Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_33.14763na 1ON1211215602e-75
KLTH0B05192gna 1ON1391091491e-12
Kwal_47.190593.522ON88644633.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_33.14763
         (121 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_33.14763 s33 (809470..809835) [366 bp, 121 aa] {ON} [contig...   220   2e-75
KLTH0B05192g Chr2 complement(429511..429930) [420 bp, 139 aa] {O...    62   1e-12
Kwal_47.19059 s47 (1080236..1082896) [2661 bp, 886 aa] {ON} YER0...    29   3.4  

>Kwal_33.14763 s33 (809470..809835) [366 bp, 121 aa] {ON} [contig
           101] FULL
          Length = 121

 Score =  220 bits (560), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 106/121 (87%), Positives = 106/121 (87%)

Query: 1   MSFQLETMNEVLEWAVGHGEHASSTGLCRGHLWAYPPEINKNSFEKNESPSSTLYNFVSP 60
           MSFQLETMNEVLEWAVGHGEHASSTGLCRGHLWAYPPEINKNSFEKNESPSSTLYNFVSP
Sbjct: 1   MSFQLETMNEVLEWAVGHGEHASSTGLCRGHLWAYPPEINKNSFEKNESPSSTLYNFVSP 60

Query: 61  HGGLVTLSHLYEMNXXXXXXXXXXXXXXXVNISRKRIYDNDQDTDLSDSRPRKMRSLAHG 120
           HGGLVTLSHLYEMN               VNISRKRIYDNDQDTDLSDSRPRKMRSLAHG
Sbjct: 61  HGGLVTLSHLYEMNEDDEEITDDSSTDSIVNISRKRIYDNDQDTDLSDSRPRKMRSLAHG 120

Query: 121 L 121
           L
Sbjct: 121 L 121

>KLTH0B05192g Chr2 complement(429511..429930) [420 bp, 139 aa] {ON}
           conserved hypothetical protein
          Length = 139

 Score = 62.0 bits (149), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 40/109 (36%), Positives = 54/109 (49%), Gaps = 4/109 (3%)

Query: 1   MSFQLETMNEVLEWAVGHGEHASSTGLCRGH--LWAYPPEINKNSFEKNESPSSTLYNFV 58
           MSF+L+ +N+VL+WA   G  A    +   H  LW+YP E      E N +PSS  Y F 
Sbjct: 1   MSFELQILNDVLDWARAPGGPAGDY-IHPSHVSLWSYPREKAFQVHEGNNNPSSARYGFD 59

Query: 59  SPHGGLVTLSHLYEMNXXXXXXXXXXXXXXXV-NISRKRIYDNDQDTDL 106
           SP+GGLVTL  LY+                 V N +RKR ++   + D 
Sbjct: 60  SPYGGLVTLESLYKERVDSSGKNYKIESGTSVENFTRKRKFEASAEDDF 108

>Kwal_47.19059 s47 (1080236..1082896) [2661 bp, 886 aa] {ON} YER032W
           (FIR1) - Putative participant in 3' mRNA processing
           [contig 188] FULL
          Length = 886

 Score = 28.9 bits (63), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 27/44 (61%), Gaps = 2/44 (4%)

Query: 26  GLCRGHLWAYPPEINKNSFEKNESPSSTLYNFVSP-HGGLVTLS 68
           GLC+  L A  P++  +SF +N +P ST  +F +P H   V++S
Sbjct: 617 GLCKAEL-AKSPQVGCSSFNENVTPLSTYNSFKNPLHPPSVSIS 659

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.130    0.395 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 12,746,476
Number of extensions: 453938
Number of successful extensions: 826
Number of sequences better than 10.0: 4
Number of HSP's gapped: 825
Number of HSP's successfully gapped: 4
Length of query: 121
Length of database: 53,481,399
Length adjustment: 90
Effective length of query: 31
Effective length of database: 43,161,459
Effective search space: 1338005229
Effective search space used: 1338005229
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 59 (27.3 bits)