Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_33.141773.161ON33733717300.0
KLTH0F06490g3.161ON39133716890.0
SAKL0C07370g3.161ON39133716610.0
TDEL0D046103.161ON39133716470.0
CAGL0K01595g3.161ON39133716360.0
KLLA0C03850g3.161ON39133716320.0
Kpol_479.253.161ON39133716310.0
Suva_4.2203.161ON39133716210.0
NDAI0G029003.161ON39133716200.0
KAFR0C01040na 1ON33733716130.0
Skud_4.2223.161ON39133716180.0
KNAG0K01130na 1ON39333716160.0
YDL029W (ARP2)3.161ON39133716150.0
Smik_4.2063.161ON39133716050.0
Ecym_52373.161ON39133716040.0
TPHA0A009203.161ON39133716030.0
NCAS0C035503.161ON39233716030.0
TBLA0F008703.161ON39133715910.0
ADR316W3.161ON39133715850.0
ZYRO0B04928g3.161ON39133715750.0
NDAI0G030408.23ON3753267653e-99
NCAS0C037008.23ON3753267645e-99
Skud_6.318.23ON3603267617e-99
TDEL0C004708.23ON3753267628e-99
CAGL0K12694g8.23ON3753267628e-99
Suva_6.188.23ON3753267628e-99
Smik_6.398.23ON3753267628e-99
YFL039C (ACT1)8.23ON3753267628e-99
KNAG0L002508.23ON3753267628e-99
KAFR0D009408.23ON3753267628e-99
TPHA0D002508.23ON3753267621e-98
Ecym_15208.23ON3763267611e-98
TBLA0C004408.23ON3753267602e-98
ABR222W8.23ON3763267592e-98
ZYRO0F02772g8.23ON3753267593e-98
Kpol_1058.158.23ON3753267574e-98
Kwal_14.11098.23ON3603267555e-98
SAKL0B00968g8.23ON3753267576e-98
KLLA0D05357g8.23ON3753267566e-98
KLTH0G18832g8.23ON3753267568e-98
SAKL0E11814g2.117ON3793356611e-83
AFR051W2.117ON4053356422e-80
Ecym_63852.117ON3773386332e-79
KLTH0B05940g2.117ON3833376185e-77
KLLA0E22925g2.117ON3803396151e-76
Kpol_1023.188.23ON3192415911e-73
NCAS0B071302.117ON3813265812e-71
ZYRO0G05676g2.117ON3813375768e-71
Kwal_33.146422.117ON3833385733e-70
TBLA0B010702.117ON3833385707e-70
KAFR0F005902.117ON3863355612e-68
YHR129C (ARP1)2.117ON3843265455e-66
TDEL0B048102.117ON3733265411e-65
NDAI0B044602.117ON3813305402e-65
Suva_15.3262.117ON3843265352e-64
Smik_8.2102.117ON3843265272e-63
TPHA0I013002.117ON3793355245e-63
Skud_8.1902.117ON3843355193e-62
KNAG0H036502.117ON3873434985e-59
Kwal_27.99581.514ON4453544073e-45
KLTH0C02508g1.514ON4513544041e-44
CAGL0H09042g2.117ON3873273992e-44
SAKL0D12804g1.514ON4563544014e-44
KNAG0B001701.514ON4533544005e-44
Kpol_1056.161.514ON4603543971e-43
TPHA0O010401.514ON4583533944e-43
AFR419C1.514ON4553543944e-43
KLLA0B13904g1.514ON4563543934e-43
NDAI0A039701.514ON4623563935e-43
TBLA0D036801.514ON4583533926e-43
KAFR0D037001.514ON4493543901e-42
YJR065C (ARP3)1.514ON4493543901e-42
Ecym_31531.514ON4583533901e-42
TDEL0F004701.514ON4613533902e-42
Smik_10.3551.514ON4493543892e-42
Skud_10.2891.514ON4493533882e-42
NCAS0A122701.514ON4543543865e-42
CAGL0F00517g1.514ON4543543866e-42
Suva_12.1541.514ON4493543848e-42
ZYRO0G01936g1.514ON4613533841e-41
KLLA0F19063g8.258ON4153221877e-15
TDEL0F038508.258ON4193181833e-14
SAKL0H17138g8.258ON4193071752e-13
ZYRO0C01738g8.258ON4142961734e-13
NDAI0G055801.287ON5151321727e-13
Kwal_56.238328.258ON4193281682e-12
TPHA0A018308.258ON4213081672e-12
KLTH0G13772g8.258ON4203191673e-12
KNAG0B019201.287ON5051311673e-12
Suva_6.1541.287ON4891601664e-12
Kpol_543.368.258ON4273131656e-12
KAFR0B027008.258ON4203121631e-11
NCAS0B060601.287ON4972541631e-11
YJL081C (ARP4)1.287ON4891601621e-11
Skud_10.1321.287ON4881211612e-11
TPHA0I010301.287ON5031121602e-11
Smik_12.1448.258ON4383201602e-11
TBLA0D053601.287ON5961471602e-11
AGR091W8.258ON4103001593e-11
NCAS0B049908.258ON4203021584e-11
Ecym_43128.258ON4113091574e-11
NDAI0B019608.258ON4391901575e-11
Smik_10.1611.287ON4892271576e-11
KNAG0G020108.258ON4243241567e-11
KAFR0A015601.287ON4851221568e-11
AFR105C1.287ON4791221559e-11
CAGL0L12166g8.258ON4213001551e-10
Skud_12.1538.258ON4381801541e-10
KLTH0H09702g1.287ON4811361532e-10
YLR085C (ARP6)8.258ON4381801522e-10
CAGL0M03201g1.287ON4931271496e-10
Kpol_282.41.287ON5011361471e-09
Suva_10.1698.258ON4381801461e-09
KLLA0D02288g1.287ON5201301452e-09
ZYRO0G21428g1.287ON4831131434e-09
Ecym_63301.287ON4801191391e-08
Kwal_14.23771.287ON4811241381e-08
TBLA0H014608.258ON4421881372e-08
SAKL0D05874g1.287ON4971151354e-08
TDEL0D015501.287ON4801271345e-08
ZYRO0A01584g2.248ON7481381256e-07
TPHA0C031602.248ON7551331212e-06
Suva_14.2812.248ON7551741212e-06
Skud_14.2722.248ON7551741168e-06
Smik_14.2672.248ON7551811141e-05
YNL059C (ARP5)2.248ON7551811105e-05
KNAG0I018602.248ON7531431096e-05
NDAI0D010602.248ON7531381096e-05
KLTH0G09482g2.248ON7451781071e-04
TDEL0C041402.248ON7491331071e-04
NCAS0G030502.248ON7431821052e-04
CAGL0J10054g2.248ON7541441042e-04
TBLA0E038602.248ON7591471033e-04
KAFR0J011602.248ON7511761016e-04
Kpol_1003.162.248ON74972980.001
Ecym_32852.248ON746133970.002
KLLA0F03421g2.248ON747149960.002
Kwal_23.48482.248ON745232960.003
SAKL0H17358g8.251ON311250930.004
ADL253C2.248ON75177920.007
SAKL0E08602g2.248ON747133890.017
KLLA0F11913g8.251ON25398840.047
Kpol_543.105.477ON876201840.075
Kpol_520.117.448ON488281820.11
TBLA0H028002.593ON484302800.17
Skud_15.3045.477ON883153800.19
Ecym_35058.251ON305223780.25
Suva_13.2022.593ON467237780.34
SAKL0F13772g7.448ON42292770.39
TPHA0N014302.593ON472194770.43
KLTH0D08624g2.593ON432234770.43
KAFR0K021507.448ON490115741.0
Smik_15.3205.477ON873128741.2
YOR141C (ARP8)5.477ON88187731.6
Ecym_23115.477ON775150731.6
Ecym_63812.121ON12768682.2
NCAS0A147207.448ON485129702.9
KLTH0B07502g2.54ON999106694.7
CAGL0F05907g2.593ON462190685.7
KAFR0E025305.477ON842100677.5
NDAI0A013007.448ON565129678.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_33.14177
         (337 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_33.14177 s33 complement(557522..558535) [1014 bp, 337 aa] {...   671   0.0  
KLTH0F06490g Chr6 complement(561947..563100,563192..563213) [117...   655   0.0  
SAKL0C07370g Chr3 complement(680403..681556,681672..681693) [117...   644   0.0  
TDEL0D04610 Chr4 complement(846092..847245,847317..847338) [1176...   639   0.0  
CAGL0K01595g Chr11 (141618..141639,141971..143124) [1176 bp, 391...   634   0.0  
KLLA0C03850g Chr3 complement(351772..352947) [1176 bp, 391 aa] {...   633   0.0  
Kpol_479.25 s479 complement(49227..50402) [1176 bp, 391 aa] {ON}...   632   0.0  
Suva_4.220 Chr4 (389822..389843,389967..391120) [1176 bp, 391 aa...   629   0.0  
NDAI0G02900 Chr7 (671423..671444,671694..672847) [1176 bp, 391 a...   628   0.0  
KAFR0C01040 Chr3 complement(212570..213583) [1014 bp, 337 aa] {O...   625   0.0  
Skud_4.222 Chr4 (394174..394195,394321..395474) [1176 bp, 391 aa...   627   0.0  
KNAG0K01130 Chr11 (220520..220541,220822..221981) [1182 bp, 393 ...   627   0.0  
YDL029W Chr4 (399340..399361,399485..400638) [1176 bp, 391 aa] {...   626   0.0  
Smik_4.206 Chr4 (379506..379527,379652..380805) [1176 bp, 391 aa...   622   0.0  
Ecym_5237 Chr5 complement(489181..490356) [1176 bp, 391 aa] {ON}...   622   0.0  
TPHA0A00920 Chr1 (181205..182380) [1176 bp, 391 aa] {ON} Anc_2.1...   622   0.0  
NCAS0C03550 Chr3 (709102..709123,709273..710429) [1179 bp, 392 a...   622   0.0  
TBLA0F00870 Chr6 complement(222947..224100,224325..224346) [1176...   617   0.0  
ADR316W Chr4 (1261691..1262866) [1176 bp, 391 aa] {ON} Syntenic ...   615   0.0  
ZYRO0B04928g Chr2 complement(398291..399444,399538..399559) [117...   611   0.0  
NDAI0G03040 Chr7 complement(708715..709832,710590..710599) [1128...   299   3e-99
NCAS0C03700 Chr3 complement(745133..746250,746901..746910) [1128...   298   5e-99
Skud_6.31 Chr6 complement(56454..57536) [1083 bp, 360 aa] {ON} Y...   297   7e-99
TDEL0C00470 Chr3 complement(72546..73663,73929..73938) [1128 bp,...   298   8e-99
CAGL0K12694g Chr11 (1258451..1258460,1259340..1260457) [1128 bp,...   298   8e-99
Suva_6.18 Chr6 complement(26677..27794,28152..28161) [1128 bp, 3...   298   8e-99
Smik_6.39 Chr6 complement(68673..69790,70076..70085) [1128 bp, 3...   298   8e-99
YFL039C Chr6 complement(53260..54377,54687..54696) [1128 bp, 375...   298   8e-99
KNAG0L00250 Chr12 complement(32595..33712,34194..34203) [1128 bp...   298   8e-99
KAFR0D00940 Chr4 complement(198280..199397,199945..199954) [1128...   298   8e-99
TPHA0D00250 Chr4 complement(34030..35147,35712..35721) [1128 bp,...   298   1e-98
Ecym_1520 Chr1 (1071497..1071506,1072543..1073663) [1131 bp, 376...   297   1e-98
TBLA0C00440 Chr3 complement(81591..82708,83412..83421) [1128 bp,...   297   2e-98
ABR222W Chr2 (818719..818728,819032..820152) [1131 bp, 376 aa] {...   296   2e-98
ZYRO0F02772g Chr6 complement(235322..236439,236524..236533) [112...   296   3e-98
Kpol_1058.15 s1058 complement(49082..50199,50349..50358) [1128 b...   296   4e-98
Kwal_14.1109 s14 complement(199181..200263) [1083 bp, 360 aa] {O...   295   5e-98
SAKL0B00968g Chr2 complement(89966..91083,91524..91533) [1128 bp...   296   6e-98
KLLA0D05357g Chr4 (461726..461735,462516..463633) [1128 bp, 375 ...   295   6e-98
KLTH0G18832g Chr7 (1626178..1626187,1626854..1627971) [1128 bp, ...   295   8e-98
SAKL0E11814g Chr5 complement(984199..985338) [1140 bp, 379 aa] {...   259   1e-83
AFR051W Chr6 (522829..524046) [1218 bp, 405 aa] {ON} Syntenic ho...   251   2e-80
Ecym_6385 Chr6 complement(749508..750641) [1134 bp, 377 aa] {ON}...   248   2e-79
KLTH0B05940g Chr2 complement(485135..486286) [1152 bp, 383 aa] {...   242   5e-77
KLLA0E22925g Chr5 complement(2040279..2041421) [1143 bp, 380 aa]...   241   1e-76
Kpol_1023.18 s1023 complement(36072..36143,36193..36201,36244..3...   232   1e-73
NCAS0B07130 Chr2 complement(1354064..1355209) [1146 bp, 381 aa] ...   228   2e-71
ZYRO0G05676g Chr7 (452257..453402) [1146 bp, 381 aa] {ON} simila...   226   8e-71
Kwal_33.14642 s33 (753758..754909) [1152 bp, 383 aa] {ON} YHR129...   225   3e-70
TBLA0B01070 Chr2 (236811..237962) [1152 bp, 383 aa] {ON} Anc_2.1...   224   7e-70
KAFR0F00590 Chr6 (120359..121519) [1161 bp, 386 aa] {ON} Anc_2.1...   220   2e-68
YHR129C Chr8 complement(362999..364153) [1155 bp, 384 aa] {ON}  ...   214   5e-66
TDEL0B04810 Chr2 (849529..850650) [1122 bp, 373 aa] {ON} Anc_2.1...   213   1e-65
NDAI0B04460 Chr2 complement(1115478..1116623) [1146 bp, 381 aa] ...   212   2e-65
Suva_15.326 Chr15 complement(565392..566546) [1155 bp, 384 aa] {...   210   2e-64
Smik_8.210 Chr8 complement(339093..340247) [1155 bp, 384 aa] {ON...   207   2e-63
TPHA0I01300 Chr9 (295950..297089) [1140 bp, 379 aa] {ON} Anc_2.1...   206   5e-63
Skud_8.190 Chr8 complement(336365..337519) [1155 bp, 384 aa] {ON...   204   3e-62
KNAG0H03650 Chr8 complement(678598..679761) [1164 bp, 387 aa] {O...   196   5e-59
Kwal_27.9958 s27 (139638..140975) [1338 bp, 445 aa] {ON} YJR065C...   161   3e-45
KLTH0C02508g Chr3 (224722..226077) [1356 bp, 451 aa] {ON} highly...   160   1e-44
CAGL0H09042g Chr8 (884592..885755) [1164 bp, 387 aa] {ON} simila...   158   2e-44
SAKL0D12804g Chr4 complement(1066058..1067428) [1371 bp, 456 aa]...   159   4e-44
KNAG0B00170 Chr2 (18478..19839) [1362 bp, 453 aa] {ON} Anc_1.514...   158   5e-44
Kpol_1056.16 s1056 (36274..37656) [1383 bp, 460 aa] {ON} (36274....   157   1e-43
TPHA0O01040 Chr15 (196178..197554) [1377 bp, 458 aa] {ON} Anc_1....   156   4e-43
AFR419C Chr6 complement(1186951..1188318) [1368 bp, 455 aa] {ON}...   156   4e-43
KLLA0B13904g Chr2 complement(1218228..1219598) [1371 bp, 456 aa]...   155   4e-43
NDAI0A03970 Chr1 (895219..896607) [1389 bp, 462 aa] {ON} Anc_1.514    155   5e-43
TBLA0D03680 Chr4 (914687..916063) [1377 bp, 458 aa] {ON} Anc_1.5...   155   6e-43
KAFR0D03700 Chr4 complement(718438..719787) [1350 bp, 449 aa] {O...   154   1e-42
YJR065C Chr10 complement(557809..559158) [1350 bp, 449 aa] {ON} ...   154   1e-42
Ecym_3153 Chr3 (288213..289589) [1377 bp, 458 aa] {ON} similar t...   154   1e-42
TDEL0F00470 Chr6 (80760..82145) [1386 bp, 461 aa] {ON} Anc_1.514...   154   2e-42
Smik_10.355 Chr10 complement(546673..548022) [1350 bp, 449 aa] {...   154   2e-42
Skud_10.289 Chr10 complement(515300..516649) [1350 bp, 449 aa] {...   154   2e-42
NCAS0A12270 Chr1 complement(2428834..2430198) [1365 bp, 454 aa] ...   153   5e-42
CAGL0F00517g Chr6 (54743..56107) [1365 bp, 454 aa] {ON} highly s...   153   6e-42
Suva_12.154 Chr12 complement(235605..236954) [1350 bp, 449 aa] {...   152   8e-42
ZYRO0G01936g Chr7 complement(144085..145470) [1386 bp, 461 aa] {...   152   1e-41
KLLA0F19063g Chr6 complement(1756529..1757776) [1248 bp, 415 aa]...    77   7e-15
TDEL0F03850 Chr6 complement(707880..709139) [1260 bp, 419 aa] {O...    75   3e-14
SAKL0H17138g Chr8 (1515123..1516382) [1260 bp, 419 aa] {ON} high...    72   2e-13
ZYRO0C01738g Chr3 (135066..136310) [1245 bp, 414 aa] {ON} simila...    71   4e-13
NDAI0G05580 Chr7 complement(1374852..1376399) [1548 bp, 515 aa] ...    71   7e-13
Kwal_56.23832 s56 (726199..727458) [1260 bp, 419 aa] {ON} YLR085...    69   2e-12
TPHA0A01830 Chr1 (369897..371162) [1266 bp, 421 aa] {ON} Anc_8.2...    69   2e-12
KLTH0G13772g Chr7 (1188875..1190137) [1263 bp, 420 aa] {ON} simi...    69   3e-12
KNAG0B01920 Chr2 complement(362300..363817) [1518 bp, 505 aa] {O...    69   3e-12
Suva_6.154 Chr6 (266531..268000) [1470 bp, 489 aa] {ON} YJL081C ...    69   4e-12
Kpol_543.36 s543 complement(80922..82205) [1284 bp, 427 aa] {ON}...    68   6e-12
KAFR0B02700 Chr2 complement(543626..544888) [1263 bp, 420 aa] {O...    67   1e-11
NCAS0B06060 Chr2 complement(1146248..1147741) [1494 bp, 497 aa] ...    67   1e-11
YJL081C Chr10 complement(283802..285271) [1470 bp, 489 aa] {ON} ...    67   1e-11
Skud_10.132 Chr10 complement(251748..253214) [1467 bp, 488 aa] {...    67   2e-11
TPHA0I01030 Chr9 complement(236150..237661) [1512 bp, 503 aa] {O...    66   2e-11
Smik_12.144 Chr12 complement(280513..281829) [1317 bp, 438 aa] {...    66   2e-11
TBLA0D05360 Chr4 (1321243..1323033) [1791 bp, 596 aa] {ON} Anc_1...    66   2e-11
AGR091W Chr7 (907238..908470) [1233 bp, 410 aa] {ON} Syntenic ho...    66   3e-11
NCAS0B04990 Chr2 complement(916170..917432) [1263 bp, 420 aa] {O...    65   4e-11
Ecym_4312 Chr4 (671413..672648) [1236 bp, 411 aa] {ON} similar t...    65   4e-11
NDAI0B01960 Chr2 complement(477552..478871) [1320 bp, 439 aa] {O...    65   5e-11
Smik_10.161 Chr10 complement(275455..276924) [1470 bp, 489 aa] {...    65   6e-11
KNAG0G02010 Chr7 complement(447621..448895) [1275 bp, 424 aa] {O...    65   7e-11
KAFR0A01560 Chr1 complement(311746..313203) [1458 bp, 485 aa] {O...    65   8e-11
AFR105C Chr6 complement(625098..626537) [1440 bp, 479 aa] {ON} S...    64   9e-11
CAGL0L12166g Chr12 complement(1308681..1309946) [1266 bp, 421 aa...    64   1e-10
Skud_12.153 Chr12 complement(284046..285362) [1317 bp, 438 aa] {...    64   1e-10
KLTH0H09702g Chr8 complement(835255..836700) [1446 bp, 481 aa] {...    64   2e-10
YLR085C Chr12 complement(300673..301989) [1317 bp, 438 aa] {ON} ...    63   2e-10
CAGL0M03201g Chr13 complement(364771..366252) [1482 bp, 493 aa] ...    62   6e-10
Kpol_282.4 s282 (8483..9988) [1506 bp, 501 aa] {ON} (8483..9988)...    61   1e-09
Suva_10.169 Chr10 complement(305734..307050) [1317 bp, 438 aa] {...    61   1e-09
KLLA0D02288g Chr4 complement(194724..196286) [1563 bp, 520 aa] {...    60   2e-09
ZYRO0G21428g Chr7 (1766725..1768176) [1452 bp, 483 aa] {ON} high...    60   4e-09
Ecym_6330 Chr6 (632900..634342) [1443 bp, 480 aa] {ON} similar t...    58   1e-08
Kwal_14.2377 s14 complement(733179..734624) [1446 bp, 481 aa] {O...    58   1e-08
TBLA0H01460 Chr8 complement(323962..325290) [1329 bp, 442 aa] {O...    57   2e-08
SAKL0D05874g Chr4 complement(479873..481366) [1494 bp, 497 aa] {...    57   4e-08
TDEL0D01550 Chr4 complement(305973..307415) [1443 bp, 480 aa] {O...    56   5e-08
ZYRO0A01584g Chr1 complement(130119..132365) [2247 bp, 748 aa] {...    53   6e-07
TPHA0C03160 Chr3 complement(699424..701691) [2268 bp, 755 aa] {O...    51   2e-06
Suva_14.281 Chr14 complement(511583..513850) [2268 bp, 755 aa] {...    51   2e-06
Skud_14.272 Chr14 complement(502920..505187) [2268 bp, 755 aa] {...    49   8e-06
Smik_14.267 Chr14 complement(493008..495275) [2268 bp, 755 aa] {...    49   1e-05
YNL059C Chr14 complement(512668..514935) [2268 bp, 755 aa] {ON} ...    47   5e-05
KNAG0I01860 Chr9 (364390..366651) [2262 bp, 753 aa] {ON} Anc_2.2...    47   6e-05
NDAI0D01060 Chr4 complement(238631..240892) [2262 bp, 753 aa] {O...    47   6e-05
KLTH0G09482g Chr7 complement(789233..791470) [2238 bp, 745 aa] {...    46   1e-04
TDEL0C04140 Chr3 (732580..734829) [2250 bp, 749 aa] {ON} Anc_2.2...    46   1e-04
NCAS0G03050 Chr7 complement(560525..562756) [2232 bp, 743 aa] {O...    45   2e-04
CAGL0J10054g Chr10 complement(985402..987666) [2265 bp, 754 aa] ...    45   2e-04
TBLA0E03860 Chr5 complement(969721..972000) [2280 bp, 759 aa] {O...    44   3e-04
KAFR0J01160 Chr10 (212425..214680) [2256 bp, 751 aa] {ON} Anc_2....    44   6e-04
Kpol_1003.16 s1003 complement(43655..45904) [2250 bp, 749 aa] {O...    42   0.001
Ecym_3285 Chr3 complement(539184..541424) [2241 bp, 746 aa] {ON}...    42   0.002
KLLA0F03421g Chr6 complement(321000..323243) [2244 bp, 747 aa] {...    42   0.002
Kwal_23.4848 s23 complement(892162..894399) [2238 bp, 745 aa] {O...    42   0.003
SAKL0H17358g Chr8 complement(1535040..1535975) [936 bp, 311 aa] ...    40   0.004
ADL253C Chr4 complement(255550..257805) [2256 bp, 751 aa] {ON} S...    40   0.007
SAKL0E08602g Chr5 (702206..704449) [2244 bp, 747 aa] {ON} simila...    39   0.017
KLLA0F11913g Chr6 complement(1094612..1095373) [762 bp, 253 aa] ...    37   0.047
Kpol_543.10 s543 complement(25137..27767) [2631 bp, 876 aa] {ON}...    37   0.075
Kpol_520.11 s520 complement(26673..28139) [1467 bp, 488 aa] {ON}...    36   0.11 
TBLA0H02800 Chr8 (655357..656811) [1455 bp, 484 aa] {ON} Anc_2.5...    35   0.17 
Skud_15.304 Chr15 complement(543860..546511) [2652 bp, 883 aa] {...    35   0.19 
Ecym_3505 Chr3 complement(941314..942231) [918 bp, 305 aa] {ON} ...    35   0.25 
Suva_13.202 Chr13 (328209..328238,328325..329698) [1404 bp, 467 ...    35   0.34 
SAKL0F13772g Chr6 (1099703..1100971) [1269 bp, 422 aa] {ON} simi...    34   0.39 
TPHA0N01430 Chr14 (314740..316158) [1419 bp, 472 aa] {ON} Anc_2....    34   0.43 
KLTH0D08624g Chr4 (722066..723364) [1299 bp, 432 aa] {ON} simila...    34   0.43 
KAFR0K02150 Chr11 (441832..443304) [1473 bp, 490 aa] {ON} Anc_7....    33   1.0  
Smik_15.320 Chr15 complement(551333..553954) [2622 bp, 873 aa] {...    33   1.2  
YOR141C Chr15 complement(589942..592587) [2646 bp, 881 aa] {ON} ...    33   1.6  
Ecym_2311 Chr2 (604942..607269) [2328 bp, 775 aa] {ON} similar t...    33   1.6  
Ecym_6381 Chr6 complement(746240..746623) [384 bp, 127 aa] {ON} ...    31   2.2  
NCAS0A14720 Chr1 (2903450..2904907) [1458 bp, 485 aa] {ON} Anc_7...    32   2.9  
KLTH0B07502g Chr2 (604448..604460,604791..607777) [3000 bp, 999 ...    31   4.7  
CAGL0F05907g Chr6 (591411..592799) [1389 bp, 462 aa] {ON} simila...    31   5.7  
KAFR0E02530 Chr5 (516623..519151) [2529 bp, 842 aa] {ON} Anc_5.4...    30   7.5  
NDAI0A01300 Chr1 complement(280662..282359) [1698 bp, 565 aa] {O...    30   8.0  

>Kwal_33.14177 s33 complement(557522..558535) [1014 bp, 337 aa] {ON}
           YDL029W (ARP2) - actin-related protein [contig 105] FULL
          Length = 337

 Score =  671 bits (1730), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/337 (96%), Positives = 325/337 (96%)

Query: 1   MIGDEASAVRSYLQISYPMENGVIKNWSDMELLWDYAFYDQMQLPSTSGGKVMLTEPPMN 60
           MIGDEASAVRSYLQISYPMENGVIKNWSDMELLWDYAFYDQMQLPSTSGGKVMLTEPPMN
Sbjct: 1   MIGDEASAVRSYLQISYPMENGVIKNWSDMELLWDYAFYDQMQLPSTSGGKVMLTEPPMN 60

Query: 61  PVKNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVL 120
           PVKNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGL            THIVPVYESVVL
Sbjct: 61  PVKNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVL 120

Query: 121 NHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLDLDTKLAR 180
           NHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLDLDTKLAR
Sbjct: 121 NHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLDLDTKLAR 180

Query: 181 ETTTLVENYELPDGRVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTIQSADVDVRS 240
           ETTTLVENYELPDGRVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTIQSADVDVRS
Sbjct: 181 ETTTLVENYELPDGRVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTIQSADVDVRS 240

Query: 241 ALYRAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLHNDPSRLDKFKVRIEDPPRRKHMVF 300
           ALYRAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLHNDPSRLDKFKVRIEDPPRRKHMVF
Sbjct: 241 ALYRAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLHNDPSRLDKFKVRIEDPPRRKHMVF 300

Query: 301 IGGAVLANIMADKDHMWLSKQEWQEMGSAAMSKFGPR 337
           IGGAVLANIMADKDHMWLSKQEWQEMGSAAMSKFGPR
Sbjct: 301 IGGAVLANIMADKDHMWLSKQEWQEMGSAAMSKFGPR 337

>KLTH0F06490g Chr6 complement(561947..563100,563192..563213) [1176
           bp, 391 aa] {ON} highly similar to uniprot|P32381
           Saccharomyces cerevisiae YDL029W ARP2 Essential
           component of the Arp2/3 complex which is a highly
           conserved actin nucleation center required for the
           motility and integrity of actin patches involved in
           endocytosis and membrane growth and polarity
          Length = 391

 Score =  655 bits (1689), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/337 (93%), Positives = 323/337 (95%)

Query: 1   MIGDEASAVRSYLQISYPMENGVIKNWSDMELLWDYAFYDQMQLPSTSGGKVMLTEPPMN 60
           MIGDEASAVRSYLQISYPMENGVIKNWSDMELLWDYAFYDQM+LPSTSGGKVMLTEPPMN
Sbjct: 55  MIGDEASAVRSYLQISYPMENGVIKNWSDMELLWDYAFYDQMKLPSTSGGKVMLTEPPMN 114

Query: 61  PVKNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVL 120
           P++NREQMCEVMFEKYDFGGVYVAIQAVLALYAQGL            THIVPVYESVVL
Sbjct: 115 PLRNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVL 174

Query: 121 NHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLDLDTKLAR 180
           NHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLDLDTKLAR
Sbjct: 175 NHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLDLDTKLAR 234

Query: 181 ETTTLVENYELPDGRVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTIQSADVDVRS 240
           ETTTLVENYELPDGRVIKVGSERFEAPECLFQP+LVDVEQPGVGEMLFNTIQ+ADVDVRS
Sbjct: 235 ETTTLVENYELPDGRVIKVGSERFEAPECLFQPNLVDVEQPGVGEMLFNTIQAADVDVRS 294

Query: 241 ALYRAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLHNDPSRLDKFKVRIEDPPRRKHMVF 300
           ALYRAIVLSGGSSMYPGLPSRLEKELKQLWFTRVL NDPSRL+KFKVRIEDPPRRKHMVF
Sbjct: 295 ALYRAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPSRLEKFKVRIEDPPRRKHMVF 354

Query: 301 IGGAVLANIMADKDHMWLSKQEWQEMGSAAMSKFGPR 337
           IGGAVLANIMADKDHMWLSKQEWQEMG +AMSKFGPR
Sbjct: 355 IGGAVLANIMADKDHMWLSKQEWQEMGPSAMSKFGPR 391

>SAKL0C07370g Chr3 complement(680403..681556,681672..681693) [1176
           bp, 391 aa] {ON} highly similar to uniprot|P32381
           Saccharomyces cerevisiae YDL029W ARP2 Essential
           component of the Arp2/3 complex which is a highly
           conserved actin nucleation center required for the
           motility and integrity of actin patches involved in
           endocytosis and membrane growth and polarity
          Length = 391

 Score =  644 bits (1661), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/337 (91%), Positives = 321/337 (95%)

Query: 1   MIGDEASAVRSYLQISYPMENGVIKNWSDMELLWDYAFYDQMQLPSTSGGKVMLTEPPMN 60
           MIGDEAS VRSYLQISYPMENG+IKNW+DMELLWDYAFY+QM+LPSTSGGKV+LTEPPMN
Sbjct: 55  MIGDEASDVRSYLQISYPMENGIIKNWADMELLWDYAFYEQMKLPSTSGGKVLLTEPPMN 114

Query: 61  PVKNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVL 120
           P++NREQMCEVMFEKYDFGGVYVAIQAVLALYAQGL            THIVPVYESVVL
Sbjct: 115 PLRNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVL 174

Query: 121 NHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLDLDTKLAR 180
           +HLT+RLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKL YVSYDLDLDTKLAR
Sbjct: 175 SHLTKRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLCYVSYDLDLDTKLAR 234

Query: 181 ETTTLVENYELPDGRVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTIQSADVDVRS 240
           ETTTLVENYELPDGRVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNT+Q+ADVDVR+
Sbjct: 235 ETTTLVENYELPDGRVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTVQAADVDVRT 294

Query: 241 ALYRAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLHNDPSRLDKFKVRIEDPPRRKHMVF 300
           ALYRA+VLSGGSSMYPGLPSRLEKELKQLWFTRVL NDPSRLDKFKVRIEDPPRRKHMVF
Sbjct: 295 ALYRAVVLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPSRLDKFKVRIEDPPRRKHMVF 354

Query: 301 IGGAVLANIMADKDHMWLSKQEWQEMGSAAMSKFGPR 337
           IGGAVLANIMADKDHMWL+KQEWQEMG AAMSKFGPR
Sbjct: 355 IGGAVLANIMADKDHMWLTKQEWQEMGPAAMSKFGPR 391

>TDEL0D04610 Chr4 complement(846092..847245,847317..847338) [1176
           bp, 391 aa] {ON} Anc_3.161 YDL029W
          Length = 391

 Score =  639 bits (1647), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/337 (90%), Positives = 317/337 (94%)

Query: 1   MIGDEASAVRSYLQISYPMENGVIKNWSDMELLWDYAFYDQMQLPSTSGGKVMLTEPPMN 60
           MIGDEAS VRSYLQISYPMENG+IKNW+DMELLWDYAF+DQM+LP+TS GK++LTEPPMN
Sbjct: 55  MIGDEASDVRSYLQISYPMENGIIKNWTDMELLWDYAFFDQMKLPTTSNGKILLTEPPMN 114

Query: 61  PVKNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVL 120
           PVKNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGL            THIVPVYESVVL
Sbjct: 115 PVKNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVL 174

Query: 121 NHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLDLDTKLAR 180
           NHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEK+ YVSYDLDLDTKLAR
Sbjct: 175 NHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKVCYVSYDLDLDTKLAR 234

Query: 181 ETTTLVENYELPDGRVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTIQSADVDVRS 240
           ETTTLVENYELPDGRVIKVG ERFEAPECLFQPSLVDVEQ GVGE+LFNTIQ+ADVD+RS
Sbjct: 235 ETTTLVENYELPDGRVIKVGQERFEAPECLFQPSLVDVEQAGVGELLFNTIQTADVDIRS 294

Query: 241 ALYRAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLHNDPSRLDKFKVRIEDPPRRKHMVF 300
           ALYRAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLHND SRLDKFKVRIEDPPRRKHMVF
Sbjct: 295 ALYRAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLHNDASRLDKFKVRIEDPPRRKHMVF 354

Query: 301 IGGAVLANIMADKDHMWLSKQEWQEMGSAAMSKFGPR 337
           IGGAVLANIMADKDHMWLSKQEWQE G AAM+KFGPR
Sbjct: 355 IGGAVLANIMADKDHMWLSKQEWQESGPAAMAKFGPR 391

>CAGL0K01595g Chr11 (141618..141639,141971..143124) [1176 bp, 391
           aa] {ON} highly similar to uniprot|P32381 Saccharomyces
           cerevisiae YDL029w ACT2
          Length = 391

 Score =  634 bits (1636), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/337 (89%), Positives = 320/337 (94%)

Query: 1   MIGDEASAVRSYLQISYPMENGVIKNWSDMELLWDYAFYDQMQLPSTSGGKVMLTEPPMN 60
           MIGDEAS VRSYLQISYPMENG+IKNW+DMELLWDYAF++QMQLP+TSGGK++LTEPPMN
Sbjct: 55  MIGDEASDVRSYLQISYPMENGIIKNWTDMELLWDYAFFNQMQLPTTSGGKILLTEPPMN 114

Query: 61  PVKNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVL 120
           PVKNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGL            THIVPVYESVVL
Sbjct: 115 PVKNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVL 174

Query: 121 NHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLDLDTKLAR 180
           NHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKL YVSYDLDLDTKLAR
Sbjct: 175 NHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLCYVSYDLDLDTKLAR 234

Query: 181 ETTTLVENYELPDGRVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTIQSADVDVRS 240
           ETTTLVENYELPDGR+IKVG ERFEAPECLFQP+LVDVEQ G+GE+LFNTIQSADVDVRS
Sbjct: 235 ETTTLVENYELPDGRIIKVGQERFEAPECLFQPNLVDVEQAGIGELLFNTIQSADVDVRS 294

Query: 241 ALYRAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLHNDPSRLDKFKVRIEDPPRRKHMVF 300
           +LY+AIVLSGGSSMYPGLPSRLEKELKQLWFTRVL+NDP+RLDKFKVRIEDPPRR+HMVF
Sbjct: 295 SLYKAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLNNDPTRLDKFKVRIEDPPRRRHMVF 354

Query: 301 IGGAVLANIMADKDHMWLSKQEWQEMGSAAMSKFGPR 337
           IGGAVLA+IMADKDHMWL+KQEW+E G+AAMSKFGPR
Sbjct: 355 IGGAVLASIMADKDHMWLTKQEWRESGAAAMSKFGPR 391

>KLLA0C03850g Chr3 complement(351772..352947) [1176 bp, 391 aa] {ON}
           highly similar to uniprot|P32381 Saccharomyces
           cerevisiae YDL029W ARP2 Essential component of the
           Arp2/3 complex which is a highly conserved actin
           nucleation center required for the motility and
           integrity of actin patches involved in endocytosis and
           membrane growth and polarity
          Length = 391

 Score =  633 bits (1632), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/337 (88%), Positives = 318/337 (94%)

Query: 1   MIGDEASAVRSYLQISYPMENGVIKNWSDMELLWDYAFYDQMQLPSTSGGKVMLTEPPMN 60
           MIGDEAS VRSYLQISYPMENG+I+NW+DMELLWDYAF++QM+LP+TSGGKV+LTEPPMN
Sbjct: 55  MIGDEASEVRSYLQISYPMENGIIRNWADMELLWDYAFFEQMKLPTTSGGKVLLTEPPMN 114

Query: 61  PVKNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVL 120
           P+KNREQMCEVMFEKYDFGG YVAIQAVLALYAQGL            THIVPVYESVVL
Sbjct: 115 PIKNREQMCEVMFEKYDFGGTYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVL 174

Query: 121 NHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLDLDTKLAR 180
           NHLTRRLDVAGRDVTRHLIDLLSRRGYAFNR+ADFETVRQIKEKL YVSYDLDLDTKLAR
Sbjct: 175 NHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLAR 234

Query: 181 ETTTLVENYELPDGRVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTIQSADVDVRS 240
           ETTTLVE+YELPDGRVIKVG ERFEAPECLFQPSLVDVEQPGVGE+LFNTIQ+ADVD+R+
Sbjct: 235 ETTTLVESYELPDGRVIKVGPERFEAPECLFQPSLVDVEQPGVGELLFNTIQAADVDIRT 294

Query: 241 ALYRAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLHNDPSRLDKFKVRIEDPPRRKHMVF 300
           +LY+AIVLSGGSSMYPGLPSRLEKELKQLWFTRVL NDP+RLDKFKVRIEDPPRRKHMVF
Sbjct: 295 SLYKAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPTRLDKFKVRIEDPPRRKHMVF 354

Query: 301 IGGAVLANIMADKDHMWLSKQEWQEMGSAAMSKFGPR 337
           IGGAVLANIMADKDHMWLSKQEW E+G AAMSKFGPR
Sbjct: 355 IGGAVLANIMADKDHMWLSKQEWHEIGPAAMSKFGPR 391

>Kpol_479.25 s479 complement(49227..50402) [1176 bp, 391 aa] {ON}
           complement(49227..50402) [1176 nt, 392 aa]
          Length = 391

 Score =  632 bits (1631), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/337 (89%), Positives = 316/337 (93%)

Query: 1   MIGDEASAVRSYLQISYPMENGVIKNWSDMELLWDYAFYDQMQLPSTSGGKVMLTEPPMN 60
           MIGDEAS VRSYLQISYPMENG+IKNW+DMELLWDYAFY+QM+LPSTSGGKV+LTEPPMN
Sbjct: 55  MIGDEASEVRSYLQISYPMENGIIKNWTDMELLWDYAFYEQMKLPSTSGGKVLLTEPPMN 114

Query: 61  PVKNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVL 120
           P+KNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGL            THIVPVYESVVL
Sbjct: 115 PLKNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVL 174

Query: 121 NHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLDLDTKLAR 180
           NHLTRRLDVAGRDVTRHLIDLLSRRGYAFNR+ADFETVRQIKEKL YVSYDLDLDT+LAR
Sbjct: 175 NHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTRLAR 234

Query: 181 ETTTLVENYELPDGRVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTIQSADVDVRS 240
           ETTTLVE YELPDGR+IKVG ERFEAPECLFQP+LVDVE  GVGE+LFNTIQSADVDVRS
Sbjct: 235 ETTTLVEKYELPDGRIIKVGQERFEAPECLFQPNLVDVESAGVGELLFNTIQSADVDVRS 294

Query: 241 ALYRAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLHNDPSRLDKFKVRIEDPPRRKHMVF 300
           +LY+AIVLSGGSSMYPGLPSRLEKELKQLWFTRVL+ DPSRLDKFKVRIEDPPRRKHMVF
Sbjct: 295 SLYKAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLNKDPSRLDKFKVRIEDPPRRKHMVF 354

Query: 301 IGGAVLANIMADKDHMWLSKQEWQEMGSAAMSKFGPR 337
           IGGAVLANIMADKDHMWLSKQEWQE G AAMSKFGPR
Sbjct: 355 IGGAVLANIMADKDHMWLSKQEWQESGPAAMSKFGPR 391

>Suva_4.220 Chr4 (389822..389843,389967..391120) [1176 bp, 391 aa]
           {ON} YDL029W (REAL)
          Length = 391

 Score =  629 bits (1621), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/337 (88%), Positives = 316/337 (93%)

Query: 1   MIGDEASAVRSYLQISYPMENGVIKNWSDMELLWDYAFYDQMQLPSTSGGKVMLTEPPMN 60
           MIGDEAS VRSYLQISYPMENG+IKNW+DMELLWDYAF++QM+L STS GK++LTEPPMN
Sbjct: 55  MIGDEASDVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLQSTSNGKILLTEPPMN 114

Query: 61  PVKNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVL 120
           P+KNRE+MCEVMFEKYDFGGVYVAIQAVLALYAQGL            THIVPVYESVVL
Sbjct: 115 PLKNREKMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVL 174

Query: 121 NHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLDLDTKLAR 180
           NHLTRRLDVAGRDVTRHLIDLLSRRGYAFNR+ADFETVRQIKEKL YVSYDLDLDTKLAR
Sbjct: 175 NHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLAR 234

Query: 181 ETTTLVENYELPDGRVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTIQSADVDVRS 240
           ETTTLVE+YELPDGR IKVG ERFEAPECLFQP LVDVEQPGVGE+LFNT+QSADVD+RS
Sbjct: 235 ETTTLVESYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRS 294

Query: 241 ALYRAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLHNDPSRLDKFKVRIEDPPRRKHMVF 300
           +LY+AIVLSGGSSMYPGLPSRLEKELKQLWF+RVLHNDPSRLDKFKVRIEDPPRRKHMVF
Sbjct: 295 SLYKAIVLSGGSSMYPGLPSRLEKELKQLWFSRVLHNDPSRLDKFKVRIEDPPRRKHMVF 354

Query: 301 IGGAVLANIMADKDHMWLSKQEWQEMGSAAMSKFGPR 337
           IGGAVLA+IMADKDHMWLSKQEWQE G AAMSKFGPR
Sbjct: 355 IGGAVLASIMADKDHMWLSKQEWQESGPAAMSKFGPR 391

>NDAI0G02900 Chr7 (671423..671444,671694..672847) [1176 bp, 391 aa]
           {ON} Anc_3.161 YDL029W
          Length = 391

 Score =  628 bits (1620), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/337 (88%), Positives = 317/337 (94%)

Query: 1   MIGDEASAVRSYLQISYPMENGVIKNWSDMELLWDYAFYDQMQLPSTSGGKVMLTEPPMN 60
           MIGDEAS VRSYLQISYPMENG+IKNW+DMELLWDYAF++QM+L +TSGGK++LTEPPMN
Sbjct: 55  MIGDEASDVRSYLQISYPMENGIIKNWTDMELLWDYAFFNQMKLNNTSGGKILLTEPPMN 114

Query: 61  PVKNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVL 120
           P+KNRE+MCEVMFEKYDFGGVYVAIQAVLALYAQGL            THIVPVYESVVL
Sbjct: 115 PLKNREKMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVL 174

Query: 121 NHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLDLDTKLAR 180
           NHLTRRLDVAGRDVTRHLIDLLSRRGYAFNR+ADFETVRQIKEKL YVSYDLDLDTKLAR
Sbjct: 175 NHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLAR 234

Query: 181 ETTTLVENYELPDGRVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTIQSADVDVRS 240
           ETTTLVE+YELPDGR IKVG ERFEAPECLFQP LVDVEQPGVGE+LFNTIQSADVDVRS
Sbjct: 235 ETTTLVESYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTIQSADVDVRS 294

Query: 241 ALYRAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLHNDPSRLDKFKVRIEDPPRRKHMVF 300
           ALY+AIVLSGGSSMYPGLPSRLEKELKQLW+TRVLHNDPSRLDKFKVRIEDPPRRKHMVF
Sbjct: 295 ALYKAIVLSGGSSMYPGLPSRLEKELKQLWYTRVLHNDPSRLDKFKVRIEDPPRRKHMVF 354

Query: 301 IGGAVLANIMADKDHMWLSKQEWQEMGSAAMSKFGPR 337
           IGGAVLA+IMADKDHMWLSKQEW E G+AAM+KFGPR
Sbjct: 355 IGGAVLASIMADKDHMWLSKQEWYEGGAAAMAKFGPR 391

>KAFR0C01040 Chr3 complement(212570..213583) [1014 bp, 337 aa] {ON} 
          Length = 337

 Score =  625 bits (1613), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/337 (87%), Positives = 316/337 (93%)

Query: 1   MIGDEASAVRSYLQISYPMENGVIKNWSDMELLWDYAFYDQMQLPSTSGGKVMLTEPPMN 60
           MIG EAS VRSYLQISYPMENG+IKNW+DMELLWDYAFY+QM+LP TS GK++LTEPPMN
Sbjct: 1   MIGGEASEVRSYLQISYPMENGIIKNWTDMELLWDYAFYEQMKLPDTSNGKILLTEPPMN 60

Query: 61  PVKNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVL 120
           P+KNRE+MCEVMFEKY+FGGVYVAIQAVLALYAQGL            THIVPVYESVVL
Sbjct: 61  PIKNREKMCEVMFEKYNFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVL 120

Query: 121 NHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLDLDTKLAR 180
           NHLTRRLDVAGRDVTR+LIDLLSRRGYAFNR+ADFETVRQIKEKL YVSYDLDLDTKLAR
Sbjct: 121 NHLTRRLDVAGRDVTRNLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLAR 180

Query: 181 ETTTLVENYELPDGRVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTIQSADVDVRS 240
           ETTTLVE+YELPDGRVIKVGSERFEAPECLFQP+LVDVEQ GVGE+LFNTIQSADVD+RS
Sbjct: 181 ETTTLVESYELPDGRVIKVGSERFEAPECLFQPNLVDVEQAGVGELLFNTIQSADVDIRS 240

Query: 241 ALYRAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLHNDPSRLDKFKVRIEDPPRRKHMVF 300
            L++AIVLSGGSSMYPGLPSRLEKELKQLWFTRVLHNDP+RLDKFKVRIEDPPRRKHMVF
Sbjct: 241 TLFKAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLHNDPTRLDKFKVRIEDPPRRKHMVF 300

Query: 301 IGGAVLANIMADKDHMWLSKQEWQEMGSAAMSKFGPR 337
           IGGAVLANIMADKDHMWLSKQEW+E G AAM+KFGPR
Sbjct: 301 IGGAVLANIMADKDHMWLSKQEWEESGPAAMAKFGPR 337

>Skud_4.222 Chr4 (394174..394195,394321..395474) [1176 bp, 391 aa]
           {ON} YDL029W (REAL)
          Length = 391

 Score =  627 bits (1618), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/337 (88%), Positives = 315/337 (93%)

Query: 1   MIGDEASAVRSYLQISYPMENGVIKNWSDMELLWDYAFYDQMQLPSTSGGKVMLTEPPMN 60
           MIGDEAS VRSYLQISYPMENG+IKNW+DMELLWDYAF++QM+LPSTS GK++LTEPPMN
Sbjct: 55  MIGDEASDVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPSTSNGKILLTEPPMN 114

Query: 61  PVKNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVL 120
           P+KNRE+MCEVMFEKYDFGGVYVAIQAVLALYAQGL            THIVPVYESVVL
Sbjct: 115 PLKNREKMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVL 174

Query: 121 NHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLDLDTKLAR 180
           +HLTRRLDVAGRDVTRHLIDLLSRRGYAFNR+ADFETVRQIKEKL YVSYDLDLDTKLAR
Sbjct: 175 SHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLAR 234

Query: 181 ETTTLVENYELPDGRVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTIQSADVDVRS 240
           ETT LVE+YELPDGR IKVG ERFEAPECLFQP LVDVEQPGVGE+LFNT+QSADVD+RS
Sbjct: 235 ETTVLVESYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRS 294

Query: 241 ALYRAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLHNDPSRLDKFKVRIEDPPRRKHMVF 300
           +LYRAIVLSGGSSMYPGLPSRLEKELKQLWF RVLHNDPSRLDKFKVRIEDPPRRKHMVF
Sbjct: 295 SLYRAIVLSGGSSMYPGLPSRLEKELKQLWFNRVLHNDPSRLDKFKVRIEDPPRRKHMVF 354

Query: 301 IGGAVLANIMADKDHMWLSKQEWQEMGSAAMSKFGPR 337
           IGGAVLA+IMADKDHMWLSKQEWQE G AAM+KFGPR
Sbjct: 355 IGGAVLASIMADKDHMWLSKQEWQESGPAAMTKFGPR 391

>KNAG0K01130 Chr11 (220520..220541,220822..221981) [1182 bp, 393 aa]
           {ON} 
          Length = 393

 Score =  627 bits (1616), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/337 (87%), Positives = 318/337 (94%)

Query: 1   MIGDEASAVRSYLQISYPMENGVIKNWSDMELLWDYAFYDQMQLPSTSGGKVMLTEPPMN 60
           M+G+EAS VRSYLQISYPMENG+IK+W+DMELLWD+AF+++M+LPSTSGGK++LTEPPMN
Sbjct: 57  MVGEEASDVRSYLQISYPMENGIIKHWTDMELLWDHAFFEKMKLPSTSGGKILLTEPPMN 116

Query: 61  PVKNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVL 120
           P+KNRE MC+VMFEKYDFGGVYVAIQAVLALYAQGL            THIVPVYESVVL
Sbjct: 117 PLKNREMMCQVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVL 176

Query: 121 NHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLDLDTKLAR 180
           NHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLD DTKLAR
Sbjct: 177 NHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLDFDTKLAR 236

Query: 181 ETTTLVENYELPDGRVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTIQSADVDVRS 240
           ETTTLVENYELPDGR+IKVG ERFEAPECLFQP+LVDVEQPGVGE+LFNTIQSADVD+RS
Sbjct: 237 ETTTLVENYELPDGRIIKVGQERFEAPECLFQPNLVDVEQPGVGELLFNTIQSADVDIRS 296

Query: 241 ALYRAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLHNDPSRLDKFKVRIEDPPRRKHMVF 300
           +LY+AIVLSGGSSMYPGLPSRLEKELKQLWFTRVL NDPSRLDKFKVRIEDPPRRKHMVF
Sbjct: 297 SLYKAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLKNDPSRLDKFKVRIEDPPRRKHMVF 356

Query: 301 IGGAVLANIMADKDHMWLSKQEWQEMGSAAMSKFGPR 337
           IGGAVLANIMADKDHMWLSKQEW+E G+ AM+KFGPR
Sbjct: 357 IGGAVLANIMADKDHMWLSKQEWEESGAQAMAKFGPR 393

>YDL029W Chr4 (399340..399361,399485..400638) [1176 bp, 391 aa] {ON}
            ARP2Essential component of the Arp2/3 complex, which is
           a highly conserved actin nucleation center required for
           the motility and integrity of actin patches; involved in
           endocytosis and membrane growth and polarity
          Length = 391

 Score =  626 bits (1615), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/337 (87%), Positives = 316/337 (93%)

Query: 1   MIGDEASAVRSYLQISYPMENGVIKNWSDMELLWDYAFYDQMQLPSTSGGKVMLTEPPMN 60
           MIGDEAS VRSYLQISYPMENG+IKNW+DMELLWDYAF++QM+LPSTS GK++LTEPPMN
Sbjct: 55  MIGDEASEVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPSTSNGKILLTEPPMN 114

Query: 61  PVKNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVL 120
           P+KNRE+MCEVMFEKYDFGGVYVAIQAVLALYAQGL            THIVPVYESVVL
Sbjct: 115 PLKNREKMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVL 174

Query: 121 NHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLDLDTKLAR 180
           +HLTRRLDVAGRDVTRHLIDLLSRRGYAFNR+ADFETVRQIKEKL YVSYDLDLDTKLAR
Sbjct: 175 SHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLAR 234

Query: 181 ETTTLVENYELPDGRVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTIQSADVDVRS 240
           ETT LVE+YELPDGR IKVG ERFEAPECLFQP LVDVEQPGVGE+LFNT+QSADVD+RS
Sbjct: 235 ETTALVESYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRS 294

Query: 241 ALYRAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLHNDPSRLDKFKVRIEDPPRRKHMVF 300
           +LY+AIVLSGGSSMYPGLPSRLEKELKQLWF+RVLHNDPSRLDKFKVRIEDPPRRKHMVF
Sbjct: 295 SLYKAIVLSGGSSMYPGLPSRLEKELKQLWFSRVLHNDPSRLDKFKVRIEDPPRRKHMVF 354

Query: 301 IGGAVLANIMADKDHMWLSKQEWQEMGSAAMSKFGPR 337
           IGGAVLA+IMADKDHMWLSKQEWQE G +AM+KFGPR
Sbjct: 355 IGGAVLASIMADKDHMWLSKQEWQESGPSAMTKFGPR 391

>Smik_4.206 Chr4 (379506..379527,379652..380805) [1176 bp, 391 aa]
           {ON} YDL029W (REAL)
          Length = 391

 Score =  622 bits (1605), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/337 (87%), Positives = 315/337 (93%)

Query: 1   MIGDEASAVRSYLQISYPMENGVIKNWSDMELLWDYAFYDQMQLPSTSGGKVMLTEPPMN 60
           MIGDEAS VRSYLQISYPMENG+IKNW+DMELLWDYAF++QM+LPSTS GK++LTEPPMN
Sbjct: 55  MIGDEASDVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPSTSNGKILLTEPPMN 114

Query: 61  PVKNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVL 120
           P+KNRE+MCEVMFEKYDFGGVYVAIQAVLALYAQGL            THIVPVYESVVL
Sbjct: 115 PLKNREKMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVL 174

Query: 121 NHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLDLDTKLAR 180
           +HLTRRLDVAGRDVTRHLIDLLSRRGYAFNR+ADFETVRQIKEKL YVSYDLDLDTKLAR
Sbjct: 175 SHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLAR 234

Query: 181 ETTTLVENYELPDGRVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTIQSADVDVRS 240
           ETT LVE+YELPDGR IKVG ERFEAPECLFQP LVDVEQPGVGE+LFNT+QSADVD+RS
Sbjct: 235 ETTALVESYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRS 294

Query: 241 ALYRAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLHNDPSRLDKFKVRIEDPPRRKHMVF 300
           +LY+AIVLSGGSSMYPGLPSRLEKELKQLWF+RVLHNDPSRLDKFKVRIEDPPRRKHMVF
Sbjct: 295 SLYKAIVLSGGSSMYPGLPSRLEKELKQLWFSRVLHNDPSRLDKFKVRIEDPPRRKHMVF 354

Query: 301 IGGAVLANIMADKDHMWLSKQEWQEMGSAAMSKFGPR 337
           IGGAVLA+IMADKDHMWLSKQEW E G A+M+KFGPR
Sbjct: 355 IGGAVLASIMADKDHMWLSKQEWLESGPASMAKFGPR 391

>Ecym_5237 Chr5 complement(489181..490356) [1176 bp, 391 aa] {ON}
           similar to Ashbya gossypii ADR316W
          Length = 391

 Score =  622 bits (1604), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/337 (88%), Positives = 314/337 (93%)

Query: 1   MIGDEASAVRSYLQISYPMENGVIKNWSDMELLWDYAFYDQMQLPSTSGGKVMLTEPPMN 60
           MIGDEAS VRSYLQISYPMENG+IKNW+DME LWDYAFYDQM++PST+G KV+LTEPPMN
Sbjct: 55  MIGDEASNVRSYLQISYPMENGIIKNWADMEQLWDYAFYDQMKIPSTAGHKVLLTEPPMN 114

Query: 61  PVKNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVL 120
           P+KNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGL            THIVPVYESVVL
Sbjct: 115 PLKNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVL 174

Query: 121 NHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLDLDTKLAR 180
           NHLTRRLDVAGRDVTR+LIDLLSRRGYAFN++ADFETVRQIKEKL YVSYDLDLDTKLA 
Sbjct: 175 NHLTRRLDVAGRDVTRYLIDLLSRRGYAFNKTADFETVRQIKEKLCYVSYDLDLDTKLAH 234

Query: 181 ETTTLVENYELPDGRVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTIQSADVDVRS 240
           ETTTLVE YELPDGRVIKVGSERFEAPECLFQPSLVDVEQ G+GEMLF+TIQSADVD+ S
Sbjct: 235 ETTTLVETYELPDGRVIKVGSERFEAPECLFQPSLVDVEQQGIGEMLFSTIQSADVDIIS 294

Query: 241 ALYRAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLHNDPSRLDKFKVRIEDPPRRKHMVF 300
           ALYRAIVLSGGSSMYPGLPSRLEKELKQLWFTRVL NDP+RLDKFKVRIEDPPRRKHMVF
Sbjct: 295 ALYRAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLKNDPARLDKFKVRIEDPPRRKHMVF 354

Query: 301 IGGAVLANIMADKDHMWLSKQEWQEMGSAAMSKFGPR 337
            GGAVLANIMADKDHMWL+K+EW+EMG AAMSKFGPR
Sbjct: 355 TGGAVLANIMADKDHMWLTKKEWEEMGPAAMSKFGPR 391

>TPHA0A00920 Chr1 (181205..182380) [1176 bp, 391 aa] {ON} Anc_2.117
           YHR129C
          Length = 391

 Score =  622 bits (1603), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/337 (87%), Positives = 317/337 (94%)

Query: 1   MIGDEASAVRSYLQISYPMENGVIKNWSDMELLWDYAFYDQMQLPSTSGGKVMLTEPPMN 60
           MIG+EASAVRSYLQISYPMENG+IKNW+DMELLWDYAFY+QM+LPSTSGGKV+LTEPP+N
Sbjct: 55  MIGEEASAVRSYLQISYPMENGIIKNWTDMELLWDYAFYEQMKLPSTSGGKVLLTEPPLN 114

Query: 61  PVKNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVL 120
           P+KNRE+MCEVMFEKYDFGGVYVAIQAVLALYAQGL            THIVPVYESVVL
Sbjct: 115 PLKNREKMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVIDSGDGVTHIVPVYESVVL 174

Query: 121 NHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLDLDTKLAR 180
           NHLTRRLDVAGRDVTRHLIDLLSRRGYAFNR+ADFETVRQIKEKL YVSYDL+LDTKLAR
Sbjct: 175 NHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLELDTKLAR 234

Query: 181 ETTTLVENYELPDGRVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTIQSADVDVRS 240
           ETTTLVENYELPDGRVIKVG ERFEA ECLFQP+LVDVE  GVGE+LFNTIQSAD+DVRS
Sbjct: 235 ETTTLVENYELPDGRVIKVGQERFEAAECLFQPNLVDVESAGVGELLFNTIQSADIDVRS 294

Query: 241 ALYRAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLHNDPSRLDKFKVRIEDPPRRKHMVF 300
           +LY+AIVLSGGSSMYPGLPSR+EKELKQLW+TRVL+NDP+RLDKFKVRIEDPPRRKHMVF
Sbjct: 295 SLYKAIVLSGGSSMYPGLPSRIEKELKQLWYTRVLNNDPARLDKFKVRIEDPPRRKHMVF 354

Query: 301 IGGAVLANIMADKDHMWLSKQEWQEMGSAAMSKFGPR 337
           IGGAVLA+IMADKDHMWLSKQEW E G AAM+KFGPR
Sbjct: 355 IGGAVLASIMADKDHMWLSKQEWAESGPAAMAKFGPR 391

>NCAS0C03550 Chr3 (709102..709123,709273..710429) [1179 bp, 392 aa]
           {ON} Anc_3.161
          Length = 392

 Score =  622 bits (1603), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/337 (87%), Positives = 314/337 (93%)

Query: 1   MIGDEASAVRSYLQISYPMENGVIKNWSDMELLWDYAFYDQMQLPSTSGGKVMLTEPPMN 60
           MIGDEAS VRSYLQISYPMENG+IKNW+DMELLWDYAF++QM+LP+TS GK++LTEPPMN
Sbjct: 55  MIGDEASEVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPTTSNGKILLTEPPMN 114

Query: 61  PVKNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVL 120
           P KNRE+MCEVMFEKYDFGGVYVAIQAVLALYAQGL            THIVPVYESVVL
Sbjct: 115 PTKNREKMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVL 174

Query: 121 NHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLDLDTKLAR 180
            HLTRRLDVAGRDVTRHLIDLLSRRGYAFNR+ADFETVRQIKEKL YVSYDLDLDTKLAR
Sbjct: 175 GHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLAR 234

Query: 181 ETTTLVENYELPDGRVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTIQSADVDVRS 240
           ETTTLVE+YELPDGR IKVG ERFEAPECLFQP LVDVEQPG+GE+LF+T+QSADVDVRS
Sbjct: 235 ETTTLVESYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGMGELLFDTVQSADVDVRS 294

Query: 241 ALYRAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLHNDPSRLDKFKVRIEDPPRRKHMVF 300
           ALY+AIVLSGGSSMYPGLPSRLEKELKQLWFTRVL NDP+RLDKFKVRIEDPPRRKHMVF
Sbjct: 295 ALYKAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPTRLDKFKVRIEDPPRRKHMVF 354

Query: 301 IGGAVLANIMADKDHMWLSKQEWQEMGSAAMSKFGPR 337
           IGGAVLA+IMADKDHMWLSKQEWQE G+A+M KFGPR
Sbjct: 355 IGGAVLASIMADKDHMWLSKQEWQESGAASMVKFGPR 391

>TBLA0F00870 Chr6 complement(222947..224100,224325..224346) [1176
           bp, 391 aa] {ON} Anc_3.161 YDL029W
          Length = 391

 Score =  617 bits (1591), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/337 (86%), Positives = 314/337 (93%)

Query: 1   MIGDEASAVRSYLQISYPMENGVIKNWSDMELLWDYAFYDQMQLPSTSGGKVMLTEPPMN 60
           MIGDEAS VRSYLQISYPMENG+IKNW+DMELLWDYAF++QM+LP+TSGGKV+LTEPPMN
Sbjct: 55  MIGDEASEVRSYLQISYPMENGIIKNWTDMELLWDYAFFNQMKLPTTSGGKVLLTEPPMN 114

Query: 61  PVKNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVL 120
           PVKNRE+MCEVMFE+YDFGGVYVAIQAVLALYAQGL            THIVPVYESVVL
Sbjct: 115 PVKNRERMCEVMFERYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVL 174

Query: 121 NHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLDLDTKLAR 180
           NHLTRRLDVAGRDVTRHLIDLLSRRGY+FNR+ADFETVRQIKEK+ YVSYDL+LDTKLAR
Sbjct: 175 NHLTRRLDVAGRDVTRHLIDLLSRRGYSFNRTADFETVRQIKEKVCYVSYDLNLDTKLAR 234

Query: 181 ETTTLVENYELPDGRVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTIQSADVDVRS 240
           ETTTLV+ YELPDGR+IKVG ERFEAPECLFQP LVDVE PGVGE+LFNTIQSAD+DVRS
Sbjct: 235 ETTTLVQEYELPDGRIIKVGQERFEAPECLFQPDLVDVESPGVGELLFNTIQSADIDVRS 294

Query: 241 ALYRAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLHNDPSRLDKFKVRIEDPPRRKHMVF 300
           +LY+AIVLSGGSSMYPGLPSRLE+ELKQLWFTR+L  D  RLDKFKVRIEDPPRRKHMVF
Sbjct: 295 SLYKAIVLSGGSSMYPGLPSRLERELKQLWFTRILKGDAERLDKFKVRIEDPPRRKHMVF 354

Query: 301 IGGAVLANIMADKDHMWLSKQEWQEMGSAAMSKFGPR 337
           IGGAVLANIMADKDHMWLSKQEWQE G+AA++KFGPR
Sbjct: 355 IGGAVLANIMADKDHMWLSKQEWQENGAAALAKFGPR 391

>ADR316W Chr4 (1261691..1262866) [1176 bp, 391 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDL029W (ARP2)
          Length = 391

 Score =  615 bits (1585), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/337 (86%), Positives = 315/337 (93%)

Query: 1   MIGDEASAVRSYLQISYPMENGVIKNWSDMELLWDYAFYDQMQLPSTSGGKVMLTEPPMN 60
           MIGDEAS VRSYLQISYPMENG+I++W+DMELLWDYAFY+QM+LPSTSGGKV+LTEPPMN
Sbjct: 55  MIGDEASQVRSYLQISYPMENGIIRDWADMELLWDYAFYEQMKLPSTSGGKVLLTEPPMN 114

Query: 61  PVKNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVL 120
           P++NREQMCEVMFEKYDFGGVYV IQAVLALYAQGL            THIVPVYESVVL
Sbjct: 115 PLRNREQMCEVMFEKYDFGGVYVGIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVL 174

Query: 121 NHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLDLDTKLAR 180
           NHLTRRLDVAGRD+TR+LIDLLSRRGYAFN++ADFETVRQIKEKL YVSYDLDLDT+LA+
Sbjct: 175 NHLTRRLDVAGRDMTRYLIDLLSRRGYAFNKTADFETVRQIKEKLCYVSYDLDLDTRLAQ 234

Query: 181 ETTTLVENYELPDGRVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTIQSADVDVRS 240
           ETTTLVE YELPDGRVIKVGSERFEAPECLFQPSLVDVEQPG+GEMLFNTIQSADVD+ S
Sbjct: 235 ETTTLVEQYELPDGRVIKVGSERFEAPECLFQPSLVDVEQPGIGEMLFNTIQSADVDIVS 294

Query: 241 ALYRAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLHNDPSRLDKFKVRIEDPPRRKHMVF 300
            LY+AIVLSGGSSMYPGLPSRLEKELKQLWFTRVL NDP+RL+KFKVRIEDPPRRKHMVF
Sbjct: 295 TLYKAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLKNDPTRLEKFKVRIEDPPRRKHMVF 354

Query: 301 IGGAVLANIMADKDHMWLSKQEWQEMGSAAMSKFGPR 337
            GGAVLA+IMADK+HMWL+KQEW+E G A+MSKFGPR
Sbjct: 355 TGGAVLASIMADKEHMWLTKQEWEESGPASMSKFGPR 391

>ZYRO0B04928g Chr2 complement(398291..399444,399538..399559) [1176
           bp, 391 aa] {ON} highly similar to uniprot|P32381
           Saccharomyces cerevisiae YDL029W ARP2 Essential
           component of the Arp2/3 complex which is a highly
           conserved actin nucleation center required for the
           motility and integrity of actin patches involved in
           endocytosis and membrane growth and polarity
          Length = 391

 Score =  611 bits (1575), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/337 (85%), Positives = 311/337 (92%)

Query: 1   MIGDEASAVRSYLQISYPMENGVIKNWSDMELLWDYAFYDQMQLPSTSGGKVMLTEPPMN 60
           MIG+EAS VRSYLQISYPMENG+I+NW DME LWDYAFY+QM+ PSTSGGK++LTEPPMN
Sbjct: 55  MIGEEASDVRSYLQISYPMENGIIRNWQDMEHLWDYAFYNQMKFPSTSGGKILLTEPPMN 114

Query: 61  PVKNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVL 120
           P+KNRE MCEVMFEKYDFGGVYVAIQAVLALYAQGL            THIVPVYESVVL
Sbjct: 115 PLKNRELMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVL 174

Query: 121 NHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLDLDTKLAR 180
           NHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDL+LDTKLAR
Sbjct: 175 NHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLNLDTKLAR 234

Query: 181 ETTTLVENYELPDGRVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTIQSADVDVRS 240
           ETT LVENYELPDGRVIKVG ERFEAPECLFQP LVDVEQPG+GE+LFNTIQSADVD+RS
Sbjct: 235 ETTVLVENYELPDGRVIKVGQERFEAPECLFQPDLVDVEQPGIGELLFNTIQSADVDIRS 294

Query: 241 ALYRAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLHNDPSRLDKFKVRIEDPPRRKHMVF 300
           +LYRAIVLSGGSSMYPGLPSRLEKELKQLW+TR+L  D +RLDKFKV+IEDPPRRKHMVF
Sbjct: 295 SLYRAIVLSGGSSMYPGLPSRLEKELKQLWYTRILRGDAARLDKFKVKIEDPPRRKHMVF 354

Query: 301 IGGAVLANIMADKDHMWLSKQEWQEMGSAAMSKFGPR 337
           IGGAVLA+IMA+KDHMWL+K+EW E G AAM+KFGPR
Sbjct: 355 IGGAVLASIMAEKDHMWLTKEEWHESGPAAMAKFGPR 391

>NDAI0G03040 Chr7 complement(708715..709832,710590..710599) [1128
           bp, 375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score =  299 bits (765), Expect = 3e-99,   Method: Compositional matrix adjust.
 Identities = 143/326 (43%), Positives = 218/326 (66%), Gaps = 13/326 (3%)

Query: 2   IGDEASAVRSYLQISYPMENGVIKNWSDMELLWDYAFYDQMQLPSTSGGKVMLTEPPMNP 61
           +GDEA + R  L + YP+E+G++ NW DME +W + FY+++++ +     V+LTE PMNP
Sbjct: 54  VGDEAQSKRGILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRV-APEEHPVLLTEAPMNP 112

Query: 62  VKNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLN 121
             NRE+M ++MFE ++    YV+IQAVL+LY+ G             TH+VP+Y    L 
Sbjct: 113 KSNREKMTQIMFETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSLP 172

Query: 122 HLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLDLDTKLARE 181
           H   R+D+AGRD+T +L+ +LS RGY+F+ +A+ E VR IKEKL YV+ D + + + A +
Sbjct: 173 HAILRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTASQ 232

Query: 182 TTTLVENYELPDGRVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTIQSADVDVRSA 241
           ++++ ++YELPDG+VI +G+ERF APE LF PS++ +E  G+ +  +N+I   DVDVR  
Sbjct: 233 SSSIEKSYELPDGQVITIGNERFRAPEALFHPSVLGLESSGIDQTTYNSIMKCDVDVRKE 292

Query: 242 LYRAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLHNDPSRLDKFKVRIEDPPRRKHMVFI 301
           LY  IV+SGGS+M+PG+  R++KE+  L         PS +   KV+I  PP RK+ V+I
Sbjct: 293 LYGNIVMSGGSTMFPGIAERMQKEITAL--------APSSM---KVKIIAPPERKYSVWI 341

Query: 302 GGAVLANIMADKDHMWLSKQEWQEMG 327
           GG++LA++   +  MW+SKQE+ E G
Sbjct: 342 GGSILASLTTFQ-QMWISKQEYDESG 366

>NCAS0C03700 Chr3 complement(745133..746250,746901..746910) [1128
           bp, 375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score =  298 bits (764), Expect = 5e-99,   Method: Compositional matrix adjust.
 Identities = 142/326 (43%), Positives = 218/326 (66%), Gaps = 13/326 (3%)

Query: 2   IGDEASAVRSYLQISYPMENGVIKNWSDMELLWDYAFYDQMQLPSTSGGKVMLTEPPMNP 61
           +GDEA + R  L + YP+E+G++ NW DME +W + FY+++++ +     V+LTE PMNP
Sbjct: 54  VGDEAQSKRGILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRV-APEEHPVLLTEAPMNP 112

Query: 62  VKNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLN 121
             NRE+M ++MFE ++    YV+IQAVL+LY+ G             TH+VP+Y    L 
Sbjct: 113 KSNREKMTQIMFETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSLP 172

Query: 122 HLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLDLDTKLARE 181
           H   R+D+AGRD+T +L+ +LS RGY+F+ +A+ E VR IKEKL YV+ D + + + A +
Sbjct: 173 HAILRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQ 232

Query: 182 TTTLVENYELPDGRVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTIQSADVDVRSA 241
           ++++ ++YELPDG+VI +G+ERF APE LF PS++ +E  G+ +  +N+I   DVDVR  
Sbjct: 233 SSSIEKSYELPDGQVITIGNERFRAPEALFHPSILSLESAGIDQTTYNSIMKCDVDVRKE 292

Query: 242 LYRAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLHNDPSRLDKFKVRIEDPPRRKHMVFI 301
           LY  IV+SGG++M+PG+  R++KE+  L         PS +   KV+I  PP RK+ V+I
Sbjct: 293 LYGNIVMSGGTTMFPGIAERMQKEITAL--------APSSM---KVKIIAPPERKYSVWI 341

Query: 302 GGAVLANIMADKDHMWLSKQEWQEMG 327
           GG++LA++   +  MW+SKQE+ E G
Sbjct: 342 GGSILASLTTFQ-QMWISKQEYDESG 366

>Skud_6.31 Chr6 complement(56454..57536) [1083 bp, 360 aa] {ON}
           YFL039C (REAL)
          Length = 360

 Score =  297 bits (761), Expect = 7e-99,   Method: Compositional matrix adjust.
 Identities = 142/326 (43%), Positives = 218/326 (66%), Gaps = 13/326 (3%)

Query: 2   IGDEASAVRSYLQISYPMENGVIKNWSDMELLWDYAFYDQMQLPSTSGGKVMLTEPPMNP 61
           +GDEA + R  L + YP+E+G++ NW DME +W + FY+++++ +     V+LTE PMNP
Sbjct: 39  VGDEAQSKRGILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRV-APEEHPVLLTEAPMNP 97

Query: 62  VKNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLN 121
             NRE+M ++MFE ++    YV+IQAVL+LY+ G             TH+VP+Y    L 
Sbjct: 98  KSNREKMTQIMFETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSLP 157

Query: 122 HLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLDLDTKLARE 181
           H   R+D+AGRD+T +L+ +LS RGY+F+ +A+ E VR IKEKL YV+ D + + + A +
Sbjct: 158 HAILRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQ 217

Query: 182 TTTLVENYELPDGRVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTIQSADVDVRSA 241
           ++++ ++YELPDG+VI +G+ERF APE LF PS++ +E  G+ +  +N+I   DVDVR  
Sbjct: 218 SSSIEKSYELPDGQVITIGNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKE 277

Query: 242 LYRAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLHNDPSRLDKFKVRIEDPPRRKHMVFI 301
           LY  IV+SGG++M+PG+  R++KE+  L         PS +   KV+I  PP RK+ V+I
Sbjct: 278 LYGNIVMSGGTTMFPGIAERMQKEITAL--------APSSM---KVKIIAPPERKYSVWI 326

Query: 302 GGAVLANIMADKDHMWLSKQEWQEMG 327
           GG++LA++   +  MW+SKQE+ E G
Sbjct: 327 GGSILASLTTFQ-QMWISKQEYDESG 351

>TDEL0C00470 Chr3 complement(72546..73663,73929..73938) [1128 bp,
           375 aa] {ON} 
          Length = 375

 Score =  298 bits (762), Expect = 8e-99,   Method: Compositional matrix adjust.
 Identities = 142/326 (43%), Positives = 218/326 (66%), Gaps = 13/326 (3%)

Query: 2   IGDEASAVRSYLQISYPMENGVIKNWSDMELLWDYAFYDQMQLPSTSGGKVMLTEPPMNP 61
           +GDEA + R  L + YP+E+G++ NW DME +W + FY+++++ +     V+LTE PMNP
Sbjct: 54  VGDEAQSKRGILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRV-APEEHPVLLTEAPMNP 112

Query: 62  VKNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLN 121
             NRE+M ++MFE ++    YV+IQAVL+LY+ G             TH+VP+Y    L 
Sbjct: 113 KSNREKMTQIMFETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSLP 172

Query: 122 HLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLDLDTKLARE 181
           H   R+D+AGRD+T +L+ +LS RGY+F+ +A+ E VR IKEKL YV+ D + + + A +
Sbjct: 173 HAILRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQ 232

Query: 182 TTTLVENYELPDGRVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTIQSADVDVRSA 241
           ++++ ++YELPDG+VI +G+ERF APE LF PS++ +E  G+ +  +N+I   DVDVR  
Sbjct: 233 SSSIEKSYELPDGQVITIGNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKE 292

Query: 242 LYRAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLHNDPSRLDKFKVRIEDPPRRKHMVFI 301
           LY  IV+SGG++M+PG+  R++KE+  L         PS +   KV+I  PP RK+ V+I
Sbjct: 293 LYGNIVMSGGTTMFPGIAERMQKEITAL--------APSSM---KVKIIAPPERKYSVWI 341

Query: 302 GGAVLANIMADKDHMWLSKQEWQEMG 327
           GG++LA++   +  MW+SKQE+ E G
Sbjct: 342 GGSILASLTTFQ-QMWISKQEYDESG 366

>CAGL0K12694g Chr11 (1258451..1258460,1259340..1260457) [1128 bp,
           375 aa] {ON} highly similar to uniprot|P02579
           Saccharomyces cerevisiae YFL039c ACT1 actin
          Length = 375

 Score =  298 bits (762), Expect = 8e-99,   Method: Compositional matrix adjust.
 Identities = 142/326 (43%), Positives = 218/326 (66%), Gaps = 13/326 (3%)

Query: 2   IGDEASAVRSYLQISYPMENGVIKNWSDMELLWDYAFYDQMQLPSTSGGKVMLTEPPMNP 61
           +GDEA + R  L + YP+E+G++ NW DME +W + FY+++++ +     V+LTE PMNP
Sbjct: 54  VGDEAQSKRGILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRV-APEEHPVLLTEAPMNP 112

Query: 62  VKNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLN 121
             NRE+M ++MFE ++    YV+IQAVL+LY+ G             TH+VP+Y    L 
Sbjct: 113 KSNREKMTQIMFETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSLP 172

Query: 122 HLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLDLDTKLARE 181
           H   R+D+AGRD+T +L+ +LS RGY+F+ +A+ E VR IKEKL YV+ D + + + A +
Sbjct: 173 HAILRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQ 232

Query: 182 TTTLVENYELPDGRVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTIQSADVDVRSA 241
           ++++ ++YELPDG+VI +G+ERF APE LF PS++ +E  G+ +  +N+I   DVDVR  
Sbjct: 233 SSSIEKSYELPDGQVITIGNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKE 292

Query: 242 LYRAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLHNDPSRLDKFKVRIEDPPRRKHMVFI 301
           LY  IV+SGG++M+PG+  R++KE+  L         PS +   KV+I  PP RK+ V+I
Sbjct: 293 LYGNIVMSGGTTMFPGIAERMQKEITAL--------APSSM---KVKIIAPPERKYSVWI 341

Query: 302 GGAVLANIMADKDHMWLSKQEWQEMG 327
           GG++LA++   +  MW+SKQE+ E G
Sbjct: 342 GGSILASLTTFQ-QMWISKQEYDESG 366

>Suva_6.18 Chr6 complement(26677..27794,28152..28161) [1128 bp, 375
           aa] {ON} YFL039C (REAL)
          Length = 375

 Score =  298 bits (762), Expect = 8e-99,   Method: Compositional matrix adjust.
 Identities = 142/326 (43%), Positives = 218/326 (66%), Gaps = 13/326 (3%)

Query: 2   IGDEASAVRSYLQISYPMENGVIKNWSDMELLWDYAFYDQMQLPSTSGGKVMLTEPPMNP 61
           +GDEA + R  L + YP+E+G++ NW DME +W + FY+++++ +     V+LTE PMNP
Sbjct: 54  VGDEAQSKRGILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRV-APEEHPVLLTEAPMNP 112

Query: 62  VKNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLN 121
             NRE+M ++MFE ++    YV+IQAVL+LY+ G             TH+VP+Y    L 
Sbjct: 113 KSNREKMTQIMFETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSLP 172

Query: 122 HLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLDLDTKLARE 181
           H   R+D+AGRD+T +L+ +LS RGY+F+ +A+ E VR IKEKL YV+ D + + + A +
Sbjct: 173 HAILRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQ 232

Query: 182 TTTLVENYELPDGRVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTIQSADVDVRSA 241
           ++++ ++YELPDG+VI +G+ERF APE LF PS++ +E  G+ +  +N+I   DVDVR  
Sbjct: 233 SSSIEKSYELPDGQVITIGNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKE 292

Query: 242 LYRAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLHNDPSRLDKFKVRIEDPPRRKHMVFI 301
           LY  IV+SGG++M+PG+  R++KE+  L         PS +   KV+I  PP RK+ V+I
Sbjct: 293 LYGNIVMSGGTTMFPGIAERMQKEITAL--------APSSM---KVKIIAPPERKYSVWI 341

Query: 302 GGAVLANIMADKDHMWLSKQEWQEMG 327
           GG++LA++   +  MW+SKQE+ E G
Sbjct: 342 GGSILASLTTFQ-QMWISKQEYDESG 366

>Smik_6.39 Chr6 complement(68673..69790,70076..70085) [1128 bp, 375
           aa] {ON} YFL039C (REAL)
          Length = 375

 Score =  298 bits (762), Expect = 8e-99,   Method: Compositional matrix adjust.
 Identities = 142/326 (43%), Positives = 218/326 (66%), Gaps = 13/326 (3%)

Query: 2   IGDEASAVRSYLQISYPMENGVIKNWSDMELLWDYAFYDQMQLPSTSGGKVMLTEPPMNP 61
           +GDEA + R  L + YP+E+G++ NW DME +W + FY+++++ +     V+LTE PMNP
Sbjct: 54  VGDEAQSKRGILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRV-APEEHPVLLTEAPMNP 112

Query: 62  VKNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLN 121
             NRE+M ++MFE ++    YV+IQAVL+LY+ G             TH+VP+Y    L 
Sbjct: 113 KSNREKMTQIMFETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSLP 172

Query: 122 HLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLDLDTKLARE 181
           H   R+D+AGRD+T +L+ +LS RGY+F+ +A+ E VR IKEKL YV+ D + + + A +
Sbjct: 173 HAILRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQ 232

Query: 182 TTTLVENYELPDGRVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTIQSADVDVRSA 241
           ++++ ++YELPDG+VI +G+ERF APE LF PS++ +E  G+ +  +N+I   DVDVR  
Sbjct: 233 SSSIEKSYELPDGQVITIGNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKE 292

Query: 242 LYRAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLHNDPSRLDKFKVRIEDPPRRKHMVFI 301
           LY  IV+SGG++M+PG+  R++KE+  L         PS +   KV+I  PP RK+ V+I
Sbjct: 293 LYGNIVMSGGTTMFPGIAERMQKEITAL--------APSSM---KVKIIAPPERKYSVWI 341

Query: 302 GGAVLANIMADKDHMWLSKQEWQEMG 327
           GG++LA++   +  MW+SKQE+ E G
Sbjct: 342 GGSILASLTTFQ-QMWISKQEYDESG 366

>YFL039C Chr6 complement(53260..54377,54687..54696) [1128 bp, 375
           aa] {ON}  ACT1Actin, structural protein involved in cell
           polarization, endocytosis, and other cytoskeletal
           functions
          Length = 375

 Score =  298 bits (762), Expect = 8e-99,   Method: Compositional matrix adjust.
 Identities = 142/326 (43%), Positives = 218/326 (66%), Gaps = 13/326 (3%)

Query: 2   IGDEASAVRSYLQISYPMENGVIKNWSDMELLWDYAFYDQMQLPSTSGGKVMLTEPPMNP 61
           +GDEA + R  L + YP+E+G++ NW DME +W + FY+++++ +     V+LTE PMNP
Sbjct: 54  VGDEAQSKRGILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRV-APEEHPVLLTEAPMNP 112

Query: 62  VKNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLN 121
             NRE+M ++MFE ++    YV+IQAVL+LY+ G             TH+VP+Y    L 
Sbjct: 113 KSNREKMTQIMFETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSLP 172

Query: 122 HLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLDLDTKLARE 181
           H   R+D+AGRD+T +L+ +LS RGY+F+ +A+ E VR IKEKL YV+ D + + + A +
Sbjct: 173 HAILRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQ 232

Query: 182 TTTLVENYELPDGRVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTIQSADVDVRSA 241
           ++++ ++YELPDG+VI +G+ERF APE LF PS++ +E  G+ +  +N+I   DVDVR  
Sbjct: 233 SSSIEKSYELPDGQVITIGNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKE 292

Query: 242 LYRAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLHNDPSRLDKFKVRIEDPPRRKHMVFI 301
           LY  IV+SGG++M+PG+  R++KE+  L         PS +   KV+I  PP RK+ V+I
Sbjct: 293 LYGNIVMSGGTTMFPGIAERMQKEITAL--------APSSM---KVKIIAPPERKYSVWI 341

Query: 302 GGAVLANIMADKDHMWLSKQEWQEMG 327
           GG++LA++   +  MW+SKQE+ E G
Sbjct: 342 GGSILASLTTFQ-QMWISKQEYDESG 366

>KNAG0L00250 Chr12 complement(32595..33712,34194..34203) [1128 bp,
           375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score =  298 bits (762), Expect = 8e-99,   Method: Compositional matrix adjust.
 Identities = 142/326 (43%), Positives = 218/326 (66%), Gaps = 13/326 (3%)

Query: 2   IGDEASAVRSYLQISYPMENGVIKNWSDMELLWDYAFYDQMQLPSTSGGKVMLTEPPMNP 61
           +GDEA + R  L + YP+E+G++ NW DME +W + FY+++++ +     V+LTE PMNP
Sbjct: 54  VGDEAQSKRGILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRV-APEEHPVLLTEAPMNP 112

Query: 62  VKNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLN 121
             NRE+M ++MFE ++    YV+IQAVL+LY+ G             TH+VP+Y    L 
Sbjct: 113 KSNREKMTQIMFETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSLP 172

Query: 122 HLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLDLDTKLARE 181
           H   R+D+AGRD+T +L+ +LS RGY+F+ +A+ E VR IKEKL YV+ D + + + A +
Sbjct: 173 HAILRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQ 232

Query: 182 TTTLVENYELPDGRVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTIQSADVDVRSA 241
           ++++ ++YELPDG+VI +G+ERF APE LF PS++ +E  G+ +  +N+I   DVDVR  
Sbjct: 233 SSSIEKSYELPDGQVITIGNERFRAPEALFHPSVLGLESSGIDQTTYNSIMKCDVDVRKE 292

Query: 242 LYRAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLHNDPSRLDKFKVRIEDPPRRKHMVFI 301
           LY  IV+SGG++M+PG+  R++KE+  L         PS +   KV+I  PP RK+ V+I
Sbjct: 293 LYGNIVMSGGTTMFPGIAERMQKEITAL--------APSSM---KVKIIAPPERKYSVWI 341

Query: 302 GGAVLANIMADKDHMWLSKQEWQEMG 327
           GG++LA++   +  MW+SKQE+ E G
Sbjct: 342 GGSILASLTTFQ-QMWISKQEYDESG 366

>KAFR0D00940 Chr4 complement(198280..199397,199945..199954) [1128
           bp, 375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score =  298 bits (762), Expect = 8e-99,   Method: Compositional matrix adjust.
 Identities = 142/326 (43%), Positives = 218/326 (66%), Gaps = 13/326 (3%)

Query: 2   IGDEASAVRSYLQISYPMENGVIKNWSDMELLWDYAFYDQMQLPSTSGGKVMLTEPPMNP 61
           +GDEA + R  L + YP+E+G++ NW DME +W + FY+++++ +     V+LTE PMNP
Sbjct: 54  VGDEAQSKRGILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRV-APEEHPVLLTEAPMNP 112

Query: 62  VKNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLN 121
             NRE+M ++MFE ++    YV+IQAVL+LY+ G             TH+VP+Y    L 
Sbjct: 113 KSNREKMTQIMFETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSLP 172

Query: 122 HLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLDLDTKLARE 181
           H   R+D+AGRD+T +L+ +LS RGY+F+ +A+ E VR IKEKL YV+ D + + + A +
Sbjct: 173 HAILRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQ 232

Query: 182 TTTLVENYELPDGRVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTIQSADVDVRSA 241
           ++++ ++YELPDG+VI +G+ERF APE LF PS++ +E  G+ +  +N+I   DVDVR  
Sbjct: 233 SSSIEKSYELPDGQVITIGNERFRAPEALFHPSVLGLESSGIDQTTYNSIMKCDVDVRKE 292

Query: 242 LYRAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLHNDPSRLDKFKVRIEDPPRRKHMVFI 301
           LY  IV+SGG++M+PG+  R++KE+  L         PS +   KV+I  PP RK+ V+I
Sbjct: 293 LYGNIVMSGGTTMFPGIAERMQKEITAL--------APSSM---KVKIIAPPERKYSVWI 341

Query: 302 GGAVLANIMADKDHMWLSKQEWQEMG 327
           GG++LA++   +  MW+SKQE+ E G
Sbjct: 342 GGSILASLTTFQ-QMWISKQEYDESG 366

>TPHA0D00250 Chr4 complement(34030..35147,35712..35721) [1128 bp,
           375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score =  298 bits (762), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 141/326 (43%), Positives = 218/326 (66%), Gaps = 13/326 (3%)

Query: 2   IGDEASAVRSYLQISYPMENGVIKNWSDMELLWDYAFYDQMQLPSTSGGKVMLTEPPMNP 61
           +GDEA + R  L + YP+E+G++ NW DME +W + FY+++++ +     V+LTE PMNP
Sbjct: 54  VGDEAQSKRGILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRV-APEEHPVLLTEAPMNP 112

Query: 62  VKNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLN 121
             NRE+M ++MFE ++    YV+IQAVL+LY+ G             TH+VP+Y    L 
Sbjct: 113 KSNREKMTQIMFETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSLP 172

Query: 122 HLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLDLDTKLARE 181
           H   R+D+AGRD+T +L+ +LS RGY+F+ +A+ E VR IKEKL YV+ D + + + A +
Sbjct: 173 HAILRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQ 232

Query: 182 TTTLVENYELPDGRVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTIQSADVDVRSA 241
           ++++ ++YELPDG+VI +G+ERF APE LF PS++ +E  G+ +  +N+I   D+DVR  
Sbjct: 233 SSSIEKSYELPDGQVITIGNERFRAPEALFHPSVLSLESAGIDQTTYNSIMKCDIDVRKE 292

Query: 242 LYRAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLHNDPSRLDKFKVRIEDPPRRKHMVFI 301
           LY  IV+SGG++M+PG+  R++KE+  L         PS +   KV+I  PP RK+ V+I
Sbjct: 293 LYGNIVMSGGTTMFPGIAERMQKEITAL--------APSSM---KVKIIAPPERKYSVWI 341

Query: 302 GGAVLANIMADKDHMWLSKQEWQEMG 327
           GG++LA++   +  MW+SKQE+ E G
Sbjct: 342 GGSILASLTTFQ-QMWISKQEYDESG 366

>Ecym_1520 Chr1 (1071497..1071506,1072543..1073663) [1131 bp, 376
           aa] {ON} similar to Ashbya gossypii ABR222W  1-intron
          Length = 376

 Score =  297 bits (761), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 143/326 (43%), Positives = 217/326 (66%), Gaps = 13/326 (3%)

Query: 2   IGDEASAVRSYLQISYPMENGVIKNWSDMELLWDYAFYDQMQLPSTSGGKVMLTEPPMNP 61
           +GDEA + R  L + YP+E+G++ NW DME +W + FY+++++ +     V+LTE PMNP
Sbjct: 55  VGDEAQSKRGILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRV-APEEHPVLLTEAPMNP 113

Query: 62  VKNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLN 121
             NRE+M ++MFE ++    YV+IQAVL+LY+ G             TH+VP+Y    L 
Sbjct: 114 KSNREKMTQIMFETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSLP 173

Query: 122 HLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLDLDTKLARE 181
           H   R+D+AGRD+T +L+ +LS RGY+F+ +A+ E VR IKEKL YV+ D D + + A +
Sbjct: 174 HAILRIDLAGRDMTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDYDQEMQTAAQ 233

Query: 182 TTTLVENYELPDGRVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTIQSADVDVRSA 241
           ++ + ++YELPDG+VI +G+ERF APE LF PS++ +E  G+ +  +N+I   DVDVR  
Sbjct: 234 SSAIEKSYELPDGQVITIGNERFRAPEALFHPSVLGLEAAGIDQTTYNSIMKCDVDVRKE 293

Query: 242 LYRAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLHNDPSRLDKFKVRIEDPPRRKHMVFI 301
           LY  IV+SGG++M+PG+  R++KE+  L         PS +   KV+I  PP RK+ V+I
Sbjct: 294 LYGNIVMSGGTTMFPGIAERMQKEITAL--------APSSM---KVKIIAPPERKYSVWI 342

Query: 302 GGAVLANIMADKDHMWLSKQEWQEMG 327
           GG++LA++   +  MW+SKQE+ E G
Sbjct: 343 GGSILASLTTFQ-QMWISKQEYDESG 367

>TBLA0C00440 Chr3 complement(81591..82708,83412..83421) [1128 bp,
           375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score =  297 bits (760), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 141/326 (43%), Positives = 218/326 (66%), Gaps = 13/326 (3%)

Query: 2   IGDEASAVRSYLQISYPMENGVIKNWSDMELLWDYAFYDQMQLPSTSGGKVMLTEPPMNP 61
           +GDEA + R  L + YP+E+G++ NW DME +W + FY+++++ +     V+LTE PMNP
Sbjct: 54  VGDEAQSKRGILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRV-APEEHPVLLTEAPMNP 112

Query: 62  VKNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLN 121
             NRE+M ++MFE ++    YV+IQAVL+LY+ G             TH+VP+Y    L 
Sbjct: 113 KSNREKMTQIMFETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSLP 172

Query: 122 HLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLDLDTKLARE 181
           H   R+D+AGRD+T +L+ +LS RGY+F+ +A+ E VR IKEKL YV+ D + + + A +
Sbjct: 173 HAIMRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQ 232

Query: 182 TTTLVENYELPDGRVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTIQSADVDVRSA 241
           ++++ ++YELPDG+VI +G+ERF APE LF PS++ +E  G+ +  +N+I   DVDVR  
Sbjct: 233 SSSIEKSYELPDGQVITIGNERFRAPEALFHPSVLSLESAGIDQTTYNSIMKCDVDVRKE 292

Query: 242 LYRAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLHNDPSRLDKFKVRIEDPPRRKHMVFI 301
           LY  IV+SGG++M+PG+  R++KE+  L         PS ++   V+I  PP RK+ V+I
Sbjct: 293 LYGNIVMSGGTTMFPGIAERMQKEITAL--------APSSME---VKIIAPPERKYSVWI 341

Query: 302 GGAVLANIMADKDHMWLSKQEWQEMG 327
           GG++LA++   +  MW+SKQE+ E G
Sbjct: 342 GGSILASLTTFQ-QMWISKQEYDESG 366

>ABR222W Chr2 (818719..818728,819032..820152) [1131 bp, 376 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YFL039C
           (ACT1); 1-intron
          Length = 376

 Score =  296 bits (759), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 142/326 (43%), Positives = 217/326 (66%), Gaps = 13/326 (3%)

Query: 2   IGDEASAVRSYLQISYPMENGVIKNWSDMELLWDYAFYDQMQLPSTSGGKVMLTEPPMNP 61
           +GDEA + R  L + YP+E+G++ NW DME +W + FY+++++ +     V+LTE PMNP
Sbjct: 55  VGDEAQSKRGILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRV-APEEHPVLLTEAPMNP 113

Query: 62  VKNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLN 121
             NRE+M ++MFE ++    YV+IQAVL+LY+ G             TH+VP+Y    L 
Sbjct: 114 KSNREKMTQIMFETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSLP 173

Query: 122 HLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLDLDTKLARE 181
           H   R+D+AGRD+T +L+ +LS RGY+F+ +A+ E VR IKEKL YV+ D + + + A +
Sbjct: 174 HAILRIDLAGRDMTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQ 233

Query: 182 TTTLVENYELPDGRVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTIQSADVDVRSA 241
           ++ + ++YELPDG+VI +G+ERF APE LF PS++ +E  G+ +  +N+I   DVDVR  
Sbjct: 234 SSAIEKSYELPDGQVITIGNERFRAPEALFHPSVLGLEAAGIDQTTYNSIMKCDVDVRKE 293

Query: 242 LYRAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLHNDPSRLDKFKVRIEDPPRRKHMVFI 301
           LY  IV+SGG++M+PG+  R++KE+  L         PS +   KV+I  PP RK+ V+I
Sbjct: 294 LYGNIVMSGGTTMFPGIAERMQKEITAL--------APSSM---KVKIIAPPERKYSVWI 342

Query: 302 GGAVLANIMADKDHMWLSKQEWQEMG 327
           GG++LA++   +  MW+SKQE+ E G
Sbjct: 343 GGSILASLTTFQ-QMWISKQEYDESG 367

>ZYRO0F02772g Chr6 complement(235322..236439,236524..236533) [1128
           bp, 375 aa] {ON} uniprot|Q2HWE7 Zygosaccharomyces rouxii
           ACT1 Actin
          Length = 375

 Score =  296 bits (759), Expect = 3e-98,   Method: Compositional matrix adjust.
 Identities = 142/326 (43%), Positives = 218/326 (66%), Gaps = 13/326 (3%)

Query: 2   IGDEASAVRSYLQISYPMENGVIKNWSDMELLWDYAFYDQMQLPSTSGGKVMLTEPPMNP 61
           +GDEA + R  L + YP+E+G++ NW DME +W + FY+++++ +     V+LTE PMNP
Sbjct: 54  VGDEAQSKRGILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRV-APEEHPVLLTEAPMNP 112

Query: 62  VKNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLN 121
             NRE+M ++MFE ++    YV+IQAVL+LY+ G             TH+VP+Y    + 
Sbjct: 113 KSNREKMTQIMFETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSMP 172

Query: 122 HLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLDLDTKLARE 181
           H   R+D+AGRD+T +L+ +LS RGY+F+ +A+ E VR IKEKL YV+ D + + + A +
Sbjct: 173 HAILRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQ 232

Query: 182 TTTLVENYELPDGRVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTIQSADVDVRSA 241
           ++++ ++YELPDG+VI +G+ERF APE LF PS++ +E  GV +  +N+I   DVDVR  
Sbjct: 233 SSSVEKSYELPDGQVITIGNERFRAPEALFHPSVLSLESSGVDQTTYNSIMKCDVDVRKD 292

Query: 242 LYRAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLHNDPSRLDKFKVRIEDPPRRKHMVFI 301
           LY  IV+SGG++M+PG+  R++KE+  L         PS +   KV+I  PP RK+ V+I
Sbjct: 293 LYGNIVMSGGTTMFPGIAERMQKEITAL--------APSSM---KVKIIAPPERKYSVWI 341

Query: 302 GGAVLANIMADKDHMWLSKQEWQEMG 327
           GG++LA++   +  MW+SKQE+ E G
Sbjct: 342 GGSILASLTTFQ-QMWISKQEYDESG 366

>Kpol_1058.15 s1058 complement(49082..50199,50349..50358) [1128 bp,
           375 aa] {ON} complement(49082..50199,50349..50358) [1128
           nt, 376 aa]
          Length = 375

 Score =  296 bits (757), Expect = 4e-98,   Method: Compositional matrix adjust.
 Identities = 141/326 (43%), Positives = 218/326 (66%), Gaps = 13/326 (3%)

Query: 2   IGDEASAVRSYLQISYPMENGVIKNWSDMELLWDYAFYDQMQLPSTSGGKVMLTEPPMNP 61
           +GDEA + R  L + YP+E+G++ NW DME +W + FY+++++ +     V+LTE PMNP
Sbjct: 54  VGDEAQSKRGILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRV-APEEHPVLLTEAPMNP 112

Query: 62  VKNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLN 121
             NRE+M ++MFE ++    YV+IQAVL+LY+ G             TH+VP+Y    + 
Sbjct: 113 KSNREKMTQIMFETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSMP 172

Query: 122 HLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLDLDTKLARE 181
           H   R+D+AGRD+T +L+ +LS RGY+F+ +A+ E VR IKEKL YV+ D + + + A +
Sbjct: 173 HGILRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQ 232

Query: 182 TTTLVENYELPDGRVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTIQSADVDVRSA 241
           ++++ ++YELPDG+VI +G+ERF APE LF PS++ +E  G+ +  +N+I   DVDVR  
Sbjct: 233 SSSIEKSYELPDGQVITIGNERFRAPEALFHPSVLGLESSGIDQTTYNSIMKCDVDVRKE 292

Query: 242 LYRAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLHNDPSRLDKFKVRIEDPPRRKHMVFI 301
           LY  IV+SGG++M+PG+  R++KE+  L         PS +   KV+I  PP RK+ V+I
Sbjct: 293 LYGNIVMSGGTTMFPGIAERMQKEITAL--------APSSM---KVKIIAPPERKYSVWI 341

Query: 302 GGAVLANIMADKDHMWLSKQEWQEMG 327
           GG++LA++   +  MW+SKQE+ E G
Sbjct: 342 GGSILASLTTFQ-QMWISKQEYDESG 366

>Kwal_14.1109 s14 complement(199181..200263) [1083 bp, 360 aa] {ON}
           YFL039C (ACT1) - Actin [contig 244] FULL
          Length = 360

 Score =  295 bits (755), Expect = 5e-98,   Method: Compositional matrix adjust.
 Identities = 142/326 (43%), Positives = 217/326 (66%), Gaps = 13/326 (3%)

Query: 2   IGDEASAVRSYLQISYPMENGVIKNWSDMELLWDYAFYDQMQLPSTSGGKVMLTEPPMNP 61
           +GDEA + R  L + YP+E+G++ NW DME +W + FY+++++ +     V+LTE PMNP
Sbjct: 39  VGDEAQSKRGILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRV-APEEHPVLLTEAPMNP 97

Query: 62  VKNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLN 121
             NRE+M +++FE ++    YV+IQAVL+LY+ G             TH+VP+Y    L 
Sbjct: 98  KSNREKMTQILFETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSLP 157

Query: 122 HLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLDLDTKLARE 181
           H   R+D+AGRD+T +L+ +LS RGY+F+ +A+ E VR IKEKL YV+ D + + + A +
Sbjct: 158 HGILRIDLAGRDMTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQ 217

Query: 182 TTTLVENYELPDGRVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTIQSADVDVRSA 241
           ++ + ++YELPDG+VI +G+ERF APE LF PSL+ +E  G+ +  +N+I   DVDVR  
Sbjct: 218 SSAIEKSYELPDGQVITIGNERFRAPEALFHPSLLGLEAAGIDQTAYNSIMKCDVDVRKE 277

Query: 242 LYRAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLHNDPSRLDKFKVRIEDPPRRKHMVFI 301
           LY  IV+SGG++M+PG+  R++KE+  L         PS +   KV+I  PP RK+ V+I
Sbjct: 278 LYGNIVMSGGTTMFPGIAERMQKEITAL--------APSSM---KVKIIAPPERKYSVWI 326

Query: 302 GGAVLANIMADKDHMWLSKQEWQEMG 327
           GG++LA++   +  MW+SKQE+ E G
Sbjct: 327 GGSILASLTTFQ-QMWISKQEYDESG 351

>SAKL0B00968g Chr2 complement(89966..91083,91524..91533) [1128 bp,
           375 aa] {ON} highly similar to uniprot|P02579
           Saccharomyces cerevisiae YFL039C ACT1 Actin
          Length = 375

 Score =  296 bits (757), Expect = 6e-98,   Method: Compositional matrix adjust.
 Identities = 141/326 (43%), Positives = 217/326 (66%), Gaps = 13/326 (3%)

Query: 2   IGDEASAVRSYLQISYPMENGVIKNWSDMELLWDYAFYDQMQLPSTSGGKVMLTEPPMNP 61
           +GDEA + R  L + YP+E+G++ NW DME +W + FY+++++ +     V+LTE PMNP
Sbjct: 54  VGDEAQSKRGILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRV-APEEHPVLLTEAPMNP 112

Query: 62  VKNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLN 121
             NRE+M +++FE ++    YV+IQAVL+LY+ G             TH+VP+Y    L 
Sbjct: 113 KSNREKMTQILFETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSLP 172

Query: 122 HLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLDLDTKLARE 181
           H   R+D+AGRD+T +L+ +LS RGY+F+ +A+ E VR IKEKL YV+ D + + + A +
Sbjct: 173 HAILRIDLAGRDMTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQ 232

Query: 182 TTTLVENYELPDGRVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTIQSADVDVRSA 241
           ++ + ++YELPDG+VI +G+ERF APE LF PS++ +E  G+ +  +N+I   DVDVR  
Sbjct: 233 SSAIEKSYELPDGQVITIGNERFRAPEALFHPSVLGLEAAGIDQTTYNSIMKCDVDVRKE 292

Query: 242 LYRAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLHNDPSRLDKFKVRIEDPPRRKHMVFI 301
           LY  IV+SGG++M+PG+  R++KE+  L         PS +   KV+I  PP RK+ V+I
Sbjct: 293 LYGNIVMSGGTTMFPGIAERMQKEITAL--------APSSM---KVKIIAPPERKYSVWI 341

Query: 302 GGAVLANIMADKDHMWLSKQEWQEMG 327
           GG++LA++   +  MW+SKQE+ E G
Sbjct: 342 GGSILASLTTFQ-QMWISKQEYDESG 366

>KLLA0D05357g Chr4 (461726..461735,462516..463633) [1128 bp, 375 aa]
           {ON} highly similar to uniprot|P60010 Saccharomyces
           cerevisiae YFL039C ACT1 Actin structural protein
           involved in cell polarization endocytosis and other
           cytoskeletal functions
          Length = 375

 Score =  295 bits (756), Expect = 6e-98,   Method: Compositional matrix adjust.
 Identities = 140/326 (42%), Positives = 217/326 (66%), Gaps = 13/326 (3%)

Query: 2   IGDEASAVRSYLQISYPMENGVIKNWSDMELLWDYAFYDQMQLPSTSGGKVMLTEPPMNP 61
           +GDEA + R  L + YP+E+G++ NW DME +W + FY+++++ +     V+LTE PMNP
Sbjct: 54  VGDEAQSKRGILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRV-APEEHPVLLTEAPMNP 112

Query: 62  VKNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLN 121
             NRE+M +++FE ++    YV+IQAVL+LY+ G             TH+VP+Y    L 
Sbjct: 113 KNNREKMTQILFETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSLP 172

Query: 122 HLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLDLDTKLARE 181
           H   R+D+AGRD+T +L+ +L+ RGY+F+ +A+ E VR IKEKL YV+ D + + + A +
Sbjct: 173 HAILRIDLAGRDITDYLMKILAERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTASQ 232

Query: 182 TTTLVENYELPDGRVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTIQSADVDVRSA 241
           ++ + ++YELPDG+VI +G+ERF APE LF PS++ +E  G+ +  +N+I   DVDVR  
Sbjct: 233 SSAVEKSYELPDGQVITIGNERFRAPEALFHPSVLSLEAAGIDQTTYNSIMKCDVDVRKE 292

Query: 242 LYRAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLHNDPSRLDKFKVRIEDPPRRKHMVFI 301
           LY  IV+SGG++M+PG+  R++KE+  L         PS +   KV+I  PP RK+ V+I
Sbjct: 293 LYGNIVMSGGTTMFPGIAERMQKEITAL--------APSSM---KVKIIAPPERKYSVWI 341

Query: 302 GGAVLANIMADKDHMWLSKQEWQEMG 327
           GG++LA++   +  MW+SKQE+ E G
Sbjct: 342 GGSILASLTTFQ-QMWISKQEYDESG 366

>KLTH0G18832g Chr7 (1626178..1626187,1626854..1627971) [1128 bp, 375
           aa] {ON} highly similar to uniprot|P60010 Saccharomyces
           cerevisiae YFL039C ACT1 Actin structural protein
           involved in cell polarization endocytosis and other
           cytoskeletal functions
          Length = 375

 Score =  295 bits (756), Expect = 8e-98,   Method: Compositional matrix adjust.
 Identities = 142/326 (43%), Positives = 217/326 (66%), Gaps = 13/326 (3%)

Query: 2   IGDEASAVRSYLQISYPMENGVIKNWSDMELLWDYAFYDQMQLPSTSGGKVMLTEPPMNP 61
           +GDEA + R  L + YP+E+G++ NW DME +W + FY+++++ +     V+LTE PMNP
Sbjct: 54  VGDEAQSKRGILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRV-APEEHPVLLTEAPMNP 112

Query: 62  VKNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLN 121
             NRE+M +++FE ++    YV+IQAVL+LY+ G             TH+VP+Y    L 
Sbjct: 113 KSNREKMTQILFETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSLP 172

Query: 122 HLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLDLDTKLARE 181
           H   R+D+AGRD+T +L+ +LS RGY+F+ +A+ E VR IKEKL YV+ D + + + A +
Sbjct: 173 HGILRIDLAGRDMTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQ 232

Query: 182 TTTLVENYELPDGRVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTIQSADVDVRSA 241
           ++ + ++YELPDG+VI +G+ERF APE LF PSL+ +E  G+ +  +N+I   DVDVR  
Sbjct: 233 SSAIEKSYELPDGQVITIGNERFRAPEALFHPSLLGLEAAGIDQTAYNSIMKCDVDVRKE 292

Query: 242 LYRAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLHNDPSRLDKFKVRIEDPPRRKHMVFI 301
           LY  IV+SGG++M+PG+  R++KE+  L         PS +   KV+I  PP RK+ V+I
Sbjct: 293 LYGNIVMSGGTTMFPGIAERMQKEITAL--------APSSM---KVKIIAPPERKYSVWI 341

Query: 302 GGAVLANIMADKDHMWLSKQEWQEMG 327
           GG++LA++   +  MW+SKQE+ E G
Sbjct: 342 GGSILASLTTFQ-QMWISKQEYDESG 366

>SAKL0E11814g Chr5 complement(984199..985338) [1140 bp, 379 aa] {ON}
           highly similar to gnl|GLV|KLLA0E23012g Kluyveromyces
           lactis KLLA0E23012g and similar to uniprot|P38696
           Saccharomyces cerevisiae YHR129C ARP1 Actin- related
           protein of the dynactin complex required for spindle
           orientation and nuclear migration putative ortholog of
           mammalian centractin
          Length = 379

 Score =  259 bits (661), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 138/335 (41%), Positives = 202/335 (60%), Gaps = 14/335 (4%)

Query: 1   MIGDEASAVRSYLQISYPMENGVIKNWSDMELLWDYAFYDQMQLPSTSGGKVMLTEPPMN 60
            IG++A  +R  L++ YP+E+G++KNWSDMEL+W++ F+  +QL +     V+ TE P+N
Sbjct: 57  FIGNQAQELRGLLKLRYPLEHGIVKNWSDMELIWNHVFHKSLQLNNIEEHPVLATEAPLN 116

Query: 61  PVKNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVL 120
           P+KNRE MCE++FE ++   VYV+IQAVL+LYA G              H VPV++   L
Sbjct: 117 PLKNREAMCEMLFETFNVPAVYVSIQAVLSLYASGRTTGCVLDCGDGCCHSVPVFDGFSL 176

Query: 121 NHLTRRLDVAGRDVTRHLIDLLSR-RGYAFNRSADFETVRQIKEKLSYVSYDLDLDTKLA 179
               RR+DVAGRDVT  L  LL +  G +   S++ E VR IKEK  YV+ D  L  +  
Sbjct: 177 PSSIRRIDVAGRDVTEFLQLLLRKTTGVSLLSSSEREIVRIIKEKACYVARD-PLTEEQT 235

Query: 180 RETTTLVENYELPDGRVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTIQSADVDVR 239
              T     ++LPDG+V+ + +E+F APE LFQP L+  E   + EM   +I   D+D+R
Sbjct: 236 YHLTPTSTIFKLPDGKVLDLKNEKFRAPEVLFQPQLIGSEFESIPEMCHQSISKVDLDLR 295

Query: 240 SALYRAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLHNDPSRLDKFKVRIEDPPRRKHMV 299
            AL   IVLSGG++M+PG   RL  EL+ L       ++P    + K++I  PP RK+  
Sbjct: 296 PALLSNIVLSGGTTMFPGFGDRLLTELRNL-------SEP----QTKIKIFAPPERKYST 344

Query: 300 FIGGAVLANIMADKDHMWLSKQEWQEMGSAAMSKF 334
           +IGG++L+ +   K  +W++K EWQE      S+F
Sbjct: 345 WIGGSILSGLSTFKK-IWVTKSEWQENPDCVHSRF 378

>AFR051W Chr6 (522829..524046) [1218 bp, 405 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHR129C (ARP1)
          Length = 405

 Score =  251 bits (642), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 129/335 (38%), Positives = 199/335 (59%), Gaps = 14/335 (4%)

Query: 1   MIGDEASAVRSYLQISYPMENGVIKNWSDMELLWDYAFYDQMQLPSTSGGKVMLTEPPMN 60
            IG++A  +R  L++ YP+++G++ NW+DME +W Y F   +QL +      ++TE P+N
Sbjct: 83  FIGNQAQELRGLLKLRYPLQHGIVTNWADMEQVWGYVFNKSLQLQNVEDHPNLVTEAPLN 142

Query: 61  PVKNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVL 120
           P KNRE+MCE++FE ++   +YV++QAVL+LYA G              H VPV++   +
Sbjct: 143 PHKNREKMCELLFESFNVPALYVSVQAVLSLYASGRTTGCVVDCGDGCCHAVPVFDGFSV 202

Query: 121 NHLTRRLDVAGRDVTRHLIDLLSR-RGYAFNRSADFETVRQIKEKLSYVSYDLDLDTKLA 179
               RR+D+AGRD+T  L  LL +  G +   S++ E VR IKEK  +V+ D  L+ +  
Sbjct: 203 PSSIRRIDIAGRDITEFLQLLLRKTTGVSLLSSSEREIVRTIKEKACFVTKDPKLEEQNF 262

Query: 180 RETTTLVENYELPDGRVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTIQSADVDVR 239
               +    ++LPDG+ I++G ER+ APE LFQP L+  E   + +M + +I   D+D+R
Sbjct: 263 PMNPSF-SKFKLPDGKTIELGQERYRAPEILFQPELIGSEFESLPDMCYQSIGKVDLDLR 321

Query: 240 SALYRAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLHNDPSRLDKFKVRIEDPPRRKHMV 299
           S LY  I+LSGG+SM PG   RL KELK L  +R            K++I  PP RK+  
Sbjct: 322 SLLYSNILLSGGTSMLPGFGDRLLKELKSLSGSRT-----------KIKIFAPPERKYST 370

Query: 300 FIGGAVLANIMADKDHMWLSKQEWQEMGSAAMSKF 334
           +IGG++L+ +   K  +W++K EW+E      S+F
Sbjct: 371 WIGGSILSGLSTFKK-LWVTKSEWEEFPDCIHSRF 404

>Ecym_6385 Chr6 complement(749508..750641) [1134 bp, 377 aa] {ON}
           similar to Ashbya gossypii AFR051W
          Length = 377

 Score =  248 bits (633), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 127/338 (37%), Positives = 201/338 (59%), Gaps = 20/338 (5%)

Query: 1   MIGDEASAVRSYLQISYPMENGVIKNWSDMELLWDYAFYDQMQLPSTSGGKVMLTEPPMN 60
            IG++A  +R  L++ +P+E+G++KNWSDME +W Y F   +QL +     +++TE P+N
Sbjct: 55  FIGNQAQELRGLLKLRHPVEHGIVKNWSDMEHIWSYVFNKSLQLQNVEDHPILITEAPLN 114

Query: 61  PVKNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVL 120
           P  NRE+MCE++FE ++   +YV+IQAVL+LYA G              H VPV++   +
Sbjct: 115 PRNNRERMCELLFESFNVPALYVSIQAVLSLYASGRTTGCVVDCGDGCCHAVPVFDGFSI 174

Query: 121 NHLTRRLDVAGRDVTRHLIDLLSR-RGYAFNRSADFETVRQIKEKLSYVSYDLDLDTKLA 179
               RR+D+AGRD+T  L  LL +  G +   S++ E VR IKEK  YV+ D  ++    
Sbjct: 175 PSSIRRIDIAGRDITEFLQLLLRKTTGVSLLSSSEREVVRIIKEKACYVAKDPHIE---- 230

Query: 180 RETTTLVENY---ELPDGRVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTIQSADV 236
            +  ++  NY   +LPDG+ I +G E+F APE LFQP L+  E   + +M + +I+  D+
Sbjct: 231 EQNFSINPNYTKFKLPDGKTIDLGQEKFRAPEILFQPELIGSEFESLPDMCYQSIEKVDL 290

Query: 237 DVRSALYRAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLHNDPSRLDKFKVRIEDPPRRK 296
           D+RS L+  ++LSGG+S+ PG   RL  ELK L  ++            K++I  PP RK
Sbjct: 291 DLRSLLFSNVLLSGGTSILPGFGDRLLSELKSLSDSQT-----------KIKIFAPPERK 339

Query: 297 HMVFIGGAVLANIMADKDHMWLSKQEWQEMGSAAMSKF 334
           +  +IGG++L+ +   K  +W+++ EW+E      S+F
Sbjct: 340 YSTWIGGSILSGLSTFK-KLWVTRAEWEEAADCIHSRF 376

>KLTH0B05940g Chr2 complement(485135..486286) [1152 bp, 383 aa] {ON}
           similar to uniprot|P38696 Saccharomyces cerevisiae
           YHR129C ARP1 Actin-related protein of the dynactin
           complex required for spindle orientation and nuclear
           migration putative ortholog of mammalian centractin
          Length = 383

 Score =  242 bits (618), Expect = 5e-77,   Method: Compositional matrix adjust.
 Identities = 128/337 (37%), Positives = 205/337 (60%), Gaps = 15/337 (4%)

Query: 1   MIGDEASAVRSYLQISYPMENGVIKNWSDMELLWDYAFYDQMQLPSTSGGKVMLTEPPMN 60
           +IG+EA  +R  L++ YP+E+GV+++W  +E LW + FY+ ++L +     +++TE P+N
Sbjct: 58  LIGNEAQKMRGLLKLHYPLEHGVVQDWPGLEQLWTHVFYNSLKLANIEEHPMLITEAPLN 117

Query: 61  PVKNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVL 120
           P+KNR +MCE++FE +    VYV+IQAVLALYA G                VPVY+   L
Sbjct: 118 PMKNRNKMCEMLFETFGSPAVYVSIQAVLALYAGGRTTGCVIDCGDGCCQSVPVYDGFTL 177

Query: 121 NHLTRRLDVAGRDVTRHLIDLLSR-RGYAFNRSADFETVRQIKEKLSYVSYDLDLDTK-- 177
               +R+DVAGRD+T  L  LL +  G   + S++ E VR IKEK  +V+ D+  + +  
Sbjct: 178 PSAIQRIDVAGRDITEFLQLLLRKSSGVTLSSSSEREIVRMIKEKACFVATDVGNEEQNY 237

Query: 178 LARETTTLVENYELPDGRVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTIQSADVD 237
               +  L   ++LPDG+++ +G+E+F APE LFQP L+  E   + EM   +I   D+D
Sbjct: 238 EGANSAELETRFKLPDGKILTLGAEKFRAPEVLFQPHLIGSEFCSIQEMCQQSISKVDLD 297

Query: 238 VRSALYRAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLHNDPSRLDKFKVRIEDPPRRKH 297
           +RS+LY +IVLSGGS+M+ G   RL  E+++        ++P+     K++I  PP RK+
Sbjct: 298 LRSSLYSSIVLSGGSTMFSGFGDRLLSEIRKT-------SEPNT----KIKIFAPPERKY 346

Query: 298 MVFIGGAVLANIMADKDHMWLSKQEWQEMGSAAMSKF 334
             +IGG++LA  ++  + +W+++ EWQE      S+F
Sbjct: 347 STWIGGSILAG-LSTFEKLWVTRAEWQENPQCIHSRF 382

>KLLA0E22925g Chr5 complement(2040279..2041421) [1143 bp, 380 aa]
           {ON} similar to uniprot|P38696 Saccharomyces cerevisiae
           YHR129C ARP1 Actin-related protein of the dynactin
           complex required for spindle orientation and nuclear
           migration putative ortholog of mammalian centractin
          Length = 380

 Score =  241 bits (615), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 129/339 (38%), Positives = 204/339 (60%), Gaps = 22/339 (6%)

Query: 1   MIGDEASAVRSYLQISYPMENGVIKNWSDMELLWDYAFYDQMQLPSTSGGKVMLTEPPMN 60
            +G++A  +R  L++ +P+E+GV+ +W+ +E LW + F   +QL S     V++TE P+N
Sbjct: 58  FVGNQAQEIRGLLKLRHPLEHGVVTDWNALEQLWGHVFEKGLQLSSLQDHPVLVTEAPLN 117

Query: 61  PVKNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVL 120
           P KNREQMCE++FE +    VYV+IQAVL+LYA G             +H VPVY+   L
Sbjct: 118 PKKNREQMCELLFETFSVPAVYVSIQAVLSLYASGRTTGCVLDSGDGCSHAVPVYDGYTL 177

Query: 121 NHLTRRLDVAGRDVTRHLIDLLSRR--GYAFNRSADFETVRQIKEKLSYVSYDLDLDTKL 178
               RR+D+AGRD++  L+ +L R+  G +   S++ E VR IKEK  Y++    LD K 
Sbjct: 178 PSAIRRIDIAGRDIS-ELLQVLIRKSTGVSLLSSSEREIVRIIKEKACYIA----LDPKE 232

Query: 179 ARETTTLVEN---YELPDGRVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTIQSAD 235
             +  T+      + LPDG+ I++ +E+F APE LF P L+  E   + E+L+ +IQ  D
Sbjct: 233 EEKNYTMHGKQTMFRLPDGKQIELDNEKFRAPEILFNPQLIGSEFQSLPEILYESIQKVD 292

Query: 236 VDVRSALYRAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLHNDPSRLDKFKVRIEDPPRR 295
           +D+R++L+  IV SGG++M PG   R+ KELK       L  +P    + K++I  PP R
Sbjct: 293 LDLRTSLFSNIVFSGGTTMIPGFGDRVLKELK-------LSCEP----QTKIKIFAPPER 341

Query: 296 KHMVFIGGAVLANIMADKDHMWLSKQEWQEMGSAAMSKF 334
           K+  +IGG++L+ +   K  +W++K+EW+E      ++F
Sbjct: 342 KYSTWIGGSILSGLSTFK-KIWVTKKEWEENPRCVHARF 379

>Kpol_1023.18 s1023
           complement(36072..36143,36193..36201,36244..37112,
           37854..37863) [960 bp, 319 aa] {ON}
           complement(36072..36143,36193..36201,36244..37112,
           37854..37863) [960 nt, 320 aa]
          Length = 319

 Score =  232 bits (591), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 105/241 (43%), Positives = 163/241 (67%), Gaps = 1/241 (0%)

Query: 2   IGDEASAVRSYLQISYPMENGVIKNWSDMELLWDYAFYDQMQLPSTSGGKVMLTEPPMNP 61
           +GDEA + R  L + YP+E+G++ NW DME +W + FY+++++ +     V+LTE PMNP
Sbjct: 54  VGDEAQSKRGILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRV-APEEHPVLLTEAPMNP 112

Query: 62  VKNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLN 121
             NRE+M ++MFE ++    YV+IQAVL+LY+ G             TH+VP+Y    + 
Sbjct: 113 KSNREKMTQIMFETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSMP 172

Query: 122 HLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLDLDTKLARE 181
           H   R+D+AGRD+T +L+ +LS RGY+F+ +A+ E VR IKEKL YV+ D + + + A +
Sbjct: 173 HGILRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQ 232

Query: 182 TTTLVENYELPDGRVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTIQSADVDVRSA 241
           ++++ ++YELPDG+VI +G+ERF APE LF PS++ +E  G+ +  +N+I   DVDVR  
Sbjct: 233 SSSIEKSYELPDGQVITIGNERFRAPEALFHPSVLGLESSGIDQTTYNSIMKCDVDVRKE 292

Query: 242 L 242
           L
Sbjct: 293 L 293

>NCAS0B07130 Chr2 complement(1354064..1355209) [1146 bp, 381 aa]
           {ON} Anc_2.117
          Length = 381

 Score =  228 bits (581), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 118/326 (36%), Positives = 182/326 (55%), Gaps = 14/326 (4%)

Query: 2   IGDEASAVRSYLQISYPMENGVIKNWSDMELLWDYAFYDQMQLPSTSGGKVMLTEPPMNP 61
           IG+ A   R  L++ +PM  G+++NW DME LW + F D +++       +++TE P+NP
Sbjct: 60  IGNRAQKSRGLLRLRHPMNRGIVENWDDMETLWSHTFNDILKINDFDEHPLLITEAPLNP 119

Query: 62  VKNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLN 121
            KNR++MCEV FEK+DF  VY+A  + L+LYA G                VP+YE   L 
Sbjct: 120 EKNRDKMCEVFFEKFDFAAVYIANPSTLSLYASGRTTGCVLDCGDGYCSSVPIYEGFALP 179

Query: 122 HLTRRLDVAGRDVTRHL-IDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLDLDTKLAR 180
              RR+DV GRDVT  L   +    G +   S++ E V+ +KEK  YVS D   D  ++ 
Sbjct: 180 SSIRRIDVGGRDVTEQLQFQIRKYTGISLYSSSEHEIVKNVKEKACYVSTDFAHDEDMSN 239

Query: 181 ETTTLVE-NYELPDGRVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTIQSADVDVR 239
                +   ++LPDG+ + +   RF APE LF+P ++ +E   V +M F +I   D+++R
Sbjct: 240 LNPEKIRCQFKLPDGKDLILDKARFRAPEILFRPQIMGLEYDSVSDMCFESISKVDLELR 299

Query: 240 SALYRAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLHNDPSRLDKFKVRIEDPPRRKHMV 299
             L+ +I+L+GGS+M+ G   RL KEL+     + L           ++I  PP RK+  
Sbjct: 300 PKLFSSIILNGGSTMFRGFGDRLLKELQIRTGNKNL-----------IKIIAPPERKYTS 348

Query: 300 FIGGAVLANIMADKDHMWLSKQEWQE 325
           +IGG++L  +   K  +W++K EWQE
Sbjct: 349 WIGGSILTGLSTFK-QLWMTKAEWQE 373

>ZYRO0G05676g Chr7 (452257..453402) [1146 bp, 381 aa] {ON} similar
           to uniprot|P38696 Saccharomyces cerevisiae YHR129C ARP1
           Actin-related protein of the dynactin complex required
           for spindle orientation and nuclear migration putative
           ortholog of mammalian centractin
          Length = 381

 Score =  226 bits (576), Expect = 8e-71,   Method: Compositional matrix adjust.
 Identities = 123/337 (36%), Positives = 197/337 (58%), Gaps = 14/337 (4%)

Query: 1   MIGDEASAVRSYLQISYPMENGVIKNWSDMELLWDYAFYDQMQLPSTSGGKVMLTEPPMN 60
            +G+ A   RS LQ+ +P+++GV+KNW+DMEL+WDY F D+++L       V++TE P+N
Sbjct: 57  FVGNLAQERRSILQLRHPVDHGVVKNWNDMELIWDYMFKDKLKLKDVDEHPVLITEAPLN 116

Query: 61  PVKNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVL 120
           PV NR++MC+++FE +    +YVA  AVL+LYA G             +  VPVY+   L
Sbjct: 117 PVSNRDEMCDLLFESFGVQALYVANPAVLSLYASGKISGCVLDCGDGYSCSVPVYQGYTL 176

Query: 121 NHLTRRLDVAGRDVTRHL-IDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLDL-DTKL 178
               +R+D+ GRD+T  L + L    G +   S + E VR IKEK  YV+ DLD+ + K 
Sbjct: 177 KSAIKRIDLGGRDLTEQLQLQLRKSTGLSLTTSGEMELVRMIKEKSCYVAVDLDIEEEKC 236

Query: 179 ARETTTLVENYELPDGRVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTIQSADVDV 238
             E   +   ++LPDG+ I +  +RF+ PE LFQPS++  E   + E+++ ++   D D+
Sbjct: 237 NYEGDQVGLKFKLPDGKFITLSKDRFQVPEILFQPSVISSEVSSIPEIIWQSVSKLDTDL 296

Query: 239 RSALYRAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLHNDPSRLDKFKVRIEDPPRRKHM 298
           R  ++  I+LSGG++M  G  +RL +EL +L              + +V+I  PP RK+ 
Sbjct: 297 RPQMWSDILLSGGTTMLKGFGNRLVQELDKL-----------NQAQSRVKIWAPPERKYT 345

Query: 299 VFIGGAVLANIMADKDHMWLSKQEWQEMGSAAMSKFG 335
            +IGG++LA  ++    + ++K +WQE  S   +K G
Sbjct: 346 SWIGGSILAE-LSTFQKIIVTKSQWQEDPSIIHTKCG 381

>Kwal_33.14642 s33 (753758..754909) [1152 bp, 383 aa] {ON} YHR129C
           (ARP1) - Centractin [contig 388] FULL
          Length = 383

 Score =  225 bits (573), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 126/338 (37%), Positives = 206/338 (60%), Gaps = 17/338 (5%)

Query: 1   MIGDEASAVRSYLQISYPMENGVIKNWSDMELLWDYAFYDQMQLPSTSGGKVMLTEPPMN 60
           ++G+EA   R  L++ YP+E+G++++WS +E LW + FY  ++L +     +++TE P+N
Sbjct: 58  LVGNEAQKQRGLLRLQYPVEHGIVQDWSGLEQLWTHVFYSSLKLNNIGDHPMLVTEAPLN 117

Query: 61  PVKNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVL 120
           P++NR++MCE+++E ++   VYV+IQAVLALYA G                VPVY+   +
Sbjct: 118 PLENRDKMCEMLYETFNVPAVYVSIQAVLALYAGGRTTGCVIDCGDGCCQSVPVYDGFSI 177

Query: 121 NHLTRRLDVAGRDVTRHLIDLLSRR-GYAFNRSADFETVRQIKEKLSYVSYDLDLDTK-- 177
               RR+DVAGRDVT  L  LL +  G     S++ E VR IKEK  YV+ ++  + +  
Sbjct: 178 PSAIRRIDVAGRDVTEFLQLLLRKSIGVTLLSSSEREIVRMIKEKACYVAPEVAAEEQKY 237

Query: 178 LARETTTLVENYELPDGRVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTIQSADVD 237
            +   +  +  ++LPDG+++ +G+E+F APE LFQP L+  E   + +M F +I   D+D
Sbjct: 238 ASSRGSEELTKFKLPDGKILSLGAEKFRAPEILFQPQLIGSEFNSIQDMCFQSISKVDLD 297

Query: 238 VRSALYRAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLHNDPSRLD-KFKVRIEDPPRRK 296
           +RS+LY ++VLSGGS+++ G   RL  EL+            SR +   K++I  PP RK
Sbjct: 298 LRSSLYSSLVLSGGSTLFAGFGDRLLNELR------------SRCEPNVKIKIFAPPERK 345

Query: 297 HMVFIGGAVLANIMADKDHMWLSKQEWQEMGSAAMSKF 334
           + V+IGG++LA  ++  + +W+++ EWQE      S+F
Sbjct: 346 YSVWIGGSILAG-LSTFEKIWVTRSEWQENPQCVHSRF 382

>TBLA0B01070 Chr2 (236811..237962) [1152 bp, 383 aa] {ON} Anc_2.117
           YHR129C
          Length = 383

 Score =  224 bits (570), Expect = 7e-70,   Method: Compositional matrix adjust.
 Identities = 122/338 (36%), Positives = 188/338 (55%), Gaps = 18/338 (5%)

Query: 1   MIGDEASAVRSYLQISYPMENGVIKNWSDMELLWDYAFYDQMQLPSTSGGKVMLTEPPMN 60
            +G+ A   R  L++ YPM++G+I+NW  ME +WD+ F D +++ +     +++TE P+N
Sbjct: 59  FVGNLAQEYRGLLKLRYPMDHGIIENWEHMETVWDHIFKDCLKVSNLGEHPLVVTEAPLN 118

Query: 61  PVKNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVL 120
           P  NRE+MCE +FE ++   +Y+A  AVL+LYA G                VP+YE   L
Sbjct: 119 PKPNREKMCETLFESFNIPALYIANPAVLSLYASGRTTGCVVEAGDGYCSSVPIYEGFAL 178

Query: 121 NHLTRRLDVAGRDVTRHL-IDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLDLDTK-- 177
               RR+D+ GRD+T+HL + L    G     S++ E VR IKE   Y+  +   + +  
Sbjct: 179 TPSIRRIDIGGRDITKHLQLQLRKSTGMWLYSSSEQEIVRLIKENGCYICSNHKKEEEKF 238

Query: 178 -LARETTTLVENYELPDGRVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTIQSADV 236
            L +E  ++  +++LPDG+ + +G  RF APE LF P L+  E   + +M+  +I   D+
Sbjct: 239 LLDQEKKSI--SFKLPDGKNLVIGPGRFRAPEILFNPLLIGSEDSSLPDMIMQSISKVDI 296

Query: 237 DVRSALYRAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLHNDPSRLDKFKVRIEDPPRRK 296
           D+RS L   I LSGGS+M+ G   RL  EL           D S     KVRI  PP RK
Sbjct: 297 DLRSKLLNNITLSGGSTMFQGFCDRLITEL-----------DFSVDKTTKVRILAPPERK 345

Query: 297 HMVFIGGAVLANIMADKDHMWLSKQEWQEMGSAAMSKF 334
           +  FIGG++LAN+   ++ MW++K +W+       +KF
Sbjct: 346 YSAFIGGSILANLSTFRN-MWVTKDQWEGDNRIIENKF 382

>KAFR0F00590 Chr6 (120359..121519) [1161 bp, 386 aa] {ON} Anc_2.117
           YHR129C
          Length = 386

 Score =  220 bits (561), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 115/335 (34%), Positives = 187/335 (55%), Gaps = 14/335 (4%)

Query: 1   MIGDEASAVRSYLQISYPMENGVIKNWSDMELLWDYAFYDQMQLPSTSGGKVMLTEPPMN 60
            IG++A   R  L++ +PM  GV++NW DME +W Y F D + L + +   +++TEPP+N
Sbjct: 61  FIGNKAQKYRGILKLRHPMLRGVVQNWDDMETIWQYVFDDTLYLENLNEHPILITEPPLN 120

Query: 61  PVKNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVL 120
            + NR++MCE +FE + F  VY+++  VL+LYA G                +PVY    L
Sbjct: 121 NMANRQKMCEALFEIFGFPAVYISVSPVLSLYASGQTTGCAVDCGDGYCTSIPVYNGFSL 180

Query: 121 NHLTRRLDVAGRDVTRHL-IDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLDLDT-KL 178
               +++D+ G D+T  L   +L   G     S++ E VR IKEK+ Y++ D +L+T K 
Sbjct: 181 ASSVKKIDIGGCDITEQLQFSILKNTGLFMYSSSEREIVRTIKEKVCYIATDYNLETEKY 240

Query: 179 ARETTTLVENYELPDGRVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTIQSADVDV 238
                 +   ++LPDG+++ +   ++ + E LF+P L+  E   + E+ + +I+  D D+
Sbjct: 241 LFNEEKMASQFKLPDGKMLNISQGKYTSTEILFRPELIGSEFDSLPEICYQSIKKVDSDL 300

Query: 239 RSALYRAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLHNDPSRLDKFKVRIEDPPRRKHM 298
           R  LY  IVLSGG++M PG  SRL KEL+ L          +  D  K+RI  PP RK+ 
Sbjct: 301 RLPLYSNIVLSGGTTMCPGFGSRLLKELQTL----------TGYDT-KIRIIAPPERKYT 349

Query: 299 VFIGGAVLANIMADKDHMWLSKQEWQEMGSAAMSK 333
            +IGG++L+  ++    +W++K  W+E      SK
Sbjct: 350 SWIGGSILSG-LSTFSKIWVTKSMWEEDNKIIHSK 383

>YHR129C Chr8 complement(362999..364153) [1155 bp, 384 aa] {ON}
           ARP1Actin-related protein of the dynactin complex;
           required for spindle orientation and nuclear migration;
           putative ortholog of mammalian centractin
          Length = 384

 Score =  214 bits (545), Expect = 5e-66,   Method: Compositional matrix adjust.
 Identities = 111/326 (34%), Positives = 181/326 (55%), Gaps = 14/326 (4%)

Query: 2   IGDEASAVRSYLQISYPMENGVIKNWSDMELLWDYAFYDQMQLPSTSGGKVMLTEPPMNP 61
           IG+ A  +R  L++ YP+++GV+++W  MEL+W Y   + +QL +     +++TE PMNP
Sbjct: 61  IGNNAQKLRGLLKLRYPIKHGVVEDWDSMELIWSYVLNEVLQLQNIGEHPLLITEAPMNP 120

Query: 62  VKNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLN 121
           +KNREQM +V+FE +D   +YV+  AVL+LYA G                VP+Y+   L 
Sbjct: 121 LKNREQMAQVLFETFDVSALYVSNPAVLSLYASGRTTGCVVDCGEGYCSTVPIYDGFALP 180

Query: 122 HLTRRLDVAGRDVTRHL-IDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLDL-DTKLA 179
               R+D+ G D+T  L   L    G +   S++ E VR +KEK+ Y++ ++   + K  
Sbjct: 181 ASMMRMDIGGADITEQLQFQLRKSAGVSLFSSSEREIVRTMKEKVCYLAKNIKKEEEKYL 240

Query: 180 RETTTLVENYELPDGRVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTIQSADVDVR 239
           + T  L+  ++LPDGR I+VG++R+ APE LF P ++ +   G+ +M   +I   D+D+R
Sbjct: 241 QGTQDLISTFKLPDGRCIEVGNDRYRAPEILFSPQIIGLGYDGLSDMCMQSIWKVDLDLR 300

Query: 240 SALYRAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLHNDPSRLDKFKVRIEDPPRRKHMV 299
             L  +I+LSGG++   G   R+      LW    L    S     K++I  P  RK+  
Sbjct: 301 KPLLSSIILSGGTTTLKGFGDRM------LWDLEALTKGTS-----KIKIIAPSERKYTT 349

Query: 300 FIGGAVLANIMADKDHMWLSKQEWQE 325
           +IGG++L   ++    +W  K +W E
Sbjct: 350 WIGGSILTG-LSTFQRLWTKKSDWLE 374

>TDEL0B04810 Chr2 (849529..850650) [1122 bp, 373 aa] {ON} Anc_2.117
           YHR129C
          Length = 373

 Score =  213 bits (541), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 117/326 (35%), Positives = 177/326 (54%), Gaps = 14/326 (4%)

Query: 2   IGDEASAVRSYLQISYPMENGVIKNWSDMELLWDYAFYDQMQLPSTSGGKVMLTEPPMNP 61
           +G++A  +R  L++ +PME GV+ +W DMELLW +  +D +QL S     +++TE P+NP
Sbjct: 58  VGNKAQRLRGLLKLKHPMERGVVSDWDDMELLWSHILFDSLQLTSGMEHPLLITEAPLNP 117

Query: 62  VKNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLN 121
             N+E+M EV FE ++   + V+I  VL+LYA G                VPV E   L 
Sbjct: 118 ESNKEKMLEVFFETFNIPAICVSIPGVLSLYASGRTTGCVVDCGEGYCSSVPVCEGYTLA 177

Query: 122 HLTRRLDVAGRDVTRHL-IDLLSRRGYAFNRSADFETVRQIKEKLSYVSYD-LDLDTKLA 179
              +R+++ G DVT+ L   L    G     S + E VR +KEK  YVS + L  + K  
Sbjct: 178 SSIKRINLGGIDVTKQLQFQLRKESGVWLFSSGERELVRTMKEKSCYVSLNQLKDEEKFT 237

Query: 180 RETTTLVENYELPDGRVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTIQSADVDVR 239
            E   +  N++LPDG ++ +   RF APE LFQP ++  E+P + EM   +I S DV++R
Sbjct: 238 FEPGKMNTNFKLPDGNMLTLSKSRFRAPEILFQPQIIASEEPSLPEMCLQSILSVDVELR 297

Query: 240 SALYRAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLHNDPSRLDKFKVRIEDPPRRKHMV 299
             L   I LSGG++M+ G   R  +EL+            S   K  +RI  PP RK+  
Sbjct: 298 PRLMSRITLSGGTTMFRGFGDRFLQELQI-----------STCKKSNIRILAPPERKYTA 346

Query: 300 FIGGAVLANIMADKDHMWLSKQEWQE 325
           +IGG++LA +   +  M  +K +W+E
Sbjct: 347 WIGGSMLAGLTTFR-KMLTTKSDWRE 371

>NDAI0B04460 Chr2 complement(1115478..1116623) [1146 bp, 381 aa]
           {ON} Anc_2.117
          Length = 381

 Score =  212 bits (540), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 113/330 (34%), Positives = 183/330 (55%), Gaps = 22/330 (6%)

Query: 2   IGDEASAVRSYLQISYPMENGVIKNWSDMELLWDYAFYDQMQLPSTSGGKVMLTEPPMNP 61
           IG+ A ++R  L++ +PM  GV+ NW DMELLW + F D + + +     +++TE P+  
Sbjct: 60  IGNRAQSIRGLLRLQHPMNRGVVDNWDDMELLWWHIFNDTLNVQNIEEHPLLITEAPLTI 119

Query: 62  VKNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLN 121
            K R  MCE +FE ++   +YVA  +VL+LYA G                 P+YE  VL 
Sbjct: 120 EKQRHIMCERLFETFNIPSLYVANPSVLSLYASGNTTGCVVDCGDGYCSSTPIYEGFVLP 179

Query: 122 HLTRRLDVAGRDVTRHL-IDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLDLDTKLAR 180
              R+++V GRD+T HL   +    G +   S + E VR IKEK+ Y+S D +     + 
Sbjct: 180 ASIRKMEVGGRDITEHLQFQIRKSSGISLYSSNEKEIVRTIKEKVCYISEDFN----KSE 235

Query: 181 ETTTLVEN-----YELPDGRVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTIQSAD 235
           E+  L ++     ++LPDG+ + +  ERF +PE LF P L+ +E   V  M F +I   D
Sbjct: 236 ESYYLRQDEMSCKFKLPDGKELTLNKERFRSPEVLFNPQLMGLENENVSAMCFESISKVD 295

Query: 236 VDVRSALYRAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLHNDPSRLDKFKVRIEDPPRR 295
           +++R  L+  I+L+GGS+++ G  SRL  +L++L   R            K++I  PP R
Sbjct: 296 LELRPKLFSNILLTGGSTLFKGFGSRLLGDLQELTNNRA-----------KIKILAPPER 344

Query: 296 KHMVFIGGAVLANIMADKDHMWLSKQEWQE 325
           K+  +IGG++L  +   K+ +W++K +W+E
Sbjct: 345 KYTSWIGGSILTGLSTFKN-LWVTKSDWEE 373

>Suva_15.326 Chr15 complement(565392..566546) [1155 bp, 384 aa] {ON}
           YHR129C (REAL)
          Length = 384

 Score =  210 bits (535), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 107/326 (32%), Positives = 185/326 (56%), Gaps = 14/326 (4%)

Query: 2   IGDEASAVRSYLQISYPMENGVIKNWSDMELLWDYAFYDQMQLPSTSGGKVMLTEPPMNP 61
           +G++A  +R  L++ YP+E+GV+++W  MEL+W +   + +QL +     +++TE PMNP
Sbjct: 61  VGNKAQRLRGLLRLQYPIEHGVVEDWDSMELIWAHILNEVLQLQNIEEHPLLITEAPMNP 120

Query: 62  VKNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLN 121
           +KNRE M +V+FE ++   +YV+  AVL+LYA G                VP+Y+   L 
Sbjct: 121 LKNREVMAQVLFETFNLPALYVSNPAVLSLYASGRTTGCVIDCGEGYCSTVPIYDGFALP 180

Query: 122 HLTRRLDVAGRDVTRHL-IDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLDL-DTKLA 179
               R+D+ GRD+T+ L   L    G +   S++ E VR IKEK+ Y++ D+   +    
Sbjct: 181 ASMMRMDIGGRDITKQLQFQLRKSAGVSLFSSSEREIVRTIKEKVCYLATDIKKEENTYM 240

Query: 180 RETTTLVENYELPDGRVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTIQSADVDVR 239
           +E+  L   ++LPDG+ I++G++R+ APE LF P ++     G+ +M   +I   D+D+R
Sbjct: 241 QESQDLTSVFKLPDGKCIEIGNDRYRAPEILFSPQIIGSGYDGLSDMCMQSIWKVDLDLR 300

Query: 240 SALYRAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLHNDPSRLDKFKVRIEDPPRRKHMV 299
           + L  +I+LSGG++   G   R+  +L+   FT+            K++I  PP RK+  
Sbjct: 301 TTLLSSIILSGGTTTLRGFGDRMLHDLEA--FTK---------GTSKIKIIAPPERKYTT 349

Query: 300 FIGGAVLANIMADKDHMWLSKQEWQE 325
           ++GG++L   ++    +W  K +W E
Sbjct: 350 WVGGSILTG-LSTFQRLWTKKSDWLE 374

>Smik_8.210 Chr8 complement(339093..340247) [1155 bp, 384 aa] {ON}
           YHR129C (REAL)
          Length = 384

 Score =  207 bits (527), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 107/326 (32%), Positives = 179/326 (54%), Gaps = 14/326 (4%)

Query: 2   IGDEASAVRSYLQISYPMENGVIKNWSDMELLWDYAFYDQMQLPSTSGGKVMLTEPPMNP 61
           +G++A  +R  L++ YPM++GV+++W  MEL+W Y   + +QL +     +++TE PMNP
Sbjct: 61  VGNKAQKLRGLLRLRYPMKHGVVEDWDSMELIWSYVLNEVLQLQNIEEHPLLITEAPMNP 120

Query: 62  VKNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLN 121
           +KNRE + +VMFE ++   +YV+  AVL+LYA G                VP+Y+   L 
Sbjct: 121 LKNREMIAQVMFETFNLSAIYVSDPAVLSLYASGRTTGCVVDCGEGYCSSVPIYDGFALP 180

Query: 122 HLTRRLDVAGRDVTRHL-IDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLDLDT-KLA 179
               R+D+ G D+T  L   +    G +   S++ E VR IKEK+ Y++ D   +  K  
Sbjct: 181 ASIMRMDIGGGDITEQLQFQIRKSAGVSLFSSSEREIVRTIKEKVCYLAKDAKKEEDKYL 240

Query: 180 RETTTLVENYELPDGRVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTIQSADVDVR 239
           + T  L+  ++LPDG+ I+VG++R+ APE LF P ++     G+  M   +I   D+D+R
Sbjct: 241 QGTQDLISAFKLPDGKSIEVGNDRYRAPEILFSPQIIGSGYDGLSNMCMQSIWKVDLDLR 300

Query: 240 SALYRAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLHNDPSRLDKFKVRIEDPPRRKHMV 299
             L  +++LSGG++   G   R+  +L+ L                K++I  PP RK+  
Sbjct: 301 KNLLSSVILSGGTTTLKGFGDRMLHDLEAL-----------TKGTSKIKIIAPPERKYTA 349

Query: 300 FIGGAVLANIMADKDHMWLSKQEWQE 325
           +IGG++L   ++    +W  K +W E
Sbjct: 350 WIGGSILTG-LSTFQKLWTKKSDWLE 374

>TPHA0I01300 Chr9 (295950..297089) [1140 bp, 379 aa] {ON} Anc_2.117
           YHR129C
          Length = 379

 Score =  206 bits (524), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 111/335 (33%), Positives = 184/335 (54%), Gaps = 14/335 (4%)

Query: 2   IGDEASAVRSYLQISYPMENGVIKNWSDMELLWDYAFYDQMQLPSTSGGKVMLTEPPMNP 61
           IG++A   R  L++ +PME+G +K+W +ME +W +     + +       +++TE P+N 
Sbjct: 57  IGNKAQENRGLLRLRHPMEHGEVKHWDEMEAVWKHTLLHDLNIQHIEEHPILITEAPLNS 116

Query: 62  VKNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLN 121
            KNRE MCE++FE ++   ++V   AVLALY+ G                VP+YE   L 
Sbjct: 117 SKNREHMCEILFESFNIPAIHVENPAVLALYSGGRTTGCVIDCGEGYCSAVPIYEGFALT 176

Query: 122 HLTRRLDVAGRDVTRHL-IDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLDLDT-KLA 179
              RR+D+ GR++T  L   +    G +   S + E VR IKE+  YV+ D+  +  K  
Sbjct: 177 PSIRRIDIGGREITEQLQFQIRKSVGMSLFSSNEKEIVRTIKERACYVADDISKEEHKYI 236

Query: 180 RETTTLVENYELPDGRVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTIQSADVDVR 239
            ++ +    ++LPDG+ + +G+ RF A E LF P L+  E   V E++F T+   D+D+R
Sbjct: 237 LDSESNSSKFKLPDGKSLSIGNVRFRATELLFNPRLIGCESDSVPEIVFQTLSRVDIDLR 296

Query: 240 SALYRAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLHNDPSRLDKFKVRIEDPPRRKHMV 299
             LY+++VL+GG+++ PG  +R+ KEL+ L          ++ D  K+RI   P RK+  
Sbjct: 297 PMLYKSLVLNGGTTVLPGFGNRILKELQIL----------TKQDT-KLRIIASPERKYTT 345

Query: 300 FIGGAVLANIMADKDHMWLSKQEWQEMGSAAMSKF 334
           +IGG++LA  ++    + ++K  W E  S   S F
Sbjct: 346 WIGGSILAG-LSTFQKILVTKSNWNEDRSRVYSSF 379

>Skud_8.190 Chr8 complement(336365..337519) [1155 bp, 384 aa] {ON}
           YHR129C (REAL)
          Length = 384

 Score =  204 bits (519), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 105/335 (31%), Positives = 181/335 (54%), Gaps = 14/335 (4%)

Query: 2   IGDEASAVRSYLQISYPMENGVIKNWSDMELLWDYAFYDQMQLPSTSGGKVMLTEPPMNP 61
           +G++A  +R  L++ YPM +GV+++W  MEL+W Y   + +QL +     +++TE PMNP
Sbjct: 61  VGNKAQKLRGLLRLRYPMTHGVVEDWDSMELIWSYMLNEVLQLQNIEEHPLLITEAPMNP 120

Query: 62  VKNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLN 121
           +KNRE M +V+FE ++   +Y++  AVL+LYA G                VP+Y+   L 
Sbjct: 121 LKNREVMAQVLFETFNLPALYISNPAVLSLYASGRTTGCVVDCGEGYCSTVPIYDGFALP 180

Query: 122 HLTRRLDVAGRDVTRHL-IDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLDLDT-KLA 179
               R+D+ GRD+T  L   L    G +   S++ E VR IKEK+ Y++ ++  +  +  
Sbjct: 181 ASIMRMDIGGRDITEQLQFQLRKSAGISLFSSSELEVVRMIKEKVCYLAKNIKKEEDRYL 240

Query: 180 RETTTLVENYELPDGRVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTIQSADVDVR 239
           +    L   ++LPDG+ I++G++R+ APE LF P ++     G+ +M   +I   D+D+R
Sbjct: 241 QGHHDLGSVFKLPDGKCIEIGNDRYRAPEILFSPQIIGSGYDGLSDMCMQSIWKVDLDLR 300

Query: 240 SALYRAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLHNDPSRLDKFKVRIEDPPRRKHMV 299
             L  +I+LSGG++   G   R+  +L+ L                K++I  PP RK+  
Sbjct: 301 KTLLSSIILSGGTTTLRGFGERMLHDLEAL-----------SKGTCKIKIIAPPERKYTT 349

Query: 300 FIGGAVLANIMADKDHMWLSKQEWQEMGSAAMSKF 334
           ++GG++L   ++    +W  K +W E  +   S  
Sbjct: 350 WVGGSILTG-LSTFQKLWTKKSDWLEDNTRVFSNL 383

>KNAG0H03650 Chr8 complement(678598..679761) [1164 bp, 387 aa] {ON}
           Anc_2.117 YHR129C
          Length = 387

 Score =  196 bits (498), Expect = 5e-59,   Method: Compositional matrix adjust.
 Identities = 116/343 (33%), Positives = 184/343 (53%), Gaps = 24/343 (6%)

Query: 1   MIGDEASAVRSYLQISYPMENGVIKNWSDMELLWDYAFYDQMQLPSTSG----GKVMLTE 56
            +G+EA  +R  L +  P+  G + NW DMELLW + FY ++QL   +       +++TE
Sbjct: 59  FVGNEAQRLRGLLALRRPISRGEVTNWDDMELLWSHIFYSKLQLGQGNSQIGDHPLLITE 118

Query: 57  PPMNPVKNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYE 116
            P+N  KNRE MCE+++E ++F  +YVA  AVL+LYA G             +   PVY+
Sbjct: 119 APLNSTKNRETMCEILYETFNFDALYVAHPAVLSLYATGQTTGCVLECGEGYSASTPVYQ 178

Query: 117 SVVLNHLTRRLDVAGRDVTRHLIDLLSRR-GYAFNRSADFETVRQIKEKLSYVSYDLDLD 175
              L    RR+D+ GRD+T+ L   + +  G +   +++ E VR IKEK +YV+ D   +
Sbjct: 179 GFALPSSIRRIDIGGRDITQELQFYIRKSTGLSLFSNSEQEIVRTIKEKANYVALDYKFE 238

Query: 176 TKL----ARETTTLVENYELPDGRVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTI 231
            +      RE T+ V+   LPDG+ +  G  ++   E LFQP L+  E   V EML  +I
Sbjct: 239 EEKFFIHERENTSTVK---LPDGQELTFGKGKYRTSEILFQPQLIGSECVSVPEMLLESI 295

Query: 232 QSADVDVRSALYRAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLHNDPSRLDKFKVRIED 291
              D+D+R+ L   IVLSGG++M  G   R   E K++         P      KV+I  
Sbjct: 296 NKVDMDLRTQLLENIVLSGGTTMLKGFDQRTMSETKKML--------PKHT---KVKIRS 344

Query: 292 PPRRKHMVFIGGAVLANIMADKDHMWLSKQEWQEMGSAAMSKF 334
              R ++ +IGG++L+ +   ++ +WL+++ ++E  S    KF
Sbjct: 345 LAERSYIAWIGGSILSGLYGFRN-LWLTREMYEEDPSMVHRKF 386

>Kwal_27.9958 s27 (139638..140975) [1338 bp, 445 aa] {ON} YJR065C
           (ARP3) - involved in the function of the actin
           cytoskeleton [contig 43] FULL
          Length = 445

 Score =  161 bits (407), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 116/354 (32%), Positives = 181/354 (51%), Gaps = 28/354 (7%)

Query: 2   IGDEASAVR---SYLQISYPMENGVIKNWSDMELLWDYAFYDQMQLPSTSGGKVMLTEPP 58
           IGDEA A     SY  +SYP+ +G ++NW  ME  W+ + +  ++         +LTEPP
Sbjct: 93  IGDEAIAASQGPSY-SLSYPIRHGQVENWDHMERFWENSIFKYLRT-EPEDHYFLLTEPP 150

Query: 59  MNPVKNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXX--------TH 110
           +NP +NREQ+ E+ FE ++  G+Y+A+QAVLAL A                       TH
Sbjct: 151 LNPPENREQVAEIFFESFNCAGLYIAVQAVLALAASWTSSKVVDRSLTGTVIDSGDGVTH 210

Query: 111 IVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSY 170
           ++PV E  V+    + + +AGRD+T  +  LL  RG          T  +IK++  YV  
Sbjct: 211 VIPVAEGYVIGSAIKNIPIAGRDITLFIQSLLRERG---EEDTTLRTAERIKQEYCYVCS 267

Query: 171 DL-----DLDTKLARETTTLVENYELPDGRVIKVGSERFEAPECLFQPSLV--DVEQPGV 223
           D+       D    +    +VEN E    +VI VG ERF APE  F P +   D   P +
Sbjct: 268 DIVKEFNKFDRDSEKFAQFIVENSEKTRRKVIDVGYERFLAPEIFFNPEIASSDFLTP-L 326

Query: 224 GEMLFNTIQSADVDVRSALYRAIVLSGGSSMYPGLPSRLEKELKQLWFTRVL---HNDPS 280
             ++  TIQ+  +DVR  LY  IVLSGGS+M+     RL+++LK +   R+    H   +
Sbjct: 327 PTIVDQTIQACPIDVRKGLYNNIVLSGGSTMFKDFGRRLQRDLKGIVNNRIALSEHLSGT 386

Query: 281 RLDKFKVRIEDPPRRKHMVFIGGAVLANIMADKDHMWLSKQEWQEMGSAAMSKF 334
           +     V++    R+++ V+ GG++LA     + +   SKQ+++E+G   +  F
Sbjct: 387 KSTGVDVQVISHRRQRNAVWFGGSLLAETAEFRGYCH-SKQDYEEIGPEIVRNF 439

>KLTH0C02508g Chr3 (224722..226077) [1356 bp, 451 aa] {ON} highly
           similar to uniprot|P47117 Saccharomyces cerevisiae
           YJR065C ARP3 Essential component of the Arp2/3 complex
           which is a highly conserved actin nucleation center
           required for the motility and integrity of actin patches
           involved in endocytosis and membrane growth and polarity
          Length = 451

 Score =  160 bits (404), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 115/354 (32%), Positives = 181/354 (51%), Gaps = 28/354 (7%)

Query: 2   IGDEASAVR---SYLQISYPMENGVIKNWSDMELLWDYAFYDQMQLPSTSGGKVMLTEPP 58
           IG+EA A     SY  +SYP+ +G ++NW  ME  W+ + +  ++         +LTEPP
Sbjct: 99  IGNEALAASQGPSY-SLSYPIRHGQVENWDHMERFWENSIFKYLRT-EPEDHFFLLTEPP 156

Query: 59  MNPVKNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXX--------TH 110
           +NP +NREQ+ E+ FE ++  G+Y+A+QAVLAL A                       TH
Sbjct: 157 LNPPENREQVAEIFFESFNCAGLYIAVQAVLALAASWTSSKVVDRSLTGTVIDSGDGVTH 216

Query: 111 IVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSY 170
           ++PV E  V+    + + +AGRD+T  +  LL  RG          T  +IK++  YV  
Sbjct: 217 VIPVAEGYVIGSAIKNIPIAGRDITLFIQSLLRERG---EEDTTLRTAERIKQEYCYVCS 273

Query: 171 DL-----DLDTKLARETTTLVENYELPDGRVIKVGSERFEAPECLFQPSLV--DVEQPGV 223
           D+       D    +    +VEN E    +VI VG ERF APE  F P +   D   P +
Sbjct: 274 DIVKEFNKFDRDPQKFAQFIVENSEKTKRKVIDVGYERFLAPEIFFNPEIASSDFLTP-L 332

Query: 224 GEMLFNTIQSADVDVRSALYRAIVLSGGSSMYPGLPSRLEKELKQLWFTRVL---HNDPS 280
             ++  TIQ+  +DVR  LY  IVLSGGS+M+     RL+++LK +   R+    H   +
Sbjct: 333 PTVVDQTIQACPIDVRKGLYNNIVLSGGSTMFKDFGRRLQRDLKGIVNNRIALSEHLSGT 392

Query: 281 RLDKFKVRIEDPPRRKHMVFIGGAVLANIMADKDHMWLSKQEWQEMGSAAMSKF 334
           +     V++    R+++ V+ GG++LA     K +   +KQ+++E+G   +  F
Sbjct: 393 KSTGVDVQVISHRRQRNAVWFGGSLLAQTAEFKSYCH-TKQDYEEIGPEIVRNF 445

>CAGL0H09042g Chr8 (884592..885755) [1164 bp, 387 aa] {ON} similar
           to uniprot|P38696 Saccharomyces cerevisiae YHR129c ACT5
          Length = 387

 Score =  158 bits (399), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 98/327 (29%), Positives = 159/327 (48%), Gaps = 15/327 (4%)

Query: 2   IGDEASAVRSYLQISYPMENGVIKNWSDMELLWDYAFYDQMQLPSTSGGKVMLTEPPMNP 61
           IG+ A   R+ L +  P     I +W  +E LWDY   +++++       V+LT      
Sbjct: 59  IGNSAYERRATLHLESPYSTNAIMSWDRLEDLWDYVLLNKLEIEQLQEHPVVLTNSMSTS 118

Query: 62  VKNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLN 121
            K  E+MCEV+FEK+    +Y +   +++LY  G               I  V + +++ 
Sbjct: 119 KKEEEKMCEVLFEKFSIPAIYCSRDPIMSLYGLGRTTGCSVSCGHRGIGITTVIDGMIVG 178

Query: 122 HLTRRLDVAGRDVTRHLIDLLSRRGYAF-NRSADFETVRQIKEKLSYVSYDLDLDTKLAR 180
             ++  +  G  VT  ++DLL        N     E +R IKE+   +S D   + +   
Sbjct: 179 GSSQISNTGGSAVTNTMLDLLRHNHPKLENGQNGIELIRSIKERCCVLSKDFYNEIRAYE 238

Query: 181 ETTTLVEN--YELPDGRVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTIQSADVDV 238
             T+   N  Y LPDG +I++GSERFEAPE +F P      +  + +M+ N+I  A +  
Sbjct: 239 LITSKTSNNKYRLPDGNIIEIGSERFEAPEIIFNPQAYGYSEIPLQKMIINSISRAGILP 298

Query: 239 RSALYRAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLHNDPSRLDKFKVRIEDPPRRKHM 298
           RS L  +IVLSGGSS+  G   RL KE+++     +  N        K+ +  P  R+ +
Sbjct: 299 RSQLLESIVLSGGSSLIKGFGERLTKEIRK----EIDGNQ-------KIMLNAPHERRFL 347

Query: 299 VFIGGAVLANIMADKDHMWLSKQEWQE 325
            +IGG+VL+ +   K  +W SK  ++E
Sbjct: 348 PWIGGSVLSGLSTMK-LLWKSKSAYRE 373

>SAKL0D12804g Chr4 complement(1066058..1067428) [1371 bp, 456 aa]
           {ON} highly similar to uniprot|P47117 Saccharomyces
           cerevisiae YJR065C ARP3 Essential component of the
           Arp2/3 complex which is a highly conserved actin
           nucleation center required for the motility and
           integrity of actin patches involved in endocytosis and
           membrane growth and polarity
          Length = 456

 Score =  159 bits (401), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 112/354 (31%), Positives = 181/354 (51%), Gaps = 28/354 (7%)

Query: 2   IGDEASAVR---SYLQISYPMENGVIKNWSDMELLWDYAFYDQMQLPSTSGGKVMLTEPP 58
           IG+EA A     SY  +SYP+ +G ++NW  ME  W+ + +  ++         +LTEPP
Sbjct: 104 IGNEALAASRGPSY-SLSYPIRHGQVENWDHMERFWENSIFKYLRT-EPEDHFFLLTEPP 161

Query: 59  MNPVKNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXX--------TH 110
           +NP +NREQ+ E+ FE ++  G+Y+A+QAVLAL A                       TH
Sbjct: 162 LNPPENREQVAEIFFESFNCAGLYIAVQAVLALAASWTSSKVTDRSLTGTVIDSGDGVTH 221

Query: 111 IVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSY 170
           ++PV E  V+    + + +AGRD+T  +  LL  RG          T  +IK++  YV  
Sbjct: 222 VIPVAEGYVIGSAIKNIPIAGRDITLFIQSLLRERGEV---DTSLRTAERIKQEYCYVCP 278

Query: 171 DL-----DLDTKLARETTTLVENYELPDGRVIKVGSERFEAPECLFQPSLV--DVEQPGV 223
           D+       D    +    +VEN E    +++ VG ERF APE  F P +   D   P +
Sbjct: 279 DIVKEFNKFDRDAGKFAQFIVENSESTKKKIVDVGYERFLAPEIFFNPEIASSDFLTP-L 337

Query: 224 GEMLFNTIQSADVDVRSALYRAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLHND---PS 280
             ++  TIQ+  +DVR  LY  IVLSGGS+M+     RL+++LK +   R+  ++    +
Sbjct: 338 PTVVDQTIQACPIDVRKGLYNNIVLSGGSTMFKDFGRRLQRDLKSIVNNRIAQSELLSGT 397

Query: 281 RLDKFKVRIEDPPRRKHMVFIGGAVLANIMADKDHMWLSKQEWQEMGSAAMSKF 334
           +     V++    R+++ V+ GG++LA     K +   +KQ+++E G   +  F
Sbjct: 398 KSTGVDVQVISHRRQRNAVWFGGSLLAQTAEFKSYCH-TKQDYEEYGPEIVRNF 450

>KNAG0B00170 Chr2 (18478..19839) [1362 bp, 453 aa] {ON} Anc_1.514
           YJR065C
          Length = 453

 Score =  158 bits (400), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 113/354 (31%), Positives = 182/354 (51%), Gaps = 28/354 (7%)

Query: 2   IGDEA---SAVRSYLQISYPMENGVIKNWSDMELLWDYAFYDQMQLPSTSGGKVMLTEPP 58
           IG+EA   S   SY  +SYP+ +G ++NW  ME  W+ + +  ++         +LTEPP
Sbjct: 101 IGNEALIASQGASY-SLSYPIRHGQVENWDHMERFWENSIFKYLRT-EPEDHFFLLTEPP 158

Query: 59  MNPVKNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXX--------TH 110
           +NP +NREQ+ E+ FE ++  G+Y+A+QAVLAL A                       TH
Sbjct: 159 LNPPENREQIAEIFFESFNCAGLYIAVQAVLALAASWTSSKVVDRSLTGTVIDSGDGVTH 218

Query: 111 IVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSY 170
           ++PV E  V+    + + +AGRD+T+ +  LL  RG A        T  +IK++  YV  
Sbjct: 219 VIPVAEGYVIGSAIKNIPIAGRDITQFIQTLLRERGEA---DTSLRTAERIKQEYCYVCP 275

Query: 171 DL-----DLDTKLARETTTLVENYELPDGRVIKVGSERFEAPECLFQPSLV--DVEQPGV 223
           D+       D    +    +VEN E    +V+ VG ERF APE  F P +   D   P +
Sbjct: 276 DIVKEFNKFDRDPEKFAQYVVENQEKTQKKVVDVGYERFLAPEIFFNPEIASSDFLTP-L 334

Query: 224 GEMLFNTIQSADVDVRSALYRAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLHND---PS 280
             ++  TIQ+  +DVR  LY  IVLSGGS+M+     RL+++LK +   R+  N+    +
Sbjct: 335 PTIVDQTIQACPIDVRKGLYNNIVLSGGSTMFKDFGRRLQRDLKSIVNNRIAQNELLSGT 394

Query: 281 RLDKFKVRIEDPPRRKHMVFIGGAVLANIMADKDHMWLSKQEWQEMGSAAMSKF 334
           +     V +    ++++ V+ GG++LA     K +   +K++++E G   +  F
Sbjct: 395 KSTGVDVSVISHRKQRNAVWFGGSLLAQTAEFKSYCH-TKKDYEEYGPEIVRNF 447

>Kpol_1056.16 s1056 (36274..37656) [1383 bp, 460 aa] {ON}
           (36274..37656) [1383 nt, 461 aa]
          Length = 460

 Score =  157 bits (397), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 110/354 (31%), Positives = 185/354 (52%), Gaps = 28/354 (7%)

Query: 2   IGDEA---SAVRSYLQISYPMENGVIKNWSDMELLWDYAFYDQMQLPSTSGGKVMLTEPP 58
           IG+EA   S   SY  +SYP+ +G I+NW  ME  W+ + +  ++         +LTEPP
Sbjct: 108 IGNEALIASQGPSY-SLSYPIRHGQIENWDHMERFWENSIFKYLRA-EPEDHFFLLTEPP 165

Query: 59  MNPVKNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXX--------TH 110
           +NP +NREQ+ E+ FE ++  G+Y+A+QAVLAL A                       TH
Sbjct: 166 LNPPENREQVAEIFFESFNCAGLYIAVQAVLALAASWTSSQVTDRSLTGTVIDSGDGVTH 225

Query: 111 IVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSY 170
           ++PV E  V+    + + +AGRD+T  +  LL  RG A        T  +IK++  YV  
Sbjct: 226 VIPVAEGYVIGSAIKNIPIAGRDITLFIQSLLRERGEA---DTSLRTAERIKQEYCYVCP 282

Query: 171 DL-----DLDTKLARETTTLVENYELPDGRVIKVGSERFEAPECLFQPSLV--DVEQPGV 223
           D+       D +  +    ++EN +    +V+ +G ERF APE  F P +   D   P +
Sbjct: 283 DIVKEFNKFDRQPEKFAQFIIENQDKTKQKVVDIGYERFLAPEIFFNPEIASSDFLTP-L 341

Query: 224 GEMLFNTIQSADVDVRSALYRAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLHNDP---S 280
             ++ +TIQ+  +DVR  LY  IVLSGGS+M+     RL++++K +  +R++ N+     
Sbjct: 342 PTVVDHTIQACPIDVRKGLYNNIVLSGGSTMFKDFSRRLQRDIKSIVNSRIIQNEAVTGV 401

Query: 281 RLDKFKVRIEDPPRRKHMVFIGGAVLANIMADKDHMWLSKQEWQEMGSAAMSKF 334
           +     V++    ++++ V+ GG++LA     K +   +K++++E G   +  F
Sbjct: 402 KSTGVDVQVISHRKQRNAVWFGGSLLAQTAEFKSYCH-TKKDYEEYGPEIVRNF 454

>TPHA0O01040 Chr15 (196178..197554) [1377 bp, 458 aa] {ON} Anc_1.514
           YJR065C
          Length = 458

 Score =  156 bits (394), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 107/353 (30%), Positives = 184/353 (52%), Gaps = 26/353 (7%)

Query: 2   IGDEA--SAVRSYLQISYPMENGVIKNWSDMELLWDYAFYDQMQLPSTSGGKVMLTEPPM 59
           IG+EA  ++      +SYP+ +G ++NW  ME  W+ + +  ++         +LTEPP+
Sbjct: 106 IGNEALVASQGPAYSLSYPIRHGQVENWDHMERFWENSIFKYLRA-EPEDHFFLLTEPPL 164

Query: 60  NPVKNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXX--------THI 111
           NP +NREQ+ E+ FE ++  G+Y+A+QAVLAL A                       TH+
Sbjct: 165 NPPENREQVAEIFFESFNCAGLYIAVQAVLALAASWTSAQVTDRSLTGTVIDSGDGVTHV 224

Query: 112 VPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYD 171
           +PV E  V+    + + +AGRD+T  +  LL  RG A    +  +T  +IK++  YV  D
Sbjct: 225 IPVAEGYVVGSAIKNIPIAGRDITLFIQSLLRERGEA---DSSLKTAERIKQEYCYVCPD 281

Query: 172 L-----DLDTKLARETTTLVENYELPDGRVIKVGSERFEAPECLFQPSLV--DVEQPGVG 224
           +       D +  +    ++EN +    +VI +G ERF APE  F P +   D   P + 
Sbjct: 282 IVKEFNKFDRQPEKFAQFIIENQDKTTKKVIDIGYERFLAPEIFFNPEIASSDFLTP-LP 340

Query: 225 EMLFNTIQSADVDVRSALYRAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLHNDP---SR 281
            ++  TIQ+  +DVR  LY  IVLSGGS+M+     RL++++K +   R+  N+    ++
Sbjct: 341 TVVDQTIQACPIDVRKGLYNNIVLSGGSTMFKDFSRRLQRDVKSIVSNRIAQNEALTGTK 400

Query: 282 LDKFKVRIEDPPRRKHMVFIGGAVLANIMADKDHMWLSKQEWQEMGSAAMSKF 334
                V++    ++++ V+ GG++LA     K +   +K++++E G   +  F
Sbjct: 401 STGVDVQVISHRKQRNAVWFGGSLLAQTAEFKGYCH-TKKDYEEHGPEIVRNF 452

>AFR419C Chr6 complement(1186951..1188318) [1368 bp, 455 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJR065C
           (ARP3)
          Length = 455

 Score =  156 bits (394), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 112/354 (31%), Positives = 186/354 (52%), Gaps = 28/354 (7%)

Query: 2   IGDEASAVR---SYLQISYPMENGVIKNWSDMELLWDYAFYDQMQLPSTSGGKVMLTEPP 58
           IG+EA A     SY  +SYP+ +G +++W+ ME  W+ + +  ++         +LTEPP
Sbjct: 103 IGNEALAAAQGPSY-SLSYPIRHGQVEDWNHMERFWENSIFKYLRT-EPEDHFFLLTEPP 160

Query: 59  MNPVKNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXX--------TH 110
           +NP +NREQ+ E+ FE ++  G+Y+A+QAVLAL A                       TH
Sbjct: 161 LNPPENREQVAEIFFESFNCAGLYIAVQAVLALAASWTSSKVTDRSLTGTVIDSGDGVTH 220

Query: 111 IVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSY 170
           ++PV E  V+    + + +AGRD+T  +  LL  RG          T  +IK++  YV  
Sbjct: 221 VIPVAEGYVIGSAIKHIPIAGRDITLFIQSLLRERGEV---DTSLRTAERIKQEYCYVCP 277

Query: 171 DLDLD-TKLARETTT----LVENYELPDGRVIKVGSERFEAPECLFQPSLV--DVEQPGV 223
           D+  +  K  R+ T     +VEN E    +V+ VG ERF APE  F P +   D   P +
Sbjct: 278 DIVKEFNKFDRDATKFAQFIVENKEKTQKKVVDVGYERFLAPEIFFNPEIASSDFLTP-L 336

Query: 224 GEMLFNTIQSADVDVRSALYRAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLHND---PS 280
             ++  TIQ+  +DVR  LY  IVLSGGS+M+     RL+++L+ +   R+  ++    +
Sbjct: 337 PTVVDQTIQACPIDVRKGLYNNIVLSGGSTMFKDFGRRLQRDLRSIVNNRIAQSELLSGT 396

Query: 281 RLDKFKVRIEDPPRRKHMVFIGGAVLANIMADKDHMWLSKQEWQEMGSAAMSKF 334
           +    +V++    R+++ V+ GG++LA     K +   +K++++E G   +  F
Sbjct: 397 KSTGVEVQVISHRRQRNAVWFGGSLLAQTAEFKSYCH-TKKDYEEYGPQIVRNF 449

>KLLA0B13904g Chr2 complement(1218228..1219598) [1371 bp, 456 aa]
           {ON} highly similar to uniprot|P47117 Saccharomyces
           cerevisiae YJR065C ARP3 Essential component of the
           Arp2/3 complex which is a highly conserved actin
           nucleation center required for the motility and
           integrity of actin patches involved in endocytosis and
           membrane growth and polarity
          Length = 456

 Score =  155 bits (393), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 114/354 (32%), Positives = 182/354 (51%), Gaps = 28/354 (7%)

Query: 2   IGDEA---SAVRSYLQISYPMENGVIKNWSDMELLWDYAFYDQMQLPSTSGGKVMLTEPP 58
           IG+EA   S   SY  +SYP+ +G ++NW  ME  W+ + +  ++         +LTEPP
Sbjct: 104 IGNEALVASQGPSY-SLSYPIRHGQVENWDHMERFWENSIFKYLRT-EPEDHFFLLTEPP 161

Query: 59  MNPVKNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXX--------TH 110
           +NP +NR+Q+ E+ FE ++  G+Y+A+QAVLAL A                       TH
Sbjct: 162 LNPPENRQQVAEIFFESFNCAGLYIAVQAVLALAASWTSSKVTDRSLTGTVIDSGDGVTH 221

Query: 111 IVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSY 170
           ++PV E  V+    + + +AGRD+T  +  LL  RG    + A   T  +IK++  YV  
Sbjct: 222 VIPVAEGYVIGSAIKNIPIAGRDITLFIQSLLRERG---EQDASLRTAERIKQEYCYVCP 278

Query: 171 DL-----DLDTKLARETTTLVENYELPDGRVIKVGSERFEAPECLFQPSLV--DVEQPGV 223
           D+       D    +    +VEN E    +V+ VG ERF APE  F P +   D   P +
Sbjct: 279 DIVKEFNKFDRDSEKFAQFIVENKERTTKKVVDVGYERFLAPEIFFNPEIASSDFLTP-L 337

Query: 224 GEMLFNTIQSADVDVRSALYRAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLHNDP---S 280
             ++  TIQ+  +DVR  LY  IVLSGGS+M+     RL+++LK +   R+  ++    +
Sbjct: 338 PVVVDETIQACPIDVRKGLYNNIVLSGGSTMFKDFGRRLQRDLKGIVNDRISQSEKLSGT 397

Query: 281 RLDKFKVRIEDPPRRKHMVFIGGAVLANIMADKDHMWLSKQEWQEMGSAAMSKF 334
           R     V +    R+++ V+ GG++LA     K +   +KQ+++E G   +  F
Sbjct: 398 RSTGVDVSVISHKRQRNAVWFGGSLLAQTGEFKSYCH-TKQDYEEYGPDIVRNF 450

>NDAI0A03970 Chr1 (895219..896607) [1389 bp, 462 aa] {ON} Anc_1.514
          Length = 462

 Score =  155 bits (393), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 114/356 (32%), Positives = 185/356 (51%), Gaps = 32/356 (8%)

Query: 2   IGDEA---SAVRSYLQISYPMENGVIKNWSDMELLWDYAFYDQMQLPSTSGGKVMLTEPP 58
           IG+EA   S   SY  +SYP+ +G ++NW  ME  W+ + +  ++         +LTEPP
Sbjct: 110 IGNEALVASQGPSY-SLSYPIRHGQVENWDHMERFWENSIFKYLRT-EPEDHFFLLTEPP 167

Query: 59  MNPVKNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXX--------TH 110
           +NP +NREQ+ E+ FE ++  G+Y+A+QAVLAL A                       TH
Sbjct: 168 LNPPENREQIAEIFFESFNCAGLYIAVQAVLALAASWTSSKVTDRSLTGTVIDSGDGVTH 227

Query: 111 IVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSY 170
           ++PV E  V+    + + +AGRD+T  +  LL  RG         +T  +IK++  YV  
Sbjct: 228 VIPVAEGYVIGSAIKNIPIAGRDITLFIQSLLRERGEV---DTSLKTAERIKQEYCYVCP 284

Query: 171 DL-----DLDTKLARETTTLVENYELPDGRVIKVGSERFEAPECLFQPSLV--DVEQPGV 223
           D+       D   ++    +VEN E    +V+ VG ERF APE  F P +   D   P +
Sbjct: 285 DIVKEFNKFDRDGSKFAQFIVENQEQTRKKVVDVGYERFLAPEIFFNPEIASSDFLTP-L 343

Query: 224 GEMLFNTIQSADVDVRSALYRAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLHNDPSRLD 283
             ++ +TIQ+  +DVR  LY  IVLSGGS+M+     RL+++LK +   R+  ++  RL 
Sbjct: 344 PTVVDHTIQACPIDVRKGLYNNIVLSGGSTMFKDFGRRLQRDLKSIVSNRIAQSE--RLS 401

Query: 284 KFK-----VRIEDPPRRKHMVFIGGAVLANIMADKDHMWLSKQEWQEMGSAAMSKF 334
             K     V++    ++++ V+ GG++LA     K +   +K++++E G   +  F
Sbjct: 402 GTKSTGVDVQVISHRKQRNAVWFGGSLLAQTAEFKSYCH-TKKDYEEYGPEIVRNF 456

>TBLA0D03680 Chr4 (914687..916063) [1377 bp, 458 aa] {ON} Anc_1.514
           YJR065C
          Length = 458

 Score =  155 bits (392), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 108/353 (30%), Positives = 182/353 (51%), Gaps = 26/353 (7%)

Query: 2   IGDEA--SAVRSYLQISYPMENGVIKNWSDMELLWDYAFYDQMQLPSTSGGKVMLTEPPM 59
           IG+EA  +A      +SYP+ +G ++NW  ME  W+ + +  ++         +LTEPP+
Sbjct: 106 IGNEALVAAQSPSYSLSYPIRHGQVENWDHMERFWENSIFKYLRT-EPEDHYFLLTEPPL 164

Query: 60  NPVKNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXX--------THI 111
           NP +NREQ+ E+ FE ++  G+Y+A+QAVLAL A                       TH+
Sbjct: 165 NPPENREQVAEIFFESFNCAGLYIAVQAVLALAASWTSSKVIDRSLTGTVIDSGDGVTHV 224

Query: 112 VPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYD 171
           +PV E  V+    + + +AGRD+T  +  LL  RG A        T  +IK++  YV  D
Sbjct: 225 IPVAEGYVIGSAIKNIPIAGRDITEFIQSLLRERGEA---DTSLRTAERIKQEYCYVCPD 281

Query: 172 L-----DLDTKLARETTTLVENYELPDGRVIKVGSERFEAPECLFQPSLV--DVEQPGVG 224
           +       D +  +    +VE+ E    +V+ VG ERF APE  F P +   D   P + 
Sbjct: 282 IVKEFNKFDRQPEKFAQFIVESQEKTKQKVVDVGYERFLAPEIFFNPEIASSDYLTP-LP 340

Query: 225 EMLFNTIQSADVDVRSALYRAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLHNDP---SR 281
            ++  TIQ+  +DVR  LY  IVLSGGS+M+     RL++++K +   R+  N+     +
Sbjct: 341 TVVDQTIQACPIDVRKGLYNNIVLSGGSTMFKDFSRRLQRDMKSIVNARISQNEKMTGVK 400

Query: 282 LDKFKVRIEDPPRRKHMVFIGGAVLANIMADKDHMWLSKQEWQEMGSAAMSKF 334
                V++    ++++ V+ GG++LA     + +   +K++++E+G   +  F
Sbjct: 401 SSGVDVQVISHRKQRNAVWFGGSLLAQTAEFRGYCH-TKRDYEEIGPEIVRNF 452

>KAFR0D03700 Chr4 complement(718438..719787) [1350 bp, 449 aa] {ON}
           Anc_1.514 YJR065C
          Length = 449

 Score =  154 bits (390), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 110/354 (31%), Positives = 181/354 (51%), Gaps = 28/354 (7%)

Query: 2   IGDEASAVR---SYLQISYPMENGVIKNWSDMELLWDYAFYDQMQLPSTSGGKVMLTEPP 58
           IG+EA A     SY  +SYP+ +G I+NW  ME  W+ + +  ++         +LTEPP
Sbjct: 97  IGNEALAAAQGPSY-SLSYPIRHGQIENWDHMERFWENSIFKYLRT-EPEDHFFLLTEPP 154

Query: 59  MNPVKNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXX--------TH 110
           +NP +NREQ+ E+ FE ++  G+Y+A+QAVLAL A                       TH
Sbjct: 155 LNPPENREQVAEIFFESFNCAGLYIAVQAVLALAASWTSSKVTDRSLTGTVIDSGDGVTH 214

Query: 111 IVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSY 170
           ++PV E  V+    + + +AGRD+T  +  LL  RG          T  +IK++  YV  
Sbjct: 215 VIPVAEGYVIGSAIKNIPIAGRDITLFIQSLLRERG---ETDTSLRTAERIKQEYCYVCP 271

Query: 171 DL-----DLDTKLARETTTLVENYELPDGRVIKVGSERFEAPECLFQPSLV--DVEQPGV 223
           D+       D    +    +VEN E    +++ VG ERF APE  F P +   D   P +
Sbjct: 272 DIVKEFNKFDRNPDKFAQFIVENQEKTQKKIVDVGYERFLAPEIFFNPEIASSDFLTP-L 330

Query: 224 GEMLFNTIQSADVDVRSALYRAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLHND---PS 280
             ++ +TIQ+  +DVR  LY  IVLSGGS+M+     RL++++K +   R+  ++    +
Sbjct: 331 PTIVDHTIQACPIDVRKGLYNNIVLSGGSTMFKDFGRRLQRDIKSIVNNRIAQSELLSGT 390

Query: 281 RLDKFKVRIEDPPRRKHMVFIGGAVLANIMADKDHMWLSKQEWQEMGSAAMSKF 334
           +     V +    ++++ V+ GG++LA     K +   +K++++E G   +  F
Sbjct: 391 KSTGVDVNVITHRKQRNAVWFGGSLLAQTAEFKSYCH-TKKDYEEYGPEIVRNF 443

>YJR065C Chr10 complement(557809..559158) [1350 bp, 449 aa] {ON}
           ARP3Essential component of the Arp2/3 complex, which is
           a highly conserved actin nucleation center required for
           the motility and integrity of actin patches; involved in
           endocytosis and membrane growth and polarity
          Length = 449

 Score =  154 bits (390), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 111/354 (31%), Positives = 182/354 (51%), Gaps = 28/354 (7%)

Query: 2   IGDEA---SAVRSYLQISYPMENGVIKNWSDMELLWDYAFYDQMQLPSTSGGKVMLTEPP 58
           IG+EA   S   SY  +SYP+ +G ++NW  ME  W+ + +  ++         +LTEPP
Sbjct: 97  IGNEALVASQGPSY-SLSYPIRHGQVENWDHMERFWENSIFKYLRT-EPEDHFFLLTEPP 154

Query: 59  MNPVKNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXX--------TH 110
           +NP +NREQ+ E+ FE ++  G+Y+A+QAVLAL A                       TH
Sbjct: 155 LNPPENREQVAEIFFESFNCAGLYIAVQAVLALAASWTSSKVTDRSLTGTVIDSGDGVTH 214

Query: 111 IVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSY 170
           ++PV E  V+    + + +AGRD+T  +  LL  RG A        T  +IK++  YV  
Sbjct: 215 VIPVAEGYVIGSAIKNIPIAGRDITLFIQSLLRERGEA---DTSLRTAEKIKQEYCYVCP 271

Query: 171 DL-----DLDTKLARETTTLVENYELPDGRVIKVGSERFEAPECLFQPSLV--DVEQPGV 223
           D+       D   ++    +VEN E    +V+ +G ERF APE  F P +   D   P +
Sbjct: 272 DIVKEFNKFDKDPSKFAQFVVENQEKTRRKVVDIGYERFLAPEIFFNPEIASSDFLTP-L 330

Query: 224 GEMLFNTIQSADVDVRSALYRAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLHND---PS 280
             ++  TIQ+  +DVR  LY  IVLSGGS+M+     RL+++LK +   R+  ++    +
Sbjct: 331 PTVVDQTIQACPIDVRKGLYNNIVLSGGSTMFKDFGRRLQRDLKSIVNNRIAQSELLSGT 390

Query: 281 RLDKFKVRIEDPPRRKHMVFIGGAVLANIMADKDHMWLSKQEWQEMGSAAMSKF 334
           +     V +    ++++ V+ GG++LA     K +   +K++++E G   +  F
Sbjct: 391 KSTGVDVSVISHRKQRNAVWFGGSLLAQTAEFKGYCH-TKKDYEEYGPEIVRNF 443

>Ecym_3153 Chr3 (288213..289589) [1377 bp, 458 aa] {ON} similar to
           Ashbya gossypii AFR419C
          Length = 458

 Score =  154 bits (390), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 106/353 (30%), Positives = 185/353 (52%), Gaps = 26/353 (7%)

Query: 2   IGDEA--SAVRSYLQISYPMENGVIKNWSDMELLWDYAFYDQMQLPSTSGGKVMLTEPPM 59
           IG+EA  +A      +SYP+++G ++NW+ ME  W+ + +  ++         +LTEPP+
Sbjct: 106 IGNEALTAAQGPAYSLSYPIKHGQVENWNHMERFWENSIFKYLRTEPEDH-FFLLTEPPL 164

Query: 60  NPVKNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXX--------THI 111
           NP +NREQ+ E+ FE ++  G+Y+A+QAVLAL A                       TH+
Sbjct: 165 NPPENREQVAEIFFESFNCAGLYIAVQAVLALAASWTSSKVTDRSLTGTVIDSGDGVTHV 224

Query: 112 VPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYD 171
           +PV E  V+    + + +AGRD+T  +  LL  RG         +T  +IK++  YV  D
Sbjct: 225 IPVAEGYVIGSAIKNIPIAGRDITLFIQSLLRERGEV---DTSLKTAERIKQEYCYVCPD 281

Query: 172 L-----DLDTKLARETTTLVENYELPDGRVIKVGSERFEAPECLFQPSLV--DVEQPGVG 224
           +       D  + + +  ++EN      +++ VG ERF APE  F P +   D   P + 
Sbjct: 282 IVKEFNKFDRDVGKFSQFIIENQGKTQKKIVDVGYERFLAPEIFFNPEIASSDFLTP-LP 340

Query: 225 EMLFNTIQSADVDVRSALYRAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLHND---PSR 281
            ++ +TIQ+  +DVR  LY  IVLSGGS+M+     RL+++L+ +   R+  ++    ++
Sbjct: 341 TIVDHTIQACPIDVRKGLYSNIVLSGGSTMFKDFGRRLQRDLRSIVNDRIAQSELLSGTK 400

Query: 282 LDKFKVRIEDPPRRKHMVFIGGAVLANIMADKDHMWLSKQEWQEMGSAAMSKF 334
                V++    R+++ V+ GG++LA     K +   +K++++E G   +  F
Sbjct: 401 STGVDVQVISHRRQRNAVWFGGSLLAQTAEFKSYCH-TKRDYEEYGPEIVRNF 452

>TDEL0F00470 Chr6 (80760..82145) [1386 bp, 461 aa] {ON} Anc_1.514
           YJR065C
          Length = 461

 Score =  154 bits (390), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 108/353 (30%), Positives = 183/353 (51%), Gaps = 26/353 (7%)

Query: 2   IGDEA--SAVRSYLQISYPMENGVIKNWSDMELLWDYAFYDQMQLPSTSGGKVMLTEPPM 59
           IG+EA  +A      +SYP+ +G ++NW  ME  W+ + +  ++         +LTEPP+
Sbjct: 109 IGNEALIAAQGPSYGLSYPIRHGQVENWDHMERFWENSIFKYLRTEPEDHC-FLLTEPPL 167

Query: 60  NPVKNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXX--------THI 111
           NP +NREQ+ E+ FE ++  G+Y+A+QAVLAL A                       TH+
Sbjct: 168 NPPENREQVAEIFFESFNCAGLYIAVQAVLALAASWTSSKVIDRSLTGTVIDSGDGVTHV 227

Query: 112 VPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYD 171
           +PV E  V+    + + +AGRD+T  +  LL  RG          T  +IK++  YV  D
Sbjct: 228 IPVAEGYVIGSAIKNIPIAGRDITLFIQQLLRERG---EEDTSLRTAERIKQEYCYVCPD 284

Query: 172 L-----DLDTKLARETTTLVENYELPDGRVIKVGSERFEAPECLFQPSLV--DVEQPGVG 224
           +       D    +    +VE+ E    +V+ VG ERF APE  F P +   D   P + 
Sbjct: 285 IVKEFNKFDRDSEKFAQFVVESQEKTRRKVVDVGCERFMAPEIFFNPEIASSDFLTP-LP 343

Query: 225 EMLFNTIQSADVDVRSALYRAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLHND---PSR 281
            ++ +TIQ+  +DVR  LY  IVLSGGS+M+     RL+++LK +   R++ ++    ++
Sbjct: 344 TIVDHTIQACPIDVRKGLYNNIVLSGGSTMFKDFGRRLQRDLKSIVNNRIVQSEYLSGTK 403

Query: 282 LDKFKVRIEDPPRRKHMVFIGGAVLANIMADKDHMWLSKQEWQEMGSAAMSKF 334
                V++    ++++ V+ GG++LA     K +   +K++++E+G   +  F
Sbjct: 404 STGVDVQVISHRKQRNAVWFGGSLLAQTAEFKSYCH-TKKDYEEIGPEIVRNF 455

>Smik_10.355 Chr10 complement(546673..548022) [1350 bp, 449 aa] {ON}
           YJR065C (REAL)
          Length = 449

 Score =  154 bits (389), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 111/354 (31%), Positives = 182/354 (51%), Gaps = 28/354 (7%)

Query: 2   IGDEA---SAVRSYLQISYPMENGVIKNWSDMELLWDYAFYDQMQLPSTSGGKVMLTEPP 58
           IG+EA   S   SY  +SYP+ +G ++NW  ME  W+ + +  ++         +LTEPP
Sbjct: 97  IGNEALVASQGPSY-SLSYPIRHGQVENWDHMERFWENSIFKYLRT-EPEDHFFLLTEPP 154

Query: 59  MNPVKNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXX--------TH 110
           +NP +NREQ+ E+ FE ++  G+Y+A+QAVLAL A                       TH
Sbjct: 155 LNPPENREQVAEIFFESFNCAGLYIAVQAVLALAASWTSSKVTDRSLTGTVIDSGDGVTH 214

Query: 111 IVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSY 170
           ++PV E  V+    + + +AGRD+T  +  LL  RG A        T  +IK++  YV  
Sbjct: 215 VIPVAEGYVIGSAIKNIPIAGRDITLFIQSLLRERGEA---DTSLRTAEKIKQEYCYVCP 271

Query: 171 DL-----DLDTKLARETTTLVENYELPDGRVIKVGSERFEAPECLFQPSLV--DVEQPGV 223
           D+       D   ++    +VEN E    +V+ +G ERF APE  F P +   D   P +
Sbjct: 272 DIVKEFNKFDRDPSKFAQFVVENQEKTRRKVVDIGYERFLAPEIFFNPEIASSDFLTP-L 330

Query: 224 GEMLFNTIQSADVDVRSALYRAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLHND---PS 280
             ++  TIQ+  +DVR  LY  IVLSGGS+M+     RL+++LK +   R+  ++    +
Sbjct: 331 PTVVDQTIQACPIDVRKGLYNNIVLSGGSTMFKDFGRRLQRDLKSIVNNRIAQSELLSGT 390

Query: 281 RLDKFKVRIEDPPRRKHMVFIGGAVLANIMADKDHMWLSKQEWQEMGSAAMSKF 334
           +     V +    ++++ V+ GG++LA     K +   +K++++E G   +  F
Sbjct: 391 KSTGVDVSVISHRKQRNAVWFGGSLLAQTAEFKGYCH-TKKDYEEYGPEIVRNF 443

>Skud_10.289 Chr10 complement(515300..516649) [1350 bp, 449 aa] {ON}
           YJR065C (REAL)
          Length = 449

 Score =  154 bits (388), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 110/353 (31%), Positives = 182/353 (51%), Gaps = 26/353 (7%)

Query: 2   IGDEA---SAVRSYLQISYPMENGVIKNWSDMELLWDYAFYDQMQLPSTSGGKVMLTEPP 58
           IG+EA   S   SY  +SYP+ +G ++NW  ME  W+ + +  ++         +LTEPP
Sbjct: 97  IGNEALVASQGPSY-SLSYPIRHGQVENWDHMERFWENSIFKYLRT-EPEDHFFLLTEPP 154

Query: 59  MNPVKNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXX--------TH 110
           +NP +NREQ+ E+ FE ++  G+Y+A+QAVLAL A                       TH
Sbjct: 155 LNPPENREQVAEIFFESFNCAGLYIAVQAVLALAASWTSSKVTDRSLTGTVIDSGDGVTH 214

Query: 111 IVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSY 170
           ++PV E  V+    + + +AGRD+T  +  LL  RG A        T  +IK++  YV  
Sbjct: 215 VIPVAEGYVIGSAIKNIPIAGRDITLFIQSLLRERGEA---DTSLRTAEKIKQEYCYVCP 271

Query: 171 DL-----DLDTKLARETTTLVENYELPDGRVIKVGSERFEAPECLFQPSLVDVEQPGVGE 225
           D+       D   ++    +VEN E    +V+ +G ERF APE  F P +   +      
Sbjct: 272 DIVKEFNKFDRDPSKFAQFVVENQEKTRRKVVDIGYERFLAPEIFFNPEIASSDFLTPLP 331

Query: 226 MLFN-TIQSADVDVRSALYRAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLHND---PSR 281
           M+ + TIQ+  +DVR  LY  IVLSGGS+M+     RL+++LK +  +R+  ++    ++
Sbjct: 332 MVVDQTIQACPIDVRKGLYNNIVLSGGSTMFKDFGRRLQRDLKSIVNSRIAQSELLSGTK 391

Query: 282 LDKFKVRIEDPPRRKHMVFIGGAVLANIMADKDHMWLSKQEWQEMGSAAMSKF 334
                V +    ++++ V+ GG++LA     K +   +K++++E G   +  F
Sbjct: 392 STGVDVSVISHRKQRNAVWFGGSLLAQTAEFKGYCH-TKKDYEEYGPEIVRNF 443

>NCAS0A12270 Chr1 complement(2428834..2430198) [1365 bp, 454 aa]
           {ON} Anc_1.514
          Length = 454

 Score =  153 bits (386), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 111/354 (31%), Positives = 181/354 (51%), Gaps = 28/354 (7%)

Query: 2   IGDEA---SAVRSYLQISYPMENGVIKNWSDMELLWDYAFYDQMQLPSTSGGKVMLTEPP 58
           IG+EA   S   SY  +SYP+ +G ++NW  ME  W+ + +  ++         +LTEPP
Sbjct: 102 IGNEALVASQGPSY-SLSYPIRHGQVENWDHMERFWENSIFKYLRT-EPEDHFFLLTEPP 159

Query: 59  MNPVKNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXX--------TH 110
           +NP +NREQ+ E+ FE ++  G+Y+A+QAVLAL A                       TH
Sbjct: 160 LNPPENREQIAEIFFESFNCAGLYIAVQAVLALAASWTSSKVTDRSLTGTVIDSGDGVTH 219

Query: 111 IVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSY 170
           ++PV E  V+    + + +AGRD+T  +  LL  RG A        T  +IK++  YV  
Sbjct: 220 VIPVAEGYVIGSAIKNIPIAGRDITLFIQSLLRERGEA---DTSLRTAERIKQEYCYVCP 276

Query: 171 DL-----DLDTKLARETTTLVENYELPDGRVIKVGSERFEAPECLFQPSLV--DVEQPGV 223
           D+       D    +    +VEN E    +++ VG ERF APE  F P +   D   P +
Sbjct: 277 DIVKEFNKFDRDGEKFAQFVVENQESTRKKIVDVGYERFLAPEIFFNPEIASSDFLTP-L 335

Query: 224 GEMLFNTIQSADVDVRSALYRAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLHND---PS 280
             ++  TIQ+  +DVR  LY  IVLSGGS+M+     RL+++LK +   R+  ++    +
Sbjct: 336 PTVVDQTIQACPIDVRKGLYNNIVLSGGSTMFKDFGRRLQRDLKGIVNNRIAQSEMLSGT 395

Query: 281 RLDKFKVRIEDPPRRKHMVFIGGAVLANIMADKDHMWLSKQEWQEMGSAAMSKF 334
           +     V++    ++++ V+ GG++LA     K +   +K+++ E G   +  F
Sbjct: 396 KSTGVNVQVISHRKQRNAVWFGGSLLAQTAEFKGYCH-TKKDYDEYGPEIVRNF 448

>CAGL0F00517g Chr6 (54743..56107) [1365 bp, 454 aa] {ON} highly
           similar to uniprot|P47117 Saccharomyces cerevisiae
           YJR065c ACT4 actin related protein
          Length = 454

 Score =  153 bits (386), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 108/354 (30%), Positives = 184/354 (51%), Gaps = 28/354 (7%)

Query: 2   IGDEASAV---RSYLQISYPMENGVIKNWSDMELLWDYAFYDQMQLPSTSGGKVMLTEPP 58
           IG+EA A    +SY  +SYP+ +G ++NW  ME  W+ + +  ++         +LTEPP
Sbjct: 102 IGNEALAAAQGQSY-SLSYPIRHGQVENWDHMERFWENSIFKYLRT-EPEDHFFLLTEPP 159

Query: 59  MNPVKNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXX--------TH 110
           +NP +NREQ+ E+ FE ++  G+Y+A+QAVLAL A                       TH
Sbjct: 160 LNPPENREQVAEIFFESFNCAGLYIAVQAVLALAASWTSPKVTDRSLTGTVIDSGDGVTH 219

Query: 111 IVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSY 170
           ++PV E  V+    + + +AGRD+T  +  LL  RG    +    +T  +IK++  YV  
Sbjct: 220 VIPVAEGYVIGSAIKNIPIAGRDITLFIQQLLRERG---EQDTSLKTAERIKQEYCYVCP 276

Query: 171 DL-----DLDTKLARETTTLVENYELPDGRVIKVGSERFEAPECLFQPSLV--DVEQPGV 223
           D+       D   ++    +VE+ E    +++ VG ERF APE  F P +   D   P +
Sbjct: 277 DIVKEFNKFDRDASKFAQFVVESQEKTRKKIVDVGYERFLAPEIFFNPEIASSDFLTP-L 335

Query: 224 GEMLFNTIQSADVDVRSALYRAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLHNDP---S 280
             ++  TIQ+  +DVR  LY  IVLSGGS+M+     RL++++K +   R+  ++    +
Sbjct: 336 PTVVDETIQACPIDVRKGLYNNIVLSGGSTMFKDFGRRLQRDMKSIVNNRIAQSEALSGT 395

Query: 281 RLDKFKVRIEDPPRRKHMVFIGGAVLANIMADKDHMWLSKQEWQEMGSAAMSKF 334
           +     V++    ++++ V+ GG++LA     K +   +K+++ E G   +  F
Sbjct: 396 KSTGVDVQVISHRKQRNAVWFGGSLLAQTAEFKSYCH-TKKDYDEYGPEIVRNF 448

>Suva_12.154 Chr12 complement(235605..236954) [1350 bp, 449 aa] {ON}
           YJR065C (REAL)
          Length = 449

 Score =  152 bits (384), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 110/354 (31%), Positives = 181/354 (51%), Gaps = 28/354 (7%)

Query: 2   IGDEA---SAVRSYLQISYPMENGVIKNWSDMELLWDYAFYDQMQLPSTSGGKVMLTEPP 58
           IG+EA   S   SY  +SYP+ +G ++NW  ME  W+ + +  ++         +LTEPP
Sbjct: 97  IGNEALVASQGPSY-SLSYPIRHGQVENWDHMERFWENSIFKYLRT-EPEDHFFLLTEPP 154

Query: 59  MNPVKNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXX--------TH 110
           +NP +NREQ+ E+ FE ++  G+Y+A+QAVLAL A                       TH
Sbjct: 155 LNPPENREQVAEIFFESFNCAGLYIAVQAVLALAASWTSSKVTDRSLTGTVIDSGDGVTH 214

Query: 111 IVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSY 170
           ++PV E  V+    + + +AGRD+T  +  LL  RG A        T  +IK++  YV  
Sbjct: 215 VIPVAEGYVIGSAIKNIPIAGRDITLFIQSLLRERGEA---DTSLRTAEKIKQEYCYVCP 271

Query: 171 DL-----DLDTKLARETTTLVENYELPDGRVIKVGSERFEAPECLFQPSLV--DVEQPGV 223
           D+       D   ++    +VEN E    + + +G ERF APE  F P +   D   P +
Sbjct: 272 DIVKEFNKFDRDPSKFAQFVVENQEKTRRKAVDIGYERFLAPEIFFNPEIASSDFLTP-L 330

Query: 224 GEMLFNTIQSADVDVRSALYRAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLHND---PS 280
             ++  TIQ+  +DVR  LY  IVLSGGS+M+     RL+++LK +   R+  ++    +
Sbjct: 331 PTVVDQTIQACPIDVRKGLYNNIVLSGGSTMFKDFGRRLQRDLKSIVNNRIAQSELLSGT 390

Query: 281 RLDKFKVRIEDPPRRKHMVFIGGAVLANIMADKDHMWLSKQEWQEMGSAAMSKF 334
           +     V +    ++++ V+ GG++LA     K +   +K++++E G   +  F
Sbjct: 391 KSTGVDVSVISHRKQRNAVWFGGSLLAQTAEFKGYCH-TKKDYEEYGPEIVRNF 443

>ZYRO0G01936g Chr7 complement(144085..145470) [1386 bp, 461 aa] {ON}
           highly similar to uniprot|P47117 Saccharomyces
           cerevisiae YJR065C ARP3 Essential component of the
           Arp2/3 complex which is a highly conserved actin
           nucleation center required for the motility and
           integrity of actin patches involved in endocytosis and
           membrane growth and polarity
          Length = 461

 Score =  152 bits (384), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 107/353 (30%), Positives = 181/353 (51%), Gaps = 26/353 (7%)

Query: 2   IGDEA--SAVRSYLQISYPMENGVIKNWSDMELLWDYAFYDQMQLPSTSGGKVMLTEPPM 59
           IG+EA  ++  +   ++YP+ +G ++NW  ME  W+ + +  ++         +LTEPP+
Sbjct: 109 IGNEALTASQGANYSLNYPIRHGQVENWDHMERFWENSIFKYLRT-EPEDHFFLLTEPPL 167

Query: 60  NPVKNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXX--------THI 111
           NP +NREQ+ E+ FE ++  G+Y+A+QAVLAL A                       TH+
Sbjct: 168 NPPENREQVAEIFFESFNCAGLYIAVQAVLALAASWTSSKVVDRSLTGTVIDSGDGVTHV 227

Query: 112 VPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYD 171
           +PV E  V+    + + +AGRD+T+ +  LL  RG          T  +IK++  YV  D
Sbjct: 228 IPVAEGYVIGSALKNIPIAGRDITQFIQSLLRERGEV---DTSLRTAERIKQEYCYVCPD 284

Query: 172 L-----DLDTKLARETTTLVENYELPDGRVIKVGSERFEAPECLFQPSLV--DVEQPGVG 224
           +       D    +    +VEN +    +V+ +G ERF APE  F P +   D   P + 
Sbjct: 285 IVKEFNKFDRDAEKFAQYVVENQDKTRQKVVDIGYERFLAPEIFFNPEIASSDFLTP-LP 343

Query: 225 EMLFNTIQSADVDVRSALYRAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLHND---PSR 281
            +L  TIQ+  +DVR  LY  IVLSGGS+M+     RL+++LK +   R+   +    +R
Sbjct: 344 TVLDQTIQACPIDVRKGLYNNIVLSGGSTMFKDFGRRLQRDLKSIVNNRIAETERLSGAR 403

Query: 282 LDKFKVRIEDPPRRKHMVFIGGAVLANIMADKDHMWLSKQEWQEMGSAAMSKF 334
                V++    ++++ V+ GG++LA     K +   +K++++E G   +  F
Sbjct: 404 STGVDVQVISHRKQRNAVWFGGSLLAQTPEFKGYCH-TKKDYEEYGPEIVRNF 455

>KLLA0F19063g Chr6 complement(1756529..1757776) [1248 bp, 415 aa]
           {ON} similar to uniprot|Q12509 Saccharomyces cerevisiae
           YLR085C ARP6 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 415

 Score = 76.6 bits (187), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 83/322 (25%), Positives = 126/322 (39%), Gaps = 61/322 (18%)

Query: 15  ISYPMENGVIKNWSDMELLWDYAFYDQMQL-------PSTSGGKVMLTEPPMNPVKNREQ 67
           I  P E G + +W     +WDY FY++            T    ++++E  M   +  + 
Sbjct: 57  IRRPHELGQLVSWELESEVWDYCFYNEDDFHWNLTHDNDTKDHHLVVSETLMTIPELSKN 116

Query: 68  MCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXX------------------XXT 109
           M +V+FE+YDF  ++    A    + QG                               T
Sbjct: 117 MDQVIFEEYDFKSMFKGPVAQYIPFYQGQYQDDAMTAAEDKKTSSYKDFQLVIDSGFNCT 176

Query: 110 HIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYV- 168
             VP+ + V      ++LD+ GR +T  L + +S R Y  N   +   V  IKE+ ++V 
Sbjct: 177 WAVPIIKGVPYYKAIKKLDIGGRFLTGLLQETISFRHY--NVMEETILVNNIKEQCTFVP 234

Query: 169 --SYDLDLDTKLARETTTLVENYELPD------GRVIKVGSER--------------FEA 206
             SY      K+     T VE Y LPD      G V K G E+              F  
Sbjct: 235 PESYFSSFHNKM----NTKVE-YVLPDFQTSFLGYVKKPGKEKLTDDAQTLLLTDEVFSV 289

Query: 207 PECLFQPSLVDVEQPGVGEMLFNTIQSADVDVRSALYRAIVLSGGSSMYPGLPSRLEKEL 266
           PE  F P +  + +PG+ E +   I      VR  L   IV +GG+   P    RL+ EL
Sbjct: 290 PETFFHPEIAQILKPGIVETILECINMCPEVVRPLLVANIVCTGGNFNIPNFHERLQTEL 349

Query: 267 KQL----WFTRVLHNDPSRLDK 284
           ++     W  +V  + P   DK
Sbjct: 350 QRQCPIDWSCKV--HSPQEKDK 369

>TDEL0F03850 Chr6 complement(707880..709139) [1260 bp, 419 aa] {ON}
           Anc_8.258 YLR085C
          Length = 419

 Score = 75.1 bits (183), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 71/318 (22%), Positives = 127/318 (39%), Gaps = 55/318 (17%)

Query: 2   IGDEASAVRSYLQISY--PMENGVIKNWSDMELLWDYAFY-----DQMQLPSTSGGKVML 54
           + ++ + ++    +S+  P E G + +W     +WDY F+     D   L  + G  ++ 
Sbjct: 42  LSNQINQIKDISSVSFKRPHEYGQLTSWELQSCVWDYCFFNPNEFDGFDLKDSKGQHLIA 101

Query: 55  TEPPMNPVKNREQMCEVMFEKYDFGGVYVA-----------IQAVLALYAQGLXXXXXXX 103
           +E  M   +  + M +V+FE+Y+F  +  A            +    +  +G        
Sbjct: 102 SETCMTLPELSKNMDQVVFEEYEFDSLLKAPISGFMPFSKHTENTKVISGKGDSESGTST 161

Query: 104 XXXX--------------XTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAF 149
                              T +VP+ + V      ++LD+ GR +   L + LS R Y  
Sbjct: 162 SETKDYEPFQMVIDSGFNCTWVVPIIKGVPFYKAVKKLDLGGRFINGLLKETLSFRHY-- 219

Query: 150 NRSADFETVRQIKEKLSYVSYDLDLDTKLARETTTLVENYELPDGRVIKVG--------- 200
           N   +   V  IKEK  ++S     D+  A++  T VE Y LPD +   +G         
Sbjct: 220 NVMDETILVNNIKEKCLFMSPVSYFDS-FAKKDQTAVE-YVLPDFQTTFLGYVADRKNPP 277

Query: 201 ----------SERFEAPECLFQPSLVDVEQPGVGEMLFNTIQSADVDVRSALYRAIVLSG 250
                      E F  PE  F P +  + +PG+ E +  ++      +R  +   I+ +G
Sbjct: 278 SKDAQTVTLRDELFSVPETFFHPEIAQLLKPGIIETILESLSLVPEPLRPLMVSNILCTG 337

Query: 251 GSSMYPGLPSRLEKELKQ 268
           G+   P  P RL  EL++
Sbjct: 338 GNFNLPHFPERLATELQR 355

>SAKL0H17138g Chr8 (1515123..1516382) [1260 bp, 419 aa] {ON} highly
           similar to uniprot|Q74ZV8 Ashbya gossypii AGR091W ARP6
           Actin-like protein ARP6 and similar to uniprot|Q12509
           Saccharomyces cerevisiae YLR085C ARP6 Nuclear actin-
           related protein involved in chromatin remodeling
           component of chromatin-remodeling enzyme complexes
          Length = 419

 Score = 72.0 bits (175), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 69/307 (22%), Positives = 120/307 (39%), Gaps = 53/307 (17%)

Query: 11  SYLQISYPMENGVIKNWSDMELLWDYAFYD----QMQLPSTSGGKVMLTEPPMNPVKNRE 66
           S +Q   P E G + +W     +WDY  Y+      ++ +T G  ++L+E  M+  +  +
Sbjct: 53  SNVQFRRPHELGQLTSWELQSCIWDYCLYNPDEFNWEIGNTKGKHLVLSEMCMSMPELSK 112

Query: 67  QMCEVMFEKYDFGGVYVA-IQAVLALYAQGLXXXXXXXXXXX------------------ 107
              +V+FE+Y+FG  +   +   +    Q L                             
Sbjct: 113 GTDQVVFEEYEFGSCFKGPVAGFVPFNWQALEHNMIYAKEDSVYRKDSTGERNEYNDFQL 172

Query: 108 -------XTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQ 160
                   T +VP+ + +      ++LD+ GR +   L + LS R Y  N   +   V  
Sbjct: 173 VIDSGFNCTWVVPIVKGIPYYKAIKKLDIGGRFLNGFLKETLSFRHY--NVMDETILVNN 230

Query: 161 IKEKLSYVSYDLDLDTKLARETTTLVENYELPD-------------------GRVIKVGS 201
           IKEK  ++S     ++   +E TT    Y LPD                    + IK+  
Sbjct: 231 IKEKCLFMSPVSYFNSFQKKEDTT--AEYVLPDFQTSFQGYVKQQKQKIPEDSQTIKLYD 288

Query: 202 ERFEAPECLFQPSLVDVEQPGVGEMLFNTIQSADVDVRSALYRAIVLSGGSSMYPGLPSR 261
           E F  PE  F P +  + +PG+ E +  +I      +R  +    V++GG+        R
Sbjct: 289 ELFSIPETFFHPEIASLLKPGIVETILESISMLPEAIRPLMVSNTVVTGGNFNIRNFARR 348

Query: 262 LEKELKQ 268
           L  EL++
Sbjct: 349 LATELQR 355

>ZYRO0C01738g Chr3 (135066..136310) [1245 bp, 414 aa] {ON} similar
           to uniprot|Q12509 Saccharomyces cerevisiae YLR085C ARP6
           Nuclear actin-related protein involved in chromatin
           remodeling component of chromatin-remodeling enzyme
           complexes
          Length = 414

 Score = 71.2 bits (173), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 65/296 (21%), Positives = 118/296 (39%), Gaps = 49/296 (16%)

Query: 18  PMENGVIKNWSDMELLWDYAFYDQ-----MQLPSTSGGKVMLTEPPMNPVKNREQMCEVM 72
           P E G + +W     +WDY F++        L  + G  ++++E  M   +  + M +V+
Sbjct: 60  PHEFGQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQHLVVSETCMTIPELSKNMDQVV 119

Query: 73  FEKYDFGGVYVAIQAVLALYAQGLXXXX---------------------XXXXXXXXTHI 111
           FE+Y+F  ++ +  A  A + +                                   T +
Sbjct: 120 FEEYEFASMFKSPIAGFAPFGRPSIAISGKGDDQPNRKAEPDAYEPFQLVIDVGFNCTWV 179

Query: 112 VPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYD 171
           VPV + +      ++LD+ GR +   L + LS R Y  N   +   V  IKE   +VS  
Sbjct: 180 VPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHY--NVMDETILVNNIKENCLFVSPV 237

Query: 172 LDLDTKLARETTTLVENYELPD-------------------GRVIKVGSERFEAPECLFQ 212
              ++   +E T +   Y LPD                    + +++  E F  PE  F 
Sbjct: 238 SYFESFKHKEQTAV--EYVLPDFQTSFLGYVKDPKKPLPQDSQTVELKDELFSVPETFFH 295

Query: 213 PSLVDVEQPGVGEMLFNTIQSADVDVRSALYRAIVLSGGSSMYPGLPSRLEKELKQ 268
           P +  + +PG+ E +  ++      +R  +   IV +GG+   P   +RL  EL++
Sbjct: 296 PEIPQLLKPGIIETILESLSILPEQLRPLMLGNIVCTGGNFNLPNFATRLATELQR 351

>NDAI0G05580 Chr7 complement(1374852..1376399) [1548 bp, 515 aa]
           {ON} Anc_1.287
          Length = 515

 Score = 70.9 bits (172), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 41/132 (31%), Positives = 66/132 (50%), Gaps = 1/132 (0%)

Query: 9   VRSYLQISYPMENGVIKNWSDMELLWDYAFYDQMQLPSTSGGKVMLTEPPMNPVKNREQM 68
            R   +I   +ENG I +W   +  WD+   +++ L S SG  V+LTEP  N V+NR++ 
Sbjct: 68  ARPDYEIKRIVENGEIADWDTAQEQWDWVLKNELFLKSNSGIPVLLTEPIWNSVENRKKS 127

Query: 69  CEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRRLD 128
            EV+ E  DF   Y++  +    +A G             T + PV + + L+  + R  
Sbjct: 128 LEVLLEGMDFEACYLSPVSTCVSFAAGRPNCLVVDIGHDTTSVSPVIDGMTLSKSSTRNF 187

Query: 129 VAGRDVTRHLID 140
           +AGR +  HLI+
Sbjct: 188 IAGRYI-NHLIE 198

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 30/110 (27%), Positives = 60/110 (54%), Gaps = 16/110 (14%)

Query: 222 GVGEMLFNTIQSADVDVRSALYRAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLHNDPSR 281
           G+ +++  +I  +DVD+R++L   +V++GG+S  P L  RL  EL +            R
Sbjct: 410 GIADLVQRSILDSDVDLRASLAHNVVITGGTSCIPRLNDRLMYELSK------------R 457

Query: 282 LDKFKVRIEDPPR---RKHMVFIGGAVLANIMADKDHMWLSKQEWQEMGS 328
           L   K RI        +++  ++GG++L + +     +W+ K+E++E+G+
Sbjct: 458 LPALKFRILTTGHLREKQYQAWLGGSILTS-LGTFHQLWVGKEEYKEVGA 506

>Kwal_56.23832 s56 (726199..727458) [1260 bp, 419 aa] {ON} YLR085C
           (ARP6) - Actin-related protein [contig 172] FULL
          Length = 419

 Score = 69.3 bits (168), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 77/328 (23%), Positives = 127/328 (38%), Gaps = 63/328 (19%)

Query: 6   ASAVRSYLQISY-----PMENGVIKNWSDMELLWDYAFYDQ-----MQLPSTSGGKVMLT 55
           ++ VRS   IS      P E G + +W     +WDY  ++        + +T G  ++ +
Sbjct: 43  SNQVRSIKDISSVVFNRPHELGQLVSWELETQIWDYCLFNPDDFNGWSIDTTKGKHLITS 102

Query: 56  EPPMNPVKNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXX--------- 106
           E  M   +  + M +V+FE+Y+F  ++ A   V   +  G                    
Sbjct: 103 ESCMTIPELSKNMDQVVFEEYEFETMFKAPVPVFVPFNTGKKSTHMLVAKEDSEVEESEV 162

Query: 107 -----------------XXTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAF 149
                              + IVPV + V      ++LD+ GR +   L + LS R Y  
Sbjct: 163 APAKNYNDFQLVIDSGFNCSWIVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHY-- 220

Query: 150 NRSADFETVRQIKEKLSYVSYDLDLDTKLARETTTLVENYELPD------------GRVI 197
           N   +   V  IKE   ++S +   ++  +R  T   + Y LPD            G+V+
Sbjct: 221 NVMDETILVNSIKENCLFMSPNAYFESFQSRSKT--AKEYVLPDFNTSFQGYLRKPGQVL 278

Query: 198 KVGS-------ERFEAPECLFQPSLVDVEQPGVGEMLFNTIQSADVDVRSALYRAIVLSG 250
              S       E F  PE  F P +  +   G+ E +  +I      +R  +   IV++G
Sbjct: 279 PAESQTIVLQDELFAVPETFFHPEIASLLNSGIVETILESISMLPEAIRPLMVGNIVITG 338

Query: 251 GSSMYPGLPSRLEKELKQL----WFTRV 274
           G+   P   SRL  EL++     W  RV
Sbjct: 339 GNFNIPNFASRLATELQRQCPTDWSCRV 366

>TPHA0A01830 Chr1 (369897..371162) [1266 bp, 421 aa] {ON} Anc_8.258
           YLR085C
          Length = 421

 Score = 68.9 bits (167), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 69/308 (22%), Positives = 119/308 (38%), Gaps = 54/308 (17%)

Query: 11  SYLQISYPMENGVIKNWSDMELLWDYAFYDQ-----MQLPSTSGGKVMLTEPPMNPVKNR 65
           S + I  P + G + +W     +WDY FY+       ++   S   ++LTE PM   +  
Sbjct: 53  SSVSIKRPHQLGQLVSWELEHEIWDYCFYNGDDFKGFEVNEDSENHLVLTETPMTLPELS 112

Query: 66  EQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTH--------------- 110
               +V+FE+Y F  +Y A  A    + +              T+               
Sbjct: 113 RNTDQVVFEEYGFDSLYKAPAANFIPFIKNDDNSFIRLSGKSKTYLDGSKENNYQDFNLV 172

Query: 111 ---------IVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQI 161
                    I+P+ + V      +++D+ GR +   L + +S R Y     +    V  I
Sbjct: 173 IDSGYNCSWIIPMIKGVPYYKAVKKMDMGGRFLNGLLKETISYRHYDVTDESML--VNNI 230

Query: 162 KEKLSYVSYDLDLDTKLARETTTLVENYELPDGRVIKVG--------------------- 200
           KE   ++S  +       ++  T VE Y LPD +   +G                     
Sbjct: 231 KENCMFIS-PVSYIESFKKKALTKVE-YVLPDFQTSFMGYVRDMKKHSTLPEHSQSIILE 288

Query: 201 SERFEAPECLFQPSLVDVEQPGVGEMLFNTIQSADVDVRSALYRAIVLSGGSSMYPGLPS 260
            E F  PE  F P + +V +PG+ E +  ++      +RS +   IV +GG+   P   S
Sbjct: 289 DELFSVPEGFFHPEMANVLKPGIIETILESLFILPESLRSLMVNNIVCTGGNFNIPNFGS 348

Query: 261 RLEKELKQ 268
           R+  EL++
Sbjct: 349 RIYTELQK 356

>KLTH0G13772g Chr7 (1188875..1190137) [1263 bp, 420 aa] {ON} similar
           to uniprot|Q12509 Saccharomyces cerevisiae YLR085C ARP6
           Nuclear actin-related protein involved in chromatin
           remodeling component of chromatin-remodeling enzyme
           complexes
          Length = 420

 Score = 68.9 bits (167), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 73/319 (22%), Positives = 124/319 (38%), Gaps = 59/319 (18%)

Query: 11  SYLQISYPMENGVIKNWSDMELLWDYAFY-----DQMQLPSTSGGKVMLTEPPMNPVKNR 65
           S +  + P + G + +W     +WDY  +     D   L +T    ++ +E  M   +  
Sbjct: 53  SSVTFNRPHKLGQLVSWELESQIWDYCLFNPDEFDGWSLDTTKNKHLIASESCMTLPELS 112

Query: 66  EQMCEVMFEKYDFGGVYVA-IQAVLALYAQGLXXXXXXXXXXX----------------- 107
           + M +V+FE+Y++  ++ A +   +   A+G                             
Sbjct: 113 KNMDQVVFEEYEYDSLFKAPVPVFVPFNAEGDTTHILVAKEDADVVASDHPSDNKDYRDY 172

Query: 108 ---------XTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETV 158
                     T +VPV + V      ++LD+ GR +   L + LS R Y  N   +   V
Sbjct: 173 ELVIDSGFNCTWVVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHY--NVMDETILV 230

Query: 159 RQIKEKLSYVSYDLDLDTKLARETTTLVENYELPD-------------------GRVIKV 199
             IKEK  ++S +   D+  +R  T   + Y LPD                    + I +
Sbjct: 231 NSIKEKCLFMSPNSYFDSFQSRLKT--AKEYVLPDFSTSFQGYLRKPGQTLPEDSQTIIL 288

Query: 200 GSERFEAPECLFQPSLVDVEQPGVGEMLFNTIQSADVDVRSALYRAIVLSGGSSMYPGLP 259
             E F  PE  F P +  +  PG+ E +  +I      +R  L   +V++GG+   P   
Sbjct: 289 QDELFAVPETFFHPEIASLLNPGIIEAILESISMLPEALRPLLVGNVVVTGGNFNIPNFA 348

Query: 260 SRLEKELKQL----WFTRV 274
           SRL  EL++     W  RV
Sbjct: 349 SRLATELQRQCPTDWSCRV 367

>KNAG0B01920 Chr2 complement(362300..363817) [1518 bp, 505 aa] {ON}
           Anc_1.287 YJL081C
          Length = 505

 Score = 68.9 bits (167), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 38/131 (29%), Positives = 63/131 (48%), Gaps = 1/131 (0%)

Query: 10  RSYLQISYPMENGVIKNWSDMELLWDYAFYDQMQLPSTSGGKVMLTEPPMNPVKNREQMC 69
           R   +I   +ENG + +W   +  W++A  +++ L ST G   +LTEP  N  KNR++  
Sbjct: 81  RKDYEIKTIVENGAVTDWDAAQEQWEWALKNELFLESTKGIPALLTEPVWNTKKNRKKSL 140

Query: 70  EVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRRLDV 129
           E + E  +F   Y+A  +    +A G               + PV + + L+  TRR   
Sbjct: 141 ETLLESMNFEACYLAPTSTCVSFATGRANCLVVDIGHDTCSVSPVVDGMTLSKSTRRSFF 200

Query: 130 AGRDVTRHLID 140
           AG+ +  HLI+
Sbjct: 201 AGKYIN-HLIE 210

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 33/110 (30%), Positives = 63/110 (57%), Gaps = 16/110 (14%)

Query: 222 GVGEMLFNTIQSADVDVRSALYRAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLHNDPSR 281
           G+ +++ ++I ++DVD+R++L   + L+GG+S+ PGL  RL  EL             +R
Sbjct: 400 GLADLVHSSIMASDVDLRASLAHNVQLTGGTSLIPGLSDRLMLELN------------AR 447

Query: 282 LDKFKVRI---EDPPRRKHMVFIGGAVLANIMADKDHMWLSKQEWQEMGS 328
           L   K RI        R++  ++GG+VL + +     +W+ +QE++E+G+
Sbjct: 448 LPALKFRILTTGHKKEREYQSWLGGSVLTS-LGTFHQLWVGRQEYEEVGA 496

>Suva_6.154 Chr6 (266531..268000) [1470 bp, 489 aa] {ON} YJL081C
           (REAL)
          Length = 489

 Score = 68.6 bits (166), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 41/160 (25%), Positives = 73/160 (45%), Gaps = 5/160 (3%)

Query: 19  MENGVIKNWSDMELLWDYAFYDQMQLPSTSGGKVMLTEPPMNPVKNREQMCEVMFEKYDF 78
           +ENG++ +W   +  W +A  +++ L S SG   +LTEP  N  +NR++  EV+ E   F
Sbjct: 75  IENGLVIDWDTAQEQWQWALKNELYLDSNSGIPALLTEPVWNSTENRKKSLEVLLEGMQF 134

Query: 79  GGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRRLDVAGRDVTRHL 138
              Y+A  +    +A G               + P+ + + L+  TRR  +AG+      
Sbjct: 135 EACYLAPTSTCVSFAAGRPNCLVVDIGHDTCSVSPIVDGMTLSKSTRRNFIAGK-----F 189

Query: 139 IDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLDLDTKL 178
           I+ L ++            ++Q K KL    +D ++D  L
Sbjct: 190 INHLIKKAIEPKEIIPLFAIKQRKPKLIKKIFDYEIDQSL 229

 Score = 62.4 bits (150), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 36/110 (32%), Positives = 66/110 (60%), Gaps = 12/110 (10%)

Query: 219 EQPGVGEMLFNTIQSADVDVRSALYRAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLHND 278
           E  G+ ++++++I S+DVD+R+ L   +VL+GG+S  PGL  RL  EL ++         
Sbjct: 381 EITGLADLVYSSIMSSDVDLRATLAHNVVLTGGTSSIPGLSDRLMTELNKIL-------- 432

Query: 279 PSRLDKFKVRIEDPPR-RKHMVFIGGAVLANIMADKDHMWLSKQEWQEMG 327
           PS   KF++      R R++  ++GG++L + +     +W+ KQE++E+G
Sbjct: 433 PSL--KFRILTTGHTRERQYQSWLGGSILTS-LGTFHQLWVGKQEYEEVG 479

>Kpol_543.36 s543 complement(80922..82205) [1284 bp, 427 aa] {ON}
           complement(80922..82205) [1284 nt, 428 aa]
          Length = 427

 Score = 68.2 bits (165), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 69/313 (22%), Positives = 123/313 (39%), Gaps = 57/313 (18%)

Query: 11  SYLQISYPMENGVIKNWSDMELLWDYAFYDQMQLPS-----TSGGKVMLTEPPMNPVKNR 65
           S + I  P E G + +W     +WDY F++  + P+     T G  ++++E  M   +  
Sbjct: 53  SSVTIRRPHELGQLVSWELEGTVWDYCFFNPDEFPNFNLKETKGHHLVVSETCMTLPELS 112

Query: 66  EQMCEVMFEKYDFGGVYVAIQAVLALY--------------------------AQGLXX- 98
             M +VMFE+Y+F  ++ +  A    +                          +Q +   
Sbjct: 113 ANMDQVMFEEYEFESLFKSPVAGFVPFLNLQDNMKMICGKGDDVMGDLISNMDSQNIKNP 172

Query: 99  ----XXXXXXXXXXTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSAD 154
                         T I+P+ + V      +++++ GR +     + +S R Y  + + +
Sbjct: 173 YSDFNLVIDSGFNCTWIIPIIKGVPYYKAVKKMEMGGRFLNGLFKETISYRHY--DVTDE 230

Query: 155 FETVRQIKEKLSYVS-----------------YDL-DLDTKLARETTTLVENYELP-DGR 195
              V  IKEK  ++S                 Y L D  T           N +LP + +
Sbjct: 231 TILVNNIKEKCLFMSPTSYMDSFKNKDRYSVDYVLPDFQTSFIGYVKDKKSNSQLPENSQ 290

Query: 196 VIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTIQSADVDVRSALYRAIVLSGGSSMY 255
           VI +  E F  PE +F P +  + +PG+ E +  ++      +R  L   IV  GG+   
Sbjct: 291 VITLTDELFSVPETIFHPEMAKLLKPGIVETILESLSIVPETIRPLLVNNIVCVGGNFNM 350

Query: 256 PGLPSRLEKELKQ 268
           P   SRL  EL++
Sbjct: 351 PNFGSRLATELQR 363

>KAFR0B02700 Chr2 complement(543626..544888) [1263 bp, 420 aa] {ON}
           Anc_8.258 YLR085C
          Length = 420

 Score = 67.4 bits (163), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 70/312 (22%), Positives = 120/312 (38%), Gaps = 61/312 (19%)

Query: 11  SYLQISYPMENGVIKNWSDMELLWDYAFYDQ-----MQLPSTSGGKVMLTEPPMNPVKNR 65
           S + I  P   G + +W    L+WDY  Y+        +  T    ++ +E  M   +  
Sbjct: 53  SSVSIKRPHTLGQLTSWEMQTLIWDYCLYNPDEFNGFNIGDTKSKHLITSETCMTLPELG 112

Query: 66  EQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXX---------------------- 103
           + M +V+FE+Y+FG +   +++ +A Y   L                             
Sbjct: 113 KNMDQVIFEEYEFGSL---MKSPVAGYMPFLRNTKDQIIIGERDTEPFVETPSTEEYRDF 169

Query: 104 -----XXXXXTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETV 158
                     T I+PV + +      ++LD+ GR +   L + LS R Y  N   +   V
Sbjct: 170 QLVVDSGFNCTWIIPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHY--NVMDETILV 227

Query: 159 RQIKEKLSYVSYDLDLDTKLARETTTLVENYELPD----------------------GRV 196
             IKEK  +VS     D+   ++ T+    Y LPD                       + 
Sbjct: 228 NNIKEKCLFVSPASYFDSFKNKDITS--REYVLPDFQTSFLGYVRPSNEQGKPLPEDSQS 285

Query: 197 IKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTIQSADVDVRSALYRAIVLSGGSSMYP 256
           I +  E F  PE  F P +  + +PG+ E +  ++      +R  +   I+  GG+   P
Sbjct: 286 ITLKDELFAVPETFFHPEISQILKPGLVETILESLSMIPEVIRPLMVSNIMCIGGNFNLP 345

Query: 257 GLPSRLEKELKQ 268
              SR+ KEL++
Sbjct: 346 HFASRVAKELQR 357

>NCAS0B06060 Chr2 complement(1146248..1147741) [1494 bp, 497 aa]
           {ON} 
          Length = 497

 Score = 67.4 bits (163), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 64/254 (25%), Positives = 108/254 (42%), Gaps = 34/254 (13%)

Query: 3   GDEASAVR------SYLQISYP-------MENGVIKNWSDMELLWDYAFYDQMQLPSTSG 49
           G E++  R      S +QI  P       +ENG I +W   +  W +A   Q+ L STSG
Sbjct: 53  GQESTTKRKRIFSESSIQIPRPDYEIKRIVENGSIMDWDAAQEQWSWALKSQLHLQSTSG 112

Query: 50  GKVMLTEPPMNPVKNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXT 109
              +LTEP  N V+NR++  E++ E  +F   Y++       +A G             T
Sbjct: 113 IPALLTEPIWNSVENRKKSLEILLEGMNFEACYLSSVPTCVSFAAGRPNCLVVDIGHDTT 172

Query: 110 HIVPVYESVVLNHLTRRLDVAGRDVT---------RHLIDLLS---RRGYAFNRSADFET 157
            + PV + + L+  + R  +AG+ +          R +I L S   RR     R+ D+  
Sbjct: 173 SVSPVVDGMTLSKSSMRNFIAGKYINTLIEKYLQPREIIPLFSIKQRRPEFIKRTFDYTV 232

Query: 158 VRQIKEKLSYVSYDLDLDTKLARETTTLVENYELPDGRVIKVGSERFEAP---ECLFQPS 214
              + +  +   +  +    L + T+T   + E    ++  + S   EAP   E +F+  
Sbjct: 233 DSSLYQYANEHEFFQECKETLCQITST--GSLEKNKDQLKTISSRSIEAPWAEELVFE-- 288

Query: 215 LVDVEQPGVGEMLF 228
             +  + G GE LF
Sbjct: 289 --NETRFGFGEELF 300

 Score = 58.5 bits (140), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 36/120 (30%), Positives = 63/120 (52%), Gaps = 22/120 (18%)

Query: 217 DVEQP------GVGEMLFNTIQSADVDVRSALYRAIVLSGGSSMYPGLPSRLEKELKQLW 270
           D+ +P      G+ +++++ I  +DVD+R++L   +VL+GGSS  PGL  RL  EL +  
Sbjct: 381 DISEPTKNDIAGLADLVYSAIIKSDVDLRASLAHNVVLTGGSSSIPGLSDRLILELNR-- 438

Query: 271 FTRVLHNDPSRLDKFKVRI---EDPPRRKHMVFIGGAVLANIMADKDHMWLSKQEWQEMG 327
                     RL   K RI        R++  ++GG++L + +     +W+ K E+ E+G
Sbjct: 439 ----------RLPALKFRILSTGHTKERQYQAWLGGSILTS-LGTFHQLWVGKNEYNEVG 487

>YJL081C Chr10 complement(283802..285271) [1470 bp, 489 aa] {ON}
           ARP4Nuclear actin-related protein involved in chromatin
           remodeling, component of chromatin-remodeling enzyme
           complexes
          Length = 489

 Score = 67.0 bits (162), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 39/160 (24%), Positives = 73/160 (45%), Gaps = 5/160 (3%)

Query: 19  MENGVIKNWSDMELLWDYAFYDQMQLPSTSGGKVMLTEPPMNPVKNREQMCEVMFEKYDF 78
           +ENG++ +W   +  W +A  +++ L S SG   +LTEP  N  +NR++  EV+ E   F
Sbjct: 75  IENGLVIDWDTAQEQWQWALQNELYLNSNSGIPALLTEPVWNSTENRKKSLEVLLEGMQF 134

Query: 79  GGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRRLDVAGRDVTRHL 138
              Y+A  +    +A G               + P+ + + L+  TRR  +AG+      
Sbjct: 135 EACYLAPTSTCVSFAAGRPNCLVVDIGHDTCSVSPIVDGMTLSKSTRRNFIAGK-----F 189

Query: 139 IDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLDLDTKL 178
           I+ L ++            ++Q K +    ++D ++D  L
Sbjct: 190 INHLIKKALEPKEIIPLFAIKQRKPEFIKKTFDYEVDKSL 229

 Score = 59.7 bits (143), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 66/119 (55%), Gaps = 16/119 (13%)

Query: 212 QPSLVDVEQPGVGEMLFNTIQSADVDVRSALYRAIVLSGGSSMYPGLPSRLEKELKQLWF 271
           +P   + E  G+ ++++++I S+DVD+R+ L   +VL+GG+S  PGL  RL  EL ++  
Sbjct: 374 KPPKENNELIGLADLVYSSIMSSDVDLRATLAHNVVLTGGTSSIPGLSDRLMTELNKI-- 431

Query: 272 TRVLHNDPSRLDKFKVRI---EDPPRRKHMVFIGGAVLANIMADKDHMWLSKQEWQEMG 327
                     L   K RI        R++  ++GG++L + +     +W+ K+E++E+G
Sbjct: 432 ----------LPSLKFRILTTGHTIERQYQSWLGGSILTS-LGTFHQLWVGKKEYEEVG 479

>Skud_10.132 Chr10 complement(251748..253214) [1467 bp, 488 aa] {ON}
           YJL081C (REAL)
          Length = 488

 Score = 66.6 bits (161), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 35/121 (28%), Positives = 61/121 (50%), Gaps = 1/121 (0%)

Query: 19  MENGVIKNWSDMELLWDYAFYDQMQLPSTSGGKVMLTEPPMNPVKNREQMCEVMFEKYDF 78
           +ENG++ +W   +  W +A  +++ L S SG   +LTEP  N ++NR++  EV+ E   F
Sbjct: 75  IENGLVIDWDTAQEQWQWALRNELYLDSNSGIPALLTEPVWNSMENRKKSLEVLLEGMQF 134

Query: 79  GGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRRLDVAGRDVTRHL 138
              Y+A  +    +A G               + P+ + + L+  TRR  +AG+ +  HL
Sbjct: 135 EACYLAPTSTCVSFAAGRPNCLVVDIGHDTCSVSPIVDGMTLSKSTRRNFIAGKFIN-HL 193

Query: 139 I 139
           I
Sbjct: 194 I 194

 Score = 60.8 bits (146), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 36/110 (32%), Positives = 65/110 (59%), Gaps = 12/110 (10%)

Query: 219 EQPGVGEMLFNTIQSADVDVRSALYRAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLHND 278
           E  G+  +++++I S+DVD+R+ L   +VL+GG+S  PGL  RL  EL ++         
Sbjct: 380 ELAGLAGLVYSSIMSSDVDLRATLAHNVVLTGGTSSIPGLSDRLMTELNKIL-------- 431

Query: 279 PSRLDKFKVRIEDPPR-RKHMVFIGGAVLANIMADKDHMWLSKQEWQEMG 327
           PS   KF++      R R++  ++GG++L + +     +W+ KQE++E+G
Sbjct: 432 PSL--KFRILTTGHIRERQYQSWLGGSILTS-LGTFHQLWVGKQEYEEVG 478

>TPHA0I01030 Chr9 complement(236150..237661) [1512 bp, 503 aa] {ON}
           Anc_1.287 YJL081C
          Length = 503

 Score = 66.2 bits (160), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 38/112 (33%), Positives = 67/112 (59%), Gaps = 18/112 (16%)

Query: 221 PGVGEMLFNTIQSADVDVRSALYRAIVLSGGSSMYPGLPSR----LEKELKQLWFTRVLH 276
           PG+ +++ ++I +ADVD+R++L   +VL+GG+S  PGL  R    L K L  L F RVL 
Sbjct: 397 PGIVDLIESSINAADVDLRTSLAHNVVLTGGTSCIPGLSDRILLELNKRLPALKF-RVLA 455

Query: 277 NDPSRLDKFKVRIEDPPRRKHMVFIGGAVLANIMADKDHMWLSKQEWQEMGS 328
           N  +R             R++  ++GG++L++ +     +W+ KQE++E+G+
Sbjct: 456 NGQTR------------ERQYQSWLGGSILSS-LGTFHQLWVGKQEYEEIGA 494

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 34/136 (25%), Positives = 62/136 (45%)

Query: 10  RSYLQISYPMENGVIKNWSDMELLWDYAFYDQMQLPSTSGGKVMLTEPPMNPVKNREQMC 69
           R+  +I   ++NG + +W   +  W +A  +++ L S  G   +LTEP  N V+NR++  
Sbjct: 89  RANYEIKPIVQNGEVVDWDAAQEQWSWALENELFLKSNEGVPALLTEPIWNTVENRKKSL 148

Query: 70  EVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRRLDV 129
           EV+ E   F   Y++       +A G               + PV + +  +  TRR  +
Sbjct: 149 EVLLEGMGFEACYLSATPTCVSFAAGRSNCLVVDIGHDIISVSPVVDGMTFSKSTRRNVI 208

Query: 130 AGRDVTRHLIDLLSRR 145
           +G+ +   + D L  R
Sbjct: 209 SGKYLNVLINDFLKPR 224

>Smik_12.144 Chr12 complement(280513..281829) [1317 bp, 438 aa] {ON}
           YLR085C (REAL)
          Length = 438

 Score = 66.2 bits (160), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 69/320 (21%), Positives = 112/320 (35%), Gaps = 73/320 (22%)

Query: 18  PMENGVIKNWSDMELLWDYAFY-----DQMQLPSTSGGKVMLTEPPMNPVKNREQMCEVM 72
           P E G +  W     +WDY F+     D   L    G  ++ +E  M   +  +   +V+
Sbjct: 60  PHELGQLTLWELESCIWDYCFFNPIEFDGFDLKEGKGHHLVASESCMTLPELSKHADQVI 119

Query: 73  FEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXX-------------------------- 106
           FE+Y+F  ++ +  A    + +                                      
Sbjct: 120 FEEYEFDSLFKSPVAAFVPFTKSYKSKMKAISGKDEDADIVVSKSNEADMPSNNPRDTQK 179

Query: 107 ----------------XXTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFN 150
                             T I+PV + +      ++LDV GR +T  L + LS R Y  N
Sbjct: 180 FDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDVGGRFLTGLLKETLSFRHY--N 237

Query: 151 RSADFETVRQIKEKLSYVSYDLDLDTKLARETTTLVENYELPD----------------- 193
              +   V  IKEK  +VS     D+   ++   L   Y LPD                 
Sbjct: 238 MMDETILVNNIKEKCLFVSPVSYFDSFKVKDKHAL--EYVLPDFQTSFLGYVRNRRKENS 295

Query: 194 -----GRVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTIQSADVDVRSALYRAIVL 248
                 + I +  E F  PE  F P +  + +PG+ E +  ++      VR  +   IV 
Sbjct: 296 PLAEDAQTITLTDELFTIPETFFHPEIAQITKPGIVEAILESLSMLPEIVRPLMVGNIVC 355

Query: 249 SGGSSMYPGLPSRLEKELKQ 268
           +GG+   P    RL  EL++
Sbjct: 356 TGGNFNLPNFAQRLAAELQR 375

>TBLA0D05360 Chr4 (1321243..1323033) [1791 bp, 596 aa] {ON}
           Anc_1.287 YJL081C
          Length = 596

 Score = 66.2 bits (160), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 42/147 (28%), Positives = 68/147 (46%), Gaps = 2/147 (1%)

Query: 1   MIGDEASAV--RSYLQISYPMENGVIKNWSDMELLWDYAFYDQMQLPSTSGGKVMLTEPP 58
           ++ DE S    RS  Q+   +ENG++ +W   E  W +A  +++ + S  G   +LTEP 
Sbjct: 145 IVFDEPSLTYPRSDYQVKRIIENGMVADWDIAEEQWSWALREKLYMDSFKGIPALLTEPV 204

Query: 59  MNPVKNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESV 118
            N V+NR++  EV+ EK +F   Y+        +A G               + PV + +
Sbjct: 205 WNTVQNRKKSLEVLLEKMEFEACYLTTIPTNVSFAAGKPNCLVVDVGHDTCSVSPVIDGM 264

Query: 119 VLNHLTRRLDVAGRDVTRHLIDLLSRR 145
            L    RR   AGR + R L + +  R
Sbjct: 265 TLTKSVRRNFFAGRYLNRLLENYIKPR 291

 Score = 64.3 bits (155), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 41/148 (27%), Positives = 74/148 (50%), Gaps = 21/148 (14%)

Query: 188 NYELPDGRVIKVGSERFEAPECLFQPSLVDVEQ-----PGVGEMLFNTIQSADVDVRSAL 242
           N + P   + + G    E  E +  P   D +      PG+ +++  T+ S+DVD+R+ L
Sbjct: 452 NADTPSENINENGKRSIEDGENVDVPKKSDKKDIDNIIPGIADLVEATVNSSDVDLRATL 511

Query: 243 YRAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLHNDPSRLDKFKVRIEDPPR---RKHMV 299
              ++L+GG+S+ PGL  RL  EL +            +L   K RI        RK+  
Sbjct: 512 AHNVILTGGTSLIPGLADRLMYELNK------------KLPALKFRILSSGHRRERKYQA 559

Query: 300 FIGGAVLANIMADKDHMWLSKQEWQEMG 327
           ++GG++L + +     +W+ K+E++E+G
Sbjct: 560 WLGGSILTS-LGTFHQLWVGKREYEEVG 586

>AGR091W Chr7 (907238..908470) [1233 bp, 410 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR085C (ARP6)
          Length = 410

 Score = 65.9 bits (159), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 66/300 (22%), Positives = 119/300 (39%), Gaps = 46/300 (15%)

Query: 11  SYLQISYPMENGVIKNWSDMELLWDYAFYDQ----MQLPSTSGGKVMLTEPPMNPVKNRE 66
           S+  I  P E G + +W   E +WDY  ++      +L  +    ++ +E  M   +  +
Sbjct: 52  SHCHIRRPSELGQLISWELEEQIWDYCLFNPDEFGWELKDSKDVDLIASETCMTIPEISK 111

Query: 67  QMCEVMFEKYDFGGVYVAIQAVLALYAQGL-------------------XXXXXXXXXXX 107
            M +V+FE+Y+FG +     A    + +                                
Sbjct: 112 NMDQVVFEEYEFGSMMKCPVAQFVPFDRARDYDIVGGAGEVVEAKSGYNNFQLVVDSGFN 171

Query: 108 XTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSY 167
            T ++PV + V     T++LD+ GR +   L + +S R Y  N   +   +  IKE+  +
Sbjct: 172 CTWVMPVIKGVPYYKATKKLDIGGRFLNGLLKETISFRHY--NVMDETILINNIKEQCCF 229

Query: 168 VSYDLDLDTKLARETTTLVENYELPD-------------------GRVIKVGSERFEAPE 208
           +      D+   R+  T VE Y LPD                    +++++  E F  PE
Sbjct: 230 MPPVSYFDS-FQRKEETRVE-YILPDFQTSLIGYVRQPKQAIPKTSQILRLEDELFTVPE 287

Query: 209 CLFQPSLVDVEQPGVGEMLFNTIQSADVDVRSALYRAIVLSGGSSMYPGLPSRLEKELKQ 268
             F P + ++ +PG+ E +   +      +R  L   IV  GG+       +RL  EL++
Sbjct: 288 TFFHPEISNILKPGLVETILECVSMVPEVLRPLLVSNIVAVGGNFNIANFATRLATELQR 347

>NCAS0B04990 Chr2 complement(916170..917432) [1263 bp, 420 aa] {ON}
           Anc_8.258 YLR085C
          Length = 420

 Score = 65.5 bits (158), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 69/302 (22%), Positives = 113/302 (37%), Gaps = 55/302 (18%)

Query: 18  PMENGVIKNWSDMELLWDYAFYDQMQLPS-----TSGGKVMLTEPPMNPVKNREQMCEVM 72
           P E G + +W     +WDYA ++  + P        G  ++ +E  M   +  + M +V+
Sbjct: 60  PHELGQLTSWELESSIWDYALFNPDEFPGFDLNDLKGKHLIASETCMTLPELSKNMDQVV 119

Query: 73  FEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXX-------------------------- 106
           FE+Y+F   Y +  A    +A                                       
Sbjct: 120 FEEYEFDSYYKSSIAGFIQFADDKNTKIISGKTEEDISLDSVNQVREKEYNDYQLVIDSG 179

Query: 107 -XXTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKL 165
              T I+PV + V      ++LD+ GR +   L + LS R Y          V  IKE  
Sbjct: 180 FNCTWIIPVIKGVPYYKAVKKLDIGGRFLDGLLKETLSFRHYDVMDETIL--VNNIKENC 237

Query: 166 SYVSYDLDLDTKLARETTTLVENYELPD-------------------GRVIKVGSERFEA 206
            +VS     D+    +  T VE Y LP+                    + IK+  E F  
Sbjct: 238 LFVSPTSYFDS-FKNKNETAVE-YVLPNFQTTFLGHVRDKTKPLPENTQTIKLYDELFSV 295

Query: 207 PECLFQPSLVDVEQPGVGEMLFNTIQSADVDVRSALYRAIVLSGGSSMYPGLPSRLEKEL 266
           PE  F P +  + +PG+ E +  ++      +R  L   +V +GG+   P   +RL  EL
Sbjct: 296 PETFFHPEIARILKPGLVETILESLSMVPELLRPLLVGNLVCTGGNFNLPHFATRLTSEL 355

Query: 267 KQ 268
           ++
Sbjct: 356 QR 357

>Ecym_4312 Chr4 (671413..672648) [1236 bp, 411 aa] {ON} similar to
           Ashbya gossypii AGR091W
          Length = 411

 Score = 65.1 bits (157), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 72/309 (23%), Positives = 127/309 (41%), Gaps = 47/309 (15%)

Query: 11  SYLQISYPMENGVIKNWSDMELLWDYAFYDQMQ----LPSTSGGKVMLTEPPMNPVKNRE 66
           S   +  P E G + +W   E +WDY  ++  +    L  +    ++++E  M+  +  +
Sbjct: 52  SNCHVRRPFELGQLVSWELEEHIWDYCLFNSDEFSWDLKDSKDVDLIVSETCMSIPEISK 111

Query: 67  QMCEVMFEKYDFGGV-------YVAIQ--AVLALY-AQGLXXXXXXX----------XXX 106
            M +V+FE+Y+FG +       Y+     A   +Y + GL                    
Sbjct: 112 HMDQVVFEEYEFGSLMKCPVAQYIPFDNMADYKVYGSDGLPVVRKKDDYNDFQLVVDSGF 171

Query: 107 XXTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLS 166
             T ++PV + V      ++LD+ GR +T  L + +S R Y  N   +      IKE+  
Sbjct: 172 NCTWVIPVIKGVPYYKAVKKLDIGGRFLTGLLKETVSFRHY--NLMDETILANNIKEQCC 229

Query: 167 Y---VSY--------DLDLDTKLARETTTLVENYELP------DGRVIKVGSERFEAPEC 209
           +   VSY        +  +D  L    T+L+     P      D + + +  E F  PE 
Sbjct: 230 FMPPVSYFDSFQKKAETRIDYVLPDFQTSLIGYVRQPKQAIPEDSQTLNLEDELFTIPET 289

Query: 210 LFQPSLVDVEQPGVGEMLFNTIQSADVDVRSALYRAIVLSGGSSMYPGLPSRLEKELKQL 269
            F P + ++ +PG+ E +  +I      +R  +   I + GG+       SRL  EL++ 
Sbjct: 290 FFHPEIANILKPGLIETVLESISMLPELIRPLMVSNIAVIGGNFNISNFASRLATELQRQ 349

Query: 270 ----WFTRV 274
               W  RV
Sbjct: 350 CPTDWSVRV 358

>NDAI0B01960 Chr2 complement(477552..478871) [1320 bp, 439 aa] {ON}
           Anc_8.258 YLR085C
          Length = 439

 Score = 65.1 bits (157), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 55/190 (28%), Positives = 84/190 (44%), Gaps = 28/190 (14%)

Query: 109 THIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYV 168
           T I+P+ + V      ++LD+ GR +T  L + LS R Y          V  IKEK  +V
Sbjct: 201 TWIIPMIKGVPYYKAIKKLDIGGRFLTGLLKETLSFRHYDLMDETLL--VNNIKEKCLFV 258

Query: 169 SYDLDLDTKLARETTTLVENYELPD--------------------GRVIKVGSERFEAPE 208
           S     D+  A+E T++   Y LPD                     +V+K+  E F  PE
Sbjct: 259 SPTSYFDSFKAKEETSV--EYILPDISSSYLGYTRENKSKPLPEGSQVVKLYDELFSVPE 316

Query: 209 CLFQPSLVDVEQPGVGEMLFNTIQSADVDVRSALYRAIVLSGGSSMYPGLPSRLEKEL-K 267
             F P +  + +PG+ E +  ++      +R  L   IV +GG+   P   +RL  EL +
Sbjct: 317 TFFHPEISRILKPGIVETILESLSMIPEILRPLLVANIVCTGGNFNLPHFAARLAAELQR 376

Query: 268 QL---WFTRV 274
           QL   W  R+
Sbjct: 377 QLPTDWTCRI 386

 Score = 40.0 bits (92), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 38/75 (50%), Gaps = 5/75 (6%)

Query: 18  PMENGVIKNWSDMELLWDYAFY-----DQMQLPSTSGGKVMLTEPPMNPVKNREQMCEVM 72
           P E G + +W     +WDY  Y     D  +L  +    ++++EP M   +  + M +V+
Sbjct: 60  PHELGQLTSWELESCIWDYCLYNPDEFDGFELGGSGKKHLIVSEPCMTLPELSKNMDQVI 119

Query: 73  FEKYDFGGVYVAIQA 87
           FE+Y+F  ++ A  A
Sbjct: 120 FEEYEFDSLFKAPTA 134

>Smik_10.161 Chr10 complement(275455..276924) [1470 bp, 489 aa] {ON}
           YJL081C (REAL)
          Length = 489

 Score = 65.1 bits (157), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 55/227 (24%), Positives = 95/227 (41%), Gaps = 28/227 (12%)

Query: 19  MENGVIKNWSDMELLWDYAFYDQMQLPSTSGGKVMLTEPPMNPVKNREQMCEVMFEKYDF 78
           +++G++ +W   +  W +A  +++ L S SG   +LTEP  N  +NR++  EV+ E   F
Sbjct: 75  VKDGLVIDWDTAQEQWQWALKNELYLNSNSGTPALLTEPVWNSTENRKKSLEVLLEGMQF 134

Query: 79  GGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRRLDVAGRDVTRHL 138
              Y+A  +    +A G               + P+ + + L+  TRR  +AG+ +  HL
Sbjct: 135 EACYLAPTSTCVSFAAGRPNCLVVDIGHDTCSVSPIVDGMTLSKSTRRNFLAGKFI-NHL 193

Query: 139 ID-------------LLSRRGYAFNRSADFETVRQI-------------KEKLSYVSYDL 172
           I              +  R+     +S ++E  + I             KE L ++    
Sbjct: 194 IKKALEPKEIIPLFAIKQRKPELIKKSFNYEVDKSIYDYANNRGFFQECKETLCHICPTK 253

Query: 173 DLDTKLARETTTLVENYELPDGRVIKVGSE-RFEAPECLFQPSLVDV 218
            L+   A  +TT   + E P    I   +E R+   E LF P   DV
Sbjct: 254 TLEETKADLSTTTKRSIESPWNEEIVFDNETRYGFAEKLFLPKEDDV 300

 Score = 61.2 bits (147), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 35/114 (30%), Positives = 64/114 (56%), Gaps = 16/114 (14%)

Query: 217 DVEQPGVGEMLFNTIQSADVDVRSALYRAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLH 276
           D E  G+  +++++I S+DVD+R+ L   +VL+GG+S+ PGL  RL  EL ++       
Sbjct: 379 DNELIGLAHLVYSSIMSSDVDLRATLAHNVVLTGGTSLIPGLSDRLMTELNKI------- 431

Query: 277 NDPSRLDKFKVRIEDPPR---RKHMVFIGGAVLANIMADKDHMWLSKQEWQEMG 327
                L   K RI        R++  ++GG++L + +     +W+ K+E++E+G
Sbjct: 432 -----LPSLKFRILTTGHTMERQYQSWLGGSILTS-LGTFHQLWVGKKEYEEVG 479

>KNAG0G02010 Chr7 complement(447621..448895) [1275 bp, 424 aa] {ON}
           Anc_8.258 YLR085C
          Length = 424

 Score = 64.7 bits (156), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 75/324 (23%), Positives = 122/324 (37%), Gaps = 64/324 (19%)

Query: 11  SYLQISYPMENGVIKNWSDMELLWDYAFYDQMQLP------STSGGKVMLTEPPMNPVKN 64
           S   I  P E G + +W     +WDY  Y+  +        +T    ++LTE      + 
Sbjct: 51  SSATIRRPHELGQLVSWELEGCIWDYCLYNPDEFDGFHLGDNTREQDLILTETCFTLPEL 110

Query: 65  REQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXX------------------- 105
            +   +V+FE+Y+F  ++ +  +    +A  +                            
Sbjct: 111 SKNSDQVVFEEYEFATMFKSPASGFMPFANLIGNKNMEHLCGKDTAVNTDYTTATTKEYR 170

Query: 106 ---------XXXTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFE 156
                       T +VP+ + V      +++D+ GR +   L + LS R Y  N   +  
Sbjct: 171 DFQLVIDSGFNCTWVVPIIKGVPFYKAIKKMDIGGRFLNGLLKETLSFRHY--NMMDETI 228

Query: 157 TVRQIKEKLSYVSYDLDLDTKLARETTTLVENYELPD--------------------GRV 196
            +  IKEK  +VS     D+   ++   +   Y LPD                    G V
Sbjct: 229 LLNNIKEKCLFVSPVSYFDSFKTKQQQAV--EYVLPDFQTSFLGYLVDESNRKGIDRGSV 286

Query: 197 --IKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTIQSADVDVRSALYRAIVLSGGSSM 254
             I +  ERF  PE  F P + ++ +PG+ E +   I      +R  L   IV  GG+  
Sbjct: 287 QTITLTDERFAVPETFFHPEMANILKPGLVETILEAISMVPEPLRPILVSNIVCVGGNFK 346

Query: 255 YPGLPSRLEKEL-KQL---WFTRV 274
            P + SRL  EL +QL   W  RV
Sbjct: 347 LPHMSSRLTSELQRQLPTDWTCRV 370

>KAFR0A01560 Chr1 complement(311746..313203) [1458 bp, 485 aa] {ON}
           Anc_1.287 YJL081C
          Length = 485

 Score = 64.7 bits (156), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 36/122 (29%), Positives = 57/122 (46%)

Query: 10  RSYLQISYPMENGVIKNWSDMELLWDYAFYDQMQLPSTSGGKVMLTEPPMNPVKNREQMC 69
           R   +I   +ENGV+ +W   +  W +A  +Q+ L S SG   +LTEP  N V+NR++  
Sbjct: 70  RKDYEIKPIVENGVVIDWDAAQEQWSWALENQLYLRSNSGIPALLTEPIWNTVENRKKSL 129

Query: 70  EVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRRLDV 129
           E++ E  DF   Y+A       +  G               + PV + + L+  T+R   
Sbjct: 130 ELLLEGMDFEACYLASTPTCVSFGTGRSSCLVVDLGHDTCSVSPVVDGMTLSKSTKRNFF 189

Query: 130 AG 131
           AG
Sbjct: 190 AG 191

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 61/109 (55%), Gaps = 16/109 (14%)

Query: 222 GVGEMLFNTIQSADVDVRSALYRAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLHNDPSR 281
           GV +++ ++I ++DVD+R+ L   +VL+GG+S  PGL  RL  EL             SR
Sbjct: 380 GVADLVHSSIMASDVDLRATLAHNVVLTGGTSTIPGLSDRLMAELN------------SR 427

Query: 282 LDKFKVRI---EDPPRRKHMVFIGGAVLANIMADKDHMWLSKQEWQEMG 327
           L   K R+        R++  ++GG+VL + +     +W+ K+E+Q++G
Sbjct: 428 LPALKFRMITTGHTRERQYQSWLGGSVLTS-LGTFHQLWVGKEEYQDVG 475

>AFR105C Chr6 complement(625098..626537) [1440 bp, 479 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL081C
           (ARP4)
          Length = 479

 Score = 64.3 bits (155), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 34/122 (27%), Positives = 57/122 (46%)

Query: 10  RSYLQISYPMENGVIKNWSDMELLWDYAFYDQMQLPSTSGGKVMLTEPPMNPVKNREQMC 69
           R   +I   ++NG + +W   E  WD+A   +++  + SG   +LTEP  N  +NR++  
Sbjct: 65  RKDYEIHNIVQNGEVVDWEKAEKQWDWAIRSELRFETNSGMPALLTEPIWNSEENRKKSL 124

Query: 70  EVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRRLDV 129
           EV+ E  DF   Y+   A    +A G             T + PV + + L+  + R  +
Sbjct: 125 EVLLESMDFSACYLVPTATAVSFAMGRPTCLVVDIGHDVTSVCPVVDGMTLSKSSMRSYI 184

Query: 130 AG 131
           AG
Sbjct: 185 AG 186

 Score = 57.8 bits (138), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 37/116 (31%), Positives = 68/116 (58%), Gaps = 12/116 (10%)

Query: 219 EQPGVGEMLFNTIQSADVDVRSALYRAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLHND 278
           E  G+ ++++++I S DVD+R+ L   +V++GG+S  PGL  R+  EL      R L   
Sbjct: 371 EVSGLADLIYSSIMSTDVDLRTTLSHNVVITGGTSSLPGLMDRISAELN-----RSL--- 422

Query: 279 PSRLDKFKVRIEDPPR-RKHMVFIGGAVLANIMADKDHMWLSKQEWQEMGSAAMSK 333
           P+   KF++      R R++  ++GG++LA+ +     +W+ KQE+ E+G+  + K
Sbjct: 423 PAL--KFRMLTSGQLRERQYQGWLGGSILAS-LGTFHQLWVGKQEYAEVGADRLLK 475

>CAGL0L12166g Chr12 complement(1308681..1309946) [1266 bp, 421 aa]
           {ON} similar to uniprot|Q12509 Saccharomyces cerevisiae
           YLR085c Actin-related protein
          Length = 421

 Score = 64.3 bits (155), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 68/300 (22%), Positives = 114/300 (38%), Gaps = 51/300 (17%)

Query: 18  PMENGVIKNWSDMELLWDYAFYDQ----MQLPSTSGGKVMLTEPPMNPVKNREQMCEVMF 73
           P E G + +W     +WDY  Y+     +   S     V+L+E  M   +  +   +V+F
Sbjct: 61  PHELGQLTSWELESCIWDYCLYNPDEFGIDWQSLENRHVVLSETCMTLPELSKNTDQVLF 120

Query: 74  EKYDFGGVYVA-IQAVLALYAQGLXXXXXXXXX--------------------------- 105
           E+Y+   +Y A   A +  Y                                        
Sbjct: 121 EEYEVDSLYKAPTAAYIPFYTTNENIKTISGKSDHGELDIEEKIEAGKEYNDFSLVIDSG 180

Query: 106 XXXTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKL 165
              T ++P+ + V      ++LDV GR +   L + +S R Y  N   +   V  IKE+ 
Sbjct: 181 FNCTWVIPIVKGVPYYKAVKKLDVGGRFLNGLLKETISFRHY--NVMDESILVNNIKEQC 238

Query: 166 SYV---SYDLDLDTKLARETTTLVENYE-------------LPD-GRVIKVGSERFEAPE 208
            YV   SY      K   +   ++ +++             LPD  +++ +  ERF  PE
Sbjct: 239 LYVDPVSYFEAFKAKGKNKIDFVLPDFQTSFQGYVRDPKTALPDNAQILTLTDERFSVPE 298

Query: 209 CLFQPSLVDVEQPGVGEMLFNTIQSADVDVRSALYRAIVLSGGSSMYPGLPSRLEKELKQ 268
             F P +    +PG+ E +  +I      +R  +   IV  GG+   PG   RL  EL++
Sbjct: 299 AFFHPEISQSLKPGIIETVLESIYMLPELLRPLMASNIVCMGGNFNLPGFTDRLVSELQR 358

>Skud_12.153 Chr12 complement(284046..285362) [1317 bp, 438 aa] {ON}
           YLR085C (REAL)
          Length = 438

 Score = 63.9 bits (154), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 50/180 (27%), Positives = 78/180 (43%), Gaps = 22/180 (12%)

Query: 109 THIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYV 168
           T I+PV + +      ++LD+ GR +T  L + LS R Y  N   +   V  +KEK  +V
Sbjct: 198 TWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHY--NMMDETILVNNVKEKCLFV 255

Query: 169 SYDLDLDTKLARETTTLV-------------------ENYELP-DGRVIKVGSERFEAPE 208
           S     D+  A++   L                    EN  LP D + I +  E F  PE
Sbjct: 256 SPVSYFDSFKAKDKHALEYVLPDFQTSFIGYVRNPREENSPLPEDAQTIALTDELFTIPE 315

Query: 209 CLFQPSLVDVEQPGVGEMLFNTIQSADVDVRSALYRAIVLSGGSSMYPGLPSRLEKELKQ 268
             F P +  + +PG+ E +  ++      VR  +   IV +GG+   P    RL  EL++
Sbjct: 316 TFFHPEISQITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNFNLPNFAQRLAAELQR 375

>KLTH0H09702g Chr8 complement(835255..836700) [1446 bp, 481 aa] {ON}
           similar to uniprot|P80428 Saccharomyces cerevisiae
           YJL081C ARP4 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 481

 Score = 63.5 bits (153), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 35/136 (25%), Positives = 62/136 (45%)

Query: 10  RSYLQISYPMENGVIKNWSDMELLWDYAFYDQMQLPSTSGGKVMLTEPPMNPVKNREQMC 69
           R   +I   +ENG + +W   +  W +A  D+++  S  G    LTE   NP +NR++  
Sbjct: 67  RPDFEIKRILENGCVVDWEAAQEQWAWAIRDELKFESFKGTPAFLTEAIWNPEENRKKSL 126

Query: 70  EVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRRLDV 129
           EV+ E  +F   Y+A  A    +A G               + PV + + L+  + R  +
Sbjct: 127 EVLLEGMEFEACYIAPTATCTSFAMGRPTCLVLDIGHDVASVCPVVDGMTLSKSSTRNFL 186

Query: 130 AGRDVTRHLIDLLSRR 145
           AG+ + + + + L  R
Sbjct: 187 AGKLLNKLIENHLKPR 202

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 33/115 (28%), Positives = 61/115 (53%), Gaps = 16/115 (13%)

Query: 222 GVGEMLFNTIQSADVDVRSALYRAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLHNDPSR 281
           G+ +++   I + DVD+R+ L   +V++GGSS  PGL  RL  EL +            +
Sbjct: 376 GLADLVNTAITATDVDLRATLAHNLVVTGGSSSIPGLTDRLMTELNK------------K 423

Query: 282 LDKFKVRIEDPPR---RKHMVFIGGAVLANIMADKDHMWLSKQEWQEMGSAAMSK 333
           L   K RI        R+   ++GG++L++ +     +W+ +QE++E+G+  + K
Sbjct: 424 LPALKFRILTSGHLRERQSRAWLGGSILSS-LGTFHQLWVGRQEYEEVGAERLLK 477

>YLR085C Chr12 complement(300673..301989) [1317 bp, 438 aa] {ON}
           ARP6Actin-related protein that binds nucleosomes; a
           component of the SWR1 complex, which exchanges histone
           variant H2AZ (Htz1p) for chromatin-bound histone H2A
          Length = 438

 Score = 63.2 bits (152), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 49/180 (27%), Positives = 78/180 (43%), Gaps = 22/180 (12%)

Query: 109 THIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYV 168
           T I+PV + +      ++LD+ GR +T  L + LS R Y  N   +   V  IKE+  +V
Sbjct: 198 TWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHY--NMMDETILVNNIKEQCLFV 255

Query: 169 SYDLDLDTKLARETTTL-------------------VENYELP-DGRVIKVGSERFEAPE 208
           S     D+   ++   L                    EN  LP D ++I +  E F  PE
Sbjct: 256 SPVSYFDSFKTKDKHALEYVLPDFQTSFLGYVRNPRKENVPLPEDAQIITLTDELFTIPE 315

Query: 209 CLFQPSLVDVEQPGVGEMLFNTIQSADVDVRSALYRAIVLSGGSSMYPGLPSRLEKELKQ 268
             F P +  + +PG+ E +  ++      VR  +   IV +GG+   P    RL  EL++
Sbjct: 316 TFFHPEISQITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNFNLPNFAQRLAAELQR 375

 Score = 32.7 bits (73), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 19/82 (23%), Positives = 36/82 (43%), Gaps = 5/82 (6%)

Query: 18  PMENGVIKNWSDMELLWDYAFY-----DQMQLPSTSGGKVMLTEPPMNPVKNREQMCEVM 72
           P E G +  W     +WDY  +     D   L    G  ++ +E  M   +  +   +V+
Sbjct: 60  PHELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSKHADQVI 119

Query: 73  FEKYDFGGVYVAIQAVLALYAQ 94
           FE+Y+F  ++ +  AV   + +
Sbjct: 120 FEEYEFDSLFKSPVAVFVPFTK 141

>CAGL0M03201g Chr13 complement(364771..366252) [1482 bp, 493 aa]
           {ON} similar to uniprot|P80428 Saccharomyces cerevisiae
           YJL081c ACT3 protein Actin-like protein ARP4
          Length = 493

 Score = 62.0 bits (149), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 34/127 (26%), Positives = 56/127 (44%)

Query: 19  MENGVIKNWSDMELLWDYAFYDQMQLPSTSGGKVMLTEPPMNPVKNREQMCEVMFEKYDF 78
           +ENG + +W      W +A  +++ + S  G   MLTEP  N  +NR +  E++ E  +F
Sbjct: 87  VENGQVCDWDSAVEQWSWALRNELHIESNRGIPAMLTEPLWNSKENRSKSLEILLEGMEF 146

Query: 79  GGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRRLDVAGRDVTRHL 138
              Y+   +    +A G               + PV + + L+  TR    AGR + + L
Sbjct: 147 EACYLTATSTAVSFATGRPNSLIVDIGHDIASVTPVIDGMSLSKSTRCNHFAGRFLNKLL 206

Query: 139 IDLLSRR 145
            D L  R
Sbjct: 207 TDYLKPR 213

 Score = 61.2 bits (147), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 39/114 (34%), Positives = 67/114 (58%), Gaps = 18/114 (15%)

Query: 219 EQPGVGEMLFNTIQSADVDVRSALYRAIVLSGGSSMYPGLPSRLEKELK----QLWFTRV 274
           E PG+ +++ ++I S DVD+R++L   +V++GGSS  PGL  R+  EL      L F RV
Sbjct: 385 ELPGIVDLISSSISSCDVDIRASLAHNLVITGGSSTIPGLSDRILNELNMKFPALKF-RV 443

Query: 275 LHNDPSRLDKFKVRIEDPPRRKHMVFIGGAVLANIMADKDHMWLSKQEWQEMGS 328
           L    S        IE    R++  ++GG++L++ +     +W+ K+E++E+GS
Sbjct: 444 LATGQS--------IE----RQYQSWLGGSILSS-LGTFHQLWIGKKEYEEVGS 484

>Kpol_282.4 s282 (8483..9988) [1506 bp, 501 aa] {ON} (8483..9988)
           [1506 nt, 502 aa]
          Length = 501

 Score = 61.2 bits (147), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 35/136 (25%), Positives = 62/136 (45%)

Query: 10  RSYLQISYPMENGVIKNWSDMELLWDYAFYDQMQLPSTSGGKVMLTEPPMNPVKNREQMC 69
           R+  +I   ++NG + +W   +  WD+A  + + L S SG    LTEP  N V+NR++  
Sbjct: 83  RADYEIKPIVKNGEVIDWDGAQEQWDWALKNALYLESNSGIPAFLTEPIWNTVENRKKSL 142

Query: 70  EVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRRLDV 129
           EV+ E   F   Y++       +A G               + PV + + L+  + R  +
Sbjct: 143 EVLLEGLQFEACYLSPTPTCISFASGRPNCLVVDIGHDVASVSPVIDGMTLSKSSMRNFI 202

Query: 130 AGRDVTRHLIDLLSRR 145
           +GR +   + + L  R
Sbjct: 203 SGRFINEKIKEFLKPR 218

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 37/117 (31%), Positives = 66/117 (56%), Gaps = 18/117 (15%)

Query: 221 PGVGEMLFNTIQSADVDVRSALYRAIVLSGGSSMYPGLPSR----LEKELKQLWFTRVLH 276
           PG+ +++ ++I + DVD+R++L   IVL+GG+S  PG   R    L K+L  L F RVL 
Sbjct: 395 PGIVDLIESSIMATDVDLRASLAHNIVLTGGTSCIPGFSDRLMLELNKKLPALKF-RVLT 453

Query: 277 NDPSRLDKFKVRIEDPPRRKHMVFIGGAVLANIMADKDHMWLSKQEWQEMGSAAMSK 333
              +R             R++  ++GG++L++ +     +W+ KQE++E G+  + K
Sbjct: 454 TGQTR------------ERQYQAWLGGSILSS-LGTFHQLWVGKQEYEESGADRLLK 497

>Suva_10.169 Chr10 complement(305734..307050) [1317 bp, 438 aa] {ON}
           YLR085C (REAL)
          Length = 438

 Score = 60.8 bits (146), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 49/180 (27%), Positives = 78/180 (43%), Gaps = 22/180 (12%)

Query: 109 THIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYV 168
           T I+PV + +      ++LD+ GR +T  L + LS R Y  N   +   V  IKEK  +V
Sbjct: 198 TWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHY--NMMDETILVNNIKEKCLFV 255

Query: 169 SYDLDLDTKLARETTTLV-------------------ENYELP-DGRVIKVGSERFEAPE 208
           S     D+  ++    L                    E+  LP D + I +  E F  PE
Sbjct: 256 SPTSYFDSFKSKNKHVLEYVLPDFQTSFIGYVRHPNEEDSPLPTDAQSITLTDELFTIPE 315

Query: 209 CLFQPSLVDVEQPGVGEMLFNTIQSADVDVRSALYRAIVLSGGSSMYPGLPSRLEKELKQ 268
             F P +  + +PG+ E +  ++      VR  +   IV +GG+   P    RL +EL++
Sbjct: 316 TFFHPEISQIIKPGIVEAILESLSMLPEIVRPLMIGNIVCTGGNFNLPNFAQRLARELQR 375

>KLLA0D02288g Chr4 complement(194724..196286) [1563 bp, 520 aa] {ON}
           similar to uniprot|P80428 Saccharomyces cerevisiae
           YJL081C ARP4 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 520

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 35/130 (26%), Positives = 62/130 (47%), Gaps = 1/130 (0%)

Query: 10  RSYLQISYPMENGVIKNWSDMELLWDYAFYDQMQLPSTSGGKVMLTEPPMNPVKNREQMC 69
           R+ ++I   +EN  I +W   +  W+YA    ++  S  G  V+LTEP  N   +R++  
Sbjct: 66  RAGMEIKPIVENSTIVDWDRAQEQWEYALNTDLKFESNKGTPVLLTEPIWNSEASRKKSL 125

Query: 70  EVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRRLDV 129
           E++ E  +F   Y+A  +    +A G             + + PV + + L+  + R  V
Sbjct: 126 EILLESMEFEACYLAANSSAVSFAMGRPTCLVVDIGHDVSTVSPVIDGMTLSKSSTRNYV 185

Query: 130 AGRDVTRHLI 139
           AG+ +  HLI
Sbjct: 186 AGKYLN-HLI 194

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 34/113 (30%), Positives = 62/113 (54%), Gaps = 18/113 (15%)

Query: 219 EQPGVGEMLFNTIQSADVDVRSALYRAIVLSGGSSMYPGLPSR----LEKELKQLWFTRV 274
           E  G+ +++  ++  ADVD+R+ L   +VL+GG+S  PGL  R    L K L  L F R+
Sbjct: 412 EVAGIVDLINKSMMEADVDLRATLAHNVVLTGGTSKIPGLSDRIMHELNKSLPALKF-RM 470

Query: 275 LHNDPSRLDKFKVRIEDPPRRKHMVFIGGAVLANIMADKDHMWLSKQEWQEMG 327
           L +   R             R++  ++GG++LA+ +     +W+ ++E++E+G
Sbjct: 471 LSSGHLR------------ERQYQGWLGGSILAS-LGTFHQLWVGREEYEEVG 510

>ZYRO0G21428g Chr7 (1766725..1768176) [1452 bp, 483 aa] {ON} highly
           similar to uniprot|P80428 Saccharomyces cerevisiae
           YJL081C ARP4 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin- remodeling
           enzyme complexes
          Length = 483

 Score = 59.7 bits (143), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 35/113 (30%), Positives = 62/113 (54%), Gaps = 16/113 (14%)

Query: 219 EQPGVGEMLFNTIQSADVDVRSALYRAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLHND 278
           E  G+ +++ ++I SADVD+R+ L   IVL+GGSS  PG   RL  EL +          
Sbjct: 375 ELAGISDLVHSSITSADVDLRATLAHNIVLTGGSSSVPGFSDRLMNELTK---------- 424

Query: 279 PSRLDKFKVRIEDPPR---RKHMVFIGGAVLANIMADKDHMWLSKQEWQEMGS 328
             +L   K R+        R++  ++GG++L + +     +W+ K+E++E+G+
Sbjct: 425 --KLPALKFRVLTTGHLRERQYQSWLGGSILTS-LGSFHQLWVGKREYEEVGA 474

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 34/136 (25%), Positives = 61/136 (44%)

Query: 10  RSYLQISYPMENGVIKNWSDMELLWDYAFYDQMQLPSTSGGKVMLTEPPMNPVKNREQMC 69
           R   +I   +ENG++ +W   +  WD+A  + + L S  G   ++TE   N ++N+ +  
Sbjct: 74  RPDYEIKPIVENGLVVDWDAAQEQWDWALRNVLHLESNKGVPALMTESIWNTMENKTKSL 133

Query: 70  EVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRRLDV 129
           EV+ E  DF   Y++       +A G                 PV + + L+  TRR  +
Sbjct: 134 EVLLETLDFEACYISSTPTCVSFATGRPNCLVVDVGHDTASSSPVVDGMTLSRSTRRNFI 193

Query: 130 AGRDVTRHLIDLLSRR 145
           +G+ V + +   L  R
Sbjct: 194 SGKFVDQLIGKYLQPR 209

>Ecym_6330 Chr6 (632900..634342) [1443 bp, 480 aa] {ON} similar to
           Ashbya gossypii AFR105C
          Length = 480

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 37/119 (31%), Positives = 66/119 (55%), Gaps = 18/119 (15%)

Query: 219 EQPGVGEMLFNTIQSADVDVRSALYRAIVLSGGSSMYPGLPSR----LEKELKQLWFTRV 274
           E  G+ +++ ++I S DVD+R+ L   +V++GGSS  PGL  R    L K L  L F R+
Sbjct: 372 EISGLADLIHSSIMSTDVDLRTTLAHNVVITGGSSSIPGLTDRILAELNKSLPALKF-RM 430

Query: 275 LHNDPSRLDKFKVRIEDPPRRKHMVFIGGAVLANIMADKDHMWLSKQEWQEMGSAAMSK 333
           L +  +R             +++  ++GG++LA+ +     +W+ KQE+ E+G+  + K
Sbjct: 431 LTSGQAR------------EKQYQSWLGGSILAS-LGTFHQLWVGKQEYAEVGADRLLK 476

 Score = 52.4 bits (124), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 31/122 (25%), Positives = 52/122 (42%)

Query: 10  RSYLQISYPMENGVIKNWSDMELLWDYAFYDQMQLPSTSGGKVMLTEPPMNPVKNREQMC 69
           R   +I   + +G + +W   +  W++A    +   S  G   +LTEP  N   NR++  
Sbjct: 66  RKDYEIKEIVRSGEVVDWDKAQEQWEWAIKSVLLFESNKGLPALLTEPIWNSEDNRKKSL 125

Query: 70  EVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRRLDV 129
           EV+ E  DF   Y+   A    +A G             T + PV + + L+  + R  +
Sbjct: 126 EVLLEGMDFEACYLTPTATAVSFAMGRPTCLVVDIGHDITSVSPVIDGMTLSKSSMRSFI 185

Query: 130 AG 131
           AG
Sbjct: 186 AG 187

>Kwal_14.2377 s14 complement(733179..734624) [1446 bp, 481 aa] {ON}
           YJL081C (ARP4) - 54.8 kDa actin-related protein [contig
           225] FULL
          Length = 481

 Score = 57.8 bits (138), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 31/124 (25%), Positives = 55/124 (44%)

Query: 9   VRSYLQISYPMENGVIKNWSDMELLWDYAFYDQMQLPSTSGGKVMLTEPPMNPVKNREQM 68
            R   +I   +E+G + +W   +  W +A  D+++  S  G    LTE   N  +NR++ 
Sbjct: 66  ARPDFEIKRILEDGCVVDWEAAQEQWTWAIRDELKFGSFKGTPAFLTEAIWNSEENRKKS 125

Query: 69  CEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRRLD 128
            EV+ E  +F   Y+A  A    +A G               + PV + + L+  + R  
Sbjct: 126 LEVLLEGMEFEACYIAPTATCVSFAMGRPTCLVVDIGHDVASVCPVVDGMTLSKSSTRNF 185

Query: 129 VAGR 132
           +AG+
Sbjct: 186 LAGK 189

 Score = 49.3 bits (116), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 32/115 (27%), Positives = 58/115 (50%), Gaps = 16/115 (13%)

Query: 222 GVGEMLFNTIQSADVDVRSALYRAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLHNDPSR 281
           G+  ++   I   DVD+R+ L   +V++GGSS   GL  RL  EL +            +
Sbjct: 376 GLANLVNTAIMETDVDLRATLAHNLVVTGGSSSILGLADRLMTELNK------------K 423

Query: 282 LDKFKVRIEDPPR---RKHMVFIGGAVLANIMADKDHMWLSKQEWQEMGSAAMSK 333
           L   K RI        R+   ++GG++L++ +     +W+ +QE++E+G+  + K
Sbjct: 424 LPALKFRILTSGHLRERQSRAWLGGSILSS-LGTFHQLWVGRQEYEEVGAERLLK 477

>TBLA0H01460 Chr8 complement(323962..325290) [1329 bp, 442 aa] {ON}
           Anc_8.258 YLR085C
          Length = 442

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 55/188 (29%), Positives = 84/188 (44%), Gaps = 24/188 (12%)

Query: 109 THIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYV 168
           T I+PV + +      +++D+ GR +T  L + LS R Y  N + +   V  IKEK  +V
Sbjct: 204 TWIIPVIKGIPYYKAIKKMDIGGRFLTGLLKETLSFRHY--NVTDETILVNNIKEKCLFV 261

Query: 169 ---SY--DLDLDTKLARE------TTTLV------ENYELPD-GRVIKVGSERFEAPECL 210
              SY     L  K A E       TT +         +LPD  ++I +  E F   E +
Sbjct: 262 APKSYAESFKLKNKTAVEYVLPDFHTTFMGYIKDNSKTKLPDNAQLITLKDELFSVTETI 321

Query: 211 FQPSLVDVEQPGVGEMLFNTIQSADVDVRSALYRAIVLSGGSSMYPGLPSRLEKEL-KQL 269
           F P +  + +PG+ E +  ++      +R  +   IV  GG+   P    RL  EL +QL
Sbjct: 322 FHPEISRILKPGIIETIIESLSMLPEVIRPLMVNNIVCIGGNFNLPNFSKRLTSELQRQL 381

Query: 270 ---WFTRV 274
              W T V
Sbjct: 382 PTDWTTHV 389

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 37/70 (52%), Gaps = 5/70 (7%)

Query: 18  PMENGVIKNWSDMELLWDYAFY-----DQMQLPSTSGGKVMLTEPPMNPVKNREQMCEVM 72
           P E G + +W     +WDY FY     D  QL  TS   ++++E  ++  +    +  ++
Sbjct: 60  PYELGQLTSWELESAIWDYCFYNPEEFDGFQLEDTSKKHLVISETCLSLPEFSRNIDHII 119

Query: 73  FEKYDFGGVY 82
           FE+Y++G +Y
Sbjct: 120 FEEYNYGSIY 129

>SAKL0D05874g Chr4 complement(479873..481366) [1494 bp, 497 aa] {ON}
           similar to uniprot|P80428 Saccharomyces cerevisiae
           YJL081C ARP4 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 497

 Score = 56.6 bits (135), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 31/115 (26%), Positives = 65/115 (56%), Gaps = 16/115 (13%)

Query: 222 GVGEMLFNTIQSADVDVRSALYRAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLHNDPSR 281
           G+ ++++++I + DVD+R+ L   +V++GG+S  PGL  R+  EL +             
Sbjct: 392 GLTDLIYSSIMATDVDLRATLAHNVVVTGGTSSIPGLTDRIMAELNK------------S 439

Query: 282 LDKFKVRIEDP---PRRKHMVFIGGAVLANIMADKDHMWLSKQEWQEMGSAAMSK 333
           L   K R+        R++  ++GG++L++ +     +W+ KQE++E+G++ + K
Sbjct: 440 LPALKFRMLTSGHLKERQYQSWLGGSILSS-LGTFHQLWVGKQEYEEVGASRLLK 493

 Score = 53.5 bits (127), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 45/214 (21%), Positives = 82/214 (38%), Gaps = 26/214 (12%)

Query: 10  RSYLQISYPMENGVIKNWSDMELLWDYAFYDQMQLPSTSGGKVMLTEPPMNPVKNREQMC 69
           R+  QI   + NG + +W   +  W +A   ++   ST G    LTEP  N  +NR++  
Sbjct: 80  RNNYQIKPIVRNGSVIDWDSAQEQWSWAIQHELHFESTKGMPAFLTEPIWNTEENRKKSL 139

Query: 70  EVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRRLDV 129
           EV+ E  +F   +++       +A G               + PV + + L+  +    +
Sbjct: 140 EVLLENMEFEACFLSPTPTCVSFAMGRPTCLVVDIGHDVCSVSPVVDGMTLSKSSTSNFI 199

Query: 130 AGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLDLDTKLARETTTLVENY 189
           AG      L++ L  +     ++     + Q         +D ++D  L           
Sbjct: 200 AG-----SLLNALLSKQLDPKKTVPLFQIAQRHPNFIPKKFDFEVDPSL----------- 243

Query: 190 ELPDGRVIKVGSERF---EAPECLFQPSLVDVEQ 220
                   K G+ER+   E  E LFQ +   +E+
Sbjct: 244 -------FKFGNERWFFQECKETLFQVAPATLEK 270

>TDEL0D01550 Chr4 complement(305973..307415) [1443 bp, 480 aa] {ON}
           Anc_1.287 YJL081C
          Length = 480

 Score = 56.2 bits (134), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 32/127 (25%), Positives = 56/127 (44%)

Query: 10  RSYLQISYPMENGVIKNWSDMELLWDYAFYDQMQLPSTSGGKVMLTEPPMNPVKNREQMC 69
           R   +I   ++N ++ +W   E  W +A  D + L S SG   +LTEP  N ++N+ +  
Sbjct: 69  RPDYEIKPIVQNSMVVDWDAAEEQWSWALKDILYLNSNSGIPALLTEPIWNTLENKTKSL 128

Query: 70  EVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRRLDV 129
           E++ E   F   Y++       +A G             T + PV + + L+  T R  +
Sbjct: 129 EILLESLQFEACYLSSTPTCVSFASGRPNCLVVDLGHDTTSVSPVVDGMTLSKSTMRNFL 188

Query: 130 AGRDVTR 136
           AG  +  
Sbjct: 189 AGNCINE 195

 Score = 55.8 bits (133), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 33/109 (30%), Positives = 58/109 (53%), Gaps = 16/109 (14%)

Query: 222 GVGEMLFNTIQSADVDVRSALYRAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLHNDPSR 281
           G  +++  +I ++DVD+R+ L   IVL+GG+S  PG   RL  EL +            +
Sbjct: 375 GAADLVNASILASDVDLRATLAHNIVLTGGTSSIPGFSDRLMSELNK------------K 422

Query: 282 LDKFKVRIEDPPR---RKHMVFIGGAVLANIMADKDHMWLSKQEWQEMG 327
           L   K RI        R++  ++GG++L + +     +W+ KQE++E+G
Sbjct: 423 LPALKFRILTTGHLRERQYQAWLGGSILTS-LGSFHQLWVGKQEYEEVG 470

>ZYRO0A01584g Chr1 complement(130119..132365) [2247 bp, 748 aa] {ON}
           highly similar to uniprot|P53946 Saccharomyces
           cerevisiae YNL059C ARP5 Nuclear actin-related protein
           involved in chromatin remodeling component of chromatin-
           remodeling enzyme complexes
          Length = 748

 Score = 52.8 bits (125), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 40/138 (28%), Positives = 64/138 (46%), Gaps = 28/138 (20%)

Query: 202 ERFEAPECLFQPSLVDVEQPGVGEML-------FNTIQSADVDVRSALYRAIVLSGGSSM 254
           ER   PE LFQP++   +Q G+ E+        F + Q    DV +++ + + ++GG++ 
Sbjct: 611 ERIRVPEVLFQPNMGGEDQAGIPELCETLLLRKFGSTQRQLSDVSTSMAQNVWITGGNAK 670

Query: 255 YPGLPSRLEKELKQLW-----FTRVLHNDPSRLDKFKVRIEDPPRRKHMVFIGGAVLANI 309
            PGL  R+ KE  +       F+     DPS LD ++               G A LA  
Sbjct: 671 LPGLRERIVKEFSEFLPSGSPFSIRKSQDPS-LDAWR---------------GMAKLAQN 714

Query: 310 MADKDHMWLSKQEWQEMG 327
             D  H +++KQE+ E G
Sbjct: 715 TEDFKHGYITKQEYLEYG 732

>TPHA0C03160 Chr3 complement(699424..701691) [2268 bp, 755 aa] {ON}
           Anc_2.248 YNL059C
          Length = 755

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 42/133 (31%), Positives = 62/133 (46%), Gaps = 18/133 (13%)

Query: 202 ERFEAPECLFQPSLVDVEQPGVGEM-------LFNTIQSADVDVRSALYRAIVLSGGSSM 254
           ER   PE LFQP +   +Q G+ E+        F +  S   D   A+ + + ++GG + 
Sbjct: 618 ERPRVPEILFQPRMGGCDQAGIIELSETMLLKKFGSKPSKLSDQAEAMAKNVWITGGHAQ 677

Query: 255 YPGLPSRLEKELKQLWFTRVLHNDPSRLDKFKVRIEDPPRRKHMVFIGGAVLANIMADKD 314
            PGL +R+ KE     FT  L ND     KF V I   P      + G A  ++  AD  
Sbjct: 678 LPGLKTRIVKE-----FTSFLPNDA----KFSVNISKHPSLD--AWKGMAKFSSDDADFK 726

Query: 315 HMWLSKQEWQEMG 327
              +SK+E++E G
Sbjct: 727 SSLISKKEYEEYG 739

 Score = 36.6 bits (83), Expect = 0.090,   Method: Compositional matrix adjust.
 Identities = 33/150 (22%), Positives = 63/150 (42%), Gaps = 10/150 (6%)

Query: 1   MIGDEAS---AVRSYLQISYPMENGVIKNWSDMELLWDYAFYDQMQLPSTSG--GKVMLT 55
            IG++ +   AVRS  Q   P +   + NW   E + +Y F   + + +  G    +++T
Sbjct: 81  FIGNDTNLDYAVRS--QSKTPFDGPFVTNWEYAEDILEYTF-KHLGVTANHGISNPLIMT 137

Query: 56  EPPMNPVKNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXX--XXXXXTHIVP 113
           E        R    +++FE ++   V   I  V A YA                 T+++P
Sbjct: 138 EKLATLQSQRANWYQLLFETFNTSNVSFGIDNVFAFYANTDKHSSGLVFGLNNQDTNVIP 197

Query: 114 VYESVVLNHLTRRLDVAGRDVTRHLIDLLS 143
           + +   +   T+R++  G     +L DL++
Sbjct: 198 IIDGKPVLTDTKRINWGGSQSVGYLSDLMT 227

>Suva_14.281 Chr14 complement(511583..513850) [2268 bp, 755 aa] {ON}
           YNL059C (REAL)
          Length = 755

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 43/174 (24%), Positives = 72/174 (41%), Gaps = 6/174 (3%)

Query: 8   AVRSYLQISYPMENGVIKNWSDMELLWDYAFYDQMQLPSTS-GGKVMLTEPPMNPVKNRE 66
           AVRS  Q   P +   + NW+  E + DY F+     P+      ++LTE        R 
Sbjct: 91  AVRS--QSRSPFDGPFVTNWNFTEEIMDYTFHHLGVSPNNGVRNPILLTERMATVQSQRA 148

Query: 67  QMCEVMFEKYDFGGVYVAIQAVLALYAQ---GLXXXXXXXXXXXXTHIVPVYESVVLNHL 123
              ++MFE Y+  GV   I ++   Y Q   G             T+++PV +   +   
Sbjct: 149 NWYQIMFETYNVPGVTFGIDSLYGFYNQNTSGNKTGLVIDCGHEDTNVIPVVDGTGVLTD 208

Query: 124 TRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLDLDTK 177
            +R++  GR    +L DL++ +   F     +     + +   YVS + D D K
Sbjct: 209 AKRINWGGRQAVDYLSDLMALKYPYFPTKLSYLQYETMYQDYCYVSPNYDEDIK 262

 Score = 43.1 bits (100), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 38/138 (27%), Positives = 61/138 (44%), Gaps = 28/138 (20%)

Query: 202 ERFEAPECLFQPSLVDVEQPGVGEM----LFNTIQSADVDVRSA---LYRAIVLSGGSSM 254
           ER   PE +FQP+L   +Q G+ E+    L     S    + S    +   + ++GG+S 
Sbjct: 617 ERIRVPEVVFQPTLGGQDQAGICELSETILLKKFGSQPGKLSSTSLDMVNNVFITGGNSK 676

Query: 255 YPGLPSRLEKELKQLW-----FTRVLHNDPSRLDKFKVRIEDPPRRKHMVFIGGAVLANI 309
            PGL  R+ +E  +       F+  + +DPS LD +K               G A LA  
Sbjct: 677 VPGLRERIVREFTEFLPVGTNFSVNMSSDPS-LDAWK---------------GMAALAQN 720

Query: 310 MADKDHMWLSKQEWQEMG 327
             +     +SK+E++E G
Sbjct: 721 KEEYKKTVISKKEYEEYG 738

>Skud_14.272 Chr14 complement(502920..505187) [2268 bp, 755 aa] {ON}
           YNL059C (REAL)
          Length = 755

 Score = 49.3 bits (116), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 41/174 (23%), Positives = 71/174 (40%), Gaps = 6/174 (3%)

Query: 8   AVRSYLQISYPMENGVIKNWSDMELLWDYAFYDQMQLPSTS-GGKVMLTEPPMNPVKNRE 66
           AVRS  Q   P +   + NW+  E + DY F+    LP+      ++LTE        R 
Sbjct: 91  AVRS--QSRSPFDGPFVTNWNFTEEIMDYTFHHLGVLPNNGISNPILLTERMATVQSQRA 148

Query: 67  QMCEVMFEKYDFGGVYVAIQAVLALYAQ---GLXXXXXXXXXXXXTHIVPVYESVVLNHL 123
              +++FE Y+  GV   I ++ + Y     G             T +VP+ +   +   
Sbjct: 149 NWYQILFETYNVPGVTFGIDSLYSFYNNNPSGNKTGLVIDCSHEDTSVVPIVDGAGILTD 208

Query: 124 TRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLDLDTK 177
            +R++  G     +L DL++ +   F     +     + +   YVS + D D K
Sbjct: 209 AKRINWGGHQAVDYLNDLMALKYPYFPTKMSYLQYETMYQDYCYVSPNYDEDIK 262

 Score = 40.0 bits (92), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 38/133 (28%), Positives = 59/133 (44%), Gaps = 18/133 (13%)

Query: 202 ERFEAPECLFQPSLVDVEQPGVGEM----LFNTIQSADVDVRSA---LYRAIVLSGGSSM 254
           ER   PE +FQP++   +Q G+ E+    L     S    + S    +   I+++GG++ 
Sbjct: 617 ERIRVPEVVFQPTMGGQDQAGICELSETILMKKFGSQRGKLSSTSLDMVNNILITGGNAK 676

Query: 255 YPGLPSRLEKELKQLWFTRVLHNDPSRLDKFKVRIEDPPRRKHMVFIGGAVLANIMADKD 314
            PGL  R+ KE  +  F  V  N         V I   P      + G A LA   A+  
Sbjct: 677 VPGLRERIVKEFTE--FLPVGTN-------VAVNISSNPSLD--AWRGMAALARNKAEYK 725

Query: 315 HMWLSKQEWQEMG 327
              +SK+E++E G
Sbjct: 726 KTVISKEEYEEYG 738

>Smik_14.267 Chr14 complement(493008..495275) [2268 bp, 755 aa] {ON}
           YNL059C (REAL)
          Length = 755

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 42/181 (23%), Positives = 73/181 (40%), Gaps = 8/181 (4%)

Query: 8   AVRSYLQISYPMENGVIKNWSDMELLWDYAFYDQMQLPSTS-GGKVMLTEPPMNPVKNRE 66
           AVRS  Q   P +   + NW+  E + DY F+    +P       ++LTE        R 
Sbjct: 91  AVRS--QSKSPFDGPFVTNWNFTEEILDYTFHHLGIVPENGISNPILLTERMATVQSQRA 148

Query: 67  QMCEVMFEKYDFGGVYVAIQAVLAL---YAQGLXXXXXXXXXXXXTHIVPVYESVVLNHL 123
              +++FE Y+  GV   I ++      Y  G             T+++P+ +   +   
Sbjct: 149 NWYQILFETYNVPGVTFGIDSLYGFYNYYPSGKQTGLVIDCGHEDTNVIPIVDGAGILTD 208

Query: 124 TRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVS--YDLDLDTKLARE 181
            +R++  G     +L DL++ +   F     +     + +   YVS  YD D+D  L  E
Sbjct: 209 AKRINWGGHQAVDYLNDLMALKYPYFPTKMSYLQYETMYQDYCYVSRNYDEDVDKILTLE 268

Query: 182 T 182
            
Sbjct: 269 N 269

 Score = 35.0 bits (79), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 33/138 (23%), Positives = 56/138 (40%), Gaps = 28/138 (20%)

Query: 202 ERFEAPECLFQPSLVDVEQPGVGEML-------FNTIQSADVDVRSALYRAIVLSGGSSM 254
           ER   PE +FQP++   +Q G+ E+        F +           +   + ++GG++ 
Sbjct: 617 ERTRVPEIVFQPTMGGQDQAGICELAETILLKKFGSQPGKLSQTSIDMANNVFITGGNAK 676

Query: 255 YPGLPSRLEKELKQLW-----FTRVLHNDPSRLDKFKVRIEDPPRRKHMVFIGGAVLANI 309
            PGL  R+ KE              + +DPS LD +K               G A LA  
Sbjct: 677 VPGLKERIVKEFTGFLPVGTNININMSSDPS-LDAWK---------------GMAALAQN 720

Query: 310 MADKDHMWLSKQEWQEMG 327
             +     +S++E++E G
Sbjct: 721 EEEYKRTIISRKEYEEYG 738

>YNL059C Chr14 complement(512668..514935) [2268 bp, 755 aa] {ON}
           ARP5Nuclear actin-related protein involved in chromatin
           remodeling, component of chromatin-remodeling enzyme
           complexes
          Length = 755

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 42/181 (23%), Positives = 74/181 (40%), Gaps = 8/181 (4%)

Query: 8   AVRSYLQISYPMENGVIKNWSDMELLWDYAFYDQMQLPSTS-GGKVMLTEPPMNPVKNRE 66
           AVRS  Q   P +   + NW+  E + DY F+    +P       ++LTE        R 
Sbjct: 91  AVRS--QSRSPFDGPFVTNWNLTEEILDYTFHHLGVVPDNGIPNPILLTERLATVQSQRT 148

Query: 67  QMCEVMFEKYDFGGVYVAIQAVLALY---AQGLXXXXXXXXXXXXTHIVPVYESVVLNHL 123
              +++FE Y+  GV   I ++ + Y     G             T+++PV +   +   
Sbjct: 149 NWYQILFETYNVPGVTFGIDSLFSFYNYNPSGNKTGLVISCGHEDTNVIPVVDGAGILTD 208

Query: 124 TRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVS--YDLDLDTKLARE 181
            +R++  G     +L DL++ +   F     +     + +   YVS  YD D++  L  E
Sbjct: 209 AKRINWGGHQAVDYLNDLMALKYPYFPTKMSYLQYETMYKDYCYVSRNYDEDIEKILTLE 268

Query: 182 T 182
            
Sbjct: 269 N 269

 Score = 37.7 bits (86), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 35/138 (25%), Positives = 57/138 (41%), Gaps = 28/138 (20%)

Query: 202 ERFEAPECLFQPSLVDVEQPGVGEM-------LFNTIQSADVDVRSALYRAIVLSGGSSM 254
           ER   PE +FQP++   +Q G+ E+        F +           +   ++++GG++ 
Sbjct: 617 ERIRVPEVIFQPTMGGQDQAGICELSETILLKKFGSQPGKLSQTSIDMVNNVLITGGNAK 676

Query: 255 YPGLPSRLEKELKQLW-----FTRVLHNDPSRLDKFKVRIEDPPRRKHMVFIGGAVLANI 309
            PGL  R+ KE           T  + +DPS LD +K               G A LA  
Sbjct: 677 VPGLKERIVKEFTGFLPTGTNITVNMSSDPS-LDAWK---------------GMAALARN 720

Query: 310 MADKDHMWLSKQEWQEMG 327
                   +SK+E++E G
Sbjct: 721 EEQYRKTVISKKEYEEYG 738

>KNAG0I01860 Chr9 (364390..366651) [2262 bp, 753 aa] {ON} Anc_2.248
           YNL059C
          Length = 753

 Score = 46.6 bits (109), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 37/143 (25%), Positives = 67/143 (46%), Gaps = 28/143 (19%)

Query: 197 IKVGSERFEAPECLFQPSLVDVEQPGVGEM----LFNTIQSADVDVRSALYRAIV---LS 249
           + + +ER   PE LF+PS+   +Q G+ E+    L     S   ++ +A  R +    ++
Sbjct: 608 LHLNTERIRVPEILFEPSIAGQDQAGIAELCETILLKKFGSKPGNLSAASSRMVNNVWIT 667

Query: 250 GGSSMYPGLPSRLEKELKQLW-----FTRVLHNDPSRLDKFKVRIEDPPRRKHMVFIGGA 304
           GG++  PG+ +R+ KE  +        +  +  DPS LD +K               G A
Sbjct: 668 GGNARIPGIKNRIVKEFTEFLPAGTPLSVHMSEDPS-LDAWK---------------GMA 711

Query: 305 VLANIMADKDHMWLSKQEWQEMG 327
            LAN   D  +  ++++E++E G
Sbjct: 712 KLANNETDYKNTAVTRKEYEEYG 734

>NDAI0D01060 Chr4 complement(238631..240892) [2262 bp, 753 aa] {ON}
           Anc_2.248 YNL059C
          Length = 753

 Score = 46.6 bits (109), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 37/138 (26%), Positives = 60/138 (43%), Gaps = 18/138 (13%)

Query: 197 IKVGSERFEAPECLFQPSLVDVEQPGVGEM-------LFNTIQSADVDVRSALYRAIVLS 249
           I +  ER   PE +FQPS+  ++Q G+ E+        F +      ++   +   I L+
Sbjct: 611 IHLNVERIRVPEIVFQPSMGGLDQAGIAELSETILLRKFGSEPKHLSELSLTMANNIWLT 670

Query: 250 GGSSMYPGLPSRLEKELKQLWFTRVLHNDPSRLDKFKVRIEDPPRRKHMVFIGGAVLANI 309
           GG+S  PGL  R+ KE ++               +F V +   P      + G A LA  
Sbjct: 671 GGNSKIPGLRERIVKEFREFLPVNT---------QFNVNMTSDP--TFDAWNGMAKLAQN 719

Query: 310 MADKDHMWLSKQEWQEMG 327
             D     +SK+E++E G
Sbjct: 720 ETDYKKTIISKKEYEEYG 737

 Score = 39.3 bits (90), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 35/171 (20%), Positives = 65/171 (38%), Gaps = 7/171 (4%)

Query: 8   AVRSYLQISYPMENGVIKNWSDMELLWDYAFYDQMQLPSTS-GGKVMLTEPPMNPVKNRE 66
            +RS  Q+  P +  +I NW  +E +  Y F     +P       +++TE        R 
Sbjct: 90  TIRS--QMKSPFDGALITNWDYVEDILQYTFNHLGVVPDHGVQNPIIITEKLATIQSQRS 147

Query: 67  QMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTH----IVPVYESVVLNH 122
              +++FE Y+       I ++ A Y                +H    I+P+ +   +  
Sbjct: 148 NWYQLLFETYNVPKATFGIDSLFAFYNNNNGSATSTGMVIDCSHEETNIIPIVDGQGILT 207

Query: 123 LTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLD 173
             +R++  GR    +L +LL+ +   F           + +   YVS D D
Sbjct: 208 DAKRINWGGRHAIDYLSNLLALKYPYFPTKLSSYQYESMYQNFCYVSQDYD 258

>KLTH0G09482g Chr7 complement(789233..791470) [2238 bp, 745 aa] {ON}
           similar to uniprot|P53946 Saccharomyces cerevisiae
           YNL059C ARP5 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 745

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 39/178 (21%), Positives = 73/178 (41%), Gaps = 10/178 (5%)

Query: 1   MIGDEAS---AVRSYLQISYPMENGVIKNWSDMELLWDYAFYDQMQLPSTSG--GKVMLT 55
            IG++ +   +VRS  Q   P +  ++ NW   E + +Y F+  + +    G    +++T
Sbjct: 80  FIGNDTNLDLSVRS--QAKSPYDGAIVSNWDYTEEIMEYTFH-HLGVNGNDGVSNPILMT 136

Query: 56  EPPMNPVKNREQMCEVMFEKYDFGGVYVAIQAVLALYAQ--GLXXXXXXXXXXXXTHIVP 113
           E        RE   +++FE +    V   I ++ + YA                 TH++P
Sbjct: 137 EKLATLQSQRENWYQLLFECFGVPQVTFGIDSLFSFYANNDATASGLVINSGNEDTHVIP 196

Query: 114 VYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYD 171
           V     +    +R++  GR    +L +LL+ +   F         + + E   YVS D
Sbjct: 197 VMNGKGVLSEAKRINWGGRQSVEYLSNLLALKYPYFPIKPSTHQFQSLYEDFCYVSVD 254

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 36/72 (50%), Gaps = 7/72 (9%)

Query: 202 ERFEAPECLFQPSLVDVEQPGVGEML-------FNTIQSADVDVRSALYRAIVLSGGSSM 254
           ER   PE +FQPS+  ++Q GV E+        F + +S   +    L   + L+GG+  
Sbjct: 609 ERIRVPEVIFQPSMAGLDQAGVTEICETNFLKKFGSTRSQLSEGSKKLAANVFLTGGNMR 668

Query: 255 YPGLPSRLEKEL 266
            PG+  R+ +E 
Sbjct: 669 LPGVRERIVREF 680

>TDEL0C04140 Chr3 (732580..734829) [2250 bp, 749 aa] {ON} Anc_2.248
           YNL059C
          Length = 749

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 38/133 (28%), Positives = 58/133 (43%), Gaps = 18/133 (13%)

Query: 202 ERFEAPECLFQPSLVDVEQPGVGEML-------FNTIQSADVDVRSALYRAIVLSGGSSM 254
           ER   PE  FQP++   +Q GV E+        F         + S + + + ++GG++ 
Sbjct: 612 ERIRVPEVFFQPTMCGEDQAGVSELCERVLLSKFGASPRQMSSITSEMAKNVWVTGGNAK 671

Query: 255 YPGLPSRLEKELKQLWFTRVLHNDPSRLDKFKVRIEDPPRRKHMVFIGGAVLANIMADKD 314
            PGL  R+ KE     FT  L  + S    F V I   P      + G A  A    D  
Sbjct: 672 IPGLRERIVKE-----FTGFLPVNTS----FNVNISSDPSLD--AWRGMAKYAQNETDYK 720

Query: 315 HMWLSKQEWQEMG 327
             ++SK+E++E G
Sbjct: 721 KSFISKKEYEEYG 733

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 41/183 (22%), Positives = 75/183 (40%), Gaps = 8/183 (4%)

Query: 1   MIGDEAS---AVRSYLQISYPMENGVIKNWSDMELLWDYAFYDQMQLPSTS-GGKVMLTE 56
            IG++ +   AVR+  Q   P +  ++ NW  +E + +Y F      P+      +++TE
Sbjct: 80  FIGNDVNLDQAVRA--QSKSPFDGPMVTNWDYVEDILEYTFNHLGSTPNNGISNPILVTE 137

Query: 57  PPMNPVKNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXX--XXXXXXXXTHIVPV 114
                   R    +V+FE ++  GV   I ++ A Y                  T+I+PV
Sbjct: 138 RLATLQTQRSSWYQVLFECFNVPGVTFGIDSLFAYYQNTTANSTGLVIGCGNEDTNIIPV 197

Query: 115 YESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLDL 174
            +   +    +R++  G     +L +L++ +   F         R + E   YVS D D 
Sbjct: 198 VDGQGMLTEAKRINWGGSQAADYLTNLMTLKYPYFPTKLSNFHYRTMYEDYCYVSQDYDE 257

Query: 175 DTK 177
           + K
Sbjct: 258 ELK 260

>NCAS0G03050 Chr7 complement(560525..562756) [2232 bp, 743 aa] {ON}
           Anc_2.117 YHR129C
          Length = 743

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 43/182 (23%), Positives = 78/182 (42%), Gaps = 14/182 (7%)

Query: 1   MIGDEAS---AVRSYLQISYPMENGVIKNWSDMELLWDYAFYDQMQLPSTSG--GKVMLT 55
            IG++ S   A+R+  Q   P +  +I NW  +E +  Y F + + +   +G    ++LT
Sbjct: 80  FIGNDVSLDQAIRT--QSKSPFDGSIITNWDYVEDIMQYIF-NHLGVVGHNGVSNPILLT 136

Query: 56  EPPMNPVKNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXX----XXXXXXTHI 111
           E        R    +++FE +D   V + I ++ A Y  GL                T +
Sbjct: 137 EKLATLQSQRSNWYQLLFECFDIPEVTLGIDSMFAFY--GLNERSSTGLVIDCGNEETDV 194

Query: 112 VPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYD 171
           +PV E   +    +R++  GR    +L DLL+ +   F         +++ +   YV+ D
Sbjct: 195 IPVVEGAGMLTDAKRINWGGRQAVDYLNDLLTLKYPYFPTKLSTAQYQRVYQDYCYVAKD 254

Query: 172 LD 173
            D
Sbjct: 255 YD 256

 Score = 39.3 bits (90), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 35/72 (48%), Gaps = 7/72 (9%)

Query: 202 ERFEAPECLFQPSLVDVEQPGVGEML-------FNTIQSADVDVRSALYRAIVLSGGSSM 254
           ER   PE LFQPS+   +Q G+ E+        F + Q        A+   + ++GG+S 
Sbjct: 614 ERIRVPEILFQPSMGGQDQAGIIELCETILTKKFGSEQRKLSPTALAMANNLWITGGNSK 673

Query: 255 YPGLPSRLEKEL 266
            PG+  R+ KE 
Sbjct: 674 LPGMKERIVKEF 685

>CAGL0J10054g Chr10 complement(985402..987666) [2265 bp, 754 aa]
           {ON} highly similar to uniprot|P53946 Saccharomyces
           cerevisiae YNL059c ARP5 Actin-related protein
          Length = 754

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 42/144 (29%), Positives = 61/144 (42%), Gaps = 30/144 (20%)

Query: 197 IKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTI-------------QSADVDVRSALY 243
           + +  ER   PE +FQP L   +Q G+ E+    I             QS D      + 
Sbjct: 612 MHINVERIRVPEVMFQPILGGQDQAGITEICETIITKKFGSTPRNLSQQSLD------MA 665

Query: 244 RAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLHNDPSRLDKFKVRIEDPPRRKHMVFIGG 303
           + + L GG++  PGL SR+ KE     FT  L +D     K  V I + P     V+ G 
Sbjct: 666 KNVWLVGGNAQVPGLKSRVVKE-----FTEFLPSDT----KINVNISEAPTLD--VWNGM 714

Query: 304 AVLANIMADKDHMWLSKQEWQEMG 327
             LAN   D     ++ +E+ E G
Sbjct: 715 YRLANTEEDYQRTIVTSEEYDECG 738

 Score = 36.2 bits (82), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 32/165 (19%), Positives = 64/165 (38%), Gaps = 3/165 (1%)

Query: 14  QISYPMENGVIKNWSDMELLWDYAFYDQMQLPSTS-GGKVMLTEPPMNPVKNREQMCEVM 72
           Q   P +  ++ NW  +E +  Y F+     P       +++ E        R    + +
Sbjct: 98  QARSPFDGPLVVNWDMVEDILQYTFHHLGVQPDNGVTNPIIINEKLACLQSQRSNWYQTL 157

Query: 73  FEKYDFGGVYVAIQAVLALYAQ--GLXXXXXXXXXXXXTHIVPVYESVVLNHLTRRLDVA 130
           FE +    V +A++ +LA Y    G             T+++P+ E   +    +R++  
Sbjct: 158 FESFGVPKVSMAVEGMLAFYGHNGGSSTGIVIDCGYEDTNVIPIVEGQGMMLDAKRINWG 217

Query: 131 GRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLDLD 175
           G     +L +LL  +   F     +    ++ +   YVS D + D
Sbjct: 218 GHSSIDYLSNLLYLKYPYFPTKLSYLQYEKMYKDYCYVSQDYETD 262

>TBLA0E03860 Chr5 complement(969721..972000) [2280 bp, 759 aa] {ON}
           Anc_2.248 YNL059C
          Length = 759

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 38/147 (25%), Positives = 63/147 (42%), Gaps = 28/147 (19%)

Query: 197 IKVGSERFEAPECLFQPSLVDVEQPGVGEM-------LFNTIQSADVDVRSALYRAIVLS 249
           I +  ER   PE +FQPS+   +Q G+ E+        FN+       +   +   + L+
Sbjct: 617 IHMNVERIRVPEVMFQPSIGGCDQAGISELSETLFLRKFNSSPRKLSSISERMLNNVWLT 676

Query: 250 GGSSMYPGLPSRLEKELKQLW-----FTRVLHNDPSRLDKFKVRIEDPPRRKHMVFIGGA 304
           GG +  PGL  R+ KE  +        +  + NDPS LD +K               G A
Sbjct: 677 GGHAKLPGLKERIVKEYTEFLPVGTKMSINISNDPS-LDTWK---------------GMA 720

Query: 305 VLANIMADKDHMWLSKQEWQEMGSAAM 331
            LA+       + ++K++++E G   M
Sbjct: 721 KLASNTDYLKKIQVTKKDYEEYGPEYM 747

 Score = 40.0 bits (92), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 38/173 (21%), Positives = 74/173 (42%), Gaps = 10/173 (5%)

Query: 13  LQISYPMENGVIKNWSDMELLWDYAFYDQMQLPSTSG---GKVMLTEPPMNPVKNREQMC 69
           +Q   P +   I NW   E ++DY  +  + + +T+G     ++LTE        R    
Sbjct: 93  IQAKRPYDGLFIANWEYAEEIFDYTLH-HLGVQTTNGSISNPIILTEKMACLQSQRANWY 151

Query: 70  EVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXX----XXXXXXTHIVPVYESVVLNHLTR 125
           +++FE +D       + ++ A Y                    T+IVP+ +   +    +
Sbjct: 152 QLLFETFDVPSATFGLDSLYAFYNNCANPFESDGLVINCGHEDTNIVPIVQGKGILTEAK 211

Query: 126 RLDVAGRDVTRHLIDLLS-RRGYAFNRSADFETVRQIKEKLSYVSYDLDLDTK 177
           R++  GR  T +L  LL+ +  Y   + ++F+  + + E   YVS + + D K
Sbjct: 212 RINWGGRHSTEYLSSLLTLKYPYFPTKLSEFQ-YQTMYEDFCYVSPNYNEDIK 263

>KAFR0J01160 Chr10 (212425..214680) [2256 bp, 751 aa] {ON} Anc_2.248
           YNL059C
          Length = 751

 Score = 43.5 bits (101), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 42/176 (23%), Positives = 71/176 (40%), Gaps = 7/176 (3%)

Query: 8   AVRSYLQISYPMENGVIKNWSDMELLWDYAFYDQMQLPSTSGGKVMLTEPPMNPVKN-RE 66
            VRS  Q   P +   I NW  +E +  Y F     +   S    ++   P+  +++ R+
Sbjct: 90  TVRS--QSKSPFDGSFIANWDYVEDIMQYTFNHLGVVGDNSVRNPLIINEPLGSLQSQRK 147

Query: 67  QMCEVMFEKYDFGGVYVAIQAVLALYA--QGLXXXXXXXXXXXXTHIVPVYESVVLNHLT 124
              E++FE +    V   I  +   YA  +G             T ++PV +   +    
Sbjct: 148 NWYELLFECFHLPNVSFGIDGMFGFYANNEGNQDGIVINCSNEETDVIPVVDGRGVLTDA 207

Query: 125 RRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVS--YDLDLDTKL 178
           +R++  GR    +L DL+S +   F         +Q+     YVS  Y  D+DT L
Sbjct: 208 KRINWGGRQAVDYLSDLMSLKYPYFPSKLSTFQYQQMYTNYCYVSPDYSNDIDTML 263

 Score = 39.3 bits (90), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 41/139 (29%), Positives = 62/139 (44%), Gaps = 18/139 (12%)

Query: 197 IKVGSERFEAPECLFQPSLVDVEQPGVGEM----LFNTIQSADVDVRS---ALYRAIVLS 249
           + +  ER   PE LFQP +   +Q G+ E+    L N   S   ++      + + I L+
Sbjct: 609 LHLNVERIRVPEILFQPIIGGQDQAGISELCETILSNKFGSKPRELSETSLGMAKNIWLT 668

Query: 250 GGSSMYPGLPSRLEKELKQLWFTRVLHNDPSRLDKFKVRIEDPPRRKHMVFIGGAVLANI 309
           GG S  PGL  R+ KE     FT  L   P    K  V++   P      + G   LA  
Sbjct: 669 GGHSKLPGLRERIVKE-----FTGFL---PVGT-KLGVKMSKNPSLD--AWYGMRKLAQN 717

Query: 310 MADKDHMWLSKQEWQEMGS 328
            AD     +SK++++E G+
Sbjct: 718 EADYKDSIISKKDYEEYGA 736

>Kpol_1003.16 s1003 complement(43655..45904) [2250 bp, 749 aa] {ON}
           complement(43655..45904) [2250 nt, 750 aa]
          Length = 749

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 35/72 (48%), Gaps = 7/72 (9%)

Query: 202 ERFEAPECLFQPSLVDVEQPGVGEML-------FNTIQSADVDVRSALYRAIVLSGGSSM 254
           ER   PE LFQP++   +Q GV E+        F +  +        +   I LSGG++ 
Sbjct: 613 ERIRVPEVLFQPTMGGCDQAGVAELCETILLKKFGSSPNQLSKTAEDMANNIWLSGGNAK 672

Query: 255 YPGLPSRLEKEL 266
            PGL +R+ KE 
Sbjct: 673 VPGLKNRIVKEF 684

 Score = 32.3 bits (72), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 29/149 (19%), Positives = 59/149 (39%), Gaps = 8/149 (5%)

Query: 1   MIGDEAS---AVRSYLQISYPMENGVIKNWSDMELLWDYAFYDQMQLPSTSGGKVMLTEP 57
            IG++ S   AVR+  Q   P +  ++ NW  ++ + +Y F     L        ++   
Sbjct: 81  FIGNDISLDQAVRA--QSKSPFDGSMVTNWEYIDEMLEYTFKHLGVLGDNGISNPLIFSE 138

Query: 58  PMNPVK-NREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXX--XXXXXXXXTHIVPV 114
            +  V+  R Q  +++FE ++       I    A +A                 T+++P+
Sbjct: 139 KLAVVQAQRSQWYQLLFETFNISKATFGIDNQFAFFANNSIDSTGLMIGCNNEDTNVIPI 198

Query: 115 YESVVLNHLTRRLDVAGRDVTRHLIDLLS 143
              V      +R++  G     ++ +LLS
Sbjct: 199 VNGVASLQECKRINWGGNHAVSYMNNLLS 227

>Ecym_3285 Chr3 complement(539184..541424) [2241 bp, 746 aa] {ON}
           similar to Ashbya gossypii ADL253C
          Length = 746

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 34/133 (25%), Positives = 63/133 (47%), Gaps = 18/133 (13%)

Query: 202 ERFEAPECLFQPSLVDVEQPGVGEML-------FNTIQSADVDVRSALYRAIVLSGGSSM 254
           ER   PE +FQPS+  ++Q G+ E+        F + +    ++   + + I ++GG++ 
Sbjct: 609 ERIRVPEVIFQPSIGGLDQAGIVELCETLLLKKFGSNRRELSEISKMMAKNIFITGGNAK 668

Query: 255 YPGLPSRLEKELKQLWFTRVLHNDPSRLDKFKVRIEDPPRRKHMVFIGGAVLANIMADKD 314
            PG+  R+ +E     F  V  N   +L       EDP       + G A  AN  +  +
Sbjct: 669 LPGIRERVVREF--TGFLPVGTNLNVKL------AEDPS---MSAWRGMAKFANNTSLYE 717

Query: 315 HMWLSKQEWQEMG 327
              ++K+E++E+G
Sbjct: 718 TSIMTKKEYEELG 730

 Score = 32.0 bits (71), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 28/134 (20%), Positives = 53/134 (39%), Gaps = 5/134 (3%)

Query: 14  QISYPMENGVIKNWSDMELLWDYAFYDQMQLPSTSG--GKVMLTEPPMNPVKNREQMCEV 71
           Q   P +  +I NW  ++ +  Y F+  + +    G    V++TE        R    E+
Sbjct: 94  QSKSPFDGSMITNWDYVDDILAYTFH-HLDVRGNGGVPNPVLITERMAALQSQRSNWYEL 152

Query: 72  MFEKYDFGGVYVAIQAVLALYAQGL--XXXXXXXXXXXXTHIVPVYESVVLNHLTRRLDV 129
           +FE Y+   V   I ++ + Y +                T ++PV     +    +R++ 
Sbjct: 153 LFECYNLQKVTFGIDSLFSFYGEHPPGTTGIAINSGNEDTSVIPVVNGKGILTEAKRINW 212

Query: 130 AGRDVTRHLIDLLS 143
            G+    +L  LLS
Sbjct: 213 GGQQSVGYLNGLLS 226

>KLLA0F03421g Chr6 complement(321000..323243) [2244 bp, 747 aa] {ON}
           similar to uniprot|P53946 Saccharomyces cerevisiae
           YNL059C ARP5 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 747

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 38/149 (25%), Positives = 61/149 (40%), Gaps = 8/149 (5%)

Query: 1   MIGDEAS---AVRSYLQISYPMENGVIKNWSDMELLWDYAFYDQMQLPSTSGGKVMLTEP 57
            IG++ S   AVRS+ +   P +  +I NW  ME +  Y F+     P+      M+   
Sbjct: 83  FIGNDCSLDNAVRSHSR--SPYDGSLITNWEYMEDMLSYTFHHLGVQPNDGISNPMILTE 140

Query: 58  PMNPVK-NREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXX--XXXXXXXXTHIVPV 114
            M  V+  R    +++FE Y    V   I  + + YA                 T+I+PV
Sbjct: 141 KMATVQAQRSNWYQLLFECYGIPQVTFGIDGLFSFYANNSPDSTGLIINSGHEDTNIIPV 200

Query: 115 YESVVLNHLTRRLDVAGRDVTRHLIDLLS 143
            +   +    +R+D  G     +L  LLS
Sbjct: 201 IKGKGILSEAKRIDWGGNQSIDYLKSLLS 229

 Score = 36.2 bits (82), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 34/72 (47%), Gaps = 7/72 (9%)

Query: 202 ERFEAPECLFQPSLVDVEQPGVGEMLFNTIQSADVDVRSALYRA-------IVLSGGSSM 254
           ER  APE +FQPS+  ++Q G+ E+    +        S L +        I ++GG++ 
Sbjct: 611 ERIRAPEVIFQPSMGGLDQAGIAELADGILTKKFGSGSSKLSQQCLDMASNIFITGGNTK 670

Query: 255 YPGLPSRLEKEL 266
            P L  R+  E 
Sbjct: 671 IPNLRERIVNEF 682

>Kwal_23.4848 s23 complement(892162..894399) [2238 bp, 745 aa] {ON}
           YNL059C (ARP5) - Actin-related protein [contig 5] FULL
          Length = 745

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 49/232 (21%), Positives = 92/232 (39%), Gaps = 29/232 (12%)

Query: 1   MIGDEAS---AVRSYLQISYPMENGVIKNWSDMELLWDYAFYDQMQLPSTSG--GKVMLT 55
            IG++ +   +VRS  Q   P +  ++ NW   E + +Y F+  + +  T G    +++T
Sbjct: 80  FIGNDTNLDLSVRS--QSRSPYDGALVTNWDYTEDIMEYTFH-HLGVKGTDGIPNPIIMT 136

Query: 56  EPPMNPVKNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXX--XXXXXXXXTHIVP 113
           E        R+   +++FE +    V   + ++ + YA                 THI+P
Sbjct: 137 EKLGALHSQRDNWYQLLFECFGAPQVTFGLDSLFSFYANNDASASGLVISSGNEDTHIIP 196

Query: 114 VYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLD 173
           V +   +    +R++  GR    +L +LL+ +   F         + + ++  YVS D  
Sbjct: 197 VVDGKGVLGEAKRINWGGRQSVDYLSNLLALKYPYFPIKPSTHQFKALYDEFCYVSPD-- 254

Query: 174 LDTKLARETTTLVENYELPDGRVIKVGSERFEAPECLFQPSLVDVEQPGVGE 225
                          Y+    R++ +  E  E    L +   VDV QP   E
Sbjct: 255 ---------------YQDEIQRILTL--EELETKNVLVEAPFVDVVQPEKSE 289

 Score = 35.4 bits (80), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 39/75 (52%), Gaps = 7/75 (9%)

Query: 202 ERFEAPECLFQPSLVDVEQPGVGEML-------FNTIQSADVDVRSALYRAIVLSGGSSM 254
           ER   PE +FQPS+  ++Q G+ E+        F + +S    +  +L   + L+GG+  
Sbjct: 609 ERIRVPEVIFQPSMGGLDQAGIIEICETNFLKKFGSSRSELSSISRSLASNVFLTGGNMR 668

Query: 255 YPGLPSRLEKELKQL 269
            PG+  R+ +E + L
Sbjct: 669 LPGMRERVVREFRGL 683

>SAKL0H17358g Chr8 complement(1535040..1535975) [936 bp, 311 aa]
           {ON} weakly similar to uniprot|Q04549 Saccharomyces
           cerevisiae YDR106W ARP10 Actin-related protein
          Length = 311

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 46/250 (18%), Positives = 101/250 (40%), Gaps = 42/250 (16%)

Query: 29  DMELLWD--YAFYDQMQLPSTSGGKVMLTEPPMNPVKNREQMCEVMFEKYDFGGVYVAIQ 86
           D E LW   Y  Y    + + S  KV++ E  + P+  +E +C+V+ ++     +     
Sbjct: 37  DEEFLWRLFYKCYHDELMVAPSSTKVVIIENVLLPLNCKELLCQVLLKRLLVSSIVFVPD 96

Query: 87  AVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRRLDVAGRDVTRHL-------- 138
            ++  ++ G+              +VP+ +  +L++ +   + AG+ +  +L        
Sbjct: 97  VLMTCFSSGVKDGLVIDVGWEYVAVVPILDLRILDNWSHISNKAGKFLYDNLKEILPPGT 156

Query: 139 -IDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLDLDTKLARETTTLVENYELPDGRVI 197
            +D+L  +  A     DF+                       RE +      E+ +G + 
Sbjct: 157 DLDILVPQIMACEGDKDFQY----------------------REISI---TKEVRNGFLK 191

Query: 198 KVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTIQSADVDVRSALYRAIVLSGGSSMYPG 257
           K      E       P   D ++  + +++  T++   VDV+  ++  ++++G +S  PG
Sbjct: 192 KTIGHFDE------DPLEYDDDELPISQVVLKTLKDLPVDVKKRVFPHLMITGLASNIPG 245

Query: 258 LPSRLEKELK 267
              +L KE+K
Sbjct: 246 FKMKLLKEVK 255

>ADL253C Chr4 complement(255550..257805) [2256 bp, 751 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL059C
           (ARP5)
          Length = 751

 Score = 40.0 bits (92), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 20/77 (25%), Positives = 40/77 (51%), Gaps = 7/77 (9%)

Query: 197 IKVGSERFEAPECLFQPSLVDVEQPGVGEML-------FNTIQSADVDVRSALYRAIVLS 249
           + +  ER   PE +FQPS+  ++Q GV E+        F++ + A       + + + ++
Sbjct: 609 MHINVERIRVPEVIFQPSIGGLDQAGVVELCETVLLKKFDSSRRALSATCEKMAKNVFIT 668

Query: 250 GGSSMYPGLPSRLEKEL 266
           GG++  PG+  R+ +E 
Sbjct: 669 GGNTKLPGIRERIVREF 685

 Score = 32.0 bits (71), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 36/170 (21%), Positives = 65/170 (38%), Gaps = 17/170 (10%)

Query: 14  QISYPMENGVIKNWSDMELLWDYAFYDQMQLPSTSGG----KVMLTEPPMNPVKNREQMC 69
           Q   P +  ++ NW  ++ +  Y F+    L    GG     V+LTE        R    
Sbjct: 98  QSRSPFDGPMVTNWDYVDDMLAYTFH---HLGVRGGGGVPNAVVLTERLATLQSQRANWY 154

Query: 70  EVMFEKYDFGGVYVAIQAVLALYAQ------GLXXXXXXXXXXXXTHIVPVYESVVLNHL 123
           E+++E Y+   V   I ++ + Y +      GL            T +VPV +   +   
Sbjct: 155 ELLYEAYNLQEVTFGIDSLFSFYGERGPGSTGL----VVSSGNEDTCVVPVVDGRGVVSE 210

Query: 124 TRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLD 173
            +R++  G+    +L  LL+ +   F           I  +  YV+ D +
Sbjct: 211 AKRINWGGQQAVDYLTGLLALKYPYFPTKLSGSQFETIYREHCYVAEDFE 260

>SAKL0E08602g Chr5 (702206..704449) [2244 bp, 747 aa] {ON} similar
           to uniprot|P53946 Saccharomyces cerevisiae YNL059C ARP5
           Nuclear actin-related protein involved in chromatin
           remodeling component of chromatin-remodeling enzyme
           complexes
          Length = 747

 Score = 38.9 bits (89), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 35/133 (26%), Positives = 61/133 (45%), Gaps = 18/133 (13%)

Query: 202 ERFEAPECLFQPSLVDVEQPGVGEM----LFNTIQSADVDVRSA---LYRAIVLSGGSSM 254
           ER   PE +FQP +  ++Q G+ E+    + N   S+   + S    +   + L+GG+  
Sbjct: 610 ERIRVPEVIFQPPMGGLDQAGIIELSETIIMNKFGSSRRQLSSVSQEMANNVFLTGGNVR 669

Query: 255 YPGLPSRLEKELKQLWFTRVLHNDPSRLDKFKVRIEDPPRRKHMVFIGGAVLANIMADKD 314
            PGL  R+ +E     FT  L   P    K+ +++   P      + G A  A    D  
Sbjct: 670 VPGLRDRIVRE-----FTEFL---PVGT-KYNIKVASDPAID--AWKGMAKFAQSSTDYK 718

Query: 315 HMWLSKQEWQEMG 327
             +++K+E++E G
Sbjct: 719 GSYVTKKEYEEYG 731

 Score = 35.0 bits (79), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 35/164 (21%), Positives = 64/164 (39%), Gaps = 5/164 (3%)

Query: 14  QISYPMENGVIKNWSDMELLWDYAFYDQMQLPSTSG--GKVMLTEPPMNPVKNREQMCEV 71
           Q   P +  +I NW  +E + +Y F + + +    G    ++LTE        R    ++
Sbjct: 94  QSRSPFDGPMITNWDYVEDMMEYTF-NHLGVVGHDGISNPILLTEKMATLQSQRSNWYQL 152

Query: 72  MFEKYDFGGVYVAIQAVLALYA--QGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRRLDV 129
           MFE +    +   I ++ + +A  Q              T+++PV     +    +R++ 
Sbjct: 153 MFECFGVPKLTFGIDSLFSYFANNQSDSTGLVISSGNEDTNVIPVVCGKGILSEAKRINW 212

Query: 130 AGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLD 173
            GR    +  +LLS +   F         + I     YVS D D
Sbjct: 213 GGRHSVEYTTNLLSLKYPYFPTKLVSSQFQSIYHDFCYVSRDYD 256

>KLLA0F11913g Chr6 complement(1094612..1095373) [762 bp, 253 aa]
           {ON} weakly similar to uniprot|Q04549 Saccharomyces
           cerevisiae YDR106W ARP10 Actin-related protein
          Length = 253

 Score = 37.0 bits (84), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 14/98 (14%), Positives = 46/98 (46%)

Query: 37  AFYDQMQLPSTSGGKVMLTEPPMNPVKNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGL 96
           +++  + + ++ G K++++EP    +  ++++C+V+F +     +      + A    G+
Sbjct: 47  SWFHDILMYNSKGVKIVISEPLWLSILRKQRLCKVLFGRLKVNSICFVPNCLAAFIGAGI 106

Query: 97  XXXXXXXXXXXXTHIVPVYESVVLNHLTRRLDVAGRDV 134
                       T ++P+++  +L+  +R   +   +V
Sbjct: 107 RNGLYIEVNSKNTELIPIFDGRILDSYSRSSKLGSDNV 144

>Kpol_543.10 s543 complement(25137..27767) [2631 bp, 876 aa] {ON}
           complement(25137..27767) [2631 nt, 877 aa]
          Length = 876

 Score = 37.0 bits (84), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 47/201 (23%), Positives = 82/201 (40%), Gaps = 20/201 (9%)

Query: 28  SDMELLWDYAFY---DQMQLPSTSGGKVMLTEPPMNPVKNREQMCEVMFEKYDFGGVYVA 84
           SD+  L++YA     + +        KV+L  P +    + E +  ++ ++  F  V + 
Sbjct: 421 SDVTRLFEYALTKRDESITQAQIQQCKVILVIPDLFEKSHIETLYRILLKEMQFQAVAIM 480

Query: 85  IQAVLALYAQGLXXXXXXXXX-XXXTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLS 143
            +++ A Y  G+             T I  V E  VL +   +LD  G D+TR     L 
Sbjct: 481 QESLAACYGAGISTASCIVNIGATQTTIACVDEGTVLENSLIKLDYGGDDITRLFTLFLL 540

Query: 144 RRGYAFNRSADFETVR--QIKEKL--SYVSY-DLDLDTKL----ARETTTLVENYELPDG 194
              + F +  D ++     + E+L  +Y ++ D ++  +L     R    + E YE    
Sbjct: 541 ENNFPF-QDLDLDSTHGWTLAEQLKKNYATFEDANMTVQLYNFVKRIPGKVSEKYEF--- 596

Query: 195 RVIKVGSERFEAPECLFQPSL 215
              KV  E   AP  LF P +
Sbjct: 597 ---KVFDEVILAPLALFYPDI 614

>Kpol_520.11 s520 complement(26673..28139) [1467 bp, 488 aa] {ON}
           complement(26673..28139) [1467 nt, 489 aa]
          Length = 488

 Score = 36.2 bits (82), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 54/281 (19%), Positives = 111/281 (39%), Gaps = 41/281 (14%)

Query: 22  GVIKNWSDMELLWDYAFYDQMQLPSTSGGKVMLTEPPM----NPVKNR--EQMCEVMFEK 75
           GV  NW  +E  W+Y F  Q++   T    V++T P        ++N+  EQ C++ FEK
Sbjct: 73  GVPYNWEALEKQWEYIFEKQLKCDPTE-LPVLITIPSSISKNEDIENKVIEQYCKIAFEK 131

Query: 76  YDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNH------------- 122
           +    + +  +++      G             + + P+ + V++ +             
Sbjct: 132 FKIPYLQIVNESLSISLGLGKKTSLVIDISGSGSSVTPIVDGVIIKNGIVKSKYGGDFLD 191

Query: 123 --LTRRLDVAGRDVTRHLID----LLSRRGY--AFNRSADFETVRQIKEKLSYVSYDLDL 174
             + ++      D+   + +     +S   +   F ++    T +++++   Y    L L
Sbjct: 192 YQIIKKFSTIDEDLEEEMTNSSNIWVSSNSWIKNFKKTMLQVTDKKLQDVEKYYEEQLRL 251

Query: 175 DTKLARETT---------TLVENYELPDGRVIKVGS-ERFEAPECLFQPSLVDVE---QP 221
             +L  + +         ++ + Y     + +   S E ++  E LFQP L   +     
Sbjct: 252 QAELQNQGSITSVGTNPLSVKKEYLYRSRKTVTFESRELYQFGEYLFQPQLASEQYNRDD 311

Query: 222 GVGEMLFNTIQSADVDVRSALYRAIVLSGGSSMYPGLPSRL 262
           G+GE+++ +I SA +    A   A    GGSS   G  S +
Sbjct: 312 GLGELIYRSITSAAMGNMPAAVAASNNIGGSSGATGGDSNV 352

>TBLA0H02800 Chr8 (655357..656811) [1455 bp, 484 aa] {ON} Anc_2.593
           YMR033W
          Length = 484

 Score = 35.4 bits (80), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 60/302 (19%), Positives = 111/302 (36%), Gaps = 62/302 (20%)

Query: 18  PMENGVIKNWSDMELLWDYAFYD---QMQLPSTSGGKVMLTEPPMNPVKNR-------EQ 67
           P+ENG+I N    +    Y +     Q    +    +   T  P+  + N        E 
Sbjct: 66  PIENGMIINLEAFQEFLKYIYISLLKQKHDENADSFEYSFTNIPLLLLNNHKWSQFQMES 125

Query: 68  MCEVMFEKYDFGGVYVAIQAVLALYAQ-GLXXXXXXXXXXXXTHIVPVYESVVLNHLTRR 126
           +   +FEK    G+ +   ++ A Y+   L            T IVP+ +   +NHL+  
Sbjct: 126 ITNFVFEKLKLNGLMLLPISLGASYSMVSLQNCCIIDIGLNHTDIVPIVDYTTINHLSNT 185

Query: 127 LDVAGRDVTRHLIDLL----SRRGYAFNRSADFETVRQIKEKLSYVSYDLDLDTKL---- 178
           L+  G  +   L  LL     ++     +S  FE + + ++  S   ++  + T      
Sbjct: 186 LNYGGSYINTILQKLLPELNDQQIEDLKKSPIFEVLTEDEKNDSAFDFNNPITTSTKNKD 245

Query: 179 --------------ARETTTLVENYE-------LP------------DGRVIKVGSERFE 205
                          ++T  ++   E       LP            +G  IK+G +RF+
Sbjct: 246 DDDADFDVASIINSGKDTREILAEREKKNQKKSLPNSQLEFNTFKDNNGNQIKIGKQRFQ 305

Query: 206 APECLFQPSLVDVEQPGVGEMLFNTI-QSADVDVRSALYRAIVLSGGSSMYPGLPSRLEK 264
             + L Q          +   + +TI Q  D+  + A++  IV+ G +S+  G    L  
Sbjct: 306 GCDELIQ---------KISTRVGHTINQLEDLSKQRAIWENIVIVGNTSLITGFKEALLN 356

Query: 265 EL 266
           +L
Sbjct: 357 QL 358

>Skud_15.304 Chr15 complement(543860..546511) [2652 bp, 883 aa] {ON}
           YOR141C (REAL)
          Length = 883

 Score = 35.4 bits (80), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 39/153 (25%), Positives = 60/153 (39%), Gaps = 9/153 (5%)

Query: 4   DEASAVRSYLQ-----ISYPMENGVIKNWSDMELLWDYAFYDQ-MQLPSTSGG--KVMLT 55
           DE   VR   Q     I+ P    + +  SD+  L +YA   + + + ST     KV+L 
Sbjct: 396 DEKFVVRKPFQGGSFNINSPYYESLAELISDVTKLLEYALASETLNVKSTKFNQYKVVLV 455

Query: 56  EPPMNPVKNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXX-XXXTHIVPV 114
            P +    + E    V+  +  F  V V  +++   Y  G+             T I  V
Sbjct: 456 IPDVFKKNHVETFIRVLLTELQFQAVAVIQESLATCYGAGISTSTCVVNIGATETRIACV 515

Query: 115 YESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGY 147
            E  VL H    L+  G D+TR    LL +  +
Sbjct: 516 DEGTVLEHSAVTLNYGGDDITRLFALLLLQSDF 548

>Ecym_3505 Chr3 complement(941314..942231) [918 bp, 305 aa] {ON}
           similar to Ashbya gossypii AGR099C
          Length = 305

 Score = 34.7 bits (78), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 39/223 (17%), Positives = 86/223 (38%), Gaps = 40/223 (17%)

Query: 51  KVMLTEPPMNPVKNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTH 110
           K+++ E  +  V  ++++C V+ ++     V      ++A  A G+            T 
Sbjct: 61  KIVILENVLLDVPKKKRLCHVLLDRLMVSSVVFLPDILMACVAGGVTDAIVVDIGWENTV 120

Query: 111 IVPVYESVVLNHLTRRLDVAGRDVTRHL-IDLLSRRGYAFNRSADFET-----VRQIKEK 164
           + P+ +  +L               +H+ I  +  +      S+ FE      VR IK  
Sbjct: 121 VAPIMDMRILE--------------QHMGISKIGAKWIGSKLSSTFEIDGEKIVRMIKLD 166

Query: 165 LSYVSYDLDLDTKLARETTTLVENYELPDGRVIKVGSERFEAPECLFQPSLVDVEQPGVG 224
                  + ++ +   +   ++ N    D             PEC       D+++  + 
Sbjct: 167 TDINCNGVQIEWRDIEDCMEILWNINKQD-------------PEC-------DIDEFPII 206

Query: 225 EMLFNTIQSADVDVRSALYRAIVLSGGSSMYPGLPSRLEKELK 267
            ++  +I+   +DV+S + + +++ GG S   GL  RL + L+
Sbjct: 207 SLVLESIKQLPIDVKSKVLQNVIIIGGLSKIQGLKERLIENLR 249

>Suva_13.202 Chr13 (328209..328238,328325..329698) [1404 bp, 467 aa]
           {ON} YMR033W (REAL)
          Length = 467

 Score = 34.7 bits (78), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 51/237 (21%), Positives = 92/237 (38%), Gaps = 44/237 (18%)

Query: 66  EQMCEVMFEKYDFGGVYVAIQAVLALYAQ-GLXXXXXXXXXXXXTHIVPVYESVVLNHLT 124
           E + + +FE  +   +     ++ A Y+   L            T I+P+ +   L+HL 
Sbjct: 125 ETITQYIFESLEINNLIQLPASLAATYSMISLQNCCIIDVGTYHTDIIPIVDYAQLDHLV 184

Query: 125 RRLDVAGRDVTRHLIDLLSR----RGYAFNRSADFETVRQIKEKLSYVSYDLD------- 173
             L V G+ +   L  LL +    +  +  +S  FE +    +KLS   +  D       
Sbjct: 185 SSLPVGGQSINDSLKKLLPQWDDDQIESLKKSPIFEVLSDDAKKLSNFDFGNDNEDEDEE 244

Query: 174 -----------------LDTKLARETTTLVENYELP-------DGRVIKVGSERFEAPEC 209
                            L+ +   + T  V+N +L        +G  IKVG +RF+   C
Sbjct: 245 TLNVAEIITSGRDTREVLEERERSQKTKNVKNSDLEFNTFWDRNGNEIKVGKQRFQG--C 302

Query: 210 LFQPSLVDVEQPGVGEMLFNTIQSADVDVRSALYRAIVLSGGSSMYPGLPSRLEKEL 266
               SL+      VG +  + I   D++   A++  I++ GG++   G    L  +L
Sbjct: 303 ---NSLLKSISNRVG-LTLDKID--DINKARAVWENIIIVGGTTSISGFKEALLGQL 353

>SAKL0F13772g Chr6 (1099703..1100971) [1269 bp, 422 aa] {ON} similar
           to uniprot|Q12406 Saccharomyces cerevisiae YPR034W ARP7
           Actin-related protein involved in transcriptional
           regulation subunit of the chromatin remodeling Snf/Swi
           complex
          Length = 422

 Score = 34.3 bits (77), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 24/92 (26%), Positives = 45/92 (48%), Gaps = 13/92 (14%)

Query: 238 VRSALYRAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLHN--DPSRLDKFKVRIEDPPRR 295
           + +AL   IV++G +S+ PG+  R+  EL   +    L +  +P  LD           R
Sbjct: 336 IHAALLTNIVITGSTSLVPGVEQRIVNELSYQFPQYKLSSFANPMVLD-----------R 384

Query: 296 KHMVFIGGAVLANIMADKDHMWLSKQEWQEMG 327
           K   + GG  ++N+ + +   W+++QE+   G
Sbjct: 385 KLQSWQGGVTMSNLPSWELGNWITRQEYDANG 416

>TPHA0N01430 Chr14 (314740..316158) [1419 bp, 472 aa] {ON} Anc_2.593
           YMR033W
          Length = 472

 Score = 34.3 bits (77), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 40/194 (20%), Positives = 74/194 (38%), Gaps = 46/194 (23%)

Query: 109 THIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLL-----------------------SRR 145
           T I+P+ +   L H +  + + G D+  HL  +L                       +++
Sbjct: 177 TDILPIVDYSQLTHFSSTIPIGGNDINTHLKSILPSLSDDQIEDLKLSNIYEVLNAEAKK 236

Query: 146 GYAFNRSADFETVRQIKEKLSYVSYDLDLDTKLARETTTLVENYELP------------D 193
            YA    AD +      +  + ++   D    L  E     EN  LP            +
Sbjct: 237 NYADLHQADEDEDDSAIDVAAIITSGRDAREILEGERKNKNEN-SLPNSELDKNSFVDRN 295

Query: 194 GRVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTIQSA-DVDVRSALYRAIVLSGGS 252
           G++I VG +RF+  E L +          + + +  TI    D++ + A++  IV+ G +
Sbjct: 296 GQLISVGKQRFQGCENLIK---------AISKRVGYTISMVQDINKQKAMWENIVIVGNT 346

Query: 253 SMYPGLPSRLEKEL 266
           S+  G    L  +L
Sbjct: 347 SLLTGFQDSLLTKL 360

>KLTH0D08624g Chr4 (722066..723364) [1299 bp, 432 aa] {ON} similar
           to uniprot|Q05123 Saccharomyces cerevisiae YMR033W ARP9
           Actin-related protein
          Length = 432

 Score = 34.3 bits (77), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 52/234 (22%), Positives = 95/234 (40%), Gaps = 41/234 (17%)

Query: 66  EQMCEVMFEKYDFGGVYVAIQAVLALYAQG-LXXXXXXXXXXXXTHIVPVYESVVLNHLT 124
           E + + +FE+           A+ + YA G L            T ++P+ + + L HL 
Sbjct: 98  ETIAQFVFEQLQINNFMFLPSALASSYALGSLQNCVVIDIHTNGTDVIPILDYIQLGHLA 157

Query: 125 RRLDVAGRDVTRHLIDLLSR----RGYAFNRSADFETVRQIKEKLSYVSYD-------LD 173
            +++  G  + + L  LL +    +     +S+ FE + +  +K S +++        LD
Sbjct: 158 VKVEHGGSQIDQELAKLLPQWTPEQIEDLKKSSIFEVLSEDAKKSSSLNFKHGEDEGALD 217

Query: 174 LDTKLA--RETTTL------------VENYELPD-------GRVIKVGSERFEAPECLFQ 212
           +   +   R+T  +            VEN E  +       G+ I VG +RF+  E    
Sbjct: 218 VAALVTSDRDTREILEEREKNKDKHNVENSEQENNVFVDRHGKQIIVGKQRFKGCE---- 273

Query: 213 PSLVDVEQPGVGEMLFNTIQSADVDVRSALYRAIVLSGGSSMYPGLPSRLEKEL 266
            SLV      VG +L    Q  D     A++  I++ GG++   G    L ++L
Sbjct: 274 -SLVAEISKTVGRVL---SQIDDFHKLRAMWENILVVGGTTSISGFKEALLQKL 323

>KAFR0K02150 Chr11 (441832..443304) [1473 bp, 490 aa] {ON} Anc_7.448
           YPR034W
          Length = 490

 Score = 33.1 bits (74), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 25/115 (21%), Positives = 49/115 (42%), Gaps = 4/115 (3%)

Query: 20  ENGVIKNWSDMELLWDYAFYDQMQLPSTSGGKVMLTEPPMN---PVKNREQMCEVMFEKY 76
           ENGV  NW  +E  W Y F ++++  S     +++T P M     ++  E+  ++ F K+
Sbjct: 70  ENGVPYNWEALERQWKYIFENELKCKSDE-FPLVITVPIMKDAVALRVMERYFDLAFNKF 128

Query: 77  DFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRRLDVAG 131
           +   + V I+ +    + G              ++ PV +  V  +   +   AG
Sbjct: 129 NVPVLQVIIEPLAIALSMGKSSALVVDLGSSSCNVTPVIDGTVAKNSVLKSKYAG 183

>Smik_15.320 Chr15 complement(551333..553954) [2622 bp, 873 aa] {ON}
           YOR141C (REAL)
          Length = 873

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 30/128 (23%), Positives = 50/128 (39%), Gaps = 4/128 (3%)

Query: 13  LQISYPMENGVIKNWSDMELLWDYAFYDQ---MQLPSTSGGKVMLTEPPMNPVKNREQMC 69
             I+ P    + +  SD+  L +YA   +   ++    +  KV+L  P +    + E   
Sbjct: 400 FNINSPYYKSLAELISDVTKLLEYALKSETLNVKPAKFNQYKVVLVIPDIFKKSHIETFI 459

Query: 70  EVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXX-XXXTHIVPVYESVVLNHLTRRLD 128
            V+  +  F  V +  +++   Y  G+             T I  V E  VL H    LD
Sbjct: 460 RVLLTELQFQAVAIIQESLATCYGAGISTSTCVVNIGASETRIACVDEGTVLEHSAITLD 519

Query: 129 VAGRDVTR 136
             G D+TR
Sbjct: 520 YGGDDITR 527

>YOR141C Chr15 complement(589942..592587) [2646 bp, 881 aa] {ON}
           ARP8Nuclear actin-related protein involved in chromatin
           remodeling, component of chromatin-remodeling enzyme
           complexes; has mRNA binding activity
          Length = 881

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 23/87 (26%), Positives = 34/87 (39%), Gaps = 1/87 (1%)

Query: 51  KVMLTEPPMNPVKNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXX-XXXT 109
           KV+L  P +    + E    V+  +  F  V +  +++   Y  G+             T
Sbjct: 449 KVVLVIPDIFKKSHVETFIRVLLTELQFQAVAIIQESLATCYGAGISTSTCVVNIGAAET 508

Query: 110 HIVPVYESVVLNHLTRRLDVAGRDVTR 136
            I  V E  VL H    LD  G D+TR
Sbjct: 509 RIACVDEGTVLEHSAITLDYGGDDITR 535

>Ecym_2311 Chr2 (604942..607269) [2328 bp, 775 aa] {ON} similar to
           Ashbya gossypii AFR135W
          Length = 775

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 35/150 (23%), Positives = 58/150 (38%), Gaps = 15/150 (10%)

Query: 15  ISYPMENGVIK----NWSDM-ELLWDYAFYDQMQLPST---------SGGKVMLTEPPMN 60
           + YP  NG       N++ + ELL D        L  T         S   V+L  P + 
Sbjct: 286 LRYPFANGSFNVKSPNYNSLQELLNDVVNLITFALSETKLNISKSQFSSYNVVLIIPDLF 345

Query: 61  PVKNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXX-XXXTHIVPVYESVV 119
                EQM  ++  + DF  V +  +++ + Y  GL             T I  V E  V
Sbjct: 346 EKSYVEQMIRLLISEMDFQAVALIQESLASCYGAGLSNSTCVIDIGGSETKISCVDEGQV 405

Query: 120 LNHLTRRLDVAGRDVTRHLIDLLSRRGYAF 149
           + +   +L   G D+T+   +LL +  + +
Sbjct: 406 IQNSCIKLSYGGDDITKLFAELLLQSNFPY 435

>Ecym_6381 Chr6 complement(746240..746623) [384 bp, 127 aa] {ON}
           similar to Ashbya gossypii AFR055W
          Length = 127

 Score = 30.8 bits (68), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 35/68 (51%), Gaps = 6/68 (8%)

Query: 229 NTIQSADVDVRSALYRAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLHNDPSRL--DKFK 286
           N I S D+DVRS+L R +V+ GG   Y  + + ++K +      R L  D   L  D+  
Sbjct: 10  NLIGSFDIDVRSSL-RLVVIVGG---YILIRNHVQKIIANRELKRKLKEDEDSLSTDRMN 65

Query: 287 VRIEDPPR 294
             +EDP +
Sbjct: 66  SLVEDPDK 73

>NCAS0A14720 Chr1 (2903450..2904907) [1458 bp, 485 aa] {ON}
           Anc_7.448 YPR034W
          Length = 485

 Score = 31.6 bits (70), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 21/129 (16%), Positives = 55/129 (42%), Gaps = 4/129 (3%)

Query: 21  NGVIKNWSDMELLWDYAFYDQMQLPSTSGGKVMLTEPPMNPVKNR---EQMCEVMFEKYD 77
           NG+  NW  ++  W+Y + + ++  S     +++T P  N   +    ++  E+ FE ++
Sbjct: 78  NGLPYNWDALKEQWEYIYREVLKCNSDE-YPLVITIPSANKDVDEIILKKYFELAFETFN 136

Query: 78  FGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRRLDVAGRDVTRH 137
              + + I+ +    + G              ++ P+ +  V+ H   +    G  +   
Sbjct: 137 VPVLQIIIEPLAVALSLGKSSSLVVNLGASGCNVTPIVDGTVIKHAVMKSKYGGDFLDFQ 196

Query: 138 LIDLLSRRG 146
           ++++L  +G
Sbjct: 197 IVNILQEKG 205

 Score = 30.0 bits (66), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 22/90 (24%), Positives = 42/90 (46%), Gaps = 15/90 (16%)

Query: 238 VRSALYRAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLHNDPSRLDKFKVRI---EDPPR 294
           V S L   +V++G  S+  G+  R+ KEL              R  ++K+     ++   
Sbjct: 402 VYSKLLSNVVITGSCSLIDGMEQRILKELS------------IRFPQYKLTTYANQNVMD 449

Query: 295 RKHMVFIGGAVLANIMADKDHMWLSKQEWQ 324
           RK   ++G   ++N+ + +   W SKQE++
Sbjct: 450 RKFQGWLGAMTMSNLPSWELGKWYSKQEYE 479

>KLTH0B07502g Chr2 (604448..604460,604791..607777) [3000 bp, 999 aa]
           {ON} weakly similar to uniprot|Q07653 Saccharomyces
           cerevisiae YDL223C HBT1
          Length = 999

 Score = 31.2 bits (69), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 28/106 (26%), Positives = 42/106 (39%), Gaps = 3/106 (2%)

Query: 131 GRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLDLDTKLARETTTLVENYE 190
           G    +HL DL  R+      S         K + S  S+   ++T+  R TTT     +
Sbjct: 807 GESANKHLGDLEGRKTKENRSSGSHHDDVDPKTRSSETSH-PQMETRYERHTTTSP--SQ 863

Query: 191 LPDGRVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTIQSADV 236
            P   + +   E   A E +  PSLVD  QP  G    N   +++ 
Sbjct: 864 SPQEGIQRYEEENVYAKEVVNMPSLVDPSQPTYGSGDRNRTSTSET 909

>CAGL0F05907g Chr6 (591411..592799) [1389 bp, 462 aa] {ON} similar
           to uniprot|Q05123 Saccharomyces cerevisiae YMR033w ARP9
           Actin-related protein
          Length = 462

 Score = 30.8 bits (68), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 45/190 (23%), Positives = 76/190 (40%), Gaps = 40/190 (21%)

Query: 109 THIVPVYESVVLNHLTRRLDVAG----RDVTRHLIDLLSRRGYAFNRSADFETV----RQ 160
           T I+PV +   + HLT  +++ G     ++ + L  L   +     RS  FE +    R+
Sbjct: 172 TDIIPVVDYTPMEHLTSTINLGGDSINTELAKKLPQLTETQIETLKRSTIFEVLSADARE 231

Query: 161 I-----KEKLSYVSYDLDLDTKLARETTTLVE------------NYEL-------PDGRV 196
           I      E++   + D+       R+T  ++E            N EL        DG+ 
Sbjct: 232 ILDTNDGEEMDEGALDVAAIVTSGRDTREVLEERERKKKQRNVKNAELDTNSFYDDDGQE 291

Query: 197 IKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTIQSADVDVRSALYRAIVLSGGSSMYP 256
           I VG +RFE  E      L++     VG +L +    A       ++  I++ GG+S   
Sbjct: 292 ITVGKQRFEGTE-----KLIESISHRVGNVLAHIHDKAKA---RHIWENIIVVGGTSSIV 343

Query: 257 GLPSRLEKEL 266
           G    L  +L
Sbjct: 344 GFREALIAQL 353

>KAFR0E02530 Chr5 (516623..519151) [2529 bp, 842 aa] {ON} Anc_5.477
           YOR141C
          Length = 842

 Score = 30.4 bits (67), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 21/100 (21%), Positives = 40/100 (40%), Gaps = 1/100 (1%)

Query: 51  KVMLTEPPMNPVKNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXX-XXXT 109
           K +L  P +    + E+M  ++  +  F  V +  +++   Y  G+             T
Sbjct: 382 KAILVIPDLFEKSHVEEMIRLLLTELPFNAVAIIQESLATCYGAGISTSTCVVNVGASET 441

Query: 110 HIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAF 149
            +  + E VVL +    L+  G D+TR    LL    + +
Sbjct: 442 SVSCIDEGVVLENSLINLNYGGDDITRLFSVLLKMNNFPY 481

>NDAI0A01300 Chr1 complement(280662..282359) [1698 bp, 565 aa] {ON}
           Anc_7.448 YPR034W
          Length = 565

 Score = 30.4 bits (67), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 23/129 (17%), Positives = 53/129 (41%), Gaps = 4/129 (3%)

Query: 20  ENGVIKNWSDMELLWDYAFYDQMQLPSTSGGKVMLTEPPMNPVKNR---EQMCEVMFEKY 76
           +NG+  NW  +E  W+Y F D ++  S     +++T P M    +    E+   ++FE++
Sbjct: 77  KNGIPYNWEALEQQWNYLFNDVLRC-SPEEYPLVITIPSMKKEIDGEVLEKYFSLVFERF 135

Query: 77  DFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLNHLTRRLDVAGRDVTR 136
            F    + ++ +    + G               + P+ +  V+ +        G  +  
Sbjct: 136 KFPVFQIILEPLAITLSLGKSSGLVIDMGSSGCRVTPIIDGTVIKNAVLSSKYGGAFLDY 195

Query: 137 HLIDLLSRR 145
            +I+ L ++
Sbjct: 196 QIIETLQKK 204

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.136    0.402 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 33,690,741
Number of extensions: 1339667
Number of successful extensions: 3565
Number of sequences better than 10.0: 167
Number of HSP's gapped: 3316
Number of HSP's successfully gapped: 229
Length of query: 337
Length of database: 53,481,399
Length adjustment: 110
Effective length of query: 227
Effective length of database: 40,868,139
Effective search space: 9277067553
Effective search space used: 9277067553
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 66 (30.0 bits)