Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_33.141823.165ON46746724950.0
KLTH0F06534g3.165ON46646721810.0
SAKL0C07414g3.165ON48248716490.0
TDEL0D045803.165ON48248516250.0
ZYRO0B04840g3.165ON47648515630.0
Kpol_1045.443.165ON46947314960.0
CAGL0C05203g3.165ON47548114700.0
Ecym_52393.165ON46447314490.0
YOL062C (APM4)3.165ON49149814450.0
Suva_15.1033.165ON49149514400.0
NCAS0C035803.165ON49149414350.0
Skud_15.913.165ON49149514200.0
Smik_15.963.165ON49149314190.0
NDAI0G029203.165ON48649113930.0
TBLA0F008403.165ON48148612921e-175
TPHA0P006603.165ON47347812891e-175
KLLA0C03894g3.165ON47548412531e-169
KNAG0K011503.165ON47448412451e-168
ADR315W3.165ON49244412041e-162
KAFR0C010203.165ON42847610201e-135
NDAI0E036807.127ON4444765571e-65
KLTH0F12584g7.127ON4414765465e-64
Kwal_55.208437.127ON4414725413e-63
Ecym_83507.127ON4454685414e-63
KLLA0D14311g7.127ON4434655396e-63
SAKL0F05346g7.127ON4474765257e-61
YPL259C (APM1)7.127ON4755035278e-61
NCAS0E021407.127ON4814785252e-60
KNAG0L009507.127ON4614905206e-60
TDEL0H028907.127ON4424785162e-59
Suva_16.457.127ON4785035182e-59
Smik_6.4667.127ON4765015172e-59
KAFR0L004707.127ON4654965162e-59
ADL017C7.127ON4434785101e-58
TPHA0C043207.127ON4544795102e-58
CAGL0K00539g7.127ON4564835083e-58
Skud_16.197.127ON4765065084e-58
Kpol_1062.567.127ON4504805041e-57
ZYRO0C05236g7.127ON4474744986e-57
TBLA0A009507.127ON4694954858e-55
KLTH0D07502g2.555ON5044812513e-22
SAKL0D13090g2.555ON4994812478e-22
Kwal_26.81462.555ON5055242416e-21
Kpol_1056.132.555ON5415562408e-21
TDEL0B064302.555ON5255392256e-19
Ecym_45912.555ON5013362184e-18
KAFR0A020602.555ON5403562033e-16
ABR047W2.555ON4982842024e-16
ZYRO0E05874g2.555ON5493302016e-16
Skud_8.262.555ON5966182016e-16
Smik_8.232.555ON6033821954e-15
Suva_8.332.555ON5966171936e-15
NCAS0A126502.555ON5882411902e-14
TPHA0I023902.555ON5593611892e-14
KLLA0F25432g2.555ON5072351892e-14
KNAG0C055502.555ON5821941882e-14
YHL019C (APM2)2.555ON6053691848e-14
CAGL0K03223g2.555ON5982631821e-13
TBLA0B067602.555ON6572301822e-13
NDAI0B016102.555ON6722551723e-12
Kwal_26.79572.522ON4563191598e-11
TDEL0A029702.522ON4963301571e-10
AGL061W2.522ON4113101534e-10
KLLA0E18789g2.522ON4971381454e-09
KAFR0D035602.522ON4551551401e-08
KLTH0D06556g2.522ON4563111402e-08
ZYRO0B01738g2.522ON4923341383e-08
SAKL0A09218g2.522ON4733051331e-07
TBLA0I006202.522ON6092361322e-07
TPHA0C041302.522ON5331531152e-05
NCAS0A048702.522ON4891541143e-05
Kpol_1018.422.522ON5751601143e-05
NDAI0K019302.522ON6122321010.001
YBR288C (APM3)2.522ON4831331000.001
Smik_2.4302.522ON484134990.002
Suva_4.5482.522ON484171970.002
Skud_2.4192.522ON484135900.021
Ecym_72662.522ON517279900.021
CAGL0L02145g2.522ON543188840.10
Kwal_55.21751singletonOFF7950730.28
KNAG0A069702.522ON505145770.77
KAFR0A077602.44ON42585741.4
Suva_7.393.535ON418104704.0
Skud_7.483.535ON418104704.5
KNAG0A022708.485ON13969665.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_33.14182
         (467 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_33.14182 s33 complement(560456..561859) [1404 bp, 467 aa] {...   965   0.0  
KLTH0F06534g Chr6 complement(565211..566611) [1401 bp, 466 aa] {...   844   0.0  
SAKL0C07414g Chr3 complement(683859..685307) [1449 bp, 482 aa] {...   639   0.0  
TDEL0D04580 Chr4 (840369..841817) [1449 bp, 482 aa] {ON} Anc_3.1...   630   0.0  
ZYRO0B04840g Chr2 (389669..391099) [1431 bp, 476 aa] {ON} highly...   606   0.0  
Kpol_1045.44 s1045 complement(103089..104498) [1410 bp, 469 aa] ...   580   0.0  
CAGL0C05203g Chr3 (496561..497988) [1428 bp, 475 aa] {ON} highly...   570   0.0  
Ecym_5239 Chr5 complement(492091..493485) [1395 bp, 464 aa] {ON}...   562   0.0  
YOL062C Chr15 complement(210520..211995) [1476 bp, 491 aa] {ON} ...   561   0.0  
Suva_15.103 Chr15 complement(183026..184501) [1476 bp, 491 aa] {...   559   0.0  
NCAS0C03580 Chr3 complement(715761..717236) [1476 bp, 491 aa] {O...   557   0.0  
Skud_15.91 Chr15 complement(169608..171083) [1476 bp, 491 aa] {O...   551   0.0  
Smik_15.96 Chr15 complement(174750..176225) [1476 bp, 491 aa] {O...   551   0.0  
NDAI0G02920 Chr7 complement(676413..677873) [1461 bp, 486 aa] {O...   541   0.0  
TBLA0F00840 Chr6 (213915..215360) [1446 bp, 481 aa] {ON} Anc_3.1...   502   e-175
TPHA0P00660 Chr16 (136114..137535) [1422 bp, 473 aa] {ON} Anc_3....   501   e-175
KLLA0C03894g Chr3 complement(354889..356316) [1428 bp, 475 aa] {...   487   e-169
KNAG0K01150 Chr11 complement(225095..226519) [1425 bp, 474 aa] {...   484   e-168
ADR315W Chr4 (1259839..1261317) [1479 bp, 492 aa] {ON} Syntenic ...   468   e-162
KAFR0C01020 Chr3 (208272..209558) [1287 bp, 428 aa] {ON} Anc_3.1...   397   e-135
NDAI0E03680 Chr5 complement(794613..795947) [1335 bp, 444 aa] {O...   219   1e-65
KLTH0F12584g Chr6 complement(1053944..1055269) [1326 bp, 441 aa]...   214   5e-64
Kwal_55.20843 s55 complement(580157..581482) [1326 bp, 441 aa] {...   213   3e-63
Ecym_8350 Chr8 (700421..701758) [1338 bp, 445 aa] {ON} similar t...   213   4e-63
KLLA0D14311g Chr4 (1216574..1217905) [1332 bp, 443 aa] {ON} simi...   212   6e-63
SAKL0F05346g Chr6 (413830..415173) [1344 bp, 447 aa] {ON} highly...   206   7e-61
YPL259C Chr16 complement(51244..52671) [1428 bp, 475 aa] {ON}  A...   207   8e-61
NCAS0E02140 Chr5 complement(410049..411494) [1446 bp, 481 aa] {O...   206   2e-60
KNAG0L00950 Chr12 complement(174410..175795) [1386 bp, 461 aa] {...   204   6e-60
TDEL0H02890 Chr8 complement(481125..482453) [1329 bp, 442 aa] {O...   203   2e-59
Suva_16.45 Chr16 complement(66786..68222) [1437 bp, 478 aa] {ON}...   204   2e-59
Smik_6.466 Chr6 (768507..769937) [1431 bp, 476 aa] {ON} YPL259C ...   203   2e-59
KAFR0L00470 Chr12 complement(85772..87169) [1398 bp, 465 aa] {ON...   203   2e-59
ADL017C Chr4 complement(679085..680416) [1332 bp, 443 aa] {ON} S...   201   1e-58
TPHA0C04320 Chr3 (932871..934235) [1365 bp, 454 aa] {ON} Anc_7.1...   201   2e-58
CAGL0K00539g Chr11 complement(64028..65398) [1371 bp, 456 aa] {O...   200   3e-58
Skud_16.19 Chr16 complement(30298..31728) [1431 bp, 476 aa] {ON}...   200   4e-58
Kpol_1062.56 s1062 (126558..127910) [1353 bp, 450 aa] {ON} (1265...   198   1e-57
ZYRO0C05236g Chr3 complement(408616..409959) [1344 bp, 447 aa] {...   196   6e-57
TBLA0A00950 Chr1 complement(210799..212208) [1410 bp, 469 aa] {O...   191   8e-55
KLTH0D07502g Chr4 (650799..652313) [1515 bp, 504 aa] {ON} simila...   101   3e-22
SAKL0D13090g Chr4 (1093315..1094814) [1500 bp, 499 aa] {ON} weak...   100   8e-22
Kwal_26.8146 s26 (665689..667206) [1518 bp, 505 aa] {ON} YHL019C...    97   6e-21
Kpol_1056.13 s1056 complement(30531..32156) [1626 bp, 541 aa] {O...    97   8e-21
TDEL0B06430 Chr2 (1137277..1138854) [1578 bp, 525 aa] {ON} Anc_2...    91   6e-19
Ecym_4591 Chr4 complement(1154444..1155949) [1506 bp, 501 aa] {O...    89   4e-18
KAFR0A02060 Chr1 (428640..430262) [1623 bp, 540 aa] {ON} Anc_2.5...    83   3e-16
ABR047W Chr2 (479283..480779) [1497 bp, 498 aa] {ON} Syntenic ho...    82   4e-16
ZYRO0E05874g Chr5 (452910..454559) [1650 bp, 549 aa] {ON} simila...    82   6e-16
Skud_8.26 Chr8 complement(55759..57549) [1791 bp, 596 aa] {ON} Y...    82   6e-16
Smik_8.23 Chr8 complement(51372..53183) [1812 bp, 603 aa] {ON} Y...    80   4e-15
Suva_8.33 Chr8 complement(69735..71525) [1791 bp, 596 aa] {ON} Y...    79   6e-15
NCAS0A12650 Chr1 (2492345..2494111) [1767 bp, 588 aa] {ON} Anc_2...    78   2e-14
TPHA0I02390 Chr9 (528997..530676) [1680 bp, 559 aa] {ON} Anc_2.5...    77   2e-14
KLLA0F25432g Chr6 complement(2365434..2366957) [1524 bp, 507 aa]...    77   2e-14
KNAG0C05550 Chr3 complement(1076437..1078185) [1749 bp, 582 aa] ...    77   2e-14
YHL019C Chr8 complement(67731..69548) [1818 bp, 605 aa] {ON}  AP...    75   8e-14
CAGL0K03223g Chr11 (296371..298167) [1797 bp, 598 aa] {ON} simil...    75   1e-13
TBLA0B06760 Chr2 (1594957..1596930) [1974 bp, 657 aa] {ON} Anc_2...    75   2e-13
NDAI0B01610 Chr2 complement(384287..386305) [2019 bp, 672 aa] {O...    71   3e-12
Kwal_26.7957 s26 complement(586544..587914) [1371 bp, 456 aa] {O...    66   8e-11
TDEL0A02970 Chr1 complement(532395..533885) [1491 bp, 496 aa] {O...    65   1e-10
AGL061W Chr7 (593647..594882) [1236 bp, 411 aa] {ON} Syntenic ho...    64   4e-10
KLLA0E18789g Chr5 (1669103..1670596) [1494 bp, 497 aa] {ON} simi...    60   4e-09
KAFR0D03560 Chr4 complement(695693..697060) [1368 bp, 455 aa] {O...    59   1e-08
KLTH0D06556g Chr4 complement(570972..572342) [1371 bp, 456 aa] {...    59   2e-08
ZYRO0B01738g Chr2 complement(139975..141453) [1479 bp, 492 aa] {...    58   3e-08
SAKL0A09218g Chr1 complement(802348..803734,803809..803843) [142...    56   1e-07
TBLA0I00620 Chr9 complement(110231..112060) [1830 bp, 609 aa] {O...    55   2e-07
TPHA0C04130 Chr3 complement(886804..888405) [1602 bp, 533 aa] {O...    49   2e-05
NCAS0A04870 Chr1 (973552..975021) [1470 bp, 489 aa] {ON} Anc_2.5...    49   3e-05
Kpol_1018.42 s1018 (137162..138889) [1728 bp, 575 aa] {ON} (1371...    49   3e-05
NDAI0K01930 Chr11 (437535..439373) [1839 bp, 612 aa] {ON} Anc_2....    44   0.001
YBR288C Chr2 complement(778012..779463) [1452 bp, 483 aa] {ON}  ...    43   0.001
Smik_2.430 Chr2 complement(763687..765141) [1455 bp, 484 aa] {ON...    43   0.002
Suva_4.548 Chr4 complement(950244..951698) [1455 bp, 484 aa] {ON...    42   0.002
Skud_2.419 Chr2 complement(746943..748397) [1455 bp, 484 aa] {ON...    39   0.021
Ecym_7266 Chr7 (559988..560022,560112..561630) [1554 bp, 517 aa]...    39   0.021
CAGL0L02145g Chr12 (252110..253741) [1632 bp, 543 aa] {ON} simil...    37   0.10 
Kwal_55.21751 s55 (964248..964487) [240 bp, 79 aa] {OFF} [contig...    33   0.28 
KNAG0A06970 Chr1 complement(1086674..1088191) [1518 bp, 505 aa] ...    34   0.77 
KAFR0A07760 Chr1 complement(1560351..1561628) [1278 bp, 425 aa] ...    33   1.4  
Suva_7.39 Chr7 complement(74084..75340) [1257 bp, 418 aa] {ON} Y...    32   4.0  
Skud_7.48 Chr7 complement(84359..85615) [1257 bp, 418 aa] {ON} Y...    32   4.5  
KNAG0A02270 Chr1 complement(206190..206609) [420 bp, 139 aa] {ON...    30   5.9  

>Kwal_33.14182 s33 complement(560456..561859) [1404 bp, 467 aa] {ON}
           YOL062C (APM4) - Clathrin associated protein, medium
           subunit [contig 105] FULL
          Length = 467

 Score =  965 bits (2495), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 467/467 (100%), Positives = 467/467 (100%)

Query: 1   MLNALFIYSLRGELLISKHVKGSVQKSMSEIFRIQVINNLDVRSPVLTLGSTTFHHIKSA 60
           MLNALFIYSLRGELLISKHVKGSVQKSMSEIFRIQVINNLDVRSPVLTLGSTTFHHIKSA
Sbjct: 1   MLNALFIYSLRGELLISKHVKGSVQKSMSEIFRIQVINNLDVRSPVLTLGSTTFHHIKSA 60

Query: 61  KNLWIVAVSRSNADSAAIWEFLYRLNELLEAFNLYSENELKERFMICYELLDIVLEDGLP 120
           KNLWIVAVSRSNADSAAIWEFLYRLNELLEAFNLYSENELKERFMICYELLDIVLEDGLP
Sbjct: 61  KNLWIVAVSRSNADSAAIWEFLYRLNELLEAFNLYSENELKERFMICYELLDIVLEDGLP 120

Query: 121 VDTELSSVASKMSVKPNAGVDNFNMFAENGHGGTNRILPVSQFLRGRPSAGNLQDIASEA 180
           VDTELSSVASKMSVKPNAGVDNFNMFAENGHGGTNRILPVSQFLRGRPSAGNLQDIASEA
Sbjct: 121 VDTELSSVASKMSVKPNAGVDNFNMFAENGHGGTNRILPVSQFLRGRPSAGNLQDIASEA 180

Query: 181 PSNIPWRMNGIKYKKNEVFLNVNERISILVSKDGSILKSYVDGTVEATTHLSGMPVCRFG 240
           PSNIPWRMNGIKYKKNEVFLNVNERISILVSKDGSILKSYVDGTVEATTHLSGMPVCRFG
Sbjct: 181 PSNIPWRMNGIKYKKNEVFLNVNERISILVSKDGSILKSYVDGTVEATTHLSGMPVCRFG 240

Query: 241 LNDALSVSTPFGDDDEYQVTNKKAIPKAAAGSVMLEDCKFHQCVQLDKFQSERTINFIAP 300
           LNDALSVSTPFGDDDEYQVTNKKAIPKAAAGSVMLEDCKFHQCVQLDKFQSERTINFIAP
Sbjct: 241 LNDALSVSTPFGDDDEYQVTNKKAIPKAAAGSVMLEDCKFHQCVQLDKFQSERTINFIAP 300

Query: 301 DGSFELMKYHVRENLNLPFKVTPIVTVVRSNSIDYQITIKSLFPSKLTAKDVQLRIPVPP 360
           DGSFELMKYHVRENLNLPFKVTPIVTVVRSNSIDYQITIKSLFPSKLTAKDVQLRIPVPP
Sbjct: 301 DGSFELMKYHVRENLNLPFKVTPIVTVVRSNSIDYQITIKSLFPSKLTAKDVQLRIPVPP 360

Query: 361 ETVSCHISTSNGKCKFVPEESAIVWKFSKYQGLTENSISATAVPMKDSTLNIEQWPRPPI 420
           ETVSCHISTSNGKCKFVPEESAIVWKFSKYQGLTENSISATAVPMKDSTLNIEQWPRPPI
Sbjct: 361 ETVSCHISTSNGKCKFVPEESAIVWKFSKYQGLTENSISATAVPMKDSTLNIEQWPRPPI 420

Query: 421 SLKFEIVMFSNSGLVVRFFNVSERDRNYKMVKWIKYLSKSGAYEVRY 467
           SLKFEIVMFSNSGLVVRFFNVSERDRNYKMVKWIKYLSKSGAYEVRY
Sbjct: 421 SLKFEIVMFSNSGLVVRFFNVSERDRNYKMVKWIKYLSKSGAYEVRY 467

>KLTH0F06534g Chr6 complement(565211..566611) [1401 bp, 466 aa] {ON}
           similar to uniprot|Q99186 Saccharomyces cerevisiae
           YOL062C APM4 Clathrin associated protein medium subunit
          Length = 466

 Score =  844 bits (2181), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 405/467 (86%), Positives = 436/467 (93%), Gaps = 1/467 (0%)

Query: 1   MLNALFIYSLRGELLISKHVKGSVQKSMSEIFRIQVINNLDVRSPVLTLGSTTFHHIKSA 60
           ML+ALFI+SLRGELLISKHV+ SV KSMSEIFRIQVINNLDVRSPVLTLGSTTFHH+KS 
Sbjct: 1   MLSALFIFSLRGELLISKHVRSSVPKSMSEIFRIQVINNLDVRSPVLTLGSTTFHHVKSP 60

Query: 61  KNLWIVAVSRSNADSAAIWEFLYRLNELLEAFNLYSENELKERFMICYELLDIVLEDGLP 120
            NLWIVAVSRSNADSAAIWEFLY+L+ LLEAF L+SENELKE FM CYELLDIVLEDG+P
Sbjct: 61  GNLWIVAVSRSNADSAAIWEFLYKLSALLEAFGLHSENELKEDFMTCYELLDIVLEDGVP 120

Query: 121 VDTELSSVASKMSVKPNAGVDNFNMFAENGHGGTNRILPVSQFLRGRPSAGNLQDIASEA 180
           VDTELSSVASKMSVKP+A  +  N F E+G+GGTNRILPV+QFLR R S+ NL D  S+ 
Sbjct: 121 VDTELSSVASKMSVKPSASAERINTFIESGNGGTNRILPVAQFLRARSSSSNLHDSHSKV 180

Query: 181 PSNIPWRMNGIKYKKNEVFLNVNERISILVSKDGSILKSYVDGTVEATTHLSGMPVCRFG 240
           PSNIPWRMNGIKYKKNEVFLNVNERISILVSKDGSILKSYVDGTVEATTHLSGMPVCRFG
Sbjct: 181 PSNIPWRMNGIKYKKNEVFLNVNERISILVSKDGSILKSYVDGTVEATTHLSGMPVCRFG 240

Query: 241 LNDALSVSTPFGDDDEYQVTNKKAIPKAAAGSVMLEDCKFHQCVQLDKFQSERTINFIAP 300
           LND+LSVSTPFG D+E   TNKKAIPKAAAGSVMLEDCKFHQCVQLDKFQSERTINFI P
Sbjct: 241 LNDSLSVSTPFG-DNESPTTNKKAIPKAAAGSVMLEDCKFHQCVQLDKFQSERTINFIPP 299

Query: 301 DGSFELMKYHVRENLNLPFKVTPIVTVVRSNSIDYQITIKSLFPSKLTAKDVQLRIPVPP 360
           DGSFELMKYHVRENLNLPFK+TP+VT+ ++NSIDY++TIKSLFPSKLTAKDVQLRIPVPP
Sbjct: 300 DGSFELMKYHVRENLNLPFKITPVVTLFKANSIDYRVTIKSLFPSKLTAKDVQLRIPVPP 359

Query: 361 ETVSCHISTSNGKCKFVPEESAIVWKFSKYQGLTENSISATAVPMKDSTLNIEQWPRPPI 420
           ETV CHISTSNG+CKFVPEESAI+WKFSKYQGLTENS+SATAVPMKDS LNI+QW +PP+
Sbjct: 360 ETVDCHISTSNGRCKFVPEESAIIWKFSKYQGLTENSLSATAVPMKDSALNIDQWSKPPM 419

Query: 421 SLKFEIVMFSNSGLVVRFFNVSERDRNYKMVKWIKYLSKSGAYEVRY 467
           SLKFEIVMFSNSGLVVRFF+VSE DRNYKMVKWIKYLSKSGAYEVRY
Sbjct: 420 SLKFEIVMFSNSGLVVRFFDVSEGDRNYKMVKWIKYLSKSGAYEVRY 466

>SAKL0C07414g Chr3 complement(683859..685307) [1449 bp, 482 aa] {ON}
           similar to uniprot|Q99186 Saccharomyces cerevisiae
           YOL062C APM4 Clathrin associated protein medium subunit
          Length = 482

 Score =  639 bits (1649), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/487 (64%), Positives = 393/487 (80%), Gaps = 25/487 (5%)

Query: 1   MLNALFIYSLRGELLISKHVKGSVQKSMSEIFRIQVINNLDVRSPVLTLGSTTFHHIKSA 60
           MLNALF++S +GEL++SK ++ ++++S++EIFRIQVINNLDVRSPVLTLGSTTFHHI+S+
Sbjct: 1   MLNALFVFSQKGELVVSKLIRDTIKRSVAEIFRIQVINNLDVRSPVLTLGSTTFHHIRSS 60

Query: 61  KNLWIVAVSRSNADSAAIWEFLYRLNELLEAFNLYSENELKERFMICYELLDIVLEDGLP 120
            NLWIVAV+RSNADSAAIWEFLY+ N LLEA+ L SE  LKE FM CYELLD+VLE+G+P
Sbjct: 61  SNLWIVAVTRSNADSAAIWEFLYKFNALLEAYGLNSEESLKEEFMTCYELLDVVLENGVP 120

Query: 121 VDTELSSVASKMSVKPNAGVDNFNMFAE---NGHGGTNRILPVSQFLRGRPSAGNLQDIA 177
           VDTELSSVASKMS +P   ++N  +  E   +     +    + +FL    + G+    +
Sbjct: 121 VDTELSSVASKMSRRPVVSLENNPLTDELLMSAAANVDLGFRMPKFL----NKGSRSSSS 176

Query: 178 SEAPSN---------IPWRMNGIKYKKNEVFLNVNERISILVSKDGSILKSYVDGTVEAT 228
             +P+N          PWR +GIKYKKNE+FL+VNERI+ILVSKDGSILKSYVDG+V+ T
Sbjct: 177 VSSPANGDEHGDPCAYPWRSSGIKYKKNEIFLDVNERINILVSKDGSILKSYVDGSVDLT 236

Query: 229 THLSGMPVCRFGLNDALSVSTPFGDDD-----EYQVTNKKAIPKAAAGSVMLEDCKFHQC 283
           THLSG P+C+FGLND+LS+       D     EY+V NKKAIPKAAAGSV LEDCKFHQC
Sbjct: 237 THLSGTPLCQFGLNDSLSLDGGTLSRDLDFISEYEVKNKKAIPKAAAGSVQLEDCKFHQC 296

Query: 284 VQLDKFQSERTINFIAPDGSFELMKYHVRENLNLPFKVTPIVTVVRSN--SIDYQITIKS 341
           VQL++F ++R I F+ PDGSFELM+YHVR+NLNLPFK+TPI + VRSN  +++Y++ +KS
Sbjct: 297 VQLNRFNTDRIIRFVPPDGSFELMRYHVRDNLNLPFKITPIFS-VRSNNGAVEYRVALKS 355

Query: 342 LFPSKLTAKDVQLRIPVPPETVSCHISTSNGKCKFVPEESAIVWKFSKYQGLTENSISAT 401
           LFPSKLTAKDV LRIPVPP TV C I+TSNG+C+FVPEE+A++WKF+KYQGLTEN++SA 
Sbjct: 356 LFPSKLTAKDVVLRIPVPPGTVDCKINTSNGRCRFVPEENAVLWKFAKYQGLTENTLSAL 415

Query: 402 AVPMKD-STLNIEQWPRPPISLKFEIVMFSNSGLVVRFFNVSERDRNYKMVKWIKYLSKS 460
            VPM + S+LN++QW RPP+SL FEI+MFSNSGLVVRFF VSERD +Y  VKW+KY+S+S
Sbjct: 416 TVPMDNQSSLNLQQWSRPPMSLTFEILMFSNSGLVVRFFKVSERDHSYHTVKWVKYISRS 475

Query: 461 GAYEVRY 467
           GAYEVRY
Sbjct: 476 GAYEVRY 482

>TDEL0D04580 Chr4 (840369..841817) [1449 bp, 482 aa] {ON} Anc_3.165
           YOL062C
          Length = 482

 Score =  630 bits (1625), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/485 (64%), Positives = 385/485 (79%), Gaps = 21/485 (4%)

Query: 1   MLNALFIYSLRGELLISKHVKGSVQKSMSEIFRIQVINNLDVRSPVLTLGSTTFHHIKS- 59
           M++A+ I+S RGEL+++K +K S++KS+S+IFRIQVINNLDVRSP+LTLGSTTFHHI+S 
Sbjct: 1   MISAILIFSSRGELIVAKTMKSSLKKSISDIFRIQVINNLDVRSPILTLGSTTFHHIRSD 60

Query: 60  -AKNLWIVAVSRSNADSAAIWEFLYRLNELLEAFNLYSENELKERFMICYELLDIVLEDG 118
            + +LW+VAVSRSNA+S AIWEFLY+LN +++ + L  E  LKE FM CYE+LD VLE+G
Sbjct: 61  GSDSLWLVAVSRSNANSGAIWEFLYKLNVIMDVYGLTKEGTLKENFMNCYEILDTVLEEG 120

Query: 119 -LPVDTELSSVASKMSVKPNAGV--------DNFNMFAEN--GHGGTNRILPVSQFLRGR 167
            +PVDTEL+SV SKM+VKP   +        D   M + N    G ++  L + +FL  R
Sbjct: 121 GIPVDTELNSVISKMTVKPPKQISGNLLDRPDLLTMSSLNLSTPGDSSSTLSMPKFLT-R 179

Query: 168 PSAGNLQDIASEAPSNIPWRMNGIKYKKNEVFLNVNERISILVSKDGSILKSYVDGTVEA 227
            +    QD+ S  PSN+ WR +GIKYKKNEV LNVNE+ISILVS+DGSILKSYVDGT++ 
Sbjct: 180 NNRSMSQDLGSNYPSNLSWRPHGIKYKKNEVLLNVNEKISILVSRDGSILKSYVDGTIDL 239

Query: 228 TTHLSGMPVCRFGLNDALSVSTPFGDDDEYQV---TNKKAIPKAAAGSVMLEDCKFHQCV 284
           TTHLSGMP+C+FGLND+LSV   FGDD   +V    NKKAIPKAAAG VMLEDCKFHQCV
Sbjct: 240 TTHLSGMPICQFGLNDSLSVE--FGDDSISEVEDFANKKAIPKAAAGRVMLEDCKFHQCV 297

Query: 285 QLDKFQSERTINFIAPDGSFELMKYHVRENLNLPFKVTPIVTVV-RSNSIDYQITIKSLF 343
            LDKF  +R I F+ PDGS ELMKY VR+NLNLPFKVTPIVT + R N+IDY++T+KSLF
Sbjct: 298 SLDKFNKDRVIKFVPPDGSMELMKYCVRDNLNLPFKVTPIVTSIGRGNTIDYRVTLKSLF 357

Query: 344 PSKLTAKDVQLRIPVPPETVSCHISTSNGKCKFVPEESAIVWKFSKYQGLTENSISATAV 403
           P KL+AKDV LRIPVPP TV C I+ SNGKCKFVPEESA++WKF+KY GLTEN++SA  V
Sbjct: 358 PGKLSAKDVSLRIPVPPGTVDCEINVSNGKCKFVPEESAMIWKFTKYTGLTENTLSAVTV 417

Query: 404 PMKDST-LNIEQWPRPPISLKFEIVMFSNSGLVVRFFNVSERDRNYKMVKWIKYLSKSGA 462
           P  D+T L ++QWPRPP+SL FEI+MFSNSGLVVR+F VS++D  Y+  KWIKY+SKSG+
Sbjct: 418 PSSDTTQLTVQQWPRPPMSLNFEIMMFSNSGLVVRYFKVSDKDERYRTAKWIKYISKSGS 477

Query: 463 YEVRY 467
           YE+RY
Sbjct: 478 YEIRY 482

>ZYRO0B04840g Chr2 (389669..391099) [1431 bp, 476 aa] {ON} highly
           similar to uniprot|Q99186 Saccharomyces cerevisiae
           YOL062C APM4 Clathrin associated protein medium subunit
          Length = 476

 Score =  606 bits (1563), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/485 (62%), Positives = 380/485 (78%), Gaps = 27/485 (5%)

Query: 1   MLNALFIYSLRGELLISKHVKGSVQKSMSEIFRIQVINNLDVRSPVLTLGSTTFHHIKS- 59
           M+NA+FIYS RGEL++SK    S+++S+S+IFRIQVINNLDVRSP+LTLGSTTFHHI+S 
Sbjct: 1   MINAIFIYSTRGELIVSKLFNNSLKRSISDIFRIQVINNLDVRSPILTLGSTTFHHIRSN 60

Query: 60  -AKNLWIVAVSRSNADSAAIWEFLYRLNELLEAFNLYSENELKERFMICYELLDIVL-ED 117
            + +LWIV VSR+NA+S AIWEFLY+ N +L+A++L  E +LKE FMICYE+LD+V+   
Sbjct: 61  GSDSLWIVTVSRTNANSGAIWEFLYKFNAILDAYDLTKEEKLKEDFMICYEILDVVIGAG 120

Query: 118 GLPVDTELSSVASKMSVKP-----------NAGVDNFNMFAENGHGGTNRILPVSQFLRG 166
           G+P+DTEL S+ASK+SVKP           ++ V NF      G   +   L + +FL  
Sbjct: 121 GIPMDTELGSIASKISVKPPKSGGTSSEPKSSTVANFP-----GSNLSTSNLSMPKFLT- 174

Query: 167 RPSAGNLQDIASEAPSNIPWRMNGIKYKKNEVFLNVNERISILVSKDGSILKSYVDGTVE 226
           R +    QD+ +  PSN PWR NGIKYKKNEVFL VNE+I+ILVS+DGSILK+YVDGT++
Sbjct: 175 RNNRSMSQDLGTNYPSNFPWRPNGIKYKKNEVFLYVNEKINILVSRDGSILKAYVDGTID 234

Query: 227 ATTHLSGMPVCRFGLNDALSVSTPFGDD---DEYQVTNKKAIPKAAAGSVMLEDCKFHQC 283
            TTHLSG P+C+FGLND+ SV   FGD    D  +  NKKA+PKAAAGSVMLEDCKFHQC
Sbjct: 235 MTTHLSGTPICQFGLNDSPSVE--FGDSLWLDTQEFHNKKAVPKAAAGSVMLEDCKFHQC 292

Query: 284 VQLDKFQSERTINFIAPDGSFELMKYHVRENLNLPFKVTPIVTVVRSNSIDYQITIKSLF 343
           V LDKF  ER I F+ PDG+ ELMKY VR+NLNLPFK+TP+VT   S +++Y+IT+KSLF
Sbjct: 293 VSLDKFNKERIIKFVPPDGNMELMKYCVRDNLNLPFKITPVVTPCGS-TVEYRITLKSLF 351

Query: 344 PSKLTAKDVQLRIPVPPETVSCHISTSNGKCKFVPEESAIVWKFSKYQGLTENSISATAV 403
           P+KL+AKDV L IPVPP TV C I+ SNGKCKF  EE+A+VW+F+KY GLTEN++SA  V
Sbjct: 352 PNKLSAKDVALHIPVPPGTVDCKINISNGKCKFESEENAMVWRFNKYHGLTENTLSAVTV 411

Query: 404 PMKDST-LNIEQWPRPPISLKFEIVMFSNSGLVVRFFNVSERDRNYKMVKWIKYLSKSGA 462
           P  D+T L ++QWPRPP+SL FEI+MFSNSGLVVR+F VS++D  Y++VKWIKY+SKSG+
Sbjct: 412 PTSDTTQLTLQQWPRPPMSLGFEIMMFSNSGLVVRYFRVSDKDEKYRVVKWIKYISKSGS 471

Query: 463 YEVRY 467
           YEVRY
Sbjct: 472 YEVRY 476

>Kpol_1045.44 s1045 complement(103089..104498) [1410 bp, 469 aa]
           {ON} complement(103091..104500) [1410 nt, 470 aa]
          Length = 469

 Score =  580 bits (1496), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/473 (59%), Positives = 368/473 (77%), Gaps = 10/473 (2%)

Query: 1   MLNALFIYSLRGELLISKHVKGSVQKSMSEIFRIQVINNLDVRSPVLTLGSTTFHHIKS- 59
           M+N + +Y+ +GEL++SK  K + ++S+S+IFR+QVINNLDVRSP+LTLGSTTFHHI+S 
Sbjct: 1   MINGVLVYTGKGELIVSKFSKSNAKRSISDIFRVQVINNLDVRSPILTLGSTTFHHIRSN 60

Query: 60  -AKNLWIVAVSRSNADSAAIWEFLYRLNELLEAFNLYSENELKERFMICYELLDIVLE-D 117
              +LW+VAV+RSNA+S AIWEFLY+ + LL AF L +E  LKE FM CYELLD++L  D
Sbjct: 61  SRDHLWLVAVTRSNANSGAIWEFLYKFDSLLNAFGLDNETTLKEEFMTCYELLDLMLNVD 120

Query: 118 GLPVDTELSSVASKMSVKPNAGVDNFNMFAENGHGGTNRILPVSQFLRGRPSAGNLQDIA 177
           G+P+DTELSSV++KMS KP   + + N  +++    ++  L +S+FL  R +     D  
Sbjct: 121 GVPLDTELSSVSAKMSTKP---LHSINSPSDSSLDNSSSPLSISKFL-NRNNRSMSVDTM 176

Query: 178 SEAPSNIPWRMNGIKYKKNEVFLNVNERISILVSKDGSILKSYVDGTVEATTHLSGMPVC 237
           +  PSN PWR NGIKYKKNE+FLN+NE+ISILVSKD +ILK+YVDGTV+ T+HLSG P C
Sbjct: 177 NTEPSNYPWRPNGIKYKKNEIFLNINEKISILVSKDETILKAYVDGTVDLTSHLSGTPTC 236

Query: 238 RFGLNDALSVSTP-FGDDDEYQVTNKKAIPKAAAGSVMLEDCKFHQCVQLDKFQSERTIN 296
           +FGLND+LSV  P + + D+    N++ IP+A AG+V+LEDCKFH+CV LDKF  +R I 
Sbjct: 237 QFGLNDSLSVDEPNYYNSDDNGFRNQQNIPRATAGTVVLEDCKFHECVSLDKFNRDRIIK 296

Query: 297 FIAPDGSFELMKYHVRENLNLPFKVTPIVTVVRSNS-IDYQITIKSLFPSKLTAKDVQLR 355
           F+ PDG  ELMKYHVR+N+NLPFKVTP V   RS + +DY+IT+KSLFPSKL+A DV L+
Sbjct: 297 FVPPDGHIELMKYHVRDNINLPFKVTPNVINSRSRTGLDYRITLKSLFPSKLSANDVVLK 356

Query: 356 IPVPPETVSCHISTSNGKCKFVPEESAIVWKFSKYQGLTENSISATAVPMKDST-LNIEQ 414
           IPVP  TV C ++ SNGKC+FVPEES I+WKF+KY GLTEN +SA  V   D+T L ++Q
Sbjct: 357 IPVPSSTVDCKLNVSNGKCRFVPEESCIIWKFAKYNGLTENKLSAVTVSSNDTTQLMLQQ 416

Query: 415 WPRPPISLKFEIVMFSNSGLVVRFFNVSERDRNYKMVKWIKYLSKSGAYEVRY 467
           W RPPISL FEI+MFSNSGLVVR+  + E+D+ Y+ VKWIKY+S+SG+YEVRY
Sbjct: 417 WARPPISLDFEIMMFSNSGLVVRYLKIMEKDQKYRTVKWIKYISRSGSYEVRY 469

>CAGL0C05203g Chr3 (496561..497988) [1428 bp, 475 aa] {ON} highly
           similar to uniprot|Q99186 Saccharomyces cerevisiae
           YOL062c APM4
          Length = 475

 Score =  570 bits (1470), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/481 (58%), Positives = 369/481 (76%), Gaps = 20/481 (4%)

Query: 1   MLNALFIYSLRGELLISKHVKGSVQKSMSEIFRIQVINNLDVRSPVLTLGSTTFHHIKS- 59
           M++A+ ++S RGEL++SK  K ++++S+S+IFRIQVINNLDVRSP+LTLGSTTF HI+S 
Sbjct: 1   MISAVLVFSSRGELIVSKFFKNNLKRSISDIFRIQVINNLDVRSPILTLGSTTFQHIRSN 60

Query: 60  --AKNLWIVAVSRSNADSAAIWEFLYRLNELLEAFNLYSENELKERFMICYELLDIVL-E 116
               +LW+V+V+RSN +  A+WEFLY+ + +LE + L +E  LKE FM+CYELLD++L E
Sbjct: 61  VHGDDLWLVSVTRSNINCGAVWEFLYKFDHMLELYGLNNEEFLKEEFMVCYELLDVMLGE 120

Query: 117 DGLPVDTELSSVASKMSVKPNA-GVDNFNMFAENGHGGTNRILP-VSQFLRGRPS----- 169
           +G P+DT+ ++V  KMSVKP+   ++NF +  +N     N  LP + +FLR   S     
Sbjct: 121 NGTPMDTDPATVIKKMSVKPSKETIENFAISVQN----KNSTLPKIPKFLRRTSSFLNQE 176

Query: 170 AGNLQDIASEAPSNIPWRMNGIKYKKNEVFLNVNERISILVSKDGSILKSYVDGTVEATT 229
           + N    A      +PWR  GI +KKNE+FL VNE+ISILVSK+GSILKSYVDGT++  T
Sbjct: 177 SSNNSSGAFNMAGELPWRPKGISHKKNEIFLYVNEKISILVSKEGSILKSYVDGTIDLVT 236

Query: 230 HLSGMPVCRFGLNDALSVSTP-FGDDDEYQVTNKKAIPKAAAGSVMLEDCKFHQCVQLDK 288
           HLSG PVC+FGLND+LSV    +GD  +Y + NKKAIPKAAAGSV+LEDCKFHQCV L+K
Sbjct: 237 HLSGTPVCQFGLNDSLSVKNDDYGDSFDY-IKNKKAIPKAAAGSVLLEDCKFHQCVSLEK 295

Query: 289 FQSERTINFIAPDGSFELMKYHVRENLNLPFKVTPIVTVVRSNS-IDYQITIKSLFPSKL 347
           F  +R I F+ PDGS ELMKYHVR N+NLPFKV+PIVT   S + ++Y+IT+KSLFPSKL
Sbjct: 296 FDKDRIIKFVPPDGSMELMKYHVRSNINLPFKVSPIVTYSSSGTAVEYRITLKSLFPSKL 355

Query: 348 TAKDVQLRIPVPPETVSCHISTSNGKCKFVPEESAIVWKFSKYQGLTENSISATAVPMKD 407
           TAK+V ++IPVPPET+ C I  SNG CKF PEE A++W F+KY GLTEN++SA  +  KD
Sbjct: 356 TAKNVTMKIPVPPETLDCKIDVSNGSCKFAPEEKAMLWTFNKYNGLTENTLSAVTITSKD 415

Query: 408 S-TLNIEQWPRPPISLKFEIVMFSNSGLVVRFFNVSERDRNYKMVKWIKYLSKSGAYEVR 466
           +  LNI+QW +PPISL FEI+MFSNSGLVVR+F + E +R YK VKWI+Y+SKSG+YE+R
Sbjct: 416 APRLNIQQWQKPPISLDFEIMMFSNSGLVVRYFTIKESER-YKTVKWIRYVSKSGSYEIR 474

Query: 467 Y 467
           Y
Sbjct: 475 Y 475

>Ecym_5239 Chr5 complement(492091..493485) [1395 bp, 464 aa] {ON}
           similar to Ashbya gossypii ADR315W
          Length = 464

 Score =  562 bits (1449), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/473 (58%), Positives = 352/473 (74%), Gaps = 15/473 (3%)

Query: 1   MLNALFIYSLRGELLISKHVKGSVQKSMSEIFRIQVINNLDVRSPVLTLGSTTFHHIKSA 60
           M++ALF+YS RG+L+ISK +K +++  +SEIFRIQVINNLDVRSP+LTLGSTTFHHI+S 
Sbjct: 1   MISALFLYSPRGDLIISKLIKDNIKLGVSEIFRIQVINNLDVRSPILTLGSTTFHHIRSN 60

Query: 61  KNLWIVAVSRSNADSAAIWEFLYRLNELLEAFNLYSENELKERFMICYELLDIVLEDGLP 120
             LW+V VSR N DSA IWEFLY  N+LLE +++ SE+ L+  FM+CYE+LDIVL++G+P
Sbjct: 61  GGLWLVTVSRGNTDSAGIWEFLYNFNKLLEVYDINSEDSLQGDFMLCYEILDIVLDNGIP 120

Query: 121 VDTELSSVASKMSVKPNAGVDNFNMFAENGHGGTNRILPVSQFLRGRPSAGNLQDIASEA 180
            DTEL+ +   +S KP          +EN  G  + +   S  ++      + +++   +
Sbjct: 121 RDTELTHIMPYISKKP---------LSENLLGSDDILNTPSWLVKAGARGMSSENLGLTS 171

Query: 181 PSNIPWRMNGIKYKKNEVFLNVNERISILVSKDGSILKSYVDGTVEATTHLSGMPVCRFG 240
                WR  GI+YKKNEV+L+V E ISILV+KDG+ILKSYVDG+V+   HLSGMPVC+FG
Sbjct: 172 KDMCLWRSEGIRYKKNEVYLDVFEHISILVNKDGAILKSYVDGSVQCVAHLSGMPVCQFG 231

Query: 241 LNDALSVST---PFGDDDEYQVTN-KKAIPKAAAGSVMLEDCKFHQCVQLDKFQSERTIN 296
            ND LS S+     G+D   +  N  KAI  A  GSV+LEDCKFHQCVQLDKF  ER I 
Sbjct: 232 FNDYLSPSSNTQSSGNDGWAEEENGTKAIKNAITGSVILEDCKFHQCVQLDKFDQERVIR 291

Query: 297 FIAPDGSFELMKYHVRENLNLPFKVTPIVTVVRSNSIDYQITIKSLFPSKLTAKDVQLRI 356
           F+ PDG FELMKYHVR+NLNLPFKVTP+VT ++  S++Y+IT+KSLFPSKL AKDV+L I
Sbjct: 292 FVPPDGLFELMKYHVRDNLNLPFKVTPMVTTLKGKSVEYRITLKSLFPSKLCAKDVELYI 351

Query: 357 PVPPETVSCHISTSNGKCKFVPEESAIVWKFSKYQGLTENSISATAVPMKDS--TLNIEQ 414
           P PP+TV+  I+ S+GK KF+PEE+AIVWK  KY GLTEN  SA  VPM +   +LN+EQ
Sbjct: 352 PAPPDTVNAKINVSSGKGKFIPEENAIVWKIHKYHGLTENVFSAVIVPMGNGNDSLNLEQ 411

Query: 415 WPRPPISLKFEIVMFSNSGLVVRFFNVSERDRNYKMVKWIKYLSKSGAYEVRY 467
           W RPPIS++FEI MFSNSGLVVR+  V E+D NY  VKW+KY+SKSGAYEVRY
Sbjct: 412 WSRPPISVRFEISMFSNSGLVVRYLKVMEKDLNYNTVKWVKYISKSGAYEVRY 464

>YOL062C Chr15 complement(210520..211995) [1476 bp, 491 aa] {ON}
           APM4Mu2-like subunit of the clathrin associated protein
           complex (AP-2); involved in vesicle transport
          Length = 491

 Score =  561 bits (1445), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/498 (58%), Positives = 369/498 (74%), Gaps = 38/498 (7%)

Query: 1   MLNALFIYSLRGELLISKHVKGSVQKSMSEIFRIQVINNLDVRSPVLTLGSTTFHHIKS- 59
           M++ + +YS RGEL+++K  K S+++S+S+IFR+QVINNLDVRSPVLTLGSTTFHHI+S 
Sbjct: 1   MISGVLVYSSRGELVLNKFFKNSLKRSISDIFRVQVINNLDVRSPVLTLGSTTFHHIRSR 60

Query: 60  -AKNLWIVAVSRSNADSAAIWEFLYRLNELLEAFNLYSENELKERFMICYELLDIVLE-D 117
              NLW+V ++RSNA+SAAIWEFLY+L+ ++ A+ L  E  LKE FMI +E+LDI+L  +
Sbjct: 61  HGDNLWLVTITRSNANSAAIWEFLYKLDAVMNAYRLDREEALKEEFMIVHEMLDIMLGGN 120

Query: 118 GLPVDTELSSVASKMSVKPNAGVDNFNMFAENGHGGTNRILPVS-------------QFL 164
           G+P+DTEL+SV ++MSVKP   V N     ++  G  N +L  S             +FL
Sbjct: 121 GIPIDTELNSVIAQMSVKP---VRNMGGLLDSPDG--NDVLSSSSSPTSSAGELHFPKFL 175

Query: 165 RGRPSAGNLQ-DIASEAPSN--IPWRMNGIKYKKNEVFLNVNERISILVSKDGSILKSYV 221
             R S+   Q D  S+   N  I WR  GI +KK+EVFL VNERI+ILVS+DGSILKSYV
Sbjct: 176 TKRSSSFLGQGDSTSDFYDNNKITWRPKGIIHKKDEVFLYVNERINILVSRDGSILKSYV 235

Query: 222 DGTVEATTHLSGMPVCRFGLNDALSVSTPFGDDDEY----------QVTNKKAIPKAAAG 271
           DGT++ TTHLSG P+CRFGLND+L + +   D+ ++             NK  IPKAAAG
Sbjct: 236 DGTIDITTHLSGTPICRFGLNDSLGMQSE--DEKKWLAQQQRHSGSDFGNKNFIPKAAAG 293

Query: 272 SVMLEDCKFHQCVQLDKFQSERTINFIAPDGSFELMKYHVRENLNLPFKVTPIVT-VVRS 330
           SV+LEDCKFH+CV LDKF     I F+ PDGS ELMKYHVR+N+NLPFKVTPIVT   R 
Sbjct: 294 SVLLEDCKFHECVSLDKFNRNHIIEFVPPDGSMELMKYHVRDNINLPFKVTPIVTHSTRD 353

Query: 331 NSIDYQITIKSLFPSKLTAKDVQLRIPVPPETVSCHISTSNGKCKFVPEESAIVWKFSKY 390
           N IDY+IT+KSLFP KL+AKDV L IPVPP TV C IS SNG CKFVPEE+A++W+F+KY
Sbjct: 354 NEIDYRITLKSLFPGKLSAKDVVLHIPVPPSTVDCKISVSNGHCKFVPEENAMIWRFNKY 413

Query: 391 QGLTENSISATAVPMKDST-LNIEQWPRPPISLKFEIVMFSNSGLVVRFFNVSERDRNYK 449
            GLTEN++SA  V   D+T LN++QW RPPISL+FE++MFSNSGLVVR+F +S +D  ++
Sbjct: 414 NGLTENTLSAVTVSTSDTTQLNLQQWTRPPISLEFEVMMFSNSGLVVRYFTISGKDSKHR 473

Query: 450 MVKWIKYLSKSGAYEVRY 467
            VKWIKY+SK+G+YEVRY
Sbjct: 474 AVKWIKYISKAGSYEVRY 491

>Suva_15.103 Chr15 complement(183026..184501) [1476 bp, 491 aa] {ON}
           YOL062C (REAL)
          Length = 491

 Score =  559 bits (1440), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/495 (56%), Positives = 367/495 (74%), Gaps = 32/495 (6%)

Query: 1   MLNALFIYSLRGELLISKHVKGSVQKSMSEIFRIQVINNLDVRSPVLTLGSTTFHHIKSA 60
           M++ + +YS RGEL+++K  K S+++S+S+IFR+QVINNLDVRSPVLTLGSTTFHHI+S 
Sbjct: 1   MISGVLVYSSRGELILNKFFKNSLKRSISDIFRVQVINNLDVRSPVLTLGSTTFHHIRSM 60

Query: 61  K--NLWIVAVSRSNADSAAIWEFLYRLNELLEAFNLYSENELKERFMICYELLDIVLE-D 117
           +  NLW+V ++RSNA+SAAIWEFLY+L+ ++ A+ L  E  LKE FMI +E+LDI+L  +
Sbjct: 61  RGDNLWLVTITRSNANSAAIWEFLYKLDSVMNAYRLDREEALKEEFMIVHEMLDIMLGGN 120

Query: 118 GLPVDTELSSVASKMSVKPNAGV-------DNFNMFAENGH----GGTNRILPVSQFLRG 166
           G+P+DTEL+SV ++MSVKP   V       D+ +M +        GG    L   +FL+ 
Sbjct: 121 GIPIDTELNSVIAQMSVKPIRNVGGLLESPDSIDMLSSTSSPSSVGGE---LHFPKFLKK 177

Query: 167 RPSA----GNLQDIASEAPSNIPWRMNGIKYKKNEVFLNVNERISILVSKDGSILKSYVD 222
           R S+    G+     S+  + I WR  GI +KK+EVFL VNER++ILVS+DGSILKSYVD
Sbjct: 178 RSSSFLGQGDSHSDFSDG-NKIAWRPKGIIHKKDEVFLYVNERMNILVSRDGSILKSYVD 236

Query: 223 GTVEATTHLSGMPVCRFGLNDALSVSTP-----FGDDDEYQ---VTNKKAIPKAAAGSVM 274
           GT++ TTHLSG PVCRFGLND+L + +          D++      NK   PKAAAGSV+
Sbjct: 237 GTIDITTHLSGTPVCRFGLNDSLGMQSEDQENWLSQQDQHSHNGFENKNCFPKAAAGSVL 296

Query: 275 LEDCKFHQCVQLDKFQSERTINFIAPDGSFELMKYHVRENLNLPFKVTPIVT-VVRSNSI 333
           LEDCKFH+CV +DKF     I F+ PDGS ELMKYHVR+N+NLPFK+TPIV    R N +
Sbjct: 297 LEDCKFHECVSIDKFNKNHIIEFVPPDGSMELMKYHVRDNINLPFKITPIVAHSARDNEV 356

Query: 334 DYQITIKSLFPSKLTAKDVQLRIPVPPETVSCHISTSNGKCKFVPEESAIVWKFSKYQGL 393
           DY+IT+KSLFP KL+AKDV L IPVPP TV C IS SNG CKFVPEE+A++W+F+K+ GL
Sbjct: 357 DYRITLKSLFPGKLSAKDVILHIPVPPSTVDCKISVSNGNCKFVPEENAMIWRFNKFNGL 416

Query: 394 TENSISATAVPMKDST-LNIEQWPRPPISLKFEIVMFSNSGLVVRFFNVSERDRNYKMVK 452
           TEN++SA  V   D+T L+++QW RPP+SL FE++MFSNSGLVVR+F +S RD  ++ VK
Sbjct: 417 TENTLSAVTVSTSDTTQLSLQQWTRPPMSLDFEVMMFSNSGLVVRYFTISSRDSKHRAVK 476

Query: 453 WIKYLSKSGAYEVRY 467
           WIKY+SKSG+YEVRY
Sbjct: 477 WIKYISKSGSYEVRY 491

>NCAS0C03580 Chr3 complement(715761..717236) [1476 bp, 491 aa] {ON}
           Anc_3.165
          Length = 491

 Score =  557 bits (1435), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/494 (56%), Positives = 369/494 (74%), Gaps = 30/494 (6%)

Query: 1   MLNALFIYSLRGELLISKHVKGSVQKSMSEIFRIQVINNLDVRSPVLTLGSTTFHHIKSA 60
           M+NAL I++ RGEL++SK  KGS+++S+++IFRIQVINNLDVRSP+LTLGSTTFHHIKS 
Sbjct: 1   MINALLIFTARGELVVSKLFKGSMKRSIADIFRIQVINNLDVRSPILTLGSTTFHHIKST 60

Query: 61  K--NLWIVAVSRSNADSAAIWEFLYRLNELLEAFNLYSENELKERFMICYELLDIVL--E 116
           +  NLWIVAVSR+N DSAAIWEFLY+L+ LL+++ L  E  LKE FMI +ELLD+++   
Sbjct: 61  RGDNLWIVAVSRNNVDSAAIWEFLYKLDSLLDSYGLNHEEYLKEEFMIVHELLDVMMCGS 120

Query: 117 DGLPVDTELSSVASKMSVKPNAGVDNFNMFAENGHGGT---------NRILPVSQFLRGR 167
            G+P+ TE S V S+MSVKP+  +                       + ++   + LR R
Sbjct: 121 GGIPMLTENSLVISRMSVKPSKSILEAQNSGNGSSNTNSNNNNNNVPDLLMSGPKLLR-R 179

Query: 168 PSAGNLQDIASEAPSNIPWRMNGIKYKKNEVFLNVNERISILVSKDGSILKSYVDGTVEA 227
            SA   QD++    ++  WR  GI +KKNEV L+VNERI+ILVSKDGS+LK+YVDG+++ 
Sbjct: 180 NSASLSQDLS--ILTDFKWRPKGIVHKKNEVILHVNERINILVSKDGSVLKAYVDGSIDL 237

Query: 228 TTHLSGMPVCRFGLNDALSVSTPFGD------------DDEYQVTNKKAIPKAAAGSVML 275
            THLSG P+C+FGLND+LSVS    D            D  +  T+KK +  A+ GSV+L
Sbjct: 238 ETHLSGTPICQFGLNDSLSVSGVDSDMYGSHNHNHHFGDVNFDKTDKKQLSMASVGSVIL 297

Query: 276 EDCKFHQCVQLDKFQSERTINFIAPDGSFELMKYHVRENLNLPFKVTPIVTVVRSNS-ID 334
           EDCKFHQCV LDKF  +R I F+ PDGS ELMKYHVR+NLNLPFKV+PIVT  R+ + ++
Sbjct: 298 EDCKFHQCVSLDKFDKDRIIKFVPPDGSMELMKYHVRDNLNLPFKVSPIVTNTRNGTALE 357

Query: 335 YQITIKSLFPSKLTAKDVQLRIPVPPETVSCHISTSNGKCKFVPEESAIVWKFSKYQGLT 394
           Y+IT+KSLFP +L+AK+V L IPVPP T+ C I+ +NG CKF+PEESA++W+F+K+ GLT
Sbjct: 358 YRITMKSLFPGRLSAKNVALHIPVPPNTMDCKINVTNGSCKFIPEESAMIWRFNKFNGLT 417

Query: 395 ENSISATAVPMKDST-LNIEQWPRPPISLKFEIVMFSNSGLVVRFFNVSERDRNYKMVKW 453
           EN++SA  +P KD+T L+++QW +PP+SL FEI+MFSNSGLVVR+F ++ERD+ YK VKW
Sbjct: 418 ENTLSAVTIPTKDNTQLSLQQWSKPPMSLDFEILMFSNSGLVVRYFTITERDQKYKAVKW 477

Query: 454 IKYLSKSGAYEVRY 467
           IKY+S+SG+YE+RY
Sbjct: 478 IKYISRSGSYEIRY 491

>Skud_15.91 Chr15 complement(169608..171083) [1476 bp, 491 aa] {ON}
           YOL062C (REAL)
          Length = 491

 Score =  551 bits (1420), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/495 (56%), Positives = 361/495 (72%), Gaps = 32/495 (6%)

Query: 1   MLNALFIYSLRGELLISKHVKGSVQKSMSEIFRIQVINNLDVRSPVLTLGSTTFHHIKS- 59
           M++ + +YS RGEL+++K  K S+++S+S+IFR+QVINNLDVRSPVLTLGSTTFHHI+S 
Sbjct: 1   MISGVLVYSSRGELILNKFFKNSLKRSISDIFRVQVINNLDVRSPVLTLGSTTFHHIRSK 60

Query: 60  -AKNLWIVAVSRSNADSAAIWEFLYRLNELLEAFNLYSENELKERFMICYELLDIVLE-D 117
              NLW+V ++RSNA+SAAIWEFLY+L+ ++ A+ L  E  LKE FMI +E+LDI+L  +
Sbjct: 61  HGDNLWLVTITRSNANSAAIWEFLYKLDAVMNAYRLDREEALKEEFMIVHEMLDIMLGGN 120

Query: 118 GLPVDTELSSVASKMSVKP----------NAGVDNFNMFAENGHGGTNRILPVSQFLRGR 167
           G+P+DTEL+SV ++MSVKP            G D  +  +     G     P  +FL+  
Sbjct: 121 GIPIDTELNSVVARMSVKPMRNTGGLLDGADGSDILSSSSSPSSAGGELHFP--KFLKKS 178

Query: 168 PSA--GNLQDIASEAPSN-IPWRMNGIKYKKNEVFLNVNERISILVSKDGSILKSYVDGT 224
            S+  G     +    SN I WR  GI +KK+EVFL VNER++ILVS+DGSILKSYVDGT
Sbjct: 179 SSSFLGQGDSTSDFYDSNKITWRATGIIHKKDEVFLYVNERMNILVSRDGSILKSYVDGT 238

Query: 225 VEATTHLSGMPVCRFGLNDALSVSTPFGDDDEY----------QVTNKKAIPKAAAGSVM 274
           ++  THL+G PVCRFGLND+L + +   D+  +             NK  +PKAAAGSV+
Sbjct: 239 IDIVTHLNGTPVCRFGLNDSLGMQSE--DEKNWLAQQHQHSRSDFGNKNFLPKAAAGSVL 296

Query: 275 LEDCKFHQCVQLDKFQSERTINFIAPDGSFELMKYHVRENLNLPFKVTPIVT-VVRSNSI 333
           LEDCKFH+CV ++KF     I FI PDGS ELMKYHVR+N+NLPFK+TPIV+   R N I
Sbjct: 297 LEDCKFHECVSIEKFNKNHIIEFIPPDGSMELMKYHVRDNINLPFKITPIVSHSTRDNEI 356

Query: 334 DYQITIKSLFPSKLTAKDVQLRIPVPPETVSCHISTSNGKCKFVPEESAIVWKFSKYQGL 393
           DY+IT+KSLFP KL+AKDV L IPVPP TV C IS SNG CKFVPEE+A++W+F+KY GL
Sbjct: 357 DYRITLKSLFPGKLSAKDVILHIPVPPSTVDCKISVSNGHCKFVPEENAMIWRFNKYNGL 416

Query: 394 TENSISATAVPMKDST-LNIEQWPRPPISLKFEIVMFSNSGLVVRFFNVSERDRNYKMVK 452
           TEN++SA  V   D+T L+ +QW RPP+SL FE++MFSNSGLVVR+F +S +D  ++ VK
Sbjct: 417 TENTLSAATVSTSDTTQLSFQQWTRPPMSLDFEVMMFSNSGLVVRYFTISGKDSKHRAVK 476

Query: 453 WIKYLSKSGAYEVRY 467
           WIKY+SKSG+YEVRY
Sbjct: 477 WIKYISKSGSYEVRY 491

>Smik_15.96 Chr15 complement(174750..176225) [1476 bp, 491 aa] {ON}
           YOL062C (REAL)
          Length = 491

 Score =  551 bits (1419), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/493 (57%), Positives = 368/493 (74%), Gaps = 28/493 (5%)

Query: 1   MLNALFIYSLRGELLISKHVKGSVQKSMSEIFRIQVINNLDVRSPVLTLGSTTFHHIKS- 59
           M++ + IYS RGEL+++K  K S+++S+S+IFR+QVINNLDVRSPVLTLGSTTFHHI+S 
Sbjct: 1   MISGVLIYSSRGELVLNKFFKNSLKRSISDIFRVQVINNLDVRSPVLTLGSTTFHHIRSR 60

Query: 60  -AKNLWIVAVSRSNADSAAIWEFLYRLNELLEAFNLYSENELKERFMICYELLDIVLE-D 117
              NLW+V ++RSNA+SAAIWEFLY+L+ ++ A+ L  E  LKE FMI +E+LDI+L  +
Sbjct: 61  HGDNLWLVTITRSNANSAAIWEFLYKLDFVMNAYRLDREEALKEEFMIVHEMLDIMLGGN 120

Query: 118 GLPVDTELSSVASKMSVKP--NAGV-----DNFNMFAENGHGGTNRI-LPVSQFLRGRPS 169
           G+P+DTEL+SV ++MSVKP  N G      D  +M + +    +    L   +FL+   S
Sbjct: 121 GIPIDTELNSVIAQMSVKPVRNTGGLLDSPDGNDMLSSSSSPSSVSGELHFPKFLKKSSS 180

Query: 170 AGNLQ-DIASE--APSNIPWRMNGIKYKKNEVFLNVNERISILVSKDGSILKSYVDGTVE 226
           +   Q D AS+    + I WR  GI +KK+EVFL VNER++ILVS+DGSILKSYVDGT++
Sbjct: 181 SFLGQGDSASDFYDGNKITWRPKGITHKKDEVFLYVNERMNILVSRDGSILKSYVDGTID 240

Query: 227 ATTHLSGMPVCRFGLNDALSVSTPFGDDDEY----------QVTNKKAIPKAAAGSVMLE 276
            TTHLSG P+CRFGLND+L + +   D+ ++             +K  I KAAAGSV+LE
Sbjct: 241 ITTHLSGTPICRFGLNDSLGMQSE--DEKKWLAQQQHHSRGNFESKNFIHKAAAGSVLLE 298

Query: 277 DCKFHQCVQLDKFQSERTINFIAPDGSFELMKYHVRENLNLPFKVTPIVT-VVRSNSIDY 335
           DCKFH+CV LDKF    TI F+ PDGS ELMKYHVR+N+NLPFK+TPIVT   R N IDY
Sbjct: 299 DCKFHECVSLDKFNKNHTIEFVPPDGSMELMKYHVRDNINLPFKITPIVTHSTRDNEIDY 358

Query: 336 QITIKSLFPSKLTAKDVQLRIPVPPETVSCHISTSNGKCKFVPEESAIVWKFSKYQGLTE 395
           +IT+KSLFP KL+AKDV L IPVPP TV C IS SNG CKFVPEE+A++W+F+KY GLTE
Sbjct: 359 RITLKSLFPGKLSAKDVTLHIPVPPSTVDCKISVSNGHCKFVPEENAMMWRFNKYNGLTE 418

Query: 396 NSISATAVPMKDST-LNIEQWPRPPISLKFEIVMFSNSGLVVRFFNVSERDRNYKMVKWI 454
           N++SA  V   D+T LN++QW RPP+SL FE++MFSNSGLVVR+F +  +D  ++ VKWI
Sbjct: 419 NTLSAVTVSTSDTTQLNLQQWTRPPMSLDFEVMMFSNSGLVVRYFTIFGKDSKHRAVKWI 478

Query: 455 KYLSKSGAYEVRY 467
           KY+S+SG+YEVRY
Sbjct: 479 KYISRSGSYEVRY 491

>NDAI0G02920 Chr7 complement(676413..677873) [1461 bp, 486 aa] {ON}
           Anc_3.165
          Length = 486

 Score =  541 bits (1393), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 274/491 (55%), Positives = 363/491 (73%), Gaps = 29/491 (5%)

Query: 1   MLNALFIYSLRGELLISKHVKGSVQKSMSEIFRIQVINNLDVRSPVLTLGSTTFHHIKSA 60
           M+N + IYS RGEL++SK  KG++++S+++IFRIQVINNLDVRSP+LTLGSTTFHHI+S+
Sbjct: 1   MINGILIYSPRGELIVSKLFKGTLKRSIADIFRIQVINNLDVRSPILTLGSTTFHHIRSS 60

Query: 61  K---NLWIVAVSRSNADSAAIWEFLYRLNELLEAFNLYSENELKERFMICYELLDIVLED 117
           K   NLW+VA +R+NA+SAAIWEFLY+L+ +L  + L  E  LKE FMI +ELLD++L  
Sbjct: 61  KDSDNLWLVAATRNNANSAAIWEFLYKLDSMLIEYGLNKEEYLKEEFMIVHELLDVMLGS 120

Query: 118 -GLPVDTELSSVASKMSVKPNAGVDNFNMFAENGHGGT--NRILPVSQFLRGRPSAGNLQ 174
            G+P++TE S V +KMSVKP     N      +GH G+  N  + + +FL+ R  +    
Sbjct: 121 CGIPLETEPSKVIAKMSVKPAKLHHNNTSSLLDGHLGSKGNNEISMPKFLK-RNDSSQSH 179

Query: 175 DIASEAPSNIPWRMNGIKYKKNEVFLNVNERISILVSKDGSILKSYVDGTVEATTHLSGM 234
           D ++ + ++  WR   IK+KKNEV L+VNE+I+ILV+KDGSILK+YVDG+++  T LSG 
Sbjct: 180 D-SNFSFNDFSWRPKDIKHKKNEVILHVNEKINILVAKDGSILKAYVDGSIDLQTRLSGT 238

Query: 235 PVCRFGLNDALSVSTPFGDDDEYQVTN----------------KKAIPKAAAGSVMLEDC 278
           PVC+FGLND+L++ +   +D EY   N                 K + KA+ G+V+LEDC
Sbjct: 239 PVCQFGLNDSLTLGS---NDSEYSSRNGRTGNNKSSMLDSNLSNKVLSKASVGNVILEDC 295

Query: 279 KFHQCVQLDKFQSERTINFIAPDGSFELMKYHVRENLNLPFKVTPIVT-VVRSNSIDYQI 337
           KFHQCV LDKF  ER I F+ PDGS ELMKYH+R NLNLPFK+TPIVT  V  +++DY+I
Sbjct: 296 KFHQCVSLDKFDRERIIKFVPPDGSVELMKYHIRNNLNLPFKITPIVTNSVTGDALDYRI 355

Query: 338 TIKSLFPSKLTAKDVQLRIPVPPETVSCHISTSNGKCKFVPEESAIVWKFSKYQGLTENS 397
            +KSLFP +L+AK V L IPVPP  + C+IS SNG CKFVP E+A+VWKF+KY GLTEN+
Sbjct: 356 ALKSLFPGRLSAKGVVLHIPVPPGVMDCNISVSNGTCKFVPAENAMVWKFNKYNGLTENT 415

Query: 398 ISATAVPMKD-STLNIEQWPRPPISLKFEIVMFSNSGLVVRFFNVSERDRNYKMVKWIKY 456
           +SA  VP K+ +   ++QW RPP+SL FEI+MFSNSGLVVR+F +SE  +NYK VKWIKY
Sbjct: 416 LSAVTVPSKEVNQTTLQQWARPPMSLDFEILMFSNSGLVVRYFTISEGHQNYKAVKWIKY 475

Query: 457 LSKSGAYEVRY 467
           +SKSG+YEVR+
Sbjct: 476 VSKSGSYEVRF 486

>TBLA0F00840 Chr6 (213915..215360) [1446 bp, 481 aa] {ON} Anc_3.165
           YOL062C
          Length = 481

 Score =  502 bits (1292), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 247/486 (50%), Positives = 350/486 (72%), Gaps = 24/486 (4%)

Query: 1   MLNALFIYSLRGELLISKHVKGSVQKSMSEIFRIQVINNLDVRSPVLTLGSTTFHHIKS- 59
           M+NA+ I++ RGELL+ K  K SV++++S+IFR+QVINN ++RSP+LTLGSTTFH I++ 
Sbjct: 1   MINAVMIFTPRGELLVFKVFKSSVKRTISDIFRVQVINNDNIRSPILTLGSTTFHFIRTT 60

Query: 60  -AKNLWIVAVSRSNADSAAIWEFLYRLNELLEAFNLYSENELKERFMICYELLDIVLE-D 117
               LW+VAV+RSNADS AIWE+LY+LN L+E + L  E+ LK+ F++C+ELLDI L  +
Sbjct: 61  AGSKLWLVAVTRSNADSGAIWEYLYKLNSLMEVYGLTHEDILKDEFIVCHELLDITLGMN 120

Query: 118 GLPVDTELSSVASKMSVKP----NAGVDNFNMFAEN----GHGGTNRILPVSQFLRGRPS 169
           GLP+DTELSSV  KM++KP     +  D  ++ A +    GH  T   +P  +FL    +
Sbjct: 121 GLPMDTELSSVIGKMTLKPAQVLTSSADRSDILASSVTTLGHNSTPISMP--KFLSRNSN 178

Query: 170 AGNLQDIASE-APSNIPWRMNGIKYKKNEVFLNVNERISILVSKDGSILKSYVDGTVEAT 228
               Q+  S+ +PSNIPWR   IKYKKNE+ +NV E+I++LV KD +IL++YVDGT++ T
Sbjct: 179 RSVTQEFESQFSPSNIPWRSRDIKYKKNEMIVNVIEKINVLVGKDDNILRAYVDGTIDIT 238

Query: 229 THLSGMPVCRFGLNDALSVSTPFGDD-----DEYQVTNKKAIPKAAAGSVMLEDCKFHQC 283
            HLSGMP+C+ G+ND   +ST  G +     +E + +N+ A+P  +   V+LE  KFHQC
Sbjct: 239 AHLSGMPMCQIGMND---LSTIQGGENAHWTNEDRASNRDAMPDVSGDRVILEGSKFHQC 295

Query: 284 VQLDKFQSERTINFIAPDGSFELMKYHVRENLNLPFKVTPIVTVV-RSNSIDYQITIKSL 342
           V LDK+  +  I FI PDG FELMKYHV  NLNLPF++TP VT+     ++ Y I +KSL
Sbjct: 296 VALDKYNKDNVIWFIPPDGQFELMKYHVSNNLNLPFRITPQVTLTSHGTALSYAIKLKSL 355

Query: 343 FPSKLTAKDVQLRIPVPPETVSCHISTSNGKCKFVPEESAIVWKFSKYQGLTENSISATA 402
           FP KL+A++V LRIPVPP T+ C I+ S+GKCKF+PEE+ +VW F ++ G TEN ++A  
Sbjct: 356 FPRKLSAENVVLRIPVPPGTLDCKINASDGKCKFIPEENCMVWSFHRFNGSTENHLNAQT 415

Query: 403 VPMKD-STLNIEQWPRPPISLKFEIVMFSNSGLVVRFFNVSERDRNYKMVKWIKYLSKSG 461
           VP +  ++ +I+QW RPP+SL F+++MFSN+GL+VR+  V E++ +Y  +KWIKY+S +G
Sbjct: 416 VPTQSIASQSIKQWTRPPMSLDFKVLMFSNTGLIVRYLKVQEKNMHYNTIKWIKYISAAG 475

Query: 462 AYEVRY 467
           +YEVRY
Sbjct: 476 SYEVRY 481

>TPHA0P00660 Chr16 (136114..137535) [1422 bp, 473 aa] {ON} Anc_3.165
           YOL062C
          Length = 473

 Score =  501 bits (1289), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 244/478 (51%), Positives = 355/478 (74%), Gaps = 16/478 (3%)

Query: 1   MLNALFIYSLRGELLISKHVKGSVQKSMSEIFRIQVINNLDVRSPVLTLGSTTFHHIKSA 60
           M+N + IYS RG+L++   +K S+++++S+IF+IQVIN+L+++SP+LTLGSTTFHHI+S+
Sbjct: 1   MINGVLIYSSRGDLIVCDLLKSSLKRTISDIFKIQVINSLEMKSPILTLGSTTFHHIRSS 60

Query: 61  K--NLWIVAVSRSNADSAAIWEFLYRLNELLEAFNLYSENELKERFMICYELLDIVL-ED 117
               LWIVA++RSNA+S  IWEFLY+L+ +L A++L +E +L E+FM+ YE++D++L  +
Sbjct: 61  SESKLWIVAITRSNANSGVIWEFLYKLDSMLTAYDLNNEEKLMEKFMVYYEMIDVMLTSN 120

Query: 118 GLPVDTELSSVASKMSVKPNAGVDNFNMFAENGHGGTNRILPVSQFLRGRPSAGNLQDIA 177
            +P++TELSS+ASK+S +    + N     +N + G    L + +FL  R S    Q+ +
Sbjct: 121 AMPINTELSSIASKISYRLPKTISNSPTNEKNNNNG----LSIPKFL-TRNSRSMSQEFS 175

Query: 178 SEAPSNIPWRMNGIKYKKNEVFLNVNERISILVSKDGSILKSYVDGTVEATTHLSGMPVC 237
           +   S+IPWR  GIKYKKNEVFL VNE+I+ILVSKD +ILK+YVDG+++  +HLSG P+C
Sbjct: 176 NITQSDIPWRPTGIKYKKNEVFLYVNEKINILVSKDQTILKAYVDGSIDLVSHLSGTPIC 235

Query: 238 RFGLNDALSVS----TPFGDDDEYQVTNKKAIP--KAAAGSVMLEDCKFHQCVQLDKFQS 291
           +FGLND LS++    +  GD+  +   + + +   ++++ SV +EDC FHQCV LDKF  
Sbjct: 236 QFGLNDYLSMTGNNISNRGDEFRHDFMDDEDLSTGRSSSSSVKIEDCTFHQCVSLDKFND 295

Query: 292 ERTINFIAPDGSFELMKYHVRENLNLPFKVTPIVTVVRSN-SIDYQITIKSLFPSKLTAK 350
           ER INF+ PDGSFELM+YHVR++LN+PFKVTP V++  S  S+ Y+I +KSLFP+ L+A 
Sbjct: 296 ERLINFVPPDGSFELMRYHVRDDLNIPFKVTPRVSISSSRCSMRYKIILKSLFPTSLSAA 355

Query: 351 DVQLRIPVPPETVSCHISTSNGKCKFVPEESAIVWKFSKYQGLTENSISATAVPMKDS-T 409
           D  L+IP+PP TV C I+ S+GKC F   ++  +WKF+KY+GLTEN +    VP   +  
Sbjct: 356 DAMLKIPLPPGTVDCKINASSGKCNFSTSDNCAIWKFNKYKGLTENELILETVPSSSTDI 415

Query: 410 LNIEQWPRPPISLKFEIVMFSNSGLVVRFFNVSERDRNYKMVKWIKYLSKSGAYEVRY 467
           L+++QW RPP+S+ FEI+MFSNSGLVV++  V ER + Y+ VKWIKY+SKSG+YE+RY
Sbjct: 416 LSLQQWTRPPMSMNFEIIMFSNSGLVVKYLKVMERVQKYRPVKWIKYVSKSGSYEIRY 473

>KLLA0C03894g Chr3 complement(354889..356316) [1428 bp, 475 aa] {ON}
           similar to uniprot|Q99186 Saccharomyces cerevisiae
           YOL062C APM4 Clathrin associated protein medium subunit,
          Length = 475

 Score =  487 bits (1253), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 243/484 (50%), Positives = 352/484 (72%), Gaps = 26/484 (5%)

Query: 1   MLNALFIYSLRGELLISKHVKGSVQKSMSEIFRIQVINNLDVRSPVLTLGSTTFHHI--K 58
           ML+A+FIY+ +G+LLISK +K  V++S++++FR QVIN+  VRSP+LTLGSTTF H+  +
Sbjct: 1   MLSAIFIYNAKGDLLISKLIKDHVKRSLADVFRTQVINDPHVRSPILTLGSTTFQHVIRE 60

Query: 59  SAKNL--WIVAVSRSNADSAAIWEFLYRLNELLEAFNLYSENELKERFMICYELLDIVLE 116
           S+ NL  W+VAVSRSN DS+ IWE+L++L +L+EAF +  E+ LK+ FM+ YE+L++ LE
Sbjct: 61  SSDNLPMWLVAVSRSNVDSSMIWEYLHKLYQLMEAFGINDEDVLKDEFMLLYEILELTLE 120

Query: 117 DGLPVDTELSSVASKMSVKPNAGVDNFNMFAENGHGGTNRILPVSQFLRG-RPSAGNLQD 175
           +G+P  T+L+ +  ++S KP   ++N N  +++     +  L  S  L+  + S  +   
Sbjct: 121 NGIPQTTDLAQIIPRVSRKP---IEN-NTISKSP--DLDDFLSGSNILKAPKLSKRSSSS 174

Query: 176 IASEAPSNIPWRMNGIKYKKNEVFLNVNERISILVSKDGSILKSYVDGTVEATTHLSGMP 235
           IA  + S  PWR +G+KYKKNEV+L++NE+I+ILV KDGSI+KS+VDG+V+  +HLSGMP
Sbjct: 175 IALSSLSECPWRPSGLKYKKNEVYLDINEKITILVGKDGSIVKSFVDGSVDCVSHLSGMP 234

Query: 236 VCRFGLNDALSVSTPFGDD----------DEYQVTNKKAIPKAAAGSVMLEDCKFHQCVQ 285
           +C+ GLND  S+    G++           EY + NKKAIP AAAGSV+LEDCKFHQCVQ
Sbjct: 235 LCQLGLNDTYSI---HGNEKSELSIVEMMSEYDIKNKKAIPNAAAGSVILEDCKFHQCVQ 291

Query: 286 LDKFQSERTINFIAPDGSFELMKYHVRENLNLPFKVTPIVTVVRSNSIDYQITIKSLFPS 345
           L+K+++   I F+ PDG F+LM+Y V +N+N+PF V P V +V++++++Y++T++SLFPS
Sbjct: 292 LNKYEANHVIQFVPPDGPFQLMQYRVIDNINIPFNVIPEVEIVKNSTLNYKVTLRSLFPS 351

Query: 346 KLTAKDVQLRIPVPPETVSCHISTSNGKCKFVPEESAIVWKFSKYQGLTENSISA-TAVP 404
            ++AKDV ++IPVPP T+ C  + S GKCK+   E  +VWK++KY+G TEN++S   A+P
Sbjct: 352 NVSAKDVTVKIPVPPTTIKCDFNVSGGKCKYDAGEKCMVWKYNKYKGSTENTLSGKVAIP 411

Query: 405 MKDSTL-NIEQWPRPPISLKFEIVMFSNSGLVVRFFNVSERDRNYKMVKWIKYLSKSGAY 463
                L ++ +W RPPIS+ FEIVMFSNSGLVVR     E   NY+ VKWIKY+S SGAY
Sbjct: 412 ATSHDLSDLLRWSRPPISMGFEIVMFSNSGLVVRHLKCQEPQLNYQPVKWIKYISHSGAY 471

Query: 464 EVRY 467
           E+RY
Sbjct: 472 EIRY 475

>KNAG0K01150 Chr11 complement(225095..226519) [1425 bp, 474 aa] {ON}
           Anc_3.165 YOL062C
          Length = 474

 Score =  484 bits (1245), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 248/484 (51%), Positives = 331/484 (68%), Gaps = 27/484 (5%)

Query: 1   MLNALFIYSLRGELLISKHVKGSVQKSMSEIFRIQVINNLDVRSPVLTLGSTTFHHIKS- 59
           M+NA+ +YS RGEL++SK  K ++++S+ +IFR+QVIN+LDVRSP+LTLGSTTFH++++ 
Sbjct: 1   MINAVLVYSARGELIVSKMFKPTLKRSVGDIFRVQVINSLDVRSPILTLGSTTFHYVRTP 60

Query: 60  AKNLWIVAVSRSNADSAAIWEFLYRLNELLEAFNLYSENELKERFMICYELLDIVLEDG- 118
            + LW+V+VSR+N +SAA WEFLY+   +L A+ L SE  LKE FM+ +ELLD ++E G 
Sbjct: 61  GEGLWVVSVSRNNENSAATWEFLYKFATMLAAYRLDSEEVLKEEFMLAWELLDTMVEGGG 120

Query: 119 LPVDTELSSVASKMSVKP-----NAGVDNFNMFAENGHGGTNRILPVSQFLRGRPSAGNL 173
           +P +T+   + S MSVKP     +   D          G      P  Q L    + G +
Sbjct: 121 IPSETDPHRIISAMSVKPAMSPVDVRADARQQQTTTSTGAFGHAFP--QLLHRASNPGGI 178

Query: 174 QDIASEAPSNIPWRMNGIKYKKNEVFLNVNERISILVSKDGSILKSYVDGTVEATTHLSG 233
             I   A  +      G + K+NE+ + V E ISILVSKDGSILK+YVDG ++ TT L G
Sbjct: 179 S-ILPHATGD------GAQLKRNEIVMVVQESISILVSKDGSILKAYVDGGIDLTTKLEG 231

Query: 234 MPVCRFGLNDALSVSTPFGD------DDEYQVTNKKAIPKAAAGSVMLEDCKFHQCVQLD 287
             VC+FGLND+LS               E Q TN + +  A  G+V+L DCKFHQCV L+
Sbjct: 232 AAVCQFGLNDSLSTDNSSNSKWDPLRSKETQGTNLE-MKNAHVGTVLLRDCKFHQCVSLE 290

Query: 288 KFQSERTINFIAPDGSFELMKYHVRENLNLPFKVTPIVTVVRSNSIDYQITIKSLFPSKL 347
           +F  +R I F  P+G+ ELMKYHVR+NLNLPFKVT +V    +N  DY++TIKSLFP KL
Sbjct: 291 RFDRDRIIRFTPPEGTIELMKYHVRDNLNLPFKVTSMVIPTANNETDYRVTIKSLFPGKL 350

Query: 348 TAKDVQLRIPVPPETVSCHISTSNGKCKFVPEESAIVWKFSKYQGLTENSISATAVPMKD 407
           +AK+V +RIPVPP T+ C I+ SNG CKF+PEE+A+VWKF KY GLTEN +SA  VP +D
Sbjct: 351 SAKNVTMRIPVPPGTLDCKINVSNGNCKFLPEENAMVWKFHKYNGLTENKLSAITVPTRD 410

Query: 408 ST-LNIEQWPRPPISLKFEIVMFSNSGLVVRFFNVSERDRN---YKMVKWIKYLSKSGAY 463
           +T L ++QW RPPISL FEI+M+SN+GLVVR+F V ++  N   +K VKWIKY+S SG+Y
Sbjct: 411 TTQLALQQWSRPPISLDFEILMYSNTGLVVRYFTVLDKHNNNTKFKTVKWIKYVSHSGSY 470

Query: 464 EVRY 467
           EVRY
Sbjct: 471 EVRY 474

>ADR315W Chr4 (1259839..1261317) [1479 bp, 492 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOL062C (APM4)
          Length = 492

 Score =  468 bits (1204), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 227/444 (51%), Positives = 309/444 (69%), Gaps = 32/444 (7%)

Query: 1   MLNALFIYSLRGELLISKHVKGSVQKSMSEIFRIQVINNLDVRSPVLTLGSTTFHHIKSA 60
           M++A F+++ RG L++SK + G  ++S+SE+FR+QVIN L++RSPVLTLGSTTF HI+++
Sbjct: 1   MIDAFFVFAPRGSLIVSKLISGEAKESLSEVFRLQVINGLEIRSPVLTLGSTTFQHIRTS 60

Query: 61  KNLWIVAVSRSNADSAAIWEFLYRLNELLEAFNLYSENELKERFMICYELLDIVLEDGLP 120
             LW+V V R NADSAAIWEFLY +N+LL+A+ + +E  L + FM+CYELLD+VL+ GLP
Sbjct: 61  GGLWMVVVVRGNADSAAIWEFLYHMNKLLDAYAINTEEALLDDFMLCYELLDVVLDSGLP 120

Query: 121 VDTELSSVASKMSVKPNAGV----DNFNMFAENGHGGTNRILPVSQFLRGRPSAGNLQDI 176
            DTELS +   +S KP  G     D+F   A     GT  +           S   L   
Sbjct: 121 QDTELSHIVPLLSRKPATGESASGDDFLNSARLRRTGTKNV-----------SVETLDHF 169

Query: 177 ASEAPSNIPWRMNGIKYKKNEVFLNVNERISILVSKDGSILKSYVDGTVEATTHLSGMPV 236
           + +     PWR  GIKYKKNEV+L+V E++S+LV++DG+ILK+YVDGTV+ T HLSGMP+
Sbjct: 170 SRDV---CPWRGEGIKYKKNEVYLDVIEKLSLLVNRDGTILKAYVDGTVQCTAHLSGMPL 226

Query: 237 CRFGLNDALSVSTPFGDDDEYQVTNKKAIPKAAAG----SVMLEDCKFHQCVQLDKFQSE 292
           C FG ND+ S+          +   ++  P+        SV+LEDCKFHQCVQL+KF  E
Sbjct: 227 CHFGFNDSQSL--------RQRSPRRQYAPRVFGTDERESVVLEDCKFHQCVQLNKFDQE 278

Query: 293 RTINFIAPDGSFELMKYHVRENLNLPFKVTPIVTVVRSNSIDYQITIKSLFPSKLTAKDV 352
           R I F+ PDG FELMKYH+R++L  PFKVTP+V+ V   SI+Y+IT++SLFP+KL+AKDV
Sbjct: 279 RVIRFVPPDGEFELMKYHIRDDLRPPFKVTPVVSKVNERSIEYRITLQSLFPTKLSAKDV 338

Query: 353 QLRIPVPPETVSCHISTSNGKCKFVPEESAIVWKFSKYQGLTENSISATAVPMKDSTLN- 411
           +L IP PP T+S  ++ S GKCKFVPEE+AI+WK  K+ GLTEN++SA  +  +      
Sbjct: 339 ELYIPAPPYTISAKVNVSCGKCKFVPEENAIIWKIHKFHGLTENTLSAVTIADEQGHYAQ 398

Query: 412 -IEQWPRPPISLKFEIVMFSNSGL 434
            ++QWPRPPIS+K EI+MFS + L
Sbjct: 399 VLDQWPRPPISMKLEIMMFSTAAL 422

>KAFR0C01020 Chr3 (208272..209558) [1287 bp, 428 aa] {ON} Anc_3.165
           YOL062C
          Length = 428

 Score =  397 bits (1020), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 213/476 (44%), Positives = 311/476 (65%), Gaps = 57/476 (11%)

Query: 1   MLNALFIYSLRGELLISKHVKGSVQKSMSEIFRIQVINNLDVRSPVLTLGSTTFHHIKSA 60
           M++A+ IY+ RGEL++SK  + ++++S+SEIFRIQVINN +VRSP+LTLGSTTFHHI+S 
Sbjct: 1   MISAILIYTPRGELIVSKLYRNNIKRSISEIFRIQVINNFNVRSPILTLGSTTFHHIRST 60

Query: 61  KN------LWIVAVSRSNADSAAIWEFLYRLNELLEAFNLYSENELKERFMICYELLD-I 113
            N      LW+V V+R+NA+SAAIWEFL +LN +L+ + + SE++LK+ FM  +E+LD +
Sbjct: 61  ANDPTDDELWLVCVNRNNANSAAIWEFLQKLNLILQQYGITSESKLKDEFMTVHEILDNM 120

Query: 114 VLEDGLPVDTELSSVASKMSVKPNAGVDNFNMFAENGHGGTNRILPVSQFLRGRPSAGNL 173
           +L  G+  +T+L S+  KMSVKP +  +             N IL         P A   
Sbjct: 121 LLGTGIIQNTDLKSIVDKMSVKPISRTNETTSTQTGFLKRRNTILTT-------PGAN-- 171

Query: 174 QDIASEAPSNIPWRMNGIKYKKNEVFLNVNERISILVSKDGSILKSYVDGTVEATTHLSG 233
               S  P+N   R +   +KKNE+F  VNE +++LVSKDGSILK+YVDG +E  +HL+G
Sbjct: 172 ---FSLIPTN---RHDA--HKKNEIFFFVNESMNLLVSKDGSILKNYVDGKIEIKSHLNG 223

Query: 234 MPVCRFGLNDALSVSTPFGDDDEYQVTNKKAIPKAAAGSVMLEDCKFHQCVQLDKFQSER 293
            P C+F L            DD+ ++T                D KF QC++  K QS R
Sbjct: 224 NPTCQFEL-----------VDDQTKIT----------------DFKFDQCIE--KVQS-R 253

Query: 294 TINFIAPDGSFELMKYHVREN-LNLPFKVTPIVTVVRSNSIDYQITIKSLFPSKLTAKDV 352
           T+   A DG  E++ YHVR++ +N+PFK+TPIV+ V+ +++DY+I++KSLFP  L+A DV
Sbjct: 254 TVRVAATDGELEIVNYHVRDDKINIPFKITPIVSTVK-DTVDYRISLKSLFPKNLSATDV 312

Query: 353 QLRIPVPPETVSCHISTSNGKCKFVPEESAIVWKFSKYQGLTENSISATAVPMKDSTLNI 412
            L IPVPP T+ C I+ SNG CKF  E++A++W F+K+ G TEN++SA  +      +N+
Sbjct: 313 VLTIPVPPNTIDCKINVSNGHCKFKAEQNAVIWTFNKFNGSTENTLSAITIADGRQIMNL 372

Query: 413 EQWPRPPISLKFEIVMFSNSGLVVRFFNVSERD-RNYKMVKWIKYLSKSGAYEVRY 467
           E W RP I L FEI M+S SGL++R   ++++D R YK  +WIKY+S++G+YE+R+
Sbjct: 373 ESWTRPSIQLTFEITMYSISGLLLRNLMITDKDKRRYKASRWIKYISRAGSYEMRF 428

>NDAI0E03680 Chr5 complement(794613..795947) [1335 bp, 444 aa] {ON}
           Anc_7.127
          Length = 444

 Score =  219 bits (557), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 149/476 (31%), Positives = 254/476 (53%), Gaps = 44/476 (9%)

Query: 1   MLNALFIYSLRGELLISKHVKGSVQKSMSEIFRIQVINNLDVRS----PVLTLGSTTFHH 56
           M +A++   ++G  L+S+  +  +  +  + F   ++ +L+  S    P LT  +T +  
Sbjct: 1   MASAIYFCDIKGRPLLSRKYRDDIPLTAIDKFA-SLLADLEEESSVIPPCLTYNNTQYLF 59

Query: 57  IKSAKNLWIVAVS---RSNADSAAIWEFLYRLNELL-EAFNLYSENELKERFMICYELLD 112
           I+ + ++++VA++   R+N   A ++ FLY++ ++L +      E  +++ ++I YELLD
Sbjct: 60  IQHS-DIYLVAITNLLRTNI--AEVFAFLYKIIDVLGDYLKTVEEESIRDNYVIIYELLD 116

Query: 113 IVLEDGLPVDTELSSVASKMSVKPNAGVDNFNMFAENGHGGTNRILPVSQFLRGRPSAGN 172
            +++ G+P  TE   +   ++ K      +F +                     RP +  
Sbjct: 117 ELMDYGIPQITETKMLKQYITQK------SFKLVKAAKKKQNAA----------RPPSA- 159

Query: 173 LQDIASEAPSNIPWRMNGIKYKKNEVFLNVNERISILVSKDGSILKSYVDGTVEATTHLS 232
           L D       ++ WR  GIKYKKNE FL++ E I++L+++ G IL+S + G V+  + LS
Sbjct: 160 LTD-------SVSWRSEGIKYKKNEAFLDIVESINMLMTQKGQILRSEILGVVKIKSRLS 212

Query: 233 GMPVCRFGLNDALSVSTPFGDDDEYQVTNKKAIPKAAAGSVMLEDCKFHQCVQLDKFQSE 292
           GMP  + G+ND    S    +DD    TN  A  K     + LED KFHQCV+L KF++E
Sbjct: 213 GMPDLKLGINDKGIFSKQLTEDD----TNNNATSK-KQNKIELEDLKFHQCVRLSKFETE 267

Query: 293 RTINFIAPDGSFELMKYHVRENLNLPFKVTPIVTVVRSNS-IDYQITIKSLFPSKLTAKD 351
           + I FI PDG FELM Y +  ++  P     +   V SNS I+     K+    K TA +
Sbjct: 268 KIITFIPPDGDFELMNYRLSTSIK-PLIWCDMNVQVHSNSRIEIHCRAKAQIKKKSTATN 326

Query: 352 VQLRIPVPPETVSCHISTSNGKCKFVPEESAIVWKFSKYQGLTENSISATAVPMKDSTLN 411
           V++ IPVP +  + +   S+G  K+VPE+SAI+WK   + G  E S++A       S+ +
Sbjct: 327 VEILIPVPEDADTPNFKYSHGSIKWVPEKSAILWKIRSFPGGKEYSMAAELCLPSTSSKS 386

Query: 412 IEQWPRPPISLKFEIVMFSNSGLVVRFFNVSERDRNYKMVKWIKYLSKSG-AYEVR 466
            E   + P+ +KF+I  F+ SG+ VR+  ++E    YK   W++Y+++SG  Y +R
Sbjct: 387 EEVQNKKPVQVKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIR 442

>KLTH0F12584g Chr6 complement(1053944..1055269) [1326 bp, 441 aa]
           {ON} highly similar to uniprot|Q00776 Saccharomyces
           cerevisiae YPL259C APM1 medium subunit of the clathrin-
           associated protein complex
          Length = 441

 Score =  214 bits (546), Expect = 5e-64,   Method: Compositional matrix adjust.
 Identities = 146/476 (30%), Positives = 241/476 (50%), Gaps = 47/476 (9%)

Query: 1   MLNALFIYSLRGELLISKHVKGSVQKSMSEIFR---IQVINNLDVRSPVLTLGSTTFHHI 57
           M + ++    +G++++S+  +  V  S  E F    ++      +  P LT     +  I
Sbjct: 1   MASCIYFCDNKGKVILSRRYRDDVPPSAIEKFPSLLLEAEQESSIVPPCLTHNGVQYLFI 60

Query: 58  KSAKNLWIVAVSRS-NADSAAIWEFLYRLNELL-EAFNLYSENELKERFMICYELLDIVL 115
           +   +++++ +SRS + + A ++ FLY+L E+L E      E  +++ F+I YELLD +L
Sbjct: 61  QH-NDIYVLTMSRSLSINVAQVFSFLYKLVEVLAEYVKTVEEESIRDNFVIIYELLDEML 119

Query: 116 EDGLPVDTELSSVASKMSVKPNAGVDNFNMFAENGHGGTNRILPVSQFLRGRPSAGNLQD 175
           + G+P  TE   +   ++ K    +       ++     N I P SQ  +          
Sbjct: 120 DYGIPQITETKMLKQYITQKSYKLI-------KSAKKSKNVIRPPSQLTK---------- 162

Query: 176 IASEAPSNIPWRMNGIKYKKNEVFLNVNERISILVSKDGSILKSYVDGTVEATTHLSGMP 235
                  ++ WR  GI YKKNE FL+V E I++L++  G +L+S + G V   + LSGMP
Sbjct: 163 -------SVSWRPEGITYKKNEAFLDVTESINMLITASGQVLRSEILGKVNVRSRLSGMP 215

Query: 236 VCRFGLNDALSVSTPFGDDDEYQVTNKKAIPKAAAGSVMLEDCKFHQCVQLDKFQSERTI 295
             + GLND    ++            KK+       ++ LED KFHQCV+L KF++E+ I
Sbjct: 216 DLKLGLNDKGIFTSVESASSSEATEGKKS-------NIELEDLKFHQCVRLSKFENEKII 268

Query: 296 NFIAPDGSFELMKYHVRENLNLPFKVTPIVTVVRSNSIDYQITIKSLFPSKLTAKDVQLR 355
            FI PDG FELM Y +   +         + V   + I+     K+    K TA +V++ 
Sbjct: 269 TFIPPDGDFELMNYRLSTPIKPLIWCDAKIQVHSQSRIEIHCRAKAQIKKKSTANNVEIL 328

Query: 356 IPVPPETVSCHISTSNGKCKFVPEESAIVWKFSKYQGLTENSISAT-AVP-MKDSTLNIE 413
           IPVP +  S     S+G  K+VPE+SAI+WK   + G  E S +A   +P M D+ +   
Sbjct: 329 IPVPEDADSPKFRYSHGSLKYVPEKSAILWKIKTFNGGKEYSFAAQLGLPSMTDAEV--- 385

Query: 414 QWPRP--PISLKFEIVMFSNSGLVVRFFNVSERDRNYKMVKWIKYLSKSG-AYEVR 466
             PR   PI +KF+I  F+ SG+ VR+  ++E    Y+   W++Y+++SG  Y +R
Sbjct: 386 --PRAKRPIQVKFQIPYFTTSGIQVRYLKINEPKLQYQSYPWVRYITQSGDDYTIR 439

>Kwal_55.20843 s55 complement(580157..581482) [1326 bp, 441 aa] {ON}
           YPL259C (APM1) - medium subunit of the
           clathrin-associated protein complex [contig 138] FULL
          Length = 441

 Score =  213 bits (541), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 140/472 (29%), Positives = 241/472 (51%), Gaps = 39/472 (8%)

Query: 1   MLNALFIYSLRGELLISKHVKGSVQKSMSEIFR---IQVINNLDVRSPVLTLGSTTFHHI 57
           M + ++     G++++S+  +  V  S  E F    ++      V  P LT     +  I
Sbjct: 1   MASCIYFCDNTGKVILSRRYRDDVPPSAIERFPALLLEAEQESSVVPPCLTHNGLQYMFI 60

Query: 58  KSAKNLWIVAVSRS-NADSAAIWEFLYRLNELL-EAFNLYSENELKERFMICYELLDIVL 115
           +   +++++ +SRS + + A ++ FLY+L E+L E      E  +++ F+I YELLD +L
Sbjct: 61  QH-NDIYVLTMSRSLSINVAQVFSFLYKLVEVLAEYLKTVEEESIRDNFVIIYELLDEML 119

Query: 116 EDGLPVDTELSSVASKMSVKPNAGVDNFNMFAENGHGGTNRILPVSQFLRGRPSAGNLQD 175
           + G+P  TE   +   ++ K    + +            N + P +Q  +          
Sbjct: 120 DYGIPQITETKMLKQYITQKSYKLIKSVK-------KSKNVVRPPAQLTK---------- 162

Query: 176 IASEAPSNIPWRMNGIKYKKNEVFLNVNERISILVSKDGSILKSYVDGTVEATTHLSGMP 235
                  ++ WR  GI YKKNE FL+V E I++L++  G +L+S + G V+  + LSGMP
Sbjct: 163 -------SVSWRPEGITYKKNEAFLDVTESINMLITASGQVLRSEILGKVKVRSRLSGMP 215

Query: 236 VCRFGLNDALSVSTPFGDDDEYQVTNKKAIPKAAAGSVMLEDCKFHQCVQLDKFQSERTI 295
             + GLND    ++  G ++    + KK+       ++ LED +FHQCV+L KF++E+ I
Sbjct: 216 DLKLGLNDKGIFTSEEGGNNAEGGSGKKS-------NIELEDLQFHQCVRLSKFENEKII 268

Query: 296 NFIAPDGSFELMKYHVRENLNLPFKVTPIVTVVRSNSIDYQITIKSLFPSKLTAKDVQLR 355
           +FI PDG F+LM Y +   +         + V   + I+     K+    K TA +V++ 
Sbjct: 269 SFIPPDGDFDLMNYRLSTPIKPLIWCDAKIQVHSQSRIEIHCRAKAQIKKKSTANNVEIL 328

Query: 356 IPVPPETVSCHISTSNGKCKFVPEESAIVWKFSKYQGLTENSISATAVPMKDSTLNIEQW 415
           IPVP +  S     S+G  K+VPE+SAI+W+   + G  E S +A       + + + + 
Sbjct: 329 IPVPEDADSPKFRYSHGSLKYVPEKSAILWRIKTFNGGKEYSFAAQLGLPSMTDVEVPKA 388

Query: 416 PRPPISLKFEIVMFSNSGLVVRFFNVSERDRNYKMVKWIKYLSKSG-AYEVR 466
            R PI +KF+I  F+ SG+ VR+  V E    Y+   W++Y+++SG  Y +R
Sbjct: 389 KR-PIQVKFQIPYFTTSGIQVRYLKVHEPKLQYQSYPWVRYITQSGDDYTIR 439

>Ecym_8350 Chr8 (700421..701758) [1338 bp, 445 aa] {ON} similar to
           Ashbya gossypii ADL017C
          Length = 445

 Score =  213 bits (541), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 139/468 (29%), Positives = 250/468 (53%), Gaps = 37/468 (7%)

Query: 1   MLNALFIYSLRGELLISKHVKGSVQKSMSEIFRIQVI---NNLDVRSPVLTLGSTTFHHI 57
           M + ++    +G+LL+S+  K  +  S  E F   +I      +V  P  +     +  I
Sbjct: 1   MSSGIYFCDAKGKLLLSRRYKDDIPISAIEQFPYLLIEKEQESNVIPPCFSHNGVQYLFI 60

Query: 58  KSAKNLWIVAVSRS-NADSAAIWEFLYRLNELLEAF-NLYSENELKERFMICYELLDIVL 115
           +   +L+I+ ++RS  A+ A ++ FL+ L ++L+ +  +  E  +K+ F+I YELLD V+
Sbjct: 61  QH-NDLYILTLTRSMYANVAQVFSFLHTLVDVLQEYMKVVEEESIKDNFVIIYELLDEVM 119

Query: 116 EDGLPVDTELSSVASKMSVKPNAGVDNFNMFAENGHGGTNRILPVSQFLRGRPSAGNLQD 175
           + G+P  T+   +   ++ K      +F +                  +R      N+  
Sbjct: 120 DSGIPQITDTKMLRQYITQK------SFKL------------------IRSAKKKKNVVR 155

Query: 176 IASEAPSNIPWRMNGIKYKKNEVFLNVNERISILVSKDGSILKSYVDGTVEATTHLSGMP 235
             S   + + WR  GIKYKKNE FL+V E I++++++ G +L+S + G V+  + LSGMP
Sbjct: 156 PPSSLTTAVSWRPEGIKYKKNEAFLDVIESINMMMTQQGQVLRSEILGKVKVRSRLSGMP 215

Query: 236 VCRFGLNDALSVSTPFGDDDEYQVTNKKAIPKAAAGSVMLEDCKFHQCVQLDKFQSERTI 295
             + GLND   + T   +++E + +++ +I +  + ++ LED KFHQCV+L KF++E+ I
Sbjct: 216 DLKLGLNDK-GIFTQSNEEEEDEPSSQPSITRKKS-NIELEDLKFHQCVRLSKFENEKII 273

Query: 296 NFIAPDGSFELMKYHVRENLNLPFKVTPIVTVVRSNSIDYQITIKSLFPSKLTAKDVQLR 355
            FI PDG FELM Y +   +         + V   + ++     K+   +K TA +V++ 
Sbjct: 274 TFIPPDGDFELMSYRLSTPIKPLIWCDAKIQVHSRSRVEVHCRAKAQIKAKSTANNVEIL 333

Query: 356 IPVPPETVSCHISTSNGKCKFVPEESAIVWKFSKYQGLTENSISA-TAVPMKDSTLNIEQ 414
           IPVP +  S     S+G  K+VPE++AI+WK   + G  + S++A   +P   S  +I  
Sbjct: 334 IPVPNDADSPKFRYSHGSIKWVPEKNAILWKIKSFPGGKDYSMAAEMGLP---SVNDIAD 390

Query: 415 WP-RPPISLKFEIVMFSNSGLVVRFFNVSERDRNYKMVKWIKYLSKSG 461
           +  + P+ +KF+I  F+ SG+ VR+  ++E    Y    W++Y+++SG
Sbjct: 391 YNFKRPVQIKFQIPYFTTSGIQVRYLKINEPKLQYNSYPWVRYITQSG 438

>KLLA0D14311g Chr4 (1216574..1217905) [1332 bp, 443 aa] {ON} similar
           to uniprot|Q00776 Saccharomyces cerevisiae YPL259C APM1
           medium subunit of the clathrin-associated protein
           complex
          Length = 443

 Score =  212 bits (539), Expect = 6e-63,   Method: Compositional matrix adjust.
 Identities = 140/465 (30%), Positives = 240/465 (51%), Gaps = 42/465 (9%)

Query: 11  RGELLISKHVKGSVQKSMSEIFRIQVINNLDVRSPVLTLGSTTFHH------IKSAKNLW 64
           +G+ L+S+  +  V +S  E F+  ++     R    ++    FHH           +++
Sbjct: 11  KGKPLLSRRYQDDVSQSAVESFQHLLLE----REQESSVMPPCFHHNGIHYMYVQYNDVY 66

Query: 65  IVAVSRS-NADSAAIWEFLYRLNELLEAFNLYSENE-LKERFMICYELLDIVLEDGLPVD 122
           ++A++RS + ++  ++ F+Y+L  ++E +    E E +++ ++I YELLD +++ G+P  
Sbjct: 67  VLALTRSVSVNATTMFAFMYKLINVVEEYVKRVEEESIRDNYIIIYELLDEMMDKGVPQV 126

Query: 123 TELSSVASKMSVKPNAGVDNFNMFAENGHGGTNRILPVSQFLRGRPSAGNLQDIASEAPS 182
           TE   +   ++ K      +F +                   R      N+    +E  +
Sbjct: 127 TETKMLKQYITQK------SFKL------------------TRSAKKQKNVARPPTELTN 162

Query: 183 NIPWRMNGIKYKKNEVFLNVNERISILVSKDGSILKSYVDGTVEATTHLSGMPVCRFGLN 242
           ++ WR  GIKYKKNE FL+V E I++L+++ G +L+S + GTV+  + LSGMP  + GLN
Sbjct: 163 SVSWRPEGIKYKKNEAFLDVIESINMLMTQQGQVLRSEILGTVKVRSRLSGMPDLKLGLN 222

Query: 243 DALSVSTPFGDDDEYQVTNKKAIPKAAAGSVMLEDCKFHQCVQLDKFQSERTINFIAPDG 302
           D    +T   +D    V +     K    ++ LED KFHQCV+L KF++E+ I FI PDG
Sbjct: 223 DKGIFTTNDQEDSPEPVVSS----KKKNSNIELEDLKFHQCVRLSKFENEKIITFIPPDG 278

Query: 303 SFELMKYHVRENLNLPFKVTPIVTVVRSNSIDYQITIKSLFPSKLTAKDVQLRIPVPPET 362
            F+LM Y +   +         V V   + I+     K+    K  A +V++ IP+P + 
Sbjct: 279 EFDLMTYRLSTPIKPLIWCDVKVQVHSGSRIEIHCRAKAQIKKKSVANNVEILIPIPEDA 338

Query: 363 VSCHISTSNGKCKFVPEESAIVWKFSKYQGLTENSISATAVPMKDSTLNIEQWPRPPISL 422
            S     S G  K+VPE++AI+WKFS +QG  E S++A       S     +  R P+ +
Sbjct: 339 DSPTFKYSRGNIKWVPEKNAILWKFSSFQGGKEYSMAAQLGLPSVSDAEPPKLKR-PVQI 397

Query: 423 KFEIVMFSNSGLVVRFFNVSERDRNYKMVKWIKYLSKSG-AYEVR 466
           KF+I  F+ SG+ VR+  + E    Y    W++Y+++SG  Y +R
Sbjct: 398 KFQIPYFTTSGIQVRYLKIEEPKLQYNSYPWVRYITQSGDDYTIR 442

>SAKL0F05346g Chr6 (413830..415173) [1344 bp, 447 aa] {ON} highly
           similar to uniprot|Q00776 Saccharomyces cerevisiae
           YPL259C APM1 medium subunit of the clathrin- associated
           protein complex
          Length = 447

 Score =  206 bits (525), Expect = 7e-61,   Method: Compositional matrix adjust.
 Identities = 146/476 (30%), Positives = 250/476 (52%), Gaps = 41/476 (8%)

Query: 1   MLNALFIYSLRGELLISKHVKGSVQKSMSEIFRIQVINNLDVRS---PVLTLGSTTFHHI 57
           M + ++    +G+ ++S+  K  +  +  + F + ++      S   P L      +  +
Sbjct: 1   MASCIYFCDSKGKKILSRRYKDDIPTNAIDKFPMLLVEREQESSVIPPCLAHNGIQYLFV 60

Query: 58  KSAKNLWIVAVSRS-NADSAAIWEFLYRLNELL-EAFNLYSENELKERFMICYELLDIVL 115
           +   +L+++ ++RS + + A ++ FLY++ E+L E   +  E  +++ F+I YELLD ++
Sbjct: 61  QH-NDLYVLTMTRSLSTNVAQLFAFLYKVVEVLTEYVKVVEEESIRDNFVIIYELLDEMM 119

Query: 116 EDGLPVDTELSSVASKMSVKPNAGVDNFNMFAENGHGGTNRILPVSQFLRGRPSAGNLQD 175
           + G+P  TE   +   ++ K      +F +  ++     N I P        P A     
Sbjct: 120 DYGIPQITETKMLKQYITQK------SFKLM-KSAKKSKNVIRP--------PIA----- 159

Query: 176 IASEAPSNIPWRMNGIKYKKNEVFLNVNERISILVSKDGSILKSYVDGTVEATTHLSGMP 235
                 +++ WR  GI YKKNE FL+V E I++L+++ G +L+S + G V+  +HLSGMP
Sbjct: 160 ----LTNSVSWRPEGIMYKKNEAFLDVVESINMLITQQGQVLRSEILGKVKVKSHLSGMP 215

Query: 236 VCRFGLNDALSVSTPFGDDDEYQVTNKKAIPKAAAGSVMLEDCKFHQCVQLDKFQSERTI 295
             + GLND    S       E +  +  A  K  A ++ LED KFHQCV+L KF++E+ I
Sbjct: 216 DLKLGLNDKGIFSNHVSGGVEDEADDLSATGKKKA-NIELEDLKFHQCVRLSKFENEKII 274

Query: 296 NFIAPDGSFELMKYHVRENLNLPFKVTPIVTVVRSNS-IDYQITIKSLFPSKLTAKDVQL 354
            FI PDG FELM Y +   +  P     I   V S S I+     K+    K TA +V++
Sbjct: 275 TFIPPDGDFELMSYRLTTPIK-PLIWCDIKIQVHSKSRIEVHCRAKAQIKKKSTANNVEI 333

Query: 355 RIPVPPETVSCHISTSNGKCKFVPEESAIVWKFSKYQGLTENSISAT-AVPMKDSTLNIE 413
            IPVP +  S     S+G  K+ PE++AI+WK   + G  E S++A   +P   S  + E
Sbjct: 334 LIPVPEDADSPKFRYSHGSIKWAPEKNAILWKIKSFPGGKEYSMAAQLGLP---SVSDFE 390

Query: 414 QWP--RPPISLKFEIVMFSNSGLVVRFFNVSERDRNYKMVKWIKYLSKSG-AYEVR 466
           + P  + P+ +KF+I  F+ SG+ VR+  ++E    Y+   W++Y+++SG  Y +R
Sbjct: 391 E-PVMKRPVQVKFQIPYFTTSGIQVRYLKINEPKMQYQSYPWVRYITQSGDDYTIR 445

>YPL259C Chr16 complement(51244..52671) [1428 bp, 475 aa] {ON}
           APM1Mu1-like medium subunit of the clathrin-associated
           protein complex (AP-1); binds clathrin; involved in
           clathrin-dependent Golgi protein sorting
          Length = 475

 Score =  207 bits (527), Expect = 8e-61,   Method: Compositional matrix adjust.
 Identities = 157/503 (31%), Positives = 258/503 (51%), Gaps = 67/503 (13%)

Query: 1   MLNALFIYSLRGELLISKHVKGSVQKSMSEIFRIQVINNLDVRS----PVLTLGSTTFHH 56
           M +A++     G+ L+S+  +  +  S  + F I ++++L+ +S    P L      +  
Sbjct: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFPI-LLSDLEEQSNLIPPCLNHNGLEYLF 59

Query: 57  IKSAKNLWIVAVSRS-NADSAAIWEFLYRLNELLEAF-NLYSENELKERFMICYELLDIV 114
           I+   +L++VA+  S +A++AAI+ FL++L E+L  +     E  +++ F+I YELLD V
Sbjct: 60  IQH-NDLYVVAIVTSLSANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEV 118

Query: 115 LEDGLPVDTELSSVASKMSVKPNAGVDNFNMFAENGHGGTNRILPVSQFLRGRPSAGNLQ 174
           ++ G+P  TE   +   ++ K    V +    A+     T            RP      
Sbjct: 119 MDYGIPQITETKMLKQYITQKSFKLVKS----AKKKRNAT------------RPPVA--- 159

Query: 175 DIASEAPSNIPWRMNGIKYKKNEVFLNVNERISILVSKDGSILKSYVDGTVEATTHLSGM 234
                  +++ WR  GI +KKNE FL++ E I++L+++ G +L+S + G V+  + LSGM
Sbjct: 160 -----LTNSVSWRPEGITHKKNEAFLDIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGM 214

Query: 235 PVCRFGLNDALSVSTPFGDD-----------DEYQVTNKK-AIPKAAAG-----SVMLED 277
           P  + G+ND    S    DD           D    T+KK +I  ++A      ++ LED
Sbjct: 215 PDLKLGINDKGIFSKYLDDDTNIPSASATTSDNNTETDKKPSITSSSATNKKKVNIELED 274

Query: 278 CKFHQCVQLDKFQSERTINFIAPDGSFELMKYHVRENLNLPFKVTPIVTVVRSNS-IDYQ 336
            KFHQCV+L KF++E+ I FI PDG F+LM Y +   +  P     +   V SNS I+  
Sbjct: 275 LKFHQCVRLSKFENEKIITFIPPDGKFDLMNYRLSTTIK-PLIWCDVNVQVHSNSRIEIH 333

Query: 337 ITIKSLFPSKLTAKDVQLRIPVPPETVSCHISTSNGKCKFVPEESAIVWKFSKYQGLTEN 396
              K+    K TA +V++ IPVP +  +     S+G  K+VPE+SAI+WK   + G  E 
Sbjct: 334 CKAKAQIKRKSTATNVEILIPVPDDADTPTFKYSHGSLKYVPEKSAILWKIRSFPGGKEY 393

Query: 397 SISAT-AVPMKDSTLNIEQWPRP-----------PISLKFEIVMFSNSGLVVRFFNVSER 444
           S+SA   +P   S  N E   R            P+ +KF+I  F+ SG+ VR+  ++E 
Sbjct: 394 SMSAELGLP---SISNNEDGNRTMPKSNAEILKGPVQIKFQIPYFTTSGIQVRYLKINEP 450

Query: 445 DRNYKMVKWIKYLSKSG-AYEVR 466
              YK   W++Y+++SG  Y +R
Sbjct: 451 KLQYKSYPWVRYITQSGDDYTIR 473

>NCAS0E02140 Chr5 complement(410049..411494) [1446 bp, 481 aa] {ON}
           Anc_7.127
          Length = 481

 Score =  206 bits (525), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 143/478 (29%), Positives = 247/478 (51%), Gaps = 42/478 (8%)

Query: 1   MLNALFIYSLRGELLISKHVKGSVQKSMSEIFRIQVINNLDVRS----PVLTLGSTTFHH 56
           M +A++    +G  L+++  +  +  S  E F   ++++L+  +    P L+     +  
Sbjct: 32  MASAVYFCDSKGYPLLARRYRDDIPISAIEKFPT-LLSDLEEETNLVPPCLSYNGMQYLF 90

Query: 57  IKSAKNLWIVAVSRS-NADSAAIWEFLYRLNELLEAF-NLYSENELKERFMICYELLDIV 114
           I+   ++++VA++ S +A++A I+ FLY+L ++L  +     E  +++ F+I YELLD  
Sbjct: 91  IQH-NDVYLVAIANSMSANAAQIFAFLYKLVDVLGNYLKTVEEESIRDNFVIIYELLDET 149

Query: 115 LEDGLPVDTELSSVASKMSVKPNAGVDNFNMFAENGHGGTNRILPVSQFLRGRPSAGNLQ 174
           ++ G+P  TE   +   ++ K      +F +             P               
Sbjct: 150 MDYGIPQITETKMLKQYITQK------SFKLVKAAKKKRNAARPP--------------- 188

Query: 175 DIASEAPSN-IPWRMNGIKYKKNEVFLNVNERISILVSKDGSILKSYVDGTVEATTHLSG 233
               EA +N + WR   IKYKKNE FL++ E I++L+++ G IL+S + G V+  + LSG
Sbjct: 189 ----EALTNSVSWRSADIKYKKNEAFLDIIESINMLMTQKGQILRSEIIGEVKVKSRLSG 244

Query: 234 MPVCRFGLNDALSVSTPFGDD--DEYQVTNKKAIPKAAAGSVMLEDCKFHQCVQLDKFQS 291
           MP  + G+ND    S    DD  +    +   +       ++ LED KFHQCV+L KF++
Sbjct: 245 MPDLKLGINDKGIFSKHMDDDSLNNEGASVASSTTDKKKNNIELEDLKFHQCVRLSKFET 304

Query: 292 ERTINFIAPDGSFELMKYHVRENLNLPFKVTPIVTVVRSNSIDYQITIKSLFPSKLTAKD 351
           E+ I FI PDG FELM Y +  ++         + V   + I+     K+    K TA +
Sbjct: 305 EKIITFIPPDGDFELMNYRLSTSIKPLIWCDMNIQVHSQSRIEIHCRAKAQIKKKSTATN 364

Query: 352 VQLRIPVPPETVSCHISTSNGKCKFVPEESAIVWKFSKYQGLTENSISAT-AVPMKDSTL 410
           VQ+ IPVP +  +     S+G  K+VPE++ I+WK   + G  E S+SA   +P   S  
Sbjct: 365 VQIIIPVPEDADTPEFKYSHGSIKYVPEKNVIIWKIRSFPGGKEYSMSAQMQLP---SIG 421

Query: 411 NIEQW-PRPPISLKFEIVMFSNSGLVVRFFNVSERDRNYKMVKWIKYLSKSG-AYEVR 466
           NIE+   + P+ +KF+I  F+ SG+ V++  ++E    YK   W++Y+++SG  Y +R
Sbjct: 422 NIEEHKAKRPVQIKFQIPYFTTSGIQVKYLKINEPKLQYKSYPWVRYITQSGDDYTIR 479

>KNAG0L00950 Chr12 complement(174410..175795) [1386 bp, 461 aa] {ON}
           Anc_7.127 YPL259C
          Length = 461

 Score =  204 bits (520), Expect = 6e-60,   Method: Compositional matrix adjust.
 Identities = 150/490 (30%), Positives = 249/490 (50%), Gaps = 55/490 (11%)

Query: 1   MLNALFIYSLRGELLISKHVKGSVQKSMSEIFRIQVINNLD---VRSPVLTLGSTTFHHI 57
           M +A++    +G+ L+S+  K  V  S  + F   + +  D   V  P +      +  I
Sbjct: 1   MASAVYFCDDKGKPLLSRRYKDDVPLSAIDKFSTLLTDLEDESAVIPPCINHNGIEYLFI 60

Query: 58  KSAKNLWIVAVSRS-NADSAAIWEFLYRLNELL-EAFNLYSENELKERFMICYELLDIVL 115
           +   +L++VA++ S   + A ++ FL++L  +L E      E  +++ F+I YEL+D ++
Sbjct: 61  QH-NDLYVVALATSLTVNIAEVFAFLHKLMGVLGEYLKTVEEESIRDNFVIIYELMDEMM 119

Query: 116 EDGLPVDTELSSVASKMSVKPNAGVDNFNMFAENGHGGTNRILPVSQFLRGRPSAGNLQD 175
           + G+P  TE   +   ++ K      +F +  E  H               RP       
Sbjct: 120 DYGIPQITEPRMLKKYITQK------SFKL--EKAHKKKRNA--------ARP------- 156

Query: 176 IASEAPSNIPWRMNGIKYKKNEVFLNVNERISILVSKDGSILKSYVDGTVEATTHLSGMP 235
             SE  +++ WR  GIKYKKNE FL++ E I++L+++ G +L+S + G V+  + LSGMP
Sbjct: 157 -PSELNNSVSWRAEGIKYKKNEAFLDIVESINMLITQKGQVLRSEIIGAVKIKSRLSGMP 215

Query: 236 VCRFGLNDA-----------LSVSTPFGDDD-----EYQVTNKKAIPKAAAGSVMLEDCK 279
             + G+ND            + V+ P   +      E  +TN     K    ++ LED K
Sbjct: 216 DLKLGINDRGIFTKYLEGNNIGVNIPDPQEHGSGVAESSITNDG---KKRKTNIELEDLK 272

Query: 280 FHQCVQLDKFQSERTINFIAPDGSFELMKYHVRENLNLPFKVTPIVTVVRSNS-IDYQIT 338
           FHQCV+L KF++E+ I FI PDG F+LM Y +  ++  P     +   V S S I+ +  
Sbjct: 273 FHQCVRLSKFENEKIITFIPPDGEFDLMNYRLTTSIK-PLIWCDVSIQVHSKSRIEIRCR 331

Query: 339 IKSLFPSKLTAKDVQLRIPVPPETVSCHISTSNGKCKFVPEESAIVWKFSKYQGLTENSI 398
            K+    K  A +VQ+ IPVP +  +     S+G  K+VPE+SAI+WK   + G  E ++
Sbjct: 332 AKAQIKKKSVAANVQILIPVPDDADTPSFKYSHGSIKYVPEQSAILWKIKSFPGGKEYAM 391

Query: 399 SA-TAVPMKDSTLNIEQWPRPPISLKFEIVMFSNSGLVVRFFNVSERDRNYKMVKWIKYL 457
            A   +P  DS    E   + P+ +KFEI  F+ SG+ VR+  ++E    YK   W++Y+
Sbjct: 392 FAEMGLPSMDSYE--EPKVKRPVQVKFEIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYI 449

Query: 458 SKSG-AYEVR 466
           ++SG  Y +R
Sbjct: 450 TQSGDDYTIR 459

>TDEL0H02890 Chr8 complement(481125..482453) [1329 bp, 442 aa] {ON}
           Anc_7.127 YPL259C
          Length = 442

 Score =  203 bits (516), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 145/478 (30%), Positives = 244/478 (51%), Gaps = 50/478 (10%)

Query: 1   MLNALFIYSLRGELLISKHVKGSVQKSMSEIFRIQVINNLDVRS----PVLTLGSTTFHH 56
           M++ ++   ++G  ++S+  +  +  S  + F   ++ +L+  S    P L      +  
Sbjct: 1   MVSGIYFCDIKGRPILSRRYRDDIPLSAIDRF-APLLADLEEESSVIPPCLNHRGIQYLF 59

Query: 57  IKSAKNLWIVAVSRSNADSAA-IWEFLYRLNELL-EAFNLYSENELKERFMICYELLDIV 114
           I+  ++L++VA+S S A +AA ++ FL++L E L +      E  +++ F+I YELLD +
Sbjct: 60  IEH-EDLYVVALSTSLATNAAQVFTFLHKLVEALGDYLKTVEEESVRDNFVIIYELLDEM 118

Query: 115 LEDGLPVDTE---LSSVASKMSVKPNAGVDNFNMFAENGHGGTNRILPVSQFLRGRPSAG 171
           ++ G+P  TE   L    ++ S K    V      A    G TN                
Sbjct: 119 MDYGIPQITETKMLKQYITQKSFKLIKAVKKVKATARPPTGLTN---------------- 162

Query: 172 NLQDIASEAPSNIPWRMNGIKYKKNEVFLNVNERISILVSKDGSILKSYVDGTVEATTHL 231
                      ++ WR +GI YKKNE FL++ E I++++++ G +L+S + G V   + L
Sbjct: 163 -----------SVSWRADGITYKKNEAFLDIVESINMVMNQQGQVLRSEIIGQVIVRSRL 211

Query: 232 SGMPVCRFGLNDALSVSTPFGDDDEYQVTNKKAIPKAAAGSVMLEDCKFHQCVQLDKFQS 291
           SGMP  + G+ND   + T   +  E QVT  K        S  LED KFHQCV+L KF++
Sbjct: 212 SGMPDLKLGINDK-GIFTRDPETGESQVTAGK-----KKSSAELEDLKFHQCVRLSKFEN 265

Query: 292 ERTINFIAPDGSFELMKYHVRENLNLPFKVTPIVTVVRSNSIDYQITIKSLFPSKLTAKD 351
           E+ I FI PDG FELM Y +   +         V V   + I+     K+    K  A +
Sbjct: 266 EKIITFIPPDGEFELMSYRLTTPVKPLIWCDVNVQVHSKSRIEIHCRAKAQIKKKSVANN 325

Query: 352 VQLRIPVPPETVSCHISTSNGKCKFVPEESAIVWKFSKYQGLTENSISATAVPMKDSTLN 411
           V++ IPVP +  +     S+G  K+VPE++AI+WK   + G  E S++A    M   ++N
Sbjct: 326 VEILIPVPDDADTPSFRYSHGSIKWVPEKNAILWKIRSFYGGKEYSMAAQ---MGLPSIN 382

Query: 412 IEQWP--RPPISLKFEIVMFSNSGLVVRFFNVSERDRNYKMVKWIKYLSKSG-AYEVR 466
             + P  + P+ +KF+I  F+ SG+ VR+  ++E    YK   W++Y++++G  Y +R
Sbjct: 383 GVEKPKFKRPVQVKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQNGDDYTIR 440

>Suva_16.45 Chr16 complement(66786..68222) [1437 bp, 478 aa] {ON}
           YPL259C (REAL)
          Length = 478

 Score =  204 bits (518), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 153/503 (30%), Positives = 258/503 (51%), Gaps = 64/503 (12%)

Query: 1   MLNALFIYSLRGELLISKHVKGSVQKSMSEIFRIQVINNLDVRS----PVLTLGSTTFHH 56
           M +A++     G+ L+S+  +  +  S  + F   ++++L+ +S    P L      +  
Sbjct: 1   MASAVYFCDHDGKPLLSRRYRDDIPLSAIDKFPT-LLSDLEEQSNLIPPCLNHNGLEYLF 59

Query: 57  IKSAKNLWIVAVSRS-NADSAAIWEFLYRLNELLEAF-NLYSENELKERFMICYELLDIV 114
           I+   +L++VA++ S +A++AAI+ FL++L E+L  +     E  +++ F+I YELLD V
Sbjct: 60  IQH-NDLYLVAIATSLSANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEV 118

Query: 115 LEDGLPVDTELSSVASKMSVKPNAGVDNFNMFAENGHGGTNRILPVSQFLRGRPSAGNLQ 174
           ++ G+P  TE   +   ++ K    V +    A+     T            RP      
Sbjct: 119 MDYGIPQITETKMLKQYITQKSFKLVKS----AKKKRNAT------------RPPVA--- 159

Query: 175 DIASEAPSNIPWRMNGIKYKKNEVFLNVNERISILVSKDGSILKSYVDGTVEATTHLSGM 234
                  +++ WR  GI +KKNE FL++ E I++L+++ G +L+S + G V+  + LSGM
Sbjct: 160 -----LTNSVSWRPEGISHKKNEAFLDIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGM 214

Query: 235 PVCRFGLNDA--------------LSVSTPFGDDDEYQVTNKK-AIPKAAAGS-----VM 274
           P  + G+ND                + ST   D+     T+KK +I  ++  S     + 
Sbjct: 215 PDLKLGINDKGIFSKYLDDSSNLPPAASTTTSDNKTDVDTDKKPSITSSSTASKRKVNIE 274

Query: 275 LEDCKFHQCVQLDKFQSERTINFIAPDGSFELMKYHVRENLNLPFKVTPIVTVVRSNS-I 333
           LED KFHQCV+L KF++E+ I FI PDG F+LM Y +   +  P     +   V SNS I
Sbjct: 275 LEDLKFHQCVRLSKFENEKIITFIPPDGKFDLMNYRLSTTIK-PLIWCDVNVQVHSNSRI 333

Query: 334 DYQITIKSLFPSKLTAKDVQLRIPVPPETVSCHISTSNGKCKFVPEESAIVWKFSKYQGL 393
           +     K+    K TA +V++ IPVP +  +     S+G  K+VPE+SAI+WK   + G 
Sbjct: 334 EIHCKAKAQIKRKSTATNVEILIPVPDDADTPTFKYSHGSLKYVPEKSAILWKLRSFPGG 393

Query: 394 TENSISAT-AVP--------MKDSTLNIEQWPRPPISLKFEIVMFSNSGLVVRFFNVSER 444
            E S+SA   +P         K    N  +  + P+ +KF+I  F+ SG+ VR+  ++E 
Sbjct: 394 KEYSMSAELGLPSISNGNDGSKTIPKNNAEILKGPVQIKFQIPYFTTSGIQVRYLKINEP 453

Query: 445 DRNYKMVKWIKYLSKSG-AYEVR 466
              YK   W++Y+++SG  Y +R
Sbjct: 454 KLQYKSYPWVRYITQSGDDYTIR 476

>Smik_6.466 Chr6 (768507..769937) [1431 bp, 476 aa] {ON} YPL259C
           (REAL)
          Length = 476

 Score =  203 bits (517), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 153/501 (30%), Positives = 256/501 (51%), Gaps = 62/501 (12%)

Query: 1   MLNALFIYSLRGELLISKHVKGSVQKSMSEIFRIQVINNLDVRS----PVLTLGSTTFHH 56
           M +A++     G+ L+S+  +  V  S  + F   ++++L+ +S    P L      +  
Sbjct: 1   MASAVYFCDHNGKPLLSRRYRDDVPLSAIDKFST-LLSDLEEQSNLIPPCLNHNGLEYLF 59

Query: 57  IKSAKNLWIVAVSRS-NADSAAIWEFLYRLNELLEAF-NLYSENELKERFMICYELLDIV 114
           I+   +L++VA+  S  A++AAI+ FL++L E+L  +     E  +++ F+I YELLD V
Sbjct: 60  IQH-NDLYLVAIVTSLTANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEV 118

Query: 115 LEDGLPVDTELSSVASKMSVKPNAGVDNFNMFAENGHGGTNRILPVSQFLRGRPSAGNLQ 174
           ++ G+P  TE   +   ++ K    V +    A+     T            RP      
Sbjct: 119 MDYGIPQITETKMLKQYITQKSFKLVKS----AKKKRNAT------------RPPVA--- 159

Query: 175 DIASEAPSNIPWRMNGIKYKKNEVFLNVNERISILVSKDGSILKSYVDGTVEATTHLSGM 234
                  +++ WR  GI +KKNE FL++ E I++L+++ G +L+S + G V+  + LSGM
Sbjct: 160 -----LTNSVSWRPEGITHKKNEAFLDIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGM 214

Query: 235 PVCRFGLNDALSVSTPFGDD------------DEYQVTNKKAIPKAAAG------SVMLE 276
           P  + G+ND    S    +D            D    T+KK    +++       ++ LE
Sbjct: 215 PDLKLGINDKGIFSKYLDNDSNIPSAVSAATSDNNTDTDKKPSITSSSTTSKRKVNIELE 274

Query: 277 DCKFHQCVQLDKFQSERTINFIAPDGSFELMKYHVRENLNLPFKVTPIVTVVRSNS-IDY 335
           D KFHQCV+L KF++E+ I FI PDG F+LM Y +   +  P     +   V SNS I+ 
Sbjct: 275 DLKFHQCVRLSKFENEKIITFIPPDGKFDLMNYRLSTTIK-PLIWCDVNVQVHSNSRIEI 333

Query: 336 QITIKSLFPSKLTAKDVQLRIPVPPETVSCHISTSNGKCKFVPEESAIVWKFSKYQGLTE 395
               K+    K TA +V++ IPVP +  +     S+G  K+VPE+SAI+WK   + G  E
Sbjct: 334 HCKAKAQIKRKSTATNVEILIPVPDDADTPTFKYSHGSLKYVPEKSAILWKLRSFPGGKE 393

Query: 396 NSISAT-AVP----MKDSTLNI----EQWPRPPISLKFEIVMFSNSGLVVRFFNVSERDR 446
            S+SA   +P     KD +  I     +  + P+ +KF+I  F+ SG+ VR+  ++E   
Sbjct: 394 YSMSAELGLPSISTSKDGSRTIPKSNAKLLKGPVQIKFQIPYFTTSGIQVRYLKINEPKL 453

Query: 447 NYKMVKWIKYLSKSG-AYEVR 466
            YK   W++Y+++SG  Y +R
Sbjct: 454 QYKSYPWVRYITQSGDDYTIR 474

>KAFR0L00470 Chr12 complement(85772..87169) [1398 bp, 465 aa] {ON}
           Anc_7.127 YPL259C
          Length = 465

 Score =  203 bits (516), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 139/496 (28%), Positives = 255/496 (51%), Gaps = 62/496 (12%)

Query: 1   MLNALFIYSLRGELLISKHVKGSVQKSMSEIFRIQVINNLDVRS----PVLTLGSTTFHH 56
           M +A++    +G+ L+S+  +  +  S  + F   ++++ +  S    P ++     +  
Sbjct: 1   MASAVYFCDHKGKPLLSRKYRDDIPLSAIDKFS-SLLSDKEEESNLLPPCISHNGIQYMF 59

Query: 57  IKSAKNLWIVAVSRS-NADSAAIWEFLYRLNELLEAF-NLYSENELKERFMICYELLDIV 114
           I+   +L++ A++ S  A+ + I+ FL+++ ++L+ +     E  +++ F+I YELLD +
Sbjct: 60  IQH-NDLYLAALATSVQANISLIFAFLHKIIDVLDGYLKTVEEESIRDNFIIIYELLDEM 118

Query: 115 LEDGLPVDTELSSVASKMSVKPNAGVDNFNMFAENGHGGTNRILPVSQFLRGRPSAGNLQ 174
           ++ GLP  TE   +   ++ K      +F +  E  H               RP      
Sbjct: 119 MDYGLPQITETKMLKKYITTK------SFKL--EKAHKKKRNA--------ARP------ 156

Query: 175 DIASEAPSNIPWRMNGIKYKKNEVFLNVNERISILVSKDGSILKSYVDGTVEATTHLSGM 234
              +E  +++ WR  GIKYKKNE FL++ E I++L+++ G +L+S + G V   + LSGM
Sbjct: 157 --PTELTNSVSWRPEGIKYKKNEAFLDIIESINMLITQKGQVLRSEIVGNVRVKSRLSGM 214

Query: 235 PVCRFGLNDA-----------LSVSTPFGDDDEYQVTNKKAIPKAAAG----SVMLEDCK 279
           P  + G+ND            + ++    D+D     N+ +I    +     ++ LED K
Sbjct: 215 PDLKLGINDRGIFTKYLEGNNIGIAKNGDDEDADDTNNESSIVSEGSNKRKTNIELEDLK 274

Query: 280 FHQCVQLDKFQSERTINFIAPDGSFELMKYHVRENLNLPFKVTPIV---TVVRSNSIDYQ 336
           FHQCV+L KF++E+ I+FI PDG F+LM Y       L   + P++     +++  I+  
Sbjct: 275 FHQCVRLSKFENEKIISFIPPDGEFDLMNYR------LSTSIKPLIWCDVSIQTYRIEIH 328

Query: 337 ITIKSLFPSKLTAKDVQLRIPVPPETVSCHISTSNGKCKFVPEESAIVWKFSKYQGLTEN 396
              K+    K  A +V++ IPVP +  S     S+GK K++PE++ ++WK S + G  E 
Sbjct: 329 CKAKAQIKKKSIATNVEILIPVPEDADSPIFKYSHGKIKYLPEKNLLLWKISSFPGGKEY 388

Query: 397 SISAT-AVPM----KDSTLNIEQWPRPPISLKFEIVMFSNSGLVVRFFNVSERDRNYKMV 451
           S++A   +P      D    +    + P+ +KF+I  F+ SG+ VR+  V+E    YK  
Sbjct: 389 SMAAQMGLPSISGEDDLNTRVSNQSKKPVQVKFKIPYFTTSGIQVRYLKVNEPKLQYKTY 448

Query: 452 KWIKYLSKSG-AYEVR 466
            W++Y+++SG  Y +R
Sbjct: 449 PWVRYITQSGDDYTIR 464

>ADL017C Chr4 complement(679085..680416) [1332 bp, 443 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL259C
           (APM1)
          Length = 443

 Score =  201 bits (510), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 137/478 (28%), Positives = 244/478 (51%), Gaps = 48/478 (10%)

Query: 1   MLNALFIYSLRGELLISKHVKGSVQKSMSEIF---RIQVINNLDVRSPVLTLGSTTFHHI 57
           M + ++    +G+LL+S+  K  +  +  E F    I+      V  P  +     +  I
Sbjct: 1   MTSGIYFCDSKGKLLLSRRYKDDIPANAIEQFPHLLIEKEQESSVLPPCFSFNGVQYLFI 60

Query: 58  KSAKNLWIVAVSRS-NADSAAIWEFLYRLNELLEAF-NLYSENELKERFMICYELLDIVL 115
           +   +L+++ +++S + + A ++ +L++L E+LE +  +  E  +K+ F+I YELLD ++
Sbjct: 61  QH-NDLYVLTLTKSMSINVAQVFSYLHKLIEVLEEYMKVVEEESIKDNFVIIYELLDEMM 119

Query: 116 EDGLPVDTELSSVASKMSVKPNAGVDNFNMFAENGHGGTNRILPVSQFLRGRPSAGNLQD 175
           + G+P  T+   +   ++ K      +F +                  +R      N+  
Sbjct: 120 DHGIPQITDTKMLRQYITQK------SFKL------------------IRSAKKKKNVVR 155

Query: 176 IASEAPSNIPWRMNGIKYKKNEVFLNVNERISILVSKDGSILKSYVDGTVEATTHLSGMP 235
             +   +++ WR  GI YKKNE FL+V E I++L+++ G +L+S + G V+  + LSGMP
Sbjct: 156 PPATLTNSVSWRPEGIVYKKNEAFLDVVESINMLLTQQGQVLRSEILGKVKVKSRLSGMP 215

Query: 236 VCRFGLNDALSVSTPFGDDDEYQVTNKKAIPKAAAGS-----VMLEDCKFHQCVQLDKFQ 290
             + GLND    +         Q  +      A+ G+     + LED KFHQCV+L KF+
Sbjct: 216 DLKLGLNDKGIFA---------QGDDDDDEEGASGGTKKKSNIELEDLKFHQCVRLTKFE 266

Query: 291 SERTINFIAPDGSFELMKYHVRENLNLPFKVTPIVTVVRSNS-IDYQITIKSLFPSKLTA 349
           +E+ I FI PDG FELM Y +   +  P     +   V S S I+     K+    K TA
Sbjct: 267 NEKIITFIPPDGDFELMSYRLSTPIK-PLIWCDVKLQVHSRSRIEIHCRAKAQIKKKSTA 325

Query: 350 KDVQLRIPVPPETVSCHISTSNGKCKFVPEESAIVWKFSKYQGLTENSISATAVPMKDST 409
            +V++ IPVP +  S     S+G  K+VP ++AI+WK   + G  + S++A  + +   +
Sbjct: 326 NNVEILIPVPEDADSPKFRYSHGTIKWVPSQNAILWKIKSFPGGKDYSMAA-EMGLPSVS 384

Query: 410 LNIEQWPRPPISLKFEIVMFSNSGLVVRFFNVSERDRNYKMVKWIKYLSKSG-AYEVR 466
            N +   + P+ +KF+I  F+ SG+ VR+  ++E    Y    W++Y+++SG  Y +R
Sbjct: 385 DNSDHKLKRPVQIKFQIPYFTTSGIQVRYLKINEPKMQYNSYPWVRYITQSGDDYTIR 442

>TPHA0C04320 Chr3 (932871..934235) [1365 bp, 454 aa] {ON} Anc_7.127
           YPL259C
          Length = 454

 Score =  201 bits (510), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 141/479 (29%), Positives = 246/479 (51%), Gaps = 41/479 (8%)

Query: 1   MLNALFIYSLRGELLISKHVKGSVQKSMSEIFR---IQVINNLDVRSPVLTLGSTTFHHI 57
           M++ ++     G+ ++++  +  +  +  + F    +Q+     V  P +      +  I
Sbjct: 1   MVSGIYFCDNAGKPILARRYRDDISINAIDNFSQLLLQLEEETGVIPPCIMHKGIHYLFI 60

Query: 58  KSAKNLWIVAVSRS-NADSAAIWEFLYRLNELLEAF-NLYSENELKERFMICYELLDIVL 115
           K + ++++VA++ S   + A I+ FL++L E+LE +  +  E  +++ F+I YELLD ++
Sbjct: 61  KHS-DIYVVALTTSYQTNVAQIFMFLHQLVEVLEEYVKIVVEESVRDNFVIIYELLDEMM 119

Query: 116 EDGLPVDTELSSVASKMSVKPNAGVDNFNMFAENGHGGTNRILPVSQFLRGRPSAGNLQD 175
           + G+P  TE   +   ++ K      +F +   +                 RP A     
Sbjct: 120 DFGIPQITETKMLKKYITQK------SFKLIKTSTSKKKKN--------AARPPA----- 160

Query: 176 IASEAPSNIPWRMNGIKYKKNEVFLNVNERISILVSKDGSILKSYVDGTVEATTHLSGMP 235
              E  +++ WR  GI YKKNE FL++ E I++LV++ G +L+S + G V   + LSGMP
Sbjct: 161 ---ELTNSVSWRPEGITYKKNEAFLDIIESINMLVTQQGQVLRSEIVGAVRVRSRLSGMP 217

Query: 236 VCRFGLNDALSVSTPFGDDDEYQVTNKKAIPKAAAG---SVMLEDCKFHQCVQLDKFQSE 292
             + G+ND    S    +++    ++   IP+        + LED KFHQCV+L KF++E
Sbjct: 218 DLKLGINDRGIFSNYLEENNVDGSSSSTPIPEGVEDKKPQIELEDLKFHQCVRLSKFENE 277

Query: 293 RTINFIAPDGSFELMKYHVRENLNLPFKVTPIVTVVRSNS-IDYQITIKSLFPSKLTAKD 351
           + I FI PDG F+LM Y +   +  P     +   V S S I+     K+    K  A +
Sbjct: 278 KIITFIPPDGEFDLMNYRLTTPIK-PLIWCDVNIQVHSKSRIEIHCRAKAQIKKKSIANN 336

Query: 352 VQLRIPVPPETVSCHISTSNGKCKFVPEESAIVWKFSKYQGLTENSISAT-AVPMKDSTL 410
           V++ IPVP +  +     S+G  K++PE++AI+WK   + G  E S+SA   +P  D   
Sbjct: 337 VEILIPVPDDADTPQFRYSHGSIKWLPEKNAILWKLRSFAGGKEYSMSAQLHLPSVDGV- 395

Query: 411 NIEQWP--RPPISLKFEIVMFSNSGLVVRFFNVSERDRNYKMVKWIKYLSKSGA-YEVR 466
              + P  R P+ +KF+I  F+ SG+ VR+  V+E    YK   W++Y+++SG  Y +R
Sbjct: 396 ---EPPKVRRPVQVKFQIPYFTTSGIQVRYLKVNEPKLQYKSYPWVRYITQSGEDYTIR 451

>CAGL0K00539g Chr11 complement(64028..65398) [1371 bp, 456 aa] {ON}
           highly similar to uniprot|Q00776 Saccharomyces
           cerevisiae YPL259c Clathrin coat assembly protein
          Length = 456

 Score =  200 bits (508), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 143/483 (29%), Positives = 244/483 (50%), Gaps = 46/483 (9%)

Query: 1   MLNALFIYSLRGELLISKHVKGSVQKSMSEIFRIQVIN---NLDVRSPVLTLGSTTFHHI 57
           M +A++    +G  L+S+  +  +  S  + F I + N     ++  P +      F  I
Sbjct: 1   MASAIYFCDNKGRPLLSRKYRDDIPFSAIDRFPILLSNFEEETNLIPPCIEHNGIQFLFI 60

Query: 58  KSAKNLWIVAVSRS-NADSAAIWEFLYRLNELL-EAFNLYSENELKERFMICYELLDIVL 115
           +   +L++VA++ S + ++A I+ FL+++ E+L E      E  +++ F+I YELLD ++
Sbjct: 61  QH-NDLYLVAIATSISCNAALIFSFLHKVIEVLSEYLKAVEEESIRDNFVIIYELLDEMM 119

Query: 116 EDGLPVDTELSSVASKMSVKPNAGVDNFNMFAENGHGGTNRILPVSQFLRGRPSAGNLQD 175
           + G+P  TE   +   ++              +                R   S  N   
Sbjct: 120 DYGIPQITEPKMLKQYIT--------------QKSFKLKKAAKKKRNAARPPTSLTN--- 162

Query: 176 IASEAPSNIPWRMNGIKYKKNEVFLNVNERISILVSKDGSILKSYVDGTVEATTHLSGMP 235
                  ++ WR  GIK+KKNE FL++ E I++L+++ G +L+S + G V+  + LSGMP
Sbjct: 163 -------SVSWRPEGIKHKKNEAFLDIIESINMLMTQKGQVLRSEIIGEVKVKSKLSGMP 215

Query: 236 VCRFGLNDALSVS---------TPFGDDDEYQVTNKKAIPKAAAGSVMLEDCKFHQCVQL 286
             + G+ND    S          P   DD     ++    K  + ++ LED KFHQCV+L
Sbjct: 216 DLKLGINDKGLFSKYLEGDENGVPIAPDD--SSVDESKPKKKRSNNMELEDLKFHQCVRL 273

Query: 287 DKFQSERTINFIAPDGSFELMKYHVRENLNLPFKVTPIVTVVRSNS-IDYQITIKSLFPS 345
            KF++E+ I FI PDG FELM Y +   +  P     +     S S I+     K+    
Sbjct: 274 SKFENEKQITFIPPDGDFELMSYRLSTAIK-PLIWCDVNIKTHSKSRIEIFCRAKAQIKK 332

Query: 346 KLTAKDVQLRIPVPPETVSCHISTSNGKCKFVPEESAIVWKFSKYQGLTENSISA-TAVP 404
           K TA +V++ IPVP +  +     S+G  K+VPE++AI+WK   + G  E S++A   +P
Sbjct: 333 KSTATNVEILIPVPEDADTPVFKYSHGSIKYVPEKNAILWKIRTFPGDKEYSMAAEMGLP 392

Query: 405 MKDSTLNIEQWPRPPISLKFEIVMFSNSGLVVRFFNVSERDRNYKMVKWIKYLSKSG-AY 463
             ++    E+  R P+ +KF+I  F+ SG+ VR+  + E++  YK   W++Y++KSG  Y
Sbjct: 393 STNAGEESEKLKR-PVQVKFQIPYFTTSGIQVRYLKIEEKNLQYKSYPWVRYITKSGDDY 451

Query: 464 EVR 466
            +R
Sbjct: 452 TIR 454

>Skud_16.19 Chr16 complement(30298..31728) [1431 bp, 476 aa] {ON}
           YPL259C (REAL)
          Length = 476

 Score =  200 bits (508), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 150/506 (29%), Positives = 254/506 (50%), Gaps = 72/506 (14%)

Query: 1   MLNALFIYSLRGELLISKHVKGSVQKSMSEIFRIQVINNLDVRS----PVLTLGSTTFHH 56
           M +A++     G+ L+S+  +  +  S  + F   ++++L+ +S    P L      +  
Sbjct: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFPT-LLSDLEEQSNLIPPCLNHNGLEYLF 59

Query: 57  IKSAKNLWIVAVSRS-NADSAAIWEFLYRLNELLEAF-NLYSENELKERFMICYELLDIV 114
           I+   +L++VA+  S  A++AAI+ FL++L E+L  +     E  +++ F+I YELLD V
Sbjct: 60  IQH-NDLYLVAIVTSLRANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEV 118

Query: 115 LEDGLPVDTELSSVASKMSVKPNAGVDNFNMFAENGHGGTNRILPVSQFLRGRPSAGNLQ 174
           ++ G+P   E   +   ++ K    V +    A+     T            RP      
Sbjct: 119 MDYGIPQICETKMLKQYITQKSFKLVKS----AKKKRNAT------------RPPVA--- 159

Query: 175 DIASEAPSNIPWRMNGIKYKKNEVFLNVNERISILVSKDGSILKSYVDGTVEATTHLSGM 234
                  +++ WR  GI +KKNE FL++ E I++L+++ G +L+S + G V+  + LSGM
Sbjct: 160 -----LTNSVSWRPEGIIHKKNEAFLDIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGM 214

Query: 235 PVCRFGLNDALSVSTPFGDD------------DEYQVTNKKAIPKAAAG------SVMLE 276
           P  + G+ND    S    DD            D    T+KK    +++       ++ LE
Sbjct: 215 PDLKLGINDKGIFSKYLDDDSNTPPPTSAATSDNITDTDKKPSITSSSTTSKRKVNIELE 274

Query: 277 DCKFHQCVQLDKFQSERTINFIAPDGSFELMKYHVRENLNLPFKVTPIVTVVRSNS-IDY 335
           D KFHQCV+L KF++E+ I FI PDG F+LM Y +   +  P     +   V SNS I+ 
Sbjct: 275 DLKFHQCVRLSKFENEKIITFIPPDGKFDLMNYRLSTTIK-PLIWCDVNVQVHSNSRIEI 333

Query: 336 QITIKSLFPSKLTAKDVQLRIPVPPETVSCHISTSNGKCKFVPEESAIVWKFSKYQGLTE 395
               K+    K TA +V++ IPVP +  +     S+G  K+VPE+SAI+WK   + G  E
Sbjct: 334 HCKAKAQIKRKSTATNVEIIIPVPDDADTPTFKYSHGSLKYVPEKSAILWKLRSFPGGKE 393

Query: 396 NSISAT--------------AVPMKDSTLNIEQWPRPPISLKFEIVMFSNSGLVVRFFNV 441
            S+SA               A+P  ++ +      + P+ +KF+I  F+ SG+ VR+  +
Sbjct: 394 YSMSAELGLPSISNDIEGHRAIPKSNAEIL-----KGPVQIKFQIPYFTTSGIQVRYLKI 448

Query: 442 SERDRNYKMVKWIKYLSKSG-AYEVR 466
           +E    YK   W++Y+++SG  Y +R
Sbjct: 449 NEPKLQYKSYPWVRYITQSGDDYTIR 474

>Kpol_1062.56 s1062 (126558..127910) [1353 bp, 450 aa] {ON}
           (126558..127910) [1353 nt, 451 aa]
          Length = 450

 Score =  198 bits (504), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 136/480 (28%), Positives = 246/480 (51%), Gaps = 44/480 (9%)

Query: 1   MLNALFIYSLRGELLISKHVKGSVQKSMSEIFRIQVINNLD---VRSPVLTLGSTTFHHI 57
           M++ ++     G+ ++S+  +  +  S  + F   ++ + +   V  P L      +  I
Sbjct: 1   MVSGVYFCDASGKPILSRRYRDDIPLSAIDKFSQILLEHEEESSVVPPCLLYQGIHYLFI 60

Query: 58  KSAKNLWIVAVSRS-NADSAAIWEFLYRLNELL-EAFNLYSENELKERFMICYELLDIVL 115
           + + ++++VA++ S   + A I+ FL++L  +L +      E  +++ F+I YELLD ++
Sbjct: 61  QHS-DIYVVALTTSYQTNIAQIFMFLHQLVSVLGDYLKSVEEESIRDNFVIIYELLDEMM 119

Query: 116 EDGLPVDTELSSVASKMSVKPNAGVDNFNMFAENGHGGTNRILPVSQFLRGRPSAGNLQD 175
           + G+P  TE   +   ++ K      +F +             PV+              
Sbjct: 120 DYGIPQITETKMLKQYITQK------SFKLIKAAKKKRNAARPPVA-------------- 159

Query: 176 IASEAPSNIPWRMNGIKYKKNEVFLNVNERISILVSKDGSILKSYVDGTVEATTHLSGMP 235
                 +++ WR  GIKYKKNE +L++ E I++L+++ G +L+S + G V+  + LSGMP
Sbjct: 160 ----LTNSVSWRQEGIKYKKNEAYLDIIESINMLMNQQGQVLRSEIIGEVKVKSRLSGMP 215

Query: 236 VCRFGLNDALSVSTPFGDDDEY----QVTNKKAIPKAAAGSVMLEDCKFHQCVQLDKFQS 291
             + G+ND    S    +++++    Q+ N  +       ++ LED KFHQCV+L KF++
Sbjct: 216 DLKLGINDKGIFSKYLENEEDFSKPVQIINDDSTTNGKKSNIELEDLKFHQCVRLSKFEN 275

Query: 292 ERTINFIAPDGSFELMKYHVRENLNLPFKVTPIVTVVRSNS-IDYQITIKSLFPSKLTAK 350
           E+ I FI PDG FELM Y +   +  P     I   V S S I+     K+    K  A 
Sbjct: 276 EKIITFIPPDGEFELMNYRLTTPIK-PLIWCDINIQVHSKSRIEIHCRAKAQIKKKSIAN 334

Query: 351 DVQLRIPVPPETVSCHISTSNGKCKFVPEESAIVWKFSKYQGLTENSISAT-AVPMKDST 409
           +V++ IPVP +  +     S+G  K++PE++AI+WK   + G  E S++A   +P  D  
Sbjct: 335 NVEILIPVPDDADTPTFKYSHGSIKWLPEKNAILWKLRSFAGGKEYSMTAQLGLPSVDGI 394

Query: 410 LNIEQWP--RPPISLKFEIVMFSNSGLVVRFFNVSERDRNYKMVKWIKYLSKSG-AYEVR 466
               + P  + P+ +KF+I  F+ SG+ VR+  ++E    YK   W++Y+++SG  Y +R
Sbjct: 395 ----EPPKVKRPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSFPWVRYITQSGDDYTIR 450

>ZYRO0C05236g Chr3 complement(408616..409959) [1344 bp, 447 aa] {ON}
           highly similar to uniprot|Q00776 Saccharomyces
           cerevisiae YPL259C APM1 medium subunit of the clathrin-
           associated protein complex
          Length = 447

 Score =  196 bits (498), Expect = 6e-57,   Method: Compositional matrix adjust.
 Identities = 136/474 (28%), Positives = 249/474 (52%), Gaps = 49/474 (10%)

Query: 1   MLNALFIYSLRGELLISKHVKGSVQKSMSEIFR---IQVINNLDVRSPVLTLGSTTFHHI 57
           M++A++    +G  ++S+  +  +  S  + F    +Q+     V  P L+     +  I
Sbjct: 1   MVSAVYFCDGKGRPILSRRYRDDIPISAIDKFAPLLLQLEEESSVIPPCLSHDGIQYLFI 60

Query: 58  KSAKNLWIVAVSRSNADSAA-IWEFLYRLNELLEAFNLYSENE-LKERFMICYELLDIVL 115
           +   +L++VA++ S A + A ++ FL++L E+LE +    E E +++ F+I YELLD ++
Sbjct: 61  QH-NDLYVVALATSLATNVAQVFAFLHKLMEVLEEYLKSVEEESVRDNFIIIYELLDEMM 119

Query: 116 EDGLPVDTELSSVASKMSVKPNAGVDNFNMFAENGHGGTNRILPVSQFLRGRPSAGNLQD 175
           + G+P  TE   +   ++ K                  + +++   +  +  P       
Sbjct: 120 DYGIPQITETKMLKQYITQK------------------SFKLMKAVKKSKAAPRP----- 156

Query: 176 IASEAPSNIPWRMNGIKYKKNEVFLNVNERISILVSKDGSILKSYVDGTVEATTHLSGMP 235
             +E  +++ WR   I +KKNE FL++ E I++L+++ G +L+S + G ++  + LSGMP
Sbjct: 157 -PTEVTNSVSWRAPNIVHKKNEAFLDIVESINMLMNQQGQVLRSEIIGQIKVKSKLSGMP 215

Query: 236 VCRFGLNDALSVSTPFGDDDEYQVTNKKAIPKAAAGSVMLEDCKFHQCVQLDKFQSERTI 295
             + G+ND   + + + + D   VT      K    ++ LED KFHQCV+L KF++E+ I
Sbjct: 216 DLKLGINDK-GIFSKYVEGDSDPVTTAVTEGKKKT-NIELEDLKFHQCVRLSKFENEKII 273

Query: 296 NFIAPDGSFELMKYHVRENLNLPFKVTPI------VTVVRSNSIDYQITIKSLFPSKLTA 349
            FI PDG+FELM Y     L++P K  P+      V V   + I+     ++    +  A
Sbjct: 274 TFIPPDGAFELMNYR----LSMPVK--PLIWCDVNVQVHSQSRIEIHCRARAQIKKRSIA 327

Query: 350 KDVQLRIPVPPETVSCHISTSNGKCKFVPEESAIVWKFSKYQGLTENSISATAVPMKDST 409
             V++ IPVP +  +     ++G  K+VP+++AI+WK   + G  E S+SA    M   +
Sbjct: 328 NSVEILIPVPDDADTPSFKYTHGSVKWVPQKNAILWKIRSFTGGKEYSMSAQ---MGLPS 384

Query: 410 LNIEQWP--RPPISLKFEIVMFSNSGLVVRFFNVSERDRNYKMVKWIKYLSKSG 461
           +N    P  + P+ +KF+I  F+ SG+ VR+  ++E    YK   W++Y+++SG
Sbjct: 385 INALDKPKVKRPVQIKFQIPYFTTSGIQVRYLKITEPKLLYKSYPWVRYITQSG 438

>TBLA0A00950 Chr1 complement(210799..212208) [1410 bp, 469 aa] {ON}
           Anc_7.127 YPL259C
          Length = 469

 Score =  191 bits (485), Expect = 8e-55,   Method: Compositional matrix adjust.
 Identities = 142/495 (28%), Positives = 249/495 (50%), Gaps = 58/495 (11%)

Query: 1   MLNALFIYSLRGELLISKHVKGSVQKSMSEIFR---IQVINNLDVRSPVLTLGSTTFHHI 57
           M++++     +G+ L+S+  +  +  +  + F    +++     V  P LT     +  I
Sbjct: 1   MVSSISFCDSKGKQLLSRKYRDDIPLTAIDNFATLLMKLEEESSVVPPCLTHNGIHYLFI 60

Query: 58  KSAKNLWIVAVSRS-NADSAAIWEFLYRLNELL-EAFNLYSENELKERFMICYELLDIVL 115
           +   +L+IVA++ S + +++ ++ FL++L E++ E      E  +++ F+I YELLD ++
Sbjct: 61  QH-NDLYIVALTTSLSTNASQVFTFLHKLVEVMSEYLKDVEEESIRDNFVIIYELLDEMM 119

Query: 116 EDGLPVDTELSSVASKMSVKPNAGVDNFNMFAENGHGGTNRILPVSQFLRGRPSAGNLQD 175
           + G+P  TE   +   ++ K      +F +             P                
Sbjct: 120 DYGIPQITETKMLKQYITQK------SFKLVKAAKKKRNAARPP---------------- 157

Query: 176 IASEAPSN-IPWRMNGIKYKKNEVFLNVNERISILVSKDGSILKSYVDGTVEATTHLSGM 234
              +A +N + WR  GIKYKKNE FL++ E I++L+++ G +L+S + G V+  + LSGM
Sbjct: 158 ---QALTNSVSWRPEGIKYKKNEAFLDIVESINMLMTQQGQVLRSEIIGEVKVRSRLSGM 214

Query: 235 PVCRFGLNDALSVSTPFGDDDEYQV----------TNKKAIPKAAAG----------SVM 274
           P  + G+ND    S                     ++K + P+ + G          +V 
Sbjct: 215 PDLKLGINDKGIFSKYLESTSSNSNSNDDNSNEVNSSKSSTPQPSTGQDEGSSRKTSNVE 274

Query: 275 LEDCKFHQCVQLDKFQSERTINFIAPDGSFELMKYHVRENLNLPFKVTPIVTVVRSNS-I 333
           LED KFHQCV+L KF++E+ I FI PDG+FELM Y +   +  P     +   V S S +
Sbjct: 275 LEDLKFHQCVRLSKFENEKIITFIPPDGNFELMSYRLTTPIK-PLIWCDVNIHVHSKSRV 333

Query: 334 DYQITIKSLFPSKLTAKDVQLRIPVPPETVSCHISTSNGKCKFVPEESAIVWKFSKYQGL 393
           +     K+    K  A +V++ IPVP +  +     S+G  K+VPE++AI+WK   + G 
Sbjct: 334 EIHCRAKAQIKKKSIANNVEILIPVPDDADTPSFRYSHGSIKWVPEKNAILWKIRSFAGG 393

Query: 394 TENSISAT-AVPMKDSTLNIEQWPRPPISLKFEIVMFSNSGLVVRFFNVSERDRNYKMVK 452
            E S++A   +P  D   N +   + P+ +KF+I  F+ SG+ VR+  V+E    YK   
Sbjct: 394 KEYSMAAQLGLPSIDD--NEKPKLKRPVQIKFQIPYFTTSGIQVRYLKVNEPKLQYKSYP 451

Query: 453 WIKYLSKSG-AYEVR 466
           W++Y+++SG  Y +R
Sbjct: 452 WVRYITQSGDDYTIR 466

>KLTH0D07502g Chr4 (650799..652313) [1515 bp, 504 aa] {ON} similar
           to uniprot|P38700 Saccharomyces cerevisiae YHL019C APM2
           homologous to the medium chain of mammalian
           clathrin-associated protein complex Similar to clathrin
           coat proteins
          Length = 504

 Score =  101 bits (251), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 105/481 (21%), Positives = 194/481 (40%), Gaps = 96/481 (19%)

Query: 43  RSPVLTLGSTTFHHIKSAKNLWIVAVSRSNA--DSAAIWEFLYRLNELLEAF---NLYSE 97
           R PV+      + +I     L+ V+VS      +   I  +L   + LL  +   N    
Sbjct: 41  RGPVIYSKGIIYIYILR-DGLYFVSVSNGGLRFNLMGILAYLNDFHALLVKYLKVNKVDR 99

Query: 98  NELKERFMICYELLDIVLEDGLPVDTELSSVASKMSVKPNAGVDNFNMFAENGHGGTNRI 157
             + + F + YEL D  L+ G+P  T+ + +   + ++ N      N  A++       I
Sbjct: 100 TGIIDNFNLIYELFDESLDYGIPQLTDYNIIRDSIKIEANVPKVPSNSQADSDEESGPEI 159

Query: 158 LPVSQFLRGRPSAGNLQD--------IASEAPSNIPWRMNGIKYKKNEVFLNVNERISIL 209
           L  S+  + +      +D        +       I WR  GI Y KNE+F+++ ER S L
Sbjct: 160 LQ-SKENKDKADIHGFRDDEQYINSFVLRTTTQAISWRPKGIYYTKNELFVDIIERQSYL 218

Query: 210 VS-KDGSILKSYVDGTVEATTHLSGMPVCRFGLNDALSVSTPFGDDDEYQVTNKKAIPKA 268
           +  K+  + +++V G +   ++LSGMP+ R  +N  L       D D             
Sbjct: 219 MDFKNSQVRQTFVYGKINCRSYLSGMPIVRVCINKMLK------DKD------------- 259

Query: 269 AAGSVMLEDCKFHQCVQLDKFQSERTINFIAPDGSFELMKYHVRENLNLPFKVTPIVTVV 328
               + L   KFHQCV L+   S+  I FI PDG F+L +Y ++ ++N     +PI+ ++
Sbjct: 260 ----LFLGSSKFHQCVSLESLSSQDYIEFIPPDGDFQLCEYKLKRHIN----DSPIIKLI 311

Query: 329 --------RSNSIDYQITIKSLFPSKLTAKDVQLRIPVP--------PETVSCHISTSNG 372
                   + + +   +TI+  F ++ +A  +++ IP            T +      +G
Sbjct: 312 DYKINERQKKHRLHLSVTIQPHFKAQNSATALKIHIPTRDLFQNYKIDLTKAPRFKCDHG 371

Query: 373 KCKFVPEESAIVWKFSKYQG------------------------LTENSISATAVPMKDS 408
              F   +  ++W     +G                        L +   S    P+++ 
Sbjct: 372 SVFFNLSDELLLWDAQGIKGGHGETSYSMHVEFALFDEEEHARKLEQIKKSMDPPPLREG 431

Query: 409 TLNIE-------------QWPRPPISLKFEIVMFSNSGLVVRFFNVSERDRNYKMVKWIK 455
               E             Q+    I+ +FE+  +++SGL V +  +SE +  Y+   W++
Sbjct: 432 AHLEELYAQVKSNKEGKGQFQSNAITAEFEVPYYTSSGLRVEYLKISEENLKYQSFSWVR 491

Query: 456 Y 456
           Y
Sbjct: 492 Y 492

>SAKL0D13090g Chr4 (1093315..1094814) [1500 bp, 499 aa] {ON} weakly
           similar to uniprot|P38700 Saccharomyces cerevisiae
           YHL019C APM2 homologous to the medium chain of mammalian
           clathrin-associated protein complex Similar to clathrin
           coat proteins
          Length = 499

 Score = 99.8 bits (247), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 113/481 (23%), Positives = 194/481 (40%), Gaps = 106/481 (22%)

Query: 45  PVLTLGSTTFHHIKSAKNLWIVAVS--------RSNADSAAIWEFLYRLNELLEA-FNLY 95
           PV       F +I+     +I AV         +S+ +  AI  +L     LL+  FN  
Sbjct: 44  PVFHYKGIHFVYIRRDGFYFISAVELVAEASNKKSHFNVMAILTYLENFYTLLKRYFNSQ 103

Query: 96  SENE--LKERFMICYELLDIVLEDGLPVDTELSSVASKMSVKPNAGVDNFNMFAENGHGG 153
             N   + + F + YELLD  L+ G+P  T+ + +   + V+ N           +    
Sbjct: 104 KLNRWLIVDNFHLIYELLDESLDFGVPQLTDYNIIQDYIKVQVNL---------HDELAD 154

Query: 154 TNRILPVSQFLRGRPSAGNLQD--IASEAPSNIPWRMNGIKYKKNEVFLNVNERISILVS 211
           +++ +   + L G     +  +  IA    S I WR  GI Y KNE FL+V E I   + 
Sbjct: 155 SSKKISKKEDLHGFEDDESYMNSFIARTTTSAISWRPKGIHYTKNEFFLDVIEEIEYCMD 214

Query: 212 KDGS-ILKSYVDGTVEATTHLSGMPVCRFGLNDALSVSTPFGDDDEYQVTNKKAIPKAAA 270
            + S I K++V G +   ++LSGMP  + GL+   S                 ++PK   
Sbjct: 215 FNKSKIRKNFVHGRIRCRSYLSGMPKLKIGLSKITS-----------------SLPKERE 257

Query: 271 GSVMLEDCKFHQCVQLDKFQSERTINFIAPDGSFELMKYHVRENLNLPFKVTPIVTVVRS 330
               + + KFHQCV L+  Q +  ++FI PDG F+L +Y ++ ++  P    P++ +V+ 
Sbjct: 258 Q--FMNNAKFHQCVSLEDLQ-KNIVSFIPPDGEFQLCEYKLKRHVRDP----PVIKLVKF 310

Query: 331 N---------SIDYQITIKSLFPSKLTAKDVQLRIPV------------PPETVSCHIST 369
           +          I   +TI + F S+ +   + +RIP+             P    C    
Sbjct: 311 DVKKEEKKRPKILISLTITTDFKSQNSTSVLNIRIPLTKIFSEYQIDLAKPPRFKC---- 366

Query: 370 SNGKCKFVPEESAIVWKFSKYQG---LTENSISAT-----AVPMKDSTLNIEQWPRPP-- 419
             G   F   +  ++W+    +G    TE+S+            K     ++    PP  
Sbjct: 367 DQGNVLFNLTDDLLLWEVGSIKGGHAQTEHSMYCEFRLYDEEEYKKQLEELKNSMDPPPL 426

Query: 420 ------------------------ISLKFEIVMFSNSGLVVRFFNVSERDRNYKMVKWIK 455
                                   +S++FEI  ++ SGL V++  + E    Y    W++
Sbjct: 427 RQGPKLEELYKQVHENENTNRSRLVSMEFEIPYYTCSGLKVQYLKIEEDQLQYHSFPWVR 486

Query: 456 Y 456
           Y
Sbjct: 487 Y 487

>Kwal_26.8146 s26 (665689..667206) [1518 bp, 505 aa] {ON} YHL019C
           (APM2) - Similiar to clathrin coat proteins [contig 55]
           FULL
          Length = 505

 Score = 97.4 bits (241), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 112/524 (21%), Positives = 218/524 (41%), Gaps = 99/524 (18%)

Query: 1   MLNALFIYSLRGELLISKHVKGSVQKSMSEIFRIQVINNLDVRSPVLTLGSTTFHHIKSA 60
           M +++F+   +   LI K  K SVQ   +  +R + +  +    PV+      F  I   
Sbjct: 1   MSSSIFLLDEQLNPLIVKSFK-SVQHPEAFAYRFKEVYKVS-NVPVIYHKGIVFISI-CR 57

Query: 61  KNLWIVAVSRSNADSAAIWEFLYRLNE---LLEAF---NLYSENELKERFMICYELLDIV 114
             L+ V++S  +  S+ +   +Y LN+   LL+ +   N      + + F + YELLD  
Sbjct: 58  DGLYFVSMSVGSLRSSIMSTLVY-LNDFHMLLKKYLRVNALDRTRIVDNFNLIYELLDES 116

Query: 115 LEDGLPVDTELSSVASKMSVKPNAGVDNFNMFAENGHGGTNRILPVSQFLRGRPSAGNLQ 174
           L+ G+P  T+ + +   + ++PN   D     + +    + +        + + +    Q
Sbjct: 117 LDFGIPQLTDFNIIRDSIKIQPNIPPDPKIARSNSDDDESEQEESNVAETQEKSNKHGFQ 176

Query: 175 D--------IASEAPSNIPWRMNGIKYKKNEVFLNVNERISILVS-KDGSILKSYVDGTV 225
           D        +       I WR  GI Y KNE+F++V E  + ++  K   + K+++ G +
Sbjct: 177 DDEEYINSFVLRTTTQAISWRPKGIYYAKNELFVDVIESQAYVMDFKHHQVRKNFIFGRI 236

Query: 226 EATTHLSGMPVCRFGLNDALSVSTPFGDDDEYQVTNKKAIPKAAAGSVMLEDCKFHQCVQ 285
              ++LSGMPV +  +N  L       D D++                 L   KFHQCV 
Sbjct: 237 ICRSYLSGMPVVKICINKMLK------DRDQF-----------------LSSAKFHQCVS 273

Query: 286 LDKFQSERTINFIAPDGSFELMKYHVRENLNLPFKVTPIVTVV--------RSNSIDYQI 337
           L+   S+  I FI PDG F+L +Y ++ +++     +P++ ++        + + +   +
Sbjct: 274 LESLSSQDFIEFIPPDGDFQLCEYKIKRHIS----DSPVIKLIEYKVVEKPKKHKLQISM 329

Query: 338 TIKSLFPSKLTAKDVQLRIPVPP--ETVSCHISTS-NGKCKFVP-----EESAIVWKFSK 389
            I+  F ++ +A  + +R+P+    ET    ++     KC F        +  ++WK + 
Sbjct: 330 KIQPHFKAQNSATFLDIRVPIQDIFETYKIDLTKQPRFKCDFGSILFNLSDGYLLWKANG 389

Query: 390 YQGLTENSISATAV------------------------PMKDSTLNIEQWP--------- 416
            +G    +  +  V                        P+++     E +          
Sbjct: 390 MKGGHGETYHSMQVEFFLFDAEAHRKEAEELKNSMDPPPLREGVRMEELYALAHEEKGQI 449

Query: 417 ----RPPISLKFEIVMFSNSGLVVRFFNVSERDRNYKMVKWIKY 456
               R  I+ +FE+  F++SGL V +  + E    Y+   W++Y
Sbjct: 450 NNPVRNMITAEFEVPYFTSSGLRVEYLKIEEEQLQYQSFPWVRY 493

>Kpol_1056.13 s1056 complement(30531..32156) [1626 bp, 541 aa] {ON}
           complement(30531..32156) [1626 nt, 542 aa]
          Length = 541

 Score = 97.1 bits (240), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 121/556 (21%), Positives = 215/556 (38%), Gaps = 127/556 (22%)

Query: 1   MLNALFIYSLRGELLISKHVKGSVQKSMSEIFRIQVINNLDVRSPVLTLGSTTFHHIKSA 60
           M + LFI     E LISK+VK    ++++ I     +N  +   PV T+    +  IK  
Sbjct: 1   MSSCLFILDESLEPLISKNVKSV--RNLTGILEFFKLNYKENGPPVFTVLEWHYVFIKRD 58

Query: 61  KNLWIVAVSRSNADSAAIWEFLYRLNELLEAFNLY------SENELKERFMICYELLDIV 114
              ++ A+  ++     +    + L++L      Y        N + +  ++  EL+D  
Sbjct: 59  SLWFMTAIHETDDRITNLMALTFYLDQLYLLLKTYFNRSSLDRNIVLDNVLLIIELIDES 118

Query: 115 LEDGLPVDTELSSVASKMSVKPNAGVDNF----NMFAENGHGGTNRILP----VSQFLRG 166
           ++ G+   T+ S +   + VK N+ + +     +   E  H G +  +P    + +  +G
Sbjct: 119 MDFGIVQLTDPSIIKDYIRVKVNSPITHLTSDDDSDTEEKHKGLSTYIPGKTDIVKLWKG 178

Query: 167 RPSA------GNLQD--------------IASEAPSNIPWRMNGIKYKKNEVFLNVNERI 206
           +P+        N QD              IA      + WR  GI Y KNE FL+V E++
Sbjct: 179 QPAVTANEGKSNEQDNYDDDDDENFINSYIAKTTIMPVSWRTKGIYYAKNEFFLDVIEKV 238

Query: 207 SILVS-KDGSILKSYVDGTVEATTHLSGMPVCRFGLNDALSVSTPFGDDDEYQVTNKKAI 265
             L+    G I K+ + G ++   +LSGMP  +  LN  +        +DE  ++N    
Sbjct: 239 QYLMDFSTGRIRKNLIHGEIKCKCYLSGMPTLKVALNKLIK-------NDEQFISN---- 287

Query: 266 PKAAAGSVMLEDCKFHQCVQLDKFQSE------------RTINFIAPDGSFELMKY---- 309
                        KFHQCV ++  + E            + I FI PDG F L KY    
Sbjct: 288 ------------SKFHQCVSINSLKREINNEEEENTYHGKEIEFIPPDGEFVLCKYELKR 335

Query: 310 HVRENLNLPFKVTPIVTVVRSNSIDYQITIKSLFPSKLTAKDVQLRIPVP--------PE 361
           HVR+   +      I   ++   I   +TI++ F  + +   + ++IP+           
Sbjct: 336 HVRDVPVIKLSNIEIKPKLKKYKIQIHVTIETHFKKQNSTSVLTIKIPLRMVFSQYKIDL 395

Query: 362 TVSCHISTSNGKCKFVPEESAIVWKFSKYQGLTENSISATAVPMKDSTLNIEQWPR---- 417
           T      +  G+  F   +  ++W+    +G   N  S   +  +    N E++ R    
Sbjct: 396 TKQPRFKSDFGEVLFNISDDFLIWEVGSMKG--GNGESKNNMVAEFFIFNQEEYDRLQEE 453

Query: 418 ------PP-------------------------------ISLKFEIVMFSNSGLVVRFFN 440
                 PP                               +++KFE+   + SGL V +  
Sbjct: 454 MKTSMNPPPLREGPKLEEIYEQTHDNRDEHDKNGISQQLLTMKFEVPYSTCSGLKVEYLK 513

Query: 441 VSERDRNYKMVKWIKY 456
           + E   NY+   W++Y
Sbjct: 514 IEENQVNYQSFPWVRY 529

>TDEL0B06430 Chr2 (1137277..1138854) [1578 bp, 525 aa] {ON}
           Anc_2.555 YHL019C
          Length = 525

 Score = 91.3 bits (225), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 121/539 (22%), Positives = 216/539 (40%), Gaps = 109/539 (20%)

Query: 1   MLNALFIYSLRGELLISKHVKGSVQKSMSEIFRIQVINNLDVRSPVLTLGSTTFHHIKSA 60
           M + +FI     E LISK++K     ++  I R+          PV++  S  F HIK +
Sbjct: 1   MSSCIFITDENLEPLISKNIKAI--PNLQGILRLFKSVYTPESQPVISASSFHFVHIKRS 58

Query: 61  KNLWIVAVSRSNADSAA--IWEFLYRLNELLE---AFNLYSENELKERFMICYELLDIVL 115
             L++  +   +A +    I  FL + + LL+   A +   +N + +  ++  EL+D  +
Sbjct: 59  SLLYVSVIHAYDASANVMLIATFLDQFHSLLKKYLAVSALDKNMVLDNVLLIMELIDESI 118

Query: 116 EDGLPVDTELSSVASKMSVK----PNAGVDNFNMFAENGHGGTNRILP-------VSQFL 164
           + G+   T+ S +   + VK     N  +D+ ++   +     N+          + +FL
Sbjct: 119 DFGVIQITDASIMRDYIRVKVNMPENKTIDDLSLGDSDTDEEDNKKTKRRSGKPNLYKFL 178

Query: 165 RGRPSA-------------GNLQD-----IASEAPSNIPWRMNGIKYKKNEVFLNVNERI 206
           RG                  +++D     IA      + WR  GI Y +NE FL+V E++
Sbjct: 179 RGAKDGTHKAEHTDTAAKEDDVEDSYNSYIAKATIMPVSWRAKGIHYARNEFFLDVVEQV 238

Query: 207 SILVS-KDGSILKSYVDGTVEATTHLSGMPVCRFGLNDALSVSTPFGDDDEYQVTNKKAI 265
             L+    G I K+ + G +   ++LSGMP  +   N            DE  +++    
Sbjct: 239 QYLMDFNSGIIKKNLIHGKIICKSYLSGMPKLKIAFN-------KLSQKDEQFISH---- 287

Query: 266 PKAAAGSVMLEDCKFHQCVQLDKFQSERTINFIAPDGSFELMKY----HVRENLNLPFKV 321
                        KFHQCV      +E+ I FI PDG F L +Y    HV++   L    
Sbjct: 288 ------------SKFHQCVTWPS-SNEKEIEFIPPDGDFVLCQYELKRHVKDQPMLKLVS 334

Query: 322 TPIVTVVRSNSIDYQITIKSLFPSKLTAKDVQLRIPVPPETVSCHIS--------TSNGK 373
             +   ++   I    TI++ F ++ +   + L+IP+        I         + +GK
Sbjct: 335 FGVKPKLKKYKIQMSCTIETHFKARNSTSTLNLKIPLARLFQEYQIDLKKPARFKSDSGK 394

Query: 374 CKFVPEESAIVWKFSKYQ---GLTENSISA---------------------TAVPMKD-- 407
             F   +  ++W     +   G T+ S++A                        P++D  
Sbjct: 395 VLFNISDDFLLWDIEVMKGGHGDTQLSMAAEFSLFNKKEFEEEQEELKNSMNPPPLRDGP 454

Query: 408 ------STLNIEQWPRPP----ISLKFEIVMFSNSGLVVRFFNVSERDRNYKMVKWIKY 456
                   ++ E+ P       +S+KFEI   + SGL V +  + E    Y+   W++Y
Sbjct: 455 KLEELYDQVHNEKGPSKMASRLLSMKFEIPYSTCSGLQVEYLKIDEEQLQYQSFPWVRY 513

>Ecym_4591 Chr4 complement(1154444..1155949) [1506 bp, 501 aa] {ON}
           similar to Ashbya gossypii ABR047W
          Length = 501

 Score = 88.6 bits (218), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 86/336 (25%), Positives = 132/336 (39%), Gaps = 80/336 (23%)

Query: 176 IASEAPSNIPWRMNGIKYKKNEVFLNVNERISILVSKDGSILKS-YVDGTVEATTHLSGM 234
           IA    S I WR  GI Y KNE +L+V E +  LV      +KS  V G ++  ++LSGM
Sbjct: 179 IARTTTSAISWRPKGIHYNKNEFYLDVIEHLEYLVDFQCMNIKSNTVYGYIQCRSYLSGM 238

Query: 235 PVCRFGLNDALSVSTPFGDDDEYQVTNKKAIPKAAAGSVMLEDCKFHQCVQLDKFQSERT 294
           P+   GLN           ++EY                 +    FHQCV LD+  +++ 
Sbjct: 239 PMLTIGLNK-------LNSENEY----------------FMRRANFHQCVNLDQLTTDKL 275

Query: 295 INFIAPDGSFELMKYHVRENLNLP---------FKVTPIVTVVRSNSIDYQITIKSLFPS 345
           I+F  PDG F+L  Y +  N++ P          K+ P  T    + +   +TI + F  
Sbjct: 276 ISFTPPDGEFQLCNYKLTRNMSDPPMIKLEDCKVKLKPRKTKDGLDRLILAVTISTYF-- 333

Query: 346 KLTAKDVQLRIPVPPETV----------SCHISTSNGKCKFVPEESAIVWKFSKYQG--- 392
           KL      L I VP   V                  GK  F   +  ++W+  K +G   
Sbjct: 334 KLQDSTSLLNIKVPLSKVFRDWDVDLSYQPRFKCEQGKVMFNITDDYLLWEVGKVKGGHG 393

Query: 393 -LTENSISATAVPMKDSTLNIEQW------PRP-------------------PIS----- 421
             T    S   +  ++    I+Q       P+P                   P S     
Sbjct: 394 DKTLKMQSEFHLHNREHEARIKQQLSNSMDPKPIRRGPHLEKLYQQTHELNSPTSEAALL 453

Query: 422 -LKFEIVMFSNSGLVVRFFNVSERDRNYKMVKWIKY 456
            ++FEI  ++ SGL V F  + E+   ++   W++Y
Sbjct: 454 KVEFEIPYYTISGLKVEFLKIEEKQLQFQSFPWVRY 489

>KAFR0A02060 Chr1 (428640..430262) [1623 bp, 540 aa] {ON} Anc_2.555
           YHL019C
          Length = 540

 Score = 82.8 bits (203), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 83/356 (23%), Positives = 136/356 (38%), Gaps = 96/356 (26%)

Query: 176 IASEAPSNIPWRMNGIKYKKNEVFLNVNERISILVSKDGSILK-SYVDGTVEATTHLSGM 234
           IA     ++ WR  GI+Y KNE FL+V E++   +    +I+K + + G +   + LSGM
Sbjct: 215 IAKTTIMSVSWRAKGIQYAKNEFFLDVIEKVEYFMDFSNNIIKKNLIHGEIICKSFLSGM 274

Query: 235 PVCRFGLNDALSVSTPFGDDDEYQVTNKKAIPKAAAGSVMLEDCKFHQCVQLDKFQSERT 294
           P  +  LN  +     F                       L  CKFHQCV  D     + 
Sbjct: 275 PTLKVSLNKIIYQDKQF-----------------------LSSCKFHQCVMPDSVDEGKV 311

Query: 295 INFIAPDGSFELMKYHVRENLN-LP------FKVTPIVTVVRSNSIDYQITIKSLFPSKL 347
           + F+ PDG F L KY ++ ++N LP      ++V P +   +   +   +TI+S F    
Sbjct: 312 LEFVPPDGDFVLCKYELKRHVNDLPLLKLISYEVKPKLDKYK---LKLFVTIESTFKKTN 368

Query: 348 TAKDVQLRIPVPPETVSCHISTSN--------GKCKFVPEESAIVWKFSKYQGLTENSIS 399
           +   + ++IP+        I  S         GK  F   +  ++W+    +G      S
Sbjct: 369 STTKLNIKIPLKVLLEKYDIDLSKNIKSRCDEGKILFNVSDDFLLWEIGAMKG----GNS 424

Query: 400 ATAVPMKDSTLNIEQWPR----------PP------------------------------ 419
              +    +  N E++ R          PP                              
Sbjct: 425 QLKMGADFALFNEEEYLRQQEELKTSMNPPPLRTGPKLEELYKQIHEEKCNNFTRKGESS 484

Query: 420 -------ISLKFEIVMFSNSGLVVRFFNVSERDRNYKMVKWIKY--LSKSG-AYEV 465
                  I + FEI   ++SGL V +  + E +  Y+   W++Y  +S  G AY V
Sbjct: 485 DETKGNLIKMDFEIPYNTSSGLKVEYLKIEEPNLQYQAFPWVRYKTISDDGYAYAV 540

>ABR047W Chr2 (479283..480779) [1497 bp, 498 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHL019C (APM2)
          Length = 498

 Score = 82.4 bits (202), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 72/284 (25%), Positives = 118/284 (41%), Gaps = 37/284 (13%)

Query: 43  RSPVLTLGSTTFHHIKSAKNLWIVAVSRSNADSAAIWEFLYRLNELLEAFNLYSENELKE 102
           R PVL+     + +I+    L+ +++S        +  F Y L +L + F  Y    L  
Sbjct: 39  RLPVLSHRGYDYIYIQR-DGLYFLSLSYGVETVVPMTVFAY-LGQLYQLFKKYLGERLNR 96

Query: 103 R-----FMICYELLDIVLEDGLPVDTELSSVASKMSVKPNAGVDNFNMFAENGHGGTNRI 157
           +     F + YEL+D  ++ G+P  T+ + +   + V+     ++    A  G     R 
Sbjct: 97  QLIMDNFHLVYELMDESIDMGIPQLTDHNIIRDYVKVQVVRRAEDGEKHA--GKHKAKRD 154

Query: 158 LPVSQFLRGRPSAGNLQ----DIASEAPSNIPWRMNGIKYKKNEVFLNVNERISILVSKD 213
               +     P A +       IA    S I WR  GI Y KNE FL+V E +  L+  +
Sbjct: 155 KAGKEEEEADPGAADEHFMNSYIAKTTTSAISWRPRGIYYSKNEFFLDVVEELEYLMDFE 214

Query: 214 GSILK-SYVDGTVEATTHLSGMPVCRFGLNDALSVSTPFGDDDEYQVTNKKAIPKAAAGS 272
            + ++ + V G +   ++LSGMP    GLN  ++    F                     
Sbjct: 215 RAQVRLNQVHGAINCRSYLSGMPQLTVGLNKMVAQDRDFT-------------------- 254

Query: 273 VMLEDCKFHQCVQLDKFQSERTINFIAPDGSFELMKYHVRENLN 316
                  FHQCV L++  ++R I F+ PDG F+L  Y +    N
Sbjct: 255 ---SQVHFHQCVDLERLATDRHITFVPPDGEFQLCHYKLARGAN 295

>ZYRO0E05874g Chr5 (452910..454559) [1650 bp, 549 aa] {ON} similar
           to uniprot|P38700 Saccharomyces cerevisiae YHL019C APM2
           homologous to the medium chain of mammalian
           clathrin-associated protein complex Similar to clathrin
           coat proteins
          Length = 549

 Score = 82.0 bits (201), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 72/330 (21%), Positives = 129/330 (39%), Gaps = 85/330 (25%)

Query: 184 IPWRMNGIKYKKNEVFLNVNERISILVS-KDGSILKSYVDGTVEATTHLSGMPVCRFGLN 242
           + WR  GI Y KNE FL+V E++  L   K+  + K+ + G +   ++LSGMP  +  LN
Sbjct: 236 VSWRAKGIHYGKNEFFLDVVEKVQYLADFKEKVVRKNLIHGKIYCKSYLSGMPKLKIALN 295

Query: 243 DALSVSTPFGDDDEYQVTNKKAIPKAAAGSVMLEDCKFHQCVQLDKFQSERTINFIAPDG 302
             L     F                       +   KFHQCV L+   +E+ + FI PDG
Sbjct: 296 KLLQRDAQF-----------------------MSHSKFHQCVALETL-NEKELEFIPPDG 331

Query: 303 SFELMKYHVRENLNLPFKVTPIVTV--------VRSNSIDYQITIKSLFPSKLTAKDVQL 354
            F L +Y ++ ++N     TPI+ +        ++   +   +TI++ F ++ +   + +
Sbjct: 332 EFILCEYELKRHVN----DTPILKITSFEIKPQLKKFKLRILLTIETHFKTRNSTSILNV 387

Query: 355 RIPVPPETVSCHISTSN--------GKCKFVPEESAIVWKFSKYQG-------------- 392
           +IP+       +I  S         G+  F   +  ++W+  + +G              
Sbjct: 388 KIPLAKLFADYNIDLSKPTRFKSAAGQVLFNLSDDFLLWEIGQMRGGHGETQFSMVAEFS 447

Query: 393 ----------------------LTE----NSISATAVPMKDSTLNIEQWPRPPISLKFEI 426
                                 L E      + A     KD  + ++      + + FEI
Sbjct: 448 LFNKEEFEREQEERKHSMNPPPLREGPKLEELYAQTHSQKDPEVLVKSIQSQLVGMDFEI 507

Query: 427 VMFSNSGLVVRFFNVSERDRNYKMVKWIKY 456
              + SGL V +  + E    Y+   W++Y
Sbjct: 508 PYTTCSGLKVEYLKIEEEQLQYQSFPWVRY 537

>Skud_8.26 Chr8 complement(55759..57549) [1791 bp, 596 aa] {ON}
           YHL019C (REAL)
          Length = 596

 Score = 82.0 bits (201), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 135/618 (21%), Positives = 218/618 (35%), Gaps = 196/618 (31%)

Query: 1   MLNALFIYSLRGELLISKHVKG-----SVQKSMSEIFRIQVINNLDVRSPVLTLGSTTFH 55
           M ++LFI     E ++SK+++      SV  S  + +        D   P+L      F 
Sbjct: 1   MSSSLFILDEDLEPVVSKNIRALPNLSSVLSSFKQCYH-------DGSPPILFQNDWFFI 53

Query: 56  HIKSAKNLWIVAV----SRSNADSAAIWEFLYRLNELLEAF---NLYSENELKERFMICY 108
           H+K    L +V+V     + N D   I  FL +   LL+ +    + S++ + +  ++  
Sbjct: 54  HLKR-DFLHLVSVIHTTDKPNIDLMTILAFLEQFYHLLQKYFEIKVLSKDLILDNVLLVL 112

Query: 109 ELLDIVLEDGLPVDTELSSVASKMSVK---PNAGVDNFN--------------------- 144
           EL+D  ++ G+   T+ S +   + VK   P   +DN                       
Sbjct: 113 ELMDECIDFGIVQVTDPSIIKDYIRVKVNLPKVAIDNDEWSSDDESSSESSAGEYSNAKK 172

Query: 145 -------------------------MFAENGHGGTNRILPVSQFLRGRPSAGN--LQD-- 175
                                    M     + G N +  V + LR +   G   L D  
Sbjct: 173 KKKNKRKKKKNSRGKNVGKSKIKGIMVNNKENKGINVVETVKETLRNKNDNGKEPLDDEL 232

Query: 176 ------------IASEAPSNIPWRMNGIKYKKNEVFLNVNERISILVS-KDGSILKSYVD 222
                       IA      I WR  GI Y KNE FL+V ER+  L+  + G I K+ + 
Sbjct: 233 SNDGNDLYINGDIAKTIIMPISWRTKGIHYAKNEFFLDVIERVQYLMDFEKGIIRKNLIH 292

Query: 223 GTVEATTHLSGMPVCRFGLNDALSVSTPFGDDDEYQVTNKKAIPKAAAGSVMLEDCKFHQ 282
           G +   ++LSGMP  +  +N  L+    F                       + +  FHQ
Sbjct: 293 GEIVCRSYLSGMPKLKISINKILNRDPQF-----------------------MSNSNFHQ 329

Query: 283 CVQLDKFQS-------------------ERTINFIAPDGSFELMKY----HVRENLNLPF 319
           CV LD   +                    R I F+ PDG F L +Y    HV++   +  
Sbjct: 330 CVSLDSINTIEKGQEKEQNTGDSQAAADAREIEFVPPDGEFVLCQYELKRHVKDAPMIKL 389

Query: 320 KVTPIVTVVRSNSIDYQITIKSLF-PSKLTAKDVQLRIPVPPETVSCHISTS-------- 370
           K   I   ++ + I     I++ F P+  T+K + ++IP+        I  S        
Sbjct: 390 KDFEIKPKLKKSKIQILTKIQTNFKPTNSTSK-LNVKIPLTRVFQDYKIDLSKQIRFKAN 448

Query: 371 NGKCKFVPEESAIVWKFSKYQGLTENSISATAVPMKD-------------STLNIEQWPR 417
           NGK  F   +  ++W+    +G  E   +A+  P  D             S  N E++ R
Sbjct: 449 NGKVVFNLSDDFLLWEIQTMKGHRER--NASNAPQDDGDPSTCASMVAEFSLFNQEEYDR 506

Query: 418 ----------PP-----------------------------ISLKFEIVMFSNSGLVVRF 438
                     PP                             +S+ FEI   + SGL V +
Sbjct: 507 LQEEMKTSMNPPPLRTGPKLEELYNQVHDKHTPHVTPRDRLVSIDFEIPYCTCSGLKVEY 566

Query: 439 FNVSERDRNYKMVKWIKY 456
             V E    Y+   W++Y
Sbjct: 567 LKVEEPQLQYQSFPWVRY 584

>Smik_8.23 Chr8 complement(51372..53183) [1812 bp, 603 aa] {ON}
           YHL019C (REAL)
          Length = 603

 Score = 79.7 bits (195), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 88/382 (23%), Positives = 142/382 (37%), Gaps = 111/382 (29%)

Query: 166 GRPSAGNL----QDIASEAPSNIPWRMNGIKYKKNEVFLNVNERISILVS-KDGSILKSY 220
           G P+ GN      DIA      I WR  GI Y KNE FL+V ER+  L+  + G I K+ 
Sbjct: 238 GLPNDGNDLYINGDIAKTIIMPISWRTKGIHYAKNEFFLDVIERVQYLMDFEKGIIRKNL 297

Query: 221 VDGTVEATTHLSGMPVCRFGLNDALSVSTPFGDDDEYQVTNKKAIPKAAAGSVMLEDCKF 280
           + G +    +LSGMP  +  +N  L+    F                       L +  F
Sbjct: 298 IHGEIVCRCYLSGMPKLKISINKILNRDAQF-----------------------LSNSSF 334

Query: 281 HQCVQLDKFQS-------------------ERTINFIAPDGSFELMKY----HVRENLNL 317
           HQCV LD  ++                    + + F+ PDG F L +Y    HV++   +
Sbjct: 335 HQCVSLDSIKTIEKREEKEDDDTGLQAAADAKELEFVPPDGEFVLCQYELKRHVKDAPMI 394

Query: 318 PFKVTPIVTVVRSNSIDYQITIKSLF-PSKLTAKDVQLRIPVPPETVSCHISTSN----- 371
             K   I   ++   I  +  I++ F P+  T+K + ++IP+        I  S      
Sbjct: 395 KLKDFQIKPKLKKFKIQIETKIQTNFKPTNSTSK-LNVKIPLTKVFQEYRIDLSKQIRFK 453

Query: 372 ---GKCKFVPEESAIVWKFSKYQGLTENSISATAVPMKDST-----------LNIEQWPR 417
              GK  F   +  ++W+    +G  E++ + T+    D              N E++ R
Sbjct: 454 SNIGKVVFNLSDDFLLWEIQAMKGHREHNTNKTSQDDNDPDACASMVAEFPLFNQEEYDR 513

Query: 418 ----------PP-----------------------------ISLKFEIVMFSNSGLVVRF 438
                     PP                             +++ FEI   + SGL + +
Sbjct: 514 LQEEKKTSMNPPPLRTGPRLEELYRQVHDQQIAHVTPRDKLVAIDFEIPYCTCSGLKIEY 573

Query: 439 FNVSERDRNYKMVKWIKYLSKS 460
             V E    Y+   W++Y + S
Sbjct: 574 LKVEEPQLQYQSFPWVRYKTTS 595

 Score = 33.5 bits (75), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 38/152 (25%), Positives = 69/152 (45%), Gaps = 13/152 (8%)

Query: 1   MLNALFIYSLRGELLISKHVKGSVQKSMSEIFRIQVINNLDVRSPVLTLGSTTFHHIKSA 60
           M ++LFI     ELL+SK+++     S       Q  +  D   P+L+     F H+K  
Sbjct: 1   MSSSLFILDENLELLVSKNIRALPSLSSVLSSFKQCYH--DEAPPILSQNDWFFIHLKR- 57

Query: 61  KNLWIVAV----SRSNADSAAIWEFLYRLNELLEAF---NLYSENELKERFMICYELLDI 113
             L  V+V     + N D   I  FL +   LL+ +    + +++ + +  ++  EL+D 
Sbjct: 58  DFLHFVSVIHTTDKPNIDLMTILAFLEQFYHLLQEYFEIKVLTKDVILDNVLLVLELMDE 117

Query: 114 VLEDGLPVDTELSSVASKMSVK---PNAGVDN 142
            ++ G+   T+ S +   + VK   P   +DN
Sbjct: 118 CIDFGIVQVTDPSIIKDYIRVKVNLPKIKIDN 149

>Suva_8.33 Chr8 complement(69735..71525) [1791 bp, 596 aa] {ON}
           YHL019C (REAL)
          Length = 596

 Score = 79.0 bits (193), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 136/617 (22%), Positives = 219/617 (35%), Gaps = 194/617 (31%)

Query: 1   MLNALFIYSLRGELLISKHVKG-----SVQKSMSEIFRIQVINNLDVRSPVLTLGSTTFH 55
           M ++LFI     E L+SK+++      S+  S  + +            P+L+     F 
Sbjct: 1   MSSSLFILDEDLEPLVSKNIRAIPNLSSILSSFKQCYHRD-------SPPILSQNGWFFI 53

Query: 56  HIKSAKNLWIV---AVSRSNADSAAIWEFLYRLNELLEAF---NLYSENELKERFMICYE 109
           H+K     +I    A  + N D  +I  FL +   LL+ +   N+ S+N + +  ++  E
Sbjct: 54  HLKRDFLHFISVIHATDKPNIDLMSILAFLEQFYHLLKKYFEINVLSKNIILDNVLLVLE 113

Query: 110 LLDIVLEDGLPVDTELSSVASKMSVK---PNAGVDNFN---------------------- 144
           L+D  ++ G+   T+ S +   + VK   P   +D+                        
Sbjct: 114 LVDECIDFGIVQVTDPSIIKDYIRVKVNLPKVPIDSDEWSSGDESSSSGSEYSDSKKRNK 173

Query: 145 -----------------------MFAENGHGGTNRILPVSQFLRGR------------PS 169
                                  M     + GT+ +  V   LR +            P+
Sbjct: 174 KKKKKKKKNGRGKNVGKSKIKSIMVNNKENKGTDVVETVKDTLRNKNDTGRNSPDDDLPN 233

Query: 170 AGNL----QDIASEAPSNIPWRMNGIKYKKNEVFLNVNERISILVS-KDGSILKSYVDGT 224
            GN      DIA      I WR  GI Y KNE FL+V ER+  L+  + G I K+ + G 
Sbjct: 234 DGNDLYINGDIAKTIIMPISWRTKGIHYSKNEFFLDVIERVQYLMDFEKGIIRKNLIHGE 293

Query: 225 VEATTHLSGMPVCRFGLNDALSVSTPFGDDDEYQVTNKKAIPKAAAGSVMLEDCKFHQCV 284
           +    +LSGMP  +  +N  L+    F                       + + KFHQCV
Sbjct: 294 IVCRCYLSGMPKLKISINKLLNRDPQF-----------------------MSNSKFHQCV 330

Query: 285 QLDKFQ------------------SERTINFIAPDGSFELMKY----HVRENLNLPFKVT 322
            LD                       + I FI PDG F L +Y    HV++   +  +  
Sbjct: 331 SLDSINIIEEEGRDTDDAGSQTATDTKEIEFIPPDGEFVLCQYELKRHVKDAPMIKLQGF 390

Query: 323 PIVTVVRSNSIDYQITIKSLF-PSKLTAKDVQLRIPVPPETVSCHISTSN--------GK 373
            I   ++   I     I++ F P+  T+K + ++IP+        I  S         GK
Sbjct: 391 EIKPKLKKFKIQIITKIQTNFKPTNSTSK-LNVKIPLTKVFQDYKIDLSKQIRFKANLGK 449

Query: 374 CKFVPEESAIVWKFSKYQGLTENSISATAVPMKD--STL----------NIEQWPR---- 417
             F   +  ++W+    +G  E   +   VP +D  STL          N E++ R    
Sbjct: 450 VVFNLSDDFLLWEIGTMKGHRER--NTGTVPQEDDASTLASMVAEFPLFNQEEYDRLQEE 507

Query: 418 ------PP--------------------------------ISLKFEIVMFSNSGLVVRFF 439
                 PP                                +S+ FEI   + SGL V + 
Sbjct: 508 LKTSMNPPPLRTGPKLEELYKQVHEERVLHTHDVAPRDKLVSVDFEIPYCTCSGLKVEYL 567

Query: 440 NVSERDRNYKMVKWIKY 456
            V E    Y+   W++Y
Sbjct: 568 KVEEPQLQYQSFPWVRY 584

>NCAS0A12650 Chr1 (2492345..2494111) [1767 bp, 588 aa] {ON}
           Anc_2.555 YHL019C
          Length = 588

 Score = 77.8 bits (190), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 64/241 (26%), Positives = 96/241 (39%), Gaps = 52/241 (21%)

Query: 176 IASEAPSNIPWRMNGIKYKKNEVFLNVNERISILVS-KDGSILKSYVDGTVEATTHLSGM 234
           IA      I WR  GI Y KNE FL+V E++   +  K G I K+ + G +   ++LSGM
Sbjct: 242 IAKTTIMPISWRTKGIHYGKNEFFLDVIEKVEYFMDFKSGVIRKNLIHGEIICRSYLSGM 301

Query: 235 PVCRFGLNDALSVSTPFGDDDEYQVTNKKAIPKAAAGSVMLEDCKFHQCVQLDKFQSERT 294
           P  +  +N  L     F                       L + KFHQCV LD  ++   
Sbjct: 302 PKLKISINKILKQDVQF-----------------------LSNVKFHQCVSLDSIRARSN 338

Query: 295 -----------------------INFIAPDGSFELMKY----HVRENLNLPFKVTPIVTV 327
                                  I FI PDG F L KY    HV++   +  +   I+  
Sbjct: 339 PPAVEEDGKKKNEEADTLGNKGEIEFIPPDGEFLLCKYELKRHVKDQPMIKLRNFEIIPK 398

Query: 328 VRSNSIDYQITIKSLFPSKLTAKDVQLRIPVPPETVSCHISTSNGKCKFVPEESAIVWKF 387
           +    I   + I++ F +  +   + LRIP+     S  I  S  + KF  E+  +++  
Sbjct: 399 LHKFKIKIHVIIETHFKTTNSTSKLNLRIPITNLFQSYRIDLSK-QPKFKCEQGTVLFNL 457

Query: 388 S 388
           S
Sbjct: 458 S 458

>TPHA0I02390 Chr9 (528997..530676) [1680 bp, 559 aa] {ON} Anc_2.555
           YHL019C
          Length = 559

 Score = 77.4 bits (189), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 83/361 (22%), Positives = 135/361 (37%), Gaps = 110/361 (30%)

Query: 176 IASEAPSNIPWRMNGIKYKKNEVFLNVNERISILVS-KDGSILKSYVDGTVEATTHLSGM 234
           IA      + WR  GI Y KNE FL+V E +  L++ KD  I ++ + G ++  ++LSGM
Sbjct: 217 IARTTTMAVSWRTKGIYYAKNEFFLDVVESVQYLMNFKDKVIRRNLIHGQIKCKSYLSGM 276

Query: 235 PVCRFGLNDALSVSTPFGDDDEYQVTNKKAIPKAAAGSVMLEDCKFHQCVQLD------- 287
           P  R  LN  L       DD ++                 L   KFHQCV L+       
Sbjct: 277 PTLRIALNKILQ------DDKQF-----------------LGHAKFHQCVSLNSINIKDL 313

Query: 288 -------------KFQSERTINFIAPDGSFELMKYHVRENLNLP-------FKVTPIVTV 327
                         F +++ I FI PDG F L +Y +R ++  P       F + P    
Sbjct: 314 EKDLEGPNDISNKNFVNKKEIEFIPPDGEFVLCQYELRRHVKDPPVINMTSFDIKPNFKK 373

Query: 328 VRSNSIDYQITIKSLFPSKLTAKDVQLRIPVPPETVSCHISTSN--------GKCKFVPE 379
            R   +   + I++ F  + +   + ++IP+        I  S         GK  F   
Sbjct: 374 FR---VQISLKIETHFKRQNSTSLMTIKIPLLQLFNDYKIDLSKQPRFKSDVGKVLFNIS 430

Query: 380 ESAIVWKFSKYQG------------------------LTENSISATAVPMK--------- 406
           E  ++W+    +G                          E  IS    P++         
Sbjct: 431 EDFLIWEIDALKGGHGENEKGMVAEFFLFNQEEYDRLQEEAKISMNPPPLRNGPKLEELY 490

Query: 407 ----------DSTLNIE-QWPRPPISLKFEIVMFSNSGLVVRFFNVSERDRNYKMVKWIK 455
                     D+ L ++ Q+    + ++FEI   + SGL V +  + E    Y+   W++
Sbjct: 491 EEMHENEDAEDTALKMKTQY----VFMQFEIPYSTCSGLKVEYLKIEEDLLKYQSFPWVR 546

Query: 456 Y 456
           Y
Sbjct: 547 Y 547

>KLLA0F25432g Chr6 complement(2365434..2366957) [1524 bp, 507 aa]
           {ON} some similarities with uniprot|P38700 Saccharomyces
           cerevisiae YHL019C APM2 homologous to the medium chain
           of mammalian clathrin-associated protein complex Similar
           to clathrin coat proteins
          Length = 507

 Score = 77.4 bits (189), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 61/235 (25%), Positives = 101/235 (42%), Gaps = 51/235 (21%)

Query: 182 SNIPWRMNGIKYKKNEVFLNVNERISILVS-KDGSILKSYVDGTVEATTHLSGMPVCRFG 240
           S + WR  GI Y KNE FL+V E++  ++  ++G +  + ++GT+   ++LSGMP    G
Sbjct: 177 SAVSWRPKGIHYGKNEFFLDVIEKLEFIMDFEEGVVRNNVINGTIICRSYLSGMPQLSIG 236

Query: 241 LNDALSVSTPFGDDDEYQVTNKKAIPKAAAGSVMLEDCKFHQCVQLDKFQSERT--INFI 298
           LN  +  +  F                       ++  KFH+CV L     E +  I FI
Sbjct: 237 LNKLMQKNVHF-----------------------MKRLKFHECVDLHTLIKEESPVIKFI 273

Query: 299 APDGSFELMKYHVRENLNLPFKVTPIVTVV--------RSNS-----IDYQITIKSLFPS 345
            PDG FEL  Y     LN P    P++ +         R N      +  +  I + F +
Sbjct: 274 PPDGEFELCNY----KLNRPLLDEPVIKLQSFGLSQKPRKNQETQDKLLLKAAITTHFKA 329

Query: 346 KLTAKDVQLRIPVPPETVSCHISTSN--------GKCKFVPEESAIVWKFSKYQG 392
           + +AK++ ++IP+       +I            G   F     +I+WK +  +G
Sbjct: 330 QDSAKELLIKIPIKSVIRKWNIDLEKPPLFKSDIGDVVFDITAGSIIWKINNLKG 384

 Score = 35.8 bits (81), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 14/37 (37%), Positives = 23/37 (62%)

Query: 420 ISLKFEIVMFSNSGLVVRFFNVSERDRNYKMVKWIKY 456
           I++ FEI  ++ SGL V +F + E   NY+   W++Y
Sbjct: 457 IAMSFEIPYYAVSGLKVEYFKIEEPQLNYQSFPWVRY 493

>KNAG0C05550 Chr3 complement(1076437..1078185) [1749 bp, 582 aa]
           {ON} Anc_2.555 YHL019C
          Length = 582

 Score = 77.0 bits (188), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 55/194 (28%), Positives = 86/194 (44%), Gaps = 36/194 (18%)

Query: 175 DIASEAPSNIPWRMNGIKYKKNEVFLNVNERISILVSKDGSIL-KSYVDGTVEATTHLSG 233
           DIA      I WR  GI Y KNE FLNV E++   +    +++ K+ + G +     LSG
Sbjct: 244 DIAKTTIMPISWRTKGIHYAKNEFFLNVIEKVEYFMDFTQNVIKKNLIHGEIRCKCFLSG 303

Query: 234 MPVCRFGLNDALSVSTPFGDDDEYQVTNKKAIPKAAAGSVMLEDCKFHQCVQLDKFQS-- 291
           MP  +  +N  ++    F                       L +CKFHQCV L   +S  
Sbjct: 304 MPNLKVSINKIVNEDKQF-----------------------LANCKFHQCVSLASLESSD 340

Query: 292 ERTINFIAPDGSFELMKY----HVRENLNLP---FKVTPIVTVVRSNSIDYQITIKSLFP 344
            + + F+ PDG F L +Y    HVR+   +    F+V P +   +       +TI++ F 
Sbjct: 341 HKDVEFVPPDGEFTLCRYELKRHVRDEPMVKLVNFEVKPKLKKFKLKL---LLTIETHFK 397

Query: 345 SKLTAKDVQLRIPV 358
           +      + LR+P+
Sbjct: 398 TTNATSKLALRVPI 411

 Score = 31.2 bits (69), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 12/43 (27%), Positives = 24/43 (55%)

Query: 420 ISLKFEIVMFSNSGLVVRFFNVSERDRNYKMVKWIKYLSKSGA 462
           +++ FE+   ++SGL V +  + E    Y+   W++Y + S A
Sbjct: 533 LTMDFEVPYCTSSGLRVEYLKIEEPQLEYQSFPWVRYTTLSDA 575

>YHL019C Chr8 complement(67731..69548) [1818 bp, 605 aa] {ON}
           APM2Protein of unknown function, homologous to the
           medium chain of mammalian clathrin-associated protein
           complex; involved in vesicular transport
          Length = 605

 Score = 75.5 bits (184), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 87/369 (23%), Positives = 133/369 (36%), Gaps = 111/369 (30%)

Query: 175 DIASEAPSNIPWRMNGIKYKKNEVFLNVNERISILVS-KDGSILKSYVDGTVEATTHLSG 233
           DIA      I WR  GI Y KNE FL+V ER+  L+  + G I K+ + G +    +LSG
Sbjct: 249 DIAKTIIMPISWRTKGIHYAKNEFFLDVIERVQYLMDFEKGVIRKNLIHGEIVCRCYLSG 308

Query: 234 MPVCRFGLNDALSVSTPFGDDDEYQVTNKKAIPKAAAGSVMLEDCKFHQCVQLDKFQS-- 291
           MP  +  +N  L+    F                       + +  FHQCV LD   +  
Sbjct: 309 MPKLKISINKILNRDPQF-----------------------MSNSSFHQCVSLDSINTIE 345

Query: 292 ------------------ERTINFIAPDGSFELMKY----HVRENLNLPFKVTPIVTVVR 329
                              R I FI PDG F L +Y    HV++   +  K   I   ++
Sbjct: 346 KDEEKNSDDDAGLQAATDAREIEFIPPDGEFVLCQYELKRHVKDAPMVRLKDFEIKPKLK 405

Query: 330 SNSIDYQITIKSLF-PSKLTAKDVQLRIPVPPETVSCHISTSN--------GKCKFVPEE 380
              I     I++ F P+  T+K + +RIP+        I  S         GK  F   +
Sbjct: 406 KFKIQIVTKIQTNFKPTNSTSK-LNVRIPLTKVFQEYKIDLSKQIRFKANIGKVVFNLSD 464

Query: 381 SAIVWKFSKYQGLTENSISATAVPMKDST--------------LNIEQWPR--------- 417
             ++W+    +G  E+S + ++    D                 N E++ R         
Sbjct: 465 DFLLWEIQTMKGHREHSTNKSSQYNSDEDDPNTCASMVAEFPLFNQEEYDRLQEEMKTSM 524

Query: 418 -PP-----------------------------ISLKFEIVMFSNSGLVVRFFNVSERDRN 447
            PP                             +++ FEI   + SGL V +  V E    
Sbjct: 525 NPPPLRTGPRLEELYRQVHDQQTSHVTPRDKLVNIDFEIPYCTCSGLKVEYLKVEEPQLQ 584

Query: 448 YKMVKWIKY 456
           Y+   W++Y
Sbjct: 585 YQSFPWVRY 593

 Score = 33.9 bits (76), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 40/157 (25%), Positives = 70/157 (44%), Gaps = 23/157 (14%)

Query: 1   MLNALFIYSLRGELLISKHVKG-----SVQKSMSEIFRIQVINNLDVRSPVLTLGSTTFH 55
           M ++LFI     E L+SK+++      SV  S  + +        D   P+L+     F 
Sbjct: 1   MSSSLFILDENLEPLVSKNIRALPNLSSVLSSFKQCYH-------DGSPPILSQNDWFFI 53

Query: 56  HIKSAKNLWIVAV----SRSNADSAAIWEFLYRLNELLEAF---NLYSENELKERFMICY 108
           H+K    L  V+V     + N D   I  FL +   LL+ +    + ++N + +  ++  
Sbjct: 54  HLKR-DFLHFVSVIHTTDKPNIDLMTILAFLEQFYHLLQKYFEIEVLTKNVILDNILLVL 112

Query: 109 ELLDIVLEDGLPVDTELSSVASKMSVK---PNAGVDN 142
           EL+D  ++ G+   T+ S +   + VK   P   VDN
Sbjct: 113 ELIDECIDFGIVQVTDPSIIKDYIRVKVNVPRVTVDN 149

>CAGL0K03223g Chr11 (296371..298167) [1797 bp, 598 aa] {ON} similar
           to uniprot|P38700 Saccharomyces cerevisiae YHL019c
           involved in clathrin-independent transport
          Length = 598

 Score = 74.7 bits (182), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 65/263 (24%), Positives = 101/263 (38%), Gaps = 80/263 (30%)

Query: 176 IASEAPSNIPWRMNGIKYKKNEVFLNVNERISILVS-KDGSILKSYVDGTVEATTHLSGM 234
           IA      + WR  GI Y KNE FL+V E++  LV  + G + +S + G +   ++LSGM
Sbjct: 241 IAKTTIMPVSWRAKGIHYAKNEFFLDVIEKLQYLVDLESGMVRRSLIHGQIVCRSYLSGM 300

Query: 235 PVCRFGLNDALSVSTPFGDDDEYQVTNKKAIPKAAAGSVMLEDCKFHQCVQLDKFQ---- 290
           P  +  LN  L     F                       +   +FHQCV LD  +    
Sbjct: 301 PKLKMSLNKLLQNDKQF-----------------------ISQVQFHQCVSLDSIEKVIK 337

Query: 291 ------------------SERTINFIAPDGSFELMKYHVRENLNLP-------FKVTP-- 323
                             +E  I FI PDG F L  Y ++ ++  P       F++TP  
Sbjct: 338 YAEEHSDELKTLKHTEHNAESEIEFIPPDGDFTLCSYELKRHIRDPPMVKLCSFEITPKW 397

Query: 324 ------IVTVVRSN--------SIDYQITIKSLFPSKLTAKDVQLRIPVPPETVSCHIST 369
                 I   V ++         +D +I I  +F      KD Q+ +  P         T
Sbjct: 398 KKYKLKISAAVETHFKPTNSTSKLDVKIPISKVF------KDYQIDLKKP-----IKFKT 446

Query: 370 SNGKCKFVPEESAIVWKFSKYQG 392
           SNG+  +   +  ++W+    +G
Sbjct: 447 SNGRVVYNISDDFLLWEIGVIKG 469

>TBLA0B06760 Chr2 (1594957..1596930) [1974 bp, 657 aa] {ON}
           Anc_2.555 YHL019C
          Length = 657

 Score = 74.7 bits (182), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 61/230 (26%), Positives = 97/230 (42%), Gaps = 37/230 (16%)

Query: 184 IPWRMNGIKYKKNEVFLNVNERISILVS-KDGSILKSYVDGTVEATTHLSGMPVCRFGLN 242
           I WR  GI Y KNE FL+V E+   ++  K+  I K+ + G +     LSGMP  +  LN
Sbjct: 287 ISWRTKGIYYAKNEFFLDVLEKQEYIMDFKNDLIRKNLIQGKIICRCFLSGMPKLKIALN 346

Query: 243 DALSVSTPFGDDDEYQVTNKKAIPKAAAGSVMLEDCKFHQCVQLDKFQSERTINFIAPDG 302
             L     F                       L   +FHQCV L+  Q+ + I FI PDG
Sbjct: 347 KLLQKDQQF-----------------------LSQLRFHQCVSLETIQN-KEIEFIPPDG 382

Query: 303 SFELMKY----HVRENLNLPFKVTPIVTVVRSNSIDYQITIKSLFPSKLTAKDVQLRIPV 358
            F L +Y    HV++  N+      I   ++   I   ++I + F  + +   + L+IP+
Sbjct: 383 EFILCEYELKRHVKDPPNIKLISFEIKPKLKKFKIQINLSITTFFKVQNSTSILNLKIPL 442

Query: 359 PP--------ETVSCHISTSNGKCKFVPEESAIVWKFSKYQGLTENSISA 400
                        S    ++ G+ KF   +  ++W+    +G    +I A
Sbjct: 443 EKLFNDYKIDLKKSPRFKSNIGQVKFNLSDDFLLWEIGSMKGGHGENIKA 492

 Score = 32.7 bits (73), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 16/58 (27%), Positives = 30/58 (51%), Gaps = 4/58 (6%)

Query: 399 SATAVPMKDSTLNIEQWPRPPISLKFEIVMFSNSGLVVRFFNVSERDRNYKMVKWIKY 456
           S   +P+K +  N  Q+    +++ FEI  ++ SGL V +  + E    Y+   W++Y
Sbjct: 592 SNKEIPLKKALSNKPQY----LTVDFEIPYYACSGLKVEYLKIEEEQLLYQSFPWVRY 645

>NDAI0B01610 Chr2 complement(384287..386305) [2019 bp, 672 aa] {ON}
           Anc_2.555 YHL019C
          Length = 672

 Score = 70.9 bits (172), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 61/255 (23%), Positives = 97/255 (38%), Gaps = 61/255 (23%)

Query: 176 IASEAPSNIPWRMNGIKYKKNEVFLNVNERISILVS-KDGSILKSYVDGTVEATTHLSGM 234
           IA      I WR  GI Y KNE FL+V E++   +  + G I K+ + G +    +LSGM
Sbjct: 287 IAKTTIMPISWRTKGIHYAKNEFFLDVIEKVEYFMDFEKGLIRKNLIHGEIVCKCYLSGM 346

Query: 235 PVCRFGLNDALSVSTPFGDDDEYQVTNKKAIPKAAAGSVMLEDCKFHQCVQLDKFQ---- 290
           P  +  +N  L   + F                       L +  FHQCV LD       
Sbjct: 347 PKLKISINKILQNDSQF-----------------------LSNAHFHQCVSLDSLHLQSA 383

Query: 291 ---------------------SERTINFIAPDGSFELMKYHVRENL-NLP---FKVTPIV 325
                                 ++ I FI PDG F L KY ++ ++ +LP    K+  I 
Sbjct: 384 EDDDGDDNANVNENENHDERDRKKEIEFIPPDGDFLLCKYELKRHVKDLPVIKLKLFDIK 443

Query: 326 TVVRSNSIDYQITIKSLFPSKLTAKDVQLRIPVPPETVSCHISTS--------NGKCKFV 377
             +    +   + I++ F +      + L+IP+        I  S         GK  F 
Sbjct: 444 PKLSKYKLKIHVIIETHFKTTNNTSKLNLKIPIERLFQEYRIDLSKQIKFKCDQGKVLFN 503

Query: 378 PEESAIVWKFSKYQG 392
             ++ ++W+    +G
Sbjct: 504 LSDNFLIWEIGSMKG 518

>Kwal_26.7957 s26 complement(586544..587914) [1371 bp, 456 aa] {ON}
           YBR288C (APM3) - clathrin associated protein medium
           chain [contig 55] FULL
          Length = 456

 Score = 65.9 bits (159), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 77/319 (24%), Positives = 128/319 (40%), Gaps = 84/319 (26%)

Query: 184 IPWRMNGIKYKKNEVFLNVNERISILV---SKDGSI--LKSYVDGTVEATTHLSGMPVCR 238
           +PWR  G+KY  NE++++V E I +++    K G +  ++  +DG V+  +HL+G PV  
Sbjct: 186 VPWRTAGLKYSNNELYVDVVETIHVILRKTEKSGQLVPVRGLIDGYVDFRSHLTGNPVVA 245

Query: 239 FGLNDALSVSTPFGDDDEYQVTNKKAIPKAAAGSVMLEDCKFHQCVQLDKFQSERTINFI 298
             LN         G D          +P              H C Q     S   + F+
Sbjct: 246 LKLN-------LHGHD--------LGVP------------ALHPCCQAQYTGSPENLQFV 278

Query: 299 APDGSFELMKYHVR-ENLNLPFKVTPIVTVVRSNSIDYQITIKSL---FPSKLT------ 348
            PDG F LM+Y +  E L    K+   + +V   S+DY + +  L   F  K+       
Sbjct: 279 PPDGKFRLMQYTIDLEALQTKSKLFSNMGLV---SLDYFVGLGDLRDEFEIKVNIAGSQH 335

Query: 349 ---AKDVQLRIPVPPETVSCHIS---TSNGKCKFVPEESAIVWKFSK---------YQGL 393
                D+ + I     T  C I    +++G  +   E +   W F K         ++G 
Sbjct: 336 VKLIDDLVVTIKFGKLTSDCRIKALRSTHGHFENGFENNIGKWSFDKETPTGTVPVFRGC 395

Query: 394 TENSISATAVPMKDSTLNIEQWPRPPISLKFEIVMFSNSGLVVRFFNVSERD------RN 447
            EN     A P +  TL++              + +SN G +     V   D      +N
Sbjct: 396 LEN-----ATPEQIKTLSLA-------------ISYSNKGSLPSGIKVGAVDIISGLPKN 437

Query: 448 YKMVKWIKYLSKSGAYEVR 466
            K  K +KY++++G + +R
Sbjct: 438 TKPFKGVKYVARTGQFNLR 456

>TDEL0A02970 Chr1 complement(532395..533885) [1491 bp, 496 aa] {ON}
           Anc_2.522 YBR288C
          Length = 496

 Score = 65.1 bits (157), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 78/330 (23%), Positives = 137/330 (41%), Gaps = 74/330 (22%)

Query: 175 DIASEAPSNIPWRMNGIKYKKNEVFLNVNERISILVSKDG----------SILKSYVDGT 224
           D +S     +PWR  G+KY  NE+++++ E I ++  K G           ++   ++G 
Sbjct: 202 DTSSREDDVVPWRTAGLKYSNNELYVDLTESIHVVYQKAGKRSRRTSSKLEMICGTINGQ 261

Query: 225 VEATTHLSGMPVCRFGLNDALSVSTPFGDDDEYQVTNKKAIPKAAAGSVMLEDCKFHQCV 284
                +LSG P     L+ A                N   +P             FH+CV
Sbjct: 262 ASVKCYLSGNPTVDLQLDLA---------------GNDLGVP------------AFHECV 294

Query: 285 QLDKFQ--SERTINFIAPDGSFELMKYHVRENLNLP-------FKVT-PIVTVVRSNSI- 333
           +LD  Q  S   + FI PDG F LM+Y +  +L+ P       F  T  +VT+  ++ + 
Sbjct: 295 ELDNHQNPSNCDLRFIPPDGRFNLMQYSI--DLDTPRIQQTRRFNHTVGLVTIDFADQLG 352

Query: 334 ----DYQITIKSLFPSKLTAKDVQLRIPVPPETVSCHISTSNGKCK------------FV 377
               +++IT+ ++  S+  A    LRI V  ++ +   S ++ K K             V
Sbjct: 353 NKTDEFEITV-NISNSREVANIEDLRIDVQLQSNTDEDSETDFKIKVLRNTHGRFDNSVV 411

Query: 378 PEESAIVWKFSKYQGLTENSISATAVPMKDSTLNIEQWPRPPISLKFEIVMFSNSGLVVR 437
           P + +  W F K        +    V   +  L   Q      SL  ++     SG+ V+
Sbjct: 412 PGQGS--WIFDKDTPTGTLPVLRGCVESTEPRLLRVQRVTASYSLSGQLA----SGIRVK 465

Query: 438 FFNVSE-RDRNYKMVKWIKYLSKSGAYEVR 466
             N+ +   ++ +  K +KY +K+G +E+R
Sbjct: 466 AINIGQLTTKSNRPFKGVKYATKTGDFEIR 495

>AGL061W Chr7 (593647..594882) [1236 bp, 411 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBR288C (APM3)
          Length = 411

 Score = 63.5 bits (153), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 67/310 (21%), Positives = 131/310 (42%), Gaps = 56/310 (18%)

Query: 179 EAPSNIPWRMNGIKYKKNEVFLNVNERISILVSKDGS---ILKSYVDGTVEATTHLSGMP 235
           EA   +PWR    +Y  NE+++++ E ++  + + GS   ++   + G ++   +LSG P
Sbjct: 135 EAGQTVPWRTADCRYVNNEIYVDLVETVNATLRQKGSSLTLINGSLSGKIDVKCYLSGNP 194

Query: 236 VCRFGLNDALSVSTPFGDDDEYQVTNKKAIPKAAAGSVMLEDCKFHQCVQLDKFQSERTI 295
             +  L  +     P                        L++   H+CV+L +     T+
Sbjct: 195 TVQLKLRTS---GHP------------------------LDNSALHRCVELGE-AGVATM 226

Query: 296 NFIAPDGSFELMKYHV---------RENLNLPFKVTPIVTVVRSNSIDYQITIKSLFPSK 346
           NF+ PDG F L +Y +         R   NL      + + +  +  +++I +     ++
Sbjct: 227 NFVPPDGRFTLAEYAIDLSAISQAARRLTNLGLVTVSLASGLGQHRDEFEIKVIIGNSTQ 286

Query: 347 LTA-KDVQLRIPVPPETVSCHIS---TSNGKCKFVPEESAIVWKFSKYQGLTENSISATA 402
           + A +D+++ +  P  + +  I    T++G  +        VW F K     + ++ +  
Sbjct: 287 VAAIEDLRITVYFPDISDAAKIKILRTTHGGWESDLSRVRGVWAFDK-----QTAVGSVP 341

Query: 403 VPMKDSTLNIEQWPR-PPISLKFEIVMFSN-----SGLVVRFFNVSERDRNYKMVKWIKY 456
           V ++    N E  P  PP+      V +S+     SG+ V    +S+     K  K +KY
Sbjct: 342 V-LRGCVENPESTPHAPPVFPSHLAVSYSHVGQLPSGIRVDTIALSDLPPGSKPFKGVKY 400

Query: 457 LSKSGAYEVR 466
            S++G Y VR
Sbjct: 401 TSRAGDYIVR 410

>KLLA0E18789g Chr5 (1669103..1670596) [1494 bp, 497 aa] {ON} similar
           to uniprot|P38153 Saccharomyces cerevisiae YBR288C APM3
           Mu3-like subunit of the yeast AP-3 complex which
           functions in transport of alkaline phosphatase to the
           vacuole via the alternate pathway clathrin associated
           protein medium chain
          Length = 497

 Score = 60.5 bits (145), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 38/138 (27%), Positives = 64/138 (46%), Gaps = 38/138 (27%)

Query: 182 SNIPWRMNGIKYKKNEVFLNVNERISILVSKDGSILKSYVDGTVEATTHLSGMPVC--RF 239
           S +PWRM+GI Y  NE+F++++E I+ +V K G +L  ++ G ++   HLSG P+   + 
Sbjct: 208 SGVPWRMSGINYANNEIFIDMSEEINAIVEK-GKLLTGHIKGCIDLNNHLSGQPLVEMKL 266

Query: 240 GLNDALSVSTPFGDDDEYQVTNKKAIPKAAAGSVMLEDCKFHQCVQLDKFQSER------ 293
           GL D             +++++                  FH+C+  DK  S        
Sbjct: 267 GLLD-------------HKLSHLNTT--------------FHRCILEDKANSINDLIAGK 299

Query: 294 --TINFIAPDGSFELMKY 309
              + F+ PDG   L +Y
Sbjct: 300 FTKLTFVPPDGRTRLCQY 317

>KAFR0D03560 Chr4 complement(695693..697060) [1368 bp, 455 aa] {ON}
           Anc_2.522 YBR288C
          Length = 455

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 47/155 (30%), Positives = 74/155 (47%), Gaps = 43/155 (27%)

Query: 169 SAGNLQDIASEAPSN------IPWRMNGIKYKKNEVFLNVNERISILVSKDG------SI 216
           +A +LQ    +APS       +PWR   IK  +NE++++V E + + + K         +
Sbjct: 154 AAKSLQ--KGQAPSKTVDNEVVPWRSKEIKTVRNEIYVDVKETLYVTLIKSNRASHRLKL 211

Query: 217 LKSYVDGTVEATTHLSGMPVCRFGLNDALSVSTPFGDDDEYQVTNKKAIPKAAAGSVMLE 276
           L  Y++G+V   + + G+P+        L VS  FG  D      K  IP          
Sbjct: 212 LNGYINGSVSVDSSIGGVPM--------LEVS--FGGCDF-----KDIIP---------- 246

Query: 277 DCKFHQCVQLDKFQSE--RTINFIAPDGSFELMKY 309
             KFH CV++++F +     I FI PDG F+LM+Y
Sbjct: 247 --KFHDCVEVNEFLTNDGNIIKFIPPDGKFQLMEY 279

>KLTH0D06556g Chr4 complement(570972..572342) [1371 bp, 456 aa] {ON}
           similar to uniprot|P38153 Saccharomyces cerevisiae
           YBR288C APM3 Mu3-like subunit of the yeast AP-3 complex
           which functions in transport of alkaline phosphatase to
           the vacuole via the alternate pathway clathrin
           associated protein medium chain
          Length = 456

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 75/311 (24%), Positives = 126/311 (40%), Gaps = 68/311 (21%)

Query: 184 IPWRMNGIKYKKNEVFLNVNERISILVSKD---GSI--LKSYVDGTVEATTHLSGMPVCR 238
           +PWR  G+KY  NE++++V E + +++ K+   G +  ++  +DG V+  +HLSG PV  
Sbjct: 186 VPWRSAGVKYSNNELYVDVVETVHVILRKNEKTGELTSVRGVLDGVVDFRSHLSGNPV-- 243

Query: 239 FGLNDALSVSTPFGDDDEYQVTNKKAIPKAAAGSVMLEDCKFHQCVQLDKFQSE-RTINF 297
             LN  L      G D          +P              HQC  LD +Q     + F
Sbjct: 244 IALNLRLR-----GHD--------LGMP------------ALHQCC-LDSYQGRPDQLRF 277

Query: 298 IAPDGSFELMKYHVR-ENLNLPFKVTPIVTVVRSNSIDYQITIKSL---FPSKL------ 347
           + PDG F+LM Y +  ++L    K+   + +V   S DY+  +  L   F   L      
Sbjct: 278 VPPDGKFQLMHYSIDLDSLQSKSKLFSNIGLV---SPDYRTELGDLGDEFEVNLNIAGSQ 334

Query: 348 ---TAKDVQLRIPVPPETVSCHIS---TSNGKCKFVPEESAIVWKFSKYQGLTENSISAT 401
                 D+ + +   P    C I    +++G  +     +   W F K            
Sbjct: 335 HAKVVDDLVITLSFGPLPSECKIKVLRSTHGHFENCASNNIGKWVFDK-------ETPTG 387

Query: 402 AVPMKDSTLNIEQWPRPPISLKFEIVMFSNSGLVVRFFNVSERD------RNYKMVKWIK 455
            +P+    L  E   R  +      V ++N G +     V   D      +N K  K +K
Sbjct: 388 TLPVLRGCL--ENATREQVRALQLSVSYTNRGELPSGIKVDSVDILSGLSKNIKPFKGVK 445

Query: 456 YLSKSGAYEVR 466
           Y++K+G + +R
Sbjct: 446 YIAKTGDFHLR 456

>ZYRO0B01738g Chr2 complement(139975..141453) [1479 bp, 492 aa] {ON}
           similar to uniprot|P38153 Saccharomyces cerevisiae
           YBR288C APM3 Mu3-like subunit of the yeast AP-3 complex
           which functions in transport of alkaline phosphatase to
           the vacuole via the alternate pathway clathrin
           associated protein medium chain
          Length = 492

 Score = 57.8 bits (138), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 70/334 (20%), Positives = 138/334 (41%), Gaps = 75/334 (22%)

Query: 179 EAPSNIPWRMNGIKYKKNEVFLNVNERISILVS---KDGSI--LKSYVDGTVEATTHLSG 233
           E+   +PWR   +KY  +E+++++ E + ++     ++ S+  +   ++G V   ++LSG
Sbjct: 187 ESEEVVPWRSGHLKYTSDEIYVDIIETVHVIYQTHHRNNSVQMVSGTINGQVNVKSYLSG 246

Query: 234 MPVCRFGLNDALSVSTPFGDDDEYQVTNKKAIPKAAAGSVMLEDCKFHQCVQLDKFQSER 293
            P     ++                           AG+ M      HQCV++ +  S  
Sbjct: 247 NPTVEMDMD--------------------------LAGNEMYAP-SMHQCVEMPQ-GSPS 278

Query: 294 TINFIAPDGSFELMKYHVRENLNLPFKVTPIVTVVRS--------NSIDYQITIK-SLFP 344
           ++ FI PDG+  L+ Y +  ++N   KVT  V +V          N  ++++ +  S  P
Sbjct: 279 SLCFIPPDGNCNLLNYTIDLDMNPKVKVTSPVGLVSVIYKDGLGLNRDEFEVHVNISNSP 338

Query: 345 SKLTAKDVQLRIPVPPETV-----------SCHISTSNGKCKFVPEESAIVWKFSKYQGL 393
           S    +D++L+I + P                 + T   K +   E+  I        G 
Sbjct: 339 SVPHIQDLKLQIELQPRIQELEEQEEEAQRDAEMDTEAKKERSQLEDGKIKV-LRNTHGR 397

Query: 394 TENSIS-ATAVPMKDSTLNIEQWP---------RPPISLKFEIVMFSNSGLV-----VRF 438
            +NS+       + DS   +   P         + P+ ++   V ++N G++     +R 
Sbjct: 398 FDNSVHPGRGTWIFDSETPVGSLPVLRGCVEDSKHPVRIQRVGVSYANEGMLPSGIGLRR 457

Query: 439 FNV------SERDRNYKMVKWIKYLSKSGAYEVR 466
            NV       E +R  ++ K +KY+ ++G YE+R
Sbjct: 458 INVRSTTNLRENNRGKRLFKGVKYVCRTGDYEIR 491

>SAKL0A09218g Chr1 complement(802348..803734,803809..803843) [1422
           bp, 473 aa] {ON} similar to uniprot|P38153 Saccharomyces
           cerevisiae YBR288C APM3 Mu3-like subunit of the yeast
           AP-3 complex which functions in transport of alkaline
           phosphatase to the vacuole via the alternate pathway
           clathrin associated protein medium chain
          Length = 473

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 73/305 (23%), Positives = 122/305 (40%), Gaps = 57/305 (18%)

Query: 184 IPWRMNGIKYKKNEVFLNVNERISILVSKDGSI-----LKSYVDGTVEATTHLSGMPVCR 238
           +PWR  G+KY  NE+++++ E ++I+++K  +      +   +DG V    +LS  P+  
Sbjct: 204 VPWRSAGVKYTNNELYVDMAETVNIILAKTRNSTSLVPISGSIDGEVGFKCYLSENPLVE 263

Query: 239 FGLNDALSVSTPFGDDDEYQVTNKKAIPKAAAGSVMLEDCKFHQCVQLDKFQ-SERTINF 297
             LN                 TN   +   A          FH+CV+ +       T+ F
Sbjct: 264 LDLN-----------------TNGHDLGIPA----------FHRCVRTEGSDFHPGTLRF 296

Query: 298 IAPDGSFELMKYHVRENLNLPFKVTPIVTVVRSNSIDYQITIKSLFPSKLTAKDVQLRIP 357
           I PDG F LM+Y++  +L+       I++ +   S+DY      L P K    + ++++ 
Sbjct: 297 IPPDGDFCLMEYNI--DLDSLRNRNKILSNLGLVSVDYHT---GLGPKK---DEFEIKVT 348

Query: 358 VPPETVSCHISTSNGKCKFVP-EESAIVWKFSKYQGLTENSISATAVPMKDSTLNIEQWP 416
           V       H+        F P  E   +       G  EN I+       D    +  +P
Sbjct: 349 VALSRNVKHVEDLKIDVHFDPLREDGKIKILRNTHGGFENGINNKGTWTFDKETPVGVFP 408

Query: 417 ---------RPPISLKFEIVMFSN-----SGLVVRFFNV-SERDRNYKMVKWIKYLSKSG 461
                      P   K+  + +SN     SG+ V   N+ S      K  K +KY++K G
Sbjct: 409 VLRGCIEGCTEPTWPKYLSMSYSNKGQLPSGIRVNSVNILSGFPAGVKPFKGVKYITKIG 468

Query: 462 AYEVR 466
            Y VR
Sbjct: 469 DYVVR 473

>TBLA0I00620 Chr9 complement(110231..112060) [1830 bp, 609 aa] {ON}
           Anc_2.522 YBR288C
          Length = 609

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 55/236 (23%), Positives = 94/236 (39%), Gaps = 58/236 (24%)

Query: 115 LEDGLPVDTELSSVASKMSVKPNAGVDNFNMFAENGHGGTNRILPVSQFLRGRPSAGNLQ 174
           + D +PV  +LS V +  +      + N     + G G T  I   S  L G  +  N+ 
Sbjct: 178 IRDNVPVKKDLSKVITSTAHTIQRSIQN----VQTGGGSTRSI--TSNLLSGSNNTSNVS 231

Query: 175 DIASEAPSN---------------IPWRMNGIKYKKNEVFLNVNERISILVSKDGS---- 215
              +   +N               +PWR   +KY  NE++++V E I ++  +  S    
Sbjct: 232 ISGNGMGNNSSSGFGNSGTINNKVVPWRSGNVKYTNNEIYIDVIEEIHVVYQRRNSKRYH 291

Query: 216 --------------ILKSYVDGTVEATTHLSGMPVCRFGLNDA--LSVSTPFGDDDEYQV 259
                         ++++ + G +   ++LS  P+    L D       T + ++D ++ 
Sbjct: 292 KINQFNRNDNSPMKLIRADIIGELNVRSYLSDNPMVEVTLVDRNYSDQKTGWSENDLFKQ 351

Query: 260 TNKKAIPKAAAGSVMLEDCKFHQCVQLDK----FQSERTINFIAPDGSFELMKYHV 311
            N   +P             FH CV++D      Q  R I FI PDG F LMKY++
Sbjct: 352 LN-LGLP------------MFHDCVEIDYEKGINQDFRHIKFIPPDGKFSLMKYNI 394

>TPHA0C04130 Chr3 complement(886804..888405) [1602 bp, 533 aa] {ON}
           Anc_2.522 YBR288C
          Length = 533

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 38/153 (24%), Positives = 70/153 (45%), Gaps = 35/153 (22%)

Query: 174 QDIASEAPSNIPWRMNGIKYKKNEVFLNVNERISILVSKDGSILKSYVDGTVEATTH--- 230
           QD+  ++   +PWRM  + +  NE++L++ E I +++        SY + T++  T    
Sbjct: 192 QDMNFDSNVAVPWRMRNVDHVNNELYLDLVESIHVVLETKKR-KSSYANSTMKIVTGNII 250

Query: 231 --------LSGMPVCRFGLNDALSVSTPFGDDDEYQVTNKKAIPKAAAGSVMLEDCKFHQ 282
                   L+G P+    ++ A       G+D E               S+ L +C   +
Sbjct: 251 GKALVKSVLNGNPIVEMKIDMA-------GNDLE---------------SIFLHECVKSK 288

Query: 283 CVQLDK-FQSERTINFIAPDGSFELMKYHVREN 314
            V  D+ F++ + I F+ PDGSF+L  Y++  N
Sbjct: 289 DVDKDQEFENTKLIKFLPPDGSFKLFDYNINLN 321

>NCAS0A04870 Chr1 (973552..975021) [1470 bp, 489 aa] {ON} Anc_2.522
           YBR288C
          Length = 489

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 38/154 (24%), Positives = 62/154 (40%), Gaps = 55/154 (35%)

Query: 184 IPWRMNGIKYKKNEVFLNVNERISILVSK-------DG--------SILKSYVDGTVEAT 228
           +PWR NGIK  K E+++++ E + +   K       DG         ++  ++ GT++  
Sbjct: 189 VPWRRNGIKDAKEELYVDLKEEVYVTYRKSDRHHGRDGIRTSNPSMELVSGHIKGTIDVR 248

Query: 229 THLSGMPVCRFGLNDALSVSTPFGDDDEYQVTNKKAIPKAAAGSVMLEDCKFHQCV---- 284
            +L+G P          +VS  F       + N   IP             FH CV    
Sbjct: 249 CYLNGNP----------TVSLMFD-----TMGNDLGIP------------SFHACVEQED 281

Query: 285 ---------QLDKFQSERTINFIAPDGSFELMKY 309
                    + + FQ +R + F+ PDG F L +Y
Sbjct: 282 QVQEQKQEQEPESFQGKRLLRFLPPDGKFRLAQY 315

>Kpol_1018.42 s1018 (137162..138889) [1728 bp, 575 aa] {ON}
           (137162..138889) [1728 nt, 576 aa]
          Length = 575

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 40/160 (25%), Positives = 66/160 (41%), Gaps = 48/160 (30%)

Query: 173 LQDIA-SEAPSNIPWRMNGIKYKKNEVFLNVNERISILV------------SKDG--SIL 217
            QD +  E  +N PWR   +K+  NE+++++ E + ++             SK     I+
Sbjct: 189 FQDFSFQENKANAPWRSQNVKHNNNEIYIDLVESVHVVYQTKIRRSNELTRSKQSIKKIV 248

Query: 218 KSYVDGTVEATTHLSGMPVCRFGLNDALSVSTPFGDDDEYQVTNKKAIPKAAAGSVMLED 277
             Y+ GT    + L+G P+    L   LS     G+D                    +  
Sbjct: 249 NGYLKGTAYVQSFLNGNPLVELQL--ELS-----GND--------------------IGH 281

Query: 278 CKFHQCVQLDKF------QSERTINFIAPDGSFELMKYHV 311
             FH+CV +D++       S  ++ FI PDG F LM Y +
Sbjct: 282 PSFHECVDIDEYLKNIDNSSISSLKFIPPDGKFTLMDYTI 321

>NDAI0K01930 Chr11 (437535..439373) [1839 bp, 612 aa] {ON} Anc_2.522
           YBR288C
          Length = 612

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 51/232 (21%), Positives = 87/232 (37%), Gaps = 67/232 (28%)

Query: 184 IPWRMNGIKYKKNEVFLNVNERISI-----LVSKDG-------------------SILKS 219
           +PWR   IK  KNE+++++ E I +     + ++ G                    ++  
Sbjct: 259 VPWRNGNIKNAKNELYIDMKEDIHVNFRNQIKNRKGRTYDNNNSNGIRVNNPSCMKLMNG 318

Query: 220 YVDGTVEATTHLSGMPVCRFGLNDALSVSTPFGDDDEYQVTNKKAIPKAAAGSVMLEDCK 279
           Y+ G ++  ++L+G P+    LN                  N    P             
Sbjct: 319 YITGVIDVRSYLNGNPIVEMKLN---------------TCGNDMGTP------------S 351

Query: 280 FHQCVQL------DKFQSERTINFIAPDGSFELMKYHVRENLNLPFKVTPIVTVVRSNSI 333
            H CV+L      D  +   ++ FI PDG F L +Y V  N N           V  N+ 
Sbjct: 352 LHPCVELEGDMNGDDDKVMDSLKFIPPDGKFCLARYCVDLNKNNK-------NAVGVNNR 404

Query: 334 DYQITIKSLFPSKLTAK--DVQLRIPVPPETVSCHISTSNGKCKFVPEESAI 383
           D  + +   F + L  +  + ++R+ +   T+  HI     K KFV   SA+
Sbjct: 405 DIGL-VNVTFENGLGPQRDEFEVRLNIKGSTMVEHIEDLKLKLKFVLNHSAM 455

>YBR288C Chr2 complement(778012..779463) [1452 bp, 483 aa] {ON}
           APM3Mu3-like subunit of the clathrin associated protein
           complex (AP-3); functions in transport of alkaline
           phosphatase to the vacuole via the alternate pathway
          Length = 483

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 34/133 (25%), Positives = 57/133 (42%), Gaps = 32/133 (24%)

Query: 184 IPWRMN-GIKYKKNEVFLNVNERISILVSKDGS---ILKSYVDGTVEATTHLSGMPVCRF 239
           +PWR +   K++ NE+++++ E   ++  K  S   +L   + G V+  ++L+  P+   
Sbjct: 199 VPWRTSRASKHENNELYVDLLETFHVVFEKKKSHLRLLTGSIHGIVDVRSYLNDNPLVAV 258

Query: 240 GLNDALSVSTPFGDDDEYQVTNKKAIPKAAAGSVMLEDCKFHQCVQL-DKFQSERTINFI 298
            LN                + N   IP              H CV++ D   S   I FI
Sbjct: 259 KLN---------------TMGNDIGIPS------------LHDCVEINDGVFSPSNITFI 291

Query: 299 APDGSFELMKYHV 311
            PDG F L++Y V
Sbjct: 292 PPDGKFRLLEYSV 304

>Smik_2.430 Chr2 complement(763687..765141) [1455 bp, 484 aa] {ON}
           YBR288C (REAL)
          Length = 484

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 33/134 (24%), Positives = 59/134 (44%), Gaps = 33/134 (24%)

Query: 184 IPWRMN-GIKYKKNEVFLNVNERISILVSKDGS---ILKSYVDGTVEATTHLSGMPVCRF 239
           +PWR +   K++ NE++L++ E   ++  K  S   ++   + GT++  ++L+  P+   
Sbjct: 199 VPWRTSRASKHENNELYLDLLETFHVVFEKKKSHIRLVNGNIHGTLDVRSYLNDTPLVLV 258

Query: 240 GLNDALSVSTPFGDDDEYQVTNKKAIPKAAAGSVMLEDCKFHQCVQLDKFQ--SERTINF 297
            LN                + N   IP              H+CV+++     S   I F
Sbjct: 259 KLN---------------TMGNDIGIPS------------LHECVEINDGGVFSPSNITF 291

Query: 298 IAPDGSFELMKYHV 311
           I PDG F L++Y V
Sbjct: 292 IPPDGKFRLLEYCV 305

>Suva_4.548 Chr4 complement(950244..951698) [1455 bp, 484 aa] {ON}
           YBR288C (REAL)
          Length = 484

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 43/171 (25%), Positives = 76/171 (44%), Gaps = 41/171 (23%)

Query: 169 SAGNLQDIASEAPSNIPWRMNGI-KYKKNEVFLNVNERISILVSKDGSILK---SYVDGT 224
           S GN+  +  E    +PWR +   K++ NE+++++ E   +++ K  + L+     + G 
Sbjct: 186 SRGNISLVEDEDI--VPWRTSKTSKHENNELYVDLLETFHVVLEKKKTRLRLVNGDICGA 243

Query: 225 VEATTHLSGMPVCRFGLNDALSVSTPFGDDDEYQVTNKKAIPKAAAGSVMLEDCKFHQCV 284
           V+  ++L+  P+    LN                + N+  IP              H+CV
Sbjct: 244 VDVRSYLNDNPLVSVKLN---------------TMGNEIGIPS------------LHECV 276

Query: 285 QL--DKFQSERTINFIAPDGSFELMKYHVRENLNLPFKVTPIVTVVRSNSI 333
           ++  D   +   I FI PDG F L++Y +  NL+   K + I    R NSI
Sbjct: 277 EINDDGEFTPSNITFIPPDGKFRLLEYSI--NLDSQLKKSGI----RMNSI 321

>Skud_2.419 Chr2 complement(746943..748397) [1455 bp, 484 aa] {ON}
           YBR288C (REAL)
          Length = 484

 Score = 39.3 bits (90), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 33/135 (24%), Positives = 58/135 (42%), Gaps = 35/135 (25%)

Query: 184 IPWRMN-GIKYKKNEVFLNVNERISILVSKDGSILK---SYVDGTVEATTHLSGMPVCRF 239
           +PWR +   K++ NE+++++ E   ++     S L+     + GTV+  ++L+  P+   
Sbjct: 199 VPWRTSKASKHENNELYVDLLETFHVVFETKKSRLRLVNGNIHGTVDVRSYLNNNPLVSV 258

Query: 240 GLNDALSVSTPFGDDDEYQVTNKKAIPKAAAGSVMLEDCKFHQCVQLDKFQSE---RTIN 296
            LN                + N   +P              H+CV++ K   E     I 
Sbjct: 259 KLN---------------TMGNDIGVPT------------LHECVEI-KDDGEFLPSNIT 290

Query: 297 FIAPDGSFELMKYHV 311
           FI PDG F L++Y V
Sbjct: 291 FIPPDGKFRLLEYSV 305

>Ecym_7266 Chr7 (559988..560022,560112..561630) [1554 bp, 517 aa]
           {ON} similar to Ashbya gossypii AGL061W
          Length = 517

 Score = 39.3 bits (90), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 55/279 (19%), Positives = 104/279 (37%), Gaps = 56/279 (20%)

Query: 54  FHHIKSAKNLWIVAVSRSNADSAAIWEFLYRLNELL-EAFN---------LYSENELKER 103
           + H  S   L+  A+     D      FL R + LL E F+         + +++ L   
Sbjct: 57  YGHFSSVNRLYYWALCEQCDDPLKPLVFLSRFDGLLMEYFDRDVLTATKLMNNQDRLALL 116

Query: 104 FMICYELLDIVLEDG------LPVDTELSSVASKMSVKPNAGVDNFNMFAENGHGGTNRI 157
                +  +IV+ D       LP+ T+LS+V S  +      + N    + N  G +N  
Sbjct: 117 LNSIIDAGEIVMSDTNKLRYLLPLHTDLSTVFSSATKTLTRTIKNRE--SSNFLGSSN-- 172

Query: 158 LPVSQFLRGRPSAGNLQDIASEAPSNIPWRMNGIKYKKNEVFLNVNERISILVSKDG--- 214
              S  + G P+     D   +A   +PWR+  +    NE+++++ E +++ + +     
Sbjct: 173 ---SSNINGGPTINRSSDSPLDAQV-VPWRIPNLSNVNNEIYVDMVETLTLNLKQSRPNS 228

Query: 215 -SILKSYVDGTVEATTHLSGMPVCRFGLNDALSVSTPFGDDDEYQVTNKKAIPKAAAGSV 273
             +    + G ++   +L G P  +  L+ A     P                       
Sbjct: 229 FHVFHGVISGKIDLKCYLRGNPTMQINLHSAGHAFKP----------------------- 265

Query: 274 MLEDCKFHQCVQ-LDKFQSERTINFIAPDGSFELMKYHV 311
                  H+C+          ++ FI PDG F L++Y +
Sbjct: 266 ----SALHRCLDPSSSSFDSSSLRFIPPDGKFTLLEYTI 300

>CAGL0L02145g Chr12 (252110..253741) [1632 bp, 543 aa] {ON} similar
           to uniprot|P38153 Saccharomyces cerevisiae YBR288c APM3
           AP-3 complex subunit mu3 subunit
          Length = 543

 Score = 37.0 bits (84), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 45/188 (23%), Positives = 69/188 (36%), Gaps = 58/188 (30%)

Query: 185 PWRMNG--IKYKKNEVFLNVNERISILVSKDGS-------------------ILKSYVDG 223
           PWR NG  I   +NE++ +V E I ++  K  S                    ++  + G
Sbjct: 226 PWR-NGKNIHNDRNELYADVREVIQVVYQKKYSSKKNDSRRKIFGRRSGHLEYVRGNISG 284

Query: 224 TVEATTHLSGMPVCRFGLNDA-LSVSTPFGDDDEYQVTNKKAIPKAAAGSVMLEDCKFHQ 282
           +V+    L+G P+    L    L +  P                             FH 
Sbjct: 285 SVDMRCFLTGNPLVEIALKQGGLDIGIP----------------------------GFHD 316

Query: 283 CVQ---LDKFQSERTINFIAPDGSFELMKYHVRENLNLPFKVTPIVTVVRSNSIDYQITI 339
           CV    L K +    ++FI PDG F LM+Y    N+NL       V +V ++  D+  T+
Sbjct: 317 CVDKTSLLKQEKISKLSFIPPDGRFTLMQY----NINLDQGKRHSVGLVHADIEDHLGTL 372

Query: 340 KSLFPSKL 347
              F   L
Sbjct: 373 GDEFEVTL 380

>Kwal_55.21751 s55 (964248..964487) [240 bp, 79 aa] {OFF} [contig
           126] FULL
          Length = 79

 Score = 32.7 bits (73), Expect = 0.28,   Method: Composition-based stats.
 Identities = 15/50 (30%), Positives = 31/50 (62%), Gaps = 3/50 (6%)

Query: 79  WEFLYRLNELLEAFNLYSENELKERFMICYEL---LDIVLEDGLPVDTEL 125
           W F++R ++ L++++    + L  +F+ CY+L   LDI  ++G  + +EL
Sbjct: 29  WAFVHRYHQNLQSYHQMQSSTLLPQFLCCYQLGVALDISAKNGSKLVSEL 78

>KNAG0A06970 Chr1 complement(1086674..1088191) [1518 bp, 505 aa]
           {ON} Anc_2.522 YBR288C
          Length = 505

 Score = 34.3 bits (77), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 30/145 (20%), Positives = 49/145 (33%), Gaps = 45/145 (31%)

Query: 184 IPWRMNGIKYKKNEVFLN------------VNERISILVSKDGSILKSYVDGTVEATTHL 231
           +PWR   +  ++NE +++             +   S        ++   + G V+   +L
Sbjct: 206 VPWRSAKVNSRRNEFYVDVRESVEVVVERAAHRSTSRGTPAPLQLVTGCITGVVDCRCYL 265

Query: 232 SGMPVCRFGLND-ALSVSTPFGDDDEYQVTNKKAIPKAAAGSVMLEDCKFHQCVQLDKF- 289
           S  P+     N+    + TP                              H CV+LD   
Sbjct: 266 SRDPIVEVTFNNHGCDLGTP----------------------------ALHDCVELDGVP 297

Query: 290 ---QSERTINFIAPDGSFELMKYHV 311
                  T+ FI PDG F LM+Y V
Sbjct: 298 EGPADHTTLKFIPPDGKFRLMEYSV 322

>KAFR0A07760 Chr1 complement(1560351..1561628) [1278 bp, 425 aa]
           {ON} Anc_2.44 YNL207W
          Length = 425

 Score = 33.1 bits (74), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 21/85 (24%), Positives = 40/85 (47%), Gaps = 14/85 (16%)

Query: 1   MLNALFIYSLRGELLISKHVKGSVQKSMSEIFRIQVINNLDVRSPVLTLGSTTFHHIKSA 60
           MLN   +YS+ G + + K          S+I+R+   N  +    +  LG T+FH +K+ 
Sbjct: 88  MLNRETVYSVGGTIGVGKE---------SDIYRVSDRNGTEKVMKIHRLGRTSFHTVKNK 138

Query: 61  KNLWIVAVSRSNADSAAIWEFLYRL 85
           ++       + NA +   W +L ++
Sbjct: 139 RDYI-----KKNAKNGVNWMYLSKI 158

>Suva_7.39 Chr7 complement(74084..75340) [1257 bp, 418 aa] {ON}
           YGL223C (REAL)
          Length = 418

 Score = 31.6 bits (70), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 23/104 (22%), Positives = 44/104 (42%), Gaps = 5/104 (4%)

Query: 357 PVPPETVSCHIST--SNGKCKFVPEESAIVWKFSKYQGLTENSISATAVPMK---DSTLN 411
           P+P    + HIS   +      VP+   ++  ++       N IS +  P +   D  LN
Sbjct: 83  PLPHHQTAAHISPIGTEDTASIVPQNILVISNWTISINNFCNRISTSTTPSRIFDDLLLN 142

Query: 412 IEQWPRPPISLKFEIVMFSNSGLVVRFFNVSERDRNYKMVKWIK 455
             +     +   FE ++ S    + RF   S +  N+ +++W+K
Sbjct: 143 FHELSLTSVPTTFETLIKSKCYQLQRFLVDSMKTLNFTLLQWVK 186

>Skud_7.48 Chr7 complement(84359..85615) [1257 bp, 418 aa] {ON}
           YGL223C (REAL)
          Length = 418

 Score = 31.6 bits (70), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 23/104 (22%), Positives = 47/104 (45%), Gaps = 5/104 (4%)

Query: 357 PVPPETVSCHISTSNGKCKF-VPEESAIV---WKFSKYQGLTENSISATAVPMKDSTL-N 411
           P+PP +++ H+S    +    +P ++ +V   W  S        + S T   + D  L N
Sbjct: 83  PLPPRSITTHVSPLGSEVAVTIPPQNILVISNWTISISNFCNRVATSTTPSRIFDELLLN 142

Query: 412 IEQWPRPPISLKFEIVMFSNSGLVVRFFNVSERDRNYKMVKWIK 455
             +     +  KFEI++ +    + +F   S    N+ +++W+K
Sbjct: 143 FHELSLTSVPTKFEILIGNKCYQLQKFLVDSMSALNFTLLQWVK 186

>KNAG0A02270 Chr1 complement(206190..206609) [420 bp, 139 aa] {ON}
           Anc_8.485 YPL037C
          Length = 139

 Score = 30.0 bits (66), Expect = 5.9,   Method: Composition-based stats.
 Identities = 21/69 (30%), Positives = 30/69 (43%), Gaps = 12/69 (17%)

Query: 121 VDTELSSVASKMSVKPNAGVDNFNMFAENGHGGTNRILPVSQ----------FLRGRPSA 170
           VD +LS    K+   P  G++  N+F ENG+       PV +           + G+PS 
Sbjct: 36  VDAKLSEHLLKLDAVPLQGIEEANLFFENGN--VLNFQPVEKVECAADYNVSMIHGKPST 93

Query: 171 GNLQDIASE 179
             L DI  E
Sbjct: 94  KKLDDILQE 102

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.134    0.389 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 49,419,659
Number of extensions: 2168322
Number of successful extensions: 6283
Number of sequences better than 10.0: 95
Number of HSP's gapped: 6187
Number of HSP's successfully gapped: 123
Length of query: 467
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 354
Effective length of database: 40,524,141
Effective search space: 14345545914
Effective search space used: 14345545914
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)