48%), Gaps = 50/597 (8%)

Query: 3   EITLGRYLFERLRQVECNTIFGLPGDFNLRLLDEIYET----EGMRWXXXXXXXXXXXXX 58
           +I LG+YLF+R+      +IFG+PGDFNL LL+ +YE     +G+RW             
Sbjct: 27  KIPLGKYLFQRVLSAGTKSIFGVPGDFNLPLLEHLYERDLVEQGLRWIGTCNELNAAYAA 86

Query: 59  XXXXRIKG-MSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTL 117
               R    + CLITT+GVGELSALNG+AG++AE+V +LH+VGV   SA+ +   +HH +
Sbjct: 87  DGFSRYSNKIGCLITTYGVGELSALNGVAGAFAENVKMLHIVGVAKSSAKHENKNIHHLI 146

Query: 118 GNGDFTVFHR---------MSANISETTAMISDLATAPAEIDRCIRTTYVRQRPVYLGLP 168
            N   + F R         +   +  +   + ++  A  +ID+ IR  Y   +P Y+ +P
Sbjct: 147 PNLHDSNFKRPNHKVYYEMVKDRVCCSAEYLENIDQACDQIDKVIRDIYRYSKPGYIFIP 206

Query: 169 SNFVDQMVPAS-LLETP-IDL--SLKPNDAAAEQEVVSTVLDLIKNAKNPVILADACASR 224
            +FV+++V  + LL TP IDL  SL   D     EV   + D I  + NP ++ D    R
Sbjct: 207 VDFVNELVETTNLLVTPVIDLESSLARPDEVTVIEVAQMIADWIYQSGNPGLVGDVLTDR 266

Query: 225 HDVKAETKKLIDVTQFPSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESSDLILS 284
           +D        I +T+  +F T  GK  IDE +P + G+Y G      V +     DL+L+
Sbjct: 267 YDATKMLNDFIQLTKMWNFTTVNGKSIIDESNPWYMGLYNGDEGVSTVIDRFHKCDLVLN 326

Query: 285 VGALLSDFNTGSFSYSYK-TKNIVEFHSDHIKIRNAT------FPGVQMKFVLQKLLTQV 337
            G  +++ N G +++ YK    IVE H  +++  +        F G+   FVL++L+ ++
Sbjct: 327 FGLDINEINHGHYTFKYKPNSKIVELHPTYVRFLDTEYGTERLFKGLNFVFVLKELINRI 386

Query: 338 G--DVVKDY----KPVAIPEIPGPNAAVDD--STPLKQQWLWNQVGKFLQEGDVVITETG 389
              + +  Y    +     EI  P    DD  ++ + Q  L   +  +L  GD+V+ ETG
Sbjct: 387 NPKECMFSYDLSVRKFCSEEIKTPEDGNDDAEASTITQNKLSKMIPDYLNPGDIVVCETG 446

Query: 390 TSAFGINQTHFPNNTYGISQVLWGSIXXXXXXXXXXXXXXX-----------XXDKN--K 436
           +  F +     P     +SQ  + SI                            D N   
Sbjct: 447 SFQFAMRDIVLPPQVKYMSQGFFLSIGTALPAAVGVGIALQDYPNQHINNFGAVDHNYKP 506

Query: 437 RVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNNGYTIEKLIHGEFAQYNEIQPWNHL 496
           R+IL  GDG+ Q+TVQE+++MIR+ +   + + NNNGYT+E+ I G    YN+I PW+  
Sbjct: 507 RLILLEGDGAAQMTVQELTSMIRFQIPIEIMLWNNNGYTVERAILGPTRSYNDIMPWDWT 566

Query: 497 DLLPTFG---AKDYETVRVATTGEWNKLAEDQEFNKNSK-IRMIEVMLPVMDAPESL 549
            L   FG    K   +  + TT +        +   N   I M+EV L VMD P  L
Sbjct: 567 KLFAAFGDFEGKYTRSTAIETTSKLLLKLNQLKNEGNRDIIEMVEVKLGVMDYPHQL 623

>Skud_4.651 Chr4 (1157087..1158994) [1908 bp, 635 aa] {ON} YDR380W
           (REAL)
          Length = 635

 Score =  268 bits (685), Expect = 4e-81,   Method: Compositional matrix adjust.
 Identities = 196/603 (32%), Positives = 289/603 (47%), Gaps = 57/603 (9%)

Query: 1   MSEITLGRYLFERLRQVECNTIFGLPGDFNLRLLDEIY----ETEGMRWXXXXXXXXXXX 56
           ++ I+ G Y+F RL      ++FG+PGDFNL LL+ +Y    E+ G++W           
Sbjct: 22  LATISFGEYIFRRLLSTGTKSVFGVPGDFNLSLLEYLYAPSVESAGLKWIGTCNELNAAY 81

Query: 57  XXXXXXRI-KGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVP-SISAQAKQLL-- 112
                 R    + CL+TTFGVGELSALNG+AGS+AE+V VLH+VGV  SI +++      
Sbjct: 82  AADGYSRYSNNIGCLVTTFGVGELSALNGVAGSFAENVKVLHIVGVAKSIDSRSDNFRDR 141

Query: 113 -LHH---TLGNGDFT-----VFHRMSAN-ISETTAMISDLATAPAEIDRCIRTTYVRQRP 162
            +HH    L   +F      V+H M  + ++ + A + D+ TA  ++D  IR  Y   +P
Sbjct: 142 NMHHLVPQLHGSNFKGPNHKVYHDMVKDRVACSVAYLEDIETACDQVDNVIRDIYKYSKP 201

Query: 163 VYLGLPSNFVDQMVPASLLETPIDLSLKPNDAAAEQEVVSTVLDLIKN----AKNPVILA 218
            Y+ +P++F D  V    L     +S +       Q  +  +LD I +    +K P IL 
Sbjct: 202 GYIFVPADFADMSVTCENLINVPHISQQDCITYPSQIQLFDILDRITSWMYSSKTPAILG 261

Query: 219 DACASRHDVKAETKKLIDVTQFPSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVES 278
           D    R+ V     KLI  T   +F T MGK  IDE +P++ G Y G      V E  ES
Sbjct: 262 DVLTDRYGVSEILNKLIYATGIWNFSTVMGKSVIDEANPKYMGQYNGKEGLRQVYEHFES 321

Query: 279 SDLILSVGALLSDFNTGSFSYSYK-TKNIVEFHSDHIKI------RNATFPGVQMKFVLQ 331
            DL+L  G  +++ N G ++++YK    I++FH ++I+           F G+    VL 
Sbjct: 322 CDLVLHFGVDINEINNGHYTFTYKPNAKIIQFHPNYIRFVDTKYGHEQMFEGINFAPVLM 381

Query: 332 KLLT---------QVGDVVKDYKPVAIPEIPGPNAAVDDSTPLKQQWLWNQVGKFLQEGD 382
           +L           Q    V  Y    + ++  P    D S  + Q  L   + KFL  GD
Sbjct: 382 ELYKGIDVSRLSLQYDSGVTSYTNETM-QLEDPTN--DQSNNITQVHLQKVMPKFLSPGD 438

Query: 383 VVITETGTSAFGINQTHFPNNTYGISQVLWGSIXXXXXXXXXXXXXXX------XXDKN- 435
           VV+ ETG+  F +    FP     ISQ  + SI                       D+N 
Sbjct: 439 VVVCETGSFQFSVRDFAFPTQLKYISQGFFLSIGMALPAALGVGIAMQDFPNAHISDENI 498

Query: 436 -----KRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNNGYTIEKLIHGEFAQYNEI 490
                 R+ILF GDG+ Q+T+QE+ST+++  +   +F+ NNNGYTIE+ I G    YN++
Sbjct: 499 GEGYKPRLILFEGDGAAQMTIQELSTILKCHITIDIFIWNNNGYTIERAIMGPTRAYNDV 558

Query: 491 QPWNHLDLLPTFGAKDYETVRVATTGEWNKLAEDQEFNKNSKIR----MIEVMLPVMDAP 546
             W    LL  FG  D +          +KLA   E  K+S  R    ++EV L V+D P
Sbjct: 559 MSWKWTKLLEAFGDFDRKHTNSTVIEYPSKLAMKLEELKSSNTRDGIELVEVKLGVLDFP 618

Query: 547 ESL 549
           E L
Sbjct: 619 EQL 621

>ACR211W Chr3 (716693..718582) [1890 bp, 629 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR380W (ARO10)
          Length = 629

 Score =  264 bits (674), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 192/611 (31%), Positives = 299/611 (48%), Gaps = 63/611 (10%)

Query: 2   SEITLGRYLFERLRQVECNTIFGLPGDFNLRLLDEIYE----TEGMRWXXXXXXXXXXXX 57
           +E+ LG Y+F RL      T+FG+PGDFN+ LL+ +Y      EG++W            
Sbjct: 28  AEMPLGEYMFRRLMSAGTKTVFGVPGDFNMGLLEHMYGEAVCAEGLQWIGTCNELNAAYA 87

Query: 58  XXXXXR-IKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLL---L 113
                R    + C++TT GVGELSALNG+AG++AEHV VLH+VGV   +AQ    L   +
Sbjct: 88  ADGYSRYCNKIGCVVTTLGVGELSALNGVAGAFAEHVKVLHIVGVSMRAAQTHPELHGNV 147

Query: 114 HH---TLGNGDF-----TVFHRM-SANISETTAMISDLATAPAEIDRCIRTTYVRQRPVY 164
           HH    L N +F      V+  M S  +S     + DL TA  +ID  IR  +   +P Y
Sbjct: 148 HHLVPRLRNSNFKAPNHKVYSEMVSGRVSCCCEFLEDLETACDQIDHVIREIWRHGKPGY 207

Query: 165 LGLPSNFVDQMV--------PASLLETPIDLSLKPNDAAAEQEVVSTVLDLIKNAKNPVI 216
           L +P++  +  V        P  +LE+ +   L+  + AA   +   +L  +  +  P I
Sbjct: 208 LFVPADMPNMKVSSRNLVQAPTIMLESAV---LERTNLAACDRIGIEILQHLYQSSTPAI 264

Query: 217 LADACASRHDVKAETKKLIDVTQFPSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAV 276
           L D    R  +  + ++L+++T   +F T MGK  +DE  P + GVY G   S      +
Sbjct: 265 LCDGLCDRFGLTGDVRRLVELTGMWNFSTIMGKSILDETQPHYKGVYYGA-GSKERNALL 323

Query: 277 ESSDLILSVGALLSDFNTGSFSYSYKTKN-IVEFHSDHIKI-RNA---TFPGVQMKFVLQ 331
           +  DLIL +G +  + NT  +++ +  ++ I+E H +++ + RN          +  VL+
Sbjct: 324 QECDLILYLGPVKDEVNTWKYTFQFNPQSMIIELHPEYVSLTRNGEQTILNSGHLLPVLR 383

Query: 332 KLLTQ--VGDVVKDYKPVAIPEIPGPNAAVDDSTPLKQQWLWNQVGKFLQEGDVVITETG 389
            +L    V ++  +Y P A   +P  +    D  P+ Q  L + + + L  GDV++ +TG
Sbjct: 384 SILAHLNVANLSFNY-PTAKKRVPREHQYAADE-PITQGMLQHMIPECLNPGDVMVVDTG 441

Query: 390 TSAFGINQTHFPNNTYGISQVLWGSIXXXXXXXXXXXXXXXXXDK------------NKR 437
           T  F +    FP +   ISQ  + SI                  +              R
Sbjct: 442 TFQFSVFDMKFPTDLKCISQSFYLSIGMALPAALGVACAMREFPRLHLGPKLANEGYTPR 501

Query: 438 VILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNNGYTIEKLIHGEFAQYNEIQPWNHLD 497
           ++L  GDG+ Q+T+QE+ST IR+ L   + + NN+GYT+E++I G    YN+I  W+   
Sbjct: 502 LVLCEGDGAAQMTIQELSTFIRYELPVEVLLWNNDGYTVERVIKGPTRSYNDIMSWDWTK 561

Query: 498 LLPTFGAKD---YETVRVATTGEWNKLAED----QEFNKNSKIRMIEVMLPVMDAP---E 547
           LL  FG  D    E+VRV    ++N L E     +   K SKIR++EV+L  MD     +
Sbjct: 562 LLRVFGDFDGTRSESVRVK---DFNSLIEHLSSWKSDKKRSKIRLMEVILDKMDISATLK 618

Query: 548 SLVKQAQLTAA 558
            L KQ Q  AA
Sbjct: 619 ELAKQFQHNAA 629

>TPHA0J02680 Chr10 (593893..595839) [1947 bp, 648 aa] {ON} Anc_5.456
           YDR380W
          Length = 648

 Score =  261 bits (667), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 194/627 (30%), Positives = 304/627 (48%), Gaps = 75/627 (11%)

Query: 2   SEITLGRYLFERLRQVECNTIFGLPGDFNLRLLDEIY-------ETEGMRWXXXXXXXXX 54
           + ITL  Y+F RLR     ++FG+PGDFNL LL+ +Y       E E + W         
Sbjct: 15  NSITLAEYIFRRLRSSGTYSLFGVPGDFNLPLLESLYHKTADGKEVELLNWIGCCNELNA 74

Query: 55  XXXXXXXXRIKG-MSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISA-QAKQLL 112
                   R    + CL+TTFGVGE+SALNGI G+  E+V VL++VG+P      + Q  
Sbjct: 75  AYAADGYSRYTNKIGCLVTTFGVGEISALNGIVGAAVENVKVLNIVGIPPTHILNSSQYN 134

Query: 113 LHHTLGN--------GDFTVFHRMSAN-ISETTAMI--SDLATAPA-----EIDRCIRTT 156
           +HH++ N         ++  +  M  N I+     +  SD+    +     +ID+ I+  
Sbjct: 135 IHHSIPNLKNSNSGVPNYKTYCDMVLNNITNNVEFLELSDIKNQNSNQVCNKIDQLIKNI 194

Query: 157 YVRQRPVYLGLPSNFVDQMVPASLL----ETPIDLSLKPNDA----AAEQEVVSTVLDLI 208
           ++  +P YL +PSN  + MV ++ L    +  +D +LK   +      E +++  +  L+
Sbjct: 195 FISSKPGYLFVPSNMTNMMVSSANLTLLPQINLDWALKSTRSNLSETIENDIIEEISQLL 254

Query: 209 KNAKNPVILADACASRHDVKAETKKLIDVTQFPSFVTPMGKGSIDEKHPRFGGVYVGTLS 268
             +K P IL D    R D + +  +LI      +F T +GK  IDE + RF G Y G  S
Sbjct: 255 YKSKKPCILCDVFIDRFDCRIQVNQLISKLNIWNFSTMLGKSIIDEDNDRFMGTYNGVTS 314

Query: 269 SPAVKEAVESSDLILSVGALLSDFNTGSFSYSYKTKN-IVEFHSDHIKIR------NATF 321
              VK+  ES DLIL +G   ++ NTG +S+SY     I+E   D+IKI       +   
Sbjct: 315 DSYVKDNFESCDLILHLGIETNEMNTGCYSFSYLPDAVIIEVGKDYIKISKHDGKISKII 374

Query: 322 PGVQMKFVLQKLLTQVGDVVKDYK--------PVAIPEIPGPNAAVDDSTPLKQQW---- 369
             + ++ V+QKLL  + D    Y         P    ++    +  ++     QQ     
Sbjct: 375 NDIMLRDVIQKLLHFIDDSKCTYSFDNNVESFPTYKNKLISKKSLENNVESKAQQTVTQD 434

Query: 370 -LWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIXXXXXXXX----- 423
            L  ++     +GDVV+ ETG+  F I    FP  T  I+Q  + SI             
Sbjct: 435 DLQVEIQTLFDKGDVVVVETGSFQFAIPDMIFPKETKLINQGFYLSIGMALPASLGVGIG 494

Query: 424 XXXXXXXXXDKN------KRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNNGYTIE 477
                    + N      K++ILF GDG+ Q+T+QE+S+++R+ +   +F+ NNNGYT+E
Sbjct: 495 MRDYPNCHINDNSEDATPKKLILFEGDGAAQMTIQELSSLLRYRIPIDIFIWNNNGYTVE 554

Query: 478 KLIHGEFAQYNEIQPWNHLDLLPTFGAKDYE-----TVRVATTGEWN-KLAEDQEFNKNS 531
           ++  GE   YN+I PW  ++LL  FG  D+E     +  ++T  E   K+ E +  N   
Sbjct: 555 RIFEGEKRSYNDIMPWKWVNLLKVFG--DHEKTFSKSTTISTVQELRCKIDELKNANPQK 612

Query: 532 KIRMIEVMLPVMDAPESL---VKQAQL 555
            I +IEV L  MD P++L   V+Q +L
Sbjct: 613 IIELIEVKLGEMDIPKNLKHIVEQMKL 639

>Smik_4.649 Chr4 (1154670..1156577) [1908 bp, 635 aa] {ON} YDR380W
           (REAL)
          Length = 635

 Score =  260 bits (665), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 193/617 (31%), Positives = 297/617 (48%), Gaps = 59/617 (9%)

Query: 1   MSEITLGRYLFERLRQVECNTIFGLPGDFNLRLLDEIY----ETEGMRWXXXXXXXXXXX 56
           ++ I  G Y+F RL  +   ++FG+PGDFNL LL+ +Y    E+ G+RW           
Sbjct: 22  LATIPFGEYIFRRLLSIGTKSVFGVPGDFNLSLLEYLYSPNVESAGLRWVGTCNELNAAY 81

Query: 57  XXXXXXRIKG-MSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVP----SISAQAKQL 111
                 R    + CLITT+GVGELSALNGIAGS+AE+V VLH+VGV     S S   K+ 
Sbjct: 82  AADGYSRYSNKIGCLITTYGVGELSALNGIAGSFAENVKVLHIVGVAKSIDSRSNNFKER 141

Query: 112 LLHH---TLGNGDFT-----VFHRMSAN-ISETTAMISDLATAPAEIDRCIRTTYVRQRP 162
            LHH    + N +F      V+H M  + ++ + A + D+ TA  ++D  IR  +   +P
Sbjct: 142 NLHHLVPQVHNSNFKGPNHKVYHDMVKDRVACSVAYLEDIETACVQVDNVIRDIFKYSKP 201

Query: 163 VYLGLPSNFVDQMVPA-SLLETP----IDLSLKPNDAAAEQEVVSTVLDLIKNAKNPVIL 217
            Y+ +P++F D  V A +L++ P     D    P +     +++  +   + ++K P IL
Sbjct: 202 GYIFVPADFADMSVAADNLVKVPHISQQDCITYPPEVQL-LDIIDKITSWMYSSKTPAIL 260

Query: 218 ADACASRHDVKAETKKLIDVTQFPSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVE 277
            D    R+ V     +LI  T+  +F T MGK  IDE +P + G Y G      V +  E
Sbjct: 261 GDVLTDRYGVSNILNELIYTTKIWNFSTVMGKSVIDESNPTYMGQYNGKEGLKQVYKHFE 320

Query: 278 SSDLILSVGALLSDFNTGSFSYSYK-TKNIVEFHSDHIKIRNAT------FPGVQMKFVL 330
           S DL+L  G  +++ N G ++++YK    I++FH ++I+  +        F GV    VL
Sbjct: 321 SCDLVLHFGVDINEINNGHYTFTYKPNAKIIQFHPEYIRFVDTKYGDEQMFEGVNFVPVL 380

Query: 331 QKL--LTQVGDVVKDYKPVAIPEIPGPNAAVDD-----STPLKQQWLWNQVGKFLQEGDV 383
           ++L  L  V  +   Y    +         ++D     S+ + Q  L   +  FL  GDV
Sbjct: 381 KELYKLIDVARLSLQYDS-NVTSYTNETMQIEDLTDDQSSIITQAHLQKVMPGFLNPGDV 439

Query: 384 VITETGTSAFGINQTHFPNNTYGISQVLWGSI------------XXXXXXXXXXXXXXXX 431
           V+ ETG+  F +    FP     ISQ  + SI                            
Sbjct: 440 VVCETGSFQFSVRDFAFPTQLKYISQGFFLSIGMALPAALGVGIAMQDYSNAHINGSNVK 499

Query: 432 XDKNKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNNGYTIEKLIHGEFAQYNEIQ 491
            D   R+ILF GDG+ Q+T+QE+ST+++  +   + + NNNGYTIE+ I G    YN+I 
Sbjct: 500 EDYKPRLILFEGDGAAQMTIQELSTILKCNVPLEIIIWNNNGYTIERAIMGPTRSYNDIM 559

Query: 492 PWNHLDLLPTFGAKDYETVRVATT------GEWNKLAEDQEFNKNSKIRMIEVMLPVMDA 545
            W    L   FG  D++    ++T          KL E +   + ++I ++EV L V+D 
Sbjct: 560 SWKWTKLFEAFG--DFDGKHTSSTLIEFPSKLALKLKELKNSARRNQIELLEVKLGVLDF 617

Query: 546 PESLVKQAQLTAATNAK 562
           PE L    +  A    K
Sbjct: 618 PEQLKCMVEAAALKRNK 634

>TBLA0A02670 Chr1 complement(648495..650417) [1923 bp, 640 aa] {ON}
           Anc_5.456 YDR380W
          Length = 640

 Score =  260 bits (665), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 198/622 (31%), Positives = 302/622 (48%), Gaps = 93/622 (14%)

Query: 4   ITLGRYLFERLRQVECNTIFGLPGDFNLRLLDEIY---------ETEGMRWXXXXXXXXX 54
           IT G Y+F+RL  +   ++FG+PGDFNL LL+ +Y         E   +RW         
Sbjct: 23  ITFGHYIFQRLLSLGTKSVFGVPGDFNLPLLEYLYDDFQSPDTKEKTSIRWVGGCNELNS 82

Query: 55  XXXXXXXXRIKG-MSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSI----SAQAK 109
                   R    +SCLITTFGVGELSA+NG++GS+AE++ VLH+VGVPS     S   K
Sbjct: 83  AYSADGYSRYTNKISCLITTFGVGELSAINGVSGSFAENIKVLHIVGVPSTKITESPVQK 142

Query: 110 QLLLHHTLGNGD--------FTVFHRMSAN-ISETTAMISDLATAPAEIDRCIRTTYVRQ 160
              LHH + + D          V+H M  + IS +T ++SD+  A   +D+ I   Y   
Sbjct: 143 NWNLHHLVPSMDCPNFNPPNHNVYHDMIKDKISCSTHILSDITKAADMVDQVILDIYKYS 202

Query: 161 RPVYLGLPSNFVDQMVPA-SLLETP---IDLSLKPNDAAAE------QEVVSTVLDLIKN 210
           RP YL +PSNF D +V   +L++ P   +D +L  N   +       +++   +L ++  
Sbjct: 203 RPGYLFVPSNFPDMLVSTKNLIDRPTITMDDALALNSIDSNFSLSHMKDLTRRILKILYK 262

Query: 211 AKNPVILADACASRHDVKAETKKLIDVTQFPSFVTPMGKGSIDEKHPRFGGVYVGTLSSP 270
           ++ P ++ D    R+  K    + I+ T+  +FVTP+ K +IDE +  + G+Y G  S+ 
Sbjct: 263 SETPAVVCDMLVDRYGGKKLINEFINRTKIRNFVTPLSKSTIDETNENYVGLYNGKQSNA 322

Query: 271 AVKEAVESSDLILSVGALLSDFNTGSFSYSYKTK-----------NIVEFHSDHIKIRNA 319
            V E  E+SDL+L  G   ++ NTG +S+SY               +VE+ + H      
Sbjct: 323 KVIEHFENSDLVLHYGVFSNEVNTGVYSHSYGPNTTLIQLNPTYLRVVEYENGHHS--EL 380

Query: 320 TFPGVQMKFVLQKLLTQVGDVVK---DYKPVAIPEIPGPNAAVDDSTPLKQQWLWNQVGK 376
            +  V    +L++LL  + D+ K    Y+P+A              T +KQ+ + N  GK
Sbjct: 381 IYRDVNFLHILKQLLKDI-DLSKLNFKYQPLA--------------TRVKQETIENSDGK 425

Query: 377 FLQE------------GDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIXXX------ 418
             Q             GD+++ +TG   F I    F +    I+Q  + SI         
Sbjct: 426 ITQASLGQAFPSTFNPGDILVADTGAFQFSIRDFVFHSQMKYITQGFYLSIGMALPCALG 485

Query: 419 XXXXXXXXXXXXXXDKNK-------RVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNN 471
                         DK+K       R+IL  GDG+ Q+TVQE+STMIR  +   +++ NN
Sbjct: 486 VGVAMQDYPLEHVYDKSKLPKNYTPRLILCEGDGAAQMTVQELSTMIREKISIEIYLWNN 545

Query: 472 NGYTIEKLIHGEFAQYNEIQPWNHLDLLPTFG---AKDYETVRVATTGEW-NKLAEDQEF 527
           +GYTIE+ I G    YN+I  WN   LL +FG    K   +V + T  +   KL + +E 
Sbjct: 546 DGYTIERAIMGPTRSYNDIAAWNWTTLLNSFGDINGKLTNSVTIETQSDLVAKLKDLKEG 605

Query: 528 NKNSKIRMIEVMLPVMDAPESL 549
           + N  I  +EVML  +D P  L
Sbjct: 606 DNNKCIEFMEVMLGKVDYPPQL 627

>TDEL0D02450 Chr4 complement(477063..479090) [2028 bp, 675 aa] {ON}
           Anc_5.456 YDR380W
          Length = 675

 Score =  259 bits (663), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 192/613 (31%), Positives = 299/613 (48%), Gaps = 68/613 (11%)

Query: 2   SEITLGRYLFERLRQVECNTIFGLPGDFNLRLLDEIYET-------EGMRWXXXXXXXXX 54
           ++I  G Y+F+RL  V   +IFG+PGD+N+RLL+ +Y+        + + W         
Sbjct: 60  AQIPFGLYVFKRLLSVGVKSIFGVPGDYNMRLLEHMYDESLVDTAGDKLEWVGCCNELNA 119

Query: 55  XXXXXXXXRIKG-MSCLITTFGVGELSALNGIAGSYAEHVGVLHVVG-----VPSISAQA 108
                   R    + C+ITT+GVGEL A++G+AG++AE V VLH+VG     V  +  + 
Sbjct: 120 AYAADGYSRYSNEIGCVITTYGVGELGAISGLAGAFAESVKVLHIVGIVDYEVNDLGPEM 179

Query: 109 KQLLLHHTLGN--------GDFTVFHRMSAN-ISETTAMISDLATAPAEIDRCIRTTYVR 159
           +   LHH L           D+ V+  M  + ++ +   + DL TA  ++D+ I   Y  
Sbjct: 180 RSHNLHHLLPRLNDSNFVGPDYRVYAEMVKDKVACSVEYLDDLETACDKVDKVIEDIYKY 239

Query: 160 QRPVYLGLPSNFVDQMVPA-SLLETPIDLSLK------PNDAAAEQEVVSTVLDLIKNAK 212
            +P YL +P +FVD++V   +L+E P  ++L+      P D A  + V   +L L+  + 
Sbjct: 240 SKPGYLFVPRSFVDELVSTKNLIEKPT-ITLRECIEKSPVDEA--KIVTEKILRLLNQSA 296

Query: 213 NPVILADACASRHDVKAETKKLIDVTQFPSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAV 272
           +P ++ D    R+ ++ E    I+      F T  GK  IDE  P + G Y G  S+P V
Sbjct: 297 SPAVIGDMFTDRYGLRVELNDFINKANIVGFSTVQGKSIIDESSPLYMGAYNGMTSAPTV 356

Query: 273 KEAVESSDLILSVGALLSDFNTGSFSYSYKTK-NIVEFHSDHIKIRNAT------FPGVQ 325
            E + + DL+L  G   ++ N G++++ +K+   IVE H  +I+  + T      + GV 
Sbjct: 357 SEKLLACDLVLHFGIEKNEVNYGNYNFPHKSDAKIVELHPQYIRFYDNTTKKEEIYKGVS 416

Query: 326 MKFVLQKLLTQVGDVVK-------DYKPVAIPE--IPGPNAAVDDSTPLKQQWLWNQVGK 376
              +L  LL Q  ++ +        +K   I E  +   +   D+++ + Q  L   +  
Sbjct: 417 FVDILD-LLNQSPELSELSFQYNSKFKAYTIEELNLDERDFGNDETSDITQGTLQKSMPN 475

Query: 377 FLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIXXXXXXXXXXXXXXXXX---- 432
           +L  GDV+I++TGT  F I     P+    I+Q  + SI                     
Sbjct: 476 YLNPGDVLISDTGTFQFAIRDFSLPSQVKYITQGFYLSIGMALPAALGVGIAMRDYPMHH 535

Query: 433 --DKNK-------RVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNNGYTIEKLIHGE 483
             D  K       +VILF GDG+ Q+TVQE+STMIR  +   +F+ NNNGYTIE++I G 
Sbjct: 536 VWDVEKIPFGYEPKVILFEGDGAAQMTVQELSTMIRHQVPIEIFLWNNNGYTIERVIEGP 595

Query: 484 FAQYNEIQPWNHLDLLPTFGAKDYETVRVATTGEW-----NKLAEDQEFNKNSKIRMIEV 538
              YN+IQPW    LL  FG  D +  R AT  E      NKL+E +  +    I  +EV
Sbjct: 596 TRPYNDIQPWKWTKLLEAFGDFDGKHSR-ATVLETRSQLENKLSELKYKDHRRGIDFMEV 654

Query: 539 MLPVMDAPESLVK 551
            L  MD P  L K
Sbjct: 655 KLATMDVPSQLQK 667

>KLLA0E02707g Chr5 (251220..253115) [1896 bp, 631 aa] {ON} similar
           to uniprot|Q06408 Saccharomyces cerevisiae YDR380W ARO10
           Phenylpyruvate decarboxylase catalyzes decarboxylation
           of phenylpyruvate to phenylacetaldehyde which is the
           first specific step in the Ehrlich pathway
          Length = 631

 Score =  251 bits (641), Expect = 8e-75,   Method: Compositional matrix adjust.
 Identities = 180/598 (30%), Positives = 295/598 (49%), Gaps = 54/598 (9%)

Query: 1   MSEITLGRYLFERLRQVECNTIFGLPGDFNLRLLDEIYETE----GMRWXXXXXXXXXXX 56
           +  I  G Y+FERL      +IFG+PGDFNL LL+ +Y+ +    G++W           
Sbjct: 29  VKNIPFGHYVFERLLNSGAKSIFGVPGDFNLPLLEYLYDEDLVANGLQWIGTCNELNGAY 88

Query: 57  XXXXXXRIKG-MSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGV-PSISAQAKQLL-- 112
                 R    + C+ITT+GVGELSALNG+AG++AE V VLH++GV PS   + +Q    
Sbjct: 89  AADGYSRYTNKLGCVITTYGVGELSALNGVAGAFAEDVKVLHIIGVSPSRFRENEQFRSH 148

Query: 113 -LHHTLGNGDF-------TVFHRMSANISETTAMISDLATAPAEIDRCIRTTYVRQRPVY 164
            +HH +   D          F  +   +  ++A + D+ TA   +D+ I       +P Y
Sbjct: 149 NVHHLVPAIDSQQPPNHQVYFDMVKDRVCCSSAFLDDINTAADRLDQVIVDICKNSKPGY 208

Query: 165 LGLPSNFVDQMVP-ASLLETPI---DLSLKP-NDAAAEQEVVSTVLDLIKNAKNPVILAD 219
           + +P +F D++V   +L++ PI   D  ++   D  A +     +L  I  +  P + +D
Sbjct: 209 VFIPVDFADKLVSNKNLIQNPIIDMDTVIESYKDENATKIAGDRLLQWIYESNAPSVFSD 268

Query: 220 ACASRHDVKAETKKLIDVTQFPSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESS 279
               R +++ E ++ I+     ++ T MGK ++DE++P++ G+Y G  +   ++  V+SS
Sbjct: 269 LLVDRFNLRKELRQFIETADVWNYNTAMGKSTLDERNPKYLGLYKGAETGKEMQATVDSS 328

Query: 280 DLILSVGALLSDFNTGSFSYSYK--------TKNIVEFHSDHIKIRNATFPGVQMKFVLQ 331
           DLIL  G   ++ N G +S+ +         + NI++F    IK +NA+    +  FV  
Sbjct: 329 DLILHFGPAKNEINCGYYSFHFNENARIIELSNNIIQFID--IKDKNAS-TVEEANFV-- 383

Query: 332 KLLTQVGDVVKDYK-PVAIPEIPGPNAAV--DDSTPLKQQWLWNQVGKFLQEGDVVITET 388
            +L  V D +   K   + P +P  N +   D++  + Q+ L   +  +  +GDV+I ET
Sbjct: 384 SVLKYVNDNLDKSKLSFSYPPVPKSNHSCEYDNNDSITQKSLKEIIPNYFNDGDVLIVET 443

Query: 389 GTSAFGINQTHFPNNTYGISQVLWGSI-------------XXXXXXXXXXXXXXXXXDKN 435
           G+  FG+    F      I+Q  + SI                              D  
Sbjct: 444 GSFQFGVPNMQFAREMKYITQSFYLSIGMALPAALGVGCGMRDYPRSHIVDQALVPKDYI 503

Query: 436 KRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNNGYTIEKLIHGEFAQYNEIQPWNH 495
            R+IL  GDG+ Q+T+QE ++ IR+ +   + V NNNGYT+E+ I+G    YN+I P+  
Sbjct: 504 PRLILCEGDGAAQMTIQEFASYIRYKIPMEILVWNNNGYTVERAINGPTRSYNDIAPFKW 563

Query: 496 LDLLPTFG---AKDYETVRVATTGEWNKLAED-QEFNKNSKIRMIEVMLPVMDAPESL 549
             LL  FG    K  E+V V    E  +L    +   + + I++ EVMLPVMD P+ L
Sbjct: 564 TALLNVFGDFENKFNESVTVEKNDELVQLLNKWKSCKERANIKLAEVMLPVMDIPQEL 621

>TBLA0A06420 Chr1 complement(1577160..1579076) [1917 bp, 638 aa]
           {ON} Anc_5.456 YDR380W
          Length = 638

 Score =  250 bits (639), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 173/613 (28%), Positives = 296/613 (48%), Gaps = 72/613 (11%)

Query: 4   ITLGRYLFERLRQVECNTIFGLPGDFNLRLLDEIY----ETEGMRWXXXXXXXXXXXXXX 59
           + LG YL+ +L Q+   TIFG+PGDFNL LL+ +Y    +  G++W              
Sbjct: 26  LPLGEYLYLKLAQIGTKTIFGVPGDFNLSLLELLYTQKVKDSGLKWVGCCNELNAAYAAD 85

Query: 60  XXXRIKG-MSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLG 118
              R    + C++TT+GVGELSALNGIAG++AE++ +LHVVGVP          +HH + 
Sbjct: 86  GYSRYTNRVGCVVTTYGVGELSALNGIAGAFAENIKLLHVVGVPPTKYNTLNHNIHHLVP 145

Query: 119 NGDFT--------VFHRM-SANISETTAMISDLATAPAEIDRCIRTTYVRQRPVYLGLPS 169
              ++        V+  M +  +    A I+DL  A  +I+  I+  +    P Y+ +P+
Sbjct: 146 RLKYSNLLAPNKEVYMEMVNEKVCCFYANITDLNQARWQIEIAIKHIFQYNLPAYIFIPT 205

Query: 170 NFVDQMVPASL-----------LETPIDLSLKPNDAAAEQEVVSTVLDLIKNAKNPVILA 218
           +F D ++P S+           +E  +++ L P+       V   +L L+ ++K P I+ 
Sbjct: 206 DFQDALIPISVNEHLSREDIMPIEEIVEIPLLPSLEMVS--VCDYILSLLYSSKTPCIIG 263

Query: 219 DACASRHDVKAETKKLIDVTQFPSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVES 278
           D    R  V  +   LI  T+  +F T M KG ++E +P + GVY G LS   + + ++ 
Sbjct: 264 DILVERFGVTKQINDLIHKTKLWNFSTFMSKGVLNESNPYYQGVYFGKLSQDHIVKKIQM 323

Query: 279 SDLILSVGALLSDFNTGSFSYSYKTKNI-VEFHSDHIKIRN------ATFPGVQMKFVLQ 331
            DLI+  G + ++ NTG +S++YK  ++ ++ H D+++I          + G++ +    
Sbjct: 324 CDLIIHFGVVENEINTGYYSFNYKPDSVLIQIHPDYVRITQFQHNIRTDYKGIEFR---- 379

Query: 332 KLLTQVGDVVKDYKPVAIPEI------PGPNAAV-----DDSTPLKQQWLWNQVGKFLQE 380
              T V  V K  +P +I         P  +A +     ++  P+   +L   + +++  
Sbjct: 380 ---TFVDMVTKGVQPNSINTTYNRLFSPSSHAYLFPLEQEEDGPISHDYLETIIPRYINP 436

Query: 381 GDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIXXX----------------XXXXXX 424
           GDVV+ ETG+  F +  T   ++   I+Q  + SI                         
Sbjct: 437 GDVVVCETGSIQFTMVNTRLSSDVEYITQGFYLSIGMAIPASLGIGMAMRDYPNLHLSKK 496

Query: 425 XXXXXXXXDKNKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNNGYTIEKLIHGEF 484
                   +   R+IL  GDG+ Q+TVQEI+ +I++ +   + +LNN GYTIE+ I G  
Sbjct: 497 SSHSNVPPNYKPRLILLEGDGAAQMTVQEITNIIKYKIPIEILLLNNQGYTIERAIKGAD 556

Query: 485 AQYNEIQPWNHLDLLPTFGAKDYETVR----VATTGEWNKLAEDQEFNKNSKIRMIEVML 540
            ++N+I  WN   LL   G    ET       +TT  + KL + +++        +EV+L
Sbjct: 557 KEFNDICEWNWPQLLNGLGGNLDETKNKYKFFSTTELYEKLKQLKDYPGKETFSFVEVIL 616

Query: 541 PVMDAPESLVKQA 553
             ++ P +L+K A
Sbjct: 617 NKLNIPTTLIKMA 629

>TPHA0E01600 Chr5 complement(325811..327766) [1956 bp, 651 aa] {ON}
           Anc_5.456 YDR380W
          Length = 651

 Score =  241 bits (614), Expect = 9e-71,   Method: Compositional matrix adjust.
 Identities = 180/600 (30%), Positives = 289/600 (48%), Gaps = 54/600 (9%)

Query: 2   SEITLGRYLFERLRQVECNTIFGLPGDFNLRLLDEIYETEG------MRWXXXXXXXXXX 55
           + I  G+Y+F RL+     ++FG+PGD+NL LL+++Y+ E       ++W          
Sbjct: 36  NRIPFGKYIFRRLQSCGTKSVFGVPGDYNLNLLEQMYDEEDSITPNEIQWIGCCNELNAA 95

Query: 56  XXXXXXXRIKG-MSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLH 114
                  R    + CLITT+GVGELSA+NGIAG++ E+V +LH+VGV S          H
Sbjct: 96  YAADGYSRYTNKIGCLITTYGVGELSAINGIAGAFTENVKLLHIVGVVSQDKMKSGRNFH 155

Query: 115 HTLGNGD--------FTVFHRMSAN-ISETTAMISDLATAPAEIDRCIRTTYVRQRPVYL 165
           H + N +        + +   M  N IS +T  + ++ATA  + D  +R  +   +P +L
Sbjct: 156 HLIPNKENANLQAPNYQICKDMIDNKISCSTKFLDNIATACDDFDDLLRDIFKNSKPGFL 215

Query: 166 GLPSNFVDQMVP-ASLLETP---IDLSLKPNDAAAE--QEVVSTVLDLIKNAKNPVILAD 219
            +P  F + MV  A+L   P   ++ S+ P+  + +    +     DLI  +K P I+ D
Sbjct: 216 FIPEEFSNLMVSDANLFLVPKITLEDSIIPSPISYDSIDRLTQITKDLIYQSKRPAIIGD 275

Query: 220 ACASRHDVKAETKKLIDVTQFPSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESS 279
               R        +LI  T   +F T MGK  I+E +  + G++ G      V + +   
Sbjct: 276 ILVDRFGGTTILNELIQNTGIWNFSTIMGKSIINEANENYIGLFSGDDGKQEVNDKIRQC 335

Query: 280 DLILSVGALLSDFNTGSFS---YSYKTKNIVEFHSDHIKIRNATFPGV----QMKFV-LQ 331
           DLIL  G   ++ N+G ++   Y  K   I+EFHS++IKI++ +   V     + F+ + 
Sbjct: 336 DLILHFGIDTNEVNSGVYTLENYYPKNAKIIEFHSNYIKIKDNSTSRVDLYKNLNFIHVL 395

Query: 332 KLLTQVGDVVK---DYKPVAIPEIPGPNAAVDDSTP-LKQQWLWNQVGKFLQEGDVVITE 387
           K L ++ D  K   DY P     I    +  + S   + Q ++ + + K L  GD+++ +
Sbjct: 396 KRLNKILDTSKLLFDY-PYISKNIQTECSDDEKSNKVITQDYIKDAILKLLNPGDILLCD 454

Query: 388 TGTSAFGINQTHFPNNTYGISQVLWGSIXXXXXXXX------------XXXXXXXXXDKN 435
           TGT  F +     P     ISQ  + SI                                
Sbjct: 455 TGTFQFSVRDYQLPPQVKYISQSFYLSIGMALPASLGVGIGMKDYPNIHIKPDDSIIKTQ 514

Query: 436 KRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNNGYTIEKLIHGEFAQYNEIQPWNH 495
            ++IL  GDG+ Q+T+QEIST+IR+ +   +F+ NN+GYTIE+ I G    YN+IQPWN 
Sbjct: 515 PKLILCEGDGAAQMTIQEISTLIRYKIPISIFLWNNDGYTIERAIRGPTRDYNDIQPWNW 574

Query: 496 LDLLPTF--GAKDY-ETVRVATTGEWNKL---AEDQEFNKNSKIRMIEVMLPVMDAPESL 549
             L+ +F    K + +T +V    E+  L    +   FN++S +  IEV L  +D P  L
Sbjct: 575 TMLIKSFETNIKSFIKTYKVTEQQEFKNLLTKIKQNNFNEDS-LNFIEVQLGRLDVPHIL 633

>SAKL0D00220g Chr4 complement(18466..20199) [1734 bp, 577 aa] {ON}
           uniprot|Q6XAE8 Saccharomyces kluyveri Pyruvate
           decarboxylase-like protein
          Length = 577

 Score =  237 bits (605), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 176/582 (30%), Positives = 278/582 (47%), Gaps = 51/582 (8%)

Query: 1   MSEITLGRYLFERLRQVECNTIFGLPGDFNLRLLDEIY--ETEGMRWXXXXXXXXXXXXX 58
           MS + LG YLF RL QV   T+FG+PGDFNL LL+ +Y  +   ++W             
Sbjct: 1   MSTMQLGTYLFYRLSQV-TKTVFGVPGDFNLNLLEHVYNFDESQIKWCGNANELNAGYAA 59

Query: 59  XXXXRIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLL---HH 115
               RI    C ITT+GVGELSALN ++G++AE+  VLH+VG  S+ A+     L   HH
Sbjct: 60  DGYSRINKFGCFITTYGVGELSALNAVSGAFAENAPVLHIVGTSSMLAKRGACPLNQIHH 119

Query: 116 ------TLGNGDFTVFHRMSANISETTAMISD--LATAPAEIDRCIRTTYVRQRPVYLGL 167
                 T    D  V+ +++   S  T  +SD  L     +ID  I + +   +P YL +
Sbjct: 120 LIPPKKTYEAPDHKVYEKLAEPFSIHTESLSDENLEKIQDQIDSVIESIFCHMKPGYLFI 179

Query: 168 PSNFVDQMVPASLLETPIDLSLKPN---------DAAAEQEVVSTVLDLIKNAKNPVILA 218
           PSN  D        E P+DL+ + N         D  A  E+VS  L  I +++NP  + 
Sbjct: 180 PSNLPDA-------EIPVDLNKQLNFDFITKLRVDPHATSEMVSLTLKRIYSSRNPGFIV 232

Query: 219 DACASRHDVKAETKKLIDVTQFPSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVES 278
           D    R D++ +    ++   F  + T   +G  DE  P F GV+   LS+    E ++ 
Sbjct: 233 DQFM-RFDLE-KLNLFLEKFNFYCYNTTTARGFADESLPNFHGVFNNELSTNGTLEILDQ 290

Query: 279 SDLILSVGALLSDFNTGSF----SYSYKTKNIVEFHSDHIKI--RNATFPGVQMKFVLQK 332
           +D IL +G   ++ N  S+    S     K+++    D+ ++        G+      ++
Sbjct: 291 NDFILHLG---TNINEVSYFVGGSTPLDKKDVIFIGKDYAQVGTNGHIITGINCHVFFEE 347

Query: 333 LLTQVGDV----VKDYKPVAIPEIPGPNAAVDDSTPLKQQWLWNQVGKFLQEGDVVITET 388
           LL ++       VK  K  A+          DDS  + Q  L   V   L+E DV+I E 
Sbjct: 348 LLQRMNSKTMPKVKTRKSTALYN--NGYTVDDDSKTVTQANLSQVVSAQLRENDVIINEM 405

Query: 389 GTSAFGINQTHFPNNTYGISQVLWGSIXXXXXXXXXXXXXXXXXDKNKRVILFIGDGSLQ 448
            +  F +    +      + Q  +GSI                  K+ RVILF GDGS Q
Sbjct: 406 CSFMFEMPNIKYSKGCQFVGQPFYGSIGYALPATLGASLAIKDYKKSGRVILFQGDGSAQ 465

Query: 449 LTVQEISTMIRWGLKPYLFVLNNNGYTIEKLIHGEFAQYNE-IQPWNHLDLLPTFGAKDY 507
           +T+QE+++ IR+ + P +F+LNN+GY++E++I G    YN+ I  W+  ++L  FG ++ 
Sbjct: 466 MTLQELASYIRFEIDPIIFMLNNSGYSVERVIKGPTRSYNDIIVDWDWCNILSVFGDRNG 525

Query: 508 E---TVRVATTGEWNKLAEDQEFNKNSKIRMIEVMLPVMDAP 546
           +   + +V   GE   +   +    + KI+M+E++L  MD P
Sbjct: 526 DRSTSYKVEKLGELKNVLTKRLDYSDGKIKMVEIILDRMDVP 567

>NDAI0A04450 Chr1 complement(1006559..1008244) [1686 bp, 561 aa]
           {ON} Anc_5.456
          Length = 561

 Score =  226 bits (576), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 169/549 (30%), Positives = 264/549 (48%), Gaps = 54/549 (9%)

Query: 67  MSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVP----SISAQAKQLLLHH---TLGN 119
           + CLITT+GVGELSALNGIAG+++E+V VLH+VGV     S S       LHH    L +
Sbjct: 13  IGCLITTYGVGELSALNGIAGAFSENVKVLHIVGVARSVHSRSQDYNNQNLHHLVPRLHD 72

Query: 120 GDFT-----VFHRMSAN-ISETTAMISDLATAPAEIDRCIRTTYVRQRPVYLGLPSNFVD 173
            +F      V+  M  + ++ +   + D+ TA  E+D+ I   Y   +P Y+ +P +F D
Sbjct: 73  SNFVGPNHKVYLEMIKDRVACSVTYLEDINTACDEVDKVIMDIYRYSKPGYVFVPVDFSD 132

Query: 174 QMV-PASLLETPIDLSLKPNDAAAEQ----EVVSTVLDLIKNAKNPVILADACASRHDVK 228
            +V P++L + P +++L+   + A      E+V  VL  I  +K P I+ D    R    
Sbjct: 133 MLVDPSNLFKRP-EITLENCVSYAPSPVVDELVRMVLQYIYESKCPSIIGDVLCDRFGAS 191

Query: 229 AETKKLIDVTQFPSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESSDLILSVGAL 288
           +    LI +T   +F T MGK  IDE +  + G+Y G  S   V E    SDL+L  G  
Sbjct: 192 SMVNNLIQLTSMWNFATVMGKSIIDESNVMYMGLYNGNESIETVTERFLQSDLVLHFGIQ 251

Query: 289 LSDFNTGSFSYSYKTK-NIVEFHSDHIKIRNAT------FPGVQMKFVLQKLLTQVG--- 338
           + + N G ++ +YK    ++EFHS++I+  +A+      F GV    VL++L+  +    
Sbjct: 252 VHEINNGHYTINYKEDAKVIEFHSEYIRFFDASTGNEKVFKGVNFVQVLERLIQTINVNK 311

Query: 339 ---DVVKDYKPVAIPEIPGPNAAVDDSTPLKQQWLWNQVGKFLQEGDVVITETGTSAFGI 395
              +   + +  A  E+  P     + T + Q +L   V  +L  GDV++ ETG+  F I
Sbjct: 312 LNFEYPSNIEKFATDEVNLPTEPT-EITKVTQNYLQKSVPHYLNPGDVLVCETGSFQFAI 370

Query: 396 NQTHFPNNTYGISQVLWGSIXXXXXXXXXXXXXXXXX-----------------DKNKRV 438
                P+    I+Q  + SI                                  D   R+
Sbjct: 371 RDFVLPSQLKYITQGFFLSIGMALPAAFGVGIAMQDYPRCHISKDHPSHVEIPDDYEPRL 430

Query: 439 ILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNNGYTIEKLIHGEFAQYNEIQPWNHLDL 498
           IL  GDG+ Q+T+QE+++M+R+ +   + +LNNNGYTIE+ I G    YN++  W+   L
Sbjct: 431 ILIEGDGAAQMTIQELTSMVRFQVPIEIMILNNNGYTIERAIRGPTRSYNDVMSWDWTKL 490

Query: 499 LPTFGAKDYETVRVATTGEWNKLAEDQEFNKN----SKIRMIEVMLPVMDAPESLVKQAQ 554
           L  FG    +    A     +KLA   +  KN    + I ++E+ L  MD P+ L     
Sbjct: 491 LEAFGDFKKQRTVSAKIETRSKLAMKLKQLKNKGKLNLIELVEIKLDTMDFPKQLQSMVD 550

Query: 555 LTAATNAKS 563
             A T   S
Sbjct: 551 AAAFTRKCS 559

>KLTH0D00418g Chr4 complement(37778..39463) [1686 bp, 561 aa] {ON}
           similar to uniprot|P16467 Saccharomyces cerevisiae
           YLR134W PDC5 Minor isoform of pyruvate decarboxylase
          Length = 561

 Score =  216 bits (549), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 149/564 (26%), Positives = 253/564 (44%), Gaps = 17/564 (3%)

Query: 5   TLGRYLFERLRQVECNTIFGLPGDFNLRLLDEIYETEGMRWXXXXXXXXXXXXXXXXXRI 64
           T+G YL  RL Q      F +PGD+NL LLD++ E   +                   R 
Sbjct: 3   TVGNYLATRLVQAGIKNHFTVPGDYNLVLLDKLQEHPELEEVNCCNELNCSFAAEGYART 62

Query: 65  KGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNGDFTV 124
           KG++ ++ TF VG  SA NGI  +Y E++ V+ + G P+ +  +   LLHHT+G  ++  
Sbjct: 63  KGIAAVVVTFSVGAFSAFNGIGSAYGENLPVILISGSPNTNDSSDHRLLHHTIGTHNYDY 122

Query: 125 FHRMSANISETTAMISDLATAPAEIDRCIRTTYVRQRPVYLGLPSNFVDQMV-PASLLET 183
            + M+  I+     I     AP+ ID  IR    +++P Y+ +P+N    +  P   + +
Sbjct: 123 QYEMAKQITCAAVQIKYPEDAPSLIDYAIRECLAKKKPCYIEVPTNMASAICAPPGPISS 182

Query: 184 PIDLSLKPNDAAAEQEVVSTVLDLIKNAKNPVILADACASRHDVKAETKKLIDVTQFPSF 243
            ++    P D  +  + V+  +D I +   P +LA       D +    +L +  +    
Sbjct: 183 LVNSVPTPKDVLS--QAVNASVDFINSHLKPTLLAGPKLKCADAQKAFLRLAEALKCAVA 240

Query: 244 VTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESSDLILSVGALLSDFNTGSFSYSYKT 303
           V P  K    E HP+F GVY G +S+      +E SDL +  G + +D++T  ++    +
Sbjct: 241 VQPAAKSMFPEDHPQFAGVYWGQVSTKKADAILEWSDLTICAGCIFTDYSTTGWTALQPS 300

Query: 304 KNIVEFHSDHIKIRNATFPGVQMKFVLQKLLTQVGDVVK---DYKPVAIPEIPGPNAAVD 360
            + +E  +D+++    +F  + +   L  L  +V +  K   +Y    + + P    A D
Sbjct: 301 SHRLEADADNVRFPGHSFDQIGLANFLNVLAERVSENDKSLIEYN--RLRQSPPLIKAAD 358

Query: 361 DSTPLKQQWLWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIXXXXX 420
               + ++ +  Q+ + +     +  ETG S F   Q   P       ++ WG I     
Sbjct: 359 PKAAITRKEMARQIQQLITPKTTLFAETGDSWFNGVQMDLPKGALFEVEMQWGHIGWSVP 418

Query: 421 XXXXXXXXXXXXDKNKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNNGYTIEKLI 480
                         ++R+I  +GDGS Q+T QE+S M+R      +F++NN GYTIE  I
Sbjct: 419 ASLGYAVGA----PDRRIITMVGDGSFQMTAQEVSLMVRLRKPIIIFLINNYGYTIEVEI 474

Query: 481 HGEFAQYNEIQPWNHLDLLPTFGAKD--YETVRVATTGEWNKLAEDQEFNKNSKIRMIEV 538
           H     YN I+ WN+  L+  F A +   +  +  T GE     E  + N  S   +IE+
Sbjct: 475 HD--GPYNNIKNWNYAALMEVFNANEGSGKGFKARTGGELADAIEKAQANV-SGPTLIEI 531

Query: 539 MLPVMDAPESLVKQAQLTAATNAK 562
            +   D    L+      A  NA+
Sbjct: 532 QINRDDCTNELITWGHFVALANAR 555

>TDEL0C07020 Chr3 complement(1283600..1285282) [1683 bp, 560 aa]
           {ON} 
          Length = 560

 Score =  208 bits (529), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 150/566 (26%), Positives = 248/566 (43%), Gaps = 21/566 (3%)

Query: 5   TLGRYLFERLRQVECNTIFGLPGDFNLRLLDEIYETEGMRWXXXXXXXXXXXXXXXXXRI 64
           T+G YL  RL +V     F +PGD+NL LLD++     +                   R 
Sbjct: 4   TVGSYLATRLSEVGIENHFVVPGDYNLALLDKLQAHPKLEEVNCSNELNCSFAAEGYARS 63

Query: 65  KGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNGDFTV 124
           KG++ ++ TF VG  SA NGI  +Y E++ V+ + G P+ +      LLHHT+G  +F  
Sbjct: 64  KGVAAVVVTFSVGAFSAFNGIGSAYGENLPVILIAGSPNTNDSIDHNLLHHTIGTHNFDY 123

Query: 125 FHRMSANISETTAMISDLATAPAEIDRCIRTTYVRQRPVYLGLPSNFVDQMVPASLLETP 184
              M+  I+     I     AP+ ID  IR    +++P Y+ +P+N   Q   +  L  P
Sbjct: 124 EFEMAKKITCAAVQIKHAKDAPSLIDFAIRECLAKKKPCYIEVPTNMSTQ---SCALPGP 180

Query: 185 ID--LSLKPNDAAAEQEVVSTVLDLIKNAKNPVILADACASRHDVKAETKKLIDVTQFPS 242
           I+  L   P++       V     LI +   P +LA         +    +L +      
Sbjct: 181 IEGVLYQSPSEPKTLTAAVDAANKLIGSRLKPTLLAGPKLKSAGAEKAFLRLAEALGCAV 240

Query: 243 FVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESSDLILSVGALLSDFNTGSFSYSYK 302
            V P  K    E HP++ GVY G +S+      ++ SDL +  G + +D++T  ++    
Sbjct: 241 AVLPAAKSLFPEDHPQYAGVYWGNVSTKKADAILQWSDLTICAGCVFTDYSTTGWTSLQP 300

Query: 303 TKNIVEFHSDHIKIRNATFPGVQMKFVLQKLLTQVGDVVKDYKPVA----IPEIPGPNAA 358
             + +E  SD++K  +  +  +++   L  L  +V    K+ K V     +  +P    A
Sbjct: 301 ATHRIEVDSDNVKFPDHYYGHIKLADFLDALAKKVS---KNDKSVVEYQRLRPVPPAIKA 357

Query: 359 VDDSTPLKQQWLWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIXXX 418
            + S  + +Q +  Q+   +     +  ETG S F   Q   P       ++ WG I   
Sbjct: 358 AEPSAAITRQEMARQIQGIINSKTTLFAETGDSWFNGVQMDLPKGAKFEVEMQWGHIGWS 417

Query: 419 XXXXXXXXXXXXXXDKNKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNNGYTIEK 478
                           ++ ++  +GDGS Q+TVQE++ MIR      +F++NN GYTIE 
Sbjct: 418 VPACFGYSVGA----PDREIVTMVGDGSFQMTVQEVAQMIRLKQPILIFLINNYGYTIEV 473

Query: 479 LIHGEFAQYNEIQPWNHLDLLPTFGAKD--YETVRVATTGEWNKLAEDQEFNKNSKIRMI 536
            IH     YN I+ WN+  L+  F A D   +  +V T  E ++  +  + N      +I
Sbjct: 474 EIHD--GPYNNIKNWNYAALMEAFNANDGHGKGFQVKTGAELSEAIKKAKSNTRGPT-LI 530

Query: 537 EVMLPVMDAPESLVKQAQLTAATNAK 562
           E+ +   D    L+      A  NA+
Sbjct: 531 EIQINRDDCTNELISWGHYVALANAR 556

>TDEL0F00150 Chr6 (12055..13737) [1683 bp, 560 aa] {ON} 
          Length = 560

 Score =  207 bits (527), Expect = 4e-59,   Method: Compositional matrix adjust.
 Identities = 150/566 (26%), Positives = 247/566 (43%), Gaps = 21/566 (3%)

Query: 5   TLGRYLFERLRQVECNTIFGLPGDFNLRLLDEIYETEGMRWXXXXXXXXXXXXXXXXXRI 64
           T+G YL  RL +V     F +PGD+NL LLD++     +                   R 
Sbjct: 4   TVGSYLATRLSEVGIENHFVVPGDYNLALLDKLQAHPKLEEVNCSNELNCSFAAEGYARS 63

Query: 65  KGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNGDFTV 124
           KG++ ++ TF VG  SA NGI  +Y E++ V+ + G P+ +      LLHHT+G  +F  
Sbjct: 64  KGVAAVVVTFSVGAFSAFNGIGSAYGENLPVILIAGSPNTNDSIDHNLLHHTIGTHNFDY 123

Query: 125 FHRMSANISETTAMISDLATAPAEIDRCIRTTYVRQRPVYLGLPSNFVDQMVPASLLETP 184
              M+  I+     I     AP+ ID  IR    +++P Y+ +P+N   Q   +  L  P
Sbjct: 124 EFEMAKKITCAAVQIKHAKDAPSLIDFAIRECLAKKKPCYIEVPTNMSTQ---SCALPGP 180

Query: 185 ID--LSLKPNDAAAEQEVVSTVLDLIKNAKNPVILADACASRHDVKAETKKLIDVTQFPS 242
           I+  L   P++       V     LI +   P +LA         +    +L +      
Sbjct: 181 IEGVLYQSPSEPKTLTAAVDAANKLIGSRLKPTLLAGPKLKSAGAEKAFLRLAEALGCAV 240

Query: 243 FVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESSDLILSVGALLSDFNTGSFSYSYK 302
            V P  K    E HP++ GVY G +S+      ++ SDL +  G + +D++T  ++    
Sbjct: 241 AVLPAAKSLFPEDHPQYAGVYWGNVSTKKADAILQWSDLTICAGCVFTDYSTTGWTSLQP 300

Query: 303 TKNIVEFHSDHIKIRNATFPGVQMKFVLQKLLTQVGDVVKDYKPVA----IPEIPGPNAA 358
             + +E  SD++K  +  +  +++   L  L  +V    K+ K V     +  +P    A
Sbjct: 301 ATHRIEVDSDNVKFPDHYYGHIKLADFLDALAKKVS---KNDKSVVEYQRLRPVPPAIKA 357

Query: 359 VDDSTPLKQQWLWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIXXX 418
            + S  + +Q +  Q+   +     +  ETG S F   Q   P       ++ WG I   
Sbjct: 358 AEPSAAITRQEMARQIQGIINSKTTLFAETGDSWFNGVQMDLPKGAKFEVEMQWGHIGWS 417

Query: 419 XXXXXXXXXXXXXXDKNKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNNGYTIEK 478
                           ++ ++  +GDGS Q+TVQE++ MIR      +F++NN GYTIE 
Sbjct: 418 VPACFGYSVGA----PDREIVTMVGDGSFQMTVQEVAQMIRLKQPILIFLINNYGYTIEV 473

Query: 479 LIHGEFAQYNEIQPWNHLDLLPTFGAKD--YETVRVATTGEWNKLAEDQEFNKNSKIRMI 536
            IH     YN I+ WN+  L+  F A D   +  +V T  E  +  +  + N      +I
Sbjct: 474 EIHD--GPYNNIKNWNYAALMEAFNANDGHGKGFQVKTGAELAEAIKKAKSNTRGPT-LI 530

Query: 537 EVMLPVMDAPESLVKQAQLTAATNAK 562
           E+ +   D    L+      A  NA+
Sbjct: 531 EIQINRDDCTNELISWGHYVALANAR 556

>Skud_7.383 Chr7
           complement(638760..638846,638850..638882,638886..638903,
           638917..639036) [258 bp, 86 aa] {ON} YGR087C (REAL)
          Length = 86

 Score = 63.5 bits (153), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 40/92 (43%), Positives = 45/92 (48%), Gaps = 6/92 (6%)

Query: 386 TETGTSAFGINQTHFPNNTYGISQVLWGSIXXXXXXXXXXXXXXXXXDKNKRVILFIGDG 445
           TETG S    NQ     + + ISQVLW  I                     R ILF GD 
Sbjct: 1   TETGASTLASNQAILLKDAHDISQVLWRPIRFANGATLSAEDI-----DPGRAILFSGDR 55

Query: 446 SLQLTVQEISTMIRWGLKPYLFVLNNNGYTIE 477
            L LTVQE+ T IRW LKPYLFV NN+   +E
Sbjct: 56  PL-LTVQEMPTTIRWRLKPYLFVPNNDKRHVE 86

>CAGL0K03465g Chr11 (320030..322063) [2034 bp, 677 aa] {ON} highly
           similar to uniprot|P07342 Saccharomyces cerevisiae
           YMR108w Acetolactate synthase
          Length = 677

 Score = 65.9 bits (159), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 73/310 (23%), Positives = 131/310 (42%), Gaps = 30/310 (9%)

Query: 4   ITLGRYLFERLRQVECNTIFGLPGDFNLRLLDEIYETEGMRWXXXXXXXXXXXXXXXXXR 63
           +T G+   E + +   +T+FG PG   L + D I+ ++  ++                 R
Sbjct: 82  LTGGQIFNEMMARNNVDTVFGYPGGAILPVYDAIHNSDKFKFVLPKHEQGAGHMAEGYAR 141

Query: 64  IKGM-SCLITTFGVGELSALNGIAGSYAEHVGVLHVVG-VPSISAQAKQLLLHHTLGNGD 121
             G    ++ T G G  + +  +A + A+ + ++   G VP+ +           +G   
Sbjct: 142 ASGKPGVVLVTSGPGATNVVTPMADALADGIPMVVFTGQVPTTAIGTDAFQEADIVG--- 198

Query: 122 FTVFHRMSANISETTAMISDLATAPAEIDRCIR-TTYVRQRPVYLGLPSNFVDQMVPASL 180
                 +S + ++   M+ ++A  P  I+   +  T  R  PV + LP +     V A++
Sbjct: 199 ------ISRSCTKWNVMVKNVAELPLRINEAFQIATSGRPGPVLVDLPKD-----VTAAI 247

Query: 181 LETPIDLSLKPNDAAAEQ-----------EVVSTVLDLIKNAKNPVI-LADACASRHDVK 228
           L TPI +       A +Q           E +    DLI  AKNPV+ +     +  D  
Sbjct: 248 LRTPIPVKSTLPSTALQQLTAGVQDQFVIENIKKSADLINIAKNPVLYVGGGILNNVDGP 307

Query: 229 AETKKLIDVTQFPSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESSDLILSVGAL 288
              K+L +  Q P   T  G G+ D++ P+   + +G         AV++SDLI++VGA 
Sbjct: 308 RLVKELSERAQIPVTTTLQGLGAFDQEDPKSLDM-LGMHGCATANLAVQNSDLIIAVGAR 366

Query: 289 LSDFNTGSFS 298
             D  TG+ +
Sbjct: 367 FDDRVTGNIT 376

>YMR108W Chr13 (484084..486147) [2064 bp, 687 aa] {ON}
           ILV2Acetolactate synthase, catalyses the first common
           step in isoleucine and valine biosynthesis and is the
           target of several classes of inhibitors, localizes to
           the mitochondria; expression of the gene is under
           general amino acid control
          Length = 687

 Score = 63.9 bits (154), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 76/310 (24%), Positives = 129/310 (41%), Gaps = 30/310 (9%)

Query: 4   ITLGRYLFERLRQVECNTIFGLPGDFNLRLLDEIYETEGMRWXXXXXXXXXXXXXXXXXR 63
           +T G+   E + +   +T+FG PG   L + D I+ ++   +                 R
Sbjct: 92  LTGGQIFNEMMSRQNVDTVFGYPGGAILPVYDAIHNSDKFNFVLPKHEQGAGHMAEGYAR 151

Query: 64  IKGM-SCLITTFGVGELSALNGIAGSYAEHVGVLHVVG-VPSISAQAKQLLLHHTLGNGD 121
             G    ++ T G G  + +  +A ++A+ + ++   G VP+ +           +G   
Sbjct: 152 ASGKPGVVLVTSGPGATNVVTPMADAFADGIPMVVFTGQVPTSAIGTDAFQEADVVG--- 208

Query: 122 FTVFHRMSANISETTAMISDLATAPAEIDRCIR-TTYVRQRPVYLGLPSNFVDQMVPASL 180
                 +S + ++   M+  +   P  I+      T  R  PV + LP +     V A++
Sbjct: 209 ------ISRSCTKWNVMVKSVEELPLRINEAFEIATSGRPGPVLVDLPKD-----VTAAI 257

Query: 181 LETPIDLSLK-PNDA------AAEQEVV----STVLDLIKNAKNPVILADACASRH-DVK 228
           L  PI      P++A       A+ E V    +   DLI  AK PV+   A    H D  
Sbjct: 258 LRNPIPTKTTLPSNALNQLTSRAQDEFVMQSINKAADLINLAKKPVLYVGAGILNHADGP 317

Query: 229 AETKKLIDVTQFPSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESSDLILSVGAL 288
              K+L D  Q P   T  G GS D++ P+   + +G         AV+++DLI++VGA 
Sbjct: 318 RLLKELSDRAQIPVTTTLQGLGSFDQEDPKSLDM-LGMHGCATANLAVQNADLIIAVGAR 376

Query: 289 LSDFNTGSFS 298
             D  TG+ S
Sbjct: 377 FDDRVTGNIS 386

>NDAI0H02380 Chr8 (578157..580214) [2058 bp, 685 aa] {ON} Anc_2.441
          Length = 685

 Score = 61.2 bits (147), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 68/305 (22%), Positives = 129/305 (42%), Gaps = 28/305 (9%)

Query: 7   GRYLFERLRQVECNTIFGLPGDFNLRLLDEIYETEGMRWXXXXXXXXXXXXXXXXXRIKG 66
           G+   E +++   +T+FG PG   L + D IY ++  ++                 R  G
Sbjct: 95  GQIFNEMMKRQNVDTVFGYPGGAILPVYDAIYNSDAFKFVLPKHEQGAGHMAEGYARASG 154

Query: 67  MS-CLITTFGVGELSALNGIAGSYAEHVGVLHVVG-VPSISAQAKQLLLHHTLGNGDFTV 124
            +  ++ T G G  + +  +A + A+ + ++   G VP+ +           +G      
Sbjct: 155 KTGVVLVTSGPGATNVVTPMADALADGIPMVVFTGQVPTSAIGTDAFQEADVVG------ 208

Query: 125 FHRMSANISETTAMISDLATAPAEIDRCIRTTYV-RQRPVYLGLPSNFVDQMVPASLLET 183
              +S + ++   M+  +A  P  I+         R  PV + LP +     V A++L  
Sbjct: 209 ---ISRSCTKWNVMVRSVAELPLRINEAFEIANSGRPGPVLVDLPKD-----VTAAILRN 260

Query: 184 PIDL-SLKP--------NDAAAEQEVVSTVLDLIKNAKNPVI-LADACASRHDVKAETKK 233
           PI + S  P         + A   E ++   DLI  AK PV+ + +   +  D     K+
Sbjct: 261 PIPIKSTLPITSQLKSVAEEAYTMESINRAADLINLAKRPVLYVGNGIMNNPDGPRLLKE 320

Query: 234 LIDVTQFPSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESSDLILSVGALLSDFN 293
           L D  Q P   T  G G+ D++ P+   + +G         A++++DL++++GA   D  
Sbjct: 321 LSDRAQIPVTTTIQGLGAFDQEDPKSLDM-LGMHGCATANLAMQNADLVIALGARFDDRV 379

Query: 294 TGSFS 298
           TG+ +
Sbjct: 380 TGNIA 384

>Smik_13.297 Chr13 (467578..469641) [2064 bp, 687 aa] {ON} YMR108W
           (REAL)
          Length = 687

 Score = 61.2 bits (147), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 71/310 (22%), Positives = 127/310 (40%), Gaps = 30/310 (9%)

Query: 4   ITLGRYLFERLRQVECNTIFGLPGDFNLRLLDEIYETEGMRWXXXXXXXXXXXXXXXXXR 63
           +T G+   E + +   +T+FG PG   L + D I+ ++   +                 R
Sbjct: 92  LTGGQIFNEMMSRQNVDTVFGYPGGAILPVYDAIHNSDKFNFVLPKHEQGAGHMAEGYAR 151

Query: 64  IKGM-SCLITTFGVGELSALNGIAGSYAEHVGVLHVVG-VPSISAQAKQLLLHHTLGNGD 121
             G    ++ T G G  + +  +A ++A+ + ++   G VP+ +           +G   
Sbjct: 152 ASGKPGVVLVTSGPGATNVVTPMADAFADGIPMVVFTGQVPTTAIGTDAFQEADVVG--- 208

Query: 122 FTVFHRMSANISETTAMISDLATAPAEIDRCIR-TTYVRQRPVYLGLPSNFVDQMVPASL 180
                 +S + ++   M+  +   P  I+      T  R  PV + LP +     V A++
Sbjct: 209 ------ISRSCTKWNVMVKSVEELPLRINEAFEIATSGRPGPVLVDLPKD-----VTAAI 257

Query: 181 LETPIDLSLK-PNDAAAE----------QEVVSTVLDLIKNAKNPVILADACASRH-DVK 228
           L  PI      P++A  +           + ++   DLI  AK PV+   A    H D  
Sbjct: 258 LRNPIPTKTTLPSNALNQLTSHTQDEFVMQSINKAADLINLAKKPVLYVGAGILNHIDGP 317

Query: 229 AETKKLIDVTQFPSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESSDLILSVGAL 288
              K+L    Q P   T  G GS D++ P+   + +G         A++++DLI++VGA 
Sbjct: 318 RLLKELSGRAQIPVTTTLQGLGSFDQEDPKSLDM-LGMHGCATANLAIQNADLIIAVGAR 376

Query: 289 LSDFNTGSFS 298
             D  TG+ S
Sbjct: 377 FDDRVTGNIS 386

>KAFR0A00570 Chr1 complement(101898..103946) [2049 bp, 682 aa] {ON}
           Anc_2.441 YMR108W
          Length = 682

 Score = 61.2 bits (147), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 71/310 (22%), Positives = 132/310 (42%), Gaps = 30/310 (9%)

Query: 4   ITLGRYLFERLRQVECNTIFGLPGDFNLRLLDEIYETEGMRWXXXXXXXXXXXXXXXXXR 63
           +T G+   E + +   +T+FG PG   L + D IY+++  ++                 R
Sbjct: 87  LTGGQIFNEMMARHNVDTVFGYPGGAILPVYDAIYQSKNFKFVLPKHEQGAGHMAEGYAR 146

Query: 64  IKGMSCLI-TTFGVGELSALNGIAGSYAEHVGVLHVVG-VPSISAQAKQLLLHHTLGNGD 121
             G   ++  T G G  + +  +A + A+ + ++   G VP+ +           +G   
Sbjct: 147 ASGKPGIVLVTSGPGATNVVTPMADALADGIPMVVFTGQVPTTAIGTDAFQEADVVG--- 203

Query: 122 FTVFHRMSANISETTAMISDLATAPAEIDRCIR-TTYVRQRPVYLGLPSNFVDQMVPASL 180
                 +S + ++   MI ++A  P  I+      T  R  PV + LP +     V A++
Sbjct: 204 ------ISRSCTKWNVMIKNVAELPVRINEAFEIATSGRPGPVLVDLPKD-----VTAAI 252

Query: 181 LE--TPIDLSLKPNDAA-----AEQEVV----STVLDLIKNAKNPVI-LADACASRHDVK 228
           L    P+  SL  N  +     A+ E V    +   DLI  AKNPV+ +        D  
Sbjct: 253 LRDAIPVGSSLPSNALSQLTNKAQDEFVLDNINKAADLINLAKNPVLYVGGGILGNEDGP 312

Query: 229 AETKKLIDVTQFPSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESSDLILSVGAL 288
              K+L +  Q P   + +G G+ D++ P+   + +G         A++++DLI+++G  
Sbjct: 313 KLLKQLSERAQIPVTTSLLGLGAFDQEDPKSLDM-LGMHGCATANLAMQNADLIIAIGTR 371

Query: 289 LSDFNTGSFS 298
             D  TG+ +
Sbjct: 372 FDDRVTGNIA 381

>SAKL0E03740g Chr5 (302160..304199) [2040 bp, 679 aa] {ON} highly
           similar to uniprot|P07342 Saccharomyces cerevisiae
           YMR108W ILV2 Acetolactate synthase catalyses the first
           common step in isoleucine and valine biosynthesis and is
           the target of several classes of inhibitors localizes to
           the mitochondria expression of the gene is under general
           amino acid control
          Length = 679

 Score = 61.2 bits (147), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 74/311 (23%), Positives = 133/311 (42%), Gaps = 32/311 (10%)

Query: 4   ITLGRYLFERLRQVECNTIFGLPGDFNLRLLDEIYETEGMRWXXXXXXXXXXXXXXXXXR 63
           +T G+   E +++ + +T+FG PG   L + D IY +    +                 R
Sbjct: 84  LTGGQIFHEMMQRHKVDTVFGYPGGAILPVYDAIYNSNAFNFVLPKHEQGAGHMAEGYAR 143

Query: 64  IKGM-SCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNGDF 122
             G    ++ T G G  + +  +A + A+ V ++   G  S +A          +G   F
Sbjct: 144 ASGKPGVVLVTSGPGATNVVTPMADALADGVPMVVFTGQVSTTA----------IGTDAF 193

Query: 123 TVFH--RMSANISETTAMISDLATAPAEIDRCIR-TTYVRQRPVYLGLPSNFVDQMVPAS 179
                  +S + ++   M+  +   P  I+      T  R  PV + LP +     V A+
Sbjct: 194 QEADVVGISRSCTKWNVMVKSIEELPRRINEAFEIATSGRPGPVLVDLPKD-----VTAA 248

Query: 180 LLETPIDL-SLKPNDA-------AAEQEVVSTVL---DLIKNAKNPVILADACASRHDVK 228
           +L  PI   S  P+DA       A ++  ++++    DLI  AK P++        H+  
Sbjct: 249 VLRNPIPTKSTLPSDALLQITKRAVDEFTMNSIAKASDLINVAKKPLLYVGGGILGHENG 308

Query: 229 AE-TKKLIDVTQFPSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESSDLILSVGA 287
            +  K+L +  Q P   T  G G+ D++ P+   + +G   S A   AV+++DLI+++GA
Sbjct: 309 PKFLKELSERAQIPVTTTLQGLGAFDQEDPKSLDM-LGMHGSAAANTAVQNADLIIALGA 367

Query: 288 LLSDFNTGSFS 298
              D  T + S
Sbjct: 368 RFDDRVTCNIS 378

>Kwal_26.7582 s26 (427437..429476) [2040 bp, 679 aa] {ON} YMR108W
           (ILV2) - acetolactate synthase [contig 54] FULL
          Length = 679

 Score = 60.8 bits (146), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 72/301 (23%), Positives = 127/301 (42%), Gaps = 32/301 (10%)

Query: 7   GRYLFERLRQVECNTIFGLPGDFNLRLLDEIYETEGMRWXXXXXXXXXXXXXXXXXRIKG 66
           G+   E +R+ + +T+FG PG   L + D IY ++   +                 R  G
Sbjct: 87  GQIFHEMMRRHKVDTVFGYPGGAILAVYDAIYNSKYFNFVLPKHEQGAGHMAEGYARASG 146

Query: 67  M-SCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNGDFTVF 125
               ++ T G G  + +  +A + A+ V ++   G  + S          ++G   F   
Sbjct: 147 KPGVVLVTSGPGATNVVTPMADALADGVPMVVFTGQVATS----------SIGTDAFQEA 196

Query: 126 H--RMSANISETTAMISDLATAPAEIDRCIRTTYV-RQRPVYLGLPSNFVDQMVPASLLE 182
               +S + ++   M+  +   P  I+         R  PV + LP +     V +++L+
Sbjct: 197 DVIGISRSCTKWNVMVKTVEELPRRINEAFEIAVSGRPGPVLVDLPKD-----VTSAILK 251

Query: 183 TPIDL-SLKPNDA------AAEQEV----VSTVLDLIKNAKNPVI-LADACASRHDVKAE 230
           TPI + S  P DA      A  QE     +  V DLI  AK P++ +      R D    
Sbjct: 252 TPIPVNSTLPFDALSKLTKATAQEFTKANIQKVADLINIAKKPLLYVGGGIFGREDGPKL 311

Query: 231 TKKLIDVTQFPSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESSDLILSVGALLS 290
            ++L D  Q P   T  G G+ D++ P+   + +G   S     +V+++DLI+++GA   
Sbjct: 312 LRQLADRAQIPVTTTIQGLGAFDQEDPKSLDM-LGMHGSAFANLSVQNADLIIALGARFD 370

Query: 291 D 291
           D
Sbjct: 371 D 371

>NCAS0F01500 Chr6 (299388..301442) [2055 bp, 684 aa] {ON} Anc_2.441
           YMR108W
          Length = 684

 Score = 59.3 bits (142), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 69/309 (22%), Positives = 127/309 (41%), Gaps = 34/309 (11%)

Query: 7   GRYLFERLRQVECNTIFGLPGDFNLRLLDEIYETEGMRWXXXXXXXXXXXXXXXXXRIKG 66
           G+   E +++   +T+FG PG   L + D IY +E   +                 R  G
Sbjct: 92  GQIFNEMMKRQNVDTVFGYPGGAILPVYDAIYNSEAFNFVLPKHEQGAGHMAEGYARASG 151

Query: 67  M-SCLITTFGVGELSALNGIAGSYAEHVGVLHVVG-VPSISAQAKQLLLHHTLGNGDFTV 124
               ++ T G G  + +  +A + A+ + ++   G VP+ +           +G      
Sbjct: 152 KPGVVLVTSGPGATNVVTPMADALADGIPMVVFTGQVPTSAIGTDAFQEADVVG------ 205

Query: 125 FHRMSANISETTAMISDLATAPAEIDRCIRTTYV-RQRPVYLGLPSNFVDQMVPASLLET 183
              +S + ++   M+  +A  P  I+         R  PV + LP +     V A++L  
Sbjct: 206 ---ISRSCTKWNVMVKSVAELPLRINEAFEIAMSGRPGPVLVDLPKD-----VTAAILRE 257

Query: 184 PIDL-------------SLKPNDAAAEQEVVSTVLDLIKNAKNPVI-LADACASRHDVKA 229
           PI +             S+   D  A+   ++   DLI  AK PV+ + +   +  D   
Sbjct: 258 PIPIKSTLPSGTLTQIKSIAQEDFLADS--INRAADLINLAKKPVLYVGNGIFNNEDGPR 315

Query: 230 ETKKLIDVTQFPSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESSDLILSVGALL 289
             K+L +  Q P   T  G G+ D++ P+   + +G         A++++DLI++VGA  
Sbjct: 316 LLKELSERAQIPVTTTIQGLGAFDQEDPKSLDM-LGMHGCATANLAMQNADLIIAVGARF 374

Query: 290 SDFNTGSFS 298
            D  TG+ +
Sbjct: 375 DDRVTGNIA 383

>TBLA0I01400 Chr9 (303028..305160) [2133 bp, 710 aa] {ON} Anc_2.441
           YMR108W
          Length = 710

 Score = 58.9 bits (141), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 75/315 (23%), Positives = 129/315 (40%), Gaps = 33/315 (10%)

Query: 1   MSEITLGRYLFERLRQVECNTIFGLPGDFNLRLLDEIYETEGMRWXXXXXXXXXXXXXXX 60
           M  +T G    E +R+   +T+FG PG   L + D IY +E  ++               
Sbjct: 111 MIGMTGGEIFNEMMRRKNVDTVFGYPGGAILPVYDAIYNSENFKFVLPRHEQGAGHMAEG 170

Query: 61  XXRIKGM-SCLITTFGVGELSALNGIAGSYAEHVGVLHVVG-VPSISAQAKQLLLHHTLG 118
             R  G    ++ T G G  + +  +A + A+ V ++   G VP+ +           +G
Sbjct: 171 YARASGKPGVVLVTSGPGATNVVTPMADALADGVPMVVFTGQVPTSAIGTDAFQEADVIG 230

Query: 119 NGDFTVFHRMSANISETTAMISDLATAPAEIDRCIRTTYV-RQRPVYLGLPSNFVDQMVP 177
                    +S + ++   M+  +   P  I+         R  PV + LP +     V 
Sbjct: 231 ---------ISRSCTKWNVMVKSVDELPKRINEAFEIAMSGRPGPVLIDLPKD-----VT 276

Query: 178 ASLLETPIDL---SLKPNDAAAE----------QEVVSTVLDLIKNAKNPVILADA-CAS 223
           A++L+ PI +   SL P  A +            E +     LI  AK PVI A A   S
Sbjct: 277 AAVLKNPIPVLNNSL-PYTAISNINQIIQRKFLSENIQETAKLINMAKKPVIYAGAGILS 335

Query: 224 RHDVKAETKKLIDVTQFPSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESSDLIL 283
             +     K+L + +Q P   T    G+ D++ P+   + +G   S     A++++DLI+
Sbjct: 336 NLNGPTLLKELSERSQIPVTTTLQALGAFDQQDPKSLDM-LGMHGSAVANLAIQNADLII 394

Query: 284 SVGALLSDFNTGSFS 298
           ++G    D  TG+ S
Sbjct: 395 ALGGRFDDRVTGNIS 409

>Kpol_297.12 s297 complement(20788..22803) [2016 bp, 671 aa] {ON}
           complement(20788..22803) [2016 nt, 672 aa]
          Length = 671

 Score = 58.2 bits (139), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 68/310 (21%), Positives = 129/310 (41%), Gaps = 30/310 (9%)

Query: 4   ITLGRYLFERLRQVECNTIFGLPGDFNLRLLDEIYETEGMRWXXXXXXXXXXXXXXXXXR 63
           +T G    E + +   +T+FG PG   L + D IY ++  ++                 R
Sbjct: 76  LTGGEIFHEMMIRNNVDTVFGYPGGAILPVYDAIYNSDKFKFVLPRHEQGAGHMAEGYSR 135

Query: 64  IKGM-SCLITTFGVGELSALNGIAGSYAEHVGVLHVVG-VPSISAQAKQLLLHHTLGNGD 121
             G    ++ T G G  + +  +A + A+ + ++   G VP+ +           +G   
Sbjct: 136 ASGKPGVVLVTSGPGATNVVTPMADALADGIPMVVFTGQVPTSAIGTDAFQEADVIG--- 192

Query: 122 FTVFHRMSANISETTAMISDLATAPAEIDRCIR-TTYVRQRPVYLGLPSNFVDQMVPASL 180
                 +S + ++   M+  +   P  I+      T  R  PV + LP +     V A++
Sbjct: 193 ------ISRSCTKWNVMVKSVEELPRRINEAFEIATSGRPGPVLVDLPKD-----VTAAI 241

Query: 181 LETPIDL-SLKPNDAAAE----------QEVVSTVLDLIKNAKNPVILADACASRHDVKA 229
           L  PI + S  P++A  +          +E +S    LI  AK PV+        H+   
Sbjct: 242 LRNPIPVNSTLPSNALNQLVKNAHNEFTEESLSKAASLINIAKRPVLYVGGGILNHEEGP 301

Query: 230 E-TKKLIDVTQFPSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESSDLILSVGAL 288
              ++L +  Q P   + +G G+ D++ P+   + +G         A++++DLI++VGA 
Sbjct: 302 RLLRELSERAQIPVTTSLLGLGAFDQEDPKSLDM-LGMHGHAPANLAIQNADLIIAVGAR 360

Query: 289 LSDFNTGSFS 298
             D  TG+ +
Sbjct: 361 FDDRVTGNIA 370

>KNAG0E02360 Chr5 complement(470361..472442) [2082 bp, 693 aa] {ON}
           Anc_2.441 YMR108W
          Length = 693

 Score = 58.2 bits (139), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 67/309 (21%), Positives = 127/309 (41%), Gaps = 27/309 (8%)

Query: 4   ITLGRYLFERLRQVECNTIFGLPGDFNLRLLDEIYETEGMRWXXXXXXXXXXXXXXXXXR 63
           +T G+   E + +   +T+FG PG   L + D IY +E  ++                 R
Sbjct: 97  LTGGQIFNEMMSRHNVDTVFGYPGGAILPVYDAIYGSENFKFVLPKHEQGAGHMAEGYAR 156

Query: 64  IKGM-SCLITTFGVGELSALNGIAGSYAEHVGVLHVVG-VPSISAQAKQLLLHHTLGNGD 121
             G    ++ T G G  + +  +A + A+ V ++   G VP+ +           +G   
Sbjct: 157 ASGKPGVVLVTSGPGATNVVTPMADALADGVPMVVFTGQVPTNAIGTDAFQEADVVG--- 213

Query: 122 FTVFHRMSANISETTAMISDLATAPAEIDRCIRTTYV-RQRPVYLGLPSNFVDQMVPASL 180
                 +S + ++   M+ ++A  P  I+         R  PV + LP +    ++  ++
Sbjct: 214 ------ISRSCTKWNVMVKNVAELPKRINEAFEIAMSGRPGPVLVDLPKDVTAAVLREAI 267

Query: 181 LETPIDLSLKPNDAAAE----------QEVVSTVLDLIKNAKNPVI-LADACASRHDVKA 229
              P + +L   +  A              ++   DLI  AK PV+ + +   +  D   
Sbjct: 268 ---PTESTLPSLNGGATTGATVFDEFLAPAINKAADLINLAKKPVLYVGNGILNNEDGPR 324

Query: 230 ETKKLIDVTQFPSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESSDLILSVGALL 289
             K+L D  Q P   T  G G+ D++ P+   + +G         A++++DLI++VGA  
Sbjct: 325 LLKELSDRAQIPVTTTLQGLGAFDQEDPKSLDM-LGMHGCATANLAIQNADLIIAVGARF 383

Query: 290 SDFNTGSFS 298
            D  TG+ +
Sbjct: 384 DDRVTGNIT 392

>KLLA0B12584g Chr2 complement(1100489..1102564) [2076 bp, 691 aa]
           {ON} highly similar to uniprot|P07342 Saccharomyces
           cerevisiae YMR108W ILV2 Acetolactate synthase catalyses
           the first common step in isoleucine and valine
           biosynthesis and is the target of several classes of
           inhibitors localizes to the mitochondria expression of
           the gene is under general amino acid control
          Length = 691

 Score = 57.8 bits (138), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 74/305 (24%), Positives = 126/305 (41%), Gaps = 34/305 (11%)

Query: 4   ITLGRYLFERLRQVECNTIFGLPGDFNLRLLDEIYETEGMRWXXXXXXXXXXXXXXXXXR 63
           +T G    E +++   +T+FG PG   L + D IY ++   +                 R
Sbjct: 96  MTGGEIFHEMMQRHNVDTVFGYPGGAILPVYDAIYNSDKFTFVLPKHEQGAGHMAEGYAR 155

Query: 64  IKGM-SCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNGDF 122
             G    ++ T G G  + +  +A + A+ V ++   G  + SA          +G   F
Sbjct: 156 ASGKPGVVLVTSGPGATNVVTPMADALADGVPLVVFTGQVATSA----------IGTDAF 205

Query: 123 TVFH--RMSANISETTAMISDLATAPAEIDRCIR-TTYVRQRPVYLGLPSNFVDQMVPAS 179
                  +S + ++   M+  +   P  I+      T  R  PV + LP +     V A+
Sbjct: 206 QEADVVGISRSCTKWNVMVKTIEELPRRINEAFEIATSGRPGPVLVDLPKD-----VTAA 260

Query: 180 LLETPIDL-SLKPNDAAAE--QEVV--------STVLDLIKNAKNPVILADACASRHDVK 228
           +L  PI + S+ P+D   +  Q VV        S   DLI  AK P++   A     ++ 
Sbjct: 261 VLRNPIPMKSILPSDTLNQLTQRVVDEFTLENISRAADLINRAKKPLLYVGAGILGSEMG 320

Query: 229 AE-TKKLIDVTQFPSFVTPMGKGSID-EKHPRFGGVYVGTLSSPAVKEAVESSDLILSVG 286
            +  K+L D  Q P   T  G G+ + E H       VG   + A   A++++DLI+++G
Sbjct: 321 PQYLKQLSDRAQIPVTTTLQGLGAFNQEDHKSLD--MVGMHGNAAANLAIQNADLIIALG 378

Query: 287 ALLSD 291
           A   D
Sbjct: 379 ARFDD 383

>KLTH0D04532g Chr4 (417085..419121) [2037 bp, 678 aa] {ON} highly
           similar to uniprot|P07342 Saccharomyces cerevisiae
           YMR108W ILV2 Acetolactate synthase catalyses the first
           common step in isoleucine and valine biosynthesis and is
           the target of several classes of inhibitors localizes to
           the mitochondria expression of the gene is under general
           amino acid control
          Length = 678

 Score = 57.4 bits (137), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 69/301 (22%), Positives = 130/301 (43%), Gaps = 32/301 (10%)

Query: 7   GRYLFERLRQVECNTIFGLPGDFNLRLLDEIYETEGMRWXXXXXXXXXXXXXXXXXRIKG 66
           G+   E +R+ + NT+FG PG   L + D IY +E   +                 R+ G
Sbjct: 86  GQIFHEMMRRHKVNTVFGYPGGAILAVYDAIYNSEHFNFVLPKHEQGAGHMAEGYARVSG 145

Query: 67  M-SCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNGDFTVF 125
               ++ T G G  + +  +A + A+ V ++   G  + S          ++G   F   
Sbjct: 146 KPGVVLVTSGPGATNVVTPMADALADGVPMVVFTGQVATS----------SIGTDAFQEA 195

Query: 126 H--RMSANISETTAMISDLATAPAEIDRCIRTTYV-RQRPVYLGLPSNFVDQMVPASLLE 182
               +S + ++   M+ ++   P  I+         R  PV + LP +     V +++L 
Sbjct: 196 DVIGISRSCTKWNVMVKNVEELPRRINEAFEIAVSGRPGPVLVDLPKD-----VTSAILR 250

Query: 183 TPIDL-SLKPNDA-------AAEQEVVSTV---LDLIKNAKNPVI-LADACASRHDVKAE 230
           TPI + S  P++A       AA++  ++ +    DLI  AK P+I +      +      
Sbjct: 251 TPIPVKSTLPSNALSKITKSAAKEFTLANLQRAADLINIAKKPLIYVGGGIFGKEQGPKL 310

Query: 231 TKKLIDVTQFPSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESSDLILSVGALLS 290
            ++L +  Q P   T  G G+ D++ P+   + +G   S     +V+++DLI+++GA   
Sbjct: 311 LRELAERAQIPVSTTIQGLGAFDQEDPKSLDM-LGMHGSAFANLSVQNADLIIALGARFD 369

Query: 291 D 291
           D
Sbjct: 370 D 370

>Ecym_6107 Chr6 complement(201133..203202) [2070 bp, 689 aa] {ON}
           similar to Ashbya gossypii AEL305C
          Length = 689

 Score = 57.4 bits (137), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 73/310 (23%), Positives = 136/310 (43%), Gaps = 30/310 (9%)

Query: 4   ITLGRYLFERLRQVECNTIFGLPGDFNLRLLDEIYETEGMRWXXXXXXXXXXXXXXXXXR 63
           +T G    E +R+ + +TIFG PG   L + D IY ++  ++                 +
Sbjct: 94  LTGGEIFHEMMRRHKVDTIFGFPGGAILPVFDAIYSSDVFKFVLPKHEQGAGHMAEGYAK 153

Query: 64  IKGM-SCLITTFGVGELSALNGIAGSYAEHVGVLHVVG-VPSISAQAKQLLLHHTLGNGD 121
             G    ++ T G G  + +  +A + A+ V ++   G VP  +           +G   
Sbjct: 154 ASGKPGVVLVTSGPGATNVVTPMADALADGVPMVVFTGQVPRSAIGTDAFQEADVVG--- 210

Query: 122 FTVFHRMSANISETTAMISDLATAPAEIDRCIR-TTYVRQRPVYLGLPSNFVDQMVPASL 180
                 +S + ++   M++ +   P  I+      T  R  PV + LP +     V AS+
Sbjct: 211 ------ISRSCTKWNVMVNSVEELPRRINEAFEIATSGRPGPVLVDLPKD-----VTASV 259

Query: 181 LETPIDL-SLKPNDAAAE-------QEVVSTVLD---LIKNAKNPVILADACASRHDVKA 229
           L++PI + S  P++   E       Q  V T+ +   LI  AK P++   A    +++  
Sbjct: 260 LKSPIPMTSTLPSNTLEELTRHVVDQHTVKTIANAAKLINMAKKPLLYVGAGILNNELGP 319

Query: 230 ET-KKLIDVTQFPSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESSDLILSVGAL 288
           +  K+L +  Q P   T  G G+ D+  P+   + +G   S A   A++++D+I+++GA 
Sbjct: 320 KVLKELAERAQIPVTTTLHGLGAFDQDDPKSLDM-LGMHGSAAANIAIQNADVIVALGAR 378

Query: 289 LSDFNTGSFS 298
             D  TG+ +
Sbjct: 379 FDDRVTGNVA 388

>Suva_13.287 Chr13 (465217..467280) [2064 bp, 687 aa] {ON} YMR108W
           (REAL)
          Length = 687

 Score = 57.0 bits (136), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 69/304 (22%), Positives = 123/304 (40%), Gaps = 32/304 (10%)

Query: 4   ITLGRYLFERLRQVECNTIFGLPGDFNLRLLDEIYETEGMRWXXXXXXXXXXXXXXXXXR 63
           +T G+   E + +   +T+FG PG   L + D I+ ++   +                 R
Sbjct: 92  LTGGQIFNEMMSRHNVDTVFGYPGGAILPVYDAIHNSDKFTFVLPRHEQGAGHMAEGYAR 151

Query: 64  IKGM-SCLITTFGVGELSALNGIAGSYAEHVGVLHVVG-VPSISAQAKQLLLHHTLGNGD 121
             G    ++ T G G  + +  +A ++A+ + ++   G VP+ +           +G   
Sbjct: 152 ASGKPGVVLVTSGPGATNVVTPMADAFADGIPMVVFTGQVPTSAIGTDAFQEADVVG--- 208

Query: 122 FTVFHRMSANISETTAMISDLATAPAEIDRCIR-TTYVRQRPVYLGLPSNFVDQMVPASL 180
                 +S + ++   M+  +   P  I+      T  R  PV + LP +     V A++
Sbjct: 209 ------ISRSCTKWNVMVKSVEELPLRINEAFEIATSGRPGPVLVDLPKD-----VTAAI 257

Query: 181 LETPI------------DLSLKPNDAAAEQEVVSTVLDLIKNAKNPVILADACASRH-DV 227
           L  PI             L+ +  D    Q  ++   DLI  AK PV+   A    H D 
Sbjct: 258 LRNPIPTKTTLPSNALNQLTSRTQDEFVLQN-INKAADLINLAKKPVLYVGAGILNHADG 316

Query: 228 KAETKKLIDVTQFPSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESSDLILSVGA 287
               K+L D  Q P   T  G G+ D++ P+   + +G         AV+++DL+++VGA
Sbjct: 317 PRLLKELSDRAQIPVTTTLQGLGAFDQEDPKSLDM-LGMHGCATANLAVQNADLLIAVGA 375

Query: 288 LLSD 291
              D
Sbjct: 376 RFDD 379

>ZYRO0G19954g Chr7 (1653353..1655455) [2103 bp, 700 aa] {ON} highly
           similar to uniprot|P07342 Saccharomyces cerevisiae
           YMR108W ILV2 Acetolactate synthase catalyses the first
           common step in isoleucine and valine biosynthesis and is
           the target of several classes of inhibitors localizes to
           the mitochondria expression of the gene is under general
           amino acid control
          Length = 700

 Score = 55.8 bits (133), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 71/311 (22%), Positives = 127/311 (40%), Gaps = 32/311 (10%)

Query: 4   ITLGRYLFERLRQVECNTIFGLPGDFNLRLLDEIYETEGMRWXXXXXXXXXXXXXXXXXR 63
           +T G+   E +R+ + +T+FG PG   L + D I+E++   +                 R
Sbjct: 104 LTGGQIFHEMMRRHDVDTVFGYPGGAILPVYDAIHESDAFNFILPRHEQGAGHMAEGYAR 163

Query: 64  IKGM-SCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNGDF 122
             G    ++ T G G  + +  +  + A+ V ++   G  + SA          +G   F
Sbjct: 164 ATGRPGVVLVTSGPGATNVVTPMTDALADGVPLIVFTGQVATSA----------IGTDAF 213

Query: 123 TVFH--RMSANISETTAMISDLATAPAEIDRCIRTTYV-RQRPVYLGLPSNFVDQMVPAS 179
                  +S + ++   M+ ++   P  I+         R  PV + LP +     V A+
Sbjct: 214 QEADVVGISRSCTKWNVMVKNVEELPKRINEAFEIAMSGRPGPVLVDLPKD-----VTAA 268

Query: 180 LLETPIDL-SLKPNDAAAE----------QEVVSTVLDLIKNAKNPVILADA-CASRHDV 227
           +L  PI   S  P+D+ A+             V    DL+  AK P++   A   +  D 
Sbjct: 269 VLRNPIPTKSTLPSDSLAQLTKRAQDEFTSNNVKRAADLVNVAKKPILYVGAGIFNNPDG 328

Query: 228 KAETKKLIDVTQFPSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESSDLILSVGA 287
               K+L +  Q P   T  G G+ D++  +   + +G         A++++DLIL+VGA
Sbjct: 329 PRLLKELSERAQIPVTTTLQGLGAFDQEDTKSLDM-LGMHGCATANLAIQNADLILAVGA 387

Query: 288 LLSDFNTGSFS 298
              D  T + S
Sbjct: 388 RFDDRVTCNIS 398

>KNAG0A06250 Chr1 complement(948840..950882) [2043 bp, 680 aa] {ON}
           Anc_2.441 YMR108W
          Length = 680

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 68/309 (22%), Positives = 125/309 (40%), Gaps = 30/309 (9%)

Query: 4   ITLGRYLFERLRQVECNTIFGLPGDFNLRLLDEIYETEGMRWXXXXXXXXXXXXXXXXXR 63
           +T G+   E + +   +T+FG PG   L + D I+E+   ++                 R
Sbjct: 84  MTGGQIFHEMMIRNNVDTVFGYPGGAILPVYDAIHESSAFKFVLPKHEQGAGHMAEGYAR 143

Query: 64  IKGM-SCLITTFGVGELSALNGIAGSYAEHVGVLHVVG-VPSISAQAKQLLLHHTLGNGD 121
             G    ++ T G G  + +  +A + A+ + ++   G VP+ +           LG   
Sbjct: 144 ASGKPGVVLVTSGPGATNVVTPMADALADGIPMVVFTGQVPTSAIGTDAFQEADVLG--- 200

Query: 122 FTVFHRMSANISETTAMISDLATAPAEIDRCIRTTYV-RQRPVYLGLPSNFVDQMVPASL 180
                 +S + ++   M+ ++A  P  I+         R  PV + LP +     V A++
Sbjct: 201 ------ISRSCTKWNIMVKNVAEMPKRINEAFDIAMSGRPGPVLVDLPKD-----VTAAI 249

Query: 181 LETPIDL-SLKPNDA----------AAEQEVVSTVLDLIKNAKNPVI-LADACASRHDVK 228
           L  PI + S  P             A  +E +     LI  AK PV+ +     +  +  
Sbjct: 250 LRNPIPVESTLPTSTLKNLVGDMHDAFTKERIEKAAKLINIAKKPVLYVGGGILNNPEGP 309

Query: 229 AETKKLIDVTQFPSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESSDLILSVGAL 288
              K L D  Q P   T  G G+ D++ P+   + +G   S     +++++DLI+++G  
Sbjct: 310 KLLKTLSDRAQIPVTTTIQGLGAFDQEDPKSLDM-LGMHGSAVANLSIQNADLIIAIGTR 368

Query: 289 LSDFNTGSF 297
             D  TG+ 
Sbjct: 369 FDDRVTGNL 377

>Skud_13.267 Chr13 (459466..461529) [2064 bp, 687 aa] {ON} YMR108W
           (REAL)
          Length = 687

 Score = 55.1 bits (131), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 71/303 (23%), Positives = 125/303 (41%), Gaps = 30/303 (9%)

Query: 4   ITLGRYLFERLRQVECNTIFGLPGDFNLRLLDEIYETEGMRWXXXXXXXXXXXXXXXXXR 63
           +T G+   E + +   +T+FG PG   L + D I+ ++   +                 R
Sbjct: 92  LTGGQIFNEMMSRQNVDTVFGYPGGAILPVYDAIHNSDKFNFVLPKHEQGAGHMAEGYAR 151

Query: 64  IKGM-SCLITTFGVGELSALNGIAGSYAEHVGVLHVVG-VPSISAQAKQLLLHHTLGNGD 121
             G    ++ T G G  + +  +A ++A+ + ++   G VP+ +           +G   
Sbjct: 152 ASGKPGVVLVTSGPGATNVVTPMADAFADGIPMVVFTGQVPTSAIGTDAFQEADVVG--- 208

Query: 122 FTVFHRMSANISETTAMISDLATAPAEIDRCIR-TTYVRQRPVYLGLPSNFVDQMVPASL 180
                 +S + ++   M+  +   P  I+      T  R  PV + LP +     V A++
Sbjct: 209 ------ISRSCTKWNVMVKTVEELPLRINEAFEIATSGRPGPVLVDLPKD-----VTAAI 257

Query: 181 LETPIDLSLK-PNDA------AAEQEVV----STVLDLIKNAKNPVILADA-CASRHDVK 228
           L  PI      P++A       A+ E V    S   DLI  AK PV+   A   +  D  
Sbjct: 258 LRNPIPTKTTLPSNALNQLTSHAQDEFVMQSISKAADLINLAKKPVLYVGAGILNNADGP 317

Query: 229 AETKKLIDVTQFPSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESSDLILSVGAL 288
              K+L +  Q P   T  G GS D++ P+   + +G         AV+++DL+++VGA 
Sbjct: 318 RLLKELSERAQIPVTTTLQGLGSFDQEDPKSLDM-LGMHGCVTANLAVQNADLLIAVGAR 376

Query: 289 LSD 291
             D
Sbjct: 377 FDD 379

>TPHA0G02440 Chr7 complement(498107..500182) [2076 bp, 691 aa] {ON}
           Anc_2.441 YMR108W
          Length = 691

 Score = 54.3 bits (129), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 67/303 (22%), Positives = 123/303 (40%), Gaps = 30/303 (9%)

Query: 4   ITLGRYLFERLRQVECNTIFGLPGDFNLRLLDEIYETEGMRWXXXXXXXXXXXXXXXXXR 63
           +T G    E +++   +T+FG PG   L + D IY ++   +                 R
Sbjct: 94  LTGGEIFHEMMKRHNVDTVFGYPGGAILPVYDAIYNSKDFNFVLPRHEQGAGHMAEGYAR 153

Query: 64  IKG-MSCLITTFGVGELSALNGIAGSYAEHVGVLHVVG-VPSISAQAKQLLLHHTLGNGD 121
             G    ++ T G G  + +  IA + A+ V ++   G VP+ +           +G   
Sbjct: 154 ASGKCGVVLVTSGPGATNVITPIADALADGVPMVVFTGQVPTAAIGTDAFQEADVIG--- 210

Query: 122 FTVFHRMSANISETTAMISDLATAPAEIDRCIR-TTYVRQRPVYLGLPSNFVDQMVPASL 180
                 +S + ++   M+  +   P  I+      T  R  PV + LP +     V AS+
Sbjct: 211 ------ISRSCTKWNVMVKRIEDLPKCINEAFEIATSGRPGPVLVDLPKD-----VQASI 259

Query: 181 LETPIDLSLK-PNDAAAE----------QEVVSTVLDLIKNAKNPVI-LADACASRHDVK 228
           L+TPI +    P++A             +  +    +LI  AK P++ +     +  +  
Sbjct: 260 LKTPIPIKTTIPSNALRHLTRNVQTQFSEVAIKRAAELINIAKKPILYVGGGILNNPEGP 319

Query: 229 AETKKLIDVTQFPSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESSDLILSVGAL 288
              K+L D  Q P   T    G+ D++ P+   + +G         A++++DLI++VGA 
Sbjct: 320 RLIKELSDRAQIPVTTTLQALGAFDQEDPKSLDM-LGMHGHAPANLAMQNADLIIAVGAR 378

Query: 289 LSD 291
             D
Sbjct: 379 FDD 381

>TDEL0A02160 Chr1 complement(389068..391116) [2049 bp, 682 aa] {ON}
           Anc_2.441 YMR108W
          Length = 682

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 65/304 (21%), Positives = 124/304 (40%), Gaps = 32/304 (10%)

Query: 4   ITLGRYLFERLRQVECNTIFGLPGDFNLRLLDEIYETEGMRWXXXXXXXXXXXXXXXXXR 63
           +T G+   E + +   +T+FG PG   L + D I++++   +                 R
Sbjct: 87  LTGGQIFHEMMIRHNVDTVFGYPGGAILPVYDAIHDSKSFNFVLPRHEQGAGHMAEGYAR 146

Query: 64  IKGM-SCLITTFGVGELSALNGIAGSYAEHVGVLHVVG-VPSISAQAKQLLLHHTLGNGD 121
             G    ++ T G G  + +  +A + A+ V ++   G VP+ +           +G   
Sbjct: 147 ASGKPGVVLVTSGPGATNVVTPMADALADGVPMVVFTGQVPTSAIGTDAFQEADVVG--- 203

Query: 122 FTVFHRMSANISETTAMISDLATAPAEIDRCIRTTYV-RQRPVYLGLPSNFVDQMVPASL 180
                 +S + ++   M+  +   P  I+         R  PV + LP +     V A++
Sbjct: 204 ------ISRSCTKWNVMVRSIEELPLRINEAFEIAVSGRPGPVLVDLPKD-----VTAAI 252

Query: 181 LETPI------------DLSLKPNDAAAEQEVVSTVLDLIKNAKNPVILADACASRHDVK 228
           L+ PI             L+ +  D +  + +V T  DL+  AK PV+   A    +   
Sbjct: 253 LKNPIPTKTTLPSNSLAQLTKRAMDESTNENIVRTA-DLLNKAKTPVLYVGAGILNNPAG 311

Query: 229 AE-TKKLIDVTQFPSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESSDLILSVGA 287
            +  K+L +  Q P   T    G+ D++ P+   + +G         A++++DLIL+VG+
Sbjct: 312 PKLLKELSERAQIPVTTTIQALGAFDQQDPKSLDM-LGMHGCATANMAIQNADLILAVGS 370

Query: 288 LLSD 291
              D
Sbjct: 371 RFDD 374

>NCAS0A04320 Chr1 complement(873722..875791) [2070 bp, 689 aa] {ON}
           Anc_2.441 YMR108W
          Length = 689

 Score = 52.0 bits (123), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 71/314 (22%), Positives = 128/314 (40%), Gaps = 38/314 (12%)

Query: 4   ITLGRYLFERLRQVECNTIFGLPGDFNLRLLDEIYETEGMRWXXXXXXXXXXXXXXXXXR 63
           +T G+   E + +   +TIFG PG   L + D I++++  ++                 R
Sbjct: 94  LTGGQIFHEMILRNNVDTIFGYPGGAILPVYDAIHDSKSFQFILPKNEQGAGHMAEGYAR 153

Query: 64  IKGM-SCLITTFGVGELSALNGIAGSYAEHVGVLHVVG-VPSISAQAKQLLLHHTLGNGD 121
             G    ++ T G    + +  +A + A+ V ++   G VP+ +           LG   
Sbjct: 154 ASGKPGVVLVTSGPAATNVITPMADALADGVPMVVFTGQVPTSAIGTDAFQEADVLG--- 210

Query: 122 FTVFHRMSANISETTAMISDLATAPAEIDRCIRTTYV-----RQRPVYLGLPSNFVDQMV 176
                 +S + ++   M+  +   P    RCI   +      R  PV + LP +     V
Sbjct: 211 ------ISRSCTKWNVMVRTVDDMP----RCINEAFEIAMSGRPGPVLVDLPKD-----V 255

Query: 177 PASLLETPIDL-SLKPNDAAAE----------QEVVSTVLDLIKNAKNPVILADA-CASR 224
            A++L  PI + S  P+ A ++           E +     LI  AK PV+   A   + 
Sbjct: 256 TAAILRNPIPVKSTLPSSALSQITKLAHDEFTMENIERAAALINIAKKPVLYVGAGILNN 315

Query: 225 HDVKAETKKLIDVTQFPSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESSDLILS 284
            D     K+L D  Q P   T  G G+ D++ P+   + +G         AV+++DL+++
Sbjct: 316 VDGPRIIKELSDRAQIPVTTTIQGLGAFDQEDPKSLDM-LGMHGCATANLAVQNADLVIA 374

Query: 285 VGALLSDFNTGSFS 298
           +G    D  TG+ +
Sbjct: 375 LGTRFDDRVTGNIT 388

>AEL305C Chr5 complement(69381..71387) [2007 bp, 668 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR108W
           (ILV2)
          Length = 668

 Score = 52.0 bits (123), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 71/307 (23%), Positives = 127/307 (41%), Gaps = 30/307 (9%)

Query: 7   GRYLFERLRQVECNTIFGLPGDFNLRLLDEIYETEGMRWXXXXXXXXXXXXXXXXXRIKG 66
           G    E +R+   +T+FG PG   L + D IY ++   +                 R  G
Sbjct: 76  GEIFHEMMRRHNVDTVFGYPGGAILPVYDAIYNSDAFNFVLPKHEQGAGHMAEGYARASG 135

Query: 67  M-SCLITTFGVGELSALNGIAGSYAEHVGVLHVVG-VPSISAQAKQLLLHHTLGNGDFTV 124
               ++ T G G  + +  +A + A+ V ++   G VP  +           +G      
Sbjct: 136 KPGVVLVTSGPGATNVVTPMADALADGVPMVVFTGQVPKAAIGTDAFQEADVVG------ 189

Query: 125 FHRMSANISETTAMISDLATAPAEIDRCIR-TTYVRQRPVYLGLPSNFVDQMVPASLLET 183
              +S + ++   M++ +   P  I+      T  R  PV + LP +     V A++L +
Sbjct: 190 ---ISRSCTKWNVMVNHVEELPRRINEAFEIATSGRPGPVLVDLPKD-----VTAAILRS 241

Query: 184 PIDL-SLKPNDA-------AAEQEVVSTVLD---LIKNAKNPVILADACASRHDVKAE-T 231
           PI L S  P+         AA+ + V ++ D   LI  A+ PV+   A         E  
Sbjct: 242 PIPLASALPSTTLAQLTRQAADIDGVRSLADASRLINMAQKPVLYVGAGILNSTRGPEFL 301

Query: 232 KKLIDVTQFPSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESSDLILSVGALLSD 291
           ++L +  Q P   T    G+ D++  +   + +G   S A    V+++DLI+++GA   D
Sbjct: 302 RELAEKAQIPVTTTLQALGAFDQEDSKSVDM-LGMHGSAAANLTVQNADLIIALGARFDD 360

Query: 292 FNTGSFS 298
             TG+ +
Sbjct: 361 RVTGNIA 367

>NDAI0E02050 Chr5 complement(414418..416490) [2073 bp, 690 aa] {ON}
           Anc_2.441
          Length = 690

 Score = 52.0 bits (123), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 69/310 (22%), Positives = 118/310 (38%), Gaps = 30/310 (9%)

Query: 4   ITLGRYLFERLRQVECNTIFGLPGDFNLRLLDEIYETEGMRWXXXXXXXXXXXXXXXXXR 63
           +T G+   E + +   +T+FG PG   L + D I+++    +                 R
Sbjct: 95  LTGGQIFHEMILRNNVDTVFGYPGGAILPVYDAIHDSSAFNFVLPKNEQGAGHMAEGYAR 154

Query: 64  IKGM-SCLITTFGVGELSALNGIAGSYAEHVGVLHVVG-VPSISAQAKQLLLHHTLGNGD 121
             G    ++ T G    + +  +A + A+ V ++   G VP+ +           LG   
Sbjct: 155 ASGKPGVVLVTSGPAATNVITPMADALADGVPMVVFTGQVPTSAIGTDAFQEADVLG--- 211

Query: 122 FTVFHRMSANISETTAMISDLATAPAEIDRCIRTTYVRQR-PVYLGLPSNFVDQMVPASL 180
                 +S + ++   M+  +   P  I+        R+  PV + LP +     V A++
Sbjct: 212 ------ISRSCTKWNVMVRSVEEMPRRINEAFEIAMSRRPGPVLVDLPKD-----VTAAI 260

Query: 181 LETPIDLSLKPNDAAAEQ-----------EVVSTVLDLIKNAKNPVILADA-CASRHDVK 228
           L  PI +       A  Q           E +    DLI  AK PV+   A   +  +  
Sbjct: 261 LRNPIPVKTTLPSGALSQLTKLAHDEFILENIKKAADLINIAKKPVLYVGAGILNNMEGP 320

Query: 229 AETKKLIDVTQFPSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESSDLILSVGAL 288
              K L    + P   T  G G+ D++ P      +G         AV++SDLI++VG  
Sbjct: 321 RILKDLSQRAKIPVTTTIQGLGAFDQEDP-LSLDMLGMHGCATANLAVQNSDLIIAVGTR 379

Query: 289 LSDFNTGSFS 298
             D  TG+ S
Sbjct: 380 FDDRVTGNIS 389

>TPHA0G02885 Chr7 complement(616977..619043) [2067 bp, 688 aa] {ON}
          Length = 688

 Score = 50.8 bits (120), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 65/303 (21%), Positives = 121/303 (39%), Gaps = 30/303 (9%)

Query: 4   ITLGRYLFERLRQVECNTIFGLPGDFNLRLLDEIYETEGMRWXXXXXXXXXXXXXXXXXR 63
           +T G    E +++   +T+FG PG   L + D IY ++   +                 R
Sbjct: 91  LTGGEIFHEMMKRHNVDTVFGYPGGAILPVYDAIYNSKDFNFVLPRHEQGAGHMAEGYAR 150

Query: 64  IKG-MSCLITTFGVGELSALNGIAGSYAEHVGVLHVVG-VPSISAQAKQLLLHHTLGNGD 121
             G    ++ T G G  + +  +A + A+ V ++   G VP+ +           +G   
Sbjct: 151 ASGKCGVVLVTSGPGATNVITPMADALADGVPMVVFTGQVPTAAIGTDAFQEADVIG--- 207

Query: 122 FTVFHRMSANISETTAMISDLATAPAEIDRCIR-TTYVRQRPVYLGLPSNFVDQMVPASL 180
                 +S + ++   M+  +   P  I+      T  R  PV + LP +     V AS+
Sbjct: 208 ------ISRSCTKWNVMVKRVEDLPKCINEAFEIATSGRPGPVLVDLPKD-----VQASI 256

Query: 181 LETPIDLSLK-PNDAAAE----------QEVVSTVLDLIKNAKNPVI-LADACASRHDVK 228
           L  PI +    P++A  +          +  +    +LI  AK P++ +     +  +  
Sbjct: 257 LRAPIPIKTTIPSNALKQLTRSAYTQFSEAGIKRAAELINIAKKPILYVGGGILNNPEGP 316

Query: 229 AETKKLIDVTQFPSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESSDLILSVGAL 288
              K+L D  Q P   T    G+ D+  P+   + +G         A++++DLI++VGA 
Sbjct: 317 RLIKELSDRAQIPVTTTLQALGAFDQDDPKSLDM-LGMHGYAPANLAIQNADLIIAVGAR 375

Query: 289 LSD 291
             D
Sbjct: 376 FDD 378

>SAKL0D10934g Chr4 (907649..909301) [1653 bp, 550 aa] {ON} similar
           to uniprot|P39994 Saccharomyces cerevisiae YEL020C
           Hypothetical ORF
          Length = 550

 Score = 50.4 bits (119), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 77/361 (21%), Positives = 141/361 (39%), Gaps = 54/361 (14%)

Query: 164 YLGLPSNFV------DQMVPASLLETPIDLSLKPNDAAAEQEVVSTVLDLIKNAKNPVIL 217
           Y+ +P N +      ++ +   ++ +P+  S  P        VVS V  LI N ++  IL
Sbjct: 153 YIDIPGNLITEEDCIEERISGKIIISPVRCSPDP-------LVVSEVARLIANNEHKEIL 205

Query: 218 ADACASRHDVKAETKKLIDVTQFPSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVE 277
                   +   E ++ +D  Q P   TPM KG + + HP    + V +  S A+++A  
Sbjct: 206 VVIGKGAVNCANEIRRFVDQFQLPFLPTPMAKGVVPDSHP----LNVSSARSLALRKA-- 259

Query: 278 SSDLILSVGALLS-DFNTGSFSYSYKTKNIVEFHSDHIKIRNATFPGVQMKFV--LQKLL 334
             D++L +GA L+   + G       T   V+F     ++ +    G+       +   L
Sbjct: 260 --DVVLLLGARLNWILHFGEPPKWKDTVKFVQFDYTPEELGHNNVAGLNYSLCGDIGLSL 317

Query: 335 TQVGDVVKDYKPVAIPEIPGPNAAVD---DSTPLKQQ----------WLWNQV----GKF 377
            ++G  +  +K        G N A+    D+  LK +            +NQV     ++
Sbjct: 318 EELGSKLHAFK------YRGLNNAIREKIDTNELKLRGKERETRTALLHYNQVYALMRQY 371

Query: 378 LQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIXXXXXXXXXXXXXXXXXDKNKR 437
           + + + ++   G +   + +  FP + Y   ++  G+                  D  K 
Sbjct: 372 ITDDETILVTEGANTMDVARISFPTD-YPKRKLDAGT-NATMGIGLGYALAAKASDTTKT 429

Query: 438 VILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNNGYTIEKLIHGEFAQYNEIQPWNHLD 497
           VI   GD +   +  E+ T +R  L   + V+NN+G     + HG   Q  E  P   L 
Sbjct: 430 VICIQGDSAFGFSAMELETAVRCSLPLVVVVMNNSG-----IYHGTVDQSVEKLPSTALS 484

Query: 498 L 498
            
Sbjct: 485 F 485

>TDEL0B05520 Chr2 complement(980893..982560) [1668 bp, 555 aa] {ON}
           Anc_1.450 YEL020C
          Length = 555

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 66/290 (22%), Positives = 116/290 (40%), Gaps = 35/290 (12%)

Query: 9   YLFERLRQVECNTIFGLPGDFNLRLLDEIYETEGMRWXXXXXXXXXXXXXXXXXRIKGM- 67
           Y  + L+Q   +T+FG+ G   + L D +   +G+++                  + G  
Sbjct: 8   YFTQLLQQYGVDTVFGIVGIPIVELADTMI-GKGIKFIACRNEQSASYAASAYGYLTGKP 66

Query: 68  SCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNGDFTVFHR 127
             L+   G G + AL GI  S +    ++ + G                L  G F    +
Sbjct: 67  GVLLVVGGPGLIHALAGIYNSMSNRWPLIVIAGS------------SEDLHKGGFQELDQ 114

Query: 128 MSANISETTAMISDLATAPAEIDRCIRTTYVRQRPVYLGLPS-NFVDQMVPASLLETPID 186
           +S  +S+       L T P  I+     TY   R    G P   ++D   P SL+   I+
Sbjct: 115 VSL-LSDHLKFTGKLTTDPDVIEL---VTYNAMRLTTTGTPGVTYID--FPGSLISESIE 168

Query: 187 LSLKPNDAAA------EQEVVSTVLDLIKNAKNPVILADACASRHDVKAETKKLIDVTQF 240
            S  P  + +      + E +  V+ L+ + +N  IL        +   E +KLI+    
Sbjct: 169 RSPYPVQSISRIQYMPDTESLQRVVKLLSSDQNKRILVVIGKGAVNASNEVRKLINDYNL 228

Query: 241 PSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESSDLILSVGALLS 290
           P   TPM KG + + HP          +S A  +A++ ++++L +GA L+
Sbjct: 229 PFLSTPMAKGVVPDSHP--------LNASSARSKALKEAEIVLVLGARLN 270

>ZYRO0E03454g Chr5 complement(270926..272575) [1650 bp, 549 aa] {ON}
           similar to uniprot|P39994 Saccharomyces cerevisiae
           YEL020C Hypothetical ORF
          Length = 549

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 96/493 (19%), Positives = 184/493 (37%), Gaps = 50/493 (10%)

Query: 9   YLFERLRQVECNTIFGLPGDFNLRLLDEIYETEGMRWXXXXXXXXXXXXXXXXXRIKGM- 67
           Y    L+    +T+FG+ G   + L D + E  G+++                  + G  
Sbjct: 6   YFTRVLQNYGVDTVFGIVGIPIVELADTMIE-HGIKFIACRNEQSASYAASAYGYLTGKP 64

Query: 68  SCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNGDFTVFHR 127
             L+   G G + AL GI  S +    +L + G    S++A+          G F    +
Sbjct: 65  GVLLVVGGPGIIHALAGIYNSMSNKWPLLVLAG----SSEAQH--------RGGFQELDQ 112

Query: 128 MSANISETTAMISDLATAPAEI---DRCIRTTYVRQRPVYLGLPSNFVDQMVPASLLETP 184
           +S  +         L ++  ++   D      Y      YL +P N +   V    L  P
Sbjct: 113 VSL-LKPYVKFSGQLNSSNIDVLTYDALRLVQYTTAGATYLDIPGNLIGSTVKKDSLP-P 170

Query: 185 IDLSLKPNDAAAEQEVVSTVLDLIKNAKNPVILADACASRHDVKAETKKLIDVTQFPSFV 244
           +     P  ++ +   V  V DLI+     V++     + H    E ++ +D  Q P   
Sbjct: 171 VKNIYVPK-SSPDPSAVQEVTDLIRKNPENVLVVVGKGAVH-ASQEIRQFVDRFQLPFLP 228

Query: 245 TPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESSDLILSVGALLSDFNTGSFSYSYKTK 304
           TPMGKG + + HP    + V +  S A++EA     ++L +GA L+     + +  +   
Sbjct: 229 TPMGKGVVPDSHP----LNVSSARSRALQEA----KVVLVLGARLNWILHFASAPKWNPD 280

Query: 305 NI-VEFHSDHIKIRNATFPGVQMK------FVLQKLLTQVGDVVKDYKPVAIPEIPGPNA 357
            + ++  SD   + +  F    +         ++ +   +GD        ++      NA
Sbjct: 281 ALFIQVDSDTTTLGHNNFKSQHLSLWGDIGLTVRLITASLGDYHSQGLSPSLQSNIARNA 340

Query: 358 AV-------DDSTPLKQQWLWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQV 410
           A          S+ L    ++  +   + +   +I   G +     +  FP + Y + ++
Sbjct: 341 AKLKSQESQQVSSRLNYNVVYAHLRPLINDESTIIVSEGANTMDKARVSFPTD-YPLQRL 399

Query: 411 LWGSIXXXXXXXXXXXXXXXXXDKNKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLN 470
             G+                  + +K V++  GD +   +  +I T  R GL   + V+N
Sbjct: 400 DAGT-NATMGVGMGYALAAKVSNPDKTVLVIQGDSAFGFSAMDIETATRSGLALIVIVMN 458

Query: 471 NNGYTIEKLIHGE 483
           N G     + HG+
Sbjct: 459 NGG-----IYHGQ 466

>NCAS0G03960 Chr7 (733213..734946) [1734 bp, 577 aa] {ON} Anc_1.450
           YEL020C
          Length = 577

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 105/522 (20%), Positives = 193/522 (36%), Gaps = 95/522 (18%)

Query: 4   ITLGRYLFERLRQVECNTIFGLPGDFNLRLLDEIYETEGMRWXXXXXXXXXXXXXXXXXR 63
           +T   Y    L+Q E +T+FG+ G   + L D++ E  G+R+                  
Sbjct: 10  LTATEYFVSLLKQYEIDTVFGIVGIPIVELADKMIE-HGIRFISCRNEQAASYAASGYGY 68

Query: 64  IKGM-SCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNGDF 122
           + G  + L+   G G + AL GI  S +    ++ + G  S +++  Q+        G F
Sbjct: 69  LTGKPAVLLVVGGPGLIHALAGIYNSMSNKWPLIVIAG--SSNSETDQV--------GGF 118

Query: 123 TVFHRMSA--NISETTAMISDLATAPAEIDRCIRTTYVRQRPV---YLGLPSNFVD---- 173
               ++S      + T  ++ +    A  +      +  Q P+   Y+  P N ++    
Sbjct: 119 QDLDQVSLLNKYVKYTVKLNSINIPTALFNAY---NFAIQSPMGVTYIDFPGNLIEGNYK 175

Query: 174 -QMVPASLLETPIDLSLKPNDAAAEQEVVSTVLDLIKNAKNPV--ILADACASRHDVKAE 230
            Q  PA+    P+ +  +   +     V      +I+N+ N V  IL       H    +
Sbjct: 176 VQAQPAT---NPVSIPRRVRCSPDPNTVNEVAKLIIENSSNNVLVILGKGAVEFHK---D 229

Query: 231 TKKLIDVTQFPSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESSDLILSVGALLS 290
             K I+    P   TPM KG + + H     + V +  S A+K+A    +++L +GA L+
Sbjct: 230 INKFINTFNLPFLPTPMAKGILPDSH----NLNVSSARSKALKDA----NIVLVLGARLN 281

Query: 291 DFNTGSFSYSYKTKNI-VEFHSD--HIKIRNATFPGVQMKFVLQKLLTQVGDVVKD---- 343
                  S  +  K I ++  +D  ++ + N T   + +   L   +  + D        
Sbjct: 282 WILHFGESPKWNAKAIFIQCDNDPSNLGVNNGTNTNLSLLGDLGLTVNSLSDAFSQITLN 341

Query: 344 --YKPVAIPEIPG------------PNAAVDDSTPLKQQWLWNQVGKFLQEGDVVITETG 389
             Y+     E+ G                + D   L    ++  + K + E   V+   G
Sbjct: 342 WKYEKGISDEMRGIILKNQFKLQEKEQRLIKDKDLLNYNVVYGALRKLMDESKTVLVTEG 401

Query: 390 TSAFGINQTHFPNNT------------------YGISQVLWGSIXXXXXXXXXXXXXXXX 431
            ++  I +  FP++                   YGI+  L                    
Sbjct: 402 ANSMDIARISFPSSVPKQRLDAGTNATMGIGLGYGIAACL---------------NELRN 446

Query: 432 XDKNKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNNG 473
             + K VIL  GD +   +  EI T +R+ L   + V+NN+G
Sbjct: 447 GKRGKDVILIQGDSAFGFSGMEIETAVRFKLGLIIVVMNNSG 488

>Smik_5.87 Chr5 complement(124637..126319) [1683 bp, 560 aa] {ON}
           YEL020C (REAL)
          Length = 560

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 100/515 (19%), Positives = 202/515 (39%), Gaps = 62/515 (12%)

Query: 8   RYLFERLRQVECNTIFGLPGDFNLRLLDEIYETEGMRWXXXXXXXXXXXXXXXXXRIKGM 67
           +Y  E L++   +T+FG+ G   ++L D +  ++G+++                  +   
Sbjct: 7   QYFAELLQRYGIDTVFGIVGIPIVQLADTMV-SKGIKFIPCRNEQAASYAASAYGYVNDK 65

Query: 68  -SCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAK---QLLLHHTLGNGDFT 123
              L+   G G + +L GI  S +    +L + G  S     K   Q L   +L     +
Sbjct: 66  PGVLLIVGGPGLIHSLAGIYNSMSNRWPLLVIAGSSSHGDTHKGGFQELDQVSL----LS 121

Query: 124 VFHRMSANIS-ETTAMISDLATAPAEIDRCIRTTYVRQRPVYLGLPSNFVDQMVPA---S 179
            F + +  ++ +   MI+  A     ++ CI+ T       Y+ +P++F++   P     
Sbjct: 122 PFLKFTGKLAPDNIRMITQKA-----LNHCIQGT---AGVAYIDVPADFIEYEKPLEGNC 173

Query: 180 LLETPIDLSLKPNDAAAEQEVVSTVLDLI-KNAKNPVILA---DACASRHDVKAETKKLI 235
            +   + + L PN    +   +  V+ LI KN +N +++     A  + H+V+    +LI
Sbjct: 174 HIGDELPVILTPNKCGPDPSRIKEVVQLILKNKENNILVVIGKGAVKNSHEVR----RLI 229

Query: 236 DVTQFPSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESSDLILSVGALLSDFNTG 295
           +    P   TPM KG + +  P           S A  +A++++D++L +GA L+     
Sbjct: 230 NKFNIPFLPTPMAKGIVPDSSP--------LNVSSARSQALKTADIVLVLGARLNWILHF 281

Query: 296 SFSYSYKTKNI-VEFHSDHIKI-RNATFPGVQMK------FVLQKLLTQVGDVVKDYKPV 347
             S  + +++I ++F S+   +  N   PG  +         +  L+ +V      +K  
Sbjct: 282 GASPKWNSESIFIQFDSNPETLGDNNISPGADLSVWGDIGLSVTALMEEVVRQDPCWKYS 341

Query: 348 AIPEIPGPNAAVDDSTPLKQQ----------WLWNQVGKFLQEGDVVITETGTSAFGINQ 397
            I +        + +  LK++           ++  +   + +    +   G +   I +
Sbjct: 342 GISQAIQEKIQFNQTRLLKKERTGGTQLNYHQVYGTLRPLIDDYRTFLVTEGANTMDIAR 401

Query: 398 THFPNNTYGISQVLWGSIXXXXXXXXXXXXXXXXXDKNKRVILFIGDGSLQLTVQEISTM 457
             FP N     + L                          V+L  GD +   +  EI T 
Sbjct: 402 VSFPTNAP--KRRLDAGTNATMGVGLGYALACKASHPELDVVLIQGDSAFGFSAMEIETA 459

Query: 458 IRWGLKPYLFVLNNNGYTIEKLIHGEFAQYNEIQP 492
           +R  L   + V+NN+G     + HGE    +++ P
Sbjct: 460 VRCQLALVIVVMNNSG-----IYHGEKDTGSDLPP 489

>YEL020C Chr5 complement(118617..120299) [1683 bp, 560 aa] {ON}
           Protein of unknown function with low sequence identity
           to Pdc1p; mRNA identified as translated by ribosome
           profiling data
          Length = 560

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 94/440 (21%), Positives = 166/440 (37%), Gaps = 46/440 (10%)

Query: 70  LITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAK---QLLLHHTLGNGDFTVFH 126
           L+   G G + AL GI  S +    +L + G  S S   K   Q L   +L     + F 
Sbjct: 69  LLIVGGPGLIHALAGIYNSMSNRWPLLVIAGSSSQSDIHKGGFQELDQVSL----LSPFL 124

Query: 127 RMSANISETTAMISDLATAPAEIDRCIRTTYVRQRPVYLGLPSNFVDQMVPA---SLLET 183
           + +  ++       D+ T  A ++ CI+ T       Y+ +P++F++   P         
Sbjct: 125 KFTGKLTPDNI---DMITQKA-LNYCIQGTAGVS---YIDVPADFIEYEKPLEGNDRTGN 177

Query: 184 PIDLSLKPNDAAAEQEVVSTVLDLIKNAKNPVILADACASRHDVKAETKKLIDVTQFPSF 243
            + + L PN    +   +  V+ LI   KN  IL            E ++L++    P  
Sbjct: 178 ELPMILTPNICGPDPSKIKKVVQLILQHKNKNILIVIGKGAVKNSHEIRRLVNTFNLPFL 237

Query: 244 VTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESSDLILSVGALLSDFNTGSFSYSYKT 303
            TPM KG + +  P           S A  +A++ +D++L +GA L+       S  + +
Sbjct: 238 PTPMAKGIVPDSSP--------LNVSSARSQALKIADIVLVLGARLNWILHFGTSPKWNS 289

Query: 304 KNI-VEFHSDHIKI-RNATFPGVQMKFVLQKLLTQVGDVVKDYKPVAIPEIPGPNAAVDD 361
           ++I ++F S+   +  N   PG  +       L+    V +  +  +  +  G    + +
Sbjct: 290 ESIFIQFDSNPETLGDNNVSPGADLSIWGDIGLSVTALVEELTRQDSCWKYSGVKQEIRE 349

Query: 362 STPLKQQWL------------WNQV----GKFLQEGDVVITETGTSAFGINQTHFPNNTY 405
              L Q  L            +NQV       + +   ++   G +   I +  FP  T 
Sbjct: 350 KIQLNQTRLLRKEKTRGAQLNYNQVYGTLRPLIDDYRTILVTEGANTMDIARISFP--TD 407

Query: 406 GISQVLWGSIXXXXXXXXXXXXXXXXXDKNKRVILFIGDGSLQLTVQEISTMIRWGLKPY 465
              + L                          V+L  GD +   +  EI T +R  L   
Sbjct: 408 APRRRLDAGTNATMGIGLGYALACKASHPELDVVLIQGDSAFGFSAMEIETAVRCQLALV 467

Query: 466 LFVLNNNG-YTIEKLIHGEF 484
           + V+NN+G Y  EK I G+ 
Sbjct: 468 IVVMNNSGIYHGEKDIEGDL 487

>Kwal_34.16116 s34 complement(208847..210508) [1662 bp, 553 aa] {ON}
           YEL020C - Hypothetical ORF [contig 268] FULL
          Length = 553

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 34/130 (26%), Positives = 56/130 (43%), Gaps = 16/130 (12%)

Query: 164 YLGLPSNFVDQMVPA---SLLETPIDLSLKPNDAAAEQEVVSTVLDLIKNAKNPVILADA 220
           YL +P + ++Q V     + +     +  +P+  A ++     V DLI       +L   
Sbjct: 155 YLDIPGDLIEQSVEKEKYNCVRNITKVEYQPSKDALQR-----VADLITENSTKSLLCVI 209

Query: 221 CASRHDVKAETKKLIDVTQFPSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESSD 280
                D   E +K I+  Q P   TPM KG + + HP           S A   A+ S+D
Sbjct: 210 GKGATDSSMEVRKFIERFQLPFLPTPMAKGVVPDSHP--------LNVSSARSLALRSAD 261

Query: 281 LILSVGALLS 290
           ++L +GA L+
Sbjct: 262 IVLVLGARLN 271

>KLTH0H14102g Chr8 (1226474..1228129) [1656 bp, 551 aa] {ON} similar
           to uniprot|P39994 Saccharomyces cerevisiae YEL020C
           Hypothetical ORF
          Length = 551

 Score = 40.8 bits (94), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 37/130 (28%), Positives = 61/130 (46%), Gaps = 16/130 (12%)

Query: 164 YLGLPSNFVDQMVPA--SLLETPI-DLSLKPNDAAAEQEVVSTVLDLIKNAKNPVILADA 220
           YL +P+N +DQ V    S     I  +S +P DAA ++     V  L+   ++  IL   
Sbjct: 153 YLDIPANVIDQEVEKNESFSRRHIAKISYQPTDAALQR-----VAKLLNANRDKNILCVI 207

Query: 221 CASRHDVKAETKKLIDVTQFPSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESSD 280
                +   + +  +D  Q P   TPM KG + + H     + V +  S A+K    S+D
Sbjct: 208 GKGATENAQQIRPFVDEFQLPFLSTPMAKGVVPDSH----ALNVSSARSLALK----SAD 259

Query: 281 LILSVGALLS 290
           ++L +GA L+
Sbjct: 260 IVLVLGARLN 269

>KAFR0K01290 Chr11 complement(267309..268724) [1416 bp, 471 aa] {ON}
           Anc_5.660 YOR059C
          Length = 471

 Score = 39.3 bits (90), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 45/88 (51%), Gaps = 4/88 (4%)

Query: 314 IKIRNATFPGVQMKFVLQKLLTQVGDVVKDYKPVAIPEIPGPNAAVDDSTPL--KQQWLW 371
           I I   +  G+  +FV+ K+ T+  +  +D +PV    +  P+  +    PL  K +WL 
Sbjct: 87  ISIVGYSLGGLIARFVVGKMFTECREFFQDIEPVMFLTMATPHLGIHFYNPLSIKYKWLL 146

Query: 372 NQVGKFLQEGDVVITETGTSAFGINQTH 399
           + V  FL  G  +I ++G   F +N+++
Sbjct: 147 DPVLTFL--GSTLIGKSGRELFIMNRSN 172

>Skud_5.76 Chr5 complement(117925..119607) [1683 bp, 560 aa] {ON}
           YEL020C (REAL)
          Length = 560

 Score = 38.5 bits (88), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 34/153 (22%), Positives = 68/153 (44%), Gaps = 15/153 (9%)

Query: 141 DLATAPAEIDRCIRTTYVRQRPVYLGLPSNFVDQMVPAS---LLETPIDLSLKPNDAAAE 197
           D+ T  A ++ CI+ T       Y+ +P++F++   P      +   + + L P     +
Sbjct: 136 DMVTQKA-LNHCIQGTAGVS---YIDVPADFIESEKPLEGNDYIANELPMILTPKKCGPD 191

Query: 198 QEVVSTVLDLIKNAKNPVILADACASRHDVKAETKKLIDVTQFPSFVTPMGKGSIDEKHP 257
              +  ++ LI + ++  IL            E ++LI+    P   TPM KG + +  P
Sbjct: 192 PSQIKEIVQLILHHRDNNILIVIGKGAVKNSHEIRRLINKFNLPFLPTPMAKGIVPDSSP 251

Query: 258 RFGGVYVGTLSSPAVKEAVESSDLILSVGALLS 290
                      S A  +A++++D++L +GA L+
Sbjct: 252 --------LNVSSARSQALKTADVVLVLGARLN 276

>KNAG0H01580 Chr8 complement(279178..280860) [1683 bp, 560 aa] {ON}
           Anc_1.450 YEL020C
          Length = 560

 Score = 37.0 bits (84), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 26/96 (27%), Positives = 42/96 (43%), Gaps = 6/96 (6%)

Query: 164 YLGLPSNFVD-QMVPASL--LETPIDLSLKPNDAAAEQEVVSTVLDLIKNAKNPVILADA 220
           Y+ +P N ++ Q V A    L  P+    +P   + +   V  V  LI   ++  +L   
Sbjct: 156 YVDIPGNLIETQAVCAGTPGLLPPVP---QPIKCSPDPHTVKRVASLILENRDKKVLVVV 212

Query: 221 CASRHDVKAETKKLIDVTQFPSFVTPMGKGSIDEKH 256
                   A  ++ ID   FP   TPMGKG + ++H
Sbjct: 213 GKGSQGAFAAVRRFIDEFNFPFLPTPMGKGVVPDEH 248

>Suva_5.68 Chr5 (108954..110639) [1686 bp, 561 aa] {ON} YEL020C
           (REAL)
          Length = 561

 Score = 35.8 bits (81), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 33/154 (21%), Positives = 65/154 (42%), Gaps = 16/154 (10%)

Query: 141 DLATAPAEIDRCIRTTYVRQRPVYLGLPSNFVDQ----MVPASLLETPIDLSLKPNDAAA 196
           D+ T  A ++ CI+ T       Y+  P++ ++     +     L   + + L PN    
Sbjct: 136 DMVTRKA-LNHCIQGTMGVS---YIDFPADLIENEKKSLAGNDHLVNELPMILTPNKCGP 191

Query: 197 EQEVVSTVLDLIKNAKNPVILADACASRHDVKAETKKLIDVTQFPSFVTPMGKGSIDEKH 256
           +   +  ++ LI   ++  IL            E ++L+     P   TPM KG + +  
Sbjct: 192 DPSKIEEIVQLILQNRDKNILIVIGKGAVKNSHEIRRLVSSFNLPFLPTPMAKGIVPDSS 251

Query: 257 PRFGGVYVGTLSSPAVKEAVESSDLILSVGALLS 290
           P           S A  +A++++D++L +GA L+
Sbjct: 252 P--------LNVSSARSQALKTADIVLVLGARLN 277

>Ecym_1360 Chr1 (739963..741597) [1635 bp, 544 aa] {ON} similar to
           Ashbya gossypii AEL055C
          Length = 544

 Score = 35.8 bits (81), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 62/345 (17%), Positives = 138/345 (40%), Gaps = 46/345 (13%)

Query: 153 IRTTYVRQRPVYLGLPSNFVDQMVPASLLETPIDLSLKPNDAAAEQEVVSTVLDLIKNAK 212
           ++T+ ++    Y+ +P   +++   +S  E P  + +       + + V  V  ++++ K
Sbjct: 139 MKTSMLQNAVTYIDIPGGLIEEKAKSSD-ELPKKMEIAHIRCGPDIQRVKEVATIMQSGK 197

Query: 213 NPVILADACASRHDVKAETKKLIDVTQFPSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAV 272
             +++    ++ +   AE +  ++  Q P   TPM KG + + H     + V    S A+
Sbjct: 198 KILVVVGRGSANY--PAEVRAFLEKYQLPFLPTPMAKGIVPDTHE----LNVNGARSLAL 251

Query: 273 KEAVESSDLILSVGALLS--------------------DFNTGSFSYSYKTKNIVEFHSD 312
           K    S++++L +GA L+                    D +  +   +         HSD
Sbjct: 252 K----SAEVVLILGARLNWILHFGLEPKWSDDACFIQVDRDLSALGTNNPRGVNFSVHSD 307

Query: 313 ---HIKIRNATFPGV-QMKFVLQKLLTQVGDVVKDYKPVAIPEIPGPNAAVDDSTPLKQQ 368
               I+  +   P   +   V +K+L+++    K  K   I  IP       + + L+  
Sbjct: 308 IGLFIEACDNVLPKTWKNDGVDEKILSKIHSNGKAMKEKEI--IP-------EGSALRYH 358

Query: 369 WLWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIXXXXXXXXXXXXX 428
            ++ ++ +F+ +   ++   G +   I +  FP  +Y   ++  G+              
Sbjct: 359 GVYAKLREFIDDKSTIMVLEGANTMDIARVSFP-TSYQKHRLDAGT-SATMGVGIGYAMA 416

Query: 429 XXXXDKNKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNNG 473
               + +K V+   GD +   +  E+ T+ R  L   + V+NN G
Sbjct: 417 AKVANPSKFVVALEGDSAFGFSAMELETIARNKLGIVVVVMNNGG 461

>CAGL0M03245g Chr13 complement(372122..373810) [1689 bp, 562 aa]
           {ON} similar to uniprot|P39994 Saccharomyces cerevisiae
           YEL020c
          Length = 562

 Score = 33.5 bits (75), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 27/93 (29%), Positives = 43/93 (46%), Gaps = 14/93 (15%)

Query: 201 VSTVLDLIKNAKNP---VILADACASRHDVKAETKKLIDVTQFPSFVTPMGKGSIDEKHP 257
           ++ V  LIK  ++    V+L   C +        +  I+   FP   TPM KG + + H 
Sbjct: 193 IAEVTSLIKEHQDKNILVVLGKGCINS---SLALRHFIEEFNFPFLPTPMAKGILPDSH- 248

Query: 258 RFGGVYVGTLSSPAVKEAVESSDLILSVGALLS 290
           R          S A  +A++S+DL+L  GA L+
Sbjct: 249 RLN-------VSAARSQALKSADLVLVFGARLN 274

>TBLA0A02835 Chr1 complement(683118..684053) [936 bp, 311 aa] {ON}
          Length = 311

 Score = 32.7 bits (73), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 27/58 (46%), Gaps = 4/58 (6%)

Query: 339 DVVKDYKPVAIPEIPGPNAAVDDSTPLKQQWLWNQVGKFLQEGDVVITETGTSAFGIN 396
           D +KD + + IP +P  NA VD      Q   W  + K L+ G V     G S F IN
Sbjct: 120 DTIKDGELMCIPRLPDGNADVDKDWTFVQA--WEAMQKLLKSGKV--KSIGVSNFSIN 173

>NDAI0G00520 Chr7 complement(112068..113795) [1728 bp, 575 aa] {ON}
           Anc_1.450 YEL020C
          Length = 575

 Score = 33.1 bits (74), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 30/127 (23%), Positives = 50/127 (39%), Gaps = 9/127 (7%)

Query: 164 YLGLPSNFVDQMVPASLLETPIDLSLKPNDAAAEQEVVSTVLDLIKNAKNPVILADACAS 223
           Y+  P + +   V    ++  I +  +   ++A+  V   V  L++   +  +L      
Sbjct: 163 YIDFPEHLISNNVRVPNMKQNISIP-RAIKSSADPLVTKEVAQLLRRNSDQNVLVIIGKG 221

Query: 224 RHDVKAETKKLIDVTQFPSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESSDLIL 283
             +        I   QFP   TPMGKG I +  P           S A   A+  SD++L
Sbjct: 222 AVNYSKGLSAFIHKYQFPFLPTPMGKGIISDMDP--------LNVSSARSSALSKSDIVL 273

Query: 284 SVGALLS 290
             GA L+
Sbjct: 274 VFGARLN 280

>TPHA0B03940 Chr2 (928983..930710) [1728 bp, 575 aa] {ON} Anc_1.450
           YEL020C
          Length = 575

 Score = 32.7 bits (73), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 108/537 (20%), Positives = 212/537 (39%), Gaps = 87/537 (16%)

Query: 1   MSEITLGRYLFERLRQVECNTIFGLPGDFNLRLLDEIYETEGMRWXXXXXXXXXXXXXXX 60
           MS I++  Y+   L++ + +T+FG+ G   +  L E + T G+++               
Sbjct: 1   MSGISVPDYISTVLKKYDIDTVFGIVG-IPIVELAESFITNGIKFISFRNEQSASYAASL 59

Query: 61  XXRIKGM-SCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAK-----QLLLH 114
              +      L+T  G G + AL GI  S   +  ++ + G   I +Q K     Q L H
Sbjct: 60  YGYLNNKPGVLLTVGGPGLIHALAGIYNSIENNWPLIVITG--GIESQQKYKNGFQELNH 117

Query: 115 HTLGNGDFTVFHRMSANISETTAMISDLATAPAEIDRCIRTTYVRQRPV-YLGLPSNFVD 173
             L N     + + +  +S       DL      +   +R + +  + V +L +P + + 
Sbjct: 118 IALLNS----YMKFTGELSTENI---DLL-----VYESMRNSMLSPKGVSFLEIPGDLIH 165

Query: 174 QMVPASLLET-----PI---DLSLKPNDAAAEQEVVSTVLDLIKNAKNPVILADACASRH 225
           + V  ++ ++     PI    L+  PND    +        + K  +N +++    A   
Sbjct: 166 KSVGKNIGDSLAKHKPILVDALTFIPNDDILLETAKFLYDAMRKRDQNMLVIVGKGAI-- 223

Query: 226 DVKAETKKLIDVTQFPSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESSDLILSV 285
              +  +  I+    P   TPM KG I++ +     + V +  S A+K+A    D+IL  
Sbjct: 224 GASSALRHFINCFNLPFLPTPMAKGIIEDSNE----LNVSSGRSMALKDA----DVILVF 275

Query: 286 GALLSDFNTGSFSYSYKTKNIVEFHSDHIKIRNATFP-GVQMKFVLQKLLTQVGDVVKDY 344
           GA L+      +  + K K+ V+F    I++ N T   G+  +  LQ  L  +GD+    
Sbjct: 276 GAKLNWIL--HYGDTPKFKDNVKF----IQVDNNTKTIGLNNQRGLQNSL--IGDIESTV 327

Query: 345 KPV--------------------AIPEIPGPNA------------AVDDSTPLKQQWLWN 372
           K +                    AI E    NA             V ++  L    ++ 
Sbjct: 328 KKLTMMINHLQNGQMITYKGLSKAIKEKILSNAIKLNEKENATPRVVPNANSLNYNVVFG 387

Query: 373 QVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIXXXXXXXXXXXXXXXXX 432
           ++    ++ + ++   G +   + +  FP + +   ++  G++                 
Sbjct: 388 RLKTLFKDEETILVTEGANTMDVARISFPTD-FPQHRIDCGTL-ATMGIGLGYAISTKLS 445

Query: 433 DKNKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNNGY----TIEKLIHGEFA 485
             NK V+L  GD +   +  E+ T +R+ L   + ++NN+G     T +  + G++A
Sbjct: 446 KPNKSVVLIQGDSAFGFSGLELETSVRFNLGLIVVIMNNSGIYHGTTKDHYLKGKYA 502

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.135    0.393 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 54,971,118
Number of extensions: 2307023
Number of successful extensions: 5999
Number of sequences better than 10.0: 137
Number of HSP's gapped: 5836
Number of HSP's successfully gapped: 148
Length of query: 564
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 449
Effective length of database: 40,294,809
Effective search space: 18092369241
Effective search space used: 18092369241
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)