Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_33.141673.162ON83883844060.0
KLTH0F06468g3.162ON83784329540.0
SAKL0C07348g3.162ON86186121450.0
ADR317C3.162ON81985619660.0
TDEL0D046003.162ON79584018840.0
ZYRO0B04906g3.162ON84785417790.0
NCAS0I020803.162ON77483517080.0
KLLA0C03828g3.162ON79384416840.0
Kpol_1032.103.162ON79182516150.0
Ecym_52363.162ON86450315980.0
Suva_4.2213.162ON76583215500.0
Skud_4.2233.162ON76983115410.0
Smik_4.2073.162ON76584315290.0
YDL028C (MPS1)3.162ON76483015100.0
KAFR0F022203.162ON74780815030.0
NDAI0A066203.162ON74785914890.0
TPHA0M003003.162ON77459114560.0
CAGL0K01617g3.162ON77483313721e-178
KNAG0K017403.162ON76583412801e-164
TBLA0F008603.162ON98045512421e-156
NCAS0C035603.162ON6413298431e-101
Skud_4.7643.92ON7562452673e-23
YDR490C (PKH1)3.92ON7662402674e-23
KNAG0B043205.406ON10273152641e-22
CAGL0L11550g5.406ON10722932622e-22
CAGL0K05709g1.52ON11032822613e-22
Suva_2.6663.92ON7642402593e-22
Smik_4.7673.92ON7582402593e-22
NCAS0H019405.406ON10153092586e-22
Kpol_1031.105.406ON11272782587e-22
Kwal_55.215455.406ON8653412568e-22
NDAI0C017005.406ON10202932542e-21
Skud_8.1635.406ON10763082532e-21
YOL100W (PKH2)3.92ON10812372514e-21
TDEL0E021805.406ON9873272504e-21
NDAI0E021108.676ON9032972505e-21
KNAG0F002901.52ON11252812506e-21
KAFR0D049505.406ON10083182489e-21
KLLA0F24618g3.229ON5562932451e-20
CAGL0K02673g2.496ON9152232461e-20
TPHA0G032002.479ON15342362472e-20
KLTH0F16676g5.406ON8783172452e-20
TPHA0H016305.406ON10362792442e-20
YDR507C (GIN4)1.52ON11423032443e-20
Smik_4.7891.52ON11363032443e-20
Smik_8.1805.406ON10732792433e-20
TBLA0A071501.52ON13912382434e-20
TBLA0B016303.177ON12952952425e-20
Skud_4.7831.52ON11353022425e-20
KAFR0A017602.496ON8852822416e-20
Kpol_1040.207.86ON12972462416e-20
NCAS0C049403.92ON11162332407e-20
SAKL0G01848g5.406ON8853032398e-20
Suva_15.2975.406ON10742792391e-19
Sklu_YGOB_Anc_2.4962.496ON6192292371e-19
Suva_2.6871.52ON11282292391e-19
Kwal_26.78612.496ON9552312391e-19
NDAI0A038702.496ON8952872381e-19
TPHA0H026307.86ON13672372391e-19
KLTH0D06006g2.496ON9542312381e-19
KNAG0B053502.496ON8362442372e-19
AER264C6.341ON14832492382e-19
KLLA0D11990g8.482ON3043082262e-19
YHR102W (KIC1)5.406ON10802802372e-19
KAFR0E010403.229ON5022372332e-19
CAGL0K08514g2.479ON14892442372e-19
KLLA0F14190g1.271ON13382952372e-19
KNAG0K006803.92ON10952452362e-19
ABL034W2.479ON14252302372e-19
KLTH0D03454g1.271ON14333042363e-19
KLTH0E11220g8.482ON3023092253e-19
ACL104C5.406ON9472792353e-19
NCAS0A050502.496ON8932312343e-19
TBLA0I002802.496ON13162962353e-19
SAKL0B04488g4.184ON3682702274e-19
KAFR0H015308.482ON3062382244e-19
KAFR0D041001.52ON11172812354e-19
KLLA0F11143g8.676ON8131992334e-19
SAKL0H11638g8.482ON3043072235e-19
Kpol_2002.461.52ON11232362336e-19
CAGL0I07513g3.92ON10762392336e-19
Skud_16.2518.482ON3052372226e-19
NDAI0K021002.496ON9092312327e-19
TPHA0C017808.482ON3053042227e-19
NCAS0C024708.482ON3112362228e-19
NDAI0F045201.24ON4893022288e-19
TDEL0B015408.482ON3042362211e-18
CAGL0L12474g8.482ON3022402201e-18
NDAI0A006601.52ON10222312301e-18
TPHA0I009201.271ON14343012311e-18
Kwal_23.63256.341ON15422392311e-18
Suva_16.2868.482ON3052372201e-18
Ecym_10581.52ON11642362301e-18
Ecym_35863.92ON10772582291e-18
KAFR0K007007.86ON13812462302e-18
YPL031C (PHO85)8.482ON3052372192e-18
KNAG0J012903.229ON5082492262e-18
Ecym_25318.482ON3013092192e-18
Kwal_26.77882.479ON12672302292e-18
TDEL0C064901.52ON11533032292e-18
TBLA0I011502.479ON17452362302e-18
TDEL0A025502.479ON13692302283e-18
Ecym_55055.406ON10032792273e-18
SAKL0C09174g3.92ON10712402273e-18
Ecym_73922.479ON14342302273e-18
KLLA0E21693g5.406ON10162792263e-18
TPHA0E036401.52ON11372302273e-18
TDEL0A062208.676ON7942482254e-18
KLLA0C01650g1.52ON11122292264e-18
Kwal_26.73551.271ON14463042264e-18
ZYRO0A03894g3.229ON4522262215e-18
NCAS0B086001.52ON11172312255e-18
Skud_8.392.496ON9232442255e-18
Ecym_24996.341ON15412642265e-18
TBLA0C029401.271ON16432882265e-18
Smik_15.573.92ON10812482255e-18
Skud_2.1413.229ON5262402216e-18
Skud_3.391.52ON10172362247e-18
Smik_2.1463.229ON5262402217e-18
KLLA0C04191g3.177ON7972852237e-18
SAKL0C01716g1.52ON12152312247e-18
Smik_8.422.496ON9392442237e-18
AGL242C8.482ON3033032148e-18
TPHA0A041703.229ON5132332208e-18
Kpol_1072.168.676ON7952472228e-18
TBLA0A035705.406ON9752952238e-18
KLTH0A06776g6.341ON15232392249e-18
SAKL0H06534g8.676ON8042422229e-18
TBLA0B023103.92ON8192322229e-18
KLTH0D11242g8.676ON7952502229e-18
NDAI0G042903.92ON11132342239e-18
Kpol_1055.242.496ON9372232229e-18
KNAG0A023108.482ON3023042139e-18
Kpol_541.498.141ON9942802221e-17
KLTH0C10912g6.31ON6972282211e-17
NCAS0A080805.611ON6232952211e-17
Kpol_499.34.184ON3742702161e-17
NDAI0G054701.271ON15552882231e-17
KLLA0B13607g2.496ON9892332221e-17
Kpol_1007.178.482ON3073052131e-17
TDEL0A027202.496ON9152372221e-17
YHL007C (STE20)2.496ON9392182211e-17
Suva_8.472.496ON9801662211e-17
Kwal_56.226933.92ON9842352211e-17
Kwal_56.224766.31ON6972332201e-17
ZYRO0F08074g8.482ON3043042121e-17
ZYRO0B06512g3.92ON11112502212e-17
CAGL0K02167g8.140ON11622782212e-17
SAKL0E02860g2.479ON13772302212e-17
TDEL0A075606.341ON15752532212e-17
TBLA0I018003.229ON6292462192e-17
NCAS0A102903.229ON5092442172e-17
AFR696C1.52ON11422312212e-17
AFR335C3.92ON10332282202e-17
Ecym_10301.24ON4402982162e-17
TBLA0B082503.92ON13472292212e-17
Suva_1.507.86ON13602452212e-17
Kpol_463.81.271ON14473052202e-17
YBR028C (YPK3)3.229ON5252402172e-17
Kpol_1018.655.611ON6013242182e-17
TPHA0C004705.611ON6313222182e-17
KLTH0F01672g1.52ON11642232193e-17
Skud_11.1262.479ON15182372203e-17
KAFR0H024308.676ON7842462183e-17
TDEL0D053203.92ON10572382193e-17
YPL153C (RAD53)8.676ON8212422183e-17
NCAS0A053706.341ON15082482193e-17
Skud_15.543.92ON10822382193e-17
Ecym_35473.229ON5372372163e-17
KLLA0F13552g2.479ON12672302193e-17
Kpol_431.92.479ON15522302193e-17
KLTH0C09548g3.92ON9932332183e-17
NDAI0I003406.341ON18362642193e-17
ZYRO0F17402g1.52ON11892292184e-17
NCAS0F015807.86ON13822462184e-17
Kwal_56.227883.229ON5152392154e-17
ZYRO0G03366g2.479ON16162462184e-17
AFR724C1.24ON4402982134e-17
KAFR0C014403.92ON10952682184e-17
Skud_16.1298.676ON8272422174e-17
TPHA0G032902.496ON9732192174e-17
CAGL0M08910g5.611ON6123212164e-17
KAFR0D033902.496ON7982192174e-17
KLLA0C12485g3.92ON9252362174e-17
Kpol_1037.523.229ON5122422145e-17
NCAS0A123502.496ON7462972165e-17
Kwal_26.87968.676ON7962402165e-17
Kwal_26.71547.86ON12133272175e-17
ZYRO0B01166g2.496ON9632342166e-17
KNAG0D003906.341ON16562432176e-17
NDAI0D040504.184ON3663322096e-17
CAGL0K06479g5.591ON9912512166e-17
Suva_16.1578.676ON8322422157e-17
TBLA0A020506.222ON4343622117e-17
CAGL0G04609g3.92ON9652292157e-17
Suva_2.1573.229ON5262392137e-17
KAFR0C030108.141ON7902812157e-17
NDAI0G034508.141ON9482202157e-17
Smik_6.3508.676ON8222422157e-17
KNAG0D039804.184ON3731942098e-17
YJL095W (BCK1)1.271ON14782882158e-17
KNAG0B017801.271ON15802882158e-17
Skud_15.1127.86ON11012502158e-17
KLTH0C08932g3.229ON5192452129e-17
SAKL0E01584g6.31ON6952412139e-17
KLTH0D05566g2.479ON11282302149e-17
Kpol_2002.241.24ON4872812119e-17
Smik_3.541.52ON10322292141e-16
AEL083W3.229ON5362332121e-16
KNAG0J017008.676ON8202322131e-16
SAKL0A01254g6.341ON15582552141e-16
TPHA0D028405.611ON6342832121e-16
Suva_3.1901.52ON10242842141e-16
CAGL0L03520g1.271ON14472872141e-16
TBLA0I024006.341ON17302742141e-16
SAKL0C00946g1.24ON5642822121e-16
TBLA0D022308.141ON11542862141e-16
YAL017W (PSK1)7.86ON13562462141e-16
Smik_1.507.86ON13572462141e-16
ZYRO0A06446g5.406ON9432802131e-16
NDAI0E031708.482ON3232262051e-16
CAGL0B04301g3.229ON5422362111e-16
TBLA0E033605.611ON6542832121e-16
NDAI0A071903.229ON5352482101e-16
Smik_4.7545.611ON6322832111e-16
Suva_15.1247.86ON11062502122e-16
YDR477W (SNF1)5.611ON6332832112e-16
Smik_10.1471.271ON14782982122e-16
Skud_10.1191.271ON14812882122e-16
NCAS0C041008.141ON9052272112e-16
Suva_2.6515.611ON6332832102e-16
NCAS0A057702.479ON14612372122e-16
Ecym_24342.496ON11222352122e-16
KLLA0A03806g5.611ON6022842102e-16
Kpol_1054.23.92ON10963032112e-16
TBLA0B038408.676ON8582422102e-16
Suva_11.655.274ON5042552083e-16
TBLA0A084304.184ON3633252043e-16
Suva_15.653.92ON10802382113e-16
KNAG0K012403.177ON9802822103e-16
Ecym_61454.184ON3652702043e-16
TDEL0D026504.184ON3662522043e-16
SAKL0C08844g3.229ON5312372083e-16
Skud_1.447.86ON13562462103e-16
Skud_4.7515.611ON6342832083e-16
SAKL0C07722g3.177ON9122822093e-16
ACR142W8.676ON8372452093e-16
ZYRO0A12826g4.184ON3661942033e-16
NCAS0A002801.24ON5352862074e-16
TBLA0D056401.225ON8162832094e-16
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_33.14167
         (838 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_33.14167 s33 (554863..557379) [2517 bp, 838 aa] {ON} YDL028...  1701   0.0  
KLTH0F06468g Chr6 (559256..561769) [2514 bp, 837 aa] {ON} simila...  1142   0.0  
SAKL0C07348g Chr3 (677348..679933) [2586 bp, 861 aa] {ON} some s...   830   0.0  
ADR317C Chr4 complement(1263080..1265539) [2460 bp, 819 aa] {ON}...   761   0.0  
TDEL0D04600 Chr4 (843530..845917) [2388 bp, 795 aa] {ON} Anc_3.1...   730   0.0  
ZYRO0B04906g Chr2 (395546..398089) [2544 bp, 847 aa] {ON} simila...   689   0.0  
NCAS0I02080 Chr9 (390551..392875) [2325 bp, 774 aa] {ON} Anc_3.162    662   0.0  
KLLA0C03828g Chr3 (349187..351568) [2382 bp, 793 aa] {ON} simila...   653   0.0  
Kpol_1032.10 s1032 (24479..26854) [2376 bp, 791 aa] {ON} (24479....   626   0.0  
Ecym_5236 Chr5 (486270..488864) [2595 bp, 864 aa] {ON} similar t...   620   0.0  
Suva_4.221 Chr4 complement(391492..393789) [2298 bp, 765 aa] {ON...   601   0.0  
Skud_4.223 Chr4 complement(395836..398145) [2310 bp, 769 aa] {ON...   598   0.0  
Smik_4.207 Chr4 complement(381159..383456) [2298 bp, 765 aa] {ON...   593   0.0  
YDL028C Chr4 complement(400997..403291) [2295 bp, 764 aa] {ON}  ...   586   0.0  
KAFR0F02220 Chr6 (432967..435210) [2244 bp, 747 aa] {ON} Anc_3.1...   583   0.0  
NDAI0A06620 Chr1 complement(1510218..1512461) [2244 bp, 747 aa] ...   578   0.0  
TPHA0M00300 Chr13 (59377..61701) [2325 bp, 774 aa] {ON} Anc_3.16...   565   0.0  
CAGL0K01617g Chr11 complement(143308..145632) [2325 bp, 774 aa] ...   533   e-178
KNAG0K01740 Chr11 (364195..366492) [2298 bp, 765 aa] {ON} Anc_3....   497   e-164
TBLA0F00860 Chr6 (219628..222570) [2943 bp, 980 aa] {ON} Anc_3.1...   483   e-156
NCAS0C03560 Chr3 complement(710551..712476) [1926 bp, 641 aa] {O...   329   e-101
Skud_4.764 Chr4 complement(1351725..1353995) [2271 bp, 756 aa] {...   107   3e-23
YDR490C Chr4 complement(1431968..1434268) [2301 bp, 766 aa] {ON}...   107   4e-23
KNAG0B04320 Chr2 complement(821265..824348) [3084 bp, 1027 aa] {...   106   1e-22
CAGL0L11550g Chr12 (1232015..1235233) [3219 bp, 1072 aa] {ON} si...   105   2e-22
CAGL0K05709g Chr11 complement(556732..560043) [3312 bp, 1103 aa]...   105   3e-22
Suva_2.666 Chr2 complement(1183839..1186133) [2295 bp, 764 aa] {...   104   3e-22
Smik_4.767 Chr4 complement(1353354..1355630) [2277 bp, 758 aa] {...   104   3e-22
NCAS0H01940 Chr8 (374913..377960) [3048 bp, 1015 aa] {ON} Anc_5....   103   6e-22
Kpol_1031.10 s1031 (25064..28447) [3384 bp, 1127 aa] {ON} (25064...   103   7e-22
Kwal_55.21545 s55 complement(882294..884891) [2598 bp, 865 aa] {...   103   8e-22
NDAI0C01700 Chr3 complement(367077..370139) [3063 bp, 1020 aa] {...   102   2e-21
Skud_8.163 Chr8 (290415..293645) [3231 bp, 1076 aa] {ON} YHR102W...   102   2e-21
YOL100W Chr15 (129237..132482) [3246 bp, 1081 aa] {ON}  PKH2Seri...   101   4e-21
TDEL0E02180 Chr5 complement(408232..411195) [2964 bp, 987 aa] {O...   100   4e-21
NDAI0E02110 Chr5 complement(430989..433700) [2712 bp, 903 aa] {O...   100   5e-21
KNAG0F00290 Chr6 (31750..35127) [3378 bp, 1125 aa] {ON} Anc_1.52...   100   6e-21
KAFR0D04950 Chr4 (971956..974982) [3027 bp, 1008 aa] {ON} Anc_5....   100   9e-21
KLLA0F24618g Chr6 complement(2288943..2290613) [1671 bp, 556 aa]...    99   1e-20
CAGL0K02673g Chr11 complement(241338..244085) [2748 bp, 915 aa] ...    99   1e-20
TPHA0G03200 Chr7 (683296..687900) [4605 bp, 1534 aa] {ON} Anc_2....   100   2e-20
KLTH0F16676g Chr6 complement(1351362..1353998) [2637 bp, 878 aa]...    99   2e-20
TPHA0H01630 Chr8 (371333..374443) [3111 bp, 1036 aa] {ON} Anc_5....    99   2e-20
YDR507C Chr4 complement(1462358..1465786) [3429 bp, 1142 aa] {ON...    99   3e-20
Smik_4.789 Chr4 complement(1385209..1388619) [3411 bp, 1136 aa] ...    99   3e-20
Smik_8.180 Chr8 (292993..296214) [3222 bp, 1073 aa] {ON} YHR102W...    98   3e-20
TBLA0A07150 Chr1 (1776160..1780335) [4176 bp, 1391 aa] {ON} Anc_...    98   4e-20
TBLA0B01630 Chr2 (360963..364850) [3888 bp, 1295 aa] {ON} Anc_3....    98   5e-20
Skud_4.783 Chr4 complement(1382552..1385959) [3408 bp, 1135 aa] ...    98   5e-20
KAFR0A01760 Chr1 complement(363462..366119) [2658 bp, 885 aa] {O...    97   6e-20
Kpol_1040.20 s1040 (57057..60950) [3894 bp, 1297 aa] {ON} (57057...    97   6e-20
NCAS0C04940 Chr3 (1006185..1009535) [3351 bp, 1116 aa] {ON} Anc_...    97   7e-20
SAKL0G01848g Chr7 (154547..157204) [2658 bp, 885 aa] {ON} weakly...    97   8e-20
Suva_15.297 Chr15 (518854..520850,520945..522172) [3225 bp, 1074...    97   1e-19
Sklu_YGOB_Anc_2.496 Chr5 (185447..187306) [1860 bp, 619 aa] {ON}...    96   1e-19
Suva_2.687 Chr2 complement(1215095..1218481) [3387 bp, 1128 aa] ...    97   1e-19
Kwal_26.7861 s26 complement(544126..546993) [2868 bp, 955 aa] {O...    97   1e-19
NDAI0A03870 Chr1 (867910..870597) [2688 bp, 895 aa] {ON} Anc_2.496     96   1e-19
TPHA0H02630 Chr8 complement(614048..618151) [4104 bp, 1367 aa] {...    97   1e-19
KLTH0D06006g Chr4 complement(532589..535453) [2865 bp, 954 aa] {...    96   1e-19
KNAG0B05350 Chr2 complement(1034166..1036676) [2511 bp, 836 aa] ...    96   2e-19
AER264C Chr5 complement(1120017..1124468) [4452 bp, 1483 aa] {ON...    96   2e-19
KLLA0D11990g Chr4 complement(1022895..1023792,1023928..1023944) ...    92   2e-19
YHR102W Chr8 (316572..319814) [3243 bp, 1080 aa] {ON}  KIC1Prote...    96   2e-19
KAFR0E01040 Chr5 complement(214744..216252) [1509 bp, 502 aa] {O...    94   2e-19
CAGL0K08514g Chr11 complement(854143..858612) [4470 bp, 1489 aa]...    96   2e-19
KLLA0F14190g Chr6 (1311121..1315137) [4017 bp, 1338 aa] {ON} uni...    96   2e-19
KNAG0K00680 Chr11 (120919..124206) [3288 bp, 1095 aa] {ON} Anc_3...    96   2e-19
ABL034W Chr2 (333432..337709) [4278 bp, 1425 aa] {ON} Syntenic h...    96   2e-19
KLTH0D03454g Chr4 (327039..331340) [4302 bp, 1433 aa] {ON} simil...    96   3e-19
KLTH0E11220g Chr5 (1005953..1005969,1006040..1006931) [909 bp, 3...    91   3e-19
ACL104C Chr3 complement(157357..160200) [2844 bp, 947 aa] {ON} S...    95   3e-19
NCAS0A05050 Chr1 complement(1002107..1004788) [2682 bp, 893 aa] ...    95   3e-19
TBLA0I00280 Chr9 (42870..46820) [3951 bp, 1316 aa] {ON} Anc_2.49...    95   3e-19
SAKL0B04488g Chr2 (395136..396242) [1107 bp, 368 aa] {ON} highly...    92   4e-19
KAFR0H01530 Chr8 complement(283589..284509) [921 bp, 306 aa] {ON...    91   4e-19
KAFR0D04100 Chr4 complement(809681..813034) [3354 bp, 1117 aa] {...    95   4e-19
KLLA0F11143g Chr6 complement(1026129..1028570) [2442 bp, 813 aa]...    94   4e-19
SAKL0H11638g Chr8 complement(994049..994946,995016..995032) [915...    91   5e-19
Kpol_2002.46 s2002 (95107..98478) [3372 bp, 1123 aa] {ON} (95107...    94   6e-19
CAGL0I07513g Chr9 (722045..725275) [3231 bp, 1076 aa] {ON} simil...    94   6e-19
Skud_16.251 Chr16 complement(457106..458006,458108..458124) [918...    90   6e-19
NDAI0K02100 Chr11 complement(469575..472304) [2730 bp, 909 aa] {...    94   7e-19
TPHA0C01780 Chr3 complement(407048..407965) [918 bp, 305 aa] {ON...    90   7e-19
NCAS0C02470 Chr3 complement(460460..461378,461483..461499) [936 ...    90   8e-19
NDAI0F04520 Chr6 complement(1098426..1099895) [1470 bp, 489 aa] ...    92   8e-19
TDEL0B01540 Chr2 complement(272561..273458,273562..273578) [915 ...    90   1e-18
CAGL0L12474g Chr12 complement(1347340..1348248) [909 bp, 302 aa]...    89   1e-18
NDAI0A00660 Chr1 (121773..124841) [3069 bp, 1022 aa] {ON} Anc_1.52     93   1e-18
TPHA0I00920 Chr9 (204753..209057) [4305 bp, 1434 aa] {ON} Anc_1....    94   1e-18
Kwal_23.6325 s23 complement(1533223..1537851) [4629 bp, 1542 aa]...    94   1e-18
Suva_16.286 Chr16 complement(495354..496254,496351..496367) [918...    89   1e-18
Ecym_1058 Chr1 (105835..109329) [3495 bp, 1164 aa] {ON} similar ...    93   1e-18
Ecym_3586 Chr3 complement(1112070..1115303) [3234 bp, 1077 aa] {...    93   1e-18
KAFR0K00700 Chr11 complement(153981..158126) [4146 bp, 1381 aa] ...    93   2e-18
YPL031C Chr16 complement(492018..492918,493021..493037) [918 bp,...    89   2e-18
KNAG0J01290 Chr10 complement(230493..232019) [1527 bp, 508 aa] {...    92   2e-18
Ecym_2531 Chr2 (1034031..1034047,1034135..1035023) [906 bp, 301 ...    89   2e-18
Kwal_26.7788 s26 (511530..515333) [3804 bp, 1267 aa] {ON} YKL101...    93   2e-18
TDEL0C06490 Chr3 complement(1191461..1194922) [3462 bp, 1153 aa]...    93   2e-18
TBLA0I01150 Chr9 complement(235187..240424) [5238 bp, 1745 aa] {...    93   2e-18
TDEL0A02550 Chr1 (457841..461950) [4110 bp, 1369 aa] {ON} Anc_2....    92   3e-18
Ecym_5505 Chr5 (1027605..1030616) [3012 bp, 1003 aa] {ON} simila...    92   3e-18
SAKL0C09174g Chr3 complement(833618..836833) [3216 bp, 1071 aa] ...    92   3e-18
Ecym_7392 Chr7 complement(803240..807544) [4305 bp, 1434 aa] {ON...    92   3e-18
KLLA0E21693g Chr5 complement(1936438..1939488) [3051 bp, 1016 aa...    92   3e-18
TPHA0E03640 Chr5 complement(769962..773375) [3414 bp, 1137 aa] {...    92   3e-18
TDEL0A06220 Chr1 (1088622..1091006) [2385 bp, 794 aa] {ON} Anc_8...    91   4e-18
KLLA0C01650g Chr3 (128119..131457) [3339 bp, 1112 aa] {ON} simil...    92   4e-18
Kwal_26.7355 s26 (326867..331207) [4341 bp, 1446 aa] {ON} YJL095...    92   4e-18
ZYRO0A03894g Chr1 (307915..309273) [1359 bp, 452 aa] {ON} simila...    90   5e-18
NCAS0B08600 Chr2 (1649375..1652728) [3354 bp, 1117 aa] {ON} Anc_...    91   5e-18
Skud_8.39 Chr8 complement(76730..79501) [2772 bp, 923 aa] {ON} Y...    91   5e-18
Ecym_2499 Chr2 complement(976395..981020) [4626 bp, 1541 aa] {ON...    92   5e-18
TBLA0C02940 Chr3 complement(706091..711022) [4932 bp, 1643 aa] {...    92   5e-18
Smik_15.57 Chr15 (92331..95576) [3246 bp, 1081 aa] {ON} YOL100W ...    91   5e-18
Skud_2.141 Chr2 complement(264097..265677) [1581 bp, 526 aa] {ON...    90   6e-18
Skud_3.39 Chr3 (66201..69254) [3054 bp, 1017 aa] {ON} YCL024W (R...    91   7e-18
Smik_2.146 Chr2 complement(275270..276850) [1581 bp, 526 aa] {ON...    90   7e-18
KLLA0C04191g Chr3 (384198..386591) [2394 bp, 797 aa] {ON} weakly...    91   7e-18
SAKL0C01716g Chr3 (143880..147527) [3648 bp, 1215 aa] {ON} simil...    91   7e-18
Smik_8.42 Chr8 complement(74075..76894) [2820 bp, 939 aa] {ON} Y...    91   7e-18
AGL242C Chr7 complement(246896..247790,247838..247854) [912 bp, ...    87   8e-18
TPHA0A04170 Chr1 (937692..939233) [1542 bp, 513 aa] {ON} Anc_3.2...    89   8e-18
Kpol_1072.16 s1072 complement(37585..39972) [2388 bp, 795 aa] {O...    90   8e-18
TBLA0A03570 Chr1 (892930..895857) [2928 bp, 975 aa] {ON} Anc_5.4...    91   8e-18
KLTH0A06776g Chr1 complement(562932..567503) [4572 bp, 1523 aa] ...    91   9e-18
SAKL0H06534g Chr8 complement(575439..577853) [2415 bp, 804 aa] {...    90   9e-18
TBLA0B02310 Chr2 (539362..541821) [2460 bp, 819 aa] {ON} Anc_3.9...    90   9e-18
KLTH0D11242g Chr4 (918232..920619) [2388 bp, 795 aa] {ON} simila...    90   9e-18
NDAI0G04290 Chr7 complement(1030530..1033871) [3342 bp, 1113 aa]...    91   9e-18
Kpol_1055.24 s1055 complement(57430..60243) [2814 bp, 937 aa] {O...    90   9e-18
KNAG0A02310 Chr1 complement(216545..217453) [909 bp, 302 aa] {ON...    87   9e-18
Kpol_541.49 s541 complement(156530..159514) [2985 bp, 994 aa] {O...    90   1e-17
KLTH0C10912g Chr3 (898372..900465) [2094 bp, 697 aa] {ON} highly...    90   1e-17
NCAS0A08080 Chr1 complement(1594221..1596092) [1872 bp, 623 aa] ...    90   1e-17
Kpol_499.3 s499 complement(6075..7199) [1125 bp, 374 aa] {ON} co...    88   1e-17
NDAI0G05470 Chr7 (1340175..1344842) [4668 bp, 1555 aa] {ON} Anc_...    91   1e-17
KLLA0B13607g Chr2 (1191592..1194561) [2970 bp, 989 aa] {ON} simi...    90   1e-17
Kpol_1007.17 s1007 (32671..32687,32861..33767) [924 bp, 307 aa] ...    87   1e-17
TDEL0A02720 Chr1 complement(491618..494365) [2748 bp, 915 aa] {O...    90   1e-17
YHL007C Chr8 complement(95118..97937) [2820 bp, 939 aa] {ON}  ST...    90   1e-17
Suva_8.47 Chr8 complement(91615..94557) [2943 bp, 980 aa] {ON} Y...    90   1e-17
Kwal_56.22693 s56 complement(239982..242936) [2955 bp, 984 aa] {...    90   1e-17
Kwal_56.22476 s56 complement(145039..147132) [2094 bp, 697 aa] {...    89   1e-17
ZYRO0F08074g Chr6 (654009..654025,654107..655004) [915 bp, 304 a...    86   1e-17
ZYRO0B06512g Chr2 complement(521075..524410) [3336 bp, 1111 aa] ...    90   2e-17
CAGL0K02167g Chr11 complement(192297..195785) [3489 bp, 1162 aa]...    90   2e-17
SAKL0E02860g Chr5 complement(228726..232859) [4134 bp, 1377 aa] ...    90   2e-17
TDEL0A07560 Chr1 complement(1316498..1321225) [4728 bp, 1575 aa]...    90   2e-17
TBLA0I01800 Chr9 complement(401728..403617) [1890 bp, 629 aa] {O...    89   2e-17
NCAS0A10290 Chr1 complement(2051582..2053111) [1530 bp, 509 aa] ...    88   2e-17
AFR696C Chr6 complement(1722130..1725558) [3429 bp, 1142 aa] {ON...    90   2e-17
AFR335C Chr6 complement(1046756..1049857) [3102 bp, 1033 aa] {ON...    89   2e-17
Ecym_1030 Chr1 (56043..57365) [1323 bp, 440 aa] {ON} similar to ...    88   2e-17
TBLA0B08250 Chr2 complement(1968879..1972922) [4044 bp, 1347 aa]...    90   2e-17
Suva_1.50 Chr1 (96474..100556) [4083 bp, 1360 aa] {ON} YAL017W (...    90   2e-17
Kpol_463.8 s463 complement(18696..23039) [4344 bp, 1447 aa] {ON}...    89   2e-17
YBR028C Chr2 complement(294425..296002) [1578 bp, 525 aa] {ON}  ...    88   2e-17
Kpol_1018.65 s1018 (189779..191584) [1806 bp, 601 aa] {ON} (1897...    89   2e-17
TPHA0C00470 Chr3 (81482..83377) [1896 bp, 631 aa] {ON} Anc_5.611...    89   2e-17
KLTH0F01672g Chr6 (127277..130771) [3495 bp, 1164 aa] {ON} simil...    89   3e-17
Skud_11.126 Chr11 (235011..239567) [4557 bp, 1518 aa] {ON} YKL10...    89   3e-17
KAFR0H02430 Chr8 complement(464446..466800) [2355 bp, 784 aa] {O...    89   3e-17
TDEL0D05320 Chr4 complement(965082..968255) [3174 bp, 1057 aa] {...    89   3e-17
YPL153C Chr16 complement(261727..264192) [2466 bp, 821 aa] {ON} ...    89   3e-17
NCAS0A05370 Chr1 complement(1061671..1066197) [4527 bp, 1508 aa]...    89   3e-17
Skud_15.54 Chr15 (88576..91824) [3249 bp, 1082 aa] {ON} YOL100W ...    89   3e-17
Ecym_3547 Chr3 complement(1034494..1036107) [1614 bp, 537 aa] {O...    88   3e-17
KLLA0F13552g Chr6 complement(1252906..1256709) [3804 bp, 1267 aa...    89   3e-17
Kpol_431.9 s431 complement(22310..26968) [4659 bp, 1552 aa] {ON}...    89   3e-17
KLTH0C09548g Chr3 (792218..795199) [2982 bp, 993 aa] {ON} simila...    89   3e-17
NDAI0I00340 Chr9 (65047..70557) [5511 bp, 1836 aa] {ON} Anc_6.341      89   3e-17
ZYRO0F17402g Chr6 complement(1445685..1449254) [3570 bp, 1189 aa...    89   4e-17
NCAS0F01580 Chr6 complement(313801..317949) [4149 bp, 1382 aa] {...    89   4e-17
Kwal_56.22788 s56 complement(281404..282951) [1548 bp, 515 aa] {...    87   4e-17
ZYRO0G03366g Chr7 (261014..265864) [4851 bp, 1616 aa] {ON} simil...    89   4e-17
AFR724C Chr6 complement(1770338..1771660) [1323 bp, 440 aa] {ON}...    87   4e-17
KAFR0C01440 Chr3 complement(295468..298755) [3288 bp, 1095 aa] {...    89   4e-17
Skud_16.129 Chr16 complement(233341..235824) [2484 bp, 827 aa] {...    88   4e-17
TPHA0G03290 Chr7 (702953..705874) [2922 bp, 973 aa] {ON} Anc_2.4...    88   4e-17
CAGL0M08910g Chr13 complement(887703..889541) [1839 bp, 612 aa] ...    88   4e-17
KAFR0D03390 Chr4 (667896..670292) [2397 bp, 798 aa] {ON} Anc_2.4...    88   4e-17
KLLA0C12485g Chr3 (1060167..1062944) [2778 bp, 925 aa] {ON} simi...    88   4e-17
Kpol_1037.52 s1037 complement(128841..130379) [1539 bp, 512 aa] ...    87   5e-17
NCAS0A12350 Chr1 complement(2446237..2447236,2447319..2448559) [...    88   5e-17
Kwal_26.8796 s26 (946406..948796) [2391 bp, 796 aa] {ON} YPL153C...    88   5e-17
Kwal_26.7154 s26 (237387..241028) [3642 bp, 1213 aa] {ON} YOL045...    88   5e-17
ZYRO0B01166g Chr2 complement(97168..100059) [2892 bp, 963 aa] {O...    88   6e-17
KNAG0D00390 Chr4 (53459..58429) [4971 bp, 1656 aa] {ON} Anc_6.34...    88   6e-17
NDAI0D04050 Chr4 (952438..953538) [1101 bp, 366 aa] {ON} Anc_4.184     85   6e-17
CAGL0K06479g Chr11 (637125..640100) [2976 bp, 991 aa] {ON} some ...    88   6e-17
Suva_16.157 Chr16 complement(270891..273389) [2499 bp, 832 aa] {...    87   7e-17
TBLA0A02050 Chr1 (495735..497039) [1305 bp, 434 aa] {ON}               86   7e-17
CAGL0G04609g Chr7 complement(437162..440059) [2898 bp, 965 aa] {...    87   7e-17
Suva_2.157 Chr2 complement(275484..277064) [1581 bp, 526 aa] {ON...    87   7e-17
KAFR0C03010 Chr3 (598970..601342) [2373 bp, 790 aa] {ON} Anc_8.1...    87   7e-17
NDAI0G03450 Chr7 (822716..825562) [2847 bp, 948 aa] {ON} Anc_8.141     87   7e-17
Smik_6.350 Chr6 (559997..562465) [2469 bp, 822 aa] {ON} YPL153C ...    87   7e-17
KNAG0D03980 Chr4 (721049..722170) [1122 bp, 373 aa] {ON} Anc_4.1...    85   8e-17
YJL095W Chr10 (247255..251691) [4437 bp, 1478 aa] {ON}  BCK1Mito...    87   8e-17
KNAG0B01780 Chr2 (326438..331180) [4743 bp, 1580 aa] {ON} Anc_1....    87   8e-17
Skud_15.112 Chr15 (202308..205613) [3306 bp, 1101 aa] {ON} YOL04...    87   8e-17
KLTH0C08932g Chr3 (749308..750867) [1560 bp, 519 aa] {ON} simila...    86   9e-17
SAKL0E01584g Chr5 complement(121830..123917) [2088 bp, 695 aa] {...    87   9e-17
KLTH0D05566g Chr4 (498055..501441) [3387 bp, 1128 aa] {ON} weakl...    87   9e-17
Kpol_2002.24 s2002 (48405..49868) [1464 bp, 487 aa] {ON} (48405....    86   9e-17
Smik_3.54 Chr3 (80309..83407) [3099 bp, 1032 aa] {ON} YCL024W (R...    87   1e-16
AEL083W Chr5 (470964..472574) [1611 bp, 536 aa] {ON} Syntenic ho...    86   1e-16
KNAG0J01700 Chr10 (309962..312424) [2463 bp, 820 aa] {ON}              87   1e-16
SAKL0A01254g Chr1 (119884..124560) [4677 bp, 1558 aa] {ON} simil...    87   1e-16
TPHA0D02840 Chr4 (591733..593637) [1905 bp, 634 aa] {ON}               86   1e-16
Suva_3.190 Chr3 (288639..288813,288870..291766) [3072 bp, 1024 a...    87   1e-16
CAGL0L03520g Chr12 complement(403100..407443) [4344 bp, 1447 aa]...    87   1e-16
TBLA0I02400 Chr9 complement(548975..554167) [5193 bp, 1730 aa] {...    87   1e-16
SAKL0C00946g Chr3 (84995..86689) [1695 bp, 564 aa] {ON} similar ...    86   1e-16
TBLA0D02230 Chr4 (557816..561280) [3465 bp, 1154 aa] {ON} Anc_8....    87   1e-16
YAL017W Chr1 (120225..124295) [4071 bp, 1356 aa] {ON}  PSK1One o...    87   1e-16
Smik_1.50 Chr1 (103132..107205) [4074 bp, 1357 aa] {ON} YAL017W ...    87   1e-16
ZYRO0A06446g Chr1 complement(513126..515957) [2832 bp, 943 aa] {...    87   1e-16
NDAI0E03170 Chr5 complement(677441..678392,678524..678543) [972 ...    84   1e-16
CAGL0B04301g Chr2 (420544..422172) [1629 bp, 542 aa] {ON} simila...    86   1e-16
TBLA0E03360 Chr5 complement(838512..840476) [1965 bp, 654 aa] {O...    86   1e-16
NDAI0A07190 Chr1 (1636773..1638380) [1608 bp, 535 aa] {ON} Anc_3...    86   1e-16
Smik_4.754 Chr4 (1333667..1335565) [1899 bp, 632 aa] {ON} YDR477...    86   1e-16
Suva_15.124 Chr15 (215781..219101) [3321 bp, 1106 aa] {ON} YOL04...    86   2e-16
YDR477W Chr4 (1412373..1414274) [1902 bp, 633 aa] {ON}  SNF1AMP-...    86   2e-16
Smik_10.147 Chr10 (239101..243537) [4437 bp, 1478 aa] {ON} YJL09...    86   2e-16
Skud_10.119 Chr10 (215299..219744) [4446 bp, 1481 aa] {ON} YJL09...    86   2e-16
NCAS0C04100 Chr3 (834997..837714) [2718 bp, 905 aa] {ON} Anc_8.141     86   2e-16
Suva_2.651 Chr2 (1164264..1166165) [1902 bp, 633 aa] {ON} YDR477...    86   2e-16
NCAS0A05770 Chr1 (1132854..1137239) [4386 bp, 1461 aa] {ON} Anc_...    86   2e-16
Ecym_2434 Chr2 complement(843308..846676) [3369 bp, 1122 aa] {ON...    86   2e-16
KLLA0A03806g Chr1 complement(338807..340615) [1809 bp, 602 aa] {...    86   2e-16
Kpol_1054.2 s1054 complement(4365..7655) [3291 bp, 1096 aa] {ON}...    86   2e-16
TBLA0B03840 Chr2 complement(881914..884490) [2577 bp, 858 aa] {O...    86   2e-16
Suva_11.65 Chr11 complement(134606..136120) [1515 bp, 504 aa] {O...    85   3e-16
TBLA0A08430 Chr1 complement(2075682..2076773) [1092 bp, 363 aa] ...    83   3e-16
Suva_15.65 Chr15 (102271..105513) [3243 bp, 1080 aa] {ON} YOL100...    86   3e-16
KNAG0K01240 Chr11 (243154..246096) [2943 bp, 980 aa] {ON} Anc_3....    86   3e-16
Ecym_6145 Chr6 complement(266766..267863) [1098 bp, 365 aa] {ON}...    83   3e-16
TDEL0D02650 Chr4 complement(505536..506636) [1101 bp, 366 aa] {O...    83   3e-16
SAKL0C08844g Chr3 (811712..813307) [1596 bp, 531 aa] {ON} simila...    85   3e-16
Skud_1.44 Chr1 (95573..99643) [4071 bp, 1356 aa] {ON} YAL017W (R...    86   3e-16
Skud_4.751 Chr4 (1332135..1334039) [1905 bp, 634 aa] {ON} YDR477...    85   3e-16
SAKL0C07722g Chr3 (717419..720157) [2739 bp, 912 aa] {ON} simila...    85   3e-16
ACR142W Chr3 (597519..600032) [2514 bp, 837 aa] {ON} Syntenic ho...    85   3e-16
ZYRO0A12826g Chr1 (1014651..1015751) [1101 bp, 366 aa] {ON} high...    83   3e-16
NCAS0A00280 Chr1 (40406..42013) [1608 bp, 535 aa] {ON} Anc_1.24        84   4e-16
TBLA0D05640 Chr4 (1380616..1383066) [2451 bp, 816 aa] {ON} Anc_1...    85   4e-16
CAGL0L06006g Chr12 complement(672704..675532) [2829 bp, 942 aa] ...    85   4e-16
TDEL0D03950 Chr4 (720229..721710) [1482 bp, 493 aa] {ON} Anc_3.2...    84   4e-16
SAKL0B09856g Chr2 complement(830531..834355) [3825 bp, 1274 aa] ...    85   4e-16
Kpol_1018.54 s1018 (163688..166192) [2505 bp, 834 aa] {ON} (1636...    85   5e-16
KLLA0C17160g Chr3 (1498959..1501454) [2496 bp, 831 aa] {ON} simi...    85   5e-16
Suva_6.169 Chr6 complement(300200..304654) [4455 bp, 1484 aa] {O...    85   5e-16
Kwal_27.11803 s27 (952938..953678) [741 bp, 246 aa] {ON} YPL031C...    80   5e-16
YOL045W Chr15 (243497..246802) [3306 bp, 1101 aa] {ON}  PSK2One ...    85   6e-16
ZYRO0D05500g Chr4 (473262..477050) [3789 bp, 1262 aa] {ON} weakl...    85   6e-16
KAFR0A01420 Chr1 (276454..280650) [4197 bp, 1398 aa] {ON} Anc_1....    85   6e-16
KNAG0B03230 Chr2 complement(625072..626997) [1926 bp, 641 aa] {O...    84   6e-16
KNAG0C06060 Chr3 (1183766..1186654) [2889 bp, 962 aa] {ON} Anc_5...    84   6e-16
NDAI0C02680 Chr3 complement(621951..624203) [2253 bp, 750 aa] {O...    84   7e-16
CAGL0K07458g Chr11 complement(737165..739279) [2115 bp, 704 aa] ...    84   7e-16
YKL101W Chr11 (248920..253476) [4557 bp, 1518 aa] {ON}  HSL1Nim1...    84   7e-16
ABR014W Chr2 (417708..420623) [2916 bp, 971 aa] {ON} Syntenic ho...    84   7e-16
SAKL0G06952g Chr7 (570584..572383) [1800 bp, 599 aa] {ON} simila...    84   7e-16
Kwal_14.1416 s14 (315842..316939) [1098 bp, 365 aa] {ON} YGR040W...    82   8e-16
KAFR0C05860 Chr3 (1160586..1162520) [1935 bp, 644 aa] {ON} Anc_5...    84   8e-16
KAFR0D03200 Chr4 (628993..633339) [4347 bp, 1448 aa] {ON} Anc_2....    84   8e-16
Skud_4.742 Chr4 (1315170..1317881) [2712 bp, 903 aa] {ON} YDR466...    84   8e-16
NDAI0B04700 Chr2 complement(1164332..1165918) [1587 bp, 528 aa] ...    83   9e-16
KLLA0A02497g Chr1 (218592..219680) [1089 bp, 362 aa] {ON} highly...    82   9e-16
SAKL0D05522g Chr4 (437018..441442) [4425 bp, 1474 aa] {ON} simil...    84   9e-16
KNAG0A06750 Chr1 (1053919..1056294) [2376 bp, 791 aa] {ON} Anc_2...    84   9e-16
KLLA0F11319g Chr6 (1042436..1044967) [2532 bp, 843 aa] {ON} simi...    84   9e-16
KLTH0G17512g Chr7 complement(1518329..1519426) [1098 bp, 365 aa]...    82   1e-15
TPHA0H00760 Chr8 complement(152442..155384) [2943 bp, 980 aa] {O...    84   1e-15
YCL024W Chr3 (79162..82275) [3114 bp, 1037 aa] {ON}  KCC4Protein...    84   1e-15
Suva_2.642 Chr2 (1147428..1148865,1149541..1150805) [2703 bp, 90...    84   1e-15
TPHA0P01050 Chr16 complement(212259..215624) [3366 bp, 1121 aa] ...    84   1e-15
Skud_11.67 Chr11 complement(135815..137341) [1527 bp, 508 aa] {O...    83   1e-15
Skud_13.154 Chr13 complement(255263..257380) [2118 bp, 705 aa] {...    83   1e-15
Kpol_495.14 s495 (33810..35684) [1875 bp, 624 aa] {ON} (33810..3...    83   1e-15
TBLA0H01660 Chr8 complement(377521..380511) [2991 bp, 996 aa] {O...    84   1e-15
Smik_13.159 Chr13 complement(260249..262366) [2118 bp, 705 aa] {...    83   1e-15
CAGL0H06259g Chr8 (615045..619055) [4011 bp, 1336 aa] {ON} simil...    84   1e-15
YMR001C Chr13 complement(269019..271136) [2118 bp, 705 aa] {ON} ...    83   1e-15
Kwal_56.23841 s56 (732202..733500) [1299 bp, 432 aa] {ON} YLR113...    82   1e-15
KAFR0D01220 Chr4 (246927..250094) [3168 bp, 1055 aa] {ON} Anc_7....    83   1e-15
ZYRO0G19074g Chr7 complement(1580648..1583413) [2766 bp, 921 aa]...    83   1e-15
YDR523C Chr4 complement(1485566..1487038) [1473 bp, 490 aa] {ON}...    82   1e-15
TDEL0H03640 Chr8 complement(600211..603924) [3714 bp, 1237 aa] {...    84   1e-15
NDAI0G03470 Chr7 complement(829975..832455) [2481 bp, 826 aa] {O...    83   1e-15
KLTH0G05698g Chr7 (453530..455323) [1794 bp, 597 aa] {ON} simila...    83   1e-15
TPHA0E03850 Chr5 complement(810694..812142) [1449 bp, 482 aa] {O...    82   1e-15
Smik_11.139 Chr11 (235511..240115) [4605 bp, 1534 aa] {ON} YKL10...    84   2e-15
KNAG0A06540 Chr1 (1002435..1006733) [4299 bp, 1432 aa] {ON} Anc_...    83   2e-15
Suva_11.123 Chr11 (235064..239644) [4581 bp, 1526 aa] {ON} YKL10...    83   2e-15
Skud_14.362 Chr14 complement(648801..653540) [4740 bp, 1579 aa] ...    83   2e-15
Kwal_47.18233 s47 complement(743846..745642) [1797 bp, 598 aa] {...    82   2e-15
ACL191C Chr3 complement(26475..27572) [1098 bp, 365 aa] {ON} Syn...    81   2e-15
YNR047W Chr14 (708523..711204) [2682 bp, 893 aa] {ON}  FPK1Ser/T...    83   2e-15
KLTH0G12738g Chr7 complement(1085500..1086804) [1305 bp, 434 aa]...    82   2e-15
CAGL0K04169g Chr11 (384567..385763) [1197 bp, 398 aa] {ON} simil...    81   2e-15
TDEL0A04580 Chr1 (816247..818331) [2085 bp, 694 aa] {ON} Anc_5.5...    83   2e-15
KAFR0F04340 Chr6 (848844..853628) [4785 bp, 1594 aa] {ON} Anc_6....    83   2e-15
TBLA0F00240 Chr6 complement(45510..49256) [3747 bp, 1248 aa] {ON...    83   2e-15
NCAS0D02100 Chr4 (385878..388058) [2181 bp, 726 aa] {ON} Anc_6.31      82   2e-15
Skud_14.379 Chr14 (677081..679774) [2694 bp, 897 aa] {ON} YNR047...    83   2e-15
ACL006W Chr3 (344395..346521) [2127 bp, 708 aa] {ON} Syntenic ho...    82   2e-15
Suva_13.163 Chr13 complement(259136..261253) [2118 bp, 705 aa] {...    82   2e-15
ZYRO0F07370g Chr6 (595931..598219) [2289 bp, 762 aa] {ON} simila...    82   2e-15
Suva_15.46 Chr15 (81948..83909) [1962 bp, 653 aa] {ON} YOL113W (...    82   2e-15
TBLA0H01330 Chr8 complement(297718..299163) [1446 bp, 481 aa] {O...    82   2e-15
CAGL0M02233g Chr13 complement(267332..269635) [2304 bp, 767 aa] ...    82   2e-15
NCAS0A09470 Chr1 complement(1883183..1887730) [4548 bp, 1515 aa]...    83   2e-15
Kwal_23.5576 s23 complement(1223517..1225031) [1515 bp, 504 aa] ...    82   2e-15
KLTH0F00946g Chr6 (73412..74950) [1539 bp, 512 aa] {ON} similar ...    82   2e-15
NDAI0D02750 Chr4 (639802..644349) [4548 bp, 1515 aa] {ON} Anc_2....    83   2e-15
ZYRO0G15290g Chr7 complement(1237119..1241582) [4464 bp, 1487 aa...    83   2e-15
NDAI0A05280 Chr1 complement(1191032..1192342) [1311 bp, 436 aa] ...    81   2e-15
KNAG0G01250 Chr7 complement(280791..283364) [2574 bp, 857 aa] {O...    82   3e-15
Smik_7.92 Chr7 (155049..157742) [2694 bp, 897 aa] {ON} YGL180W (...    82   3e-15
NCAS0D04600 Chr4 (875553..880604) [5052 bp, 1683 aa] {ON} Anc_6....    83   3e-15
YDR466W Chr4 (1395121..1397817) [2697 bp, 898 aa] {ON}  PKH3Prot...    82   3e-15
TBLA0A01630 Chr1 complement(385348..386386,386496..386512) [1056...    80   3e-15
KLTH0G06974g Chr7 (556626..558125) [1500 bp, 499 aa] {ON} highly...    81   3e-15
TPHA0G01600 Chr7 complement(329313..331850) [2538 bp, 845 aa] {O...    82   3e-15
YNR031C Chr14 complement(680694..685433) [4740 bp, 1579 aa] {ON}...    82   3e-15
NCAS0C01370 Chr3 complement(250693..253092) [2400 bp, 799 aa] {O...    82   3e-15
Ecym_5588 Chr5 complement(1205102..1206943) [1842 bp, 613 aa] {O...    82   3e-15
Smik_15.122 Chr15 (209665..212970) [3306 bp, 1101 aa] {ON} YOL04...    82   3e-15
NDAI0H00940 Chr8 complement(209645..211702) [2058 bp, 685 aa] {O...    82   4e-15
CAGL0D01694g Chr4 complement(176981..178279) [1299 bp, 432 aa] {...    80   4e-15
Ecym_4652 Chr4 (1272725..1276156) [3432 bp, 1143 aa] {ON} simila...    82   4e-15
AEL230W Chr5 (198401..200227) [1827 bp, 608 aa] {ON} Syntenic ho...    81   4e-15
KLLA0C08525g Chr3 (744554..749209) [4656 bp, 1551 aa] {ON} simil...    82   4e-15
KLLA0B11946g Chr2 complement(1048033..1049352) [1320 bp, 439 aa]...    80   4e-15
TPHA0A01630 Chr1 complement(328040..329347) [1308 bp, 435 aa] {O...    80   4e-15
ZYRO0A05544g Chr1 (450809..452704) [1896 bp, 631 aa] {ON} highly...    81   4e-15
Kwal_33.13112 s33 (76807..78324) [1518 bp, 505 aa] {ON} YDR523C ...    81   4e-15
TDEL0B04700 Chr2 (834336..836996) [2661 bp, 886 aa] {ON} Anc_8.1...    82   4e-15
Suva_14.385 Chr14 complement(661987..666732) [4746 bp, 1581 aa] ...    82   4e-15
KNAG0E00850 Chr5 complement(158992..161127) [2136 bp, 711 aa] {O...    81   4e-15
KLLA0E03587g Chr5 complement(323764..325707) [1944 bp, 647 aa] {...    81   5e-15
NCAS0I02680 Chr9 (498371..500752) [2382 bp, 793 aa] {ON}               81   5e-15
Smik_14.377 Chr14 (666338..669025) [2688 bp, 895 aa] {ON} YNR047...    82   5e-15
Suva_3.110 Chr3 complement(160016..164146) [4131 bp, 1376 aa] {O...    82   5e-15
Smik_4.745 Chr4 (1316457..1319201) [2745 bp, 914 aa] {ON} YDR466...    81   5e-15
NDAI0A08560 Chr1 complement(1969778..1973731) [3954 bp, 1317 aa]...    82   5e-15
CAGL0I09504g Chr9 (909589..911175) [1587 bp, 528 aa] {ON} simila...    80   5e-15
Smik_16.204 Chr16 complement(369272..370021) [750 bp, 249 aa] {O...    77   5e-15
Kpol_1031.32 s1031 (76827..78821) [1995 bp, 664 aa] {ON} (76827....    81   6e-15
KAFR0B02140 Chr2 (417972..420662) [2691 bp, 896 aa] {ON} Anc_8.1...    81   6e-15
Kwal_47.18307 s47 complement(776521..778386) [1866 bp, 621 aa] {...    81   6e-15
SAKL0G06402g Chr7 (535632..537986) [2355 bp, 784 aa] {ON} simila...    81   6e-15
SAKL0H16038g Chr8 complement(1401627..1402931) [1305 bp, 434 aa]...    80   6e-15
Ecym_2640 Chr2 complement(1232617..1236594) [3978 bp, 1325 aa] {...    82   6e-15
TDEL0A04780 Chr1 (842715..844580) [1866 bp, 621 aa] {ON} Anc_5.6...    81   6e-15
TPHA0M01500 Chr13 (317999..319291) [1293 bp, 430 aa] {ON} Anc_3....    80   6e-15
KAFR0G02690 Chr7 complement(555573..557714) [2142 bp, 713 aa] {O...    81   6e-15
Ecym_3035 Chr3 complement(70391..72613) [2223 bp, 740 aa] {ON} s...    81   6e-15
NDAI0G02700 Chr7 complement(618268..619611) [1344 bp, 447 aa] {O...    80   7e-15
KLLA0F20053g Chr6 (1867209..1868543) [1335 bp, 444 aa] {ON} high...    80   7e-15
SAKL0G10978g Chr7 (929164..930729) [1566 bp, 521 aa] {ON} highly...    80   7e-15
Kpol_543.55 s543 (126256..127533) [1278 bp, 425 aa] {ON} (126256...    80   7e-15
Smik_4.803 Chr4 complement(1408345..1409817) [1473 bp, 490 aa] {...    80   7e-15
YGL180W Chr7 (160065..162758) [2694 bp, 897 aa] {ON}  ATG1Protei...    81   7e-15
Suva_7.82 Chr7 (156049..158751) [2703 bp, 900 aa] {ON} YGL180W (...    81   8e-15
AAR009W Chr1 (358947..360308) [1362 bp, 453 aa] {ON} Syntenic ho...    80   8e-15
TBLA0A07460 Chr1 (1848207..1849757) [1551 bp, 516 aa] {ON} Anc_1...    80   8e-15
ADL315C Chr4 complement(146096..147400) [1305 bp, 434 aa] {ON} S...    79   8e-15
Ecym_6344 Chr6 complement(664647..668840) [4194 bp, 1397 aa] {ON...    81   9e-15
TDEL0G04380 Chr7 (792278..794446) [2169 bp, 722 aa] {ON} Anc_6.3...    80   9e-15
TPHA0M01840 Chr13 complement(380953..385818) [4866 bp, 1621 aa] ...    81   9e-15
Suva_2.703 Chr2 complement(1238496..1239953) [1458 bp, 485 aa] {...    80   9e-15
CAGL0M11748g Chr13 (1168856..1170199) [1344 bp, 447 aa] {ON} hig...    79   9e-15
Kpol_1028.40 s1028 (95617..100392) [4776 bp, 1591 aa] {ON} (9561...    81   9e-15
KLLA0F07623g Chr6 (720246..723935) [3690 bp, 1229 aa] {ON} simil...    81   9e-15
Ecym_4266 Chr4 complement(564935..566329) [1395 bp, 464 aa] {ON}...    79   1e-14
KAFR0B02980 Chr2 (623470..624804) [1335 bp, 444 aa] {ON} Anc_8.3...    79   1e-14
TBLA0E02790 Chr5 complement(693136..695562) [2427 bp, 808 aa] {O...    80   1e-14
Suva_10.202 Chr10 (380079..381386) [1308 bp, 435 aa] {ON} YLR113...    79   1e-14
Smik_14.360 Chr14 complement(638655..643406) [4752 bp, 1583 aa] ...    80   1e-14
Skud_7.91 Chr7 (165681..168374) [2694 bp, 897 aa] {ON} YGL180W (...    80   1e-14
TDEL0D01400 Chr4 (269367..273656) [4290 bp, 1429 aa] {ON} Anc_1....    80   1e-14
YGR040W Chr7 (575398..576504) [1107 bp, 368 aa] {ON}  KSS1Mitoge...    78   1e-14
Kwal_27.9773 s27 (57252..58472) [1221 bp, 406 aa] {ON} YAR018C (...    79   1e-14
SAKL0D06534g Chr4 complement(538606..540091,540155..540237) [156...    79   1e-14
AFR377C Chr6 complement(1116589..1118769) [2181 bp, 726 aa] {ON}...    80   1e-14
Skud_5.249 Chr5 complement(400867..404310) [3444 bp, 1147 aa] {O...    80   1e-14
TPHA0J00630 Chr10 (139476..140600) [1125 bp, 374 aa] {ON} Anc_4....    78   1e-14
KAFR0F03900 Chr6 (763094..764203) [1110 bp, 369 aa] {ON} Anc_4.1...    78   1e-14
Suva_6.78 Chr6 (135988..137325) [1338 bp, 445 aa] {ON} YFR014C (...    79   1e-14
Smik_3.173 Chr3 complement(242285..246307) [4023 bp, 1340 aa] {O...    80   1e-14
TPHA0F02430 Chr6 complement(535865..538261) [2397 bp, 798 aa] {O...    80   2e-14
NDAI0E02320 Chr5 (480203..483001) [2799 bp, 932 aa] {ON}               80   2e-14
TBLA0D05010 Chr4 complement(1234934..1236238) [1305 bp, 434 aa] ...    79   2e-14
ZYRO0D06182g Chr4 complement(529121..530416) [1296 bp, 431 aa] {...    79   2e-14
TDEL0C06780 Chr3 complement(1236767..1238173) [1407 bp, 468 aa] ...    79   2e-14
TBLA0B00490 Chr2 complement(94755..97118) [2364 bp, 787 aa] {ON}...    80   2e-14
TPHA0H02390 Chr8 (561244..563436) [2193 bp, 730 aa] {ON} Anc_6.3...    80   2e-14
ZYRO0A05214g Chr1 complement(418443..421268) [2826 bp, 941 aa] {...    80   2e-14
Smik_12.173 Chr12 (351727..353034) [1308 bp, 435 aa] {ON} YLR113...    79   2e-14
Skud_4.797 Chr4 complement(1405618..1407075) [1458 bp, 485 aa] {...    79   2e-14
Skud_12.181 Chr12 (354407..355702) [1296 bp, 431 aa] {ON} YLR113...    79   2e-14
KNAG0G02300 Chr7 (528489..529748) [1260 bp, 419 aa] {ON} Anc_8.3...    78   2e-14
YLR113W Chr12 (371620..372927) [1308 bp, 435 aa] {ON}  HOG1Mitog...    79   2e-14
AGR048C Chr7 complement(807464..808825) [1362 bp, 453 aa] {ON} S...    79   2e-14
Suva_14.402 Chr14 (690198..692915) [2718 bp, 905 aa] {ON} YNR047...    80   2e-14
Smik_6.125 Chr6 (201071..202177) [1107 bp, 368 aa] {ON} YGR040W ...    78   2e-14
Skud_7.337 Chr7 (562750..563856) [1107 bp, 368 aa] {ON} YGR040W ...    78   2e-14
Kpol_1037.20 s1037 (41658..43772) [2115 bp, 704 aa] {ON} (41658....    79   2e-14
TDEL0D04460 Chr4 complement(813075..815816) [2742 bp, 913 aa] {O...    79   2e-14
KLTH0E15004g Chr5 (1328930..1330165) [1236 bp, 411 aa] {ON} simi...    78   2e-14
SAKL0H24750g Chr8 complement(2152673..2155420) [2748 bp, 915 aa]...    79   2e-14
NCAS0A07990 Chr1 complement(1578473..1581346) [2874 bp, 957 aa] ...    79   2e-14
Ecym_3488 Chr3 complement(915087..916400) [1314 bp, 437 aa] {ON}...    78   2e-14
Skud_13.262 Chr13 complement(448758..450791) [2034 bp, 677 aa] {...    79   2e-14
KAFR0C02840 Chr3 (559821..560873) [1053 bp, 350 aa] {ON} Anc_8.1...    77   2e-14
Kwal_33.13831 s33 complement(413256..415358) [2103 bp, 700 aa] {...    79   2e-14
KLLA0C06138g Chr3 (540409..542535) [2127 bp, 708 aa] {ON} simila...    79   2e-14
TPHA0J00420 Chr10 complement(96445..98568) [2124 bp, 707 aa] {ON...    79   3e-14
ZYRO0C07480g Chr3 (565426..567750) [2325 bp, 774 aa] {ON} highly...    79   3e-14
KLTH0E06754g Chr5 (619163..621784) [2622 bp, 873 aa] {ON} simila...    79   3e-14
ZYRO0C06776g Chr3 complement(508813..511485) [2673 bp, 890 aa] {...    79   3e-14
KLTH0D02486g Chr4 (247566..251237) [3672 bp, 1223 aa] {ON} simil...    79   3e-14
Suva_7.325 Chr7 (550760..551866) [1107 bp, 368 aa] {ON} YGR040W ...    77   3e-14
CAGL0M09361g Chr13 complement(928484..931918) [3435 bp, 1144 aa]...    79   3e-14
KNAG0D04810 Chr4 (867817..872139) [4323 bp, 1440 aa] {ON} Anc_7....    79   3e-14
ACR191C Chr3 complement(680398..683847) [3450 bp, 1149 aa] {ON} ...    79   3e-14
NCAS0C01670 Chr3 complement(306682..309372) [2691 bp, 896 aa] {O...    79   3e-14
Kpol_1037.6 s1037 (12601..15534) [2934 bp, 977 aa] {ON} (12601.....    79   3e-14
YPR054W Chr16 (666280..667446) [1167 bp, 388 aa] {ON}  SMK1Middl...    77   3e-14
ZYRO0F18062g Chr6 complement(1494752..1496167) [1416 bp, 471 aa]...    78   3e-14
CAGL0K03399g Chr11 complement(311316..313427) [2112 bp, 703 aa] ...    79   3e-14
Smik_13.290 Chr13 complement(457921..459951) [2031 bp, 676 aa] {...    79   4e-14
NDAI0G06240 Chr7 (1546580..1549282) [2703 bp, 900 aa] {ON} Anc_1...    79   4e-14
KAFR0D03020 Chr4 (596365..598398) [2034 bp, 677 aa] {ON} Anc_2.4...    78   4e-14
YBR274W Chr2 (749594..751177) [1584 bp, 527 aa] {ON}  CHK1Serine...    78   4e-14
NCAS0C03690 Chr3 (741930..744881) [2952 bp, 983 aa] {ON}               79   4e-14
KLTH0E16126g Chr5 complement(1427208..1429814) [2607 bp, 868 aa]...    79   4e-14
ZYRO0C13156g Chr3 complement(1041022..1042068) [1047 bp, 348 aa]...    77   4e-14
NCAS0A02120 Chr1 (401097..402230) [1134 bp, 377 aa] {ON} Anc_4.184     77   4e-14
YOL113W Chr15 (104326..106293) [1968 bp, 655 aa] {ON}  SKM1Membe...    78   4e-14
KLLA0B11902g Chr2 (1041657..1043144) [1488 bp, 495 aa] {ON} unip...    77   5e-14
NCAS0A04360 Chr1 (880768..882822) [2055 bp, 684 aa] {ON} Anc_2.446     78   5e-14
TDEL0A02010 Chr1 (365325..366782) [1458 bp, 485 aa] {ON} Anc_2.4...    77   5e-14
ACL054W Chr3 (269703..272621) [2919 bp, 972 aa] {ON} Syntenic ho...    78   5e-14
NDAI0H02470 Chr8 complement(597707..601942) [4236 bp, 1411 aa] {...    78   6e-14
Kwal_47.17263 s47 complement(321115..324498) [3384 bp, 1127 aa] ...    78   6e-14
NDAI0B02900 Chr2 complement(737651..738709) [1059 bp, 352 aa] {O...    76   6e-14
Ecym_1275 Chr1 complement(560481..561836) [1356 bp, 451 aa] {ON}...    77   6e-14
NDAI0H01020 Chr8 complement(225366..228566) [3201 bp, 1066 aa] {...    78   6e-14
KNAG0I02670 Chr9 complement(524008..526734) [2727 bp, 908 aa] {O...    78   6e-14
Smik_16.296 Chr16 (542962..544128) [1167 bp, 388 aa] {ON} YPR054...    76   6e-14
Smik_3.189 Chr3 (273885..276044) [2160 bp, 719 aa] {ON} YCR091W ...    78   6e-14
TDEL0H00890 Chr8 complement(146908..149088) [2181 bp, 726 aa] {O...    78   7e-14
Kwal_47.17252 s47 (318148..320766) [2619 bp, 872 aa] {ON} YGL180...    78   7e-14
Kpol_1023.26 s1023 (51805..54024) [2220 bp, 739 aa] {ON} (51805....    77   7e-14
NCAS0C03380 Chr3 complement(664012..665310) [1299 bp, 432 aa] {O...    77   7e-14
KAFR0E01580 Chr5 (318991..320280) [1290 bp, 429 aa] {ON} Anc_5.2...    77   7e-14
Skud_3.146 Chr3 complement(227229..231233) [4005 bp, 1334 aa] {O...    78   7e-14
KLTH0E16104g Chr5 complement(1425822..1427042) [1221 bp, 406 aa]...    76   7e-14
YMR104C Chr13 complement(473420..475453) [2034 bp, 677 aa] {ON} ...    77   8e-14
Kpol_1060.53 s1060 complement(126120..128330) [2211 bp, 736 aa] ...    77   8e-14
ZYRO0F13310g Chr6 (1092612..1096322) [3711 bp, 1236 aa] {ON} som...    78   8e-14
NCAS0B07380 Chr2 complement(1396315..1397898) [1584 bp, 527 aa] ...    77   8e-14
NCAS0D04710 Chr4 complement(901442..903856) [2415 bp, 804 aa] {O...    77   8e-14
CAGL0J03872g Chr10 (368472..370457) [1986 bp, 661 aa] {ON} simil...    77   8e-14
KLTH0C05478g Chr3 complement(471760..475254) [3495 bp, 1164 aa] ...    78   8e-14
TDEL0F04290 Chr6 (801456..802739) [1284 bp, 427 aa] {ON} Anc_8.3...    76   9e-14
TDEL0D02040 Chr4 (395555..397138) [1584 bp, 527 aa] {ON} Anc_1.3...    77   9e-14
TBLA0A06670 Chr1 complement(1630701..1632023) [1323 bp, 440 aa] ...    76   9e-14
TDEL0E01710 Chr5 complement(330667..332706) [2040 bp, 679 aa] {O...    77   9e-14
TPHA0D01140 Chr4 (238656..240524) [1869 bp, 622 aa] {ON} Anc_8.6...    77   9e-14
SAKL0F13618g Chr6 (1085967..1089494) [3528 bp, 1175 aa] {ON} sim...    77   9e-14
NDAI0K02390 Chr11 (537260..539920) [2661 bp, 886 aa] {ON} Anc_6....    77   9e-14
ZYRO0B09196g Chr2 complement(721019..722569) [1551 bp, 516 aa] {...    77   9e-14
Kpol_1028.16 s1028 complement(45186..47825) [2640 bp, 879 aa] {O...    77   1e-13
TPHA0H00410 Chr8 (79426..82197) [2772 bp, 923 aa] {ON} Anc_8.141...    77   1e-13
Suva_2.11 Chr2 complement(17473..18858) [1386 bp, 461 aa] {ON} Y...    76   1e-13
Kpol_2001.10 s2001 (30724..33018) [2295 bp, 764 aa] {ON} (30724....    77   1e-13
KAFR0K02490 Chr11 (515669..518356) [2688 bp, 895 aa] {ON} Anc_5....    77   1e-13
Kpol_1033.55 s1033 (138831..140555,140557..140895) [2064 bp, 687...    77   1e-13
TPHA0M02080 Chr13 (426966..429635) [2670 bp, 889 aa] {ON} Anc_6....    77   1e-13
NCAS0E03010 Chr5 (599358..602810) [3453 bp, 1150 aa] {ON} Anc_7....    77   1e-13
Kpol_1002.111 s1002 (277615..278664) [1050 bp, 349 aa] {ON} (277...    75   1e-13
KLTH0F05918g Chr6 complement(525566..527254) [1689 bp, 562 aa] {...    76   1e-13
KAFR0H01040 Chr8 complement(189604..190860) [1257 bp, 418 aa] {O...    75   1e-13
CAGL0C05005g Chr3 complement(467626..470856) [3231 bp, 1076 aa] ...    77   1e-13
NDAI0F01600 Chr6 complement(392424..393662) [1239 bp, 412 aa] {O...    75   1e-13
Kpol_541.48 s541 (152877..153692,153695..156046) [3168 bp, 1055 ...    77   1e-13
YCR073C Chr3 complement(242588..246583) [3996 bp, 1331 aa] {ON} ...    77   1e-13
YCR091W Chr3 (274404..276566) [2163 bp, 720 aa] {ON}  KIN82Putat...    77   1e-13
TPHA0O01400 Chr15 complement(277678..279258) [1581 bp, 526 aa] {...    76   1e-13
Kwal_27.10581 s27 complement(403249..406713) [3465 bp, 1154 aa] ...    77   1e-13
NCAS0A05570 Chr1 (1093653..1096409) [2757 bp, 918 aa] {ON} Anc_6...    77   1e-13
KAFR0C04280 Chr3 (848308..849912) [1605 bp, 534 aa] {ON} Anc_1.3...    76   1e-13
KNAG0C02440 Chr3 complement(475652..476857) [1206 bp, 401 aa] {O...    75   2e-13
NDAI0G03030 Chr7 (704910..708269) [3360 bp, 1119 aa] {ON}              77   2e-13
TPHA0L02180 Chr12 (453556..455538) [1983 bp, 660 aa] {ON} Anc_5....    76   2e-13
KLTH0G05214g Chr7 (423793..425754) [1962 bp, 653 aa] {ON} weakly...    76   2e-13
Skud_16.340 Chr16 (631100..632266) [1167 bp, 388 aa] {ON} YPR054...    75   2e-13
SAKL0H06754g Chr8 (594995..597649) [2655 bp, 884 aa] {ON} simila...    76   2e-13
NCAS0A09750 Chr1 (1940202..1942370) [2169 bp, 722 aa] {ON}             76   2e-13
KNAG0I02830 Chr9 (549811..554358) [4548 bp, 1515 aa] {ON} Anc_1....    77   2e-13
Skud_3.165 Chr3 (258916..261066) [2151 bp, 716 aa] {ON} YCR091W ...    76   2e-13
Smik_2.13 Chr2 complement(14021..17473) [3453 bp, 1150 aa] {ON} ...    77   2e-13
Smik_2.14 Chr2 complement(14021..17473) [3453 bp, 1150 aa] {ON} ...    77   2e-13
KAFR0A05090 Chr1 (1011918..1013924) [2007 bp, 668 aa] {ON}             76   2e-13
NCAS0B04490 Chr2 (814474..815523) [1050 bp, 349 aa] {ON} Anc_8.141     74   2e-13
SAKL0C07744g Chr3 (720519..721799) [1281 bp, 426 aa] {ON} simila...    75   2e-13
YBL105C Chr2 complement(14241..17696) [3456 bp, 1151 aa] {ON}  P...    77   2e-13
ZYRO0D08184g Chr4 (706856..711601) [4746 bp, 1581 aa] {ON} simil...    77   2e-13
CAGL0C03509g Chr3 complement(350846..353533) [2688 bp, 895 aa] {...    76   2e-13
TPHA0G01630 Chr7 (336511..339126) [2616 bp, 871 aa] {ON} Anc_8.6...    76   2e-13
Skud_10.50 Chr10 complement(84697..85890) [1194 bp, 397 aa] {ON}...    75   2e-13
YJL164C Chr10 complement(109966..111159) [1194 bp, 397 aa] {ON} ...    75   2e-13
AFR019W Chr6 (471481..472560) [1080 bp, 359 aa] {ON} Syntenic ho...    74   2e-13
Ecym_7361 Chr7 complement(753862..755313) [1452 bp, 483 aa] {ON}...    75   2e-13
Skud_1.72 Chr1 (141337..144261) [2925 bp, 974 aa] {ON} YAR019C (...    76   2e-13
SAKL0C06666g Chr3 complement(628448..630367) [1920 bp, 639 aa] {...    76   2e-13
Ecym_6196 Chr6 (364576..365652) [1077 bp, 358 aa] {ON} similar t...    74   2e-13
TDEL0F00930 Chr6 complement(160181..163573) [3393 bp, 1130 aa] {...    76   2e-13
YKL161C Chr11 complement(149386..150687) [1302 bp, 433 aa] {ON} ...    75   2e-13
KAFR0C04590 Chr3 complement(917915..922321) [4407 bp, 1468 aa] {...    76   2e-13
KAFR0F01800 Chr6 complement(350480..351754) [1275 bp, 424 aa] {O...    75   2e-13
Skud_2.4 Chr2 complement(4805..8260) [3456 bp, 1151 aa] {ON} YBL...    76   3e-13
TPHA0A04570 Chr1 (1038551..1040674) [2124 bp, 707 aa] {ON} Anc_1...    76   3e-13
CAGL0I05896g Chr9 (560169..562505) [2337 bp, 778 aa] {ON} some s...    76   3e-13
SAKL0C06248g Chr3 complement(577990..580185) [2196 bp, 731 aa] {...    75   3e-13
Smik_2.417 Chr2 (735214..736797) [1584 bp, 527 aa] {ON} YBR274W ...    75   3e-13
Kpol_1072.29 s1072 complement(61987..64668) [2682 bp, 893 aa] {O...    76   3e-13
NCAS0B05560 Chr2 complement(1050313..1051371) [1059 bp, 352 aa] ...    74   3e-13
KAFR0A03730 Chr1 (761946..764312) [2367 bp, 788 aa] {ON} Anc_8.6...    75   3e-13
CAGL0L05632g Chr12 (612478..614511) [2034 bp, 677 aa] {ON} simil...    75   3e-13
Kpol_513.17 s513 (49097..50824) [1728 bp, 575 aa] {ON} (49097..5...    75   3e-13
Suva_6.221 Chr6 (399862..400920,400924..402096) [2232 bp, 743 aa...    75   3e-13
TBLA0A08810 Chr1 (2161249..2162304) [1056 bp, 351 aa] {ON} Anc_8...    74   3e-13
YKL126W Chr11 (205707..207749) [2043 bp, 680 aa] {ON}  YPK1Serin...    75   3e-13
KNAG0F00170 Chr6 (13778..15409) [1632 bp, 543 aa] {ON} Anc_1.24 ...    75   3e-13
KLLA0F23155g Chr6 (2157146..2158429) [1284 bp, 427 aa] {ON} simi...    74   3e-13
CAGL0I06248g Chr9 (600351..602792) [2442 bp, 813 aa] {ON} simila...    75   3e-13
Smik_1.79 Chr1 complement(149839..152763) [2925 bp, 974 aa] {ON}...    75   3e-13
KNAG0A06290 Chr1 (958438..960516) [2079 bp, 692 aa] {ON} Anc_2.4...    75   3e-13
CAGL0F00913g Chr6 (97023..100643) [3621 bp, 1206 aa] {ON} simila...    75   4e-13
Smik_10.66 Chr10 complement(108043..109236) [1194 bp, 397 aa] {O...    74   4e-13
KNAG0A05580 Chr1 (830643..831560) [918 bp, 305 aa] {ON} Anc_2.33...    73   4e-13
NCAS0A08880 Chr1 (1756271..1757539) [1269 bp, 422 aa] {ON} Anc_1...    74   4e-13
Suva_13.281 Chr13 complement(455094..457136) [2043 bp, 680 aa] {...    75   4e-13
KLTH0H10318g Chr8 complement(888661..890128,890228..890316) [155...    75   4e-13
NDAI0G06150 Chr7 (1519393..1521780) [2388 bp, 795 aa] {ON} Anc_1...    75   4e-13
AFR092W Chr6 (595092..599363) [4272 bp, 1423 aa] {ON} Syntenic h...    75   4e-13
CAGL0M10153g Chr13 complement(1010688..1013291) [2604 bp, 867 aa...    75   4e-13
Smik_15.39 Chr15 (72332..74314) [1983 bp, 660 aa] {ON} YOL113W (...    75   4e-13
Skud_2.406 Chr2 (718522..720105) [1584 bp, 527 aa] {ON} YBR274W ...    75   4e-13
ZYRO0F07194g Chr6 complement(581438..584254) [2817 bp, 938 aa] {...    75   4e-13
Suva_4.535 Chr4 (921278..922861) [1584 bp, 527 aa] {ON} YBR274W ...    75   4e-13
TDEL0H01070 Chr8 complement(192834..194624) [1791 bp, 596 aa] {O...    75   4e-13
KAFR0C00930 Chr3 complement(186877..189687) [2811 bp, 936 aa] {O...    75   4e-13
Kpol_1035.17 s1035 complement(39908..41503) [1596 bp, 531 aa] {O...    74   5e-13
Suva_16.382 Chr16 (673009..674205) [1197 bp, 398 aa] {ON} YPR054...    74   5e-13
YHR030C Chr8 complement(168890..170344) [1455 bp, 484 aa] {ON}  ...    74   5e-13
Kwal_27.12559 s27 (1273349..1274593) [1245 bp, 414 aa] {ON} YPR0...    74   5e-13
SAKL0H24706g Chr8 (2145552..2149100) [3549 bp, 1182 aa] {ON} sim...    75   5e-13
Kwal_23.6458 s23 (1592349..1594955) [2607 bp, 868 aa] {ON} YNR04...    75   5e-13
Skud_2.90 Chr2 (176138..177199) [1062 bp, 353 aa] {ON} YBL016W (...    73   5e-13
NCAS0I00470 Chr9 (74336..77584) [3249 bp, 1082 aa] {ON} Anc_7.86       75   6e-13
TDEL0A07860 Chr1 (1365985..1368498) [2514 bp, 837 aa] {ON} Anc_6...    75   6e-13
AFL217C Chr6 complement(30765..32840) [2076 bp, 691 aa] {ON} Syn...    75   6e-13
YBL016W Chr2 (192451..193512) [1062 bp, 353 aa] {ON}  FUS3Mitoge...    73   6e-13
Suva_15.216 Chr15 complement(376197..377624) [1428 bp, 475 aa] {...    74   6e-13
TBLA0C03140 Chr3 (759258..760763) [1506 bp, 501 aa] {ON} Anc_5.2...    74   6e-13
TBLA0E02290 Chr5 complement(563483..567385) [3903 bp, 1300 aa] {...    75   6e-13
NDAI0H02340 Chr8 complement(568767..570887) [2121 bp, 706 aa] {O...    74   6e-13
Suva_6.245 Chr6 (438131..439315) [1185 bp, 394 aa] {ON} YJL164C ...    73   6e-13
Ecym_2397 Chr2 complement(771343..773961) [2619 bp, 872 aa] {ON}...    75   6e-13
NCAS0A11020 Chr1 (2193556..2194869) [1314 bp, 437 aa] {ON} Anc_3...    74   6e-13
Smik_2.101 Chr2 (186008..187069) [1062 bp, 353 aa] {ON} YBL016W ...    73   6e-13
NCAS0C01590 Chr3 (293327..295921) [2595 bp, 864 aa] {ON} Anc_8.654     75   6e-13
Ecym_5209 Chr5 complement(445530..448133) [2604 bp, 867 aa] {ON}...    75   7e-13
NDAI0G05300 Chr7 (1289208..1290521) [1314 bp, 437 aa] {ON} Anc_1...    74   7e-13
Kpol_520.17 s520 complement(37953..41447) [3495 bp, 1164 aa] {ON...    75   7e-13
KLLA0E06447g Chr5 complement(577669..581154) [3486 bp, 1161 aa] ...    75   7e-13
KNAG0C01060 Chr3 complement(205965..207374) [1410 bp, 469 aa] {O...    74   8e-13
Smik_11.113 Chr11 (191688..193730) [2043 bp, 680 aa] {ON} YMR104...    74   8e-13
NDAI0E04610 Chr5 (1042690..1046154) [3465 bp, 1154 aa] {ON} Anc_...    74   8e-13
TDEL0C03050 Chr3 (545862..549299) [3438 bp, 1145 aa] {ON} Anc_7....    74   8e-13
Smik_7.319 Chr7 complement(534132..535472) [1341 bp, 446 aa] {ON...    73   8e-13
YAR019C Chr1 complement(172211..175135) [2925 bp, 974 aa] {ON}  ...    74   8e-13
KAFR0G01200 Chr7 (273238..274761) [1524 bp, 507 aa] {ON} Anc_1.2...    74   9e-13
NCAS0D00400 Chr4 complement(61545..63716) [2172 bp, 723 aa] {ON}...    74   9e-13
TDEL0C03710 Chr3 (653934..655169) [1236 bp, 411 aa] {ON} Anc_1.1...    73   9e-13
NDAI0A00960 Chr1 complement(197205..198431) [1227 bp, 408 aa] {O...    73   9e-13
Kwal_33.13984 s33 complement(471429..473378) [1950 bp, 649 aa] {...    74   9e-13
TBLA0A04720 Chr1 (1168895..1172683) [3789 bp, 1262 aa] {ON} Anc_...    74   9e-13
Kwal_33.14081 s33 complement(519343..521085) [1743 bp, 580 aa] {...    74   9e-13
KLLA0B07205g Chr2 complement(624606..625973) [1368 bp, 455 aa] {...    73   9e-13
Smik_8.97 Chr8 complement(148421..149857) [1437 bp, 478 aa] {ON}...    73   9e-13
KAFR0H02540 Chr8 complement(483399..485852) [2454 bp, 817 aa] {O...    74   9e-13
CAGL0J00539g Chr10 (47095..48561) [1467 bp, 488 aa] {ON} highly ...    73   9e-13
Kpol_376.5 s376 (6334..7767) [1434 bp, 477 aa] {ON} (6334..7767)...    73   1e-12
Kwal_55.20326 s55 complement(351010..353262) [2253 bp, 750 aa] {...    74   1e-12
TBLA0C05830 Chr3 complement(1408930..1410210) [1281 bp, 426 aa] ...    73   1e-12
ZYRO0F06842g Chr6 (561269..563800) [2532 bp, 843 aa] {ON} simila...    74   1e-12
Skud_8.86 Chr8 complement(149508..150953) [1446 bp, 481 aa] {ON}...    73   1e-12
AER223C Chr5 complement(1044971..1047679) [2709 bp, 902 aa] {ON}...    74   1e-12
TPHA0C02880 Chr3 (623723..624778) [1056 bp, 351 aa] {ON} Anc_8.1...    72   1e-12
ZYRO0G16082g Chr7 complement(1320266..1321714) [1449 bp, 482 aa]...    73   1e-12
TPHA0B02440 Chr2 (560189..561592) [1404 bp, 467 aa] {ON} Anc_5.2...    73   1e-12
CAGL0M08404g Chr13 complement(836791..838179) [1389 bp, 462 aa] ...    73   1e-12
ACR281C Chr3 complement(864528..868307) [3780 bp, 1259 aa] {ON} ...    74   1e-12
ZYRO0G18546g Chr7 (1530693..1533050) [2358 bp, 785 aa] {ON} simi...    74   1e-12
KLLA0B12716g Chr2 (1109939..1112089) [2151 bp, 716 aa] {ON} simi...    74   1e-12
KAFR0G01080 Chr7 complement(243965..247417) [3453 bp, 1150 aa] {...    74   1e-12
Smik_6.339 Chr6 (538177..540774) [2598 bp, 865 aa] {ON} YPL141C ...    74   1e-12
YFR014C Chr6 complement(172537..173877) [1341 bp, 446 aa] {ON}  ...    73   1e-12
KLTH0F05522g Chr6 complement(477035..478975) [1941 bp, 646 aa] {...    73   1e-12
YJL128C Chr10 complement(178097..180103) [2007 bp, 668 aa] {ON} ...    74   1e-12
Smik_11.62 Chr11 complement(120153..121346) [1194 bp, 397 aa] {O...    72   1e-12
KLTH0H08316g Chr8 (730027..731094) [1068 bp, 355 aa] {ON} simila...    72   1e-12
Suva_11.99 Chr11 (192143..194197) [2055 bp, 684 aa] {ON} YMR104C...    73   1e-12
Skud_11.103 Chr11 (192587..194629) [2043 bp, 680 aa] {ON} YMR104...    73   1e-12
CAGL0J11638g Chr10 complement(1130744..1132984) [2241 bp, 746 aa...    73   1e-12
Kwal_26.8751 s26 complement(928853..931399) [2547 bp, 848 aa] {O...    74   1e-12
NCAS0I02850 Chr9 (529637..532042) [2406 bp, 801 aa] {ON} Anc_1.180     73   1e-12
KNAG0A06140 Chr1 (931737..933437) [1701 bp, 566 aa] {ON} Anc_2.4...    73   1e-12
TBLA0I00910 Chr9 complement(170526..173945) [3420 bp, 1139 aa] {...    74   2e-12
CAGL0B02739g Chr2 complement(262590..264620) [2031 bp, 676 aa] {...    73   2e-12
Suva_11.56 Chr11 complement(119479..120675) [1197 bp, 398 aa] {O...    72   2e-12
ZYRO0G20306g Chr7 complement(1675578..1677227) [1650 bp, 549 aa]...    73   2e-12
YPL141C Chr16 complement(283464..286061) [2598 bp, 865 aa] {ON} ...    73   2e-12
SAKL0A00484g Chr1 complement(57938..60544) [2607 bp, 868 aa] {ON...    73   2e-12
Suva_7.375 Chr7 (643870..645591) [1722 bp, 573 aa] {ON} YGR092W ...    73   2e-12
Suva_2.105 Chr2 (186428..187489) [1062 bp, 353 aa] {ON} YBL016W ...    72   2e-12
YKL166C Chr11 complement(134509..135705) [1197 bp, 398 aa] {ON} ...    72   2e-12
TDEL0F00840 Chr6 (144884..146875) [1992 bp, 663 aa] {ON} Anc_2.9...    73   2e-12
CAGL0M13541g Chr13 (1333846..1335714) [1869 bp, 622 aa] {ON} sim...    73   2e-12
Smik_6.178 Chr6 (291601..293322) [1722 bp, 573 aa] {ON} YGR092W ...    72   2e-12
Skud_11.58 Chr11 complement(120855..122042) [1188 bp, 395 aa] {O...    72   2e-12
CAGL0J04290g Chr10 complement(403542..404615) [1074 bp, 357 aa] ...    71   2e-12
Skud_11.56 Chr11 complement(117617..119776) [2160 bp, 719 aa] {O...    73   2e-12
TPHA0B01520 Chr2 complement(336164..339616) [3453 bp, 1150 aa] {...    73   2e-12
KNAG0J02660 Chr10 (495011..497425) [2415 bp, 804 aa] {ON} Anc_1....    73   2e-12
TPHA0H00420 Chr8 complement(82575..85691) [3117 bp, 1038 aa] {ON...    73   2e-12
Kwal_27.9763 s27 (54483..57089) [2607 bp, 868 aa] {ON} YAR019C (...    73   2e-12
KLTH0E06776g Chr5 complement(622147..625575) [3429 bp, 1142 aa] ...    73   2e-12
KAFR0F01940 Chr6 complement(379908..382283) [2376 bp, 791 aa] {O...    73   2e-12
NCAS0B01470 Chr2 (241003..243186) [2184 bp, 727 aa] {ON} Anc_8.654     73   2e-12
KNAG0D02140 Chr4 complement(362745..365357) [2613 bp, 870 aa] {O...    73   2e-12
YDL108W Chr4 (267698..267725,267807..268699) [921 bp, 306 aa] {O...    70   2e-12
CAGL0J06072g Chr10 complement(574501..576822) [2322 bp, 773 aa] ...    73   2e-12
KNAG0C01820 Chr3 (355604..357376) [1773 bp, 590 aa] {ON}               72   2e-12
AEL115C Chr5 complement(405062..406222) [1161 bp, 386 aa] {ON} S...    71   2e-12
Skud_6.89 Chr6 (166257..167594) [1338 bp, 446 aa] {ON} YFR014C (...    72   2e-12
ZYRO0D17468g Chr4 (1439376..1441958) [2583 bp, 860 aa] {ON} weak...    73   2e-12
KLLA0A05819g Chr1 (541545..543659) [2115 bp, 704 aa] {ON} simila...    72   2e-12
TPHA0G01710 Chr7 complement(350452..352869) [2418 bp, 805 aa] {O...    73   2e-12
Smik_10.106 Chr10 complement(175752..177776) [2025 bp, 674 aa] {...    72   2e-12
KNAG0I01480 Chr9 (287733..289055) [1323 bp, 440 aa] {ON} Anc_1.3...    72   2e-12
Ecym_4448 Chr4 complement(917136..918872) [1737 bp, 578 aa] {ON}...    72   3e-12
TDEL0A06000 Chr1 (1053427..1055799) [2373 bp, 790 aa] {ON} Anc_8...    72   3e-12
AER232C Chr5 complement(1066272..1067981) [1710 bp, 569 aa] {ON}...    72   3e-12
SAKL0D07656g Chr4 complement(627469..628767) [1299 bp, 432 aa] {...    72   3e-12
Skud_7.391 Chr7 (652479..654200) [1722 bp, 573 aa] {ON} YGR092W ...    72   3e-12
NCAS0B08280 Chr2 (1579804..1581033) [1230 bp, 409 aa] {ON} Anc_1...    71   3e-12
NDAI0D01620 Chr4 (386654..388132) [1479 bp, 492 aa] {ON} Anc_5.274     72   3e-12
Ecym_5251 Chr5 (522785..525466) [2682 bp, 893 aa] {ON} similar t...    72   3e-12
KAFR0G00480 Chr7 complement(131066..132268) [1203 bp, 400 aa] {O...    71   3e-12
NCAS0B06000 Chr2 complement(1134919..1135808,1135909..1135957) [...    70   3e-12
NDAI0B00220 Chr2 (29825..32470) [2646 bp, 881 aa] {ON} Anc_1.180       72   3e-12
Skud_13.465 Chr13 (826172..827929) [1758 bp, 585 aa] {ON} YMR291...    72   3e-12
KLLA0F01276g Chr6 complement(120001..121560) [1560 bp, 519 aa] {...    72   3e-12
TBLA0I01370 Chr9 complement(294202..296526) [2325 bp, 774 aa] {O...    72   3e-12
Smik_10.91 Chr10 complement(145745..148153) [2409 bp, 802 aa] {O...    72   3e-12
Skud_10.87 Chr10 complement(153140..155164) [2025 bp, 674 aa] {O...    72   3e-12
KLTH0D10714g Chr4 (880389..883007) [2619 bp, 872 aa] {ON} simila...    72   3e-12
KAFR0A07370 Chr1 complement(1487868..1490012) [2145 bp, 714 aa] ...    72   3e-12
CAGL0G05720g Chr7 complement(547617..549833) [2217 bp, 738 aa] {...    72   3e-12
KAFR0F01790 Chr6 complement(347491..349884) [2394 bp, 797 aa] {O...    72   3e-12
KAFR0A06790 Chr1 complement(1371892..1372806) [915 bp, 304 aa] {...    70   4e-12
Suva_16.169 Chr16 complement(292738..295314) [2577 bp, 858 aa] {...    72   4e-12
TDEL0C03740 Chr3 (658468..660702) [2235 bp, 744 aa] {ON} Anc_1.1...    72   4e-12
TBLA0D02240 Chr4 complement(561856..566547) [4692 bp, 1563 aa] {...    72   4e-12
SAKL0E03608g Chr5 complement(291806..294007) [2202 bp, 733 aa] {...    72   4e-12
KAFR0G01810 Chr7 (386620..389130) [2511 bp, 836 aa] {ON} Anc_1.2...    72   4e-12
YGR092W Chr7 (668189..669907) [1719 bp, 572 aa] {ON}  DBF2Ser/Th...    72   4e-12
YJL141C Chr10 complement(147967..150390) [2424 bp, 807 aa] {ON} ...    72   4e-12
Smik_4.128 Chr4 (244339..244354,244439..245331) [909 bp, 302 aa]...    70   4e-12
Kwal_17.2687 s17 complement(6084..7172) [1089 bp, 362 aa] {ON} Y...    70   4e-12
KNAG0A03040 Chr1 complement(372150..374084) [1935 bp, 644 aa] {O...    72   4e-12
KLTH0A07458g Chr1 (620459..623080) [2622 bp, 873 aa] {ON} simila...    72   4e-12
TPHA0D02740 Chr4 (566279..568819) [2541 bp, 846 aa] {ON} Anc_5.5...    72   4e-12
AEL118C Chr5 complement(399738..401789) [2052 bp, 683 aa] {ON} S...    72   4e-12
Kpol_463.19 s463 complement(53246..55561) [2316 bp, 771 aa] {ON}...    72   4e-12
KNAG0H00790 Chr8 complement(124926..126131) [1206 bp, 401 aa] {O...    71   4e-12
KLTH0F04730g Chr6 complement(417013..419133) [2121 bp, 706 aa] {...    72   4e-12
KLTH0E04334g Chr5 complement(391495..393723) [2229 bp, 742 aa] {...    72   4e-12
TPHA0G02910 Chr7 (624676..626727) [2052 bp, 683 aa] {ON} Anc_2.4...    72   4e-12
NCAS0A04220 Chr1 (855791..857353) [1563 bp, 520 aa] {ON} Anc_2.425     71   4e-12
SAKL0H07084g Chr8 complement(619288..622047) [2760 bp, 919 aa] {...    72   5e-12
KNAG0C02600 Chr3 complement(504486..507134) [2649 bp, 882 aa] {O...    72   5e-12
Kpol_1018.162 s1018 (414868..416904) [2037 bp, 678 aa] {ON} (414...    72   5e-12
NDAI0K01370 Chr11 (313672..315714) [2043 bp, 680 aa] {ON}              72   5e-12
Suva_4.145 Chr4 complement(268826..270370) [1545 bp, 514 aa] {ON...    71   5e-12
KNAG0K01250 Chr11 (246241..247467) [1227 bp, 408 aa] {ON} Anc_3....    70   5e-12
TDEL0B06320 Chr2 (1118534..1119868) [1335 bp, 444 aa] {ON} Anc_1...    71   5e-12
TDEL0E03520 Chr5 (657779..659251) [1473 bp, 490 aa] {ON} Anc_5.2...    71   6e-12
Kpol_1069.13 s1069 complement(27223..28506) [1284 bp, 427 aa] {O...    70   6e-12
SAKL0A04246g Chr1 complement(396019..397221) [1203 bp, 400 aa] {...    70   6e-12
KLLA0E10539g Chr5 (929989..931104) [1116 bp, 371 aa] {ON} highly...    70   6e-12
Ecym_8400 Chr8 complement(825315..828515) [3201 bp, 1066 aa] {ON...    72   6e-12
Ecym_8098 Chr8 (210698..212857) [2160 bp, 719 aa] {ON} similar t...    71   6e-12
TPHA0B01150 Chr2 complement(259998..262070) [2073 bp, 690 aa] {O...    71   6e-12
YDL101C Chr4 complement(280307..281848) [1542 bp, 513 aa] {ON}  ...    71   6e-12
Ecym_8095 Chr8 (205952..207106) [1155 bp, 384 aa] {ON} similar t...    70   6e-12
TPHA0G02800 Chr7 (597211..598722) [1512 bp, 503 aa] {ON} Anc_2.4...    71   6e-12
TBLA0F02350 Chr6 complement(578797..580467) [1671 bp, 556 aa] {O...    71   6e-12
KLLA0E15313g Chr5 (1362851..1365025) [2175 bp, 724 aa] {ON} simi...    71   7e-12
Kpol_448.13 s448 (25051..27063) [2013 bp, 670 aa] {ON} (25051..2...    71   7e-12
ABL028W Chr2 (345953..348121) [2169 bp, 722 aa] {ON} Syntenic ho...    71   7e-12
TBLA0A01580 Chr1 complement(367370..369976) [2607 bp, 868 aa] {O...    71   7e-12
TBLA0D04420 Chr4 complement(1097314..1099356) [2043 bp, 680 aa] ...    71   7e-12
TBLA0A10420 Chr1 (2562614..2564092) [1479 bp, 492 aa] {ON} Anc_5...    70   8e-12
Skud_15.399 Chr15 (714789..717212) [2424 bp, 807 aa] {ON} YOR233...    71   8e-12
Smik_13.507 Chr13 (835298..837058) [1761 bp, 586 aa] {ON} YMR291...    71   8e-12
KNAG0D00210 Chr4 complement(22721..25222) [2502 bp, 833 aa] {ON}...    71   8e-12
SAKL0E05984g Chr5 complement(485895..487391,487462..487482) [151...    70   8e-12
KAFR0H01460 Chr8 complement(269957..271705) [1749 bp, 582 aa] {O...    71   8e-12
KNAG0D01090 Chr4 complement(183319..184437) [1119 bp, 372 aa] {O...    70   8e-12
CAGL0L07326g Chr12 (810529..812049) [1521 bp, 506 aa] {ON} simil...    70   8e-12
KNAG0G01240 Chr7 (277868..280597) [2730 bp, 909 aa] {ON} Anc_8.1...    71   8e-12
TBLA0H02950 Chr8 complement(721123..723906) [2784 bp, 927 aa] {O...    71   8e-12
Suva_6.208 Chr6 (369853..371880) [2028 bp, 675 aa] {ON} YJL128C ...    71   8e-12
NCAS0E01150 Chr5 complement(217594..219315) [1722 bp, 573 aa] {O...    70   8e-12
KLLA0B13112g Chr2 complement(1146006..1148198) [2193 bp, 730 aa]...    71   9e-12
Skud_7.92 Chr7 complement(169006..170697) [1692 bp, 563 aa] {ON}...    70   9e-12
NCAS0C04120 Chr3 complement(840008..842755) [2748 bp, 915 aa] {O...    71   9e-12
TPHA0P01270 Chr16 complement(254480..257137) [2658 bp, 885 aa] {...    71   9e-12
ZYRO0E05588g Chr5 (430271..431686) [1416 bp, 471 aa] {ON} simila...    70   9e-12
KLTH0D04818g Chr4 (439491..441566) [2076 bp, 691 aa] {ON} simila...    70   9e-12
ZYRO0C15862g Chr3 (1239992..1241305) [1314 bp, 437 aa] {ON} simi...    70   1e-11
KAFR0E01810 Chr5 complement(372094..373524) [1431 bp, 476 aa] {O...    70   1e-11
KAFR0J02620 Chr10 complement(502187..504265) [2079 bp, 692 aa] {...    70   1e-11
TBLA0B00770 Chr2 complement(168444..170519) [2076 bp, 691 aa] {O...    70   1e-11
NCAS0I02840 Chr9 (528136..529344) [1209 bp, 402 aa] {ON} Anc_1.2...    70   1e-11
TDEL0A06140 Chr1 complement(1074016..1076601) [2586 bp, 861 aa] ...    70   1e-11
KLLA0E01585g Chr5 (149305..149370,149488..150960) [1539 bp, 512 ...    70   1e-11
KLLA0D11814g Chr4 complement(1007240..1009021) [1782 bp, 593 aa]...    70   1e-11
ZYRO0B07854g Chr2 complement(613992..616007) [2016 bp, 671 aa] {...    70   1e-11
Skud_10.73 Chr10 complement(123049..125436) [2388 bp, 795 aa] {O...    70   1e-11
SAKL0C05280g Chr3 complement(502205..504490) [2286 bp, 761 aa] {...    70   1e-11
KLTH0E09658g Chr5 (869857..870957) [1101 bp, 366 aa] {ON} highly...    69   1e-11
YKL168C Chr11 complement(131288..133462) [2175 bp, 724 aa] {ON} ...    70   1e-11
Kwal_56.24091 s56 (845680..846825) [1146 bp, 381 aa] {ON} YPL209...    69   1e-11
Ecym_4523 Chr4 (1039929..1042070) [2142 bp, 713 aa] {ON} similar...    70   1e-11
ADR033W Chr4 (764716..766449) [1734 bp, 577 aa] {ON} Syntenic ho...    70   1e-11
KAFR0K00280 Chr11 complement(64906..65988) [1083 bp, 360 aa] {ON...    69   1e-11
KLLA0C00979g Chr3 (73295..74746) [1452 bp, 483 aa] {ON} similar ...    70   1e-11
Skud_16.140 Chr16 complement(255090..257687) [2598 bp, 865 aa] {...    70   1e-11
KLLA0C18568g Chr3 (1639958..1642282) [2325 bp, 774 aa] {ON} simi...    70   1e-11
TBLA0B03860 Chr2 (887855..890821) [2967 bp, 988 aa] {ON} Anc_8.6...    70   1e-11
NDAI0I00250 Chr9 (42174..44867) [2694 bp, 897 aa] {ON} Anc_3.177...    70   1e-11
TDEL0B04490 Chr2 (792559..793629) [1071 bp, 356 aa] {ON} Anc_8.1...    69   1e-11
CAGL0H01639g Chr8 (158967..160532) [1566 bp, 521 aa] {ON} simila...    70   1e-11
TBLA0C01750 Chr3 (412762..415707) [2946 bp, 981 aa] {ON} Anc_8.6...    70   1e-11
ZYRO0A05192g Chr1 complement(416951..418198) [1248 bp, 415 aa] {...    69   1e-11
ZYRO0G02530g Chr7 (194463..196577) [2115 bp, 704 aa] {ON} highly...    70   1e-11
ZYRO0G18502g Chr7 (1528075..1529265) [1191 bp, 396 aa] {ON} simi...    69   1e-11
KNAG0C02080 Chr3 complement(404332..405588) [1257 bp, 418 aa] {O...    69   1e-11
NCAS0A06680 Chr1 (1320265..1321704) [1440 bp, 479 aa] {ON} Anc_5...    69   1e-11
Kpol_1072.19 s1072 (44906..47596) [2691 bp, 896 aa] {ON} (44906....    70   2e-11
SAKL0H11352g Chr8 complement(975064..976857) [1794 bp, 597 aa] {...    70   2e-11
SAKL0B05082g Chr2 (436707..438896) [2190 bp, 729 aa] {ON} simila...    70   2e-11
Suva_15.155 Chr15 complement(267680..269038) [1359 bp, 452 aa] {...    69   2e-11
TBLA0D00220 Chr4 (52218..54500) [2283 bp, 760 aa] {ON} Anc_2.96 ...    70   2e-11
CAGL0D02002g Chr4 (207419..209080) [1662 bp, 553 aa] {ON} simila...    69   2e-11
NCAS0H03070 Chr8 complement(590494..592440) [1947 bp, 648 aa] {O...    70   2e-11
Kwal_27.11830 s27 (964584..966311) [1728 bp, 575 aa] {ON} YPL042...    70   2e-11
KNAG0C04310 Chr3 complement(842994..846503) [3510 bp, 1169 aa] {...    70   2e-11
KAFR0C04780 Chr3 (948771..951131) [2361 bp, 786 aa] {ON} Anc_6.3...    70   2e-11
SAKL0H19668g Chr8 (1736301..1737674) [1374 bp, 457 aa] {ON} high...    69   2e-11
ACR133C Chr3 complement(581468..584023) [2556 bp, 851 aa] {ON} S...    70   2e-11
TPHA0E02840 Chr5 (594381..595589) [1209 bp, 402 aa] {ON} Anc_6.2...    69   2e-11
SAKL0B07304g Chr2 (625541..627007) [1467 bp, 488 aa] {ON} simila...    69   2e-11
YMR291W Chr13 (852630..854390) [1761 bp, 586 aa] {ON}  TDA1Prote...    69   2e-11
ZYRO0D03344g Chr4 complement(278347..280326) [1980 bp, 659 aa] {...    69   2e-11
NCAS0F01460 Chr6 complement(290441..292465) [2025 bp, 674 aa] {O...    69   2e-11
TPHA0H00750 Chr8 complement(150811..152043) [1233 bp, 410 aa] {O...    69   2e-11
NDAI0A00940 Chr1 complement(193710..195800) [2091 bp, 696 aa] {O...    69   2e-11
TPHA0G02480 Chr7 (509815..511860) [2046 bp, 681 aa] {ON} Anc_2.4...    69   2e-11
KLLA0F02838g Chr6 (264329..266596) [2268 bp, 755 aa] {ON} simila...    69   2e-11
Smik_4.135 Chr4 complement(256861..258402) [1542 bp, 513 aa] {ON...    69   2e-11
Kwal_23.3992 s23 complement(515493..517208) [1716 bp, 571 aa] {O...    69   2e-11
NDAI0C03900 Chr3 complement(883841..885310) [1470 bp, 489 aa] {O...    69   2e-11
NCAS0B03740 Chr2 complement(668231..671380) [3150 bp, 1049 aa] {...    70   2e-11
YOL016C Chr15 complement(294777..296120) [1344 bp, 447 aa] {ON} ...    69   2e-11
KLLA0A09713g Chr1 (851952..853625) [1674 bp, 557 aa] {ON} simila...    69   3e-11
Kwal_33.13846 s33 complement(419630..420757) [1128 bp, 375 aa] {...    68   3e-11
Smik_15.153 Chr15 complement(261920..263248) [1329 bp, 442 aa] {...    69   3e-11
Smik_11.60 Chr11 complement(116793..118970) [2178 bp, 725 aa] {O...    69   3e-11
Ecym_2194 Chr2 complement(381633..382733) [1101 bp, 366 aa] {ON}...    68   3e-11
KLTH0H11396g Chr8 complement(973355..974668) [1314 bp, 437 aa] {...    69   3e-11
KNAG0J01590 Chr10 (292565..294982) [2418 bp, 805 aa] {ON} Anc_8....    69   3e-11
Kpol_2002.75 s2002 complement(168123..169394) [1272 bp, 423 aa] ...    68   3e-11
TDEL0F03120 Chr6 (570471..572192) [1722 bp, 573 aa] {ON} Anc_3.4...    69   3e-11
Suva_7.106 Chr7 (202969..204540) [1572 bp, 523 aa] {ON} YGL158W ...    69   3e-11
TPHA0B03850 Chr2 (909219..910841) [1623 bp, 540 aa] {ON} Anc_1.4...    69   3e-11
TDEL0A00600 Chr1 complement(101753..102877) [1125 bp, 374 aa] {O...    68   3e-11
Kwal_26.7635 s26 (451306..453381) [2076 bp, 691 aa] {ON} YKL126W...    69   3e-11
YGL179C Chr7 complement(163409..165091) [1683 bp, 560 aa] {ON}  ...    69   3e-11
YOR233W Chr15 (775846..778248) [2403 bp, 800 aa] {ON}  KIN4Serin...    69   3e-11
Skud_15.144 Chr15 complement(254620..255969) [1350 bp, 449 aa] {...    68   3e-11
SAKL0C05368g Chr3 complement(510576..511832) [1257 bp, 418 aa] {...    68   3e-11
Suva_13.481 Chr13 (834531..836279) [1749 bp, 582 aa] {ON} YMR291...    69   3e-11
Kwal_27.10004 s27 complement(156153..158360) [2208 bp, 735 aa] {...    69   3e-11
KLTH0F12012g Chr6 complement(1013169..1014881) [1713 bp, 570 aa]...    69   3e-11
Kwal_26.7552 s26 (416444..417829) [1386 bp, 461 aa] {ON} YKL139W...    68   3e-11
ZYRO0E07018g Chr5 (531316..532419) [1104 bp, 367 aa] {ON} simila...    68   3e-11
KAFR0C00920 Chr3 complement(185475..186674) [1200 bp, 399 aa] {O...    68   3e-11
KAFR0K00330 Chr11 (74162..75283) [1122 bp, 373 aa] {ON} Anc_6.21...    68   4e-11
Kpol_161.2 s161 complement(3125..4246) [1122 bp, 373 aa] {ON} co...    68   4e-11
KLLA0D14905g Chr4 (1256065..1257768) [1704 bp, 567 aa] {ON} simi...    69   4e-11
ACR249C Chr3 complement(797020..798951) [1932 bp, 643 aa] {ON} S...    69   4e-11
NDAI0D04110 Chr4 (966439..967560) [1122 bp, 373 aa] {ON} Anc_4.192     67   4e-11
TBLA0B08650 Chr2 (2065061..2066308) [1248 bp, 415 aa] {ON} Anc_3...    68   4e-11
TDEL0C04800 Chr3 (866157..867467) [1311 bp, 436 aa] {ON} Anc_3.3...    68   4e-11
TBLA0A08290 Chr1 complement(2039328..2041376) [2049 bp, 682 aa] ...    69   4e-11
Kwal_0.96 s0 complement(46082..47365) [1284 bp, 427 aa] {ON} YOL...    68   4e-11
CAGL0H10318g Chr8 complement(1006299..1007222) [924 bp, 307 aa] ...    67   4e-11
SAKL0D12628g Chr4 (1048973..1051429) [2457 bp, 818 aa] {ON} weak...    69   4e-11
NDAI0G03920 Chr7 complement(934765..935889) [1125 bp, 374 aa] {O...    67   4e-11
TBLA0A02030 Chr1 complement(491365..492576) [1212 bp, 403 aa] {O...    68   4e-11
CAGL0B01925g Chr2 (176316..179150) [2835 bp, 944 aa] {ON} simila...    69   4e-11
TDEL0A02220 Chr1 (402496..404565) [2070 bp, 689 aa] {ON} Anc_2.4...    69   4e-11
TDEL0E05310 Chr5 (972769..973893) [1125 bp, 374 aa] {ON} Anc_6.2...    67   4e-11
TPHA0E03300 Chr5 (703575..704912) [1338 bp, 445 aa] {ON} Anc_1.1...    68   4e-11
KLTH0F04840g Chr6 complement(427194..428339) [1146 bp, 381 aa] {...    67   5e-11
KLTH0H03982g Chr8 complement(363432..364628) [1197 bp, 398 aa] {...    67   5e-11
Kpol_2001.30 s2001 (87817..90093) [2277 bp, 758 aa] {ON} (87817....    69   5e-11
ADL389W Chr4 (27641..29776) [2136 bp, 711 aa] {ON} Syntenic homo...    69   5e-11
TPHA0B03130 Chr2 complement(719624..721372) [1749 bp, 582 aa] {O...    68   5e-11
Suva_11.54 Chr11 complement(116221..118401) [2181 bp, 726 aa] {O...    69   5e-11
NDAI0E01290 Chr5 complement(255593..257782) [2190 bp, 729 aa] {O...    69   5e-11
Kpol_1033.1 s1033 complement(1..828) [828 bp, 276 aa] {ON} compl...    66   5e-11
CAGL0G09020g Chr7 (860266..861351) [1086 bp, 361 aa] {ON} highly...    67   5e-11
Ecym_2457 Chr2 (888054..890165) [2112 bp, 703 aa] {ON} similar t...    68   5e-11
Skud_10.49 Chr10 complement(81651..84206) [2556 bp, 851 aa] {ON}...    68   5e-11
Kpol_183.1 s183 (158..2257) [2100 bp, 699 aa] {ON} (158..2257) [...    68   6e-11
Kpol_1018.137 s1018 complement(366178..367914) [1737 bp, 578 aa]...    68   6e-11
Ecym_6307 Chr6 (578677..580227) [1551 bp, 516 aa] {ON} similar t...    68   6e-11
Suva_16.274 Chr16 complement(476249..477916) [1668 bp, 555 aa] {...    68   6e-11
ZYRO0D10252g Chr4 (860458..863109) [2652 bp, 883 aa] {ON} simila...    68   6e-11
Skud_15.39 Chr15 (69445..71412) [1968 bp, 655 aa] {ON} YOL113W (...    68   6e-11
Suva_8.284 Chr8 (514891..517317) [2427 bp, 808 aa] {ON} YOR233W ...    68   6e-11
KLLA0D09328g Chr4 complement(788565..791705) [3141 bp, 1046 aa] ...    68   6e-11
KNAG0G01430 Chr7 complement(322758..323822) [1065 bp, 354 aa] {O...    67   6e-11
TPHA0A05460 Chr1 (1233608..1235170) [1563 bp, 520 aa] {ON} Anc_5...    68   6e-11
Skud_15.25 Chr15 complement(43728..44864) [1137 bp, 378 aa] {ON}...    67   6e-11
NCAS0C04540 Chr3 complement(929920..931056) [1137 bp, 378 aa] {O...    67   6e-11
TDEL0G00630 Chr7 complement(128151..129764) [1614 bp, 537 aa] {O...    67   7e-11
Kpol_265.1 s265 (4826..7099) [2274 bp, 757 aa] {ON} (4826..7099)...    68   7e-11
SAKL0F06094g Chr6 (457709..459442) [1734 bp, 577 aa] {ON} unipro...    68   7e-11
TBLA0C02310 Chr3 complement(546887..548596) [1710 bp, 569 aa] {O...    68   7e-11
Ecym_2042 Chr2 complement(67312..68397) [1086 bp, 361 aa] {ON} s...    67   7e-11
Suva_16.160 Chr16 (277393..280149) [2757 bp, 918 aa] {ON} YPL150...    68   7e-11
NDAI0B03310 Chr2 complement(844616..845557) [942 bp, 313 aa] {ON...    66   7e-11
TBLA0B03970 Chr2 complement(904167..907793) [3627 bp, 1208 aa] {...    68   7e-11
TBLA0A10690 Chr1 (2642723..2645632) [2910 bp, 969 aa] {ON} Anc_4...    68   7e-11
TPHA0F02150 Chr6 complement(475516..477768) [2253 bp, 750 aa] {O...    68   7e-11
Kpol_1012.6 s1012 (11581..13467) [1887 bp, 628 aa] {ON} (11581.....    68   7e-11
CAGL0M03729g Chr13 complement(420316..422901) [2586 bp, 861 aa] ...    68   7e-11
Smik_15.417 Chr15 (725513..727933) [2421 bp, 806 aa] {ON} YOR233...    68   7e-11
KLTH0E11396g Chr5 (1018348..1020069) [1722 bp, 573 aa] {ON} simi...    67   7e-11
TBLA0B06510 Chr2 (1536156..1538489) [2334 bp, 777 aa] {ON} Anc_1...    68   8e-11
Suva_4.138 Chr4 (256421..257197) [777 bp, 258 aa] {ON} YDL108W (...    65   8e-11
KLLA0E07437g Chr5 complement(672690..673787) [1098 bp, 365 aa] {...    67   8e-11
Kwal_26.8709 s26 (907885..910374) [2490 bp, 829 aa] {ON} YPL141C...    68   8e-11
Kpol_1045.46 s1045 complement(106567..108372) [1806 bp, 601 aa] ...    67   8e-11
NCAS0D00630 Chr4 complement(107310..108593) [1284 bp, 427 aa] {O...    67   9e-11
Ecym_2540 Chr2 (1048071..1049792) [1722 bp, 573 aa] {ON} similar...    67   9e-11
NDAI0A06130 Chr1 complement(1391744..1394203) [2460 bp, 819 aa] ...    67   9e-11
ZYRO0G17094g Chr7 complement(1404552..1406804) [2253 bp, 750 aa]...    67   9e-11
KNAG0J01670 Chr10 complement(304021..307050) [3030 bp, 1009 aa] ...    68   9e-11
ADL168C Chr4 complement(398517..399605) [1089 bp, 362 aa] {ON} S...    66   1e-10
Skud_14.40 Chr14 (62496..65006) [2511 bp, 836 aa] {ON} YNL298W (...    67   1e-10
Kpol_1037.7 s1037 (15938..17182) [1245 bp, 414 aa] {ON} (15938.....    67   1e-10
Suva_6.222 Chr6 (400975..402096) [1122 bp, 373 aa] {ON} YJL141C ...    66   1e-10
Suva_10.464 Chr10 (809505..811721) [2217 bp, 738 aa] {ON} YLR362...    67   1e-10
AER222C Chr5 complement(1043479..1044750) [1272 bp, 423 aa] {ON}...    66   1e-10
Suva_7.83 Chr7 complement(159329..161038) [1710 bp, 569 aa] {ON}...    67   1e-10
TBLA0A07770 Chr1 complement(1916632..1917939) [1308 bp, 435 aa] ...    67   1e-10
KNAG0M01450 Chr13 (254622..256061) [1440 bp, 479 aa] {ON}              67   1e-10
NDAI0J01250 Chr10 complement(291314..294844) [3531 bp, 1176 aa] ...    67   1e-10
TPHA0O01120 Chr15 complement(217462..218751) [1290 bp, 429 aa] {...    66   1e-10
TBLA0C06820 Chr3 (1645811..1647508) [1698 bp, 565 aa] {ON} Anc_5...    67   1e-10
Suva_6.246 Chr6 (439815..442373) [2559 bp, 852 aa] {ON} YJL165C ...    67   1e-10
AFL101C Chr6 complement(249144..250247) [1104 bp, 367 aa] {ON} S...    66   1e-10
YGR052W Chr7 (593596..594705) [1110 bp, 369 aa] {ON}  FMP48Putat...    66   1e-10
Smik_10.65 Chr10 complement(104987..107545) [2559 bp, 852 aa] {O...    67   1e-10
TPHA0F03520 Chr6 (755480..757756) [2277 bp, 758 aa] {ON} Anc_1.5...    67   1e-10
TPHA0L01350 Chr12 (282034..283884) [1851 bp, 616 aa] {ON}              67   1e-10
KNAG0A02220 Chr1 complement(198240..199979) [1740 bp, 579 aa] {O...    67   1e-10
Ecym_4647 Chr4 (1261859..1263511) [1653 bp, 550 aa] {ON} similar...    67   1e-10
AEL185C Chr5 complement(291129..292676) [1548 bp, 515 aa] {ON} S...    67   1e-10
ACR196C Chr3 complement(692321..693913) [1593 bp, 530 aa] {ON} S...    67   1e-10
YJL165C Chr10 complement(106894..109461) [2568 bp, 855 aa] {ON} ...    67   1e-10
Ecym_8339 Chr8 (684113..686875) [2763 bp, 920 aa] {ON} similar t...    67   1e-10
Kpol_530.41 s530 (94710..96326) [1617 bp, 538 aa] {ON} (94710..9...    67   1e-10
KNAG0F02900 Chr6 (549477..551426) [1950 bp, 649 aa] {ON}               67   1e-10
Kwal_27.11919 s27 (1003201..1003827) [627 bp, 209 aa] {OFF} YBR1...    64   1e-10
Kpol_1033.50 s1033 complement(126043..127197) [1155 bp, 384 aa] ...    66   1e-10
AGL249C Chr7 complement(234347..236092) [1746 bp, 581 aa] {ON} S...    67   1e-10
Kpol_1031.76 s1031 (193193..194923) [1731 bp, 576 aa] {ON} (1931...    67   1e-10
CAGL0L12650g Chr12 (1360085..1361788) [1704 bp, 567 aa] {ON} sim...    67   1e-10
KNAG0C02430 Chr3 complement(472213..474804) [2592 bp, 863 aa] {O...    67   1e-10
Ecym_6040 Chr6 complement(77854..80544) [2691 bp, 896 aa] {ON} s...    67   1e-10
TPHA0D03940 Chr4 (825250..826989) [1740 bp, 579 aa] {ON} Anc_3.4...    67   2e-10
YLR362W Chr12 (849866..852019) [2154 bp, 717 aa] {ON}  STE11Sign...    67   2e-10
TPHA0C00160 Chr3 complement(17339..19603) [2265 bp, 754 aa] {ON}...    67   2e-10
Kpol_1065.3 s1065 complement(4445..5575) [1131 bp, 376 aa] {ON} ...    65   2e-10
NDAI0B00210 Chr2 (27983..29185) [1203 bp, 400 aa] {ON} Anc_1.182       66   2e-10
CAGL0F04741g Chr6 (478256..479584) [1329 bp, 442 aa] {ON} simila...    66   2e-10
Smik_12.450 Chr12 (788896..791106) [2211 bp, 736 aa] {ON} YLR362...    67   2e-10
ZYRO0C02288g Chr3 complement(181604..184327) [2724 bp, 907 aa] {...    67   2e-10
Kwal_56.24059 s56 complement(829673..830734) [1062 bp, 353 aa] {...    65   2e-10
Ecym_6092 Chr6 (178965..180299) [1335 bp, 444 aa] {ON} similar t...    66   2e-10
KNAG0L00520 Chr12 (79786..80892) [1107 bp, 368 aa] {ON} Anc_7.86...    65   2e-10
Ecym_8004 Chr8 complement(5273..7957) [2685 bp, 894 aa] {ON} sim...    67   2e-10
ZYRO0F08778g Chr6 (702733..703626) [894 bp, 297 aa] {ON} highly ...    65   2e-10
CAGL0H07535g Chr8 (736241..737137) [897 bp, 298 aa] {ON} highly ...    65   2e-10
Kpol_534.14 s534 (34465..34591,34724..35616) [1020 bp, 339 aa] {...    65   2e-10
NDAI0E02390 Chr5 complement(496256..498907) [2652 bp, 883 aa] {O...    67   2e-10
TDEL0D00330 Chr4 complement(55638..57872) [2235 bp, 744 aa] {ON}...    67   2e-10
Suva_15.32 Chr15 complement(56314..57447) [1134 bp, 377 aa] {ON}...    65   2e-10
NDAI0H03520 Chr8 (860096..861472) [1377 bp, 458 aa] {ON}               66   2e-10
Kwal_55.22001 s55 (1069907..1070998) [1092 bp, 363 aa] {ON} YNL3...    65   2e-10
TDEL0E00690 Chr5 (144269..146770) [2502 bp, 833 aa] {ON} Anc_3.6...    67   2e-10
NCAS0J00960 Chr10 (157010..159121) [2112 bp, 703 aa] {ON}              66   2e-10
NCAS0B08300 Chr2 (1582859..1584796) [1938 bp, 645 aa] {ON} Anc_1...    66   2e-10
KAFR0A08360 Chr1 complement(1677561..1680050) [2490 bp, 829 aa] ...    66   2e-10
KNAG0D01140 Chr4 (192308..193495) [1188 bp, 395 aa] {ON}               65   2e-10
Skud_4.154 Chr4 complement(275783..277324) [1542 bp, 513 aa] {ON...    66   2e-10
TDEL0B01470 Chr2 complement(257397..259169) [1773 bp, 590 aa] {O...    66   2e-10
Ecym_2566 Chr2 (1105239..1106126) [888 bp, 295 aa] {ON} similar ...    64   2e-10
ZYRO0G19052g Chr7 (1576638..1580033) [3396 bp, 1131 aa] {ON} sim...    67   2e-10
KLTH0H04180g Chr8 (381111..382172) [1062 bp, 353 aa] {ON} highly...    65   2e-10
Ecym_3525 Chr3 (993328..995784) [2457 bp, 818 aa] {ON} similar t...    66   2e-10
Skud_16.76 Chr16 (139571..140719) [1149 bp, 382 aa] {ON} YPL203W...    65   2e-10
KLTH0C02662g Chr3 complement(240347..242674) [2328 bp, 775 aa] {...    66   2e-10
KNAG0M00190 Chr13 complement(25224..27602) [2379 bp, 792 aa] {ON...    66   2e-10
Ecym_2405 Chr2 (788655..791222) [2568 bp, 855 aa] {ON} similar t...    66   2e-10
Skud_4.146 Chr4 (263181..263196,263281..264173) [909 bp, 302 aa]...    64   2e-10
CAGL0K10604g Chr11 complement(1030055..1031395) [1341 bp, 446 aa...    65   2e-10
KLTH0G13288g Chr7 complement(1139058..1142486) [3429 bp, 1142 aa...    66   3e-10
Smik_14.34 Chr14 (53272..55788) [2517 bp, 838 aa] {ON} YNL298W (...    66   3e-10
Suva_15.411 Chr15 (716095..718542) [2448 bp, 815 aa] {ON} YHR205...    66   3e-10
Smik_6.408 Chr6 complement(657018..658163) [1146 bp, 381 aa] {ON...    65   3e-10
NCAS0G03420 Chr7 (628644..630668) [2025 bp, 674 aa] {ON} Anc_1.507     66   3e-10
YPL203W Chr16 (166256..167398) [1143 bp, 380 aa] {ON}  TPK2cAMP-...    65   3e-10
CAGL0E05720g Chr5 (569265..570341) [1077 bp, 358 aa] {ON} simila...    65   3e-10
YOL128C Chr15 complement(78352..79479) [1128 bp, 375 aa] {ON}  Y...    65   3e-10
KLTH0H01584g Chr8 (143065..144453) [1389 bp, 462 aa] {ON} simila...    65   3e-10
AEL205W Chr5 (246871..249252) [2382 bp, 793 aa] {ON} Syntenic ho...    66   3e-10
Suva_16.104 Chr16 (176201..177352) [1152 bp, 383 aa] {ON} YPL203...    65   3e-10
KAFR0B06980 Chr2 (1452754..1455081) [2328 bp, 775 aa] {ON} Anc_4...    66   3e-10
KLTH0F18942g Chr6 (1535941..1537032) [1092 bp, 363 aa] {ON} high...    65   3e-10
KNAG0A05670 Chr1 complement(847460..849016) [1557 bp, 518 aa] {O...    65   3e-10
Kwal_47.17868 s47 (587449..588546) [1098 bp, 365 aa] {ON} YMR139...    65   3e-10
Kwal_56.24584 s56 complement(1063271..1064578) [1308 bp, 435 aa]...    65   3e-10
NDAI0E03080 Chr5 complement(653882..655798) [1917 bp, 638 aa] {O...    65   3e-10
NCAS0A09570 Chr1 complement(1907017..1909200) [2184 bp, 727 aa] ...    65   3e-10
ZYRO0G00506g Chr7 complement(38488..40854) [2367 bp, 788 aa] {ON...    66   3e-10
TDEL0G02620 Chr7 (501589..501613,501677..502566) [915 bp, 304 aa...    64   3e-10
TDEL0D04450 Chr4 complement(811665..812924) [1260 bp, 419 aa] {O...    65   3e-10
KAFR0C03020 Chr3 complement(601565..603121) [1557 bp, 518 aa] {O...    65   3e-10
Smik_8.295 Chr8 (484074..486548) [2475 bp, 824 aa] {ON} YHR205W ...    66   3e-10
YHR205W Chr8 (509363..511837) [2475 bp, 824 aa] {ON}  SCH9AGC fa...    65   4e-10
SAKL0C12870g Chr3 (1145051..1146142) [1092 bp, 363 aa] {ON} high...    64   4e-10
Smik_7.93 Chr7 complement(158441..160132) [1692 bp, 563 aa] {ON}...    65   4e-10
Skud_16.239 Chr16 complement(438063..439727) [1665 bp, 554 aa] {...    65   4e-10
KAFR0F03970 Chr6 (777047..778201) [1155 bp, 384 aa] {ON} Anc_4.1...    65   4e-10
Skud_7.350 Chr7 (580913..582022) [1110 bp, 369 aa] {ON} YGR052W ...    64   4e-10
Suva_14.42 Chr14 (65645..68239) [2595 bp, 864 aa] {ON} YNL298W (...    65   4e-10
Suva_11.86 Chr11 (169096..170685) [1590 bp, 529 aa] {ON} YKL139W...    65   4e-10
KAFR0A01340 Chr1 (259300..261171) [1872 bp, 623 aa] {ON} Anc_1.2...    65   4e-10
KLLA0B03586g Chr2 complement(326871..329075) [2205 bp, 734 aa] {...    65   4e-10
CAGL0E01683g Chr5 complement(166821..167948) [1128 bp, 375 aa] {...    64   4e-10
NDAI0E01690 Chr5 (335849..337051) [1203 bp, 400 aa] {ON} Anc_2.391     65   4e-10
Skud_16.398 Chr16 (712145..713827) [1683 bp, 560 aa] {ON} YPR111...    65   4e-10
NCAS0A06440 Chr1 (1270771..1273020) [2250 bp, 749 aa] {ON} Anc_4...    65   4e-10
Ecym_7473 Chr7 (963826..966045) [2220 bp, 739 aa] {ON} similar t...    65   4e-10
SAKL0H16632g Chr8 complement(1461613..1464801) [3189 bp, 1062 aa...    65   4e-10
TDEL0E05220 Chr5 complement(957515..958597) [1083 bp, 360 aa] {O...    64   4e-10
Suva_5.250 Chr5 (392904..396323) [3420 bp, 1139 aa] {ON} YER129W...    65   4e-10
Ecym_4291 Chr4 complement(620549..623986) [3438 bp, 1145 aa] {ON...    65   4e-10
YPL042C Chr16 complement(473040..474707) [1668 bp, 555 aa] {ON} ...    65   4e-10
KLLA0A06820g Chr1 complement(615686..618004) [2319 bp, 772 aa] {...    65   4e-10
Suva_1.86 Chr1 complement(150761..153685) [2925 bp, 974 aa] {ON}...    65   4e-10
CAGL0M02519g Chr13 complement(290723..292993) [2271 bp, 756 aa] ...    65   4e-10
KLLA0A07403g Chr1 (661261..663900) [2640 bp, 879 aa] {ON} simila...    65   4e-10
Ecym_2744 Chr2 complement(1442759..1444465) [1707 bp, 568 aa] {O...    65   5e-10
Smik_2.300 Chr2 (546211..547107) [897 bp, 298 aa] {ON} YBR160W (...    64   5e-10
YBR160W Chr2 (560078..560974) [897 bp, 298 aa] {ON}  CDC28Cataly...    64   5e-10
TBLA0F00820 Chr6 (209607..211844) [2238 bp, 745 aa] {ON} Anc_3.1...    65   5e-10
ACL053C Chr3 complement(273163..276708) [3546 bp, 1181 aa] {ON} ...    65   5e-10
SAKL0B12364g Chr2 (1060853..1063021) [2169 bp, 722 aa] {ON} high...    65   5e-10
KAFR0H02510 Chr8 complement(476574..479213) [2640 bp, 879 aa] {O...    65   5e-10
NCAS0F02190 Chr6 complement(435844..437706) [1863 bp, 620 aa] {O...    65   5e-10
Kwal_14.2497 s14 complement(784224..785480) [1257 bp, 418 aa] {O...    64   5e-10
ADR379C Chr4 complement(1386598..1388076) [1479 bp, 492 aa] {ON}...    65   5e-10
NDAI0D03420 Chr4 (806856..809261) [2406 bp, 801 aa] {ON} Anc_4.384     65   5e-10
KLLA0F12188g Chr6 (1122745..1124385) [1641 bp, 546 aa] {ON} some...    65   5e-10
KLLA0B09790g Chr2 complement(855327..856214) [888 bp, 295 aa] {O...    63   5e-10
Skud_2.287 Chr2 (527443..528339) [897 bp, 298 aa] {ON} YBR160W (...    63   5e-10
YPL150W Chr16 (268188..270893) [2706 bp, 901 aa] {ON} Protein ki...    65   5e-10
Kwal_23.5290 s23 complement(1095011..1097470) [2460 bp, 819 aa] ...    65   5e-10
Ecym_8399 Chr8 (821221..824766) [3546 bp, 1181 aa] {ON} similar ...    65   6e-10
ZYRO0D02970g Chr4 complement(231363..233669) [2307 bp, 768 aa] {...    65   6e-10
Skud_8.272 Chr8 (478199..480706) [2508 bp, 835 aa] {ON} YHR205W ...    65   6e-10
KNAG0A05920 Chr1 complement(883522..884742) [1221 bp, 406 aa] {O...    64   6e-10
SAKL0A04466g Chr1 (413816..414937) [1122 bp, 373 aa] {ON} highly...    64   6e-10
Smik_15.25 Chr15 complement(46541..47668) [1128 bp, 375 aa] {ON}...    64   6e-10
Suva_4.411 Chr4 (729465..730361) [897 bp, 298 aa] {ON} YBR160W (...    63   6e-10
KAFR0D02900 Chr4 (575853..577313) [1461 bp, 486 aa] {ON} Anc_7.5...    64   6e-10
KLLA0D03190g Chr4 (267933..269051) [1119 bp, 372 aa] {ON} highly...    64   6e-10
KNAG0I01360 Chr9 complement(262712..264556) [1845 bp, 614 aa] {O...    65   6e-10
ZYRO0F11418g Chr6 complement(936573..938117) [1545 bp, 514 aa] {...    64   6e-10
KLTH0D04356g Chr4 (405904..405987,406076..407401) [1410 bp, 469 ...    64   6e-10
Ecym_5624 Chr5 (1256658..1258022) [1365 bp, 454 aa] {ON} similar...    64   6e-10
TBLA0J00990 Chr10 (224999..227335) [2337 bp, 778 aa] {ON} Anc_1....    65   7e-10
TPHA0A02770 Chr1 complement(597703..600129) [2427 bp, 808 aa] {O...    65   7e-10
YGL158W Chr7 (207033..208571) [1539 bp, 512 aa] {ON}  RCK1Protei...    64   7e-10
Kwal_47.16761 s47 (100315..102549) [2235 bp, 744 aa] {ON} YHR205...    65   7e-10
Kpol_1018.148 s1018 (393064..394413) [1350 bp, 449 aa] {ON} (393...    64   7e-10
YPR111W Chr16 (747306..749000) [1695 bp, 564 aa] {ON}  DBF20Ser/...    64   7e-10
Skud_11.113 Chr11 complement(207796..209355) [1560 bp, 519 aa] {...    64   7e-10
Kpol_1004.19 s1004 (36090..36101,36217..37689) [1485 bp, 494 aa]...    64   7e-10
CAGL0B04147g Chr2 (402798..404498) [1701 bp, 566 aa] {ON} highly...    64   7e-10
Smik_16.193 Chr16 complement(350311..351978) [1668 bp, 555 aa] {...    64   8e-10
Smik_6.136 Chr6 (219577..220686) [1110 bp, 369 aa] {ON} YGR052W ...    64   8e-10
KLTH0B06424g Chr2 complement(518184..520328) [2145 bp, 714 aa] {...    64   8e-10
KNAG0E00360 Chr5 (54187..55563) [1377 bp, 458 aa] {ON}                 64   8e-10
NDAI0E01310 Chr5 complement(260484..262094) [1611 bp, 536 aa] {O...    64   8e-10
KAFR0C01720 Chr3 (351078..352208) [1131 bp, 376 aa] {ON} Anc_3.4...    64   8e-10
Kpol_1000.14 s1000 complement(36018..38015) [1998 bp, 665 aa] {O...    64   8e-10
NCAS0B01450 Chr2 (237824..239341) [1518 bp, 505 aa] {ON} Anc_8.652     64   9e-10
KLLA0C04213g Chr3 (386815..387999) [1185 bp, 394 aa] {ON} simila...    64   9e-10
Kpol_1066.45 s1066 complement(76786..79428) [2643 bp, 880 aa] {O...    64   9e-10
Ecym_2203 Chr2 (401590..402648) [1059 bp, 352 aa] {ON} similar t...    63   9e-10
Suva_16.439 Chr16 (755102..756796) [1695 bp, 564 aa] {ON} YPR111...    64   9e-10
KLTH0E11924g Chr5 (1059134..1060030) [897 bp, 298 aa] {ON} highl...    62   9e-10
Smik_16.354 Chr16 (625456..627150) [1695 bp, 564 aa] {ON} YPR111...    64   9e-10
TBLA0D05770 Chr4 (1424960..1427671) [2712 bp, 903 aa] {ON} Anc_1...    64   9e-10
SAKL0C12386g Chr3 complement(1108341..1110923) [2583 bp, 860 aa]...    64   9e-10
ZYRO0G08844g Chr7 complement(711678..712766) [1089 bp, 362 aa] {...    63   1e-09
NCAS0H01780 Chr8 complement(341549..344773) [3225 bp, 1074 aa] {...    64   1e-09
KLTH0A01320g Chr1 (118671..121115) [2445 bp, 814 aa] {ON} simila...    64   1e-09
TBLA0C04600 Chr3 (1112043..1115990) [3948 bp, 1315 aa] {ON} Anc_...    64   1e-09
KLTH0D11044g Chr4 complement(901388..903937) [2550 bp, 849 aa] {...    64   1e-09
Ecym_6425 Chr6 (825834..828095) [2262 bp, 753 aa] {ON} similar t...    64   1e-09
NDAI0H03460 Chr8 complement(836849..838726) [1878 bp, 625 aa] {O...    64   1e-09
NDAI0J01990 Chr10 (491491..493758) [2268 bp, 755 aa] {ON} Anc_4....    64   1e-09
CAGL0F09075g Chr6 (894761..897001) [2241 bp, 746 aa] {ON} simila...    64   1e-09
ADR167W Chr4 (994581..997202) [2622 bp, 873 aa] {ON} Syntenic ho...    64   1e-09
TBLA0B08520 Chr2 complement(2038517..2041321) [2805 bp, 934 aa] ...    64   1e-09
KAFR0B01510 Chr2 complement(284425..286092) [1668 bp, 555 aa] {O...    64   1e-09
ADR058C Chr4 complement(810939..811826) [888 bp, 295 aa] {ON} Sy...    62   1e-09
Skud_12.164 Chr12 (315700..319182) [3483 bp, 1160 aa] {ON} YLR09...    64   1e-09
Skud_12.447 Chr12 (790003..792210) [2208 bp, 735 aa] {ON} YLR362...    64   1e-09
Ecym_6400 Chr6 complement(779716..781983) [2268 bp, 755 aa] {ON}...    64   1e-09
ZYRO0C12408g Chr3 (979857..981593) [1737 bp, 578 aa] {ON} highly...    64   1e-09
CAGL0F03245g Chr6 complement(316924..320034) [3111 bp, 1036 aa] ...    64   1e-09
KLTH0D17204g Chr4 complement(1426818..1429085) [2268 bp, 755 aa]...    64   1e-09
CAGL0F00649g Chr6 (71961..73505) [1545 bp, 514 aa] {ON} similar ...    63   1e-09
TDEL0H04100 Chr8 complement(706443..707306,707369..707974) [1470...    63   1e-09
KAFR0D03100 Chr4 complement(610106..611635) [1530 bp, 509 aa] {O...    63   1e-09
Smik_1.78 Chr1 complement(147996..149303) [1308 bp, 435 aa] {ON}...    63   1e-09
AFR205C Chr6 complement(805580..806953) [1374 bp, 457 aa] {ON} S...    63   1e-09
TPHA0O00670 Chr15 (125331..127088) [1758 bp, 585 aa] {ON} Anc_1....    63   1e-09
YNL298W Chr14 (68915..71443) [2529 bp, 842 aa] {ON}  CLA4Cdc42p-...    64   2e-09
AFL090W Chr6 (274336..275376) [1041 bp, 346 aa] {ON} Syntenic ho...    62   2e-09
AGR058W Chr7 (823626..826841) [3216 bp, 1071 aa] {ON} Syntenic h...    64   2e-09
KAFR0G00460 Chr7 complement(128077..130023) [1947 bp, 648 aa] {O...    63   2e-09
ABL011C Chr2 complement(378257..380362) [2106 bp, 701 aa] {ON} S...    64   2e-09
SAKL0F11110g Chr6 (868447..869832) [1386 bp, 461 aa] {ON} simila...    63   2e-09
NDAI0G05370 Chr7 (1313015..1315555) [2541 bp, 846 aa] {ON} Anc_1...    64   2e-09
Kpol_513.7 s513 (14160..15050) [891 bp, 296 aa] {ON} (14160..150...    62   2e-09
TPHA0G02990 Chr7 complement(640488..642098) [1611 bp, 536 aa] {O...    63   2e-09
ZYRO0F08272g Chr6 (668685..670508) [1824 bp, 607 aa] {ON} simila...    63   2e-09
TPHA0P01380 Chr16 (278259..279380) [1122 bp, 373 aa] {ON} Anc_3....    62   2e-09
Skud_11.88 Chr11 (169115..170659) [1545 bp, 514 aa] {ON} YKL139W...    63   2e-09
NDAI0C03610 Chr3 (829317..831476) [2160 bp, 719 aa] {ON} Anc_5.38      63   2e-09
ACR119W Chr3 (560761..563556) [2796 bp, 931 aa] {ON} Syntenic ho...    64   2e-09
SAKL0H10758g Chr8 complement(930403..931302) [900 bp, 299 aa] {O...    62   2e-09
NDAI0F03200 Chr6 complement(770618..772924) [2307 bp, 768 aa] {O...    63   2e-09
Smik_12.155 Chr12 (312480..315968) [3489 bp, 1162 aa] {ON} YLR09...    64   2e-09
NDAI0F01650 Chr6 (403635..404738) [1104 bp, 367 aa] {ON} Anc_6.214     62   2e-09
KAFR0E03030 Chr5 (606567..607457) [891 bp, 296 aa] {ON} Anc_8.51...    62   2e-09
NDAI0E01960 Chr5 (397897..399717) [1821 bp, 606 aa] {ON} Anc_2.425     63   2e-09
KLLA0D07810g Chr4 complement(669095..671251) [2157 bp, 718 aa] {...    63   2e-09
NDAI0G01280 Chr7 complement(281834..283573) [1740 bp, 579 aa] {O...    63   2e-09
TDEL0G02820 Chr7 complement(543911..545377,545450..545476) [1494...    63   2e-09
Suva_7.334 Chr7 (568847..569956) [1110 bp, 369 aa] {ON} YGR052W ...    62   2e-09
Smik_14.167 Chr14 (311655..312284,312591..314228) [2268 bp, 755 ...    63   2e-09
ZYRO0C02772g Chr3 (216325..217464) [1140 bp, 379 aa] {ON} highly...    62   2e-09
Smik_6.414 Chr6 (666806..667909) [1104 bp, 367 aa] {ON} YPL209C ...    62   2e-09
KAFR0C04480 Chr3 (894906..896213) [1308 bp, 435 aa] {ON} Anc_1.3...    62   2e-09
Kwal_0.155 s0 (84856..86619) [1764 bp, 587 aa] {ON} YLR248W (RCK...    63   2e-09
Skud_16.132 Chr16 (239797..242571) [2775 bp, 924 aa] {ON} YPL150...    63   2e-09
ZYRO0D04752g Chr4 complement(397364..398215,398290..398907) [147...    62   2e-09
NDAI0B02500 Chr2 (625206..629036) [3831 bp, 1276 aa] {ON} Anc_8....    63   2e-09
Suva_14.178 Chr14 (328862..331195) [2334 bp, 777 aa] {ON} YNL161...    63   2e-09
Ecym_5241 Chr5 complement(495748..497586) [1839 bp, 612 aa] {ON}...    63   2e-09
KNAG0H03140 Chr8 complement(589553..592363) [2811 bp, 936 aa] {O...    63   2e-09
Skud_1.73 Chr1 (144821..146128) [1308 bp, 435 aa] {ON} YAR018C (...    62   3e-09
KAFR0A06190 Chr1 complement(1251546..1253690) [2145 bp, 714 aa] ...    63   3e-09
TBLA0B09590 Chr2 (2272405..2273328) [924 bp, 307 aa] {ON} Anc_2....    61   3e-09
Kpol_1050.13 s1050 (34788..36578) [1791 bp, 596 aa] {ON} (34788....    63   3e-09
Kwal_55.20189 s55 (288918..291356) [2439 bp, 812 aa] {ON} YHR082...    63   3e-09
TPHA0L00500 Chr12 (83710..86589) [2880 bp, 959 aa] {ON} Anc_7.86...    63   3e-09
KNAG0E01390 Chr5 (275055..276776) [1722 bp, 573 aa] {ON} Anc_1.4...    62   3e-09
Smik_11.97 Chr11 (168854..170491) [1638 bp, 545 aa] {ON} YKL139W...    62   3e-09
YAR018C Chr1 complement(170396..171703) [1308 bp, 435 aa] {ON}  ...    62   3e-09
Smik_4.157 Chr4 complement(289446..290605,290830..291250) [1581 ...    62   3e-09
Kwal_55.21709 s55 (948619..949641) [1023 bp, 340 aa] {ON} YOR061...    62   3e-09
KNAG0F01440 Chr6 (261403..263685) [2283 bp, 760 aa] {ON}               63   3e-09
KLTH0B07106g Chr2 (571005..573260) [2256 bp, 751 aa] {ON} simila...    63   3e-09
YKL139W Chr11 (182958..184544) [1587 bp, 528 aa] {ON}  CTK1Catal...    62   3e-09
NCAS0B04580 Chr2 (831695..835255) [3561 bp, 1186 aa] {ON} Anc_8....    63   3e-09
KAFR0K02450 Chr11 (504087..504131,504190..505680) [1536 bp, 511 ...    62   3e-09
SAKL0D06666g Chr4 (551260..552522) [1263 bp, 420 aa] {ON} some s...    62   3e-09
Smik_5.275 Chr5 (426176..429601) [3426 bp, 1141 aa] {ON} YER129W...    63   3e-09
SAKL0E04950g Chr5 (401903..402994) [1092 bp, 363 aa] {ON} highly...    62   3e-09
Kwal_56.23717 s56 complement(674222..676798) [2577 bp, 858 aa] {...    63   3e-09
Skud_14.32 Chr14 complement(49930..51057) [1128 bp, 375 aa] {ON}...    62   3e-09
KAFR0F02190 Chr6 (428623..430095) [1473 bp, 490 aa] {ON} Anc_3.1...    62   3e-09
CAGL0G03047g Chr7 (282299..283918) [1620 bp, 539 aa] {ON} highly...    62   3e-09
NCAS0A02180 Chr1 (410419..411489) [1071 bp, 356 aa] {ON} Anc_4.192     62   3e-09
KNAG0I00590 Chr9 (100275..102068) [1794 bp, 597 aa] {ON}               62   3e-09
YNL307C Chr14 complement(56446..57573) [1128 bp, 375 aa] {ON}  M...    62   3e-09
Skud_4.39 Chr4 complement(70857..72947) [2091 bp, 696 aa] {ON} Y...    62   3e-09
SAKL0G08250g Chr7 (703212..705707) [2496 bp, 831 aa] {ON} simila...    62   3e-09
SAKL0E12342g Chr5 complement(1021369..1023795) [2427 bp, 808 aa]...    62   3e-09
Smik_14.24 Chr14 complement(40883..42010) [1128 bp, 375 aa] {ON}...    62   3e-09
TPHA0E02270 Chr5 (471696..472916) [1221 bp, 406 aa] {ON} Anc_5.2...    62   3e-09
ZYRO0D06776g Chr4 complement(583027..586641) [3615 bp, 1204 aa] ...    63   3e-09
KNAG0B01130 Chr2 complement(208528..210279) [1752 bp, 583 aa] {O...    62   3e-09
KAFR0D04500 Chr4 (887515..889989) [2475 bp, 824 aa] {ON} Anc_1.5...    62   3e-09
CAGL0J11308g Chr10 (1099969..1102155) [2187 bp, 728 aa] {ON} sim...    62   4e-09
Kwal_33.14434 s33 complement(672031..674310) [2280 bp, 759 aa] {...    62   4e-09
TDEL0F00530 Chr6 complement(88187..90517) [2331 bp, 776 aa] {ON}...    62   4e-09
TPHA0L01470 Chr12 (303604..304497) [894 bp, 297 aa] {ON} Anc_8.5...    61   4e-09
SAKL0E04092g Chr5 complement(326532..327901,327970..327982) [138...    62   4e-09
YER129W Chr5 (417281..420709) [3429 bp, 1142 aa] {ON}  SAK1Upstr...    62   4e-09
ZYRO0F06798g Chr6 (558198..559676) [1479 bp, 492 aa] {ON} simila...    62   4e-09
NDAI0B03190 Chr2 complement(815759..817309) [1551 bp, 516 aa] {O...    62   4e-09
NCAS0A11530 Chr1 (2281835..2283223) [1389 bp, 462 aa] {ON} Anc_3...    62   4e-09
YDL214C Chr4 complement(74446..76545) [2100 bp, 699 aa] {ON}  PR...    62   4e-09
KAFR0I02010 Chr9 complement(411589..412887) [1299 bp, 432 aa] {O...    62   4e-09
KLLA0D07348g Chr4 (626999..629728) [2730 bp, 909 aa] {ON} simila...    62   4e-09
ADR300C Chr4 complement(1222344..1225016) [2673 bp, 890 aa] {ON}...    62   4e-09
YLR096W Chr12 (332590..336033) [3444 bp, 1147 aa] {ON}  KIN2Seri...    62   4e-09
AFR035W Chr6 (498529..500688) [2160 bp, 719 aa] {ON} Syntenic ho...    62   4e-09
YDL079C Chr4 complement(312951..314044,314337..314748) [1506 bp,...    62   4e-09
TBLA0B06940 Chr2 (1639189..1643520) [4332 bp, 1443 aa] {ON} Anc_...    62   4e-09
KLLA0F19536g Chr6 (1808263..1811577) [3315 bp, 1104 aa] {ON} sim...    62   4e-09
TPHA0D01770 Chr4 (365255..370279) [5025 bp, 1674 aa] {ON} Anc_5....    62   4e-09
YJR059W Chr10 (545787..548243) [2457 bp, 818 aa] {ON}  PTK2Putat...    62   4e-09
Kpol_1042.20 s1042 (45090..47261) [2172 bp, 723 aa] {ON} (45090....    62   4e-09
TPHA0O01620 Chr15 (321912..324359) [2448 bp, 815 aa] {ON} Anc_2....    62   5e-09
Kpol_1041.29 s1041 (73725..74876) [1152 bp, 383 aa] {ON} (73725....    61   5e-09
KLLA0D08415g Chr4 (714473..716797) [2325 bp, 774 aa] {ON} simila...    62   5e-09
KNAG0K02370 Chr11 complement(475088..477739) [2652 bp, 883 aa] {...    62   5e-09
TDEL0B06160 Chr2 complement(1086672..1088327) [1656 bp, 551 aa] ...    62   5e-09
Smik_6.347 Chr6 complement(553316..556069) [2754 bp, 917 aa] {ON...    62   5e-09
TPHA0E02820 Chr5 complement(589816..590970) [1155 bp, 384 aa] {O...    61   5e-09
NDAI0A04040 Chr1 complement(907696..910041) [2346 bp, 781 aa] {O...    62   5e-09
Kwal_YGOB_27.11919 s27 (1003201..1003830,1004866..1005135) [900 ...    60   5e-09
KLTH0E03652g Chr5 (330227..332671) [2445 bp, 814 aa] {ON} simila...    62   5e-09
KNAG0A01330 Chr1 complement(34784..35977) [1194 bp, 397 aa] {ON}...    61   5e-09
KLLA0B02332g Chr2 complement(206863..207948) [1086 bp, 361 aa] {...    61   5e-09
Suva_10.180 Chr10 (337364..340843) [3480 bp, 1159 aa] {ON} YLR09...    62   5e-09
KAFR0D04800 Chr4 complement(942369..944690) [2322 bp, 773 aa] {O...    62   5e-09
KAFR0F02710 Chr6 (528336..529493) [1158 bp, 385 aa] {ON} Anc_2.3...    61   6e-09
NCAS0I02060 Chr9 (386630..388573) [1944 bp, 647 aa] {ON} Anc_3.1...    62   6e-09
CAGL0H09152g Chr8 complement(895722..898055) [2334 bp, 777 aa] {...    62   6e-09
TPHA0P00640 Chr16 (132185..133963) [1779 bp, 592 aa] {ON} Anc_3....    61   6e-09
TDEL0D04560 Chr4 (835822..837885) [2064 bp, 687 aa] {ON} Anc_3.1...    62   7e-09
NCAS0D00710 Chr4 (122875..124737) [1863 bp, 620 aa] {ON}               61   7e-09
NCAS0G01820 Chr7 complement(323288..325690) [2403 bp, 800 aa] {O...    62   7e-09
Skud_14.172 Chr14 (323327..325564) [2238 bp, 745 aa] {ON} YNL161...    61   7e-09
NDAI0C01850 Chr3 (407978..411712) [3735 bp, 1244 aa] {ON}              62   7e-09
Suva_8.282 Chr8 (511665..513185) [1521 bp, 506 aa] {ON} YOR231W ...    61   7e-09
NCAS0A09960 Chr1 complement(1993554..1995926) [2373 bp, 790 aa] ...    61   7e-09
TPHA0O01030 Chr15 complement(191875..193890) [2016 bp, 671 aa] {...    61   7e-09
CAGL0B03509g Chr2 complement(349638..351431) [1794 bp, 597 aa] {...    61   7e-09
CAGL0M02299g Chr13 (273725..276406) [2682 bp, 893 aa] {ON} simil...    61   8e-09
Kwal_23.3590 s23 complement(353755..355254) [1500 bp, 499 aa] {O...    61   8e-09
Suva_4.33 Chr4 complement(63334..65427) [2094 bp, 697 aa] {ON} Y...    61   8e-09
Ecym_5252 Chr5 (525687..526976) [1290 bp, 429 aa] {ON} similar t...    60   8e-09
TBLA0C00720 Chr3 (149299..151149) [1851 bp, 616 aa] {ON} Anc_1.4...    61   8e-09
NDAI0A04760 Chr1 complement(1088637..1090103) [1467 bp, 488 aa] ...    61   9e-09
ZYRO0B04796g Chr2 (385611..387683) [2073 bp, 690 aa] {ON} simila...    61   9e-09
YNL161W Chr14 (332597..334867) [2271 bp, 756 aa] {ON}  CBK1Serin...    61   9e-09
AFL188C Chr6 complement(88793..90211) [1419 bp, 472 aa] {ON} Syn...    60   1e-08
KAFR0E00330 Chr5 complement(74619..76574) [1956 bp, 651 aa] {ON}...    61   1e-08
TPHA0J00820 Chr10 (193408..197064) [3657 bp, 1218 aa] {ON} Anc_8...    61   1e-08
KAFR0B05410 Chr2 complement(1111152..1112771) [1620 bp, 539 aa] ...    60   1e-08
Skud_10.283 Chr10 (503324..505765) [2442 bp, 813 aa] {ON} YJR059...    61   1e-08
TBLA0C01320 Chr3 complement(289223..290626) [1404 bp, 467 aa] {O...    60   1e-08
TDEL0D01220 Chr4 complement(228529..230451) [1923 bp, 640 aa] {O...    61   1e-08
AGR334W Chr7 (1355098..1356693) [1596 bp, 531 aa] {ON} Syntenic ...    60   1e-08
CAGL0M11396g Chr13 (1122109..1125687) [3579 bp, 1192 aa] {ON} si...    61   1e-08
TDEL0A05980 Chr1 (1049221..1050771) [1551 bp, 516 aa] {ON} Anc_8...    60   1e-08
NCAS0B05090 Chr2 (946126..949758) [3633 bp, 1210 aa] {ON}              61   1e-08
TDEL0C02110 Chr3 (364853..366340) [1488 bp, 495 aa] {ON} Anc_7.3...    60   1e-08
KLTH0F09988g Chr6 complement(868693..869931) [1239 bp, 412 aa] {...    60   1e-08
KAFR0I02440 Chr9 complement(493668..495128) [1461 bp, 486 aa] {O...    60   1e-08
Skud_16.70 Chr16 complement(129918..131021) [1104 bp, 367 aa] {O...    60   1e-08
Ecym_4773 Chr4 complement(1504949..1506541) [1593 bp, 530 aa] {O...    60   1e-08
KNAG0K01710 Chr11 (360438..361931) [1494 bp, 497 aa] {ON} Anc_3....    60   1e-08
TPHA0G01730 Chr7 complement(355001..356779) [1779 bp, 592 aa] {O...    60   1e-08
ZYRO0A08448g Chr1 complement(677122..678225) [1104 bp, 367 aa] {...    60   1e-08
Skud_8.143 Chr8 complement(242422..245535) [3114 bp, 1037 aa] {O...    61   1e-08
TPHA0B00240 Chr2 complement(44468..46525) [2058 bp, 685 aa] {ON}...    60   1e-08
Suva_14.32 Chr14 complement(52757..53884) [1128 bp, 375 aa] {ON}...    60   1e-08
Smik_10.349 Chr10 (534756..537209) [2454 bp, 817 aa] {ON} YJR059...    61   1e-08
TPHA0I00820 Chr9 (177222..179651) [2430 bp, 809 aa] {ON} Anc_1.2...    61   1e-08
Kwal_33.14554 s33 (717776..719920) [2145 bp, 714 aa] {ON} YNL161...    60   1e-08
Suva_13.319 Chr13 (525309..526421) [1113 bp, 370 aa] {ON} YMR139...    60   1e-08
NCAS0A12200 Chr1 (2417539..2419782) [2244 bp, 747 aa] {ON} Anc_1...    60   1e-08
KNAG0G02110 Chr7 (477260..480838) [3579 bp, 1192 aa] {ON} Anc_8....    61   1e-08
Smik_8.160 Chr8 complement(245207..248323) [3117 bp, 1038 aa] {O...    61   1e-08
NDAI0F03390 Chr6 (816047..818380) [2334 bp, 777 aa] {ON}               60   1e-08
ZYRO0A07062g Chr1 (576600..576615,576675..577561) [903 bp, 300 a...    59   1e-08
KNAG0A03900 Chr1 complement(520500..521390) [891 bp, 296 aa] {ON...    59   1e-08
YJL106W Chr10 (221390..223327) [1938 bp, 645 aa] {ON}  IME2Serin...    60   1e-08
KAFR0K01540 Chr11 (320997..322706) [1710 bp, 569 aa] {ON} Anc_3....    60   1e-08
NDAI0C05340 Chr3 (1236394..1237296) [903 bp, 300 aa] {ON}              59   1e-08
Skud_4.97 Chr4 (168099..169670) [1572 bp, 523 aa] {ON} YDL159W (...    60   1e-08
Smik_4.25 Chr4 complement(52454..54547) [2094 bp, 697 aa] {ON} Y...    60   1e-08
ZYRO0G16632g Chr7 (1360854..1365827) [4974 bp, 1657 aa] {ON} hig...    60   2e-08
KNAG0A03060 Chr1 complement(375640..377142) [1503 bp, 500 aa] {O...    60   2e-08
SAKL0D08294g Chr4 (692455..693966) [1512 bp, 503 aa] {ON} some s...    60   2e-08
KLLA0C16577g Chr3 complement(1451181..1452695) [1515 bp, 504 aa]...    60   2e-08
NCAS0C02390 Chr3 complement(446642..448468) [1827 bp, 608 aa] {O...    60   2e-08
SAKL0B11044g Chr2 complement(962142..962940,963019..963086,96315...    60   2e-08
KNAG0F01240 Chr6 complement(223003..225591) [2589 bp, 862 aa] {O...    60   2e-08
Kpol_529.18 s529 (52782..55118) [2337 bp, 778 aa] {ON} (52782..5...    60   2e-08
CAGL0L07810g Chr12 complement(859653..861443) [1791 bp, 596 aa] ...    60   2e-08
CAGL0D02244g Chr4 complement(229504..230967) [1464 bp, 487 aa] {...    60   2e-08
SAKL0D09240g Chr4 (764130..765761) [1632 bp, 543 aa] {ON} some s...    60   2e-08
NCAS0A01100 Chr1 (218400..219464) [1065 bp, 354 aa] {ON}               59   2e-08
TBLA0H03440 Chr8 (840759..841643) [885 bp, 294 aa] {ON} Anc_8.51...    59   2e-08
NCAS0C01110 Chr3 (207664..209664) [2001 bp, 666 aa] {ON} Anc_8.716     60   2e-08
Smik_10.132 Chr10 (212933..214873) [1941 bp, 646 aa] {ON} YJL106...    60   2e-08
TBLA0B07330 Chr2 complement(1745229..1746821,1746990..1747013) [...    60   2e-08
KAFR0B00920 Chr2 (170792..172300) [1509 bp, 502 aa] {ON} Anc_7.3...    60   2e-08
KLTH0B09042g Chr2 (736520..738112) [1593 bp, 530 aa] {ON} simila...    60   2e-08
TPHA0K02030 Chr11 (432238..434505) [2268 bp, 755 aa] {ON} Anc_4....    60   2e-08
KLTH0D03080g Chr4 (295808..297730) [1923 bp, 640 aa] {ON} simila...    60   2e-08
KLLA0E12145g Chr5 (1080245..1081612) [1368 bp, 455 aa] {ON} simi...    59   2e-08
KAFR0A07560 Chr1 (1525225..1527504) [2280 bp, 759 aa] {ON} Anc_2...    60   2e-08
NCAS0B02350 Chr2 complement(394128..395018) [891 bp, 296 aa] {ON...    59   2e-08
Smik_13.338 Chr13 (528578..529690) [1113 bp, 370 aa] {ON} YMR139...    59   2e-08
Skud_16.141 Chr16 complement(259166..260707) [1542 bp, 513 aa] {...    59   2e-08
Suva_11.108 Chr11 complement(207520..209070) [1551 bp, 516 aa] {...    59   2e-08
Kpol_185.2 s185 complement(1614..3704) [2091 bp, 696 aa] {ON} co...    60   2e-08
NDAI0B02070 Chr2 (514024..517800) [3777 bp, 1258 aa] {ON}              60   2e-08
CAGL0M08360g Chr13 complement(833220..835520) [2301 bp, 766 aa] ...    60   2e-08
Ecym_6136 Chr6 complement(248721..250187) [1467 bp, 488 aa] {ON}...    59   2e-08
TDEL0F04060 Chr6 (749896..753276) [3381 bp, 1126 aa] {ON} Anc_8....    60   3e-08
TBLA0B09740 Chr2 (2312062..2314815) [2754 bp, 917 aa] {ON} Anc_2...    60   3e-08
Suva_1.84 Chr1 complement(148430..149737) [1308 bp, 435 aa] {ON}...    59   3e-08
TPHA0C04570 Chr3 (985491..987071) [1581 bp, 526 aa] {ON} Anc_2.3...    59   3e-08
NCAS0B05910 Chr2 (1120092..1121645) [1554 bp, 517 aa] {ON} Anc_2...    59   3e-08
Kwal_14.1273 s14 complement(259953..261200) [1248 bp, 415 aa] {O...    59   3e-08
Smik_12.321 Chr12 (579087..580919) [1833 bp, 610 aa] {ON} YLR248...    59   3e-08
ZYRO0G05214g Chr7 (420482..422980) [2499 bp, 832 aa] {ON} some s...    60   3e-08
KLTH0D10670g Chr4 (877472..878806) [1335 bp, 444 aa] {ON} some s...    59   3e-08
Kpol_1044.3 s1044 (4910..5845,5849..7711) [2799 bp, 932 aa] {ON}...    60   3e-08
YNL183C Chr14 complement(293137..295509) [2373 bp, 790 aa] {ON} ...    59   3e-08
Suva_10.345 Chr10 (601536..603365) [1830 bp, 609 aa] {ON} YLR248...    59   3e-08
TPHA0C04650 Chr3 complement(1006190..1007119) [930 bp, 309 aa] {...    58   3e-08
NCAS0A08770 Chr1 complement(1733181..1734890) [1710 bp, 569 aa] ...    59   3e-08
TDEL0E01820 Chr5 complement(348423..349403) [981 bp, 326 aa] {ON...    58   3e-08
KAFR0B02800 Chr2 (571295..574582) [3288 bp, 1095 aa] {ON} Anc_8....    60   3e-08
YHR082C Chr8 complement(268459..271548) [3090 bp, 1029 aa] {ON} ...    59   3e-08
YMR139W Chr13 (546125..547237) [1113 bp, 370 aa] {ON}  RIM11Prot...    59   3e-08
Suva_14.158 Chr14 complement(289281..291650) [2370 bp, 789 aa] {...    59   3e-08
YDL025C Chr4 complement(405344..407206) [1863 bp, 620 aa] {ON}  ...    59   3e-08
CAGL0M10829g Chr13 complement(1076233..1081236) [5004 bp, 1667 a...    59   4e-08
NCAS0C01580 Chr3 (291554..292873) [1320 bp, 439 aa] {ON} Anc_8.652     59   4e-08
NCAS0A06000 Chr1 (1184842..1187133) [2292 bp, 763 aa] {ON} Anc_4...    59   4e-08
ABL143C Chr2 complement(128215..130392) [2178 bp, 725 aa] {ON} S...    59   4e-08
Suva_6.182 Chr6 complement(328699..330642) [1944 bp, 647 aa] {ON...    59   4e-08
NDAI0G05190 Chr7 complement(1258638..1260452) [1815 bp, 604 aa] ...    59   4e-08
Smik_3.94 Chr3 (128344..130155) [1812 bp, 603 aa] {ON} YCR008W (...    59   4e-08
Kpol_1066.46 s1066 (82874..86551) [3678 bp, 1225 aa] {ON} (82874...    59   4e-08
Skud_4.225 Chr4 complement(400160..401992) [1833 bp, 610 aa] {ON...    59   4e-08
NCAS0A14050 Chr1 complement(2763082..2764551) [1470 bp, 489 aa] ...    59   4e-08
KAFR0C05130 Chr3 (1018035..1019402) [1368 bp, 455 aa] {ON} Anc_7...    59   4e-08
KAFR0B04630 Chr2 (964764..966302) [1539 bp, 512 aa] {ON} Anc_1.3...    59   4e-08
Skud_7.114 Chr7 (211645..213153) [1509 bp, 502 aa] {ON} YGL158W ...    59   4e-08
Kwal_26.7276 s26 (293129..295069) [1941 bp, 646 aa] {ON} YJL106W...    59   4e-08
NCAS0G02070 Chr7 (372747..374960) [2214 bp, 737 aa] {ON} Anc_2.96      59   4e-08
Suva_16.170 Chr16 complement(296877..298406) [1530 bp, 509 aa] {...    59   4e-08
KAFR0C00430 Chr3 complement(88561..91410) [2850 bp, 949 aa] {ON}...    59   5e-08
Skud_13.300 Chr13 (519521..520633) [1113 bp, 370 aa] {ON} YMR139...    58   5e-08
Skud_10.107 Chr10 (189314..191254) [1941 bp, 646 aa] {ON} YJL106...    59   5e-08
KNAG0C03830 Chr3 (751393..752877) [1485 bp, 494 aa] {ON} Anc_7.3...    58   5e-08
KAFR0I02100 Chr9 (431876..433258) [1383 bp, 460 aa] {ON} Anc_1.3...    58   5e-08
TBLA0H00370 Chr8 (71216..73393) [2178 bp, 725 aa] {ON} Anc_2.425...    59   5e-08
Kpol_1044.26 s1044 complement(60216..62666) [2451 bp, 816 aa] {O...    59   5e-08
Smik_6.338 Chr6 (535192..536727) [1536 bp, 511 aa] {ON} YPL140C ...    58   5e-08
NDAI0A06630 Chr1 complement(1514165..1515943) [1779 bp, 592 aa] ...    59   5e-08
NCAS0E01560 Chr5 (294095..295345) [1251 bp, 416 aa] {ON}               58   5e-08
Skud_3.73 Chr3 (110742..112556) [1815 bp, 604 aa] {ON} YCR008W (...    59   5e-08
KLLA0D07304g Chr4 (623352..624749) [1398 bp, 465 aa] {ON} some s...    58   5e-08
YPL140C Chr16 complement(287514..289034) [1521 bp, 506 aa] {ON} ...    58   5e-08
SAKL0H01364g Chr8 complement(143450..145141) [1692 bp, 563 aa] {...    58   5e-08
Skud_15.397 Chr15 (711559..713082) [1524 bp, 507 aa] {ON} YOR231...    58   6e-08
Suva_4.87 Chr4 (160236..161810) [1575 bp, 524 aa] {ON} YDL159W (...    58   6e-08
ZYRO0A07546g Chr1 complement(619278..620747,620833..620847) [148...    58   6e-08
YPL209C Chr16 complement(156490..157593) [1104 bp, 367 aa] {ON} ...    58   6e-08
NDAI0K01480 Chr11 complement(337108..338706) [1599 bp, 532 aa] {...    58   6e-08
ZYRO0E05170g Chr5 complement(390866..392593) [1728 bp, 575 aa] {...    58   6e-08
KLLA0E17073g Chr5 complement(1515721..1518279) [2559 bp, 852 aa]...    59   6e-08
Suva_3.33 Chr3 (42176..44020) [1845 bp, 614 aa] {ON} YCR008W (REAL)    58   7e-08
TPHA0F02870 Chr6 complement(636574..638259) [1686 bp, 561 aa] {O...    58   7e-08
ZYRO0C09768g Chr3 (740592..742925) [2334 bp, 777 aa] {ON} simila...    58   7e-08
TDEL0B01250 Chr2 complement(228145..229038) [894 bp, 297 aa] {ON...    57   7e-08
KLTH0F17490g Chr6 (1413752..1414774) [1023 bp, 340 aa] {ON} high...    57   7e-08
YCR008W Chr3 (128470..130281) [1812 bp, 603 aa] {ON}  SAT4Ser/Th...    58   7e-08
TPHA0H01500 Chr8 complement(336652..339639) [2988 bp, 995 aa] {O...    58   7e-08
ZYRO0E04246g Chr5 complement(322215..324035) [1821 bp, 606 aa] {...    58   7e-08
Smik_14.147 Chr14 complement(272373..274742) [2370 bp, 789 aa] {...    58   7e-08
TDEL0E02510 Chr5 (486415..489156) [2742 bp, 913 aa] {ON} Anc_5.3...    58   7e-08
TPHA0I03100 Chr9 complement(681645..683666) [2022 bp, 673 aa] {O...    58   7e-08
CAGL0L06820g Chr12 (769035..770135) [1101 bp, 366 aa] {ON} highl...    57   7e-08
TBLA0H01820 Chr8 (429920..433417) [3498 bp, 1165 aa] {ON} Anc_5....    58   8e-08
Suva_15.275 Chr15 complement(470782..473862) [3081 bp, 1026 aa] ...    58   8e-08
Suva_12.148 Chr12 (223571..225982) [2412 bp, 804 aa] {ON} YJR059...    58   8e-08
TDEL0E03300 Chr5 complement(621448..626409) [4962 bp, 1653 aa] {...    58   8e-08
Smik_15.415 Chr15 (722292..723815) [1524 bp, 507 aa] {ON} YOR231...    58   8e-08
Ecym_2302 Chr2 (587299..588951) [1653 bp, 550 aa] {ON} similar t...    58   8e-08
KLLA0A02717g Chr1 (245082..246380) [1299 bp, 432 aa] {ON} weakly...    57   8e-08
NCAS0E02230 Chr5 (429499..430176,430250..431104) [1533 bp, 510 a...    57   8e-08
NDAI0E03760 Chr5 (817014..818765) [1752 bp, 583 aa] {ON} Anc_7.41      58   9e-08
Ecym_8337 Chr8 (679844..681460) [1617 bp, 538 aa] {ON} similar t...    58   9e-08
Ecym_6056 Chr6 complement(107449..108888) [1440 bp, 479 aa] {ON}...    57   9e-08
TDEL0B06900 Chr2 complement(1220590..1222257) [1668 bp, 555 aa] ...    58   9e-08
Smik_4.79 Chr4 (149246..150796) [1551 bp, 516 aa] {ON} YDL159W (...    57   9e-08
AER195C Chr5 complement(1005431..1006945) [1515 bp, 504 aa] {ON}...    57   9e-08
SAKL0E12958g Chr5 (1066434..1068653) [2220 bp, 739 aa] {ON} simi...    58   9e-08
TDEL0A01120 Chr1 complement(189217..191466) [2250 bp, 749 aa] {O...    58   9e-08
TPHA0N01450 Chr14 complement(318088..320340) [2253 bp, 750 aa] {...    58   1e-07
TBLA0F01550 Chr6 complement(385184..386716) [1533 bp, 510 aa] {O...    57   1e-07
Ecym_3371 Chr3 (706573..706597,706675..707570) [921 bp, 306 aa] ...    56   1e-07
KNAG0G00280 Chr7 complement(43196..45262) [2067 bp, 688 aa] {ON}...    57   1e-07
YLR248W Chr12 (634252..636084) [1833 bp, 610 aa] {ON}  RCK2Prote...    57   1e-07
NDAI0G05060 Chr7 complement(1227369..1229495) [2127 bp, 708 aa] ...    57   1e-07
CAGL0H01837g Chr8 complement(176352..178736) [2385 bp, 794 aa] {...    58   1e-07
KLTH0H12650g Chr8 (1072961..1074592) [1632 bp, 543 aa] {ON} simi...    57   1e-07
KNAG0B05880 Chr2 (1155395..1157695) [2301 bp, 766 aa] {ON} Anc_4...    57   1e-07
Kwal_26.8703 s26 (905007..906341) [1335 bp, 444 aa] {ON} YOR231W...    57   1e-07
ADR253W Chr4 (1141941..1143083) [1143 bp, 380 aa] {ON} Syntenic ...    57   1e-07
AEL284C Chr5 complement(106480..107919) [1440 bp, 479 aa] {ON} S...    57   1e-07
AAL029W Chr1 (289989..291593) [1605 bp, 534 aa] {ON} Syntenic ho...    57   1e-07
Smik_4.209 Chr4 complement(385530..386995,387230..387623) [1860 ...    57   1e-07
Kpol_1027.1 s1027 (1..2088) [2088 bp, 695 aa] {ON} (1..2088) [20...    57   1e-07
KNAG0C01040 Chr3 complement(203429..204976) [1548 bp, 515 aa] {O...    57   1e-07
KLLA0C03938g Chr3 complement(358851..360632) [1782 bp, 593 aa] {...    57   1e-07
YDL159W Chr4 (172481..174028) [1548 bp, 515 aa] {ON}  STE7Signal...    57   1e-07
KAFR0I01570 Chr9 (330982..332574) [1593 bp, 530 aa] {ON} Anc_2.5...    57   1e-07
Kpol_1072.31 s1072 complement(67104..68684) [1581 bp, 526 aa] {O...    57   1e-07
Suva_11.178 Chr11 complement(330253..332184) [1932 bp, 643 aa] {...    57   1e-07
Skud_15.519 Chr15 complement(932720..934216) [1497 bp, 498 aa] {...    57   1e-07
CAGL0G04455g Chr7 (426386..428641) [2256 bp, 751 aa] {ON} simila...    57   1e-07
CAGL0J03828g Chr10 (365325..366728) [1404 bp, 467 aa] {ON} simil...    57   2e-07
CAGL0J04972g Chr10 (475587..476606) [1020 bp, 339 aa] {ON} some ...    56   2e-07
AFR076W Chr6 (564252..566714) [2463 bp, 820 aa] {ON} Syntenic ho...    57   2e-07
TBLA0B03990 Chr2 complement(910314..912455) [2142 bp, 713 aa] {O...    57   2e-07
ZYRO0F12122g Chr6 complement(984069..985910) [1842 bp, 613 aa] {...    57   2e-07
Kwal_23.4276 s23 complement(648061..649626) [1566 bp, 521 aa] {O...    57   2e-07
CAGL0H01199g Chr8 (110610..115556) [4947 bp, 1648 aa] {ON} highl...    57   2e-07
NDAI0D02970 Chr4 (701299..704058) [2760 bp, 919 aa] {ON} Anc_4.4...    57   2e-07
KNAG0F03410 Chr6 (640115..645094) [4980 bp, 1659 aa] {ON}              57   2e-07
Kpol_1067.14 s1067 (29413..31050) [1638 bp, 545 aa] {ON} (29413....    57   2e-07
CAGL0I03498g Chr9 (297344..298699) [1356 bp, 451 aa] {ON} simila...    56   2e-07
CAGL0H10208g Chr8 complement(996853..999936) [3084 bp, 1027 aa] ...    57   2e-07
KLLA0D12100g Chr4 complement(1031728..1033161) [1434 bp, 477 aa]...    56   2e-07
CAGL0K04301g Chr11 (405248..406315) [1068 bp, 355 aa] {ON} simil...    56   2e-07
TBLA0E04970 Chr5 (1272310..1273944) [1635 bp, 544 aa] {ON} Anc_4...    56   2e-07
Skud_12.329 Chr12 (580813..582645) [1833 bp, 610 aa] {ON} YLR248...    56   2e-07
NCAS0A04010 Chr1 complement(809163..810299) [1137 bp, 378 aa] {O...    56   2e-07
Kpol_1055.25 s1055 complement(62930..67933) [5004 bp, 1667 aa] {...    57   2e-07
Kwal_YGOB_0.307 s0 (145676..147175) [1500 bp, 500 aa] {ON} ANNOT...    56   3e-07
YBR059C Chr2 complement(356861..360187) [3327 bp, 1108 aa] {ON} ...    57   3e-07
Kwal_0.307 s0 (145676..147145) [1470 bp, 490 aa] {OFF} YCR008W (...    56   3e-07
ZYRO0F01034g Chr6 (80328..82826) [2499 bp, 832 aa] {ON} similar ...    56   3e-07
Suva_4.223 Chr4 complement(395869..397719) [1851 bp, 616 aa] {ON...    56   3e-07
TPHA0G00730 Chr7 (139442..141364) [1923 bp, 640 aa] {ON} Anc_8.7...    56   3e-07
Suva_4.168 Chr4 complement(302527..303654) [1128 bp, 375 aa] {ON...    55   3e-07
ADL283W Chr4 (205173..205197,205250..206145) [921 bp, 306 aa] {O...    55   3e-07
KNAG0B00260 Chr2 complement(36240..38477) [2238 bp, 745 aa] {ON}...    56   3e-07
SAKL0E06534g Chr5 complement(533369..534267,534334..534358) [924...    55   3e-07
Skud_4.176 Chr4 complement(308461..309594) [1134 bp, 377 aa] {ON...    55   3e-07
Ecym_6359 Chr6 complement(699564..702176) [2613 bp, 870 aa] {ON}...    56   3e-07
ACR117W Chr3 (557738..559312) [1575 bp, 524 aa] {ON} Syntenic ho...    56   3e-07
Kpol_251.4 s251 (5802..8318) [2517 bp, 838 aa] {ON} (5802..8318)...    56   3e-07
KLTH0H11858g Chr8 (1013677..1015374) [1698 bp, 565 aa] {ON} some...    56   3e-07
TBLA0B03590 Chr2 (834488..837022) [2535 bp, 844 aa] {ON} Anc_8.7...    56   3e-07
Kpol_1014.8 s1014 (13007..14368) [1362 bp, 453 aa] {ON} (13007.....    55   3e-07
Skud_14.151 Chr14 complement(284115..286490) [2376 bp, 791 aa] {...    56   3e-07
KAFR0F00380 Chr6 complement(91358..92800) [1443 bp, 480 aa] {ON}...    56   3e-07
KNAG0B04460 Chr2 (856495..859461) [2967 bp, 988 aa] {ON} Anc_5.3...    56   3e-07
TBLA0C05800 Chr3 complement(1402262..1405207) [2946 bp, 981 aa] ...    56   3e-07
TBLA0B01990 Chr2 complement(458264..461623) [3360 bp, 1119 aa] {...    56   3e-07
Kpol_487.14 s487 complement(56520..58394) [1875 bp, 624 aa] {ON}...    56   3e-07
TDEL0B05820 Chr2 complement(1031136..1032863) [1728 bp, 575 aa] ...    55   4e-07
NDAI0A01970 Chr1 (440268..442184) [1917 bp, 638 aa] {ON} Anc_7.335     55   4e-07
TBLA0B10030 Chr2 (2399979..2402123) [2145 bp, 714 aa] {ON} Anc_4...    55   4e-07
Smik_7.115 Chr7 (201140..202663) [1524 bp, 507 aa] {ON} YGL158W ...    55   4e-07
KAFR0A03710 Chr1 (758918..760399) [1482 bp, 493 aa] {ON} Anc_8.6...    55   4e-07
ADR313W Chr4 (1255930..1257666) [1737 bp, 578 aa] {ON} Syntenic ...    55   4e-07
CAGL0K11550g Chr11 (1118971..1120587) [1617 bp, 538 aa] {ON} sim...    55   5e-07
Smik_4.367 Chr4 (655941..659141) [3201 bp, 1066 aa] {ON} YDR122W...    55   5e-07
YOR231W Chr15 (772601..774127) [1527 bp, 508 aa] {ON}  MKK1Mitog...    55   5e-07
TDEL0G03220 Chr7 complement(600259..601350) [1092 bp, 363 aa] {O...    54   6e-07
TBLA0I01930 Chr9 complement(436511..440596) [4086 bp, 1361 aa] {...    55   6e-07
Suva_2.283 Chr2 (489490..492759) [3270 bp, 1089 aa] {ON} YDR122W...    55   6e-07
Skud_12.48 Chr12 complement(97218..99422) [2205 bp, 734 aa] {ON}...    55   6e-07
TBLA0E02590 Chr5 complement(651679..654864) [3186 bp, 1061 aa] {...    55   6e-07
NDAI0H03740 Chr8 (912611..915373) [2763 bp, 920 aa] {ON} Anc_2.71      55   6e-07
TPHA0B01010 Chr2 complement(229538..231634) [2097 bp, 698 aa] {O...    55   6e-07
Kwal_33.13222 s33 (127342..127788) [447 bp, 148 aa] {OFF} YDR507...    52   6e-07
TBLA0G00820 Chr7 complement(191559..192833) [1275 bp, 424 aa] {O...    55   6e-07
KAFR0A04070 Chr1 complement(817388..819325) [1938 bp, 645 aa] {O...    55   7e-07
SAKL0D05104g Chr4 (402641..404692) [2052 bp, 683 aa] {ON} simila...    55   7e-07
CAGL0I04422g Chr9 (394159..395427) [1269 bp, 422 aa] {ON} some s...    54   7e-07
SAKL0H07128g Chr8 complement(623681..625141) [1461 bp, 486 aa] {...    55   7e-07
CAGL0D06600g Chr4 (626571..628748) [2178 bp, 725 aa] {ON} simila...    55   7e-07
Skud_4.383 Chr4 (666354..669551) [3198 bp, 1065 aa] {ON} YDR122W...    55   7e-07
KNAG0J00820 Chr10 complement(137927..141202) [3276 bp, 1091 aa] ...    55   7e-07
ZYRO0B00638g Chr2 (42738..44930) [2193 bp, 730 aa] {ON} similar ...    55   8e-07
YKL116C Chr11 complement(221344..222900) [1557 bp, 518 aa] {ON} ...    54   8e-07
ADL043C Chr4 complement(612088..614109) [2022 bp, 673 aa] {ON} S...    55   8e-07
Smik_12.44 Chr12 complement(92046..94262) [2217 bp, 738 aa] {ON}...    55   8e-07
TBLA0D03740 Chr4 complement(926538..929057) [2520 bp, 839 aa] {O...    55   8e-07
Suva_8.405 Chr8 complement(730738..732348) [1611 bp, 536 aa] {ON...    54   9e-07
NCAS0D01230 Chr4 complement(225213..226661) [1449 bp, 482 aa] {O...    54   9e-07
CAGL0I05192g Chr9 complement(493635..494756) [1122 bp, 373 aa] {...    54   9e-07
Smik_11.200 Chr11 complement(333676..335592) [1917 bp, 638 aa] {...    54   9e-07
ZYRO0G02816g Chr7 complement(213421..214980) [1560 bp, 519 aa] {...    54   9e-07
Kpol_1064.31 s1064 complement(52651..54350) [1700 bp, 566.666666...    54   1e-06
Kpol_YGOB_1064.31 s1064 complement(52620..54350) [1731 bp, 577 a...    54   1e-06
KLTH0F06578g Chr6 complement(568519..570309) [1791 bp, 596 aa] {...    54   1e-06
TBLA0E02460 Chr5 (620609..621745) [1137 bp, 378 aa] {ON} Anc_7.2...    54   1e-06
TPHA0G02090 Chr7 complement(429178..430527) [1350 bp, 449 aa] {O...    54   1e-06
NCAS0A08610 Chr1 complement(1700839..1702704) [1866 bp, 621 aa] ...    54   1e-06
KNAG0B01670 Chr2 (307587..309860) [2274 bp, 757 aa] {ON} Anc_1.2...    54   1e-06
YDR122W Chr4 (694700..697894) [3195 bp, 1064 aa] {ON}  KIN1Serin...    54   1e-06
KLLA0C10802g Chr3 complement(926916..931934) [5019 bp, 1672 aa] ...    55   1e-06
NDAI0E00960 Chr5 (195116..197251) [2136 bp, 711 aa] {ON} Anc_8.716     54   1e-06
SAKL0C07458g Chr3 complement(687452..689395) [1944 bp, 647 aa] {...    54   1e-06
KLLA0C07535g Chr3 (658746..660620) [1875 bp, 624 aa] {ON} some s...    54   1e-06
TBLA0A09370 Chr1 complement(2310412..2311443) [1032 bp, 343 aa] ...    54   1e-06
NDAI0C05160 Chr3 (1199533..1201026) [1494 bp, 497 aa] {ON} Anc_8...    54   1e-06
KNAG0D04040 Chr4 (730581..731897) [1317 bp, 438 aa] {ON} Anc_4.1...    54   1e-06
KAFR0A00840 Chr1 complement(151896..152894) [999 bp, 332 aa] {ON...    53   1e-06
KLLA0F23507g Chr6 complement(2198603..2200066) [1464 bp, 487 aa]...    54   1e-06
TPHA0O01080 Chr15 complement(205407..207653) [2247 bp, 748 aa] {...    54   1e-06
NCAS0C02510 Chr3 complement(468113..469390) [1278 bp, 425 aa] {O...    54   1e-06
TDEL0A06610 Chr1 complement(1151052..1152824) [1773 bp, 590 aa] ...    54   1e-06
CAGL0I05390g Chr9 complement(508677..510041) [1365 bp, 454 aa] {...    54   1e-06
Kwal_33.13681 s33 complement(350547..352694) [2148 bp, 715 aa] {...    54   1e-06
YKL048C Chr11 complement(347214..349136) [1923 bp, 640 aa] {ON} ...    54   1e-06
NCAS0C05490 Chr3 (1114733..1115755) [1023 bp, 340 aa] {ON} Anc_5...    53   1e-06
Ecym_7206 Chr7 complement(423402..425576) [2175 bp, 724 aa] {ON}...    54   1e-06
CAGL0K12562g Chr11 (1235695..1240743) [5049 bp, 1682 aa] {ON} si...    54   1e-06
YLL019C Chr12 complement(105686..107899) [2214 bp, 737 aa] {ON} ...    54   1e-06
CAGL0K11990g Chr11 complement(1156224..1159199) [2976 bp, 991 aa...    54   1e-06
KLTH0G18194g Chr7 (1570885..1572132) [1248 bp, 415 aa] {ON} weak...    54   1e-06
Suva_3.129 Chr3 (193311..194282) [972 bp, 323 aa] {ON} YCR091W (...    53   2e-06
Skud_15.432 Chr15 complement(761490..763601) [2112 bp, 703 aa] {...    54   2e-06
KLLA0E14785g Chr5 complement(1323743..1324675) [933 bp, 310 aa] ...    53   2e-06
Suva_10.55 Chr10 complement(110943..113177) [2235 bp, 744 aa] {O...    54   2e-06
TDEL0F01550 Chr6 (282677..284839) [2163 bp, 720 aa] {ON} Anc_4.4...    54   2e-06
CAGL0K01661g Chr11 complement(147781..149229) [1449 bp, 482 aa] ...    53   2e-06
NDAI0A05700 Chr1 (1288604..1292077) [3474 bp, 1157 aa] {ON} Anc_...    54   2e-06
NDAI0H00610 Chr8 complement(141913..143022) [1110 bp, 369 aa] {O...    53   2e-06
SAKL0H24288g Chr8 (2099353..2101317) [1965 bp, 654 aa] {ON} simi...    54   2e-06
Kwal_14.1159 s14 complement(219896..224461) [4566 bp, 1521 aa] {...    54   2e-06
NCAS0B00420 Chr2 complement(54562..56718) [2157 bp, 718 aa] {ON}...    54   2e-06
Skud_9.134 Chr9 complement(256610..257728) [1119 bp, 372 aa] {ON...    53   2e-06
Kpol_1056.20 s1056 complement(44529..46724) [2196 bp, 731 aa] {O...    54   2e-06
NCAS0A10590 Chr1 complement(2108142..2111429) [3288 bp, 1095 aa]...    54   2e-06
KLLA0D13266g Chr4 complement(1137750..1141208) [3459 bp, 1152 aa...    54   2e-06
KLTH0F09504g Chr6 (824743..824770,824831..825729) [927 bp, 308 a...    52   2e-06
Smik_2.191 Chr2 complement(338792..342118) [3327 bp, 1108 aa] {O...    54   2e-06
Ecym_8380 Chr8 (772519..774573) [2055 bp, 684 aa] {ON} similar t...    53   2e-06
Kwal_33.15381 s33 complement(1080902..1083868) [2967 bp, 988 aa]...    54   2e-06
Kpol_1033.63 s1033 complement(158652..160205) [1554 bp, 517 aa] ...    53   2e-06
KAFR0F02730 Chr6 (537477..539309) [1833 bp, 610 aa] {ON} Anc_4.4...    53   2e-06
KLLA0C14278g Chr3 (1240990..1242615) [1626 bp, 541 aa] {ON} simi...    53   2e-06
ZYRO0D07502g Chr4 complement(652782..654320) [1539 bp, 512 aa] {...    53   2e-06
YIL035C Chr9 complement(287790..288908) [1119 bp, 372 aa] {ON}  ...    52   2e-06
Kwal_33.14192 s33 complement(563582..565315) [1734 bp, 577 aa] {...    53   2e-06
SAKL0G10384g Chr7 complement(883824..888848) [5025 bp, 1674 aa] ...    54   2e-06
NDAI0G01760 Chr7 (384420..385700) [1281 bp, 426 aa] {ON}               53   3e-06
YDR283C Chr4 complement(1025070..1030049) [4980 bp, 1659 aa] {ON...    53   3e-06
CAGL0F03311g Chr6 complement(327599..330736) [3138 bp, 1045 aa] ...    53   3e-06
Suva_9.165 Chr9 complement(276469..277587) [1119 bp, 372 aa] {ON...    52   3e-06
TPHA0H01300 Chr8 (293254..294282) [1029 bp, 342 aa] {ON} Anc_5.6...    52   3e-06
Skud_11.181 Chr11 complement(326935..328845) [1911 bp, 636 aa] {...    53   3e-06
SAKL0H11748g Chr8 complement(1002207..1003541) [1335 bp, 444 aa]...    52   3e-06
NDAI0C04000 Chr3 (907842..912812) [4971 bp, 1656 aa] {ON} Anc_5....    53   3e-06
CAGL0I08349g Chr9 complement(813998..816001) [2004 bp, 667 aa] {...    53   3e-06
NDAI0J00420 Chr10 (73312..75606) [2295 bp, 764 aa] {ON} Anc_7.515      53   3e-06
KAFR0A01040 Chr1 complement(197612..200350) [2739 bp, 912 aa] {O...    53   3e-06
KLLA0E11947g Chr5 complement(1060048..1061892) [1845 bp, 614 aa]...    52   3e-06
SAKL0H05588g Chr8 (502752..504602) [1851 bp, 616 aa] {ON} simila...    52   3e-06
SAKL0G00990g Chr7 complement(89700..90824) [1125 bp, 374 aa] {ON...    52   4e-06
ZYRO0B16038g Chr2 (1300484..1301515) [1032 bp, 343 aa] {ON} high...    52   4e-06
CAGL0F03707g Chr6 complement(359839..361665) [1827 bp, 608 aa] {...    52   4e-06
NDAI0G03110 Chr7 complement(725984..731107) [5124 bp, 1707 aa] {...    53   4e-06
TDEL0B02610 Chr2 complement(470263..471282) [1020 bp, 339 aa] {O...    52   4e-06
ZYRO0G04488g Chr7 complement(360635..362545) [1911 bp, 636 aa] {...    52   4e-06
NCAS0G00490 Chr7 complement(83953..84996) [1044 bp, 347 aa] {ON}...    52   4e-06
YPR161C Chr16 complement(864449..866422) [1974 bp, 657 aa] {ON} ...    52   4e-06
ABR177C Chr2 complement(735829..738090) [2262 bp, 753 aa] {ON} S...    52   4e-06
KAFR0A02560 Chr1 complement(532248..533351) [1104 bp, 367 aa] {O...    52   4e-06
NCAS0F02520 Chr6 (495799..500631) [4833 bp, 1610 aa] {ON} Anc_5....    52   5e-06
Suva_2.449 Chr2 complement(789612..794603) [4992 bp, 1663 aa] {O...    52   5e-06
KNAG0J01950 Chr10 complement(352815..354317) [1503 bp, 500 aa] {...    52   5e-06
Smik_4.532 Chr4 complement(956572..961554) [4983 bp, 1660 aa] {O...    52   5e-06
NCAS0B02530 Chr2 complement(422882..424207) [1326 bp, 441 aa] {O...    52   5e-06
TBLA0A03220 Chr1 complement(765108..768590) [3483 bp, 1160 aa] {...    52   5e-06
YOR267C Chr15 complement(822588..824867) [2280 bp, 759 aa] {ON} ...    52   5e-06
Ecym_8129 Chr8 (269437..271626) [2190 bp, 729 aa] {ON} similar t...    52   5e-06
TBLA0C03180 Chr3 complement(770462..775468) [5007 bp, 1668 aa] {...    52   5e-06
TDEL0A02330 Chr1 complement(420205..421662) [1458 bp, 485 aa] {O...    52   5e-06
Kwal_47.17345 s47 complement(364905..367004) [2100 bp, 699 aa] {...    52   5e-06
Suva_16.97 Chr16 complement(165977..167083) [1107 bp, 368 aa] {O...    51   5e-06
TBLA0B08810 Chr2 (2094401..2095375) [975 bp, 324 aa] {ON} Anc_2....    51   6e-06
NCAS0A04440 Chr1 complement(895181..896935) [1755 bp, 584 aa] {O...    52   6e-06
Suva_8.316 Chr8 complement(561812..563914) [2103 bp, 700 aa] {ON...    52   6e-06
TPHA0M01120 Chr13 complement(223548..225914) [2367 bp, 788 aa] {...    52   6e-06
KLTH0G18612g Chr7 (1604066..1608640) [4575 bp, 1524 aa] {ON} sim...    52   6e-06
Kwal_23.5668 s23 (1263868..1268937) [5070 bp, 1689 aa] {ON} YDR2...    52   6e-06
SAKL0F07854g Chr6 (600324..601442) [1119 bp, 372 aa] {ON} highly...    51   6e-06
NDAI0F00560 Chr6 complement(128674..129717) [1044 bp, 347 aa] {O...    51   6e-06
Kwal_47.18098 s47 (685497..686621) [1125 bp, 374 aa] {ON} YIL035...    51   6e-06
KAFR0K01310 Chr11 (270172..271191) [1020 bp, 339 aa] {ON} Anc_5....    51   7e-06
Smik_9.156 Chr9 complement(261998..263116) [1119 bp, 372 aa] {ON...    51   7e-06
SAKL0D03234g Chr4 (262365..264941) [2577 bp, 858 aa] {ON} some s...    52   7e-06
Kwal_55.21900 s55 complement(1027253..1029130) [1878 bp, 625 aa]...    52   7e-06
KLLA0F22297g Chr6 complement(2083448..2085547) [2100 bp, 699 aa]...    52   7e-06
Kwal_26.8347 s26 complement(748254..750032) [1779 bp, 592 aa] {O...    52   7e-06
Kpol_1063.4 s1063 complement(10790..11932) [1143 bp, 380 aa] {ON...    51   7e-06
Smik_15.449 Chr15 complement(772245..774437) [2193 bp, 730 aa] {...    52   8e-06
KLTH0F03916g Chr6 complement(348177..350282) [2106 bp, 701 aa] {...    52   8e-06
NDAI0A02720 Chr1 complement(612346..613455) [1110 bp, 369 aa] {O...    51   8e-06
Smik_11.125 Chr11 complement(208208..209764) [1557 bp, 518 aa] {...    51   8e-06
TBLA0I01310 Chr9 (279407..281245) [1839 bp, 612 aa] {ON} Anc_2.4...    51   8e-06
Kpol_1041.9 s1041 (27806..29059) [1254 bp, 417 aa] {ON} (27806.....    51   8e-06
Skud_2.179 Chr2 complement(325193..328465) [3273 bp, 1090 aa] {O...    52   8e-06
ADR204W Chr4 (1062593..1063612) [1020 bp, 339 aa] {ON} Syntenic ...    51   8e-06
CAGL0G02035g Chr7 (179911..180930) [1020 bp, 339 aa] {ON} highly...    51   8e-06
KNAG0C01020 Chr3 (200271..202595) [2325 bp, 774 aa] {ON} Anc_1.1...    52   8e-06
Skud_11.20 Chr11 complement(51603..53558) [1956 bp, 651 aa] {ON}...    51   9e-06
Smik_16.420 Chr16 complement(725685..727658) [1974 bp, 657 aa] {...    51   9e-06
NCAS0A13320 Chr1 (2622149..2623258) [1110 bp, 369 aa] {ON}             51   9e-06
KNAG0L01860 Chr12 (336795..337817) [1023 bp, 340 aa] {ON} Anc_5....    50   9e-06
Kpol_1031.67 s1031 (174170..175663) [1494 bp, 497 aa] {ON} (1741...    51   9e-06
NDAI0H02930 Chr8 (715278..716846) [1569 bp, 522 aa] {ON} Anc_2.391     51   1e-05
KNAG0H00560 Chr8 (89502..91268) [1767 bp, 588 aa] {ON} Anc_2.597...    51   1e-05
Ecym_4364 Chr4 (772870..773997) [1128 bp, 375 aa] {ON} similar t...    50   1e-05
KNAG0D00830 Chr4 complement(130823..131986) [1164 bp, 387 aa] {O...    50   1e-05
KNAG0I03000 Chr9 (596789..598840) [2052 bp, 683 aa] {ON} Anc_4.4...    51   1e-05
Skud_16.460 Chr16 complement(807116..809077) [1962 bp, 653 aa] {...    51   1e-05
KLTH0D01386g Chr4 (129448..130053,130132..130974) [1449 bp, 482 ...    51   1e-05
Suva_11.24 Chr11 complement(52742..52930,52961..54523) [1752 bp,...    51   1e-05
Kpol_489.20 s489 complement(59150..60178) [1029 bp, 342 aa] {ON}...    50   1e-05
Suva_16.491 Chr16 complement(848824..850794) [1971 bp, 656 aa] {...    51   1e-05
KLTH0D08712g Chr4 complement(728072..729886) [1815 bp, 604 aa] {...    51   1e-05
Kpol_1013.52 s1013 (123332..125881) [2550 bp, 849 aa] {ON} (1233...    51   1e-05
KAFR0B03170 Chr2 complement(656163..658025) [1863 bp, 620 aa] {O...    51   1e-05
TDEL0E02600 Chr5 (501545..504934) [3390 bp, 1129 aa] {ON} Anc_5....    51   1e-05
KLLA0F17006g Chr6 complement(1561859..1563106) [1248 bp, 415 aa]...    50   1e-05
Kwal_26.8941 s26 complement(1014543..1016528) [1986 bp, 661 aa] ...    51   1e-05
KLTH0A03542g Chr1 (306667..307803) [1137 bp, 378 aa] {ON} highly...    50   1e-05
ADL102C Chr4 complement(503667..504785) [1119 bp, 372 aa] {ON} S...    50   1e-05
KLTH0E07128g Chr5 complement(657986..660064) [2079 bp, 692 aa] {...    51   1e-05
KAFR0B00520 Chr2 (105553..107502) [1950 bp, 649 aa] {ON} Anc_4.1...    51   1e-05
TBLA0B01650 Chr2 (370837..372306) [1470 bp, 489 aa] {ON} Anc_3.1...    50   1e-05
Kpol_1002.21 s1002 complement(62702..63895) [1194 bp, 397 aa] {O...    50   1e-05
KAFR0J01370 Chr10 complement(250424..252766) [2343 bp, 780 aa] {...    51   1e-05
Ecym_2650 Chr2 complement(1257641..1260325) [2685 bp, 894 aa] {O...    51   1e-05
CAGL0M13167g Chr13 complement(1293074..1294906) [1833 bp, 610 aa...    50   1e-05
Kpol_2001.46 s2001 (127016..129376) [2361 bp, 786 aa] {ON} (1270...    50   1e-05
Ecym_4056 Chr4 complement(119406..120428) [1023 bp, 340 aa] {ON}...    50   1e-05
NDAI0D01450 Chr4 (339780..341948) [2169 bp, 722 aa] {ON} Anc_1.507     50   2e-05
Smik_15.535 Chr15 complement(940569..942050) [1482 bp, 493 aa] {...    50   2e-05
Skud_15.228 Chr15 (403382..404401) [1020 bp, 339 aa] {ON} YOR061...    50   2e-05
TPHA0D00360 Chr4 complement(55596..60206) [4611 bp, 1536 aa] {ON...    51   2e-05
AEL179W Chr5 (302948..303817) [870 bp, 289 aa] {ON} NOHBY510; No...    49   2e-05
Skud_4.546 Chr4 complement(967636..972618) [4983 bp, 1660 aa] {O...    51   2e-05
TPHA0L01240 Chr12 (263357..264814) [1458 bp, 485 aa] {ON} Anc_8....    50   2e-05
Kpol_1052.22 s1052 (72364..75669) [3306 bp, 1101 aa] {ON} (72364...    50   2e-05
Ecym_2357 Chr2 (700079..701914) [1836 bp, 611 aa] {ON} similar t...    50   2e-05
YOR061W Chr15 (441534..442553) [1020 bp, 339 aa] {ON}  CKA2Alpha...    50   2e-05
Smik_16.209 Chr16 complement(377965..379425) [1461 bp, 486 aa] {...    50   2e-05
ADR163W Chr4 (989728..991008) [1281 bp, 426 aa] {ON} Syntenic ho...    50   2e-05
Skud_4.237 Chr4 (418979..420502) [1524 bp, 507 aa] {ON} YDL017W ...    50   2e-05
Suva_8.111 Chr8 (204414..205433) [1020 bp, 339 aa] {ON} YOR061W ...    50   2e-05
KNAG0G02780 Chr7 complement(615058..617202) [2145 bp, 714 aa] {O...    50   2e-05
TDEL0C00590 Chr3 complement(94223..99031) [4809 bp, 1602 aa] {ON...    50   2e-05
YOR351C Chr15 complement(995018..996511) [1494 bp, 497 aa] {ON} ...    50   2e-05
CAGL0C02893g Chr3 complement(286017..287966) [1950 bp, 649 aa] {...    50   2e-05
NDAI0F01340 Chr6 complement(327928..329148) [1221 bp, 406 aa] {O...    49   2e-05
Skud_16.256 Chr16 complement(465728..467362) [1635 bp, 544 aa] {...    50   2e-05
TDEL0H02380 Chr8 complement(399810..400931) [1122 bp, 373 aa] {O...    49   2e-05
YDL017W Chr4 (424209..425732) [1524 bp, 507 aa] {ON}  CDC7DDK (D...    50   2e-05
SAKL0C04576g Chr3 complement(444365..446611) [2247 bp, 748 aa] {...    50   3e-05
NDAI0K01150 Chr11 complement(264377..266527) [2151 bp, 716 aa] {...    50   3e-05
ADR174C Chr4 complement(1008796..1010811) [2016 bp, 671 aa] {ON}...    50   3e-05
AAL083W Chr1 (196774..201870) [5097 bp, 1698 aa] {ON} Syntenic h...    50   3e-05
Suva_16.291 Chr16 complement(504006..505433) [1428 bp, 475 aa] {...    50   3e-05
YKL198C Chr11 complement(68232..70220) [1989 bp, 662 aa] {ON}  P...    50   3e-05
KLTH0D05082g Chr4 complement(457124..458680) [1557 bp, 518 aa] {...    50   3e-05
KLTH0D12166g Chr4 complement(987310..989061) [1752 bp, 583 aa] {...    50   3e-05
TBLA0A01660 Chr1 complement(391368..392828) [1461 bp, 486 aa] {O...    49   3e-05
AFR372W Chr6 (1109169..1111493) [2325 bp, 774 aa] {ON} Syntenic ...    50   3e-05
AER216C Chr5 complement(1032840..1034348) [1509 bp, 502 aa] {ON}...    49   3e-05
KLLA0E04247g Chr5 (382874..383995) [1122 bp, 373 aa] {ON} simila...    49   3e-05
Smik_4.218 Chr4 (406174..407697) [1524 bp, 507 aa] {ON} YDL017W ...    49   3e-05
Ecym_6294 Chr6 complement(551351..552982) [1632 bp, 543 aa] {ON}...    50   3e-05
SAKL0F15510g Chr6 complement(1251475..1253373) [1899 bp, 632 aa]...    50   3e-05
Smik_15.241 Chr15 (407598..408617) [1020 bp, 339 aa] {ON} YOR061...    49   3e-05
KLTH0F18458g Chr6 complement(1491777..1493663) [1887 bp, 628 aa]...    49   3e-05
TBLA0D01200 Chr4 (303528..305198) [1671 bp, 556 aa] {ON} Anc_8.7...    49   3e-05
Kwal_YGOB_23.3471 s23 (305207..305234,305298..306196) [927 bp, 3...    49   3e-05
KAFR0H01570 Chr8 complement(290698..291897) [1200 bp, 399 aa] {O...    49   3e-05
KNAG0H02860 Chr8 (531728..532843) [1116 bp, 371 aa] {ON}               49   3e-05
AEL149C Chr5 complement(348350..350533) [2184 bp, 727 aa] {ON} S...    49   3e-05
Smik_9.84 Chr9 (162983..165409) [2427 bp, 808 aa] {ON} YIL095W (...    49   4e-05
KLLA0F16467g Chr6 (1519800..1520822) [1023 bp, 340 aa] {ON} high...    49   4e-05
Klac_YGOB_Anc_8.34 Chr6 (836287..839007,839010..841004) [4716 bp...    50   4e-05
Kpol_365.3 s365 complement(2204..4177,4180..4206,4209..4874) [26...    49   4e-05
Ecym_1313 Chr1 complement(633556..634455) [900 bp, 299 aa] {ON} ...    49   4e-05
KAFR0E02850 Chr5 (575512..576786) [1275 bp, 424 aa] {ON} Anc_8.4...    49   4e-05
NCAS0A15040 Chr1 complement(2962030..2964036) [2007 bp, 668 aa] ...    49   4e-05
Suva_9.104 Chr9 (178011..180428) [2418 bp, 805 aa] {ON} YIL095W ...    49   4e-05
ACR218W Chr3 (731433..736142) [4710 bp, 1569 aa] {ON} Syntenic h...    49   4e-05
TDEL0B01590 Chr2 complement(280143..281573) [1431 bp, 476 aa] {O...    49   4e-05
SAKL0E03344g Chr5 (272024..273754) [1731 bp, 576 aa] {ON} simila...    49   4e-05
Suva_4.297 Chr4 complement(523650..526973) [3324 bp, 1107 aa] {O...    49   5e-05
TBLA0G01910 Chr7 complement(500551..502596) [2046 bp, 681 aa] {O...    49   5e-05
TPHA0B02780 Chr2 complement(633307..634449) [1143 bp, 380 aa] {O...    49   5e-05
NCAS0F02410 Chr6 complement(476683..478071) [1389 bp, 462 aa] {O...    49   5e-05
Kpol_1051.42 s1051 (98030..99379,99382..100212) [2181 bp, 726 aa...    49   5e-05
KAFR0E01490 Chr5 (298209..303167) [4959 bp, 1652 aa] {ON} Anc_5....    49   5e-05
KLTH0G06468g Chr7 complement(513119..518251) [5133 bp, 1710 aa] ...    49   5e-05
Kwal_27.11777 s27 (942591..943985) [1395 bp, 464 aa] {ON} YPL026...    49   5e-05
KNAG0K01660 Chr11 complement(345808..347331) [1524 bp, 507 aa] {...    49   5e-05
Smik_11.24 Chr11 complement(52600..54522) [1923 bp, 640 aa] {ON}...    49   6e-05
TPHA0G01450 Chr7 (297855..299861) [2007 bp, 668 aa] {ON}               49   6e-05
TBLA0J00250 Chr10 (42058..44457) [2400 bp, 799 aa] {ON} Anc_7.51...    49   6e-05
ZYRO0D16170g Chr4 (1348849..1349982) [1134 bp, 377 aa] {ON} high...    48   6e-05
SAKL0B11308g Chr2 complement(984543..986369) [1827 bp, 608 aa] {...    49   6e-05
Ecym_8164 Chr8 (342672..346076) [3405 bp, 1134 aa] {ON} similar ...    49   6e-05
KNAG0C02250 Chr3 complement(444156..446639) [2484 bp, 827 aa] {O...    49   7e-05
ZYRO0A05060g Chr1 complement(405402..406886) [1485 bp, 494 aa] {...    48   7e-05
TBLA0D02070 Chr4 complement(522456..523958) [1503 bp, 500 aa] {O...    48   7e-05
KNAG0B04500 Chr2 (865766..869089) [3324 bp, 1107 aa] {ON} Anc_5....    49   7e-05
Kwal_26.7682 s26 complement(470565..472121) [1557 bp, 518 aa] {O...    48   7e-05
TPHA0I02660 Chr9 (582108..584219) [2112 bp, 703 aa] {ON} Anc_1.3...    49   7e-05
Suva_4.232 Chr4 (417104..418627) [1524 bp, 507 aa] {ON} YDL017W ...    48   7e-05
KLTH0B02178g Chr2 (171582..174551) [2970 bp, 989 aa] {ON} simila...    49   8e-05
KLTH0C07260g Chr3 (626334..629039) [2706 bp, 901 aa] {ON} simila...    49   8e-05
Kwal_23.3471 s23 (305414..306196) [783 bp, 260 aa] {OFF} YDL108W...    47   8e-05
TBLA0G03450 Chr7 (913497..919415) [5919 bp, 1972 aa] {ON} Anc_8....    49   9e-05
CAGL0H00979g Chr8 complement(94328..95527) [1200 bp, 399 aa] {ON...    48   9e-05
ABL055C Chr2 complement(295495..297105) [1611 bp, 536 aa] {ON} S...    48   9e-05
Ecym_1508 Chr1 (1045857..1050941) [5085 bp, 1694 aa] {ON} simila...    49   9e-05
KNAG0A04080 Chr1 complement(551409..552635) [1227 bp, 408 aa] {O...    48   9e-05
ABR088C Chr2 complement(546325..547920) [1596 bp, 531 aa] {ON} S...    48   9e-05
Kpol_1039.33 s1039 complement(102096..104201) [2106 bp, 701 aa] ...    48   9e-05
YJL187C Chr10 complement(76803..79262) [2460 bp, 819 aa] {ON}  S...    48   1e-04
CAGL0K00693g Chr11 complement(75466..78096) [2631 bp, 876 aa] {O...    48   1e-04
KNAG0D02790 Chr4 (507235..508848) [1614 bp, 537 aa] {ON} Anc_5.3...    48   1e-04
KLLA0F26983g Chr6 (2489326..2490729) [1404 bp, 467 aa] {ON} some...    48   1e-04
NDAI0A06470 Chr1 (1470263..1472083) [1821 bp, 606 aa] {ON} Anc_3...    48   1e-04
Suva_6.26 Chr6 complement(42811..48072) [5262 bp, 1753 aa] {ON} ...    48   1e-04
NCAS0I01870 Chr9 (345214..346866) [1653 bp, 550 aa] {ON} Anc_3.1...    48   1e-04
NCAS0B08320 Chr2 complement(1585766..1588471) [2706 bp, 901 aa] ...    48   1e-04
KNAG0A06390 Chr1 complement(974644..976254) [1611 bp, 536 aa] {O...    47   1e-04
KAFR0F02310 Chr6 (452380..453912) [1533 bp, 510 aa] {ON} Anc_3.1...    47   1e-04
TBLA0B05930 Chr2 (1400163..1402316) [2154 bp, 717 aa] {ON} Anc_2...    47   1e-04
TDEL0F02980 Chr6 (539327..541549) [2223 bp, 740 aa] {ON} Anc_1.1...    47   1e-04
Ecym_7414 Chr7 (848665..850440) [1776 bp, 591 aa] {ON} similar t...    47   1e-04
SAKL0A03344g Chr1 complement(305149..306243) [1095 bp, 364 aa] {...    47   2e-04
Ecym_5258 Chr5 (536868..538376) [1509 bp, 502 aa] {ON} similar t...    47   2e-04
ADL217W Chr4 (321491..323743) [2253 bp, 750 aa] {ON} Syntenic ho...    47   2e-04
Ecym_3323 Chr3 (618386..620632) [2247 bp, 748 aa] {ON} similar t...    47   2e-04
NDAI0C00570 Chr3 (108274..110547) [2274 bp, 757 aa] {ON}               47   2e-04
TDEL0H00560 Chr8 (94614..96500) [1887 bp, 628 aa] {ON} Anc_7.515...    47   2e-04
Kwal_27.10945 s27 (565717..568524) [2808 bp, 935 aa] {ON} YBR059...    47   2e-04
TPHA0D01540 Chr4 complement(316471..318594) [2124 bp, 707 aa] {O...    47   2e-04
KNAG0E03200 Chr5 complement(641437..646020) [4584 bp, 1527 aa] {...    47   2e-04
Smik_6.46 Chr6 complement(84451..89733) [5283 bp, 1760 aa] {ON} ...    47   2e-04
Smik_4.494 Chr4 (900954..902321) [1368 bp, 455 aa] {ON} YDR247W ...    46   2e-04
NCAS0C03770 Chr3 complement(761101..765897) [4797 bp, 1598 aa] {...    47   3e-04
NCAS0I01210 Chr9 complement(218242..222582) [4341 bp, 1446 aa] {...    47   3e-04
Kpol_1072.1 s1072 (686..2683) [1998 bp, 665 aa] {ON} (686..2683)...    47   3e-04
YPL026C Chr16 complement(500675..502183) [1509 bp, 502 aa] {ON} ...    46   3e-04
NCAS0B06260 Chr2 complement(1180650..1182821) [2172 bp, 723 aa] ...    46   3e-04
Kwal_55.20221 s55 (304482..308006) [3525 bp, 1174 aa] {ON} YHR07...    47   3e-04
ZYRO0F03014g Chr6 complement(255189..260003) [4815 bp, 1604 aa] ...    47   3e-04
Ecym_6044 Chr6 complement(84500..85756) [1257 bp, 418 aa] {ON} s...    46   3e-04
KAFR0C03520 Chr3 (715667..720019) [4353 bp, 1450 aa] {ON} Anc_8....    47   3e-04
AFL143C Chr6 complement(164241..165326) [1086 bp, 361 aa] {ON} S...    46   3e-04
TDEL0D03520 Chr4 (647828..650977) [3150 bp, 1049 aa] {ON} Anc_3....    46   4e-04
TDEL0A06750 Chr1 (1179818..1180936) [1119 bp, 372 aa] {ON} Anc_6...    45   4e-04
KNAG0B05340 Chr2 complement(1031600..1033588) [1989 bp, 662 aa] ...    46   4e-04
CAGL0K12496g Chr11 (1219220..1220302) [1083 bp, 360 aa] {ON} sim...    45   4e-04
TPHA0A04330 Chr1 (974713..976218) [1506 bp, 501 aa] {ON} Anc_3.1...    46   4e-04
KLLA0B07579g Chr2 (659591..661759) [2169 bp, 722 aa] {ON} simila...    46   4e-04
Ecym_1502 Chr1 (1030765..1031838) [1074 bp, 357 aa] {ON} similar...    45   4e-04
KNAG0F03730 Chr6 complement(697517..699586) [2070 bp, 689 aa] {O...    46   4e-04
Skud_6.38 Chr6 complement(72416..77692) [5277 bp, 1758 aa] {ON} ...    46   4e-04
AGR315C Chr7 complement(1319993..1322872) [2880 bp, 959 aa] {ON}...    46   5e-04
KNAG0A02350 Chr1 complement(223757..225022) [1266 bp, 421 aa] {O...    45   5e-04
TDEL0D01930 Chr4 complement(373906..375753) [1848 bp, 615 aa] {O...    45   5e-04
KLLA0E08405g Chr5 complement(756205..758538) [2334 bp, 777 aa] {...    45   6e-04
YIL095W Chr9 (183937..186369) [2433 bp, 810 aa] {ON}  PRK1Protei...    45   6e-04
YFL033C Chr6 complement(69115..74427) [5313 bp, 1770 aa] {ON}  R...    46   6e-04
Suva_6.268 Chr6 (470348..472519) [2172 bp, 723 aa] {ON} YJL187C ...    45   6e-04
TDEL0D04390 Chr4 complement(799835..801340) [1506 bp, 501 aa] {O...    45   6e-04
NCAS0I03020 Chr9 (555481..557853) [2373 bp, 790 aa] {ON} Anc_1.149     45   6e-04
Skud_10.30 Chr10 complement(51698..54124) [2427 bp, 808 aa] {ON}...    45   7e-04
ZYRO0E06864g Chr5 complement(516731..520078) [3348 bp, 1115 aa] ...    45   7e-04
Kpol_1066.19 s1066 (31013..32806) [1794 bp, 597 aa] {OFF} (31013...    45   7e-04
Kpol_YGOB_1066.19 s1066 (30983..32806) [1824 bp, 607 aa] {ON} AN...    45   7e-04
CAGL0K11275g Chr11 (1094626..1096203) [1578 bp, 525 aa] {ON} sim...    45   7e-04
KLTH0E03828g Chr5 (345775..349131) [3357 bp, 1118 aa] {ON} simil...    45   7e-04
Ecym_8210 Chr8 (431406..434297) [2892 bp, 963 aa] {ON} similar t...    45   8e-04
KLTH0H03080g Chr8 complement(274038..275078) [1041 bp, 346 aa] {...    44   8e-04
KNAG0H01220 Chr8 (209884..212625) [2742 bp, 913 aa] {ON} Anc_3.2...    45   8e-04
KAFR0F01630 Chr6 complement(323802..326057) [2256 bp, 751 aa] {O...    45   8e-04
SAKL0G13882g Chr7 complement(1191656..1194604) [2949 bp, 982 aa]...    45   8e-04
SAKL0D06820g Chr4 (566145..567938) [1794 bp, 597 aa] {ON} simila...    45   0.001
Kpol_1035.40 s1035 (101912..102910,102960..102968,103011..106556...    45   0.001
Smik_11.58 Chr11 (112932..115715) [2784 bp, 927 aa] {ON} YKL171W...    45   0.001
Skud_9.78 Chr9 (160531..162960) [2430 bp, 809 aa] {ON} YIL095W (...    45   0.001
ZYRO0C12078g Chr3 (946320..948647) [2328 bp, 775 aa] {ON} simila...    45   0.001
KAFR0G00440 Chr7 (124896..127328) [2433 bp, 810 aa] {ON} Anc_1.1...    45   0.001
KLLA0F01408g Chr6 (135424..136302) [879 bp, 292 aa] {ON} conserv...    44   0.001
Kpol_1035.34 s1035 (79914..80978) [1065 bp, 354 aa] {ON} (79914....    44   0.001
KLTH0E15972g Chr5 complement(1414595..1416016) [1422 bp, 473 aa]...    44   0.001
AGR027C Chr7 complement(763303..766188) [2886 bp, 961 aa] {ON} S...    44   0.001
Smik_10.45 Chr10 complement(74813..77278) [2466 bp, 821 aa] {ON}...    44   0.001
Kpol_1065.6 s1065 (12266..12916,12918..13280,13332..13340,13394....    44   0.001
ZYRO0A02772g Chr1 complement(223226..224473) [1248 bp, 415 aa] {...    44   0.001
NDAI0A00920 Chr1 (189693..192521) [2829 bp, 942 aa] {ON} Anc_1.1...    44   0.002
YKL171W Chr11 (127475..130261) [2787 bp, 928 aa] {ON}  NNK1Prote...    44   0.002
CAGL0J05082g Chr10 (483782..485743) [1962 bp, 653 aa] {ON} simil...    44   0.002
TPHA0C01810 Chr3 complement(413495..414790) [1296 bp, 431 aa] {O...    44   0.002
AEL173W Chr5 (313261..314856) [1596 bp, 531 aa] {ON} Syntenic ho...    44   0.002
ADR293C Chr4 complement(1207021..1210425) [3405 bp, 1134 aa] {ON...    44   0.002
CAGL0J03432g Chr10 (330031..331899) [1869 bp, 622 aa] {ON} simil...    44   0.002
TPHA0C03380 Chr3 (740939..743032) [2094 bp, 697 aa] {ON} Anc_2.2...    44   0.002
CAGL0K01815g Chr11 (162973..164487) [1515 bp, 504 aa] {ON} simil...    44   0.002
KLLA0F18612g Chr6 (1711131..1713575) [2445 bp, 814 aa] {ON} some...    44   0.002
NCAS0G03810 Chr7 complement(703842..705827) [1986 bp, 661 aa] {O...    44   0.002
SAKL0C07876g Chr3 (732534..733970) [1437 bp, 478 aa] {ON} simila...    44   0.002
KNAG0E03260 Chr5 complement(654134..655246) [1113 bp, 370 aa] {O...    43   0.002
ZYRO0G20570g Chr7 (1695518..1697305) [1788 bp, 595 aa] {ON} simi...    44   0.002
KLLA0D11044g Chr4 complement(942458..944068) [1611 bp, 536 aa] {...    44   0.002
TPHA0A04030 Chr1 (901665..904829) [3165 bp, 1054 aa] {ON} Anc_3....    44   0.002
CAGL0I08899g Chr9 complement(863906..866701) [2796 bp, 931 aa] {...    44   0.002
KLTH0H10582g Chr8 (914695..916440) [1746 bp, 581 aa] {ON} weakly...    44   0.002
KLLA0C04345g Chr3 (397899..399326) [1428 bp, 475 aa] {ON} simila...    43   0.002
NDAI0G00640 Chr7 (139655..141520) [1866 bp, 621 aa] {ON} Anc_2.284     44   0.002
Kpol_1010.68 s1010 complement(168093..169595) [1503 bp, 500 aa] ...    43   0.003
TPHA0N00370 Chr14 (68298..69650) [1353 bp, 450 aa] {ON} Anc_7.41...    43   0.003
Skud_11.54 Chr11 (113775..116570) [2796 bp, 931 aa] {ON} YKL171W...    43   0.003
Suva_4.344 Chr4 (606007..610371) [4365 bp, 1454 aa] {ON} YBR097W...    43   0.003
CAGL0G02607g Chr7 complement(240244..242310) [2067 bp, 688 aa] {...    43   0.004
SAKL0B01210g Chr2 complement(109892..114658) [4767 bp, 1588 aa] ...    43   0.004
Kpol_209.1 s209 (1823..5734) [3912 bp, 1303 aa] {ON} (1823..5734...    43   0.004
KLLA0B06501g Chr2 complement(576636..579089) [2454 bp, 817 aa] {...    43   0.004
Suva_15.271 Chr15 complement(460466..463813) [3348 bp, 1115 aa] ...    43   0.004
Skud_13.385 Chr13 complement(672612..674966) [2355 bp, 784 aa] {...    43   0.004
ZYRO0D10472g Chr4 (876899..880357) [3459 bp, 1152 aa] {ON} simil...    43   0.005
NCAS0G01210 Chr7 complement(215860..216963) [1104 bp, 367 aa] {O...    42   0.005
Kwal_27.9804 s27 (69307..70728) [1422 bp, 473 aa] {ON} YDL017W (...    42   0.005
SAKL0E07722g Chr5 complement(625066..627441) [2376 bp, 791 aa] {...    42   0.005
ZYRO0F03190g Chr6 complement(270262..271371) [1110 bp, 369 aa] {...    42   0.005
AEL120W Chr5 (396394..398715) [2322 bp, 773 aa] {ON} Syntenic ho...    42   0.006
CAGL0F03905g Chr6 complement(377962..380088) [2127 bp, 708 aa] {...    42   0.006
NDAI0F01640 Chr6 (401323..403086) [1764 bp, 587 aa] {ON} Anc_6.215     42   0.007
TBLA0A02240 Chr1 (539297..540538) [1242 bp, 413 aa] {ON} Anc_6.2...    42   0.007
TBLA0J01200 Chr10 (271800..275420) [3621 bp, 1206 aa] {ON} Anc_1...    42   0.007
TPHA0H01470 Chr8 complement(329451..333578) [4128 bp, 1375 aa] {...    42   0.007
KLTH0G10318g Chr7 (872129..874501) [2373 bp, 790 aa] {ON} simila...    42   0.007
NCAS0A01090 Chr1 (216576..218042) [1467 bp, 488 aa] {ON} Anc_6.215     42   0.007
Suva_13.399 Chr13 complement(679223..681388) [2166 bp, 721 aa] {...    42   0.008
Skud_8.139 Chr8 complement(232178..235534) [3357 bp, 1118 aa] {O...    42   0.008
Kwal_27.11542 s27 complement(841389..843764) [2376 bp, 791 aa] {...    42   0.008
Suva_14.327 Chr14 complement(578572..580470) [1899 bp, 632 aa] {...    42   0.008
KLLA0D10527g Chr4 (892955..894892) [1938 bp, 645 aa] {ON} simila...    42   0.008
TPHA0A02630 Chr1 complement(562516..565164) [2649 bp, 882 aa] {O...    42   0.008
KAFR0C03480 Chr3 (708186..709277) [1092 bp, 363 aa] {ON} Anc_8.4...    41   0.009
Kwal_14.2554 s14 (811455..813233) [1779 bp, 592 aa] {ON} YJL057C...    42   0.009
Suva_11.52 Chr11 (112355..115156) [2802 bp, 933 aa] {ON} YKL171W...    42   0.010
TBLA0D01110 Chr4 (283160..285640) [2481 bp, 826 aa] {ON} Anc_8.7...    41   0.010
Kwal_33.13225 s33 (127676..130570) [2895 bp, 964 aa] {ON} YFR016...    42   0.011
YDR247W Chr4 (956013..957398) [1386 bp, 461 aa] {ON}  VHS1Cytopl...    41   0.011
Smik_13.424 Chr13 complement(682907..685177) [2271 bp, 756 aa] {...    41   0.011
YMR216C Chr13 complement(698811..701039) [2229 bp, 742 aa] {ON} ...    41   0.012
Kwal_26.9032 s26 complement(1047382..1049157) [1776 bp, 591 aa] ...    41   0.012
TBLA0D02510 Chr4 complement(626101..627234) [1134 bp, 377 aa] {O...    41   0.012
SAKL0B07326g Chr2 (627224..631477) [4254 bp, 1417 aa] {ON} simil...    41   0.012
Suva_6.29 Chr6 complement(51588..52691) [1104 bp, 367 aa] {ON} Y...    41   0.012
SAKL0G08448g Chr7 (718250..721717) [3468 bp, 1155 aa] {ON} simil...    41   0.012
TBLA0A06660 Chr1 complement(1626147..1630400) [4254 bp, 1417 aa]...    41   0.013
YBR097W Chr2 (436951..441315) [4365 bp, 1454 aa] {ON}  VPS15Myri...    41   0.014
Kpol_1003.35 s1003 (89266..91407) [2142 bp, 713 aa] {ON} (89266....    41   0.014
NCAS0C01030 Chr3 (192001..194043) [2043 bp, 680 aa] {ON} Anc_8.732     41   0.016
Skud_16.42 Chr16 complement(75193..76287) [1095 bp, 364 aa] {ON}...    40   0.017
Kpol_538.20 s538 (39404..42382) [2979 bp, 992 aa] {ON} (39404..4...    41   0.017
Suva_2.413 Chr2 (735541..736923) [1383 bp, 460 aa] {ON} YDR247W ...    40   0.017
Kwal_56.24274 s56 (932404..933444) [1041 bp, 346 aa] {ON} YPL236...    40   0.018
TBLA0B09215 Chr2 complement(2180179..2181375) [1197 bp, 398 aa] ...    40   0.018
NDAI0A07790 Chr1 (1790683..1795206) [4524 bp, 1507 aa] {ON} Anc_...    41   0.019
NDAI0K01030 Chr11 (239418..241712) [2295 bp, 764 aa] {ON} Anc_8....    40   0.020
KLLA0F22605g Chr6 complement(2109034..2111913) [2880 bp, 959 aa]...    40   0.020
YHR079C Chr8 complement(258244..261591) [3348 bp, 1115 aa] {ON} ...    40   0.021
NDAI0G05790 Chr7 complement(1433294..1435252) [1959 bp, 652 aa] ...    40   0.022
Kpol_1064.42 s1064 complement(78573..80207) [1635 bp, 544 aa] {O...    40   0.022
TPHA0A02760 Chr1 (594482..597502) [3021 bp, 1006 aa] {ON} Anc_1....    40   0.023
Smik_14.311 Chr14 complement(558013..559926) [1914 bp, 637 aa] {...    40   0.024
TPHA0G01380 Chr7 (279600..281579) [1980 bp, 659 aa] {ON} Anc_8.7...    40   0.024
Kpol_1006.14 s1006 (52420..54042) [1623 bp, 540 aa] {ON} (52420....    40   0.025
TPHA0H01880 Chr8 (441140..442402) [1263 bp, 420 aa] {ON} Anc_6.2...    40   0.025
Smik_5.268 Chr5 (413820..415397) [1578 bp, 525 aa] {ON} YER123W ...    40   0.025
TPHA0E02830 Chr5 (591805..593364) [1560 bp, 519 aa] {ON} Anc_6.2...    40   0.025
KLTH0D12518g Chr4 complement(1023214..1024992) [1779 bp, 592 aa]...    40   0.025
SAKL0A04444g Chr1 (412103..413527) [1425 bp, 474 aa] {ON} highly...    40   0.026
CAGL0K02299g Chr11 complement(206161..207777) [1617 bp, 538 aa] ...    40   0.027
Ecym_8392 Chr8 (803292..804806) [1515 bp, 504 aa] {ON} similar t...    40   0.028
Skud_2.225 Chr2 (405095..409459) [4365 bp, 1454 aa] {ON} YBR097W...    40   0.028
KAFR0G01670 Chr7 (363200..367459) [4260 bp, 1419 aa] {ON} Anc_3....    40   0.029
SAKL0H05214g Chr8 (468419..470185) [1767 bp, 588 aa] {ON} simila...    40   0.029
Skud_5.255 Chr5 complement(415109..416686) [1578 bp, 525 aa] {ON...    40   0.030
TPHA0G00610 Chr7 (114519..116138) [1620 bp, 539 aa] {ON} Anc_8.7...    40   0.030
Ecym_3160 Chr3 complement(304537..306957) [2421 bp, 806 aa] {ON}...    40   0.030
YER123W Chr5 (404813..406387) [1575 bp, 524 aa] {ON}  YCK3Palmit...    40   0.031
KLLA0D03168g Chr4 (265761..267278) [1518 bp, 505 aa] {ON} simila...    40   0.034
Smik_8.156 Chr8 complement(234928..238269) [3342 bp, 1113 aa] {O...    40   0.035
NCAS0H01740 Chr8 complement(331436..335284) [3849 bp, 1282 aa] {...    40   0.036
TBLA0D00250 Chr4 (61918..63618) [1701 bp, 566 aa] {ON} Anc_2.105...    39   0.037
Kpol_413.7 s413 complement(18363..20267) [1905 bp, 634 aa] {ON} ...    39   0.038
Ecym_6239 Chr6 complement(445704..447791) [2088 bp, 695 aa] {ON}...    39   0.039
NCAS0B04520 Chr2 (821360..822787) [1428 bp, 475 aa] {ON} Anc_8.132     39   0.040
Kwal_33.13825 s33 (409772..412477) [2706 bp, 901 aa] {ON} YKL171...    40   0.040
TDEL0C04810 Chr3 (867670..871932) [4263 bp, 1420 aa] {ON} Anc_3....    40   0.043
Kpol_1033.51 s1033 complement(127843..129165) [1323 bp, 440 aa] ...    39   0.044
Kwal_56.24064 s56 complement(831165..832592) [1428 bp, 475 aa] {...    39   0.045
ZYRO0E07876g Chr5 (616134..617243) [1110 bp, 369 aa] {ON} simila...    39   0.046
NDAI0C01890 Chr3 (419452..423777) [4326 bp, 1441 aa] {ON} Anc_5....    39   0.047
KLLA0F01507g Chr6 (144356..145774) [1419 bp, 472 aa] {ON} some s...    39   0.048
ZYRO0A06182g Chr1 (493846..496062) [2217 bp, 738 aa] {ON} simila...    39   0.048
TDEL0B03770 Chr2 (676581..678575) [1995 bp, 664 aa] {ON} Anc_8.7...    39   0.049
KAFR0C02290 Chr3 complement(449963..451204) [1242 bp, 413 aa] {O...    39   0.050
NCAS0D03820 Chr4 complement(708820..710241) [1422 bp, 473 aa] {O...    39   0.051
NDAI0B00400 Chr2 (74403..76643) [2241 bp, 746 aa] {ON} Anc_1.149       39   0.052
Smik_2.239 Chr2 (421843..426207) [4365 bp, 1454 aa] {ON} YBR097W...    39   0.053
YNL020C Chr14 complement(595623..597539) [1917 bp, 638 aa] {ON} ...    39   0.061
NCAS0B07200 Chr2 complement(1363351..1364940) [1590 bp, 529 aa] ...    39   0.061
SAKL0C05236g Chr3 (498347..501385) [3039 bp, 1012 aa] {ON} simil...    39   0.061
ZYRO0A01848g Chr1 (152134..154248) [2115 bp, 704 aa] {ON} simila...    39   0.063
KLLA0A06776g Chr1 (612115..614517) [2403 bp, 800 aa] {ON} simila...    39   0.065
Smik_6.409 Chr6 complement(658629..660119) [1491 bp, 496 aa] {ON...    39   0.066
TBLA0B06620 Chr2 complement(1556378..1559671) [3294 bp, 1097 aa]...    39   0.068
TDEL0G02150 Chr7 (422718..424703) [1986 bp, 661 aa] {ON} Anc_2.2...    39   0.068
Suva_7.481 Chr7 complement(829537..832644) [3108 bp, 1035 aa] {O...    39   0.069
Ecym_2202 Chr2 (399184..400629) [1446 bp, 481 aa] {ON} similar t...    39   0.070
Suva_16.102 Chr16 (173734..175209) [1476 bp, 491 aa] {ON} YPL204...    39   0.071
KAFR0A01740 Chr1 complement(356086..358035) [1950 bp, 649 aa] {O...    39   0.074
KNAG0E03740 Chr5 complement(738877..741528) [2652 bp, 883 aa] {O...    39   0.075
TDEL0E05230 Chr5 complement(958851..960323) [1473 bp, 490 aa] {O...    39   0.078
Smik_8.216 Chr8 complement(349478..351145) [1668 bp, 555 aa] {ON...    39   0.080
KLTH0E11110g Chr5 (997486..998847) [1362 bp, 453 aa] {ON} simila...    38   0.081
CAGL0G06138g Chr7 complement(585585..587204) [1620 bp, 539 aa] {...    38   0.083
KLTH0H04158g Chr8 (378344..379798) [1455 bp, 484 aa] {ON} simila...    38   0.085
KNAG0J02030 Chr10 complement(368141..370327) [2187 bp, 728 aa] {...    39   0.088
Skud_14.309 Chr14 complement(566344..568263) [1920 bp, 639 aa] {...    38   0.090
TPHA0I01240 Chr9 (283537..285210) [1674 bp, 557 aa] {ON} Anc_2.1...    38   0.091
CAGL0H03553g Chr8 complement(328668..330155) [1488 bp, 495 aa] {...    38   0.091
YPL204W Chr16 (164276..165760) [1485 bp, 494 aa] {ON}  HRR25Prot...    38   0.093
Suva_5.243 Chr5 (380441..382012) [1572 bp, 523 aa] {ON} YER123W ...    38   0.095
SAKL0B04752g Chr2 (416940..418259) [1320 bp, 439 aa] {ON} weakly...    38   0.096
TBLA0F01730 Chr6 complement(431961..433004) [1044 bp, 347 aa] {O...    38   0.097
CAGL0H08437g Chr8 complement(825191..829423) [4233 bp, 1410 aa] ...    39   0.097
TBLA0D05210 Chr4 (1279846..1282323) [2478 bp, 825 aa] {ON} Anc_1...    38   0.099
AFR150C Chr6 complement(707303..708352) [1050 bp, 349 aa] {ON} S...    38   0.10 
KNAG0D02200 Chr4 complement(374609..376075) [1467 bp, 488 aa] {O...    38   0.10 
YNL154C Chr14 complement(343636..345276) [1641 bp, 546 aa] {ON} ...    38   0.10 
TBLA0G02780 Chr7 (730835..732529) [1695 bp, 564 aa] {ON} Anc_8.1...    38   0.10 
KNAG0H02020 Chr8 complement(357248..359026) [1779 bp, 592 aa] {O...    38   0.10 
Skud_16.75 Chr16 (137624..139108) [1485 bp, 494 aa] {ON} YPL204W...    38   0.10 
Smik_14.174 Chr14 complement(323054..324709) [1656 bp, 551 aa] {...    38   0.11 
Skud_14.179 Chr14 complement(334239..335924) [1686 bp, 561 aa] {...    38   0.11 
AER348C Chr5 complement(1275897..1277774) [1878 bp, 625 aa] {ON}...    38   0.11 
Skud_4.509 Chr4 (910551..911945) [1395 bp, 464 aa] {ON} YDR247W ...    38   0.11 
KNAG0D01130 Chr4 (190658..191947) [1290 bp, 429 aa] {ON} Anc_6.2...    38   0.11 
NDAI0I01070 Chr9 (259836..261278) [1443 bp, 480 aa] {ON} Anc_6.215     38   0.12 
NDAI0B02430 Chr2 (608926..610590) [1665 bp, 554 aa] {ON} Anc_8.132     38   0.12 
TDEL0E04680 Chr5 complement(875878..878862) [2985 bp, 994 aa] {O...    38   0.12 
AFL091W Chr6 (272431..273867) [1437 bp, 478 aa] {ON} Syntenic ho...    38   0.13 
KAFR0F00520 Chr6 (111106..112659) [1554 bp, 517 aa] {ON} Anc_2.1...    38   0.14 
Skud_7.518 Chr7 complement(847291..850359) [3069 bp, 1022 aa] {O...    38   0.14 
NDAI0E03210 Chr5 complement(686073..687317) [1245 bp, 414 aa] {O...    37   0.15 
Suva_14.185 Chr14 complement(340104..341789) [1686 bp, 561 aa] {...    37   0.15 
Smik_6.306 Chr6 complement(480942..484031) [3090 bp, 1029 aa] {O...    38   0.15 
TPHA0J02370 Chr10 complement(523628..525016) [1389 bp, 462 aa] {...    37   0.16 
KAFR0K00320 Chr11 (72569..73942) [1374 bp, 457 aa] {ON} Anc_6.21...    37   0.17 
YHR135C Chr8 complement(372694..374310) [1617 bp, 538 aa] {ON}  ...    37   0.17 
NCAS0G02120 Chr7 (381894..383465) [1572 bp, 523 aa] {ON} Anc_2.105     37   0.18 
NDAI0B04530 Chr2 complement(1128472..1130094) [1623 bp, 540 aa] ...    37   0.18 
KAFR0B02070 Chr2 (408079..409539) [1461 bp, 486 aa] {ON} Anc_8.1...    37   0.19 
TBLA0A02040 Chr1 complement(493305..495056) [1752 bp, 583 aa] {O...    37   0.20 
Suva_15.332 Chr15 complement(575263..575547,575959..576084,57614...    37   0.20 
SAKL0H24508g Chr8 (2123140..2124606) [1467 bp, 488 aa] {ON} unip...    37   0.20 
YFL029C Chr6 complement(78055..79161) [1107 bp, 368 aa] {ON}  CA...    37   0.20 
KLLA0C07216g Chr3 (626227..628278) [2052 bp, 683 aa] {ON} simila...    37   0.21 
KLLA0B11924g Chr2 complement(1043344..1047582) [4239 bp, 1412 aa...    37   0.21 
Suva_16.70 Chr16 complement(110631..111725) [1095 bp, 364 aa] {O...    37   0.22 
YGR188C Chr7 complement(872044..875109) [3066 bp, 1021 aa] {ON} ...    37   0.22 
ZYRO0C15884g Chr3 (1241605..1245873) [4269 bp, 1422 aa] {ON} sim...    37   0.22 
NDAI0F03150 Chr6 complement(757283..758923) [1641 bp, 546 aa] {O...    37   0.23 
CAGL0M08316g Chr13 (829069..831963) [2895 bp, 964 aa] {ON} weakl...    37   0.23 
KAFR0H03330 Chr8 complement(635910..637019) [1110 bp, 369 aa] {O...    37   0.23 
ADL053C Chr4 complement(589599..591014) [1416 bp, 471 aa] {ON} S...    37   0.23 
KNAG0F01490 Chr6 (270931..272604) [1674 bp, 557 aa] {ON} Anc_2.1...    37   0.24 
TDEL0F01010 Chr6 complement(178943..180418) [1476 bp, 491 aa] {O...    37   0.25 
ZYRO0G08866g Chr7 complement(713156..714661) [1506 bp, 501 aa] {...    37   0.26 
TDEL0F00910 Chr6 (157379..159070) [1692 bp, 563 aa] {ON} Anc_2.1...    37   0.26 
Ecym_3487 Chr3 complement(910575..914810) [4236 bp, 1411 aa] {ON...    37   0.27 
TPHA0A03700 Chr1 complement(808996..813273) [4278 bp, 1425 aa] {...    37   0.27 
KAFR0A07320 Chr1 complement(1478564..1480033) [1470 bp, 489 aa] ...    37   0.28 
Kwal_33.14596 s33 (735962..737464) [1503 bp, 500 aa] {ON} YNL154...    37   0.29 
Kpol_1027.20 s1027 complement(43412..44974) [1563 bp, 520 aa] {O...    37   0.29 
ZYRO0E02376g Chr5 complement(181177..182817) [1641 bp, 546 aa] {...    37   0.30 
KLTH0B06204g Chr2 complement(502282..503778) [1497 bp, 498 aa] {...    37   0.30 
Skud_8.196 Chr8 complement(346056..346463,346494..347684) [1599 ...    37   0.32 
AFR040W Chr6 (505602..507245) [1644 bp, 547 aa] {ON} Syntenic ho...    36   0.34 
TDEL0C00660 Chr3 complement(107849..108952) [1104 bp, 367 aa] {O...    36   0.35 
ZYRO0G05412g Chr7 (435657..437408) [1752 bp, 583 aa] {ON} simila...    36   0.39 
NCAS0A09170 Chr1 (1813960..1815846) [1887 bp, 628 aa] {ON} Anc_1...    36   0.39 
Kwal_47.17314 s47 complement(347091..348356) [1266 bp, 421 aa] {...    36   0.39 
SAKL0E12100g Chr5 complement(1004036..1005622) [1587 bp, 528 aa]...    36   0.39 
ZYRO0G12232g Chr7 (964508..967591) [3084 bp, 1027 aa] {ON} simil...    36   0.45 
NDAI0B03560 Chr2 complement(892839..895109) [2271 bp, 756 aa] {O...    36   0.45 
NCAS0A07080 Chr1 complement(1400590..1403607) [3018 bp, 1005 aa]...    36   0.45 
TPHA0D01000 Chr4 (202605..204125) [1521 bp, 506 aa] {ON} Anc_8.1...    36   0.46 
CAGL0J05940g Chr10 (562687..564147) [1461 bp, 486 aa] {ON} simil...    36   0.51 
KLLA0E13531g Chr5 (1193481..1194902) [1422 bp, 473 aa] {ON} some...    36   0.53 
TBLA0B05310 Chr2 complement(1251914..1253494) [1581 bp, 526 aa] ...    35   0.59 
YPR106W Chr16 (740061..741392) [1332 bp, 443 aa] {ON}  ISR1Predi...    35   0.60 
Kpol_1002.53 s1002 (150289..151668) [1380 bp, 459 aa] {ON} (1502...    35   0.61 
Skud_12.343 Chr12 (611224..613746) [2523 bp, 840 aa] {ON} YLR263...    35   0.65 
KAFR0B03270 Chr2 complement(677477..679231) [1755 bp, 584 aa] {O...    35   0.65 
NDAI0D02140 Chr4 complement(496708..499785) [3078 bp, 1025 aa] {...    35   0.68 
YPL236C Chr16 complement(101608..102702) [1095 bp, 364 aa] {ON} ...    35   0.68 
KLTH0E06952g Chr5 complement(639783..641045) [1263 bp, 420 aa] {...    35   0.69 
KAFR0K00880 Chr11 (188439..191069) [2631 bp, 876 aa] {ON} Anc_5....    35   0.71 
Kpol_2001.31 s2001 complement(90402..93110) [2709 bp, 902 aa] {O...    35   0.72 
SAKL0H10340g Chr8 complement(883790..886009) [2220 bp, 739 aa] {...    35   0.76 
Smik_6.441 Chr6 (721619..722713) [1095 bp, 364 aa] {ON} YPL236C ...    35   0.78 
KLTH0E15026g Chr5 (1331171..1335730) [4560 bp, 1519 aa] {ON} sim...    35   0.78 
KNAG0J02520 Chr10 (472464..476795) [4332 bp, 1443 aa] {ON} Anc_3...    35   0.78 
Skud_6.41 Chr6 complement(81310..82416) [1107 bp, 368 aa] {ON} Y...    35   0.88 
Suva_16.433 Chr16 (747883..749205) [1323 bp, 440 aa] {ON} YPR106...    35   1.0  
Smik_6.49 Chr6 complement(93305..94408) [1104 bp, 367 aa] {ON} Y...    35   1.1  
KNAG0F01980 Chr6 (379013..380368) [1356 bp, 451 aa] {ON} Anc_6.2...    35   1.1  
KNAG0H03710 Chr8 complement(687550..689184) [1635 bp, 544 aa] {O...    34   1.5  
SAKL0B01474g Chr2 complement(145734..146777) [1044 bp, 347 aa] {...    34   1.8  
ZYRO0F09174g Chr6 complement(744109..745638) [1530 bp, 509 aa] {...    33   2.5  
YOR212W Chr15 (742910..744181) [1272 bp, 423 aa] {ON}  STE4G pro...    33   4.1  
NDAI0A03310 Chr1 (750920..753373) [2454 bp, 817 aa] {ON} Anc_4.106     33   4.1  
ZYRO0G18590g Chr7 complement(1533974..1536202) [2229 bp, 742 aa]...    33   5.2  
KLTH0G18282g Chr7 complement(1576512..1577558) [1047 bp, 348 aa]...    32   6.6  
KLLA0F08877g Chr6 (825217..826182) [966 bp, 321 aa] {ON} uniprot...    32   6.7  
AFR355C Chr6 complement(1082122..1084953) [2832 bp, 943 aa] {ON}...    32   7.3  
Kwal_60.24924 s60 (6769..6981) [213 bp, 70 aa] {OFF} [contig 455...    29   8.1  

>Kwal_33.14167 s33 (554863..557379) [2517 bp, 838 aa] {ON} YDL028C
           (MPS1) - serine/threonine/tyrosine protein kinase (dual
           specificity), able to autophosphorylate as well as act
           on Mad1p. A mutation predicted to abolish kinase
           function eliminates in vitro protein kinase activity and
           behaves like a null mutation in vivo. [contig 105] FULL
          Length = 838

 Score = 1701 bits (4406), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 823/838 (98%), Positives = 823/838 (98%)

Query: 1   MSSYSVRSNLISKPPEIRGLDFRPRRPNIHSTARDDSDDENMLGPPTLSNFGSALLSDKE 60
           MSSYSVRSNLISKPPEIRGLDFRPRRPNIHSTARDDSDDENMLGPPTLSNFGSALLSDKE
Sbjct: 1   MSSYSVRSNLISKPPEIRGLDFRPRRPNIHSTARDDSDDENMLGPPTLSNFGSALLSDKE 60

Query: 61  NVEPHRSTASSRHHPLNQMSRTHSQLPSRTETLAMSREFSTANTNSSYTGPHSTIHSVDH 120
           NVEPHRSTASSRHHPLNQMSRTHSQLPSRTETLAMSREFSTANTNSSYTGPHSTIHSVDH
Sbjct: 61  NVEPHRSTASSRHHPLNQMSRTHSQLPSRTETLAMSREFSTANTNSSYTGPHSTIHSVDH 120

Query: 121 SDSTLFATFKDNQQSMTTFNPDDQLHQSGLDRVSLEQSRSKIKSLQQALRDDLSSRNSKR 180
           SDSTLFATFKDNQQSMTTFNPDDQLHQSGLDRVSLEQSRSKIKSLQQALRDDLSSRNSKR
Sbjct: 121 SDSTLFATFKDNQQSMTTFNPDDQLHQSGLDRVSLEQSRSKIKSLQQALRDDLSSRNSKR 180

Query: 181 RTRRFASSRLSLLGPAKRASSTSGTPNRSELIEESNISQPEGNISNSSTRTASANLNEHN 240
           RTRRFASSRLSLLGPAKRASSTSGTPNRSELIEESNISQPEGNISNSSTRTASANLNEHN
Sbjct: 181 RTRRFASSRLSLLGPAKRASSTSGTPNRSELIEESNISQPEGNISNSSTRTASANLNEHN 240

Query: 241 IFYEPQNSNQAIQSSHSPFISSTINYEDVEFGDLNPYQYLKKYNLPTTELPNISRIYFER 300
           IFYEPQNSNQAIQSSHSPFISSTINYEDVEFGDLNPYQYLKKYNLPTTELPNISRIYFER
Sbjct: 241 IFYEPQNSNQAIQSSHSPFISSTINYEDVEFGDLNPYQYLKKYNLPTTELPNISRIYFER 300

Query: 301 QKGQNRKAALRKSIASKDAIQNRIATTSSPHSPPVDADAIRRDNSAFKRQPRRKISESAT 360
           QKGQNRKAALRKSIASKDAIQNRIATTSSPHSPPVDADAIRRDNSAFKRQPRRKISESAT
Sbjct: 301 QKGQNRKAALRKSIASKDAIQNRIATTSSPHSPPVDADAIRRDNSAFKRQPRRKISESAT 360

Query: 361 SNDPKAWSSPFSGINNPTVASARRTDQYQADEKYSNTEIPDPNAFDSFRRREALSNININ 420
           SNDPKAWSSPFSGINNPTVASARRTDQYQADEKYSNTEIPDPNAFDSFRRREALSNININ
Sbjct: 361 SNDPKAWSSPFSGINNPTVASARRTDQYQADEKYSNTEIPDPNAFDSFRRREALSNININ 420

Query: 421 SYSAAQPQHKKPKYSDYNPQEFGRLPRPSLENRSPISNKEEPQFKHRSPPLIPGKHVEIV 480
           SYSAAQPQHKKPKYSDYNPQEFGRLPRPSLENRSPISNKEEPQFKHRSPPLIPGKHVEIV
Sbjct: 421 SYSAAQPQHKKPKYSDYNPQEFGRLPRPSLENRSPISNKEEPQFKHRSPPLIPGKHVEIV 480

Query: 481 EPIRTKESIPLKPPASSDDINGRKRPVVYVNGTEYEKLELLGRGGTSXXXXXXXXXXXXX 540
           EPIRTKESIPLKPPASSDDINGRKRPVVYVNGTEYEKLELLGRGGTS             
Sbjct: 481 EPIRTKESIPLKPPASSDDINGRKRPVVYVNGTEYEKLELLGRGGTSKVYKVKNANNNKV 540

Query: 541 XXLKRVSFDEFDDSSIDGFKGEIELLKKLETQPRVVKLIDHEMDHGVLYVVMECGDHDLS 600
             LKRVSFDEFDDSSIDGFKGEIELLKKLETQPRVVKLIDHEMDHGVLYVVMECGDHDLS
Sbjct: 541 YALKRVSFDEFDDSSIDGFKGEIELLKKLETQPRVVKLIDHEMDHGVLYVVMECGDHDLS 600

Query: 601 QTLAHRSGMPLDVEFVRYHAQEMLKCVKVVHDAGIVHSDLKPANFVFVKGILKIIDFGIA 660
           QTLAHRSGMPLDVEFVRYHAQEMLKCVKVVHDAGIVHSDLKPANFVFVKGILKIIDFGIA
Sbjct: 601 QTLAHRSGMPLDVEFVRYHAQEMLKCVKVVHDAGIVHSDLKPANFVFVKGILKIIDFGIA 660

Query: 661 NAVPEHTVNIYRETQIGTPNYMAPEALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQ 720
           NAVPEHTVNIYRETQIGTPNYMAPEALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQ
Sbjct: 661 NAVPEHTVNIYRETQIGTPNYMAPEALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQ 720

Query: 721 MIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEKTSNGDTVPKTAIDTMKACLERNPNKRWT 780
           MIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEKTSNGDTVPKTAIDTMKACLERNPNKRWT
Sbjct: 721 MIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEKTSNGDTVPKTAIDTMKACLERNPNKRWT 780

Query: 781 VEEVANGSFVKPVSVTHFFIRDLIENSVRYGANQKEISSAKVEELAEDVWHRLEEFRL 838
           VEEVANGSFVKPVSVTHFFIRDLIENSVRYGANQKEISSAKVEELAEDVWHRLEEFRL
Sbjct: 781 VEEVANGSFVKPVSVTHFFIRDLIENSVRYGANQKEISSAKVEELAEDVWHRLEEFRL 838

>KLTH0F06468g Chr6 (559256..561769) [2514 bp, 837 aa] {ON} similar
           to uniprot|P54199 Saccharomyces cerevisiae YDL028C MPS1
           Dual-specificity kinase required for spindle pole body
           (SPB) duplication and spindle checkpoint function
           substrates include SPB proteins Spc42p Spc110p and
           Spc98p mitotic exit network protein Mob1p and checkpoint
           protein Mad1p
          Length = 837

 Score = 1142 bits (2954), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 576/843 (68%), Positives = 669/843 (79%), Gaps = 11/843 (1%)

Query: 1   MSSYSVRSNLISKPPEIRGLDFRPRRPNIHSTARDDSDDENMLGPPTLSNFGSALLSDKE 60
           MSSY+VRS+ +   P  R L+F  RR ++ S ARDDSDDENMLGPP LSNFGSALLSDKE
Sbjct: 1   MSSYTVRSS-VPGAPSNRRLEFPARRTSVQSLARDDSDDENMLGPPKLSNFGSALLSDKE 59

Query: 61  NVEPHRSTASSRHHPLNQMSRTHSQLP---SRTETLAMSREFSTANTNSSYTGPHSTIHS 117
           NVEP+     SR+  ++   R +SQ P   +R ET    REFS++NTN+S  GP+ST HS
Sbjct: 60  NVEPY---PYSRNQSVSNAKR-YSQPPRAAARPETFGAVREFSSSNTNNSVAGPYSTFHS 115

Query: 118 VDHSDSTLFATFKDNQQSMTTFNPDDQLHQSGLDRVSLEQSRSKIKSLQQALRDDLSSRN 177
            +HSDST+FAT K NQQSMTTFNP+    Q   + + LE+SRS++KS+QQ LRD+LS R+
Sbjct: 116 EEHSDSTMFATSKHNQQSMTTFNPETPSEQGKPEDMYLEKSRSRVKSMQQTLRDELSLRS 175

Query: 178 SKRRTRRFASSRLSLLGPAKRASSTSGTPNRSELIEESNISQPEGNISNSSTRTASANLN 237
           SKRR RRF SSR +LLGPAKRASS +GTPN SEL +ESN+SQ E N S+SS+  A+A+ N
Sbjct: 176 SKRRNRRFVSSRFNLLGPAKRASSNTGTPNHSELADESNVSQQEANFSHSSSAGATAHQN 235

Query: 238 EHNIFYEPQNSNQAIQSSHSPFISSTINYEDVEFGDLNPYQYLKKYNLPTTELPNISRIY 297
           E+N+FYE QNS+   + S +P   ++INY+++EFGDLNPYQYLKK+N+PTTELPNISR+Y
Sbjct: 236 EYNVFYESQNSSSPQKDSAAPTDHTSINYDNIEFGDLNPYQYLKKHNIPTTELPNISRLY 295

Query: 298 FERQKGQNRKAALRKSIASKDAIQNRIATTSSPHSPPVD-ADAIRRDNSAFKRQPRRKIS 356
           FERQKG+NRK ALRK+IA+KDA Q R+ + S  +SP +   D I+R+ S  KRQPRRKIS
Sbjct: 296 FERQKGENRKTALRKNIAAKDAFQTRLTSASLSNSPLLKHVDLIKREQSIPKRQPRRKIS 355

Query: 357 ESATSNDPKAWSSPFSGINNPTVASARRTDQYQADEKYSNTEIPDPNAFDSFRRREALSN 416
           + AT+ND KAWSSP S       A +R     +A E Y N E P+ + F S RRREALSN
Sbjct: 356 DHATNNDSKAWSSPVSSSKGLKTAPSRDGTSPRASEMYENIERPERDTFGSIRRREALSN 415

Query: 417 ININSYSAAQPQHKKPKYSDYNPQEFGRLPRPSLENRSPISNKEEPQFKHRSPPLIPG-K 475
           ININS +  Q Q+K+ KYS  N +E   + RP  E+           FKHRSPP +P  K
Sbjct: 416 ININS-NYHQLQNKRTKYSTENLEEARGIHRPPFEHSVQEERFANHGFKHRSPPAVPERK 474

Query: 476 HVEIVEPIRTKESIPLKPPASSDDINGRKRPVVYVNGTEYEKLELLGRGGTSXXXXXXXX 535
           HVEIVEP++T ESIPLKPPA+S D   R++P +YVNGTEYEKLELLGRGG+S        
Sbjct: 475 HVEIVEPLKTTESIPLKPPATSGDSYNRRKPTIYVNGTEYEKLELLGRGGSSKVYKVKNV 534

Query: 536 XXXXXXXLKRVSFDEFDDSSIDGFKGEIELLKKLETQPRVVKLIDHEMDHGVLYVVMECG 595
                  LKRVSFDEFDDSSI+GFKGEIELLKKLET+PRVVKLIDHEMDHGVLY VMECG
Sbjct: 535 ANNKVYALKRVSFDEFDDSSIEGFKGEIELLKKLETKPRVVKLIDHEMDHGVLYEVMECG 594

Query: 596 DHDLSQTLAHRSGMPLDVEFVRYHAQEMLKCVKVVHDAGIVHSDLKPANFVFVKGILKII 655
           DHDLS TLA RSGM LDVEFVR+H+QEMLKCVKVVHD+GIVHSDLKPANFVFVKGILKII
Sbjct: 595 DHDLSHTLALRSGMGLDVEFVRFHSQEMLKCVKVVHDSGIVHSDLKPANFVFVKGILKII 654

Query: 656 DFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNYTHNQAPEQSRWKVGKPSDIWSCG 715
           DFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNYT  Q  EQ+RWKVGKPSDIWSCG
Sbjct: 655 DFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNYTQGQPAEQNRWKVGKPSDIWSCG 714

Query: 716 CIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEKTSNGDTVPKTAIDTMKACLERNP 775
           CIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEKTSNGD VPKTAIDTMKACLERNP
Sbjct: 715 CIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEKTSNGDVVPKTAIDTMKACLERNP 774

Query: 776 NKRWTVEEVANGSFVKPVSVTHFFIRDLIENSVRYGANQKEISSAKVEELAEDVWHRLEE 835
            KRW+V+EV NG FVKP++VTHFFIRDLI+NSV+YGANQ+EIS+ K+EELAEDVWHRL +
Sbjct: 775 EKRWSVDEVLNGPFVKPIAVTHFFIRDLIKNSVKYGANQREISNEKIEELAEDVWHRLAD 834

Query: 836 FRL 838
           FRL
Sbjct: 835 FRL 837

>SAKL0C07348g Chr3 (677348..679933) [2586 bp, 861 aa] {ON} some
           similarities with uniprot|P54199 Saccharomyces
           cerevisiae YDL028C MPS1 Dual-specificity kinase required
           for spindle pole body (SPB) duplication and spindle
           checkpoint function substrates include SPB proteins
           Spc42p Spc110p and Spc98p mitotic exit network protein
           Mob1p and checkpoint protein Mad1p
          Length = 861

 Score =  830 bits (2145), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 459/861 (53%), Positives = 586/861 (68%), Gaps = 88/861 (10%)

Query: 34  RDDSDDENMLGPPTLSNFGSALLSDKENVEP-----HRSTASS--RHHPLNQMSRTHSQL 86
           +DDSDDE+ +GPP LSNFGSALL DKEN  P      R  A++  R     Q   T  Q 
Sbjct: 33  KDDSDDEHPIGPPKLSNFGSALLFDKENHTPTGTGLQRDAAAADLRKSVAFQDISTGCQR 92

Query: 87  PSRTETLAMSREFS---TANTNSSYTGPHSTIHSVDHSDSTLFATFKDNQQSMTTFNPDD 143
           PS+   + +SR  S    +NTN+++   + + +S D S STLF T + +Q SMTT +P+ 
Sbjct: 93  PSQ---VPLSRNLSLNSMSNTNNTFGASYPSYNSEDPSQSTLFTTSR-HQPSMTTVHPEP 148

Query: 144 QLHQSGLDRVSLEQSRSKIKSLQQALRDDLSSRNSKRRTRRFASSRLSLLGPAKRASSTS 203
                GLD    EQS  ++++LQ +L+++LSSR++KRR RRF SSRL LLGPAKRASST+
Sbjct: 149 H----GLDSSKSEQSSHRLRALQHSLKEELSSRHAKRRNRRFVSSRLGLLGPAKRASSTA 204

Query: 204 GTPNRSELIEESNISQPEGNISNSSTRTASANLNE-HNIFYEPQNSNQAIQSSHSPFISS 262
           G        ++++ISQ E N+S SS+ +     NE +N+F E  ++    +  H+    +
Sbjct: 205 GLAYTDSGNDDASISQQEANVSGSSSTSGFVGNNEGYNVFLE-SHTGAGERQHHTSSKDT 263

Query: 263 TINYEDVEFGDLNPYQYLKKYNLPTTELPNISRIYFERQKGQNRKAALRKSIASKDAIQN 322
            ++Y DV+FGDLNPYQYLKK+NLPT+ELPNIS+IYFERQK +NR+ ALRK++ +++ +  
Sbjct: 264 GVDYRDVDFGDLNPYQYLKKHNLPTSELPNISKIYFERQKEENRRTALRKNVVTRETLHE 323

Query: 323 RIATTSSPHSPPVDADAI--RRDNSAFK----------------RQPRRKISESATSNDP 364
           R+A+      P V   A   +R+++                   RQPRRK S++ +S   
Sbjct: 324 RVASM-----PNVSFGAALQQREHAGASTSTNTSNSASNSNITTRQPRRKASDTPSSAFS 378

Query: 365 KAWSSPFSGINNPTVASARRTDQY----QADEKYSNTEIPDPNAFDS--FRRREALSNIN 418
           K+ SSP +  N+ T A A    ++       +KY       P A D+   ++REAL+NI+
Sbjct: 379 KSLSSPLTTSNSSTYAVAATAAKHPYIDHPQQKYDT-----PPATDTPIHKKREALANID 433

Query: 419 INSYSAAQPQHKKPKYSDYNPQEFGRLPRPSLENRSPISNKEE----PQFKHR------- 467
            NS   +  Q K             R    SL N      +++     +F HR       
Sbjct: 434 TNSQRHSHAQTK-----------MHRSSAASLRNEVHQHRQQQLGSQQEFLHRRAPAPPP 482

Query: 468 ---SPPLIPGKHVEIVEPIRTKESIPLKPPAS-------SDDINGRKRPVVYVNGTEYEK 517
              S P    +  E+ +  R  E++PLKPPA+       S D + R++P + VNGTEYEK
Sbjct: 483 PPPSLPTDSDRRGELTKAARV-ETVPLKPPATGSLKPPASLDSHARRKPTIQVNGTEYEK 541

Query: 518 LELLGRGGTSXXXXXXXXXXXXXXXLKRVSFDEFDDSSIDGFKGEIELLKKLETQPRVVK 577
           +ELLGRGG+S               LKRV+FDEFD+SS+DGFKGEIELLKKLE QPRVV+
Sbjct: 542 MELLGRGGSSKVYKVRTPNNKVYA-LKRVAFDEFDESSVDGFKGEIELLKKLENQPRVVR 600

Query: 578 LIDHEMDHGVLYVVMECGDHDLSQTLAHRSGMPLDVEFVRYHAQEMLKCVKVVHDAGIVH 637
           L+D+EM HGVL+VVMECGDHDLS  LAHR+ +PLD+EFVRYHAQEML+CVKVVHDA IVH
Sbjct: 601 LVDYEMAHGVLFVVMECGDHDLSSILAHRASLPLDIEFVRYHAQEMLRCVKVVHDADIVH 660

Query: 638 SDLKPANFVFVKGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNYTHNQA 697
           SDLKPANFVFVKGILKIIDFGIANAVP+HTVNIYRETQIGTPNYMAPEALVAMNY   Q 
Sbjct: 661 SDLKPANFVFVKGILKIIDFGIANAVPDHTVNIYRETQIGTPNYMAPEALVAMNYAQGQP 720

Query: 698 PEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEKTSNGD 757
            +Q+RWKVGKPSDIWSCGCI+YQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEKT +GD
Sbjct: 721 HQQNRWKVGKPSDIWSCGCILYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEKTPSGD 780

Query: 758 TVPKTAIDTMKACLERNPNKRWTVEEVANGSFVKPVSVTHFFIRDLIENSVRYGANQKEI 817
            VP+TA+DTMKACLERNP+KR TV+EV NG+F++PVSVTHFF+RDLI+N+V+YG+ Q+E+
Sbjct: 781 VVPRTALDTMKACLERNPDKRCTVDEVLNGAFIRPVSVTHFFVRDLIKNAVKYGSEQREV 840

Query: 818 SSAKVEELAEDVWHRLEEFRL 838
           SS KVEELA+DVW+RL EFRL
Sbjct: 841 SSEKVEELADDVWNRLAEFRL 861

>ADR317C Chr4 complement(1263080..1265539) [2460 bp, 819 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL028C
           (MPS1)
          Length = 819

 Score =  761 bits (1966), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 439/856 (51%), Positives = 555/856 (64%), Gaps = 106/856 (12%)

Query: 25  RRPNIHSTARDDSDDENMLGPPTLSNFGSALLSDKENVEPHRSTASSRHHPLNQMSRTHS 84
           RRP +H  +  DSDD++ LGPP LSNFGSALL+DKEN  P              + R+ +
Sbjct: 28  RRPQLHLNS--DSDDDHPLGPPKLSNFGSALLTDKENETP------------TYLRRSGT 73

Query: 85  QLPSRTETLAMSREFSTANTNSSYTGPHSTIHSVDHSDSTLFATFKDNQQSMTTFNPDDQ 144
            L     T       S     S++TG  +T    + S STLF++   +Q SMTT   D +
Sbjct: 74  SLQGGNATAT-----SGHTKPSTFTGTMNT----EDSHSTLFSSMSKHQPSMTTV--DAE 122

Query: 145 LHQSGLDRVSLEQSRSKIKSLQQALRDDLSSRNSKRRTRRFASSRLSLLGPAKRASSTSG 204
               G D +S      + + +QQ+++D++ SR   RR+RRF +SRL+ LGPAKR S+T+ 
Sbjct: 123 RTAPGDDGLS----SHRYQVIQQSMKDEILSRQGTRRSRRFITSRLATLGPAKRNSTTTN 178

Query: 205 TPNRSELI--EESNISQPEGNISNSSTRTASA-NLNEHNIFYEPQN-SNQAIQSSHSPFI 260
               S +   E  ++S  EGN+S SS   +   N N +N+F + +  +    + SHS   
Sbjct: 179 FEFSSNISHDEPRDVSHQEGNVSTSSNSNSGVLNNNGYNVFLDTEERARHDDKESHSAAR 238

Query: 261 SSTI-NYEDVEFGDLNPYQYLKKYNLPTTELPNISRIYFERQKGQNRKAALRKSIASKDA 319
            S + +Y ++ FGDLNPYQYLKK+NLPT+ELPNISRIYFE QK +NR+AA+RK++ +   
Sbjct: 239 QSGLSDYGNISFGDLNPYQYLKKHNLPTSELPNISRIYFEMQKRENRRAAVRKNVLNGSG 298

Query: 320 IQ---------------------NRIATTSSPH---SPPVDADA-IRRDNSAFKRQPRRK 354
            Q                     N IA+ SS     +PP  A++ I+RD     RQPRRK
Sbjct: 299 GQVAQLPTNNSAIASTAVALKEANGIASISSGSNKLTPPQAANSMIKRD-----RQPRRK 353

Query: 355 ISESATSNDPKAWSSPFSGINNPTVASARRTDQYQADEKYSNTEIPDPNAFDSFRRREAL 414
            S+++ S+  K  SSP S    P  A +++    Q +       + + N     ++REAL
Sbjct: 354 HSDASVSSFSKLLSSPISA-GAPNYADSQKHTPVQKNSTPYEPLLINQNT----KKREAL 408

Query: 415 SNININSYSAAQPQHKKPKYSDYNPQEFGRLPRPSLENRSPISNKEEPQFKHRSPPLIPG 474
           +++++N+        KK K  + +                         +  ++P     
Sbjct: 409 NSLDVNANRHPSIITKKQKVDELH------------------------DYLKKAPAAASV 444

Query: 475 KHVEIVEPIR--TKESIPLKPPASSDDIN-----GRKRPVVYVNGTEYEKLELLGRGGTS 527
           K VEIVEP+R     +IPLKPP++    N      RKR V+ VNG+EYEK+ELLGRGG+S
Sbjct: 445 KKVEIVEPVRDPVITTIPLKPPSAEVPANVHQLPQRKRQVITVNGSEYEKVELLGRGGSS 504

Query: 528 XXXXXXXXXXXXXXXLKRVSFDEFDDSSIDGFKGEIELLKKLETQPRVVKLIDHEMDHGV 587
                          LKRVSFDEFDD+S DGFKGEIELLKKLE Q RVVKLIDHEM+HGV
Sbjct: 505 KVYKVRNSSNRIYA-LKRVSFDEFDDASADGFKGEIELLKKLENQTRVVKLIDHEMNHGV 563

Query: 588 LYVVMECGDHDLSQTLAHRSGMPLDVEFVRYHAQEMLKCVKVVHDAGIVHSDLKPANFVF 647
           LYVVMECGDHDLSQ LA RS MPLD+EFVRYHAQEMLKCVKVVHDAGIVHSDLKPANFVF
Sbjct: 564 LYVVMECGDHDLSQVLAQRSSMPLDIEFVRYHAQEMLKCVKVVHDAGIVHSDLKPANFVF 623

Query: 648 VKGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNYTHN-----QAPEQSR 702
           VKGILKIIDFGIANAVP+HTVNIYR+TQIGTPNYMAPEALVAMNYT +     Q    +R
Sbjct: 624 VKGILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVAMNYTQDSDQIQQEMHHNR 683

Query: 703 WKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEKTSNGDTVPKT 762
           WKVGKPSDIWSCGCI+YQMIYG+PPYG FQGQNRLLAIMNPEVKIVYPEKT  GD VP+T
Sbjct: 684 WKVGKPSDIWSCGCIMYQMIYGKPPYGSFQGQNRLLAIMNPEVKIVYPEKTPTGDFVPRT 743

Query: 763 AIDTMKACLERNPNKRWTVEEVANGSFVKPVSVTHFFIRDLIENSVRYGANQKEISSAKV 822
           A+DT+KACLERNP +RWTV+E+  G F+KP++VTHFFIRDLI+N+V+YG++Q+ +S  KV
Sbjct: 744 ALDTIKACLERNPERRWTVDELLRGPFIKPITVTHFFIRDLIKNAVKYGSDQRYVSKEKV 803

Query: 823 EELAEDVWHRLEEFRL 838
           E LA+DVWHRL +FRL
Sbjct: 804 ENLADDVWHRLSDFRL 819

>TDEL0D04600 Chr4 (843530..845917) [2388 bp, 795 aa] {ON} Anc_3.162
           YDL028C
          Length = 795

 Score =  730 bits (1884), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 420/840 (50%), Positives = 552/840 (65%), Gaps = 85/840 (10%)

Query: 26  RPNIHSTARDDSDDENMLGPPTLSNFGSALLSDKENVEPHRSTASSRHHPL-NQMSRTHS 84
           R   H+  +DDSDDE + GPP LS+FG ALL +KEN+ P   +   R  P  N   R   
Sbjct: 14  RKKSHAAYKDDSDDEKITGPPKLSDFGVALLMEKENMAP---SMVRRGEPSPNSFKRELK 70

Query: 85  QLPSRTETLAMSREFSTANTNSSYTGPHSTIHSVDHSDSTLFATFKDNQQ-SMTTFNPDD 143
                T T      FS +N  +S++  + + +S + S ST+FA  + NQQ SMTT + + 
Sbjct: 71  TRFGPTNT----DYFSGSNNQTSFSQTYVSANSGEPSQSTIFAQSRFNQQPSMTTMDTNG 126

Query: 144 QLHQSGLDRVSLEQSRSKIKSLQQALRDDLSSRNSKRRTRRFA-SSRLSLLGPAKRASST 202
                 +    LE S  +IKS+QQ +R++L++R+++RR+RRF   +R+ +LGPAKRASST
Sbjct: 127 ----IKIPASDLETSFGRIKSMQQNMREELTTRHAQRRSRRFLHGTRIGVLGPAKRASST 182

Query: 203 SGTPNRSELIEESNISQPEGNISNSSTRTASANLNEHNIFYEPQNSNQAIQSSHSPFISS 262
           +G        + S++S   GN+     +T +  L EH     P      +    +     
Sbjct: 183 NGA-------DMSDLSI--GNV-QMVQQTDNTPLEEHREVQSPAEIKPDLTKKETR-TRD 231

Query: 263 TINYEDVEFGDLNPYQYLKKYNLPTTELPNISRIYFERQKGQNRKAALRKSIASKDAIQN 322
            ++Y+ ++FGD+NP QYLK +NL ++ELP +S++YFERQ+ +  + AL+KSI+S++A+ N
Sbjct: 232 VLDYKSIDFGDMNPVQYLKLHNLSSSELPKLSKVYFERQREEIHQMALQKSISSREALTN 291

Query: 323 RIATTSSPHSPPVDADAIRRDNSAFKRQPRRKISESATSNDPK-----AWSSPFSG---- 373
           ++  + S  S     ++IRR+ S+    PRRK+S+++ S+  K     ++SSP +     
Sbjct: 292 KVQRSFSSIS--SSGNSIRRE-SSMPLYPRRKLSDTSVSSAAKTSFQSSFSSPLAYPKKN 348

Query: 374 --INNPTVASARRTD-------QYQADEKYSNTEIPDPNAFDSFRRREALSNININ---S 421
             I+ P V S    D       QY   E+Y+           SF++REAL+NI+IN    
Sbjct: 349 FLIDQPVVTSKPAADHGKNLTKQYAQREQYT--------LESSFKKREALANIDINRNSQ 400

Query: 422 YSAAQPQHKKPKYSDYNPQEFGRLPRPSLENRSPISNKEEPQFKHRSPPL-IPGKHVEIV 480
            S  QP+  KP  +     E   LP P +       NKEE  + +R PP     K VEI+
Sbjct: 401 ESLQQPKRFKPIRTQEQLSE-SHLPEPYV-------NKEE--YLNREPPKPRATKRVEIL 450

Query: 481 EPIRTKESIPLKPPASSDDINGRKRPVVYVNGTEYEKLELLGRGGTSXXXXXXXXXXXXX 540
           EP         KP          ++ VV VN  EYEK+ELLGRGG+S             
Sbjct: 451 EP---------KPSQGQS-----RKNVVKVNDVEYEKVELLGRGGSSKVYKVRDRSNNVY 496

Query: 541 XXLKRVSFDEFDDSSIDGFKGEIELLKKLETQPRVVKLIDHEMDHGVLYVVMECGDHDLS 600
             LKRV FDEFDDSS+ GFKGEIELLKKLE Q RVV+L+DHEM+HGVLY++MECGDHDLS
Sbjct: 497 A-LKRVVFDEFDDSSVSGFKGEIELLKKLENQNRVVQLVDHEMEHGVLYLIMECGDHDLS 555

Query: 601 QTLAHRSGMPLDVEFVRYHAQEMLKCVKVVHDAGIVHSDLKPANFVFVKGILKIIDFGIA 660
           + L HR+GMPLD+EFVRYHA+EML+CVKVVHD+GIVHSDLKPANFVFVKGILKIIDFGIA
Sbjct: 556 RILNHRAGMPLDMEFVRYHAREMLRCVKVVHDSGIVHSDLKPANFVFVKGILKIIDFGIA 615

Query: 661 NAVPEHTVNIYRETQIGTPNYMAPEALVAMNYTHN--QAPEQSRWKVGKPSDIWSCGCII 718
           NAVP+HTVNIYRE QIGTPNYMAPEALVAMNYT +  +  +Q+RWKVGKPSDIWSCGCII
Sbjct: 616 NAVPDHTVNIYRENQIGTPNYMAPEALVAMNYTQDDEKYQQQNRWKVGKPSDIWSCGCII 675

Query: 719 YQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEKTSNGDTVPKTAIDTMKACLERNPNKR 778
           YQMIYGRPPYGGFQGQNRLLAIMNP+VKI++ +KTS  +T+P++A+DTMKACL RNP+KR
Sbjct: 676 YQMIYGRPPYGGFQGQNRLLAIMNPDVKIIFSDKTSRDETIPRSALDTMKACLTRNPDKR 735

Query: 779 WTVEEVANGSFVKPVSVTHFFIRDLIENSVRYGANQKEISSAKVEELAEDVWHRLEEFRL 838
            TV+EV   +F+KP+ VT FFIRDLI+N+VRYGA+QKE+S  KVEELA+DV  RL +FRL
Sbjct: 736 LTVDEVLESNFLKPLMVTPFFIRDLIKNAVRYGADQKEVSKEKVEELADDVLSRLSDFRL 795

>ZYRO0B04906g Chr2 (395546..398089) [2544 bp, 847 aa] {ON} similar
           to uniprot|P54199 Saccharomyces cerevisiae YDL028C MPS1
           Dual-specificity kinase required for spindle pole body
           (SPB) duplication and spindle checkpoint function
           substrates include SPB proteins Spc42p Spc110p and
           Spc98p mitotic exit network protein Mob1p and checkpoint
           protein Mad1p
          Length = 847

 Score =  689 bits (1779), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 420/854 (49%), Positives = 542/854 (63%), Gaps = 100/854 (11%)

Query: 35  DDSDDENMLGPPTLSNFGSALLSDKENVEPHRSTASSRHHPLNQMSRTHSQLPSRTETLA 94
           DDSDDE +  PP LSNFGSALLS+KE         +   + L +M    S  PS     +
Sbjct: 44  DDSDDEKISIPPKLSNFGSALLSEKE-------KENINENDLFEMLPKDSVKPS-----S 91

Query: 95  MSREFSTANTNSSYTGPHSTIHSVDHSDSTLFATFKDNQQ-SMTTFNPDDQLHQSGLDRV 153
           ++ E    + N +    +++IHS D S STLFA ++ +QQ SMTT N  D   + G D  
Sbjct: 92  LNNEPYYNSVNHTPGNTYASIHSGDPSQSTLFAQYRSHQQPSMTTMNSTDVQDKDGND-- 149

Query: 154 SLEQSRSKIKSLQQALRDDLSSRNSKRRTRRFA-SSRLSLLGPAKRASSTSGTPNRSELI 212
             E S  KIKS+QQ++R++L+SR+++RR+RRF  SSR   LGPAKRAS+           
Sbjct: 150 -FENSFQKIKSMQQSMREELTSRHAERRSRRFLNSSRKEFLGPAKRASAIF--------- 199

Query: 213 EESNISQPEGNISNSSTRTASANLNEHNIFYEPQNSNQAIQ--SSHSPFISSTINYEDVE 270
                  PE     +  R  S   N +       +++  +Q     SP    +++ + V+
Sbjct: 200 -------PE-----ALDRRFSGTTNSNGTNDNNNSTDGLLQLNREESPEEKLSLSSQ-VD 246

Query: 271 FGDLNPYQYLKKYNLPTTELPNISRIYFERQKGQNRKAALRKSIASKDAIQNRIATTSSP 330
            GDLNP QYLKK++LPT+ELP ISR+YFE+QK +  + A  K    ++ ++    ++S  
Sbjct: 247 LGDLNPVQYLKKHDLPTSELPRISRLYFEKQKPRKMELARLK----QEILRESRTSSSGN 302

Query: 331 HSPPVDADAIRRDNS-AFKRQPRRKISESATSND-PKAWSSPFSGINNPTVASARRTDQY 388
           +   V    IRR+NS +   QPRRK+S++++ N   + +SSP +     +V S R     
Sbjct: 303 NGSGVQHIPIRRENSLSAATQPRRKLSDTSSRNIFQRGFSSPVAR----SVDSQRNILSD 358

Query: 389 QADEKYSNTE-IPDPNAF-DSFRRREALSNININSYSAAQ---PQHKKPKY--------- 434
           ++  K++  +  P  N    S R+REAL+NI++N  +  Q   P+ K+ KY         
Sbjct: 359 KSSLKHNEYDSYPHSNTLLYSHRKREALANIDVNRNNNDQIYEPELKRYKYFDEHHNNNR 418

Query: 435 -SDYNPQE----------------------FGRLPRPSLENRSPI--SNKEEPQFKHRSP 469
            +DY P+                         RLP  +     PI  S  +E +F HR  
Sbjct: 419 NNDYEPESKRYDLFEDHRNGNNNKDEKPISLERLPSEAPPVAIPIHPSVIQENEFHHREA 478

Query: 470 PLIPG-KHVEIVEPIRTKESIPLKPPASSDDINGRKRPVVYVNGTEYEKLELLGRGGTSX 528
           P  P  K VEIVEP +  +S       SS+     +R    VN  EYEK+ELLGRGG+S 
Sbjct: 479 PKPPVVKKVEIVEPEKRTDS----KGKSSNGEALTRRNATTVNDVEYEKIELLGRGGSSK 534

Query: 529 XXXXXXXXXXXXXXLKRVSFDEFDDSSIDGFKGEIELLKKLETQPRVVKLIDHEMDHGVL 588
                         LKRV FDEFDDSS++GFKGEIELL KL+ + RVVKL D+EM+HGVL
Sbjct: 535 VYKVKDNNNKLYA-LKRVVFDEFDDSSVNGFKGEIELLNKLKDKTRVVKLFDYEMEHGVL 593

Query: 589 YVVMECGDHDLSQTLAHRSGMPLDVEFVRYHAQEMLKCVKVVHDAGIVHSDLKPANFVFV 648
           Y++MECGDHDLSQ L  R+GMPLD+EFVRYHA+EMLKCVKVVHDAGIVHSDLKPANFVFV
Sbjct: 594 YLIMECGDHDLSQILNQRAGMPLDIEFVRYHAREMLKCVKVVHDAGIVHSDLKPANFVFV 653

Query: 649 KGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNYT----HNQAPEQSRWK 704
           KGILKIIDFGIANAVP+HTVNIYRETQIGTPNYMAPEALVAMNYT     ++  +Q+RWK
Sbjct: 654 KGILKIIDFGIANAVPDHTVNIYRETQIGTPNYMAPEALVAMNYTGQNDGDKYKQQNRWK 713

Query: 705 VGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEKTSNGDTVPKTAI 764
           VGKPSD+WSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKI++ EKT+N + VP++ +
Sbjct: 714 VGKPSDVWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIIFSEKTANDEAVPRSIL 773

Query: 765 DTMKACLERNPNKRWTVEEVANGSFVKPVSVTHFFIRDLIENSVRYGANQKEISSAKVEE 824
           DTMKACL RNP+KR TV+EV +  F+KPV VT FFIRDLI+N+VRYGA+QKE+S  KVEE
Sbjct: 774 DTMKACLLRNPDKRLTVDEVLDSPFLKPVMVTPFFIRDLIKNAVRYGADQKEVSKEKVEE 833

Query: 825 LAEDVWHRLEEFRL 838
           LA+DV  +L + RL
Sbjct: 834 LADDVLGKLADIRL 847

>NCAS0I02080 Chr9 (390551..392875) [2325 bp, 774 aa] {ON} Anc_3.162
          Length = 774

 Score =  662 bits (1708), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/835 (45%), Positives = 520/835 (62%), Gaps = 119/835 (14%)

Query: 35  DDSDDENMLGPPTLSNFGSALLSDKENVEPHRSTASSRHHPLNQMSRTHSQLPSRTETLA 94
           DDSDDE + GPP LSNF SA LS     E  ++T++ R    N                 
Sbjct: 28  DDSDDEKVSGPPVLSNFASAFLS-----EGDKNTSNIREEETNV---------------- 66

Query: 95  MSREFSTANTNSSYTGPHSTIHSVDHSD----STLFA-TFKDNQQSMTTFNPDDQL---H 146
               F+ +N   S T P+++I      D    STLFA T  + Q S+TT N  +     H
Sbjct: 67  ----FNNSNMKLSQT-PNNSIEPNQADDLSLHSTLFANTVGNRQSSLTTMNSTNNFALNH 121

Query: 147 QSGLDRVSLEQSRSKIKSLQQALRDDLSSRNSKRRTRRFASSRLSLLGPAKRASSTSGTP 206
            +  +    E +  KIKSLQQ ++++L+SR  +RR +RF +SR + LGPAKRAS+++ + 
Sbjct: 122 DTNKEHTVFEDNLQKIKSLQQTMKEELTSRYIERRNKRFLTSRRNNLGPAKRASTSAISA 181

Query: 207 NRSELIEESNI--------SQPEGNISNSSTRTASANLNEHNIFYEPQNSNQAIQSSHSP 258
           +  +  +E++         +Q + NI        S+ LN  N  ++  N +         
Sbjct: 182 STEDRYQENDKHSNNEKYSTQDDSNILAKQVGRLSSPLNRQNRAFQSSNGDDT------- 234

Query: 259 FISSTINYEDVEFGDLNPYQYLKKYNLPTTELPNISRIYFERQKGQNRKAALRKS-IASK 317
            +   ++Y  +EFG+L P++YLKK++LPT+ELP ISRIYFE+QK +NR+  LRK   +SK
Sbjct: 235 NMKEPVDYSSIEFGELTPFEYLKKHDLPTSELPYISRIYFEKQKLENRQTVLRKRRFSSK 294

Query: 318 DAIQNRIATTSS--PHSPPVD--ADAIRRDNSAFKRQPRRKISESATSNDPKAWSSPF-- 371
           +++   + TTSS  P+S   +   + + RD S     PRRKIS++++    +   S    
Sbjct: 295 ESLS--LGTTSSLAPYSNSKNNTTNQVSRDLSL----PRRKISDTSSKISKQILKSNINL 348

Query: 372 --SGINN--PTVASARRTDQYQADEKYSNTEIPDPNAFDSFRRREALSNININSYSAAQP 427
             SG +   P + S +R  Q+++ EK S               R  L ++N+N+ S  + 
Sbjct: 349 SESGSHGFPPDLQSIQR--QHESAEKLS---------------RAPLIDLNVNNVSPKRM 391

Query: 428 QHKKP--KYSD--YNPQEFGRLPRPSLENRSPISNKEEPQFKHRSPPLIPGKHVEIVEPI 483
              +   K+SD   N Q+F +      +    +  K+ P+           K VEIVEP 
Sbjct: 392 DKLRETHKFSDSRLNVQDFSK------KTDVVVYEKQAPR-----------KKVEIVEPK 434

Query: 484 RTKESIPLKPPASSDDINGRKRPVVYVNGTEYEKLELLGRGGTSXXXXXXXXXXXXXXXL 543
           R+   +              KR  + VN TEYEK+ELLGRGG+S               L
Sbjct: 435 RSHSKLA-------------KRNTITVNDTEYEKIELLGRGGSSRVYKVKNSQNKVFA-L 480

Query: 544 KRVSFDEFDDSSIDGFKGEIELLKKLETQPRVVKLIDHEMDHGVLYVVMECGDHDLSQTL 603
           KRVSFDEFDDSS+DGFKGEIELL+KL  + RVVKL D++MD GVL+++MECGDHDLSQ L
Sbjct: 481 KRVSFDEFDDSSVDGFKGEIELLEKLSNESRVVKLFDYQMDSGVLFLIMECGDHDLSQIL 540

Query: 604 AHRSGMPLDVEFVRYHAQEMLKCVKVVHDAGIVHSDLKPANFVFVKGILKIIDFGIANAV 663
           + RS MPLD++FVRYHA+E+++C+K+VHDAGIVHSDLKPANFVFVKGILKIIDFGIANA+
Sbjct: 541 SQRSDMPLDMDFVRYHAREVVRCIKIVHDAGIVHSDLKPANFVFVKGILKIIDFGIANAI 600

Query: 664 PEHTVNIYRETQIGTPNYMAPEALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIY 723
           P+HTVNIYRE QIGTPNYMAPEALVAMNYT N+    ++WKVGKPSDIWSCGCIIYQMIY
Sbjct: 601 PDHTVNIYRENQIGTPNYMAPEALVAMNYT-NENDGGNKWKVGKPSDIWSCGCIIYQMIY 659

Query: 724 GRPPYGGFQGQNRLLAIMNPEVKIVYPEKTSNGDTVPKTAIDTMKACLERNPNKRWTVEE 783
           GRPPY GFQGQNRLLAIMNP+VK+++ EKT+N +++P++ ID MK CL R+P KRW+V++
Sbjct: 660 GRPPYAGFQGQNRLLAIMNPDVKVIFSEKTANNESIPRSLIDLMKGCLTRDPEKRWSVDQ 719

Query: 784 VANGSFVKPVSVTHFFIRDLIENSVRYGANQKEISSAKVEELAEDVWHRLEEFRL 838
           V    F  P+ VT FFI+DLI+N+VRYG +Q+E+S+ K+EELA DV  RL +F++
Sbjct: 720 VLESPFFNPIVVTPFFIKDLIKNAVRYGVDQREVSNEKIEELANDVLGRLTDFKM 774

>KLLA0C03828g Chr3 (349187..351568) [2382 bp, 793 aa] {ON} similar
           to uniprot|P54199 Saccharomyces cerevisiae YDL028C MPS1
           Dual-specificity kinase required for spindle pole body
           (SPB) duplication and spindle checkpoint function
           substrates include SPB proteins Spc42p Spc110p and
           Spc98p mitotic exit network protein Mob1p and checkpoint
           protein Mad1p
          Length = 793

 Score =  653 bits (1684), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 391/844 (46%), Positives = 515/844 (61%), Gaps = 140/844 (16%)

Query: 68  TASSRH-HPLNQMSRTHSQLPSRTETLAMSREFSTANTNSSYTGPHSTIHSVDHSDSTLF 126
           TA S+H +   Q ++T  + P+ +  L   R F+  NT       H++ H+ D S ST+F
Sbjct: 17  TAESQHEYSRYQDAKTGLEEPTHSNPLHFVRHFNGRNTT------HTSNHTEDQSQSTVF 70

Query: 127 ATF-KDNQQSMTTFNP----DDQL------HQSGLDRVSLE---------QSRSKIKSLQ 166
               K  Q SMTT N     D+ +      H +  ++++ E          +  K K LQ
Sbjct: 71  TMVNKQFQPSMTTMNTVVKEDNDISNSNSNHDNKYNKLNEESLMKDDTHSHTSQKFKVLQ 130

Query: 167 QALRDDL---SSRNSKRRTRRFASSRLSLLGPAKRASSTS-------------GTPNRSE 210
           Q+++++L   ++++S +R RRF +SRLS LGPAKR  STS                N S 
Sbjct: 131 QSMKEELYNSTTKSSNKRNRRFITSRLSSLGPAKRNLSTSFNVDSPSESRVDNSQINSSI 190

Query: 211 LIEESNISQPEGNISNSSTRTASAN---LNEHNIFYEP--QNSNQAIQSSHSPF--ISST 263
           + + SNISQ +  I NS T  +S      ++HNIF E   Q+S  +   +  P   +   
Sbjct: 191 INDTSNISQQD--IENSHTSNSSNTGYRYHDHNIFLETHRQHSTPSHDENKDPSANLQPN 248

Query: 264 INYEDVEFGDLNPYQYLKKYNLPTTELPNISRIYFERQKGQNRKAALRKSIASKDAIQNR 323
           INYE+++FGDLNPYQYLKKYNLP+ ELP IS++YFERQK +NRK  LRK+ +   A++  
Sbjct: 249 INYENIDFGDLNPYQYLKKYNLPSGELPYISKVYFERQKEENRKTVLRKATSGTLALKRE 308

Query: 324 IATTSSPHSPPVDADAIRRDNSAFKRQPRRKI---SESATSNDPKAWSSPFSGINNPTVA 380
                            RR  +A  RQPRRK    ++  +  DP   SSP     N  V 
Sbjct: 309 FT-------------QYRRTQTA--RQPRRKHNFGTDKTSLQDP--LSSPLQ--KNQLVF 349

Query: 381 SARRTDQYQADEKYSNTEIPDPNAFDSFRRREALSNININSYSAAQPQHKKPKY-SDYNP 439
                   + D + +N             +REAL  +++N+ S++Q + K+PKY +D+ P
Sbjct: 350 Q-------EVDRELAN-------------KREALKPLDVNNPSSSQ-EAKRPKYENDHVP 388

Query: 440 QEFGRLPRPSLENRSPISNKEEPQFKHRSPPL----IPGKHVEIVEPIR-TKESIPLKPP 494
           +++    RP             P F HR  P      P K VEIVEP + T E IPLK  
Sbjct: 389 EDY----RP-------------PFFSHRKAPSPHDSKPFKKVEIVEPPKSTVEVIPLKSE 431

Query: 495 AS---------------SDDINGRKR-----PVVYVNGTEYEKLELLGRGGTSXXXXXXX 534
                            +   + +KR     P + VNGT YEK+ELLG+GG S       
Sbjct: 432 GCDVSSKLNKGDNYLNYNGSFDTKKRTSYAVPTITVNGTAYEKVELLGKGG-SGKVYKVK 490

Query: 535 XXXXXXXXLKRVSFDEFDDSSIDGFKGEIELLKKLETQPRVVKLIDHEMDHGVLYVVMEC 594
                   LKRVSFDEFD+SSIDGFKGEIELLKKLE + RVVKLID+ M  GVL+++MEC
Sbjct: 491 SSDHKVYALKRVSFDEFDESSIDGFKGEIELLKKLENKQRVVKLIDYHMGQGVLFLLMEC 550

Query: 595 GDHDLSQTLAHRSGMPLDVEFVRYHAQEMLKCVKVVHDAGIVHSDLKPANFVFVKGILKI 654
           G+HDLSQ L  RS +P D EFVRYH QEM+KCVKVVHDA IVHSDLKPANFVFVKG+LKI
Sbjct: 551 GEHDLSQVLTQRSKIPFDTEFVRYHFQEMIKCVKVVHDADIVHSDLKPANFVFVKGMLKI 610

Query: 655 IDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNYTHNQAPEQSRWKVGKPSDIWSC 714
           IDFGIANAVP+HTVNIYR+ QIGTPNYMAPE LVAMN+T N   EQ++WKVGKPSD+WSC
Sbjct: 611 IDFGIANAVPDHTVNIYRDNQIGTPNYMAPETLVAMNFTRNDG-EQAKWKVGKPSDVWSC 669

Query: 715 GCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEKTSNGDTVPKTAIDTMKACLERN 774
           GCI+YQM+YG+PPYG FQG NRL AIMNP+VKI YPEK S G  +P+T IDT+++CLERN
Sbjct: 670 GCILYQMVYGKPPYGTFQGNNRLYAIMNPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERN 729

Query: 775 PNKRWTVEEVANGSFVKPVSVTHFFIRDLIENSVRYGANQKEISSAKVEELAEDVWHRLE 834
           P  R T++++ +G+ + PV+VT FFI DLI+N+V YG +QK +++ +VEEL+EDVW++L 
Sbjct: 730 PISRVTIDQLLSGALINPVTVTKFFIHDLIKNAVNYGCDQKHVNNERVEELSEDVWNKLA 789

Query: 835 EFRL 838
           EF+L
Sbjct: 790 EFKL 793

>Kpol_1032.10 s1032 (24479..26854) [2376 bp, 791 aa] {ON}
           (24479..26854) [2376 nt, 792 aa]
          Length = 791

 Score =  626 bits (1615), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 379/825 (45%), Positives = 514/825 (62%), Gaps = 96/825 (11%)

Query: 34  RDDSDDENMLGPPTLSNFGSALL-SDKENVEPHRSTASSRHHPLNQMSRTHSQLPSRTET 92
           +DDSDDE + G P LSNFGSALL S+KEN+              N+++ T+  L +  ++
Sbjct: 43  QDDSDDEQITGFPKLSNFGSALLTSEKENITK------------NKLTNTNLTL-NDDKS 89

Query: 93  LAMSREFSTANTNSSYTGPHSTIHSVDHSDSTLFATFKDNQQSMTTFNPDDQLHQSGLDR 152
           LA     ST + N +  G  +T  S+  S +     + ++ ++++T N   Q        
Sbjct: 90  LAYDNYSSTLSINRA--GNVNTTSSM--SKANNNYEYNNSSENISTGNSTFQ-------- 137

Query: 153 VSLEQSRSKIKSLQQALRDDLSSRNSKRR-TRRFAS-SRLSLLGPAKRASSTS---GTPN 207
                   + K L ++++D+L+++N +RR TRRF + +++ +LGPA R +  +   G  +
Sbjct: 138 --------RFKGLHESIKDELNTKNLERRKTRRFFNRTKMGVLGPAMRTNLENEKLGKNS 189

Query: 208 RSELIEE--SNISQPEGNISNSSTRTASANLNEHNIFYEPQNSNQAIQSSHSPFISSTIN 265
           + E IEE  +   QP   IS+SST  +S+  + H+     Q+ NQ  Q+        TIN
Sbjct: 190 KHETIEEKINKYDQPAHLISSSSTVASSSYTSYHDTH---QSINQTSQT--------TIN 238

Query: 266 YEDVEFGDLNPYQYLKKYNLPTTELPNISRIYFERQKGQNRKAALRKSIASKDAIQNRIA 325
           Y+ ++FG+LNP QY+KK NLPTTELP IS++YFERQ+ ++RK AL+K  +SK+ + +  +
Sbjct: 239 YDLIDFGELNPVQYIKKNNLPTTELPTISKLYFERQRAESRKIALKKHSSSKELLFSSSS 298

Query: 326 TTSSPHSPPVDADAIRRDNSAFKRQPRRKISESATSNDPKAWSSP-FSGINNPTVASARR 384
           +        + +DA          Q   K   + T  D  A S P  S   N     +R 
Sbjct: 299 SALKNSFNQI-SDA----------QNESKCISNNTG-DTDALSEPKISDKENSRSTWSRN 346

Query: 385 TDQYQADEKYSNTEI-PDPNAFDSF--RRREALSNININSYSAAQPQHKKPKYSDYNPQE 441
                 D+  +N E   +P+ + S   ++REALS+IN+N+       +    Y +    +
Sbjct: 347 GYAILKDDYINNLEYYKNPSGYSSSLNKKREALSSINVNT-------NHNHSYQELGDNK 399

Query: 442 FGRLPRPSLENR--------SPISNKEEPQFKHRSPPLIPGKHVEIVEPIRTKESIPLKP 493
             ++    +E+         S +  ++  Q    +      K VEI+EP           
Sbjct: 400 RNKISTKGIESEIEHVAARNSMLEQQKVEQLNSANIHKHGKKKVEIIEP----------K 449

Query: 494 PASSDDINGRKRPVVYVNGTEYEKLELLGRGGTSXXXXXXXXXXXXXXXLKRVSFDEFDD 553
            AS++ I    + VV VNG EYEK+ELLGRGG+S               LKRV FDEFD+
Sbjct: 450 SASANRI--ASKSVVSVNGVEYEKIELLGRGGSSKVYKVKNVHNNKIFALKRVMFDEFDE 507

Query: 554 SSIDGFKGEIELLKKLETQPRVVKLIDHEMDHGVLYVVMECGDHDLSQTLAHRSGMPLDV 613
           SSID FKGEIELLKKLE + RVV LI H+M+ GVL ++MECGDHDLSQ L  R  MPLD+
Sbjct: 508 SSIDSFKGEIELLKKLENEKRVVTLIQHQMESGVLLLIMECGDHDLSQILNQRMNMPLDI 567

Query: 614 EFVRYHAQEMLKCVKVVHDAGIVHSDLKPANFVFVKGILKIIDFGIANAVPEHTVNIYRE 673
           EF+R+HA+EMLKCVKVVHDAGIVHSDLKPANFVFVKGILKIIDFGIANAVP+HTVNIYRE
Sbjct: 568 EFIRFHAREMLKCVKVVHDAGIVHSDLKPANFVFVKGILKIIDFGIANAVPDHTVNIYRE 627

Query: 674 TQIGTPNYMAPEALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQG 733
           TQIGTPNYMAPEALVAMN +   + +Q++WKVGKPSDIWSCGCI+YQM YGRPPYG FQG
Sbjct: 628 TQIGTPNYMAPEALVAMN-SQQDSDQQNKWKVGKPSDIWSCGCILYQMFYGRPPYGSFQG 686

Query: 734 QNRLLAIMNPEVKIVYPEKTSNGDTVPKTAIDTMKACLERNPNKRWTVEEVANGSFVKPV 793
           QNRLLAIMNP VKIV+ EKTSN + +P++A++TMKACL RNP+KRW V++V  GSF  PV
Sbjct: 687 QNRLLAIMNPNVKIVFSEKTSNNERIPRSALETMKACLIRNPDKRWAVDQVLEGSFFNPV 746

Query: 794 SVTHFFIRDLIENSVRYGANQKEISSAKVEELAEDVWHRLEEFRL 838
            VT F IRDLI+N+V YGA+Q+ ++  K+ ELA+DV +RL +FRL
Sbjct: 747 MVTSFIIRDLIKNAVNYGADQRYVTDEKITELADDVLNRLADFRL 791

>Ecym_5236 Chr5 (486270..488864) [2595 bp, 864 aa] {ON} similar to
           Ashbya gossypii ADR317C
          Length = 864

 Score =  620 bits (1598), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/503 (61%), Positives = 373/503 (74%), Gaps = 43/503 (8%)

Query: 349 RQPRRKISESATSNDPKAWSSPFSGINNPTVASARRTDQYQADEKYSNTEIPDPNAFDSF 408
           RQPRRK S+++ S+  K  SSP +G  N  V S +   Q Q   + S   +       + 
Sbjct: 392 RQPRRKTSDASVSSFSKILSSPITGAANNYVESQK---QIQPPMQRSPVSLGPLQLNPNT 448

Query: 409 RRREALSNININSYSAAQPQHKKPKYSDYNPQEFGRLPRPSLENRSPISNKEEPQFKHRS 468
           ++REAL+ +++NS +     HKK K  + N     + P                     +
Sbjct: 449 KKREALNKLDVNSTNQQAIVHKKHKSDEQNFYHIRKAP---------------------N 487

Query: 469 PPLIPGKHVEIVEPIRTK--ESIPLKPPASSDDING------RKRPVVYVNGTEYEKLEL 520
           PP +  K VEI+EP++     +IPLKPP++    NG      RKR ++ VNG+EYEK+EL
Sbjct: 488 PPAV--KKVEIIEPVKDTVITTIPLKPPSTE---NGSYQTPQRKRQIIQVNGSEYEKVEL 542

Query: 521 LGRGGTSXXXXXXXXXXXXXXXLKRVSFDEFDDSSIDGFKGEIELLKKLETQPRVVKLID 580
           LGRGG+S               LKRVSFDEFDD+SIDGFKGEIELLK+LE Q RVVKLID
Sbjct: 543 LGRGGSSKVYKVRSSNNKIYA-LKRVSFDEFDDTSIDGFKGEIELLKRLEDQTRVVKLID 601

Query: 581 HEMDHGVLYVVMECGDHDLSQTLAHRSGMPLDVEFVRYHAQEMLKCVKVVHDAGIVHSDL 640
           HEM+HGVLYVVMECGDHDLSQ LA R+ MP D+EFVRYHAQEMLKCV+VVHD GIVHSDL
Sbjct: 602 HEMNHGVLYVVMECGDHDLSQVLAQRANMPFDIEFVRYHAQEMLKCVQVVHDTGIVHSDL 661

Query: 641 KPANFVFVKGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNYTHNQAP-- 698
           KPANFVFVKGILKIIDFGIANAVP+HTVNIYR+TQIGTPNYMAPEALVAMNYT +Q    
Sbjct: 662 KPANFVFVKGILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVAMNYTPDQGQTE 721

Query: 699 ---EQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEKTSN 755
              +Q+RWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEKT++
Sbjct: 722 QEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEKTTH 781

Query: 756 GDTVPKTAIDTMKACLERNPNKRWTVEEVANGSFVKPVSVTHFFIRDLIENSVRYGANQK 815
           GD VP+TA+DT+KACLERNP +RWTV+++  G F+KPVSVTHFFIRDLI+N+V+YG++Q+
Sbjct: 782 GDLVPRTALDTIKACLERNPERRWTVDDLLRGPFIKPVSVTHFFIRDLIKNAVKYGSDQR 841

Query: 816 EISSAKVEELAEDVWHRLEEFRL 838
            +S  KVE+LA+DVW+RL +FRL
Sbjct: 842 YVSKEKVEDLADDVWNRLSDFRL 864

 Score =  169 bits (429), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 118/300 (39%), Positives = 174/300 (58%), Gaps = 50/300 (16%)

Query: 36  DSDDENMLGPPTLSNFGSALLSDKENVEP---HRSTASSRHHPLNQMSRTHSQLPSRTET 92
           DSDDEN L PP LSNFGSAL +DKEN  P    +S   ++  P   ++   ++ P+ T T
Sbjct: 38  DSDDENPLSPPKLSNFGSALFTDKENETPTYLRKSGVVAQPAPYPNINMNANKPPTLTGT 97

Query: 93  LAMSREFSTANTNSSYTGPHSTIHSVDHSDSTLFATFKDNQQSMTTFNPDDQL-HQSGLD 151
           L M                       D S STLF +   +Q SMTT N + +   + GL 
Sbjct: 98  LHMD----------------------DGSHSTLFTSVSKHQPSMTTVNQEQRTPGEEGL- 134

Query: 152 RVSLEQSRSKIKSLQQALRDDLSSRNSKRRTRRFASSRLSLLGPAKRASSTSGTPNRSEL 211
                    + + +QQ+++D+LSSR   RR+RRF +SRLS LGPAKR ++ +   + S  
Sbjct: 135 ------GSYRFQMIQQSMKDELSSRQIMRRSRRFITSRLSTLGPAKRNTTLTANLDFSSN 188

Query: 212 I---EESNISQPEGNISNSSTRTASANLNE-HNIFYEPQ-------NSNQAIQSSHSPFI 260
           +   +  ++S  +GNIS+SS   +    N+ +N+F + +         N  ++S+     
Sbjct: 189 MSHEDSRDLSHQDGNISSSSNNHSGLLQNQDYNVFLDTEPNCRPDSKENDGLKSA----- 243

Query: 261 SSTINYEDVEFGDLNPYQYLKKYNLPTTELPNISRIYFERQKGQNRKAALRKSIASKDAI 320
            S+I+Y+++ FGDLNPYQYLKK+NLPT+ELPNISRIYFE QK +NR+AA+RK+I + ++I
Sbjct: 244 -SSIDYDNISFGDLNPYQYLKKHNLPTSELPNISRIYFEIQKKENRRAAVRKNIFTNNSI 302

>Suva_4.221 Chr4 complement(391492..393789) [2298 bp, 765 aa] {ON}
           YDL028C (REAL)
          Length = 765

 Score =  601 bits (1550), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 371/832 (44%), Positives = 502/832 (60%), Gaps = 110/832 (13%)

Query: 33  ARDDSDDENMLGPPTLSNFGSALLSDKENVEPHRSTASSRHHPLNQMSRTHSQLPSRTET 92
           AR  SDDE    PP LSNFGSALLS  E     +  ++      N         P   ET
Sbjct: 18  ARQFSDDEEFTTPPKLSNFGSALLSHTEKTSVSQELSNKNDKIAN---------PVFEET 68

Query: 93  LAMSREFSTANTNSSYTGPHSTIHSVDHSDSTLFATFKDN--QQSMTTFNPDDQLHQSGL 150
                  S+ +   S  G  ++ H+   S STLF  +  N  Q SMTT N +D     G 
Sbjct: 69  ----NRSSSRSHPPSSMGNLTSGHTSTSSHSTLFGRYLKNNHQTSMTTMNTNDIEINVG- 123

Query: 151 DRVSLEQSRSKIKSLQQALRDDLSSRNSKRRTRRF-ASSRLSLLGPAKRASSTSGTPNRS 209
              SL++S  KI+SL+Q +++D++S+ ++RR++RF  S+R + LGPAKRAS+ +      
Sbjct: 124 --NSLDKSFEKIRSLRQNMKEDITSKYTERRSKRFLISNRTTKLGPAKRASTLTNVF--- 178

Query: 210 ELIEESNISQPEGNISNSSTRTASANLNEHNIFYEPQNSNQAIQSSHSPFISSTIN--YE 267
                      + ++ NSS +  S NL E          +     S + F  +  N  YE
Sbjct: 179 -----------DDDVPNSSNQLIS-NLRE-------TTESPLDDPSETEFKETKKNSDYE 219

Query: 268 DVEFGDLNPYQYLKKYNLPTTELPNISRIYFERQKGQNRKAALRKSIASKDAIQNRIATT 327
            + FGDLNP QY+KK+NLPT++LP IS+IYF++Q+ +NR+AALRK  + +   +NR ++T
Sbjct: 220 SINFGDLNPIQYIKKHNLPTSDLPMISQIYFDKQREENRQAALRKHSSRELLSKNRSSST 279

Query: 328 SSPHS-PPVDADAIRRDNSAFKRQPRRKISESATSN--------------DPKAWSSPFS 372
              +S   V+ D     NS    QPRRKIS  ++S+              D   +S+  S
Sbjct: 280 PLSNSYSLVNKDHSITSNS--NSQPRRKISTGSSSSKSSIEIRKVLKENIDTDNYSNLKS 337

Query: 373 GINNPTVASARRTDQYQADEKYSNTEIPDPNAFDSFRRREALSNININSYSAAQPQHKKP 432
            IN     S+R  D        S++E           +REAL NI+IN+           
Sbjct: 338 PINKIYRESSRNKD--------SDSE-----------KREALRNISINT----------- 367

Query: 433 KYSDYNPQEFGRLPRPSLENRSPISN---KEEPQFKHRSPPLIP-GKHVEIVEPIRTKES 488
            ++D   Q+  +  + SL++     N   K +  F HR  P  P  K VEIVEPI++   
Sbjct: 368 SHADSGLQQDNKRLKRSLDDAIIHDNENMKNQDVFYHRPAPKPPVTKKVEIVEPIKSASL 427

Query: 489 IPLKPPASSDDINGRKRPVVYVNGTEYEKLELLGRGGTSXXXXXXXXXXXXXXXLKRVSF 548
                           R ++ VN ++YEK+ELLGRGG+S               LKRVSF
Sbjct: 428 -------------SNSRNIITVNDSQYEKIELLGRGGSSRVYKVKGAGNKVYA-LKRVSF 473

Query: 549 DEFDDSSIDGFKGEIELLKKLETQPRVVKLIDHEMDHGVLYVVMECGDHDLSQTLAHRSG 608
           D FDDSS+DGFKGEIELL+KL+ Q RV++L+D+EM  G+LY++MECGDHDLSQ L  RS 
Sbjct: 474 DAFDDSSVDGFKGEIELLEKLKDQKRVIQLLDYEMGDGLLYLIMECGDHDLSQILNQRSN 533

Query: 609 MPLDVEFVRYHAQEMLKCVKVVHDAGIVHSDLKPANFVFVKGILKIIDFGIANAVPEHTV 668
           M LD  F+R++A+EML+C+KVVHDAGIVHSDLKPANFV VKGILKIIDFGIANAVPEHTV
Sbjct: 534 MSLDFNFIRFYAKEMLQCIKVVHDAGIVHSDLKPANFVLVKGILKIIDFGIANAVPEHTV 593

Query: 669 NIYRETQIGTPNYMAPEALVAMNYTHNQAPEQ--SRWKVGKPSDIWSCGCIIYQMIYGRP 726
           NIYRETQIGTPNYMAPEALVAMNYT      Q  ++WKVG+PSD+WSCGCI+YQMIYG+P
Sbjct: 594 NIYRETQIGTPNYMAPEALVAMNYTQTNENRQEGNKWKVGRPSDMWSCGCIVYQMIYGKP 653

Query: 727 PYGGFQGQNRLLAIMNPEVKIVYPEKTSNGDTVPKTAIDTMKACLERNPNKRWTVEEVAN 786
           PYG FQGQNRLLAIMNP+VKI +P+ TSN + +PK+AI+ MKACL RNP+KRWTV++V +
Sbjct: 654 PYGSFQGQNRLLAIMNPDVKIPFPDHTSNNERIPKSAIELMKACLYRNPDKRWTVDKVLS 713

Query: 787 GSFVKPVSVTHFFIRDLIENSVRYGANQKEISSAKVEELAEDVWHRLEEFRL 838
            +F++P  ++   + DLI N+VRYG+ + +IS   + ++ E V  +  ++++
Sbjct: 714 STFLQPFMISGSIMEDLIRNAVRYGSEKPQISHDDLNDVVETVLRKFADYKI 765

>Skud_4.223 Chr4 complement(395836..398145) [2310 bp, 769 aa] {ON}
           YDL028C (REAL)
          Length = 769

 Score =  598 bits (1541), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/831 (43%), Positives = 496/831 (59%), Gaps = 104/831 (12%)

Query: 33  ARDDSDDENMLGPPTLSNFGSALLSDKENVEPHRSTASSRHHPLNQMSRTHSQLPSRTET 92
            R  SDDE    PP LSNFGSALLS                         H++  S +E 
Sbjct: 18  TRQLSDDEEFTTPPKLSNFGSALLS-------------------------HTEKASTSEA 52

Query: 93  LAMSREFSTAN-------------TNSSYTGPHSTIHSVDHSDSTLFATFKDN--QQSMT 137
           L+ ++    AN                S  G  ++ H+   S STLF  +  N  Q SMT
Sbjct: 53  LSTNKNDKIANPVFEEMNRSSSRSHPPSSMGNLTSGHTSTSSQSTLFGRYLRNSHQTSMT 112

Query: 138 TFNPDDQLHQSGLDRVSLEQSRSKIKSLQQALRDDLSSRNSKRRTRRF-ASSRLSLLGPA 196
           T N  D     G    SL++S  +IK+L+Q +++D++S+ ++RR++RF  S+R + LGPA
Sbjct: 113 TMNTSDIEMSVG---NSLDKSFERIKNLRQNMKEDITSKYAERRSKRFLISNRTTKLGPA 169

Query: 197 KRASSTSGTPNRSELIEESNISQPEGNISNSSTRTASANLNEHNIFYEPQNSNQAIQSSH 256
           KRA++          + + +++     + + S  T  + L +            + Q+  
Sbjct: 170 KRATTLKS-------VFDDDVADSSNQLISISRETTESPLAD------------SYQAGF 210

Query: 257 SPFISSTINYEDVEFGDLNPYQYLKKYNLPTTELPNISRIYFERQKGQNRKAALRKSIAS 316
                  + YE ++F DLNP QY+KK+NL T++LP IS+IYF+RQ+ +N++AALRK  +S
Sbjct: 211 RGTRKKDMKYESIDFEDLNPIQYIKKHNLSTSDLPIISQIYFDRQREENKQAALRKH-SS 269

Query: 317 KDAIQNRIATTSSPHSPPVDA--DAIRRDNSAFKRQPRRKISESATSNDPKA-WSSPFSG 373
           ++ +    ++++S  S    A  DA    NS+   QPRRK+S  + S+         F  
Sbjct: 270 RELLSRNRSSSTSLSSGNSLANKDASITFNSS--SQPRRKVSTGSFSSKSSVEIRKTFKE 327

Query: 374 INNPTVASARRTDQYQADEKYSNTEIPDPNAFDSFRRREALSNININSYSA---AQPQHK 430
             N +  ++     ++  ++ S  + PD        +RE L NI+IN+  A    Q ++K
Sbjct: 328 NVNASNINSPNGPVHKIYKEISRNKDPD------CEKREVLRNISINANHADNILQQENK 381

Query: 431 KPKYSDYNPQEFGRLPRPSLENRSPISNKEEPQFKHRSPPLIP-GKHVEIVEPIRTKESI 489
           + K S         L    +     ++ K +  F HR  P  P  K VEIVEP RT  S 
Sbjct: 382 RLKRS---------LDDAIINENEDVNVKNQEVFYHRPAPKPPVTKKVEIVEPARTATS- 431

Query: 490 PLKPPASSDDINGRKRPVVYVNGTEYEKLELLGRGGTSXXXXXXXXXXXXXXXLKRVSFD 549
                          R ++ VN ++YEK+ELLGRGG+S               LKRVSFD
Sbjct: 432 ------------SSNRNMITVNDSQYEKIELLGRGGSSRVYKVKGSGNKVYA-LKRVSFD 478

Query: 550 EFDDSSIDGFKGEIELLKKLETQPRVVKLIDHEMDHGVLYVVMECGDHDLSQTLAHRSGM 609
            FDDSSIDGFKGEIELL+KL+ + RV++L+D+EM  G+LY++MECGDHDLSQ L  R  M
Sbjct: 479 AFDDSSIDGFKGEIELLEKLKDEKRVIQLLDYEMGDGLLYLIMECGDHDLSQILNQRGNM 538

Query: 610 PLDVEFVRYHAQEMLKCVKVVHDAGIVHSDLKPANFVFVKGILKIIDFGIANAVPEHTVN 669
            LD  FVR++A+EML+C+KVVHDAGIVHSDLKPANFV VKGILKIIDFGIANAVPEHTVN
Sbjct: 539 SLDFNFVRFYAKEMLQCIKVVHDAGIVHSDLKPANFVLVKGILKIIDFGIANAVPEHTVN 598

Query: 670 IYRETQIGTPNYMAPEALVAMNYTHNQAP--EQSRWKVGKPSDIWSCGCIIYQMIYGRPP 727
           IYRETQIGTPNYMAPEALVAMNYT N     + ++WKVG+PSD+WSCGCI+YQMIYG+PP
Sbjct: 599 IYRETQIGTPNYMAPEALVAMNYTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPP 658

Query: 728 YGGFQGQNRLLAIMNPEVKIVYPEKTSNGDTVPKTAIDTMKACLERNPNKRWTVEEVANG 787
           YG FQGQNRLLAIMNP+VKI +PE TSN + +PK+AI+ MKACL RNP+KRWTV++V N 
Sbjct: 659 YGSFQGQNRLLAIMNPDVKIPFPEHTSNDEKIPKSAIELMKACLYRNPDKRWTVDKVLNS 718

Query: 788 SFVKPVSVTHFFIRDLIENSVRYGANQKEISSAKVEELAEDVWHRLEEFRL 838
           +F++P  ++   + DLI N+VRYG+ + +IS   + ++ E V  +  ++++
Sbjct: 719 TFLQPFMISESIMEDLIRNAVRYGSEKPQISHDNLNDVVETVLRKFADYKI 769

>Smik_4.207 Chr4 complement(381159..383456) [2298 bp, 765 aa] {ON}
           YDL028C (REAL)
          Length = 765

 Score =  593 bits (1529), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/843 (43%), Positives = 515/843 (61%), Gaps = 122/843 (14%)

Query: 28  NIHSTARDDSDDENMLGPPTLSNFGSALLSDKENVEPHRSTASSRHHPLNQMSRTHSQLP 87
           N  +  R  SDDE    PP LSNFGSALLS  E      + +S   H  N+M+       
Sbjct: 13  NSRTNMRQFSDDEEFTTPPKLSNFGSALLSHSEKTSAPETLSS---HKTNKMT------- 62

Query: 88  SRTETLAMSREFSTANTNSSYTGPHSTIHSVDHSDSTLFATFKDN--QQSMTTFNPDDQL 145
                L      S+ +   S  G  ++ H+   S STLF  +  N  Q SMTT N +D  
Sbjct: 63  --NHVLEEMDRSSSRSHPPSSMGNLTSGHTSTSSHSTLFGRYLRNNHQTSMTTMNTNDIE 120

Query: 146 HQSGLDRVSLEQSRSKIKSLQQALRDDLSSRNSKRRTRRF-ASSRLSLLGPAKRASSTSG 204
              G    SL++S  +I++L+Q +++D++S+ ++RR++RF  S+R + LGPAKRA++ + 
Sbjct: 121 INVG---NSLDKSFERIRNLRQNMKEDMTSKYAERRSKRFLISNRTTKLGPAKRATTLT- 176

Query: 205 TPNRSELIEESNISQPEGNISNSSTRTASANLNEHNIFYEPQNSNQAI--QSSHSPFISS 262
                      N+   E  + NSS           N+   P+ + + +   S+ S F  S
Sbjct: 177 -----------NVFDEE--VPNSS-----------NLPINPRETIETLLEDSNKSGFRES 212

Query: 263 --TINYEDVEFGDLNPYQYLKKYNLPTTELPNISRIYFERQKGQNRKAALRKSIASKDAI 320
              ++YE +EFGDLNP QY+KK+NLPT++LP IS+IYF++Q+ +NR+AALRK  +S++ +
Sbjct: 213 KKNMDYESIEFGDLNPIQYIKKHNLPTSDLPLISQIYFDKQREENRQAALRKH-SSRELL 271

Query: 321 ---QNRIATTSSPHSPPVDADAIRRDNSAFKRQP--------------RRKISESATSND 363
              ++   + SS +  P   ++I   NS+  R+               RR + E+  +++
Sbjct: 272 YKNRSSSTSLSSNNLLPSKDNSITFINSSLPRRKISTGSSSSKSSIEIRRALKENIDTSN 331

Query: 364 PKAWSSPFSGINNPTVASARRTDQYQADEKYSNTEIPDPNAFDSFRRREALSNININSYS 423
             +++SP   I+      +R  D        S++E           +R  L NI+IN+  
Sbjct: 332 NSSFNSPIHNIHKEI---SRNKD--------SDSE-----------KRGVLRNISINANH 369

Query: 424 AAQPQHKKPKYSDYNPQEFGRLPRPSLENRSPISNKEEPQ-----FKHRSPPLIP-GKHV 477
           A               Q+  RL R SL++   I+N+ E +     F HR  P  P  K V
Sbjct: 370 ADNILQ----------QDNKRLKR-SLDD--VITNENENKKIQEVFYHRPAPKPPVTKKV 416

Query: 478 EIVEPIRTKESIPLKPPASSDDINGRKRPVVYVNGTEYEKLELLGRGGTSXXXXXXXXXX 537
           EIVEP ++         ASS +     R ++ VN ++YEK+ELLGRGG+S          
Sbjct: 417 EIVEPAKS---------ASSSN----NRSMITVNDSQYEKIELLGRGGSSRVYKVKGSGN 463

Query: 538 XXXXXLKRVSFDEFDDSSIDGFKGEIELLKKLETQPRVVKLIDHEMDHGVLYVVMECGDH 597
                LKRVSFD FDDSS+DGFKGEIELL+KL+ Q RV++L+D+EM  G+LY++MECGDH
Sbjct: 464 KIYA-LKRVSFDAFDDSSVDGFKGEIELLEKLKDQRRVIQLLDYEMGDGLLYLIMECGDH 522

Query: 598 DLSQTLAHRSGMPLDVEFVRYHAQEMLKCVKVVHDAGIVHSDLKPANFVFVKGILKIIDF 657
           DLSQ L  RS MPLD  FVR++ +EML C+KVVHDAGIVHSDLKPANFV VKGILKIIDF
Sbjct: 523 DLSQILNQRSNMPLDFNFVRFYTKEMLLCIKVVHDAGIVHSDLKPANFVLVKGILKIIDF 582

Query: 658 GIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNYTH--NQAPEQSRWKVGKPSDIWSCG 715
           GIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNYT   +   E ++WKVG+PSD+WSCG
Sbjct: 583 GIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNYTQSSDNQHEGNKWKVGRPSDMWSCG 642

Query: 716 CIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEKTSNGDTVPKTAIDTMKACLERNP 775
           CIIYQMIYG+PPYG FQGQNRLLAIMNP+VKI +PE TSN + +PK+AI+ MKACL RNP
Sbjct: 643 CIIYQMIYGKPPYGSFQGQNRLLAIMNPDVKIPFPEYTSNNEKIPKSAIELMKACLYRNP 702

Query: 776 NKRWTVEEVANGSFVKPVSVTHFFIRDLIENSVRYGANQKEISSAKVEELAEDVWHRLEE 835
           +KRWTV++V + +F++P  ++   + DLI+N+VRYG+ + +IS   + ++ E V  +  +
Sbjct: 703 DKRWTVDKVLSSTFLQPFMISGSIMEDLIKNAVRYGSEKPQISHDDLNDVVETVLRKFSD 762

Query: 836 FRL 838
           +++
Sbjct: 763 YKI 765

>YDL028C Chr4 complement(400997..403291) [2295 bp, 764 aa] {ON}
           MPS1Dual-specificity kinase required for spindle pole
           body (SPB) duplication and spindle checkpoint function;
           substrates include SPB proteins Spc42p, Spc110p, and
           Spc98p, mitotic exit network protein Mob1p, and
           checkpoint protein Mad1p
          Length = 764

 Score =  586 bits (1510), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 364/830 (43%), Positives = 503/830 (60%), Gaps = 103/830 (12%)

Query: 31  STARDDSDDENMLGPPTLSNFGSALLSDKENVEPHRSTASSRHHPLNQMSRTHSQLPSRT 90
           +  R  SDDE    PP LSNFGSALLS  E     +++AS         S  + ++ +R 
Sbjct: 16  TNTRQFSDDEEFTTPPKLSNFGSALLSHTE-----KTSASEILS-----SHNNDKIANRL 65

Query: 91  ETLAMSREFSTANTNSSYTGPHSTIHSVDHSDSTLFATFKDN--QQSMTTFNPDDQLHQS 148
           E +  S   S+ +      G  ++ H+   S STLF  +  N  Q SMTT N  D     
Sbjct: 66  EEMDRS---SSRSHPPPSMGNLTSGHTSTSSHSTLFGRYLRNNHQTSMTTMNTSDIEINV 122

Query: 149 GLDRVSLEQSRSKIKSLQQALRDDLSSRNSKRRTRRF-ASSRLSLLGPAKRASSTSGTPN 207
           G    SL++S  +I++L+Q +++D++++ ++RR++RF  S+R + LGPAKRA + +    
Sbjct: 123 G---NSLDKSFERIRNLRQNMKEDITAKYAERRSKRFLISNRTTKLGPAKRAMTLTN--- 176

Query: 208 RSELIEESNISQPEGNISNSSTRTASANLNEHNIFYEPQNSNQAI----QSSHSPFISST 263
              + +E   + P                       +P N+ + +    + SH      T
Sbjct: 177 ---IFDEDVPNSPN----------------------QPINARETVELPLEDSHQTNFKET 211

Query: 264 ---INYEDVEFGDLNPYQYLKKYNLPTTELPNISRIYFERQKGQNRKAALRKSIASKDAI 320
               +Y+ ++FGDLNP QY+KK+NLPT++LP IS+IYF++Q+ +NR+AALRK  +S++ +
Sbjct: 212 KRNTDYDSIDFGDLNPIQYIKKHNLPTSDLPLISQIYFDKQREENRQAALRKH-SSRELL 270

Query: 321 QNRIATTSSPHSPPVDADAIRRDNSAFKRQPRRKISESATSNDP-----KAWSSPFSGIN 375
               +++SS  S  + A+      S    QPRRK+S  ++S+       +A        N
Sbjct: 271 YKSRSSSSSLSSNNLLANKDNSITSNNGSQPRRKVSTGSSSSKSSIEIRRALKENIDTSN 330

Query: 376 NPTVAS-ARRTDQYQADEKYSNTEIPDPNAFDSFRRREALSNININSYSAAQPQHKKPKY 434
           N    S   +  +  +  K S++E           +RE L NI+IN+  A          
Sbjct: 331 NSNFNSPIHKIYKGISRNKDSDSE-----------KREVLRNISINANHA---------- 369

Query: 435 SDYNPQEFGRLPRPSLEN---RSPISNKEEPQFKHRSPPLIP-GKHVEIVEPIRTKESIP 490
            +   QE  RL R SL++      I++K    F HR  P  P  K VEIVEP ++     
Sbjct: 370 DNLLQQENKRLKR-SLDDAITNENINSKNLEVFYHRPAPKPPVTKKVEIVEPAKSASL-- 426

Query: 491 LKPPASSDDINGRKRPVVYVNGTEYEKLELLGRGGTSXXXXXXXXXXXXXXXLKRVSFDE 550
                         R ++ VN ++YEK+ELLGRGG+S               LKRVSFD 
Sbjct: 427 -----------SNNRNIITVNDSQYEKIELLGRGGSS-RVYKVKGSGNRVYALKRVSFDA 474

Query: 551 FDDSSIDGFKGEIELLKKLETQPRVVKLIDHEMDHGVLYVVMECGDHDLSQTLAHRSGMP 610
           FDDSSIDGFKGEIELL+KL+ Q RV++L+D+EM  G+LY++MECGDHDLSQ L  RSGMP
Sbjct: 475 FDDSSIDGFKGEIELLEKLKDQKRVIQLLDYEMGDGLLYLIMECGDHDLSQILNQRSGMP 534

Query: 611 LDVEFVRYHAQEMLKCVKVVHDAGIVHSDLKPANFVFVKGILKIIDFGIANAVPEHTVNI 670
           LD  FVR++ +EML C+KVVHDAGIVHSDLKPANFV VKGILKIIDFGIANAVPEHTVNI
Sbjct: 535 LDFNFVRFYTKEMLLCIKVVHDAGIVHSDLKPANFVLVKGILKIIDFGIANAVPEHTVNI 594

Query: 671 YRETQIGTPNYMAPEALVAMNYTHN--QAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPY 728
           YRETQIGTPNYMAPEALVAMNYT N     E ++WKVG+PSD+WSCGCIIYQMIYG+PPY
Sbjct: 595 YRETQIGTPNYMAPEALVAMNYTQNSENQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPY 654

Query: 729 GGFQGQNRLLAIMNPEVKIVYPEKTSNGDTVPKTAIDTMKACLERNPNKRWTVEEVANGS 788
           G FQGQNRLLAIMNP+VKI +PE TSN + +PK+AI+ MKACL RNP+KRWTV++V + +
Sbjct: 655 GSFQGQNRLLAIMNPDVKIPFPEHTSNNEKIPKSAIELMKACLYRNPDKRWTVDKVLSST 714

Query: 789 FVKPVSVTHFFIRDLIENSVRYGANQKEISSAKVEELAEDVWHRLEEFRL 838
           F++P  ++   + DLI N+VRYG+ +  IS   + ++ + V  +  ++++
Sbjct: 715 FLQPFMISGSIMEDLIRNAVRYGSEKPHISQDDLNDVVDTVLRKFADYKI 764

>KAFR0F02220 Chr6 (432967..435210) [2244 bp, 747 aa] {ON} Anc_3.162
           YDL028C
          Length = 747

 Score =  583 bits (1503), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/808 (42%), Positives = 481/808 (59%), Gaps = 99/808 (12%)

Query: 40  ENMLGPPTLSNFGSALLSDKENVEPHRSTASSRHHPLNQMSRTHSQLPSRTETLAMSREF 99
           EN++GPP LSNFGSALL++ +N      T S  H     ++      P     +++SR  
Sbjct: 30  ENIIGPPKLSNFGSALLTENDN----SGTTSRFHTQFRSLNGNSVHSP-----ISLSRNN 80

Query: 100 STANTNSSYTGPHSTIHSVDHSDSTLFATFKDNQ-QSMTTF---NPDDQLHQSGLDRVSL 155
           S  +   +   P ++I          FAT  +N+  SMTT    + D  +  +  D+   
Sbjct: 81  SYGSYGIAEQSPQTSI----------FATTINNRPISMTTIQNGSADSNVTNNVNDK--Y 128

Query: 156 EQSRSKIKSLQQALRDDLSSRNSKRRTRRFASSRLSLLGPAKRASSTSGTPNRSELIEES 215
           E S +KI  +QQ+++D+L+SR++ R  R   ++R++ LGPAKRAS+            E 
Sbjct: 129 ESSYNKINKIQQSIKDELTSRHTGRIKRFLNTNRMNKLGPAKRASTM-----------EV 177

Query: 216 NISQPEGNISNSSTRTASANLNEHNIFYEPQNSNQAIQSSHSPFISSTINYEDVEFGDLN 275
           +I  P    +N S  ++S      ++F     S QAI+ ++        +Y ++ FGDLN
Sbjct: 178 DIPLPAN--TNDSYNSSS------DVF-----SGQAIEEANDIKEVQNYDYSNINFGDLN 224

Query: 276 PYQYLKKYNLPTTELPNISRIYFERQKGQNRKAALRKSIASKDAIQ---NRIATTSSPHS 332
           P+Q+L+KYNLPTTELPNIS+IYFERQK +NR + L+K   +    +   N I   S   +
Sbjct: 225 PFQFLRKYNLPTTELPNISKIYFERQKEENRLSILKKHTNNNTGAKTNGNDIKDFSISKN 284

Query: 333 PPVDADAIRRDNSAFKRQPRRKISESATSNDPKAWSSPFSGINNPTVASARRTDQYQADE 392
              +     ++        R  ++ + +S    +  SP S  NN         D  +   
Sbjct: 285 LTSEDKTDLKNTVNTGLVSRTLLNSTLSSRKTNSSLSPKSKDNN----EFNSLDVEEPKH 340

Query: 393 KYSNTEIPDPNAFDSFRRREALSNININSYSAAQPQHKKPKYSDYNPQEFGRLPRPSLEN 452
             SN +   PN     +RRE L +++ N     +P+ K+ K  + N +            
Sbjct: 341 LTSNNDEIRPN-----KRREPLVDLSTNR---KEPELKRFKTFEENKK------------ 380

Query: 453 RSPISNKEEPQFKHRSPPLIPGKHVEIVEPIRTKESIPLKPPASSDDINGRKRPVVYVNG 512
           R  I N++E   +     +   K VEI+EP                 ++ R+R V+ VN 
Sbjct: 381 RDEIINEKENVVQDVPKSM---KRVEIMEP----------------KMSHRQRNVINVNE 421

Query: 513 TEYEKLELLGRGGTSXXXXXXXXXXXXXXXLKRVSFDEFDDSSIDGFKGEIELLKKLETQ 572
           TEYEK+ELLGRGG+S               LKRV FDEFDDSSI+GFKGEI+LL KL  +
Sbjct: 422 TEYEKIELLGRGGSS-KVYKVKGPSNKVFALKRVVFDEFDDSSINGFKGEIKLLNKLRNE 480

Query: 573 PRVVKLIDHEMDHGVLYVVMECGDHDLSQTLAHRS--GMPLDVEFVRYHAQEMLKCVKVV 630
            RVVKL D+EM+ G+LY++MECGD DLSQ L  +    +P D+EF+RY+ +EM+KCVKVV
Sbjct: 481 NRVVKLFDYEMNQGLLYLIMECGDVDLSQILNQKINLNLPFDIEFIRYYTREMIKCVKVV 540

Query: 631 HDAGIVHSDLKPANFVFVKGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAM 690
           HD GIVHSDLKPANFV VKG+LKIIDFGIA+AVP+HTVNIYRETQ GTPNYMAPE L+AM
Sbjct: 541 HDNGIVHSDLKPANFVLVKGVLKIIDFGIADAVPDHTVNIYRETQTGTPNYMAPETLIAM 600

Query: 691 NYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYP 750
           NYT+N A +  +WKVGKPSD+WSCGCIIYQMIYG+ PY GFQGQ+R+ AIMN +VKIVYP
Sbjct: 601 NYTNNGAKDL-KWKVGKPSDVWSCGCIIYQMIYGKAPYAGFQGQHRIFAIMNSDVKIVYP 659

Query: 751 EKTSNGDTVPKTAIDTMKACLERNPNKRWTVEEVANGSFVKPVSVTHFFIRDLIENSVRY 810
           EKT+  + +PKT ++ MK CL R+P KRWTV+++ + +F+ P+  +  FIRDLI+N++ +
Sbjct: 660 EKTNEEELIPKTMVELMKNCLRRDPGKRWTVDDILSSTFLNPIVTSQSFIRDLIKNAITF 719

Query: 811 GANQKEISSAKVEELAEDVWHRLEEFRL 838
           G+ QK +S  K+ +L  DV  RL+EF++
Sbjct: 720 GSQQKIVSEDKINDLTNDVLTRLQEFKM 747

>NDAI0A06620 Chr1 complement(1510218..1512461) [2244 bp, 747 aa]
           {ON} 
          Length = 747

 Score =  578 bits (1489), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 350/859 (40%), Positives = 494/859 (57%), Gaps = 133/859 (15%)

Query: 1   MSSYSVRSNLISKPPEIRGLDFRPRRPNIHSTARDDSDDENMLGPPTLSNFGSALLSDKE 60
           MS Y  R       P  R  D   R P    T   DSDDE +  PP LS F SAL S K+
Sbjct: 1   MSKYKYR-------PRARTHDSEQRSP----TYSTDSDDEPLSDPPKLSTFASALFSVKD 49

Query: 61  N---VEPHRSTASSRHHPLNQMSRTHSQLPSRTETLAMSREFSTANTNSSYTGPHSTIHS 117
           +   ++   +  S+ + P+N+ +                      + N S+   ++    
Sbjct: 50  SSNQLDFSENYNSTTNGPINKYA-----------------GLKNVSANESHNITNNATQF 92

Query: 118 VDHSD-STLFA-TFKDNQQSMTTFN------PDDQLHQSGLDRVSLEQSRSKIKSLQQAL 169
            DHS  ST+FA T    Q S+TT N       D+       + + +E +  +IK LQQ++
Sbjct: 93  DDHSSISTIFAHTNLPRQPSITTTNNNVPGDDDNARLAESYNELEMESNLQRIKVLQQSM 152

Query: 170 RDDLSSRNSKRRTRRFASSRLSLLGPAKRASSTSGTPNRSELIEESNISQPEGNISNSST 229
           +++L+SR  +RR RRF +SRL+ LGPAKRASS          + E +I +   +I N++ 
Sbjct: 153 KEELTSRYVERRNRRFLTSRLTRLGPAKRASSA---------VSEKDILR---SIDNNTQ 200

Query: 230 RTAS-------ANLNEHNIFYEPQNSNQAIQSSHSPFISSTINYEDVEFGDLNPYQYLKK 282
                      + L++  I   P+++ +             I+Y  ++FG L P++YLKK
Sbjct: 201 HLLPEYHTPPLSVLDQKEISTVPESAARG-----------NIDYSSIDFGRLKPFEYLKK 249

Query: 283 YNLPTTELPNISRIYFERQKGQNRKAALRKSIASKDAIQNRIATTSSPHSPPVDADAIRR 342
             LPT+ELP+IS+ YF++QK ++ +  L+K   + +    +I T +         + + +
Sbjct: 250 KKLPTSELPSISKAYFQKQKEESLQNTLKKRHRTLNE-DPKIGTFNDEGGS--SGNIVSK 306

Query: 343 DNSAFKRQPRRKISESATSNDPKAWSSPFSGINNPTVASARRTDQYQADEKYSNTEIPDP 402
                   PRRK S+        A + P +  N P       TD+Y             P
Sbjct: 307 GTPRIPNLPRRKFSQ--------ASARPSAPHNLPP------TDKY------------GP 340

Query: 403 NAFDSFRRREALSNININSYSAAQPQHKKPKYSDYNPQEFGRLPRPSLENRSPISNKEEP 462
             + S   R+ L++++IN+ S ++  HK           FG      ++   P + K   
Sbjct: 341 IQYSS---RDVLTSLDINNQSPSKADHK-----------FGY----DIQIGKPYTVKTPL 382

Query: 463 QFKHRSPPLIPGKHVEIVEPIRTKESIPLKPPASSDDINGRKRPVVYVNGTEYEKLELLG 522
              ++   L P K VEI+EP    +              G+K  +  VNG +YEK+ELLG
Sbjct: 383 NESYKR--LSPKKKVEIIEPFIYAQK----------KKTGKKLSIT-VNGIDYEKIELLG 429

Query: 523 RGGTSXXXXXXXXXXXXXXXLKRVSFDEFDDSSIDGFKGEIELLKKLETQPRVVKLIDHE 582
           RGG+S               LKRVSFDEFDDSSI GFKGEIELL+KL  +PRVV+L D++
Sbjct: 430 RGGSSKVYKVKNDQNKIFA-LKRVSFDEFDDSSIAGFKGEIELLEKLCKEPRVVRLFDYQ 488

Query: 583 MDHGVLYVVMECGDHDLSQTLAHRSGMPLDVEFVRYHAQEMLKCVKVVHDAGIVHSDLKP 642
           M  GVLY++MECGD+DLSQ L  R G PLD++F+RYH +E+LKCVK VHDAGIVHSDLKP
Sbjct: 489 MSSGVLYLIMECGDNDLSQVLNQRMGFPLDMDFLRYHVRELLKCVKAVHDAGIVHSDLKP 548

Query: 643 ANFVFVKGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNYTHNQA---PE 699
           ANFVF+KG+LK+IDFGIAN +P+HTVN+YRE+QIGTPNYMAPE L+A N++  Q+    E
Sbjct: 549 ANFVFIKGLLKLIDFGIANVIPDHTVNVYRESQIGTPNYMAPETLIATNHSIEQSDLNKE 608

Query: 700 QSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEKTSNGDTV 759
            S+WKVGKPSD+WSCGCIIYQMIYGRPPY GFQGQNRLLAIMNPEVK+++ E+T+  + +
Sbjct: 609 MSKWKVGKPSDVWSCGCIIYQMIYGRPPYAGFQGQNRLLAIMNPEVKVIFSERTAKDEKI 668

Query: 760 PKTAIDTMKACLERNPNKRWTVEEVANGSFVKPVSVTHFFIRDLIENSVRYGANQKEISS 819
           P + ID MKACL R+P KRW+++++    F  P+ VT FFI+DLI+N+V+YG +QK ++ 
Sbjct: 669 PTSLIDLMKACLLRDPAKRWSIDKLLCSPFFNPIIVTPFFIKDLIKNAVKYGTDQKTVTD 728

Query: 820 AKVEELAEDVWHRLEEFRL 838
           AK+EEL+ DV  RL +F++
Sbjct: 729 AKIEELSNDVLERLNDFKM 747

>TPHA0M00300 Chr13 (59377..61701) [2325 bp, 774 aa] {ON} Anc_3.162
           YDL028C
          Length = 774

 Score =  565 bits (1456), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/591 (51%), Positives = 387/591 (65%), Gaps = 55/591 (9%)

Query: 255 SHSPFISSTINYEDVEFGDLNPYQYLKKYNLPTTELPNISRIYFERQKGQNRKAALRKSI 314
           S++   ++ I+Y  +E GDLNP+Q LKKYNLP+TEL  IS++YFE+QK +NRK  ++K  
Sbjct: 232 SNTSLPNTMIDYNLIEIGDLNPFQVLKKYNLPSTELATISKLYFEKQKEENRKNIMKKRS 291

Query: 315 ASKDAIQNRIATTSSPHSPPVDADAIRRDNSAFKRQPRRKISESATSNDPKAWSSPFSGI 374
            SK+     I++ S                S+F      + S   +  D           
Sbjct: 292 VSKEGFMTSISSNSVSSK--------ISRQSSFHTTTNNRHSSMVSKQD----------- 332

Query: 375 NNPTVASARRTDQYQADEKYS---NTEIPDPNAFDSFRRREALSNININ-SYSAAQPQHK 430
              T A    T   ++DEK     N   PD         R+ L++I+IN + +    + K
Sbjct: 333 ---TNAILMNTTSTRSDEKVMKPLNEYEPD---------RKVLASIDINKNINVNAIEKK 380

Query: 431 KPKYSDYNPQEFGRLPRPSLENRSPISNKEEPQ-FKHRSPPLIPGKHVEIVEPIRTKESI 489
           +P    Y+ ++       S E++S  S  E+P  F+         K VEIVEP       
Sbjct: 381 RPVEHQYSYEKSKIHISESRESQS--STVEKPHTFQDNKEGQKIVKKVEIVEP------- 431

Query: 490 PLKPPASSDDINGRK--RPVVYVNGTEYEKLELLGRGGTSXXXXXXXXXXXXXXXLKRVS 547
               P S   +  RK  + +V VN  EYE++ELLGRGG+S               LKRV 
Sbjct: 432 ----PTS---MTNRKSSKSIVSVNDIEYERIELLGRGGSSKVYKVKNTNNNRVYALKRVV 484

Query: 548 FDEFDDSSIDGFKGEIELLKKLETQPRVVKLIDHEMDHGVLYVVMECGDHDLSQTLAHRS 607
           FDEFDD+S+D FKGEIELLKKLE + RVVKLI ++MD+GVLY+VMECGDHDLSQ L  R+
Sbjct: 485 FDEFDDTSVDAFKGEIELLKKLENEKRVVKLIQYQMDNGVLYLVMECGDHDLSQILNQRA 544

Query: 608 GMPLDVEFVRYHAQEMLKCVKVVHDAGIVHSDLKPANFVFVKGILKIIDFGIANAVPEHT 667
            MPLDV+F+RY+++EMLKCVKVVHDAGIVHSDLKPANFV VKGILKIIDFGIANAVP+HT
Sbjct: 545 NMPLDVDFIRYYSREMLKCVKVVHDAGIVHSDLKPANFVLVKGILKIIDFGIANAVPDHT 604

Query: 668 VNIYRETQIGTPNYMAPEALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPP 727
           VNIYR+TQIGTPNYMAPEALVA+N   N   +++RW+VGKPSDIWSCGCI+YQM YGRPP
Sbjct: 605 VNIYRDTQIGTPNYMAPEALVALNEVSN-VEKKNRWRVGKPSDIWSCGCIMYQMFYGRPP 663

Query: 728 YGGFQGQNRLLAIMNPEVKIVYPEKTSNGDTVPKTAIDTMKACLERNPNKRWTVEEVANG 787
           YG FQ QNRLLAIMNPEVKIV+ EKTS  + VPK+A+DTMKACL R+P KRWT +E+ + 
Sbjct: 664 YGAFQNQNRLLAIMNPEVKIVFSEKTSKNERVPKSALDTMKACLIRSPEKRWTADEILDA 723

Query: 788 SFVKPVSVTHFFIRDLIENSVRYGANQKEISSAKVEELAEDVWHRLEEFRL 838
           SF+ PV VT + +RDLI N+V YG++Q ++S  K+ ELA+DV +RL +FRL
Sbjct: 724 SFLNPVLVTPYIVRDLIRNAVYYGSDQGQVSEDKITELADDVLNRLADFRL 774

>CAGL0K01617g Chr11 complement(143308..145632) [2325 bp, 774 aa]
           {ON} similar to uniprot|P54199 Saccharomyces cerevisiae
           YDL028c Serine/threonine protein kinase
          Length = 774

 Score =  533 bits (1372), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 338/833 (40%), Positives = 480/833 (57%), Gaps = 108/833 (12%)

Query: 36  DSDDENMLGPPTLSNFGSALLSDK-ENVEPHRSTASSRHHPLNQMSRTHSQLPSRTETLA 94
           DSDD  +  PP LSNFGS L+SD  EN+ P+RS        +++ +R H    S ++ L 
Sbjct: 19  DSDDGEIGNPPKLSNFGSELISDAIENINPNRSDKK----LISEETRIHE---SHSQQLN 71

Query: 95  MSREFSTANTNSSYTGPHSTIHSVDHSDSTLFATFKDNQQ-SMTTFNPDDQLHQSGLDRV 153
                ST  T+S+     S ++  D S ST+F   + + Q S TT++   Q      D  
Sbjct: 72  TDINQSTRVTHSA----SSPLYFEDTSPSTMFVQSQASAQPSATTYDISSQ------DYS 121

Query: 154 SLEQSRSKIKSLQQALRDDLSSRNSKRRTRRF--ASSRLSLLGPAKRASSTSGTPNRSEL 211
              +S  K+KS Q  L+ +L++R S+RRTRRF  A++R + LGPA R  ++         
Sbjct: 122 DSSKSFIKLKSKQDTLKQELTTRYSERRTRRFLHATNRTTKLGPALRNLTSPALA----- 176

Query: 212 IEESNISQPEGNISNSSTRTASAN--LNEHNIFYEPQNSNQAIQSSHSPFISSTIN---- 265
           I ++N      +I N    T+  N   + +N + +   + Q I +S     ++  N    
Sbjct: 177 INDNN------SIDNKMNETSKVNSSFDTNNAYVDFHQTKQDIYTSGEEHNNTKDNGKIG 230

Query: 266 ------YEDVEFGDLNPYQYLKKYNLPTTELPNISRIYFERQKGQNRKAALRKSIASKDA 319
                 Y D+   + NP QY+K +NLPT+EL  IS+ YFE+QK +NRK AL K++  K +
Sbjct: 231 ATQQNDYSDINIHECNPIQYMKMHNLPTSELSKISKAYFEKQKEENRKKAL-KNVNMKQS 289

Query: 320 IQNRIATTSSPHSPPVDADAIRRDNSAFKRQPRRKISESATSNDPKAWSSPFSGINNPTV 379
           +   +   S+   P +++    ++N+          +    S +  + S   +  ++P  
Sbjct: 290 LNYDLKHYSNSF-PSIESG---KENNLIHNTEIEDFNGRGHSTNNHSSSYLSNSHSHPVS 345

Query: 380 ASARRTDQYQADEKYSNTEIPDP-------NAFDSFR--RREALSNININS-YSAAQPQH 429
                +         +N E+  P       NA DS+R  +REAL NI++NS        +
Sbjct: 346 TQFVES---------ANIELEKPTLKKSLSNA-DSYRHTQREALQNIDVNSNVRDGAIDY 395

Query: 430 KKPKYSDYNPQEFGRLPRPSLENRSPISNKEEPQFKHRSPPLIPGKHVEIVEPIRTKESI 489
           K+ K +  + +  G L +                 K+R       K VEIVEP       
Sbjct: 396 KRQKIALKDSEFDGILDKK----------------KYRGI-----KRVEIVEP-----PT 429

Query: 490 PLKPPASSDDINGRKRPVVYVNGTEYEKLELLGRGGTSXXXXXXXXXXXXXXXLKRVSFD 549
             +PP+        ++ VV VNGTEYE++ELLGRGG+S               LK+VSFD
Sbjct: 430 STRPPS--------RKNVVSVNGTEYERVELLGRGGSSNVYKVRGLKNRVYA-LKKVSFD 480

Query: 550 EFDDSSIDGFKGEIELLKKLETQPRVVKLIDHEMDHGVLYVVMECGDHDLSQTLAHRSGM 609
           EFD+SS++GFKGEI LLK+L+ Q RVV+L D EM  GVLY++MECGD+DLSQ L  R+  
Sbjct: 481 EFDESSVEGFKGEISLLKQLQNQNRVVQLYDFEMGSGVLYLLMECGDYDLSQVLHQRANQ 540

Query: 610 PLDVEFVRYHAQEMLKCVKVVHDAGIVHSDLKPANFVFVKGILKIIDFGIANAVPEHTVN 669
           P D+EF+RYHA+EM+ CVKVVHDAGIVHSDLKPANFVFVKGILKIIDFGIANAVP+HTVN
Sbjct: 541 PFDMEFIRYHAREMVTCVKVVHDAGIVHSDLKPANFVFVKGILKIIDFGIANAVPDHTVN 600

Query: 670 IYRETQIGTPNYMAPEALVAMNYTHNQ----APEQSRWKVGKPSDIWSCGCIIYQMIYGR 725
           IYR+ QIGTPNYMAPEALVA NYT +       + ++WK+GKP+DIWSCGCIIYQMIYG+
Sbjct: 601 IYRDMQIGTPNYMAPEALVANNYTADNDGKYDQKTNKWKIGKPADIWSCGCIIYQMIYGK 660

Query: 726 PPYGGFQGQNRLLAIMNPEVKIVYPEKTSNGDTVPKTAIDTMKACLERNPNKRWTVEEVA 785
           PPY  +QGQ RLL+IM+P VKI Y E   +   +P  A++ M+ CL RNP +RW+  ++ 
Sbjct: 661 PPYAKYQGQERLLSIMDPNVKIEYKEVLPDKTVIPSLALELMQYCLMRNPEERWSALQIL 720

Query: 786 NGSFVKPVSVTHFFIRDLIENSVRYGANQKEISSAKVEELAEDVWHRLEEFRL 838
           +  F+ P+ V+  FI++LI  +V YGA + ++S +++E L + V  RL +FR+
Sbjct: 721 DSPFLNPLMVSQDFIKNLITTAVSYGAREGDVSPSRLEALTDSVLARLADFRM 773

>KNAG0K01740 Chr11 (364195..366492) [2298 bp, 765 aa] {ON} Anc_3.162
           YDL028C
          Length = 765

 Score =  497 bits (1280), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 314/834 (37%), Positives = 446/834 (53%), Gaps = 148/834 (17%)

Query: 41  NMLGPPTLSNFGSALLSDKENVEPHRSTASSRHHPLNQMSRTHSQLPSRTETL------- 93
           N++GPP LS+FGS LL++  N   H  T +        +   HS  P  T+ +       
Sbjct: 44  NIIGPPKLSDFGSNLLNESAN---HSGTFTK----FRGLGMAHS--PRVTQRIDGPGGNN 94

Query: 94  ----------AMSREFSTANTNSSYTGPHSTIHSVDHSDSTLFATFKDNQQSMTTFNPDD 143
                     + S  F +   N +     +T++++ H DS+  +T K++  + T      
Sbjct: 95  IVSHRNGSSPSSSSIFGSTVYNPARPSSMTTVNNLKHEDSSRISTVKNDVLNRTLERRRL 154

Query: 144 QLHQSGL------DRVSLEQSRSKIKSLQQALRDDLSSRNSKRRTRRFAS-SRLSLLGPA 196
               S L      + + L+     I+ ++Q +RD+ +S+  +RR +RF +  R + LGPA
Sbjct: 155 SRTASSLSNPPTVNSIDLKDHEVNIEKIKQTIRDETTSKLLERRAKRFLNLERRNRLGPA 214

Query: 197 KRASSTSG--TPNRSELIEESNISQPEGNISNSSTRTASANLNEHNIFYEPQNSNQAIQS 254
           KR S TS   T    +L+ +               R A   + + +    PQ        
Sbjct: 215 KRTSMTSSLITSEMDDLLIQ---------------RDAKGEVEQQDREMTPQ-------- 251

Query: 255 SHSPFISSTINYEDVEFGDLNPYQYLKKYNLPTTELPNISRIYFERQKGQNRKAALRKSI 314
                    ++Y ++ FGDLNP+QY+ KYN+P  ELP IS++Y E++K +NR+ ALRK  
Sbjct: 252 ---------VDYSNIVFGDLNPFQYVNKYNIPMEELPQISKVYIEKRKEENRRVALRKHS 302

Query: 315 ASKD----------AIQNRIATTSSPHSPPVDADAIRRDNSAFKRQPRRKISESATSNDP 364
           +S            A +      S  +  PV AD +          P  + S+   ++ P
Sbjct: 303 SSSLNVVSNSSQYWANKGNYDDKSEENEKPV-ADLL---------GPAIRHSDQTGTSGP 352

Query: 365 KAWSSPFSGINNPTVASARRTDQYQADEKYSNTEIPDPNAFDSFRRREALSNININSYSA 424
               +P   +N       ++      +E Y        N     R+RE L+N+N+N    
Sbjct: 353 LPPRTPVQ-LNESNHNVMKQELPAHNNENY--------NVNKLIRKREVLANLNVNQ--- 400

Query: 425 AQPQHKKPKYSDYNPQEFGRLPRPSLENRSPISNKEEPQFKHRSPPLIPGKHVEIVEPIR 484
            +P+ KKPK          +L +P++  R                       VEI EP  
Sbjct: 401 KEPELKKPK------NNLEQLDKPAIIKR-----------------------VEIQEP-- 429

Query: 485 TKESIPLKPPASSDDINGRKRPVVYVNGTEYEKLELLGRGGTSXXXXXXXXXXXXXXXLK 544
                  KP         +K   + +N  EYEK+ELLG GG+S               LK
Sbjct: 430 -------KP--------SKKNTSIVINNEEYEKIELLGSGGSSKVYKVRDSSKKVFA-LK 473

Query: 545 RVSFDEFDDSSIDGFKGEIELLKKLETQPRVVKLIDHEMDHGVLYVVMECGDHDLSQTLA 604
           RV+ D F++SS++ FKGEI LL+KL+ Q RVV+L ++ ++  VLY++MECGD+DLS  L 
Sbjct: 474 RVAIDMFEESSVESFKGEIALLEKLKNQERVVQLYNYALESSVLYLIMECGDYDLSVMLR 533

Query: 605 HRSGMPLDVEFVRYHAQEMLKCVKVVHDAGIVHSDLKPANFVFVKGILKIIDFGIANAVP 664
            R   PLD EFVRY+A+E+  CVKVVHD GIVHSDLKPANF+FVKG LKIIDFGIANAVP
Sbjct: 534 ERLNKPLDTEFVRYYAREISHCVKVVHDVGIVHSDLKPANFIFVKGTLKIIDFGIANAVP 593

Query: 665 EHTVNIYRETQIGTPNYMAPEALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYG 724
           EHTVNIYRETQIGTPNYMAPEALVAMNYT+ ++   SRWKVGKPSD+WS GCIIYQM+YG
Sbjct: 594 EHTVNIYRETQIGTPNYMAPEALVAMNYTNGES-NVSRWKVGKPSDVWSLGCIIYQMVYG 652

Query: 725 RPPYGGFQGQNRLLAIMNPEVKIVYPEKTSNGDTVPKTAIDTMKACLERNPNKRWTVEEV 784
           +PPY  FQG +R+ AI+ P VKI YP     G TVP + I+ +K CL R+PNKR  V+ +
Sbjct: 653 KPPYASFQGNDRIRAIIKPSVKIEYPS-VKEGVTVPNSIIELIKVCLNRDPNKRVDVDGM 711

Query: 785 ANGSFVKPVSVTHFFIRDLIENSVRYGANQKEISSAKVEELAEDVWHRLEEFRL 838
            N +F+ P+ V+  F+RDL++N+V YG  Q ++S   ++ LA DV  +L E+R+
Sbjct: 712 LNSTFLSPILVSEAFVRDLVKNAVEYGIKQGDVSITTIDALANDVIEKLSEYRI 765

>TBLA0F00860 Chr6 (219628..222570) [2943 bp, 980 aa] {ON} Anc_3.162
           YDL028C
          Length = 980

 Score =  483 bits (1242), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 239/455 (52%), Positives = 322/455 (70%), Gaps = 29/455 (6%)

Query: 410 RREALSNININ---SYSAAQPQHKKPKYSDYNPQEFG------RLP----RPSLENRSPI 456
           RR AL++I+IN    Y++   +HK+ K +D    +        R+P    R +  ++S +
Sbjct: 529 RRTALTSIDINKRSGYASPSREHKRSKTTDNYKMDVSVLESNSRIPSSANRINYRSKSAL 588

Query: 457 SNKEEP-----QFKHRSPPLIPGKH----VEIVEPIRTKESIPLKPPASSDDINGRKRPV 507
           ++   P           PP+ P  H    +   +P + ++ + +  P +   I+  ++P+
Sbjct: 589 ADYNNPMQDIDHLPSSQPPVRPPPHFIPSLSQPQPQQVRKKVEIIEPEAK--IHNYQKPI 646

Query: 508 VYVNGTEYEKLELLGRGGTSXXXXXXXXXXXXXXXLKRVSFDEFDDSSIDGFKGEIELLK 567
           + VN  EYEK+ LLGRGG+S               LKRV FDEFDDSSI+GFKGEIELLK
Sbjct: 647 IIVNNIEYEKVALLGRGGSSKVYKVKGPKNSYYA-LKRVLFDEFDDSSIEGFKGEIELLK 705

Query: 568 KLETQPRVVKLIDHEMDHGVLYVVMECGDHDLSQTLAHRSGMPLDVEFVRYHAQEMLKCV 627
           KLE + RVV+L D++M++G L+++MECGD DLS+ L  RS  PLD+EF+RY+++EMLKCV
Sbjct: 706 KLEHEERVVRLFDYKMENGTLHLIMECGDLDLSRILHQRSKQPLDLEFIRYYSREMLKCV 765

Query: 628 KVVHDAGIVHSDLKPANFVFVKGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEAL 687
           +VVH+  IVHSDLKPANFV V  +LKIIDFGIANAVP+HTVNIYRE QIGTPNYMAPEAL
Sbjct: 766 QVVHNNDIVHSDLKPANFVLVGSVLKIIDFGIANAVPDHTVNIYRECQIGTPNYMAPEAL 825

Query: 688 VAMNYTHNQAPEQ----SRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNP 743
           V+MN T N+        +RWKVGKPSD+WSCGCI+YQM YG+PPYG +QGQNRLLAIMNP
Sbjct: 826 VSMNLTSNENENAQKPVNRWKVGKPSDVWSCGCILYQMFYGKPPYGHYQGQNRLLAIMNP 885

Query: 744 EVKIVYPEKTSNGDTVPKTAIDTMKACLERNPNKRWTVEEVANGSFVKPVSVTHFFIRDL 803
           EV+I YPE T N + +P++AIDTMKACL R+P+KR+T+EE+ N  F  P+ VT FF++DL
Sbjct: 886 EVEIKYPEFTPNNEPIPRSAIDTMKACLYRDPSKRFTIEELLNNPFFSPIMVTPFFLQDL 945

Query: 804 IENSVRYGANQKEISSAKVEELAEDVWHRLEEFRL 838
           I+NSVRYG ++K IS+ ++E++++DV +RL EF L
Sbjct: 946 IKNSVRYGIDRKNISNEELEKMSDDVLNRLREFIL 980

 Score = 61.6 bits (148), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 34/110 (30%), Positives = 62/110 (56%), Gaps = 7/110 (6%)

Query: 224 ISNSSTRTASANLNEHNIFYEPQNSNQAIQSSHS----PFISSTINYEDVEFGDLNPYQY 279
           I N   R A+   N +       N++  I + ++    P IS   +Y  +EF  LNP QY
Sbjct: 277 IENIPLRIATTETNINTKLTNRNNNDATISNDYNHNSKPIIS---DYSSIEFNGLNPMQY 333

Query: 280 LKKYNLPTTELPNISRIYFERQKGQNRKAALRKSIASKDAIQNRIATTSS 329
            +K++LP +ELP +++ Y ++Q+ +NRKA L++   S+  + N++  ++S
Sbjct: 334 WRKHDLPPSELPKLNKAYLQKQREENRKAVLKQRSTSRMILSNKMTNSTS 383

 Score = 52.0 bits (123), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 56/170 (32%), Positives = 86/170 (50%), Gaps = 16/170 (9%)

Query: 35  DDSDDENML--GPPTLSNFGSALLSDKENVEPHRSTASSRHHPLNQMSRTHSQLPSRTET 92
           DDSDDE+ +  GPP LSNFGSALLS++E         +++ H  + M    S L  +T+ 
Sbjct: 30  DDSDDEDNIERGPPKLSNFGSALLSNQE-------EQNNKQHQQDVMESKDS-LQIKTDK 81

Query: 93  LAMSREFSTANTNSSYTGPHSTIHSVDHSDSTLFATFKDNQQSMTTFNPDDQLHQSGLDR 152
             + R  +  N  S+    H+  HS   + +       D  QS+TT   D+  +   L+ 
Sbjct: 82  HNIWRNNTNINNTSNTLFGHTDEHSQTSTSTMTSVRMHD-HQSVTTLYSDN--NGKDLNN 138

Query: 153 VSLEQS-RSKIKSLQQALRDDLSSRNSKRRTRRFASSRLSLLGPAKRASS 201
             ++ S +S  +SL+Q  R++L SR  +R  R   + +   LGPA R SS
Sbjct: 139 TLVKDSNKSTFRSLKQLSREELPSR--QRNRRLLQNLKAGNLGPASRTSS 186

>NCAS0C03560 Chr3 complement(710551..712476) [1926 bp, 641 aa] {ON}
           Anc_3.162
          Length = 641

 Score =  329 bits (843), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 150/329 (45%), Positives = 219/329 (66%), Gaps = 3/329 (0%)

Query: 510 VNGTEYEKLELLGRGGTSXXXXXXXXXXXXXXXLKRVSFDEFDDSSIDGFKGEIELLKKL 569
           +   E   +ELLG+GG+S               LK++  +E D++     + EIELLK+L
Sbjct: 316 ITDEELSIVELLGKGGSSKVYKVQDRTGKYYA-LKQILLEELDENLKTDLEREIELLKRL 374

Query: 570 ETQPRVVKLIDHEMDHGVLYVVMECGDHDLSQTLAHRSGMPLDVEFVRYHAQEMLKCVKV 629
             + RVVKLI++++D  ++ V+MECG+ DLS  L  R   P D+ FVR  ++EM++C+K 
Sbjct: 375 AREERVVKLIEYKIDDRMVQVLMECGNFDLSHVLHERVNRPFDINFVRLMSKEMIECIKA 434

Query: 630 VHDAGIVHSDLKPANFVFVKGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVA 689
           VHD+ IVHSDLKPANF+FVKG LK+IDFGIAN + ++T+N+YR TQ+GTPNYMAPE L++
Sbjct: 435 VHDSDIVHSDLKPANFIFVKGTLKLIDFGIANKIADNTLNVYRNTQMGTPNYMAPETLIS 494

Query: 690 MNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVY 749
            NY++N       WK+GKPSDIWS GCI+YQM YG PPY  F G +RLLAIMNP ++I Y
Sbjct: 495 QNYSNNNN--NLLWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAIMNPNIQIDY 552

Query: 750 PEKTSNGDTVPKTAIDTMKACLERNPNKRWTVEEVANGSFVKPVSVTHFFIRDLIENSVR 809
           P ++  G  VP++ +  +K CL R+P  R T +E+ + SF  P+ ++  F+  LI+N++ 
Sbjct: 553 PNESPCGKKVPQSLVALIKTCLNRDPQLRATTDEIQHCSFFNPMIISKPFLESLIDNAIN 612

Query: 810 YGANQKEISSAKVEELAEDVWHRLEEFRL 838
           YG   + I+  +++ L+ +V  +L    L
Sbjct: 613 YGIENQNITQDRIKLLSNEVVSKLSTLNL 641

 Score = 57.4 bits (137), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 46/205 (22%), Positives = 91/205 (44%), Gaps = 39/205 (19%)

Query: 104 TNSSYTGPHSTIHSVDHSDSTLFATFKDNQQSMTTFNPDDQLHQSGLDRVSLEQSRSKIK 163
           +NS        + S D + S++F    + Q    T  P   ++    D  +  +  + I 
Sbjct: 3   SNSPMLSIDKILESADSTCSSIFTQSNNCQIPSDTTIP---IYTKECDIYAKHERYNDIM 59

Query: 164 SLQQALRDDLSSRNSKRRTRRFAS-SRLSLLGPAKRAS-STSGTPNRSELIEESNISQPE 221
            +Q+ ++D ++ +  ++R  R+ + S+  +LGPA+R++ + + T  +S L +  NI++P+
Sbjct: 60  EMQREMKDQITFKTEQKRLYRWRTRSKSHVLGPARRSTQALNKTTAKSHLSDLENINEPK 119

Query: 222 GNISNSSTRTASANLNEHNIFYEPQNSNQAIQSSHSPFISSTINYEDVEFGDLNPYQYLK 281
                                                 +      ++ E G+LNP+QYLK
Sbjct: 120 ----------------------------------RESILGEETGLKETELGELNPFQYLK 145

Query: 282 KYNLPTTELPNISRIYFERQKGQNR 306
           K NLPT EL  ++++Y  R+  + R
Sbjct: 146 KNNLPTKELSRLTKLYCNRKLDETR 170

>Skud_4.764 Chr4 complement(1351725..1353995) [2271 bp, 756 aa] {ON}
           YDR490C (REAL)
          Length = 756

 Score =  107 bits (267), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 76/245 (31%), Positives = 114/245 (46%), Gaps = 37/245 (15%)

Query: 566 LKKLETQPRVVKLIDHEMDHGVLYVVMECGDHDLSQTLAHRSGMPLDVEFVRYHAQEMLK 625
           L+KL     +++L     D   LY ++E   H     L  + G  L+ +  RY+A +++ 
Sbjct: 177 LQKLNGTKGIIRLFFTFQDEASLYFLLEYASHGDFLGLIKKYG-SLNEKCARYYASQIID 235

Query: 626 CVKVVHDAGIVHSDLKPANFVFVKGI-LKIIDFGIANAVPEH---------TVNIYRETQ 675
            V  +H  GI+H D+KP N +  K + +K+ DFG A  +PE            ++Y  ++
Sbjct: 236 AVDSLHAIGIIHRDIKPENILLDKDMKVKLTDFGTAKILPEQPSNNADGKPCFDLYARSK 295

Query: 676 --IGTPNYMAPEALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQG 733
             +GT  Y++PE L       N +   SR       DIW+ GCI+YQM+ G+PP   F+ 
Sbjct: 296 SFVGTAEYVSPELL-------NDSYTDSR------CDIWAFGCILYQMVAGKPP---FKA 339

Query: 734 QNRLLAIMNPEVKIVYPEKTSNGDTVPKTAIDTMKACLERNPNKRWTVEEVANGSFVKPV 793
            N  L      +KI Y          P  A D +K  L R PN R TVE++    F   V
Sbjct: 340 ANEYLTFQKV-MKIQYAFTAG----FPLIAKDLVKKLLVREPNDRLTVEQIKAHVFFHGV 394

Query: 794 SVTHF 798
              HF
Sbjct: 395 ---HF 396

>YDR490C Chr4 complement(1431968..1434268) [2301 bp, 766 aa] {ON}
           PKH1Serine/threonine protein kinase involved in
           sphingolipid-mediated signaling pathway that controls
           endocytosis; activates Ypk1p and Ykr2p, components of
           signaling cascade required for maintenance of cell wall
           integrity; redundant with Pkh2p
          Length = 766

 Score =  107 bits (267), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 73/240 (30%), Positives = 115/240 (47%), Gaps = 34/240 (14%)

Query: 566 LKKLETQPRVVKLIDHEMDHGVLYVVMECGDHDLSQTLAHRSGMPLDVEFVRYHAQEMLK 625
           L+KL     + KL     D   LY ++E   H     L  + G  L+    RY+A +++ 
Sbjct: 177 LQKLNGTKGIFKLFFTFQDEASLYFLLEYAPHGDFLGLIKKYG-SLNETCARYYASQIID 235

Query: 626 CVKVVHDAGIVHSDLKPANFVFVKGI-LKIIDFGIANAVPEHTVN---------IYRETQ 675
            V  +H+ GI+H D+KP N +  K + +K+ DFG A  +PE   N         +Y +++
Sbjct: 236 AVDSLHNIGIIHRDIKPENILLDKNMKVKLTDFGTAKILPEEPSNTADGKPYFDLYAKSK 295

Query: 676 --IGTPNYMAPEALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQG 733
             +GT  Y++PE L+  NYT ++             DIW+ GCI+YQM+ G+PP   F+ 
Sbjct: 296 SFVGTAEYVSPE-LLNDNYTDSRC------------DIWAFGCILYQMLAGKPP---FKA 339

Query: 734 QNRLLAIMNPEVKIVYPEKTSNGDTVPKTAIDTMKACLERNPNKRWTVEEVANGSFVKPV 793
            N  L      +KI Y          P+   D +K  L R+PN R T++++    F   V
Sbjct: 340 ANEYLTFQKV-MKIQYAFTAG----FPQIVKDLVKKLLVRDPNDRLTIKQIKAHLFFHEV 394

>KNAG0B04320 Chr2 complement(821265..824348) [3084 bp, 1027 aa] {ON}
           Anc_5.406 YHR102W
          Length = 1027

 Score =  106 bits (264), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 77/315 (24%), Positives = 139/315 (44%), Gaps = 38/315 (12%)

Query: 493 PPASSDDINGRKRPVVYVNGTEYEKLELLGRGGTSXXXXXXXXXXXXXXXLKRVSFDEFD 552
           P    DDIN             + + E++G+G                  +K ++ D  D
Sbjct: 30  PKKKDDDINA-----------AFRRTEVIGKGKFGVVYKGYNLRTKHVYAIKVLNLDS-D 77

Query: 553 DSSIDGFKGEIELLKKLETQPRVVKLIDHEMDHGVLYVVME-CGDHDLSQTLAHRSGMPL 611
           +  ++  + EI+ L  L+  P V +     + +  L+++ME C    L   L  R G  +
Sbjct: 78  EDEVEDVQREIQFLASLKQLPNVTRYYGSYLKNTSLWIIMEYCAGGSLRSLL--RPGK-I 134

Query: 612 DVEFVRYHAQEMLKCVKVVHDAGIVHSDLKPANFVFV-KGILKIIDFGIANAVPEHTVNI 670
           D +++    +E+L  +K +H   I+H D+K AN +   +G +K+ DFG+A  + + T  +
Sbjct: 135 DEKYIGVIMRELLVALKFIHKDNIIHRDIKAANVLITNEGGVKLCDFGVAAQLNQRT--L 192

Query: 671 YRETQIGTPNYMAPEALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGG 730
            R+T  GTP +MAPE ++   Y   +             DIWS G   Y++  G PPY  
Sbjct: 193 RRQTMAGTPYWMAPEVIMEGVYYDTKV------------DIWSLGITAYEISTGNPPYCD 240

Query: 731 FQGQNRLLAIMNPEVKIVYPEKTSNGDTVPKTAIDTMKACLERNPNKRWTVEEVANGSFV 790
            +    +  I   +     P +    +  P    + +  CL+ +PN+R + +E+    F+
Sbjct: 241 VEALRAMQLITKSK-----PPRLEGRNYTPLIK-EFIALCLDEDPNERLSADELLKSKFI 294

Query: 791 KPVSVT-HFFIRDLI 804
           K    T    +++LI
Sbjct: 295 KAHKTTPTIVLKELI 309

>CAGL0L11550g Chr12 (1232015..1235233) [3219 bp, 1072 aa] {ON}
           similar to uniprot|P38692 Saccharomyces cerevisiae
           YHR102w NRK1 ser/thr protein kinase
          Length = 1072

 Score =  105 bits (262), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 71/293 (24%), Positives = 136/293 (46%), Gaps = 27/293 (9%)

Query: 515 YEKLELLGRGGTSXXXXXXXXXXXXXXXLKRVSFDEFDDSSIDGFKGEIELLKKLETQPR 574
           +++ E++GRG                  +K ++ D  +D  ++  + EI+ L  L+  P 
Sbjct: 16  FKRTEVIGRGKFGIVYKGYHVKTKQVYAIKVLNLDSSEDE-VEDVQREIQFLASLKQIPN 74

Query: 575 VVKLIDHEMDHGVLYVVME-CGDHDLSQTLAHRSGMPLDVEFVRYHAQEMLKCVKVVHDA 633
           + +     +    L+++ME C    L   L  R G  +D +++    +E+L  +KV+H  
Sbjct: 75  ITRYYGSYLRGTSLWIIMEYCAGGSLRSLL--RPG-KIDEKYIGVIMRELLVALKVIHKD 131

Query: 634 GIVHSDLKPANFVFV-KGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNY 692
            ++H D+K AN +   +G +K+ DFG+A  +  +  ++ R+T  GTP +MAPE ++   Y
Sbjct: 132 NVIHRDIKAANVLITNEGQVKLCDFGVAAQL--NQTSLRRQTMAGTPYWMAPEVIMEGVY 189

Query: 693 THNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEK 752
              +             DIWS G   Y++  G PPY   +    +  I+  +     P +
Sbjct: 190 YDTKV------------DIWSLGITAYEIATGNPPYCDVEALRAMQLIIKSK-----PPR 232

Query: 753 TSNGDTVPKTAIDTMKACLERNPNKRWTVEEVANGSFVKPVSVT-HFFIRDLI 804
               +  P+   + +  CL+ +P +R + EE+    F+K    T    +++LI
Sbjct: 233 LEERNYTPQLK-EFIALCLDEDPQERLSAEELLKTKFIKTHKATPTTILKELI 284

>CAGL0K05709g Chr11 complement(556732..560043) [3312 bp, 1103 aa]
           {ON} similar to uniprot|Q12263 Saccharomyces cerevisiae
           YDR507c GIN4
          Length = 1103

 Score =  105 bits (261), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 81/282 (28%), Positives = 129/282 (45%), Gaps = 40/282 (14%)

Query: 519 ELLGRGGTSXXXXXXXXXXXXXXXLKRVS---FDEFDDSSIDG---------FKGEIELL 566
           E LG G T                +K +S   F+  ++S  +G          + EI ++
Sbjct: 24  ETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESNGDATNALPYNIEQEI-II 82

Query: 567 KKLETQPRVVKLIDHEMDHGVLYVVMECGDH-DLSQTLAHRSGMPLDVEFVRYHAQEMLK 625
            KL   P V++L D    +  LY+V+E  +  +L   L  R  +P + E VR   Q ++ 
Sbjct: 83  MKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGPLP-ENEAVRAFRQ-III 140

Query: 626 CVKVVHDAGIVHSDLKPANFVFVKGI-LKIIDFGIANAVPEHTVNIYRETQIGTPNYMAP 684
            +   H  G+VH DLKP N +    + +KI DFG+A    E  +    ET  G+P+Y AP
Sbjct: 141 GISYCHSLGVVHRDLKPENLLLDNKLNIKIADFGMAALESEDKL---LETSCGSPHYAAP 197

Query: 685 EALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQG--QNRLLAIMN 742
           E +  + Y             G  SD+WSCG I++ ++ GR P+    G  +N LL +  
Sbjct: 198 EIISGLPYE------------GFSSDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQK 245

Query: 743 PEVKIVYPEKTSNGDTVPKTAIDTMKACLERNPNKRWTVEEV 784
            E ++       + D + K A D +   L  +P+KR T+ E+
Sbjct: 246 GEFEM------PDDDEITKEAQDLLARLLTVDPSKRITIREI 281

>Suva_2.666 Chr2 complement(1183839..1186133) [2295 bp, 764 aa] {ON}
           YDR490C (REAL)
          Length = 764

 Score =  104 bits (259), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 70/240 (29%), Positives = 112/240 (46%), Gaps = 34/240 (14%)

Query: 566 LKKLETQPRVVKLIDHEMDHGVLYVVMECGDHDLSQTLAHRSGMPLDVEFVRYHAQEMLK 625
           L+KL     +++L     D   LY ++E   H     L  + G  L+ +  RY+A +++ 
Sbjct: 176 LQKLNGTKGIIRLFFTFQDEASLYFLLEYAPHGDFLALIKKYG-SLNEQCARYYASQIID 234

Query: 626 CVKVVHDAGIVHSDLKPANFVFVKGI-LKIIDFGIANAVPEH-----------TVNIYRE 673
            V  +H  GI+H D+KP N +  K + +K+ DFG A  +PE             +N   +
Sbjct: 235 AVDSLHTIGIIHRDIKPENILLDKDMKVKLTDFGTAKILPEEPSNDADGKPCFDLNARSK 294

Query: 674 TQIGTPNYMAPEALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQG 733
           + +GT  Y++PE L       N +   SR       DIW+ GCI++QM+ G+PP   F+ 
Sbjct: 295 SFVGTAEYVSPELL-------NDSYTDSR------CDIWAFGCILFQMVAGKPP---FKA 338

Query: 734 QNRLLAIMNPEVKIVYPEKTSNGDTVPKTAIDTMKACLERNPNKRWTVEEVANGSFVKPV 793
            N  L      +KI Y          P+   D +K  L + PN R T+E++    F + V
Sbjct: 339 SNEYLTFQKV-MKIQYAFTAG----FPQIIKDLVKKLLVKEPNDRLTIEQIKAHIFFQTV 393

>Smik_4.767 Chr4 complement(1353354..1355630) [2277 bp, 758 aa] {ON}
           YDR490C (REAL)
          Length = 758

 Score =  104 bits (259), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 71/240 (29%), Positives = 112/240 (46%), Gaps = 34/240 (14%)

Query: 566 LKKLETQPRVVKLIDHEMDHGVLYVVMECGDHDLSQTLAHRSGMPLDVEFVRYHAQEMLK 625
           L+KL     +++L     D   LY ++E   H     L  + G  L+    RY+A +++ 
Sbjct: 177 LQKLNGTKGIIRLFFTFQDEASLYFLLEYAPHGDFLGLIKKYG-SLNEICARYYASQIID 235

Query: 626 CVKVVHDAGIVHSDLKPANFVFVKGI-LKIIDFGIANAVPEHTVN---------IYRETQ 675
            V  +H  GI+H D+KP N +  K + +K+ DFG A  +PE   N         +Y +++
Sbjct: 236 AVDSLHSIGIIHRDIKPENILLDKDMKVKLTDFGTAKILPEQPSNAADGKPCFDLYAKSK 295

Query: 676 --IGTPNYMAPEALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQG 733
             +GT  Y++PE L       N +   SR       DIW+ GCI+YQM+ G+PP   F+ 
Sbjct: 296 SFVGTAEYVSPELL-------NDSYTDSR------CDIWAFGCILYQMLAGKPP---FKA 339

Query: 734 QNRLLAIMNPEVKIVYPEKTSNGDTVPKTAIDTMKACLERNPNKRWTVEEVANGSFVKPV 793
            N  L      +KI Y          P+   D +K  L R+PN R  +E++    F   +
Sbjct: 340 ANEYLTFQKV-MKIQYAFTAG----FPQIVKDLVKKLLVRDPNDRLAIEQIKAHVFFDKI 394

>NCAS0H01940 Chr8 (374913..377960) [3048 bp, 1015 aa] {ON} Anc_5.406
          Length = 1015

 Score =  103 bits (258), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 75/309 (24%), Positives = 138/309 (44%), Gaps = 31/309 (10%)

Query: 515 YEKLELLGRGGTSXXXXXXXXXXXXXXXLKRVSFDEFDDSSIDGFKGEIELLKKLETQPR 574
           + + E++GRG                  +K ++ D  D+  ++  + E++ L  L+  P 
Sbjct: 37  FRRTEVIGRGKFGIVYKGYHVRTKQIYAIKVLNLDS-DEDEVEDVQREVQFLSSLKQIPN 95

Query: 575 VVKLIDHEMDHGVLYVVME-CGDHDLSQTLAHRSGMPLDVEFVRYHAQEMLKCVKVVHDA 633
           + +     +    L+++ME C    L   L  R G  +D +++    +E+L  +K +H  
Sbjct: 96  ITRYYGSYLKDTSLWIIMEYCAGGSLRSLL--RPGK-IDEKYIGVIMRELLVALKYIHKD 152

Query: 634 GIVHSDLKPANFVFV-KGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNY 692
            ++H D+K AN +   +G +K+ DFG+A  + + T  + R+T  GTP +MAPE ++   Y
Sbjct: 153 NVIHRDIKAANVLITNEGSVKLCDFGVAAQLNQST--LRRQTMAGTPYWMAPEVIMEGVY 210

Query: 693 THNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEK 752
              +             DIWS G   Y++  G PPY   +    +  I   +     P +
Sbjct: 211 YDTKV------------DIWSLGITAYEIATGNPPYCEVEALRAMQLITKSK-----PPR 253

Query: 753 TSNGDTVPKTAIDTMKACLERNPNKRWTVEEVANGSFVK-----PVSVTHFFIRDLIENS 807
             +    P    + +  CL+ +P +R + EE++   F+K     PVS+    I   +   
Sbjct: 254 LESRSYTPLLK-EFIALCLDEDPKERLSAEELSKTKFIKAHKLTPVSILKELISRYLLFR 312

Query: 808 VRYGANQKE 816
            R  A+ KE
Sbjct: 313 DRNKASSKE 321

>Kpol_1031.10 s1031 (25064..28447) [3384 bp, 1127 aa] {ON}
           (25064..28447) [3384 nt, 1128 aa]
          Length = 1127

 Score =  103 bits (258), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 67/278 (24%), Positives = 127/278 (45%), Gaps = 26/278 (9%)

Query: 516 EKLELLGRGGTSXXXXXXXXXXXXXXXLKRVSFDEFDDSSIDGFKGEIELLKKLETQPRV 575
           ++ E++GRG                  +K ++ D  D   ++  + EI+ L  L+  P +
Sbjct: 45  KRTEVIGRGKFGVVYKGYHLKTKHVYAIKVLNLDS-DSDEVEDVQREIQFLASLKQVPNI 103

Query: 576 VKLIDHEMDHGVLYVVME-CGDHDLSQTLAHRSGMPLDVEFVRYHAQEMLKCVKVVHDAG 634
            +     +    L+++ME C    L   L  R GM +D +++    +E+L  ++ +H   
Sbjct: 104 TRYYGSYLQDTNLWIIMEYCAGGSLRTLL--RPGM-IDEKYIGVIMRELLTALQCIHKDN 160

Query: 635 IVHSDLKPANFVFV-KGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNYT 693
           ++H D+K AN +   +G +K+ DFG+A  +  +  ++ R+T  GTP +MAPE ++   Y 
Sbjct: 161 VIHRDIKAANVLITNEGKVKLCDFGVAAQL--NQTSLRRQTMAGTPYWMAPEVIMEGVYY 218

Query: 694 HNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEKT 753
             +             DIWS G   Y++  G PPY   +    +  I   +   +   + 
Sbjct: 219 DTKV------------DIWSLGITAYEIATGNPPYCEIEALRAMQLITKSKPARLEGRQY 266

Query: 754 SNGDTVPKTAIDTMKACLERNPNKRWTVEEVANGSFVK 791
           S+G        + +  CL+ +P +R + EE+    F+K
Sbjct: 267 SSG------LKEFIALCLDEDPKERLSAEELQKSKFIK 298

>Kwal_55.21545 s55 complement(882294..884891) [2598 bp, 865 aa] {ON}
           YHR102W (KIC1) - PAK/Ste20 kinase family [contig 128]
           FULL
          Length = 865

 Score =  103 bits (256), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 82/341 (24%), Positives = 149/341 (43%), Gaps = 38/341 (11%)

Query: 501 NGRKRPVVYVNGTEYEKLELLGRGGTSXXXXXXXXXXXXXXXLKRVSFDEFDDSSIDGFK 560
           NG  R  V    T +++ E++GRG                  +K ++ D  DD  ++  +
Sbjct: 8   NGSSRSSV---STLFKRTEVIGRGKFGVVYKGYYTKTKQVCAIKVLNLDSADDE-VEDVQ 63

Query: 561 GEIELLKKLETQPRVVKLIDHEMDHGVLYVVME-CGDHDLSQTLAHRSGMPLDVEFVRYH 619
            EI+ L  L+  P +       ++   L+V+ME C    L   L  R G  +  +++   
Sbjct: 64  KEIQFLSSLKQVPNITHYYGSYLNDTKLWVIMEYCAGGSLRTLL--RPGK-IGEQYIGVI 120

Query: 620 AQEMLKCVKVVHDAGIVHSDLKPANFVFVK-GILKIIDFGIANAVPEHTVNIYRETQIGT 678
            +E+L  +  +H  G++H D+K AN +    G +K+ DFG+A  + +    I R+T  GT
Sbjct: 121 MRELLTALMHIHKDGVIHRDIKAANVLITNDGHIKLCDFGVAAQLSQ--TKIRRQTMAGT 178

Query: 679 PNYMAPEALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLL 738
           P +MAPE ++   Y   +             DIWS G   Y++  G PPY   +    + 
Sbjct: 179 PYWMAPEVIMEGVYYDTKV------------DIWSLGITAYEIATGNPPYCEVEALRAMQ 226

Query: 739 AIMNPEVKIVYPEKTSNGDTVPKTAIDTMKACLERNPNKRWTVEEVANGSFVK-----PV 793
            I   +   +   + S+         + +  CL+ +P +R + E++    F+K     PV
Sbjct: 227 LITKSKPPRLEGRQHSSA------LKEIIALCLDEDPKERPSAEDLLKTKFIKLHKNVPV 280

Query: 794 SVTHFFIRDLIENSVRYGANQKEISSAKVEELAEDVWHRLE 834
           S+    +++LI   + +   + +  S     L +D  HR +
Sbjct: 281 SI----LKELISRYLLHRDKRSQRESVSSSALEDDEPHRTD 317

>NDAI0C01700 Chr3 complement(367077..370139) [3063 bp, 1020 aa] {ON}
           Anc_5.406
          Length = 1020

 Score =  102 bits (254), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 72/293 (24%), Positives = 130/293 (44%), Gaps = 31/293 (10%)

Query: 515 YEKLELLGRGGTSXXXXXXXXXXXXXXXLKRVSFDEFDDSSIDGFKGEIELLKKLETQPR 574
           + + E++GRG                  +K ++ D  D+  ++  + EI+ L  L+  P 
Sbjct: 42  FRRTEVIGRGKFGIVYKGYHVKTKQIYAIKVLNLDS-DEDEVEDVQREIQFLASLKQLPN 100

Query: 575 VVKLIDHEMDHGVLYVVME-CGDHDLSQTLAHRSGMPLDVEFVRYHAQEMLKCVKVVHDA 633
           + +     +    L+++ME C    L   L  R G  +D +++    +E+L  +K +H  
Sbjct: 101 ITRYYGSYLKDTSLWIIMEYCAGGSLRTLL--RPGK-IDEKYIGVITREILIALKYIHKD 157

Query: 634 GIVHSDLKPANFVFV-KGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNY 692
            I+H D+K AN +   +G +K+ DFG+A  + + T    R+T  GTP +MAPE ++   Y
Sbjct: 158 NIIHRDIKAANVLITNEGSIKLCDFGVAAQLNQSTKR--RQTMAGTPYWMAPEVIMEGVY 215

Query: 693 THNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEK 752
              +             DIWS G   Y++  G PPY   +    +  I   +     P +
Sbjct: 216 YDTKV------------DIWSLGITTYEIATGNPPYCEIEALRAMQLITKSK-----PPR 258

Query: 753 TSNGDTVPKTAIDTMKACLERNPNKRWTVEEVANGSFVK-----PVSVTHFFI 800
               +  P    + +  CL+ +P +R + E++    F+K     PVS+    I
Sbjct: 259 LEGRNYSPLLK-EFVALCLDEDPKERMSAEDLLKTKFIKAHKLTPVSILKELI 310

>Skud_8.163 Chr8 (290415..293645) [3231 bp, 1076 aa] {ON} YHR102W
           (REAL)
          Length = 1076

 Score =  102 bits (253), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 72/308 (23%), Positives = 137/308 (44%), Gaps = 37/308 (12%)

Query: 515 YEKLELLGRGGTSXXXXXXXXXXXXXXXLKRVSFDEFDDSSIDGFKGEIELLKKLETQPR 574
           +++ E++GRG                  +K ++ D  D   ++  + EI+ L  L+  P 
Sbjct: 23  FKRTEVVGRGKFGVVYKGYNVKTRRVYAIKVLNLDS-DSDEVEDVQREIQFLASLKQMPN 81

Query: 575 VVKLIDHEMDHGVLYVVME-CGDHDLSQTLAHRSGMPLDVEFVRYHAQEMLKCVKVVHDA 633
           + +     +    L+++ME C    L   L  R G  +D +++    +E+L  +K +H  
Sbjct: 82  ITRYYGSYLKDTSLWILMEYCAGGSLRSLL--RPGK-IDEKYIGVIMRELLVALKCIHKD 138

Query: 634 GIVHSDLKPANFVFV-KGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNY 692
            ++H D+K AN +   +G +K+ DFG+A  V  +  ++ R+T  GTP +MAPE ++   Y
Sbjct: 139 NVIHRDIKAANVLITNEGSVKLCDFGVAAQV--NQTSLRRQTMAGTPYWMAPEVIMEGVY 196

Query: 693 THNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEK 752
              +             DIWS G   Y++  G PPY   +    +  I+  +     P +
Sbjct: 197 YDTKV------------DIWSLGITTYEIATGNPPYCDVEALRAMQLIIKSK-----PPR 239

Query: 753 TSNGDTVPKTAIDTMKACLERNPNKRWTVEEVANGSFVK-----PVSVT------HFFIR 801
              G +   +  + +  CL+ +P +R + +++    F+K     P S+       +   R
Sbjct: 240 LE-GRSYSSSLKEFIALCLDEDPKERLSADDLLRSKFIKTHRATPTSILKELISRYLLFR 298

Query: 802 DLIENSVR 809
           D  +N  R
Sbjct: 299 DKNKNKYR 306

>YOL100W Chr15 (129237..132482) [3246 bp, 1081 aa] {ON}
           PKH2Serine/threonine protein kinase involved in
           sphingolipid-mediated signaling pathway that controls
           endocytosis; activates Ypk1p and Ykr2p, components of
           signaling cascade required for maintenance of cell wall
           integrity; redundant with Pkh1p
          Length = 1081

 Score =  101 bits (251), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 71/237 (29%), Positives = 114/237 (48%), Gaps = 34/237 (14%)

Query: 566 LKKLETQPRVVKLIDHEMDHGVLYVVMECGDHDLSQTLAHRSGMPLDVEFVRYHAQEMLK 625
           L+KL   P VV+L     D   LY ++E   +    +L  + G  LD    RY+A +++ 
Sbjct: 231 LQKLNNSPSVVRLFSTFQDESSLYFLLEYAPNGDFLSLMKKYG-SLDETCARYYAAQIID 289

Query: 626 CVKVVHDAGIVHSDLKPANFVFVKGILKI--IDFGIA-------NAV--PEHTVNIYRET 674
            +  +H  GI+H D+KP N + + G +KI   DFG A       N+V  PE+ ++   ++
Sbjct: 290 AIDYLHSNGIIHRDIKPEN-ILLDGEMKIKLTDFGTAKLLNPTNNSVSKPEYDLSTRSKS 348

Query: 675 QIGTPNYMAPEALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQ 734
            +GT  Y++PE L       N +    R       DIW+ GCI++QMI G+PP   F+  
Sbjct: 349 FVGTAEYVSPELL-------NDSFTDYRC------DIWAFGCILFQMIAGKPP---FKAT 392

Query: 735 NRLLAIMNPEVKIVYPEKTSNGDTVPKTAIDTMKACLERNPNKRWTVEEVANGSFVK 791
           N  L      +K+ Y    +     P    D +K  L +N ++R T+ ++    F K
Sbjct: 393 NEYLTFQKV-MKVQY----AFTPGFPLIIRDLVKKILVKNLDRRLTISQIKEHHFFK 444

>TDEL0E02180 Chr5 complement(408232..411195) [2964 bp, 987 aa] {ON}
           Anc_5.406 YHR102W
          Length = 987

 Score =  100 bits (250), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 76/327 (23%), Positives = 143/327 (43%), Gaps = 30/327 (9%)

Query: 512 GTEYEKLELLGRGGTSXXXXXXXXXXXXXXXLKRVSFDEFDDSSIDGFKGEIELLKKLET 571
           G+ +++ E++GRG                  +K ++ D  D+  ++  + E++ L  ++ 
Sbjct: 23  GSIFKRTEIIGRGKFGVVYKGYHSRTKQVFAIKVLNLDS-DEDEVEDVQREVQFLASMKQ 81

Query: 572 QPRVVKLIDHEMDHGVLYVVME-CGDHDLSQTLAHRSGMPLDVEFVRYHAQEMLKCVKVV 630
            P + +     +    L++++E C    L   L  R G  +D +++    +E+L  +K +
Sbjct: 82  VPNITQYYGSYLKDTTLWIIIEYCAGGSLRTLL--RPGK-IDEKYIGVIMRELLIALKFI 138

Query: 631 HDAGIVHSDLKPANFVFVK-GILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVA 689
           H   ++H DLK AN +    G +K+ DFG+A  + +   N  R T  GTP +MAPE ++ 
Sbjct: 139 HRDNVIHRDLKAANVLITNDGQVKLCDFGVAAQLNQS--NSRRHTMAGTPYWMAPEVIME 196

Query: 690 MNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVY 749
             Y   +             DIWS G   Y+   G PPY   +    +  I   +     
Sbjct: 197 GVYYDTKV------------DIWSLGITTYEAATGNPPYCEVEALRAMQLITKSK----- 239

Query: 750 PEKTSNGDTVPKTAIDTMKACLERNPNKRWTVEEVANGSFVKPVSVT-HFFIRDLIENSV 808
           P +   G +      + +  CL+ +P +R + EE+    F+K    T    ++ LI   +
Sbjct: 240 PPRLE-GRSYSPLLKEFIALCLDEDPKERLSAEELLKTKFIKAHKATPTTLLKQLISRYL 298

Query: 809 RYGANQKEISSAKVEELAEDVWHRLEE 835
            +  N K   SA+      D + +++E
Sbjct: 299 LFRDNNK---SARESIFLPDDYQKVDE 322

>NDAI0E02110 Chr5 complement(430989..433700) [2712 bp, 903 aa] {ON} 
          Length = 903

 Score =  100 bits (250), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 80/297 (26%), Positives = 138/297 (46%), Gaps = 17/297 (5%)

Query: 519 ELLGRGGTSXXXXXXXXXXXXXXXLKRVSFDEFDDSSIDGFKGEIELLKKLETQPRVVKL 578
           E++G+G  +               +K +S  +   S++DG   E+E+L++L+  PR+V+L
Sbjct: 206 EVVGQGAFATVKKAVERSTGKTFAVKIISKRKVMGSNMDGVSRELEVLQRLD-HPRIVRL 264

Query: 579 IDHEMDHGVLYVVME-CGDHDLSQTLAHRSGMPLDVEFVRYHAQEMLKCVKVVHDAGIVH 637
                DH   Y++ME     DL   +A    +  D    R  ++++L+ +K +H  GI H
Sbjct: 265 KGFYEDHENYYMLMEFVSGGDLMDFVAAHGAVGEDAG--REISRQILEAIKYIHSMGISH 322

Query: 638 SDLKPANFVFVKG---ILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMN--- 691
            DLKP N +  +    ++KI DFG+A      T   + +T  GT  Y+APE +   N   
Sbjct: 323 RDLKPDNILIEQDDPVLVKITDFGLAKVQDNGT---FMKTFCGTLAYVAPEIISGKNDGE 379

Query: 692 YTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPE 751
              N      R +     D+WS GC++Y ++ G  P+ G   Q +L   ++   +  Y E
Sbjct: 380 LRENADANSERNEYSSLVDMWSMGCLVYVILTGHLPFSG-STQKQLYKQIS---RGSYHE 435

Query: 752 KTSNGDTVPKTAIDTMKACLERNPNKRWTVEEVANGSFVKPVSVTHFFIRDLIENSV 808
                  +   A D + + L+  PN R T E+     ++K    +  F+++   NSV
Sbjct: 436 GPLKDFRISDEARDFIDSLLQVKPNDRLTAEKALEHPWIKMAQFSQSFVKNNSVNSV 492

>KNAG0F00290 Chr6 (31750..35127) [3378 bp, 1125 aa] {ON} Anc_1.52
           YDR507C
          Length = 1125

 Score =  100 bits (250), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 82/281 (29%), Positives = 124/281 (44%), Gaps = 37/281 (13%)

Query: 519 ELLGRGGTSXXXXXXXXXXXXXXXLKRVSFDEFDDSSID-------------GFKGEIEL 565
           E LG G T                +K +S   F DS++              G + EI +
Sbjct: 22  ETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNVTSMVDNTTPDALPYGIEREIVI 81

Query: 566 LKKLETQPRVVKLIDHEMDHGVLYVVMECGDH-DLSQTLAHRSGMPLDVEFVRYHAQEML 624
           +K L     V++L D    +  LY+V+E  +  +L   L  R  +P + E +R+  Q ++
Sbjct: 82  MKLL-NHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERGPLP-ENEAIRFFRQ-II 138

Query: 625 KCVKVVHDAGIVHSDLKPANFVF-VKGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMA 683
             +   H  GIVH DLKP N +   K  +KI DFG+A    E  +    ET  G+P+Y A
Sbjct: 139 IGISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMAALETEDKL---LETSCGSPHYAA 195

Query: 684 PEALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNP 743
           PE +  + Y H           G  SD+WSCG I+Y ++ GR P+    G  R L +   
Sbjct: 196 PEIVSGIPY-H-----------GFASDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQ 243

Query: 744 EVKIVYPEKTSNGDTVPKTAIDTMKACLERNPNKRWTVEEV 784
             +   PE     D + K A + +   L  NP +R T  ++
Sbjct: 244 AGQFEMPE----DDEISKEAQNLISKILVVNPAERITARDI 280

>KAFR0D04950 Chr4 (971956..974982) [3027 bp, 1008 aa] {ON} Anc_5.406
           YHR102W
          Length = 1008

 Score =  100 bits (248), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 77/318 (24%), Positives = 142/318 (44%), Gaps = 35/318 (11%)

Query: 514 EYEKLELLGRGGTSXXXXXXXXXXXXXXXLKRVSFDEFDDSSIDGFKGEIELLKKLETQP 573
           ++ +  ++GRG                  +K ++ D  D+  ++  + EI+ L  L+  P
Sbjct: 34  KFRRTNVIGRGKFGVVYKGYHLNTKHVYAIKVLNLDS-DEDEVEDVQKEIQFLASLKQLP 92

Query: 574 RVVKLIDHEMDHGVLYVVME-CGDHDLSQTLAHRSGMPLDVEFVRYHAQEMLKCVKVVHD 632
            + +     + +  L+++ME CG   L   L  R G  +D +++    +E+L  +K +H 
Sbjct: 93  NITRYYGSYLKNTSLWIIMEYCGGGSLRSLL--RPG-KIDEKYIGVIMREILIALKYIHK 149

Query: 633 AGIVHSDLKPANFVFVK-GILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMN 691
             ++H D+K AN +    G +K+ DFG+A  +  +     R+T  GTP +MAPE ++   
Sbjct: 150 DNVIHRDIKAANVLINNDGSIKLCDFGVAAQL--NQTKSRRQTMAGTPYWMAPEVIMEGV 207

Query: 692 YTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPE 751
           Y   +A            DIWS G   Y++  G PPY   +    +  I   +     P 
Sbjct: 208 YYDTKA------------DIWSTGITAYEVTTGNPPYCDVEALRAMQLIAKSK-----PP 250

Query: 752 KTSNGDTVPKTAIDTMKACLERNPNKRWTVEEVANGSFVK-----PVSVTHFFIRDLIEN 806
           +   G        + +  CL+ +P++R T +E+   +F+K     P S+    +++LI  
Sbjct: 251 RLE-GRNYSALIKEFIATCLDEDPSERPTADELLKTAFIKTYKPLPTSI----LKELISR 305

Query: 807 SVRYGANQKEISSAKVEE 824
            + +    K  S A V E
Sbjct: 306 YLLFRDKTKRESVAVVAE 323

>KLLA0F24618g Chr6 complement(2288943..2290613) [1671 bp, 556 aa]
           {ON} similar to uniprot|P38070 Saccharomyces cerevisiae
           YBR028C Hypothetical ORF
          Length = 556

 Score = 99.0 bits (245), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 86/293 (29%), Positives = 128/293 (43%), Gaps = 45/293 (15%)

Query: 565 LLKKLETQPRVVKLIDHEMDHGVLYVVME-CGDHDLSQTLAHRSGMPLDVEFVRYHAQEM 623
           +L +LE  P +VKL     D+  LY+V++     +L   L  +    LD   V ++A E+
Sbjct: 234 ILSQLE-HPNIVKLFYSFHDNHKLYLVLQYIPGGELFYHLKEQG--TLDEGTVAFYAAEL 290

Query: 624 LKCVKVVHDAGIVHSDLKPANFVF-VKGILKIIDFGIAN-------AVPEHTVNIYR-ET 674
              +K +H  GIV+ DLKP N +   +G L + DFG++        A PE   N+ +  +
Sbjct: 291 SCALKFLHSKGIVYRDLKPENCLLNERGHLVLTDFGLSKKSVFDDAATPEEGENVNQLYS 350

Query: 675 QIGTPNYMAPEALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQ 734
            IGTP Y APE L    YT N              D +S GC++Y M+ G+PP+ G   +
Sbjct: 351 IIGTPEYCAPEILAGEPYTQN-------------CDWYSLGCLVYDMLIGKPPFTGVNHK 397

Query: 735 NRLLAIMNPEVKIVYPEKTSNGDTVPKTAIDTMKACLERNPNKRWTVEEV---------- 784
             L  I   +     P   S+G        D + A L ++P KRW V++           
Sbjct: 398 IILNKIKQEKTGARIPSYLSDGFK------DYLGALLRKDPTKRWDVDKYWAQDGPKTKK 451

Query: 785 -ANGSFVKPVSVTHFFIRDLIENSVRYGANQKEISSAKVEELAEDVWHRLEEF 836
              G       + HF  R +I   +  G  QK IS   +  +  D W   E F
Sbjct: 452 KKAGQAKTTNYIGHFIFRKIIWKQLLSGDLQK-ISVGPILPIITD-WELAENF 502

>CAGL0K02673g Chr11 complement(241338..244085) [2748 bp, 915 aa]
           {ON} similar to uniprot|Q03497 Saccharomyces cerevisiae
           YHL007c STE20 Serine/threonine-protein kinase
          Length = 915

 Score = 99.4 bits (246), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 69/223 (30%), Positives = 109/223 (48%), Gaps = 27/223 (12%)

Query: 575 VVKLIDHEMDHGVLYVVMECGDH-DLSQTLAHRSGMPLDVEFVRYHAQEMLKCVKVVHDA 633
           +V  ID  +  G L++VME  +   L+  + H     L    +    +E LK ++ +H  
Sbjct: 677 IVNFIDSYLAKGDLWIVMEYMEGGSLTDVVTH---CLLSEGQIGAVCRETLKGLQFLHSK 733

Query: 634 GIVHSDLKPANFVF-VKGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNY 692
           G++H D+K  N +  +KG +K+ DFG    + E+  N+ R T +GTP +MAPE +     
Sbjct: 734 GVLHRDIKSDNILLSLKGNIKLTDFGFCAQINEN--NLKRTTMVGTPYWMAPEVV----- 786

Query: 693 THNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRL-LAIMNPEVKIVYPE 751
                   SR + G   DIWS G +I +MI G PPY        L L   N   K+  PE
Sbjct: 787 --------SRKEYGPKVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIATNGTPKLKEPE 838

Query: 752 KTSNGDTVPKTAIDTMKACLERNPNKRWTVEEVANGSFVKPVS 794
             S  DT+ K     +  CL+ +P++R T  E+ +  F+  ++
Sbjct: 839 ALS--DTLTK----FLDWCLKVDPSERATATELLDDPFITEIA 875

>TPHA0G03200 Chr7 (683296..687900) [4605 bp, 1534 aa] {ON} Anc_2.479
           YKL101W
          Length = 1534

 Score = 99.8 bits (247), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 72/236 (30%), Positives = 117/236 (49%), Gaps = 29/236 (12%)

Query: 552 DDSSIDGFKGEIELLKKLETQPRVVKLIDHEMDHGVLYVVMECGDH-DLSQTLAHRSGMP 610
           D+S+  G + EI ++K L + P V+ L +   +   LY+V+E  D  +L   L  + G  
Sbjct: 200 DNSNRYGIEREIVIMK-LVSHPNVMALYEVWENKNELYLVLEYVDGGELFDYLVSK-GKL 257

Query: 611 LDVEFVRYHAQEMLKCVKVVHDAGIVHSDLKPANFVFVKG--ILKIIDFGIANAVPEHTV 668
            ++E VRY  Q +++ V+  H   I H DLKP N +  K   ++KI DFG+A        
Sbjct: 258 TELEAVRYFKQ-IIRGVQYCHSFNICHRDLKPENLLLDKKRKLIKIADFGMA---ALQVS 313

Query: 669 NIYRETQIGTPNYMAPEALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPY 728
           N   +T  G+P+Y +PE  + M  T+N          G PSD+WSCG I++ ++ G  P+
Sbjct: 314 NTLLKTSCGSPHYASPE--IVMGKTYN----------GGPSDVWSCGIILFALLTGHLPF 361

Query: 729 GGFQGQNRLLAIMNPEVKIVYPEKTSNGDTVPKTAIDTMKACLERNPNKRWTVEEV 784
                +  L+ + N   ++  P      + + K A D +   L  NP  R T E++
Sbjct: 362 NDDSIKKLLIKVQNGRYQM--P------NYLSKDAKDLISRILLVNPKARLTTEQI 409

>KLTH0F16676g Chr6 complement(1351362..1353998) [2637 bp, 878 aa]
           {ON} weakly similar to uniprot|P38692 Saccharomyces
           cerevisiae YHR102W KIC1 Protein kinase of the PAK/Ste20
           kinase family required for cell integrity possibly
           through regulating 1 6-beta-glucan levels in the wall
           physically interacts with Cdc31p (centrin) which is a
           component of the spindle pole body
          Length = 878

 Score = 99.0 bits (245), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 75/317 (23%), Positives = 146/317 (46%), Gaps = 29/317 (9%)

Query: 513 TEYEKLELLGRGGTSXXXXXXXXXXXXXXXLKRVSFDEFDDSSIDGFKGEIELLKKLETQ 572
           T +++ E++GRG                  +K ++ D  DD  ++  + E++ L  L+  
Sbjct: 17  TLFKRTEVIGRGKFGIVYKGYYIKTNRVCAIKVLNLDSADDE-VEDVQKEVQFLSSLKQV 75

Query: 573 PRVVKLIDHEMDHGVLYVVME-CGDHDLSQTLAHRSGMPLDVEFVRYHAQEMLKCVKVVH 631
           P +       +++  L+V+ME C    L   L  R G  +  +++    +E+L  +  +H
Sbjct: 76  PNITHYYGSYLNNTELWVIMEYCAGGSLRTLL--RPGK-IGEQYIGVIMRELLIALMHIH 132

Query: 632 DAGIVHSDLKPANFVFVK-GILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAM 690
             G++H D+K AN +    G +K+ DFG+A  + +    I R+T  GTP +MAPE ++  
Sbjct: 133 KDGVIHRDIKAANVLITNDGHIKLCDFGVAAQLSQ--TKIRRQTMAGTPYWMAPEVIMEG 190

Query: 691 NYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYP 750
            Y   +             DIWS G   Y++  G PPY   +    +  I   +   +  
Sbjct: 191 VYYDTKV------------DIWSLGITAYEIATGNPPYCDVEALRAMQLITKSKPPRLEG 238

Query: 751 EKTSNGDTVPKTAIDTMKACLERNPNKRWTVEEVANGSFVKP-VSVTHFFIRDLIENSV- 808
            + S+         + +  CL+ +P +R + EE+    F++   +V+   +++LI   + 
Sbjct: 239 RQHSSA------LKEFIALCLDEDPKERPSAEELLKTKFIRLHKNVSASILKELISRYLL 292

Query: 809 -RYGANQKEISSAKVEE 824
            R   +++E S++ +EE
Sbjct: 293 HRDKHSRRESSTSGLEE 309

>TPHA0H01630 Chr8 (371333..374443) [3111 bp, 1036 aa] {ON} Anc_5.406
           YHR102W
          Length = 1036

 Score = 98.6 bits (244), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 64/279 (22%), Positives = 127/279 (45%), Gaps = 26/279 (9%)

Query: 515 YEKLELLGRGGTSXXXXXXXXXXXXXXXLKRVSFDEFDDSSIDGFKGEIELLKKLETQPR 574
           + + E++GRG                  +K ++ D   D  ++  + E++ L  L+  P 
Sbjct: 46  FRRTEVIGRGKFGVVYKGYHVKTQQVYAIKVLNLDSESDE-VEDVQREVQFLSSLKQFPN 104

Query: 575 VVKLIDHEMDHGVLYVVME-CGDHDLSQTLAHRSGMPLDVEFVRYHAQEMLKCVKVVHDA 633
           +++     +    L+++M+ C    +   L  R G  +D +++    +E+L  ++ +H  
Sbjct: 105 IIRYFGSYLKDTNLWIIMDYCAGGSIRTLL--RPG-KIDEKYIGIIMREILIALQYIHKD 161

Query: 634 GIVHSDLKPANFVFV-KGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNY 692
            ++H D+K AN +   +G +K+ DFG+A  + +    + R+T  GTP +MAPE ++   Y
Sbjct: 162 NVIHRDIKAANVLVTNEGKVKLCDFGVAAQLNQ--TKLRRQTMAGTPYWMAPEVIMEGAY 219

Query: 693 THNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEK 752
              +A            DIWS G   Y++  G PPY   +    +  I   +     P +
Sbjct: 220 YDTKA------------DIWSLGITAYEIATGNPPYCEIEALRAMQLITKSK-----PAR 262

Query: 753 TSNGDTVPKTAIDTMKACLERNPNKRWTVEEVANGSFVK 791
              G +   +  + +  CL+ +P +R + EE+    F+K
Sbjct: 263 LE-GRSYSTSLKEFIALCLDEDPKERLSAEELQKTKFIK 300

>YDR507C Chr4 complement(1462358..1465786) [3429 bp, 1142 aa] {ON}
           GIN4Protein kinase involved in bud growth and assembly
           of the septin ring, proposed to have kinase-dependent
           and kinase-independent activities; undergoes
           autophosphorylation; similar to Kcc4p and Hsl1p
          Length = 1142

 Score = 98.6 bits (244), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 84/303 (27%), Positives = 132/303 (43%), Gaps = 40/303 (13%)

Query: 500 INGRKRPVVYVNGTEYEKL-ELLGRGGTSXXXXXXXXXXXXXXXLKRVSFDEFDDSSIDG 558
           ING   P +  N     KL E LG G T                +K +S   F+  ++ G
Sbjct: 3   INGNSIPAIKDNTIGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSG 62

Query: 559 ---------------FKGEIELLKKLETQPRVVKLIDHEMDHGVLYVVMECGDH-DLSQT 602
                           + EI ++ KL   P V++L D    +  LY+V+E  +  +L   
Sbjct: 63  TSIVGSTTPDALPYGIEREI-IIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNL 121

Query: 603 LAHRSGMPLDVEFVRYHAQEMLKCVKVVHDAGIVHSDLKPANFVFV-KGILKIIDFGIAN 661
           L  R  +P + E +R+  Q ++  V   H  GIVH DLKP N +   K  +KI DFG+A 
Sbjct: 122 LVERGPLP-EHEAIRFFRQ-IIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAA 179

Query: 662 AVPEHTVNIYRETQIGTPNYMAPEALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQM 721
              E  +    ET  G+P+Y APE +  + Y             G  SD+WSCG I++ +
Sbjct: 180 LETEGKL---LETSCGSPHYAAPEIVSGIPYQ------------GFASDVWSCGVILFAL 224

Query: 722 IYGRPPYGGFQGQNRLLAIMNPEVKIVYPEKTSNGDTVPKTAIDTMKACLERNPNKRWTV 781
           + GR P+    G  R L +   + +   P    + D + + A D ++  L  +P +R   
Sbjct: 225 LTGRLPFDEEDGNIRTLLLKVQKGEFEMP----SDDEISREAQDLIRKILTVDPERRIKT 280

Query: 782 EEV 784
            ++
Sbjct: 281 RDI 283

>Smik_4.789 Chr4 complement(1385209..1388619) [3411 bp, 1136 aa]
           {ON} YDR507C (REAL)
          Length = 1136

 Score = 98.6 bits (244), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 83/303 (27%), Positives = 131/303 (43%), Gaps = 40/303 (13%)

Query: 500 INGRKRPVVYVNGTEYEKL-ELLGRGGTSXXXXXXXXXXXXXXXLKRVSFDEFDDSSIDG 558
           +NG   P +  N     KL E LG G T                +K +S   F+  ++ G
Sbjct: 3   VNGNSVPAIKDNTIGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKTVFNTGNVSG 62

Query: 559 ---------------FKGEIELLKKLETQPRVVKLIDHEMDHGVLYVVMECGDH-DLSQT 602
                           + EI ++ KL   P V++L D    +  LY+V+E  +  +L   
Sbjct: 63  TSIVGSTTPDALPYGIEREI-IIMKLLNHPNVLRLYDVWETNADLYLVLEYAEKGELFNL 121

Query: 603 LAHRSGMPLDVEFVRYHAQEMLKCVKVVHDAGIVHSDLKPANFVFV-KGILKIIDFGIAN 661
           L  R  +P + E +R+  Q ++  V   H  GIVH DLKP N +   K  +KI DFG+A 
Sbjct: 122 LVERGPLP-ENEAIRFFRQ-IIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAA 179

Query: 662 AVPEHTVNIYRETQIGTPNYMAPEALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQM 721
              E  +    ET  G+P+Y APE +  + Y             G  SD+WSCG I++ +
Sbjct: 180 LETEGKL---LETSCGSPHYAAPEIVSGIPYQ------------GFASDVWSCGVILFAL 224

Query: 722 IYGRPPYGGFQGQNRLLAIMNPEVKIVYPEKTSNGDTVPKTAIDTMKACLERNPNKRWTV 781
           + GR P+    G  R L +   + +   P    + D + + A D +   L  +P +R   
Sbjct: 225 LTGRLPFDEEDGNIRTLLLKVQKGEFELP----SDDEISREAQDLISRILTVDPERRIKT 280

Query: 782 EEV 784
            ++
Sbjct: 281 RDI 283

>Smik_8.180 Chr8 (292993..296214) [3222 bp, 1073 aa] {ON} YHR102W
           (REAL)
          Length = 1073

 Score = 98.2 bits (243), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 65/279 (23%), Positives = 127/279 (45%), Gaps = 26/279 (9%)

Query: 515 YEKLELLGRGGTSXXXXXXXXXXXXXXXLKRVSFDEFDDSSIDGFKGEIELLKKLETQPR 574
           +++ E++GRG                  +K ++ D  D   ++  + EI+ L  L+    
Sbjct: 23  FKRTEVIGRGKFGVVYKGYNVKTRRVYAIKVLNLDS-DSDEVEDVQREIQFLASLKQISN 81

Query: 575 VVKLIDHEMDHGVLYVVME-CGDHDLSQTLAHRSGMPLDVEFVRYHAQEMLKCVKVVHDA 633
           + +     +    L+++ME C    L   L  R G  +D +++    +E+L  +K +H  
Sbjct: 82  ITRYYGSYLKDTSLWIIMEYCAGGSLRSLL--RPGK-IDEKYIGVIMRELLVALKCIHKD 138

Query: 634 GIVHSDLKPANFVFV-KGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNY 692
            ++H D+K AN +   +G +K+ DFG+A  V  +  ++ R+T  GTP +MAPE ++   Y
Sbjct: 139 NVIHRDIKAANVLITNEGNVKLCDFGVAAQV--NQTSLRRQTMAGTPYWMAPEVIMEGVY 196

Query: 693 THNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEK 752
              +             DIWS G   Y++  G PPY   +    +  I+  +     P +
Sbjct: 197 YDTKV------------DIWSLGITTYEIATGNPPYCDVEALRAMQLIIKSK-----PPR 239

Query: 753 TSNGDTVPKTAIDTMKACLERNPNKRWTVEEVANGSFVK 791
              G +   +  + +  CL+ +P +R + +++    F+K
Sbjct: 240 LE-GRSYSPSLKEFIALCLDEDPKERLSADDLLRSKFIK 277

>TBLA0A07150 Chr1 (1776160..1780335) [4176 bp, 1391 aa] {ON}
           Anc_1.52 YDR507C
          Length = 1391

 Score = 98.2 bits (243), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 70/238 (29%), Positives = 113/238 (47%), Gaps = 28/238 (11%)

Query: 558 GFKGEIELLKKLETQPRVVKLIDHEMDHGVLYVVMECGDH-DLSQTLAHRSGMPLDVEFV 616
           G + EI ++ KL   P V++L D       LY+V+E  +  +L   L  R  +P + E +
Sbjct: 77  GIEREI-IIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLP-ENEAI 134

Query: 617 RYHAQEMLKCVKVVHDAGIVHSDLKPANFVFV-KGILKIIDFGIANAVPEHTVNIYRETQ 675
           R+  Q ++  +   H  GIVH DLKP N +   K  +KI DFG+A    E  +    ET 
Sbjct: 135 RFFRQ-IIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKL---LETS 190

Query: 676 IGTPNYMAPEALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQG-- 733
            G+P+Y APE +  + Y             G  +D+WSCG I++ ++ GR P+    G  
Sbjct: 191 CGSPHYAAPEIISGLPYH------------GLETDVWSCGIILFALLTGRLPFDEEDGNI 238

Query: 734 QNRLLAIMNPEVKIVYPEKTSNGDTVPKTAIDTMKACLERNPNKRWTVEEVANGSFVK 791
           +N LL + + + ++         D + + A D +   L  +P KR    E+     V+
Sbjct: 239 RNLLLKVQSGQFEM------PGNDEISREAQDLISKILTVDPKKRIKTREILKHPLVQ 290

>TBLA0B01630 Chr2 (360963..364850) [3888 bp, 1295 aa] {ON} Anc_3.177
           YAR019C
          Length = 1295

 Score = 97.8 bits (242), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 75/295 (25%), Positives = 130/295 (44%), Gaps = 30/295 (10%)

Query: 502 GRKRPVVYVNGTEYEKLELLGRGGTSXXXXXXXXXXXXXXXLKRVSFDEFDDSSIDGFKG 561
            R     +V   +Y  + ++G+G                  +K+V++D  +D  ++    
Sbjct: 66  NRTESTEFVTKAQYGLINVIGKGSFGVVYKAVNRQTNQVIAIKQVNYD--NDEELNDIMS 123

Query: 562 EIELLKKLETQPRVVKLIDHEMDHGVLYVVME-CGDHDLSQTLAHRSGMPLDVEFVRYHA 620
           EI LLK L     +VK          LY+++E C    L   ++   G+P + +  +Y  
Sbjct: 124 EINLLKNLN-HKHIVKYHGFMQKSDTLYILLEYCAHGSLKNLISSSKGIP-EKDAQQYII 181

Query: 621 QEMLKCVKVVHDAGIVHSDLKPANFVFVK-GILKIIDFGIANAVPEHTVNIYRETQIGTP 679
           Q +   V  +H  G++H D+K AN +  K   +K+ DFG++  V   T+ +   T  G+ 
Sbjct: 182 QTLYGLV-YLHAQGVIHRDIKAANILLDKDNTVKLADFGVSTRVGNATMAM---TLAGSL 237

Query: 680 NYMAPEALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLA 739
           N+MAPE L                     SDIWS G  + ++I G PP+      N   A
Sbjct: 238 NWMAPEIL-------------GNKGASTLSDIWSLGATVVELITGNPPFHNLVDINIYYA 284

Query: 740 IMNPEVKIVYPEKTSNGDTVPKTAIDTMKACLERNPNKRWTVEEVANGSFVKPVS 794
           I N     + PE         +TAID +  C ++N  +R T +++ N  +++P++
Sbjct: 285 IENDNY--IPPE-----GAFSETAIDFLNLCFKKNMYRRPTAQQLLNHKWLQPMT 332

>Skud_4.783 Chr4 complement(1382552..1385959) [3408 bp, 1135 aa]
           {ON} YDR507C (REAL)
          Length = 1135

 Score = 97.8 bits (242), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 84/302 (27%), Positives = 130/302 (43%), Gaps = 38/302 (12%)

Query: 500 INGRKRPVVYVNGTEYEKL-ELLGRGGTSXXXXXXXXXXXXXXXLKRVSFDEFDDSSIDG 558
           +NG   P +  N     KL E LG G T                +K +S   F+  ++ G
Sbjct: 3   VNGNSVPAIKDNTIGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMSG 62

Query: 559 --FKGEIE------------LLKKLETQPRVVKLIDHEMDHGVLYVVMECGDH-DLSQTL 603
               G I             ++ KL   P V++L D    +  LY+V+E  +  +L   L
Sbjct: 63  TSIVGSITPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLL 122

Query: 604 AHRSGMPLDVEFVRYHAQEMLKCVKVVHDAGIVHSDLKPANFVFV-KGILKIIDFGIANA 662
             R  +P + E +R+  Q ++  V   H  GIVH DLKP N +   K  +KI DFG+A  
Sbjct: 123 VERGPLP-ENEAIRFFRQ-IIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAAL 180

Query: 663 VPEHTVNIYRETQIGTPNYMAPEALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMI 722
             E  +    ET  G+P+Y APE +  + Y             G  SD+WSCG I++ ++
Sbjct: 181 ETEGKL---LETSCGSPHYAAPEIVSGIPYQ------------GFASDVWSCGVILFALL 225

Query: 723 YGRPPYGGFQGQNRLLAIMNPEVKIVYPEKTSNGDTVPKTAIDTMKACLERNPNKRWTVE 782
            GR P+    G  R L +   + +   P    + D V + A D +   L  +P +R    
Sbjct: 226 TGRLPFDEEDGNIRTLLLKVQKGQFELP----SDDEVSREAQDLICKILTVDPKRRIKAR 281

Query: 783 EV 784
           ++
Sbjct: 282 DI 283

>KAFR0A01760 Chr1 complement(363462..366119) [2658 bp, 885 aa] {ON}
           Anc_2.496 YHL007C
          Length = 885

 Score = 97.4 bits (241), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 73/282 (25%), Positives = 126/282 (44%), Gaps = 34/282 (12%)

Query: 514 EYEKLELLGRGGTSXXXXXXXXXXXXXXXLKRVSFDEFDDSSIDGFKGEIELLKKLETQP 573
           +Y  L  +G+G +                +K+++F++     +     EI L+ K     
Sbjct: 564 KYVNLIKIGQGASGGVYTATDVNTEASVAIKKMNFEKQPKKEL--IVNEI-LVMKASRHE 620

Query: 574 RVVKLIDHEMDHGVLYVVME-CGDHDLSQTLAHRSGMPLDVEFVRYHAQEMLKCVKVVHD 632
            +V  ID    +G L+V+ME      L+  + H     L  + +    +E L  ++ +H 
Sbjct: 621 NIVNFIDSYFLNGNLWVIMEYMKGGSLTDVVTH---CILTEQQISTVTRETLNGLRFLHS 677

Query: 633 AGIVHSDLKPANFVF-VKGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMN 691
            G++H D+K  N +  + G +K+ DFG    + E  +N+ R T +GTP +MAPE +    
Sbjct: 678 KGVIHRDIKSDNVLLSLSGDIKLTDFGFCAQINE--INLKRTTMVGTPYWMAPEVV---- 731

Query: 692 YTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIM---NPEVKIV 748
                    SR + G   DIWS G +I +MI G PPY        L  I     PE+K  
Sbjct: 732 ---------SRKEYGPKVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIATNGTPELK-- 780

Query: 749 YPEKTSNGDTVPKTAIDTMKACLERNPNKRWTVEEVANGSFV 790
                 + D++ +     +  CL+ +P++R +  E+ N  F+
Sbjct: 781 ------DPDSLSECLKAFLDWCLKVDPHERASATELLNDRFI 816

>Kpol_1040.20 s1040 (57057..60950) [3894 bp, 1297 aa] {ON}
            (57057..60950) [3894 nt, 1298 aa]
          Length = 1297

 Score = 97.4 bits (241), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 70/246 (28%), Positives = 116/246 (47%), Gaps = 37/246 (15%)

Query: 553  DSSIDGFKGEIELLKKLETQPR--VVKLIDHEMDHGVLYVVM----ECGDHDLSQTLAHR 606
            D  +     EI+++  L   P   +++L+D   D    Y+      E G  DL   +  +
Sbjct: 1081 DRQLGTILSEIQIMSTLNKHPHDNILRLLDFFEDDDYYYIETPMHGETGCIDLFDLIEFK 1140

Query: 607  SGMPLDVEFVRYHAQEMLKCVKVVHDAGIVHSDLKPANFVF-VKGILKIIDFGIANAVPE 665
            + M  +VE  +    +++  +K +HD GIVH D+K  N +   +G +K+IDFG A  V  
Sbjct: 1141 TNMS-EVE-TKLIFMQVVSSIKFLHDQGIVHRDIKDENVIVDSQGFIKLIDFGSAAYVKS 1198

Query: 666  HTVNIYRETQIGTPNYMAPEALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGR 725
               +++    +GT +Y APE L    Y            VGKP DIW+ G ++Y +I+  
Sbjct: 1199 GPFDVF----VGTIDYAAPEVLGGEPY------------VGKPQDIWAIGILLYTIIFKE 1242

Query: 726  PPYGGFQGQNRLLAIMNPEVKIVYPEKTSNGDTVPKTAIDTMKACLERNPNKRWTVEEVA 785
             P+           I+  E+K      TS G    +  +D +K  L RNP KR T++E+ 
Sbjct: 1243 NPFYNID------EILEAELKF----NTSTG--ACEDCVDLIKRILTRNPTKRPTIDEIY 1290

Query: 786  NGSFVK 791
            N  +++
Sbjct: 1291 NDKWLQ 1296

>NCAS0C04940 Chr3 (1006185..1009535) [3351 bp, 1116 aa] {ON}
           Anc_3.92
          Length = 1116

 Score = 97.1 bits (240), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 66/233 (28%), Positives = 111/233 (47%), Gaps = 29/233 (12%)

Query: 566 LKKLETQPRVVKLIDHEMDHGVLYVVMECGDHDLSQTLAHRSGMPLDVEFVRYHAQEMLK 625
           L++L     +++L     D   LY ++E   +    +L  + G  L+ E   Y+  +++ 
Sbjct: 226 LQRLNNSRSIIRLFFTFQDEASLYFLLEYAPNGDLLSLMKKFG-SLNEECCCYYGAQIID 284

Query: 626 CVKVVHDAGIVHSDLKPANFVFVKGI-LKIIDFGIA----NAVPEHTVNIYRETQ--IGT 678
            +K +H  GI+H D+KP N +  K + +KI DFG A    N  P  + ++   ++  +GT
Sbjct: 285 AIKFMHSKGIIHRDIKPENILLDKDMKVKITDFGTAKILDNKPPGTSYDLLTRSKSFVGT 344

Query: 679 PNYMAPEALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLL 738
             Y++PE L+  NYT  +            SDIW+ GCI++QMI G+PP   F+  N  L
Sbjct: 345 AEYVSPE-LLNDNYTDAR------------SDIWAFGCIVFQMIAGKPP---FKATNEYL 388

Query: 739 AIMNPEVKIVYPEKTSNGDTVPKTAIDTMKACLERNPNKRWTVEEVANGSFVK 791
                 +K+ Y          P    D +K  L + P +R T+E +    F +
Sbjct: 389 TFQK-VMKVQYAFTAG----FPTVVRDLVKRILIKAPEQRLTIEAIEKHHFFR 436

>SAKL0G01848g Chr7 (154547..157204) [2658 bp, 885 aa] {ON} weakly
           similar to uniprot|P38692 Saccharomyces cerevisiae
           YHR102W KIC1 Protein kinase of the PAK/Ste20 kinase
           family required for cell integrity possibly through
           regulating 1 6-beta-glucan levels in the wall physically
           interacts with Cdc31p (centrin) which is a component of
           the spindle pole body
          Length = 885

 Score = 96.7 bits (239), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 72/303 (23%), Positives = 130/303 (42%), Gaps = 35/303 (11%)

Query: 500 INGRKRPVVYVNGTE---------YEKLELLGRGGTSXXXXXXXXXXXXXXXLKRVSFDE 550
           ++ +K  V   NGT          Y++ E++GRG                  +K ++ D 
Sbjct: 2   LSTKKSGVSTANGTSAPSNNVSSIYKRTEVIGRGKFGVVYKGYHIRTKQICAIKVLNLDT 61

Query: 551 FDDSSIDGFKGEIELLKKLETQPRVVKLIDHEMDHGVLYVVME-CGDHDLSQTLAHRSGM 609
            +D  ++  + EI+ L  L+  P +       +    L+++ME C    L   L  R G 
Sbjct: 62  SEDE-VEDVQKEIQFLSSLKQVPNITHYYGSYLYDTKLWIIMEYCAGGSLRTLL--RPG- 117

Query: 610 PLDVEFVRYHAQEMLKCVKVVHDAGIVHSDLKPANFVFVK-GILKIIDFGIANAVPEHTV 668
            +D +++    +E+L  +  +H   ++H D+K AN +    G +K+ DFG+A  + +   
Sbjct: 118 KIDEKYIGVIMRELLVALLYIHKDNVIHRDIKAANVLITNDGRVKLCDFGVAAQLTQS-- 175

Query: 669 NIYRETQIGTPNYMAPEALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPY 728
           N+ R+T  GTP +MAPE ++   Y   +             DIWS G   Y++  G PPY
Sbjct: 176 NVRRQTMAGTPYWMAPEVIMEGVYYDTKV------------DIWSLGITTYEITTGNPPY 223

Query: 729 GGFQGQNRLLAIMNPEVKIVYPEKTSNGDTVPKTAIDTMKACLERNPNKRWTVEEVANGS 788
              +    +  I   +     P +       P    + +  CL+ +P +R   E++    
Sbjct: 224 CDVEALRAMQLITKSK-----PPRLEGRQYSPLLK-EFIALCLDEDPKERLAAEDLLKTR 277

Query: 789 FVK 791
           F+K
Sbjct: 278 FIK 280

>Suva_15.297 Chr15 (518854..520850,520945..522172) [3225 bp, 1074
           aa] {ON} YHR102W (REAL)
          Length = 1074

 Score = 96.7 bits (239), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 65/279 (23%), Positives = 127/279 (45%), Gaps = 26/279 (9%)

Query: 515 YEKLELLGRGGTSXXXXXXXXXXXXXXXLKRVSFDEFDDSSIDGFKGEIELLKKLETQPR 574
           +++ E++GRG                  +K ++ D  D   ++  + EI+ L  L+    
Sbjct: 23  FKRTEVIGRGKFGVVYKGYNVKTRRVFAIKVLNLDS-DSDEVEDVQREIQFLASLKQIHN 81

Query: 575 VVKLIDHEMDHGVLYVVME-CGDHDLSQTLAHRSGMPLDVEFVRYHAQEMLKCVKVVHDA 633
           + +     +    L+++ME C    L   L  R G  +D +++    +E+L  +K +H  
Sbjct: 82  ITRYYGSYLKDTSLWIIMEYCAGGSLRSLL--RPGK-IDEKYIGVIMREVLVALKCIHKD 138

Query: 634 GIVHSDLKPANFVFV-KGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNY 692
            ++H D+K AN +   +G +K+ DFG+A  V  +  ++ R+T  GTP +MAPE ++   Y
Sbjct: 139 NVIHRDIKAANVLITNEGNVKLCDFGVAAQV--NQTSLRRQTMAGTPYWMAPEVIMEGVY 196

Query: 693 THNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEK 752
              +             DIWS G   Y++  G PPY   +    +  I+  +     P +
Sbjct: 197 YDTKV------------DIWSLGITTYEIATGNPPYCEVEALRAMQLIIKSK-----PPR 239

Query: 753 TSNGDTVPKTAIDTMKACLERNPNKRWTVEEVANGSFVK 791
              G +   +  + +  CL+ +P +R + +++    F+K
Sbjct: 240 LE-GRSYSPSLKEFIALCLDEDPKERLSADDLLKSKFIK 277

>Sklu_YGOB_Anc_2.496 Chr5 (185447..187306) [1860 bp, 619 aa] {ON}
           ANNOTATED BY YGOB -
          Length = 619

 Score = 95.9 bits (237), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 70/229 (30%), Positives = 107/229 (46%), Gaps = 27/229 (11%)

Query: 565 LLKKLETQPRVVKLIDHEMDHGVLYVVMECGDH-DLSQTLAHRSGMPLDVEFVRYHAQEM 623
           L+ K      +V  ID  +  G L+VVME  +   L+  + H     L    +    +E 
Sbjct: 376 LVMKGSKHSNIVNFIDSYLLKGDLWVVMEYMEGGSLTDVVTH---CILTEGQIGAVCRET 432

Query: 624 LKCVKVVHDAGIVHSDLKPANFVF-VKGILKIIDFGIANAVPEHTVNIYRETQIGTPNYM 682
           LK ++ +H  G++H D+K  N +  + G +K+ DFG    + E  VN+ R T +GTP +M
Sbjct: 433 LKGLQFLHSKGVIHRDIKSDNILLSMNGDIKLTDFGFCAQINE--VNLKRTTMVGTPYWM 490

Query: 683 APEALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAI-M 741
           APE +             SR + G   DIWS G +I +MI G PPY        L  I  
Sbjct: 491 APEVV-------------SRKEYGPKVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIAT 537

Query: 742 NPEVKIVYPEKTSNGDTVPKTAIDTMKACLERNPNKRWTVEEVANGSFV 790
           N   K+  PE  S+      T  + +  CL+ +P  R    E+ +G+F+
Sbjct: 538 NGTPKLKDPENLSD------TLKEFLGWCLKVDPEDRANAAELLSGTFI 580

>Suva_2.687 Chr2 complement(1215095..1218481) [3387 bp, 1128 aa]
           {ON} YCL024W (REAL)
          Length = 1128

 Score = 96.7 bits (239), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 69/229 (30%), Positives = 110/229 (48%), Gaps = 24/229 (10%)

Query: 558 GFKGEIELLKKLETQPRVVKLIDHEMDHGVLYVVMECGDH-DLSQTLAHRSGMPLDVEFV 616
           G + EI ++ KL   P V++L D    +  LY+V+E  +  +L   L  R  +P + E +
Sbjct: 77  GIEREI-IIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLP-ENEAI 134

Query: 617 RYHAQEMLKCVKVVHDAGIVHSDLKPANFVFV-KGILKIIDFGIANAVPEHTVNIYRETQ 675
           R+  Q ++  V   H  GIVH DLKP N +   K  +KI DFG+A    E  +    ET 
Sbjct: 135 RFFRQ-IIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKL---LETS 190

Query: 676 IGTPNYMAPEALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQN 735
            G+P+Y APE +  + Y             G  SD+WSCG I++ ++ GR P+    G  
Sbjct: 191 CGSPHYAAPEIVSGIPYQ------------GFASDVWSCGVILFALLTGRLPFDEEDGNI 238

Query: 736 RLLAIMNPEVKIVYPEKTSNGDTVPKTAIDTMKACLERNPNKRWTVEEV 784
           R L +   + +   P    + D + + A D +   L  +P +R    ++
Sbjct: 239 RALLLKVQKGEFELP----SDDEISREAQDLISKILTVDPERRIKARDI 283

>Kwal_26.7861 s26 complement(544126..546993) [2868 bp, 955 aa] {ON}
           YHL007C (STE20) - serine/threonine protein kinase
           [contig 55] FULL
          Length = 955

 Score = 96.7 bits (239), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 67/231 (29%), Positives = 107/231 (46%), Gaps = 31/231 (13%)

Query: 565 LLKKLETQPRVVKLIDHEMDHGVLYVVMECGDH-DLSQTLAHRSGMPLDVEFVRYHAQEM 623
           L+ K      +V  ID  +  G L+VVME  +   L+  + H     L    +   ++E 
Sbjct: 714 LVMKASKHANIVNFIDSYLLRGDLWVVMEYMEGGSLTDVVTH---CILTEGQIGAVSRET 770

Query: 624 LKCVKVVHDAGIVHSDLKPANFVF-VKGILKIIDFGIANAVPEHTVNIYRETQIGTPNYM 682
           LK ++ +H  G++H D+K  N +  + G +K+ DFG    + E  +N+ R T +GTP +M
Sbjct: 771 LKGLQFLHSKGVIHRDIKSDNVLLSMSGEIKLTDFGFCAQINE--INLKRTTMVGTPYWM 828

Query: 683 APEALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIM- 741
           APE +             SR + G   DIWS G +I +MI G PPY        L  I  
Sbjct: 829 APEVV-------------SRKEYGPKVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIAT 875

Query: 742 --NPEVKIVYPEKTSNGDTVPKTAIDTMKACLERNPNKRWTVEEVANGSFV 790
              PE+K        + D++       +  CL  NP++R T  ++ +  F+
Sbjct: 876 NGTPELK--------DADSLSDDLKSFLGWCLHVNPDERATASQLLSDPFI 918

>NDAI0A03870 Chr1 (867910..870597) [2688 bp, 895 aa] {ON} Anc_2.496
          Length = 895

 Score = 96.3 bits (238), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 77/287 (26%), Positives = 130/287 (45%), Gaps = 36/287 (12%)

Query: 514 EYEKLELLGRGGTSXXXXXXXXXXXXXXXLKRVSFDEFDDSSIDGFKGEIELLKKLETQP 573
           +Y  L  +GRGG++               +K+++ ++     +     EI ++KK +  P
Sbjct: 612 KYANLVKIGRGGSALVYTAYEVGTNLSVAIKQINLEKQPRKQL--ILNEIIVMKKSQ-HP 668

Query: 574 RVVKLIDHEMDHGVLYVVMECGDH----DLSQTLAHRSGMPLDVEFVRYHAQEMLKCVKV 629
            +V  ID  +  G L+V+ME  +     D+      R G       +    +E+LK +  
Sbjct: 669 NIVNFIDSYLVDGKLWVIMEYMEAGSLTDVVTRCILREGQ------IGAVCREVLKGLVF 722

Query: 630 VHDAGIVHSDLKPANFVF-VKGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALV 688
           +H  G++H D+K  N +  + G +K+ DFG    +  + +++ R T +GTP +MAPE + 
Sbjct: 723 LHSKGVIHRDIKSDNVLLSMDGDIKLTDFGFCAQL--NDIHLKRNTMVGTPYWMAPEIVE 780

Query: 689 AMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAI-MNPEVKI 747
             +Y     P+          DIWS G +I +MI G PPY        L  I  N   K+
Sbjct: 781 KKHY----CPK---------VDIWSLGVMIIEMIEGEPPYLNEPPLRALYLIATNGTPKL 827

Query: 748 VYPEKTSNGDTVPKTAIDTMKACLERNPNKRWTVEEVANGSFVKPVS 794
             PEK S      +T  + +  CL  +P  R T  E+ N  F+  ++
Sbjct: 828 KDPEKLS------ETLSEFINCCLFVDPELRKTAAELLNHRFITEIA 868

>TPHA0H02630 Chr8 complement(614048..618151) [4104 bp, 1367 aa] {ON}
            Anc_7.86 YAL017W
          Length = 1367

 Score = 96.7 bits (239), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 69/237 (29%), Positives = 114/237 (48%), Gaps = 37/237 (15%)

Query: 562  EIELLKKLETQPR--VVKLIDHEMDHGVLYVVM----ECGDHDLSQTLAHRSGMPLDVEF 615
            EI+++  L   P   +++L+D   D    Y+      E G  DL   +  +S M  + E 
Sbjct: 1160 EIQIMTTLNKSPHENIMQLLDFFEDDDYYYIETPLHGETGCIDLFDLIEFKSNMT-ESE- 1217

Query: 616  VRYHAQEMLKCVKVVHDAGIVHSDLKPANFVF-VKGILKIIDFGIANAVPEHTVNIYRET 674
             R    +++  +K +HD+ IVH D+K  N +   KG +K+IDFG A  V     +++   
Sbjct: 1218 ARLIFIQVVLGIKHLHDSNIVHRDVKDENVIVDAKGFVKLIDFGSAAYVNSGPFDVF--- 1274

Query: 675  QIGTPNYMAPEALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQ 734
             +GT +Y APE L    Y            +GKP DIW+ G ++Y +++   P+      
Sbjct: 1275 -VGTIDYAAPEVLSGEPY------------LGKPQDIWAIGILLYTIMFKENPFYNID-- 1319

Query: 735  NRLLAIMNPEVKIVYPEKTSNGDTVPKTAIDTMKACLERNPNKRWTVEEVANGSFVK 791
                 I+  E+KI      +N     +  ID +K  L +NPNKR T++E+ N  ++K
Sbjct: 1320 ----EILEAELKI------NNTSDASQDCIDLIKRILTKNPNKRPTIDEIVNDKWLK 1366

>KLTH0D06006g Chr4 complement(532589..535453) [2865 bp, 954 aa] {ON}
           similar to uniprot|Q03497 Saccharomyces cerevisiae
           YHL007C STE20 Signal transducing kinase of the PAK (p21-
           activated kinase) family involved in pheromone response
           and pseudohyphal/invasive growth pathways activated by
           Cdc42p binds Ste4p at a GBB motif present in
           noncatalytic domains of PAK kinases
          Length = 954

 Score = 96.3 bits (238), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 67/231 (29%), Positives = 107/231 (46%), Gaps = 31/231 (13%)

Query: 565 LLKKLETQPRVVKLIDHEMDHGVLYVVMECGDH-DLSQTLAHRSGMPLDVEFVRYHAQEM 623
           L+ K      +V  ID  +  G L+VVME  +   L+  + H     L    +   ++E 
Sbjct: 713 LVMKASKHANIVNFIDSYLLRGDLWVVMEYMEGGSLTDVVTH---CILTEGQIGAVSRET 769

Query: 624 LKCVKVVHDAGIVHSDLKPANFVF-VKGILKIIDFGIANAVPEHTVNIYRETQIGTPNYM 682
           LK ++ +H  G++H D+K  N +  + G +K+ DFG    + E  +N+ R T +GTP +M
Sbjct: 770 LKGLQFLHSKGVIHRDIKSDNILLSMTGEIKLTDFGFCAQINE--INLKRTTMVGTPYWM 827

Query: 683 APEALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIM- 741
           APE +             SR + G   DIWS G +I +MI G PPY        L  I  
Sbjct: 828 APEVV-------------SRKEYGPKVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIAT 874

Query: 742 --NPEVKIVYPEKTSNGDTVPKTAIDTMKACLERNPNKRWTVEEVANGSFV 790
              PE+K        + D++       +  CL  +P++R T  E+ +  F+
Sbjct: 875 NGTPELK--------DADSLSDDLKGFLGWCLHVDPDERATASELLSDPFI 917

>KNAG0B05350 Chr2 complement(1034166..1036676) [2511 bp, 836 aa]
           {ON} Anc_2.496 YHL007C
          Length = 836

 Score = 95.9 bits (237), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 69/244 (28%), Positives = 112/244 (45%), Gaps = 27/244 (11%)

Query: 565 LLKKLETQPRVVKLIDHEMDHGVLYVVMECGDH-DLSQTLAHRSGMPLDVEFVRYHAQEM 623
           ++ K    P +V  ID  +  G L+V+ME  +   L+  + H     L    +    +E 
Sbjct: 598 IVMKDSKHPNIVNFIDSFLLKGDLWVIMEFMEGGSLTDVVTH---CILTEGQIGTVCRET 654

Query: 624 LKCVKVVHDAGIVHSDLKPANFVF-VKGILKIIDFGIANAVPEHTVNIYRETQIGTPNYM 682
           L+ ++ +H  G++H D+K  N +  +KG +K+ DFG    + EH  N+ R T +GTP +M
Sbjct: 655 LRGLQFLHSNGVIHRDIKSDNILLSMKGDIKLTDFGFCAQINEH--NLKRTTMVGTPYWM 712

Query: 683 APEALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRL-LAIM 741
           APE +             SR + G   DIWS G +I +MI   PPY        L L   
Sbjct: 713 APEVV-------------SRKEYGPKVDIWSLGIMIIEMIESEPPYLNETPLRALYLIAT 759

Query: 742 NPEVKIVYPEKTSNGDTVPKTAIDTMKACLERNPNKRWTVEEVANGSFVKPVSVTHFFIR 801
           N   K+  PE  S+         D +  CL+ NP++R +   +    F+   S  +  + 
Sbjct: 760 NGTPKLKEPELLSD------VLNDFLSWCLKVNPDERASASTLLEDPFITEYSEPNVSLA 813

Query: 802 DLIE 805
            L++
Sbjct: 814 PLVK 817

>AER264C Chr5 complement(1120017..1124468) [4452 bp, 1483 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YCR073C
            (SSK22) and YNR031C (SSK2)
          Length = 1483

 Score = 96.3 bits (238), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 69/249 (27%), Positives = 119/249 (47%), Gaps = 27/249 (10%)

Query: 559  FKGEIELLKKLETQPRVVKLIDHEMDHGVLYVVME-CGDHDLSQTLAHRSGMPLDVEFVR 617
             + E+ +L+ L   P VV+    E+    + + ME C    L+  LAH  G   D    +
Sbjct: 1237 IRDEMTVLEML-NHPNVVQYYGVEVHRDRVNIFMEYCEGGSLASLLAH--GRIEDEMVTQ 1293

Query: 618  YHAQEMLKCVKVVHDAGIVHSDLKPANFVF-VKGILKIIDFGIANAVPEH---TVNIYR- 672
             ++ +ML+ +  +H++G+ H D+KP N +    GI+K +DFG A  +  +    +N+ + 
Sbjct: 1294 VYSLQMLEGLAYLHESGVDHRDIKPENILLDFNGIIKYVDFGAAKVLASNGSKKLNLEQH 1353

Query: 673  ---ETQIGTPNYMAPEALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYG 729
               E  IGTP YM+PEA+    Y           K G   DIWS GC+I +M+ GR P+ 
Sbjct: 1354 MEGEKMIGTPMYMSPEAISGTGYG----------KFGS-DDIWSLGCVILEMVTGRRPWA 1402

Query: 730  GFQGQNRLLAIMNPEVKIVYPEKTSNGDTVPKTAIDTMKACLERNPNKRWTVEEVANGSF 789
                Q  ++  +      ++P K    + + +  I  +  CL ++PN+R T  E+    +
Sbjct: 1403 NLDNQWAIIYQVAAGQIPMFPSK----NEMSQAGIKFLSRCLIQDPNQRSTAVELLMDPW 1458

Query: 790  VKPVSVTHF 798
            +  +    F
Sbjct: 1459 IIEIRTIAF 1467

>KLLA0D11990g Chr4 complement(1022895..1023792,1023928..1023944)
           [915 bp, 304 aa] {ON} highly similar to uniprot|P17157
           Saccharomyces cerevisiae YPL031C PHO85 Cyclin-dependent
           kinase with ten cyclin partners involved in
           environmental stress response in phosphate-rich
           conditions Pho85p-Pho80p complex phosphorylates Pho4p
           which in turn represses PHO5
          Length = 304

 Score = 91.7 bits (226), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 79/308 (25%), Positives = 139/308 (45%), Gaps = 53/308 (17%)

Query: 513 TEYEKLELLGRGGTSXXXXXXXXXXXXXXXLKRVSFDEFDDSSIDGFKGEIELLKKLETQ 572
           +++++LE +G G  +               LK V  D  + +     + EI L+K+L+  
Sbjct: 5   SQFKQLEKVGNGTYATVYKGLNKTTGVYVALKEVKLDSEEGTPSTAIR-EISLMKELK-H 62

Query: 573 PRVVKLIDHEMDHGVLYVVMECGDHDLSQTLAHR----SGMPLDVEFVRYHAQEMLKCVK 628
             +V+L D       L +V E  D+DL + + +R    S   L+++ V+Y   ++L+ V 
Sbjct: 63  DNIVRLFDVIHTENKLTLVFEFMDNDLKKFMDNRNKGNSHKGLEMDLVKYFQWQLLQGVA 122

Query: 629 VVHDAGIVHSDLKPANFVFV-KGILKIIDFGIANA--VPEHTVNIYRETQIGTPNYMAPE 685
             H+  I+H DLKP N +   +G LK+ DFG+A A  +P +T +    +++ T  Y AP+
Sbjct: 123 FCHENRILHRDLKPQNLLINNRGQLKLGDFGLARAFGIPVNTFS----SEVVTLWYRAPD 178

Query: 686 ALVA-MNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAI---M 741
            L+   NY                 DIWSCGCI+ +MI G+P + G   + +L  I   M
Sbjct: 179 VLMGSRNYC-------------TSIDIWSCGCILAEMIMGKPLFPGSNDEEQLKLIFDTM 225

Query: 742 NPEVKIVYPEKT-----------------------SNGDTVPKTAIDTMKACLERNPNKR 778
              V+  +P+ T                       +  + +    +D +   L+ NP+ R
Sbjct: 226 GTPVEQTWPQVTQLAKYNPLLPPHMPRDLKQLLQNNTEEVLDDNVVDLLHGLLQLNPDAR 285

Query: 779 WTVEEVAN 786
            + ++  N
Sbjct: 286 LSAKDALN 293

>YHR102W Chr8 (316572..319814) [3243 bp, 1080 aa] {ON}  KIC1Protein
           kinase of the PAK/Ste20 family, required for cell
           integrity; physically interacts with Cdc31p (centrin),
           which is a component of the spindle pole body; part of
           the RAM network that regulates cellular polarity and
           morphogenesis
          Length = 1080

 Score = 95.9 bits (237), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 66/280 (23%), Positives = 127/280 (45%), Gaps = 28/280 (10%)

Query: 515 YEKLELLGRGGTSXXXXXXXXXXXXXXXLKRVSFDEFDDSSIDGFKGEIELLKKLETQPR 574
           +++ E++GRG                  +K ++ D  D   ++  + EI+ L  L+    
Sbjct: 23  FKRTEVIGRGKFGVVYKGYNVKTGRVYAIKVLNLDS-DSDEVEDVQREIQFLASLKQISN 81

Query: 575 VVKLIDHEMDHGVLYVVME-CGDHDLSQTLAHRSGMPLDVEFVRYHAQEMLKCVKVVHDA 633
           + +     +    L+++ME C    L   L  R G  +D +++    +E+L  +K +H  
Sbjct: 82  ITRYYGSYLKDTSLWIIMEHCAGGSLRSLL--RPGK-IDEKYIGVIMRELLVALKCIHKD 138

Query: 634 GIVHSDLKPANFVFV-KGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNY 692
            ++H D+K AN +   +G +K+ DFG+A  V  +  ++ R+T  GTP +MAPE ++   Y
Sbjct: 139 NVIHRDIKAANVLITNEGNVKLCDFGVAAQV--NQTSLRRQTMAGTPYWMAPEVIMEGVY 196

Query: 693 THNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEK 752
              +             DIWS G   Y++  G PPY   +    +  I+  +     P +
Sbjct: 197 YDTKV------------DIWSLGITTYEIATGNPPYCDVEALRAMQLIIKSK-----PPR 239

Query: 753 TSNGDTVPKTAIDTMKA-CLERNPNKRWTVEEVANGSFVK 791
               D    T++    A CL+ +P +R + +++    F++
Sbjct: 240 LE--DRSYSTSLKEFIALCLDEDPKERLSADDLLKSKFIR 277

>KAFR0E01040 Chr5 complement(214744..216252) [1509 bp, 502 aa] {ON}
           Anc_3.229 YBR028C
          Length = 502

 Score = 94.4 bits (233), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 73/237 (30%), Positives = 111/237 (46%), Gaps = 44/237 (18%)

Query: 565 LLKKLETQPRVVKLIDHEMDHGVLYVVME-CGDHDLSQTLAHRSGMPLDVEFVRYHAQEM 623
           +L KLE  P VVKL     DH  LY++++     +L   L  R    LD + V ++A E+
Sbjct: 180 ILSKLE-HPNVVKLFYSFHDHSKLYLILQYIPGGELFFHLKERG--TLDEDTVAFYAAEI 236

Query: 624 LKCVKVVHDAGIVHSDLKPANFVFV-KGILKIIDFGIANAVPEHTV-----------NIY 671
              +K +HD GIV+ DLKP N +   +G L + DFG++    ++             +IY
Sbjct: 237 SVALKFLHDNGIVYRDLKPENCLLSQRGHLVLTDFGLSKEAVDNVSDNESTELNSPEDIY 296

Query: 672 R-ETQIGTPNYMAPEALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGG 730
              + IGTP Y APE L  + Y  N              D +S GC+++ M+ G+PPY G
Sbjct: 297 TLHSIIGTPEYAAPEILQGLPYNKN-------------CDWYSLGCLLFDMLVGKPPYTG 343

Query: 731 FQGQNRLLAIMNPEVKIVYPEKTSNGDTVPKTAIDTMK----ACLERNPNKRWTVEE 783
                      N +V +   +K   G  +P    D MK      L+++  KRW V++
Sbjct: 344 ----------TNHKVILNKIQKDKQGPRIPFYLSDGMKDMLNWLLKKDKTKRWDVDK 390

>CAGL0K08514g Chr11 complement(854143..858612) [4470 bp, 1489 aa]
           {ON} similar to uniprot|P34244 Saccharomyces cerevisiae
           YKL101w serine/threonine-protein kinase
          Length = 1489

 Score = 95.9 bits (237), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 73/244 (29%), Positives = 117/244 (47%), Gaps = 31/244 (12%)

Query: 553 DSSIDGFKGEIEL-LKKLETQPRVVKLIDHEMDHGVLYVVMECGDH-DLSQTLAHRSGMP 610
           DS+++ +  E E+ + KL + P V+ L++   +   LY+V+E  D  +L   L  + G  
Sbjct: 165 DSALNPYGIEREIVIMKLISHPNVMGLLEVWENKSELYLVLEYVDGGELFDYLVSK-GKL 223

Query: 611 LDVEFVRYHAQEMLKCVKVVHDAGIVHSDLKPANFVFVKG--ILKIIDFGIANA-VPEHT 667
            + E V Y  Q +++ V   H   I H DLKP N +  K   ++KI DFG+A   +P   
Sbjct: 224 SEPEAVHYFTQ-IIQGVSYCHSFNICHRDLKPENLLLDKKNKVIKIADFGMAALELP--- 279

Query: 668 VNIYRETQIGTPNYMAPEALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPP 727
            N   ET  G+P+Y +PE ++   Y             G PSD+WSCG I++ ++ G  P
Sbjct: 280 -NKLLETSCGSPHYASPEIVMGKPYH------------GGPSDVWSCGIILFALLTGHLP 326

Query: 728 YGGFQGQNRLLAIMNPEVKIVYPEKTSNGDTVPKTAIDTMKACLERNPNKRWTVEEVANG 787
           +     +  LL +     ++  P   +N       A D +   L  NP KR T+ E+ N 
Sbjct: 327 FNDDNIKKLLLKVQAGRFQL--PPYLTND------AKDLITRILVTNPEKRLTINEILNH 378

Query: 788 SFVK 791
             +K
Sbjct: 379 PLIK 382

>KLLA0F14190g Chr6 (1311121..1315137) [4017 bp, 1338 aa] {ON}
            uniprot|O60030 Kluyveromyces lactis BCK1 MAP kinase
            kinase kinase
          Length = 1338

 Score = 95.9 bits (237), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 76/295 (25%), Positives = 128/295 (43%), Gaps = 32/295 (10%)

Query: 515  YEKLELLGRGGTSXXXXXXXXXXXXXXXLKRVSFDEF---DDSSI---DGFKGEIELLKK 568
            + K E++G+G                  +K+V+  EF   D+S+I   +  K E+  LK 
Sbjct: 1038 WIKGEIIGKGSFGAVYLALNVTTGEMLAVKQVTVPEFSSQDESAISMVEALKSEVSTLKD 1097

Query: 569  LETQPRVVKLIDHEMDHGVLYVVMECGDHDLSQTLAHRSGMPLDVEFVRYHAQEMLKCVK 628
            L     +V+ +  E  +G+  + +E        +L    G   D + +R+  +++L+ + 
Sbjct: 1098 LN-HVNIVQYLGFEEKNGIYSLFLEYVAGGSVGSLIRMYGR-FDDQLIRHLTKQVLEGLA 1155

Query: 629  VVHDAGIVHSDLKPANFVFVK-GILKIIDFGIANAVPEHTVNIYRETQI---GTPNYMAP 684
             +H  GI+H D+K  N +    G+ KI DFGI+      + NIY  + +   GT  +MAP
Sbjct: 1156 YLHSKGILHRDMKADNLLLDNDGVCKISDFGIS----RKSNNIYSNSDMTMRGTVFWMAP 1211

Query: 685  EAL-VAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNP 743
            E +  A  Y+          KV    DIWS GC++ +M  G+ P+  F+    +  I   
Sbjct: 1212 EMVDTAHGYSA---------KV----DIWSLGCVVLEMFAGKRPWSNFEVVAAMFQIGKS 1258

Query: 744  EVKIVYPEKTSNGDTVPKTAIDTMKACLERNPNKRWTVEEVANGSFVKPVSVTHF 798
            +     P+ T   D V       +  C E +P  R T + +    F K  S   F
Sbjct: 1259 KTAPPIPDDTK--DLVSPAGQSFLDQCFEIDPEMRPTADSLVGHPFCKTSSSFDF 1311

>KNAG0K00680 Chr11 (120919..124206) [3288 bp, 1095 aa] {ON} Anc_3.92
           YDR490C
          Length = 1095

 Score = 95.5 bits (236), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 68/245 (27%), Positives = 113/245 (46%), Gaps = 35/245 (14%)

Query: 562 EIELLKKLETQPRVVKLIDHEMDHGVLYVVMECGDHDLSQTLAHRSGMPLDVEFVRYHAQ 621
           E   L+++   P VV+L     D   LY ++E   +    +L  + G  L+ +  +Y++ 
Sbjct: 195 EKNALQRVNDSPMVVRLFFTFQDEASLYFLLEFAPNGDFLSLMKKFG-SLNEDAAKYYSA 253

Query: 622 EMLKCVKVVHDAGIVHSDLKPANFVFVKGI-LKIIDFGIANAV------------PEHTV 668
           +++  +  +H  GIVH D+KP N +  K   +KI DFG A  +            PE+ +
Sbjct: 254 QIIDAIGFLHSRGIVHRDMKPENILLDKNWKIKITDFGTAKILEKTAQQEAGGSGPEYNL 313

Query: 669 NIYRETQIGTPNYMAPEALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPY 728
               ++ +GT  Y++PE L       N +    R       DIW+ GCI+YQM+ G+PP 
Sbjct: 314 LTRSKSFVGTAEYVSPELL-------NDSFVDYR------CDIWAFGCIVYQMLAGKPP- 359

Query: 729 GGFQGQNRLLAIMNPEVKIVYPEKTSNGDTVPKTAIDTMKACLERNPNKRWTVEEVANGS 788
             F+  N  L      +K+ Y          P    D +K  L ++ +KR TV+++    
Sbjct: 360 --FKATNEYLTFQK-VMKVQYAFTAG----FPLVIRDLVKRILVKDLDKRLTVQQIQRHH 412

Query: 789 FVKPV 793
           F K V
Sbjct: 413 FFKGV 417

>ABL034W Chr2 (333432..337709) [4278 bp, 1425 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YKL101W (HSL1)
          Length = 1425

 Score = 95.9 bits (237), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 70/230 (30%), Positives = 111/230 (48%), Gaps = 29/230 (12%)

Query: 558 GFKGEIELLKKLETQPRVVKLIDHEMDHGVLYVVME-CGDHDLSQTLAHRSGMPLDVEFV 616
           G + EI ++ KL T P ++ L +   +   LY+V+E     +L   L  R  +P + E +
Sbjct: 110 GIEREI-IIMKLITHPNIMALYEVWENKSELYLVLEYVEGGELFDYLIARGKLP-EQEAI 167

Query: 617 RYHAQEMLKCVKVVHDAGIVHSDLKPANFVFVKG--ILKIIDFGIANAVPEHTVNIYRET 674
            Y  Q +++ V   H+  I H DLKP N +  K    +KI DFG+A      T N   ET
Sbjct: 168 HYFKQ-IVQGVSYCHNFNICHRDLKPENLLLDKKNKTVKIADFGMAAL---ETTNRLLET 223

Query: 675 QIGTPNYMAPEALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQ 734
             G+P+Y +PE ++   Y             G PSD+WSCG I++ ++ G  P+     +
Sbjct: 224 SCGSPHYASPEIVMGQKYH------------GSPSDVWSCGIILFALLTGHLPFNDDNVR 271

Query: 735 NRLLAIMNPEVKIVYPEKTSNGDTVPKTAIDTMKACLERNPNKRWTVEEV 784
             LL + +   ++      SN   V K A D +   L  +P KR TV+++
Sbjct: 272 KLLLKVQHGRYQM-----PSN---VSKEAKDLISKILVVDPEKRITVDKI 313

>KLTH0D03454g Chr4 (327039..331340) [4302 bp, 1433 aa] {ON} similar to
            uniprot|Q01389 Saccharomyces cerevisiae YJL095W BCK1
            Mitogen-activated protein (MAP) kinase kinase kinase
            acting in the protein kinase C signaling pathway which
            controls cell integrity upon activation by Pkc1p
            phosphorylates downstream kinases Mkk1p and Mkk2p
          Length = 1433

 Score = 95.5 bits (236), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 76/304 (25%), Positives = 131/304 (43%), Gaps = 36/304 (11%)

Query: 497  SDDINGRKRPVVYVNGTEYEKLELLGRGGTSXXXXXXXXXXXXXXXLKRV------SFDE 550
            S + NG  +   ++ G      E++G+G                  +K+V      S DE
Sbjct: 1134 SKNSNGEYKEFAWIKG------EIIGKGSFGSVYLGLNVTTGEMMAVKQVEVPRYGSQDE 1187

Query: 551  FDDSSIDGFKGEIELLKKLETQPRVVKLIDHEMDHGVLYVVMECGDHDLSQTLAHRSGMP 610
               S ++  K E+  LK L+    +V+ +  E  + V  + +E        +L    G  
Sbjct: 1188 TTLSVLEALKSEVSTLKDLD-HVNIVQYLGFENKNHVYSLFLEYVAGGSVGSLIRLFGR- 1245

Query: 611  LDVEFVRYHAQEMLKCVKVVHDAGIVHSDLKPANFVF-VKGILKIIDFGIANAVPEHTVN 669
             D + +R+ A ++L+ +  +H  GI+H D+K  N +  V GI KI DFGI+    + + N
Sbjct: 1246 FDEDLIRFLAVQVLRGLAYLHSKGILHRDMKADNLLLDVDGICKISDFGIS----KKSNN 1301

Query: 670  IYRETQI---GTPNYMAPEALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRP 726
            IY  + +   GT  +MAPE +             ++       DIWS GC++ +M  G+ 
Sbjct: 1302 IYSNSDMTMRGTVFWMAPEMV------------DTKQGYSAKVDIWSLGCVVLEMFAGKR 1349

Query: 727  PYGGFQGQNRLLAIMNPEVKIVYPEKTSNGDTVPKTAIDTMKACLERNPNKRWTVEEVAN 786
            P+  F+    +  I   +     PE T     +   A   + AC E +P KR T +++ +
Sbjct: 1350 PWSNFEVVAAMFKIGKFKSAPPIPEDTQK--LLSAEAKSFLDACFEIDPEKRPTADDLLS 1407

Query: 787  GSFV 790
              F 
Sbjct: 1408 HPFC 1411

>KLTH0E11220g Chr5 (1005953..1005969,1006040..1006931) [909 bp, 302
           aa] {ON} highly similar to uniprot|P17157 Saccharomyces
           cerevisiae YPL031C PHO85 Cyclin-dependent kinase with
           ten cyclin partners involved in environmental stress
           response in phosphate-rich conditions Pho85p-Pho80p
           complex phosphorylates Pho4p which in turn represses
           PHO5
          Length = 302

 Score = 91.3 bits (225), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 84/309 (27%), Positives = 141/309 (45%), Gaps = 55/309 (17%)

Query: 513 TEYEKLELLGRGGTSXXXXXXXXXXXXXXXLKRVSFDEFDDSSIDGFKGEIELLKKLETQ 572
           +++++LE LG G  +               LK V  D  + +     + EI L+K+L+ +
Sbjct: 5   SQFKQLEKLGNGTYATVYKGLNKTTGIYVALKEVKLDSEEGTPSTAVR-EISLMKELKHE 63

Query: 573 PRVVKLIDHEMDHGVLYVVMECGDHDLSQTLAHR----SGMPLDVEFVRYHAQEMLKCVK 628
             +V+L D       L +V E  D+DL + +  R    +    ++  V+Y   ++L+ V 
Sbjct: 64  -NIVRLYDVIHTENKLTLVFEFMDNDLKKYMDSRIVGNTPYGFEMSLVKYFEWQLLQGVA 122

Query: 629 VVHDAGIVHSDLKPANFVFV-KGILKIIDFGIANA--VPEHTVNIYRETQIGTPNYMAPE 685
             H+  I+H DLKP N +   KG LK+ DFG+A A  +P +T +    +++ T  Y AP+
Sbjct: 123 FCHENRILHRDLKPQNLLINNKGQLKLGDFGLARAFGIPVNTFS----SEVVTLWYRAPD 178

Query: 686 ALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEV 745
            L+  + T++ +            DIWSCGCI+ +MI GRP + G   + +L  I   E 
Sbjct: 179 VLMG-SRTYSTS-----------IDIWSCGCILAEMITGRPLFPGTNDEEQLKLIF--ET 224

Query: 746 KIVYPEKTSNG-DTVPK---------------------------TAIDTMKACLERNPNK 777
                E+T  G  T+PK                           T ID +   L+ NP++
Sbjct: 225 MGTPTERTWPGVSTLPKYNPRLPQHLPKDLGALLQSQTREKMELTLIDLLYGLLQLNPDR 284

Query: 778 RWTVEEVAN 786
           R + ++  N
Sbjct: 285 RLSAKQALN 293

>ACL104C Chr3 complement(157357..160200) [2844 bp, 947 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YHR102W
           (KIC1)
          Length = 947

 Score = 95.1 bits (235), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 69/279 (24%), Positives = 127/279 (45%), Gaps = 26/279 (9%)

Query: 515 YEKLELLGRGGTSXXXXXXXXXXXXXXXLKRVSFDEFDDSSIDGFKGEIELLKKLETQPR 574
           +++ E++GRG                  +K ++ D  +D  ++  + EI+ L  L+  P 
Sbjct: 25  FKRTEVIGRGKFGVVYKAYHAKTKQVYAVKVLNLDCPEDE-VEDVQKEIQFLASLKQVPN 83

Query: 575 VVKLIDHEMDHGVLYVVME-CGDHDLSQTLAHRSGMPLDVEFVRYHAQEMLKCVKVVHDA 633
           + +     +    L+V+ME C    L   L  R G  +D +++    +++L  +  +H  
Sbjct: 84  ITRYYGSYLYDTKLWVIMEYCAGGSLRTLL--RPGK-IDEKYLGVIVRKLLIALVYIHKD 140

Query: 634 GIVHSDLKPANFVFV-KGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNY 692
            ++H D+K AN +   +G +K+ DFG+A  +     N  R+T  GTP +MAPE ++   Y
Sbjct: 141 NVIHRDIKAANVLITNEGHVKLCDFGVAAQL--TAANHKRQTMAGTPYWMAPEVIMEGVY 198

Query: 693 THNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEK 752
            + +A            DIWS G   Y++  G PPY   +    +  I   +     P +
Sbjct: 199 YNTKA------------DIWSLGITAYEIATGNPPYCDVEALRAMQLITKSK-----PPR 241

Query: 753 TSNGDTVPKTAIDTMKACLERNPNKRWTVEEVANGSFVK 791
               +  P    + +  CL+ +P +R T E++ +  FVK
Sbjct: 242 LEGRNYSPLLK-EFIALCLDEDPEERPTAEDLLSSKFVK 279

>NCAS0A05050 Chr1 complement(1002107..1004788) [2682 bp, 893 aa]
           {ON} Anc_2.496
          Length = 893

 Score = 94.7 bits (234), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 69/231 (29%), Positives = 108/231 (46%), Gaps = 31/231 (13%)

Query: 565 LLKKLETQPRVVKLIDHEMDHGVLYVVMECGDH-DLSQTLAHRSGMPLDVEFVRYHAQEM 623
           L+ K    P +V  ID  +  G L+V+ME  +   L+  + H     L    +    +E 
Sbjct: 658 LVMKGSRHPNIVNFIDSYLLDGDLWVIMEYMEGGSLTDVVTH---CILTEGQIGAVCRET 714

Query: 624 LKCVKVVHDAGIVHSDLKPANFVF-VKGILKIIDFGIANAVPEHTVNIYRETQIGTPNYM 682
           L  ++ +H  G++H D+K  N +  + G +K+ DFG    + E  +N+ R T +GTP +M
Sbjct: 715 LSGLQFLHSKGVLHRDIKSDNILLSISGDIKLTDFGFCAQINE--INLKRTTMVGTPYWM 772

Query: 683 APEALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIM- 741
           APE +             SR + G   DIWS G +I +MI G PPY        L  I  
Sbjct: 773 APEVV-------------SRKEYGPKVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIAT 819

Query: 742 --NPEVKIVYPEKTSNGDTVPKTAIDTMKACLERNPNKRWTVEEVANGSFV 790
              PE+K   PE   N   V +  +D    CL+ +P +R +  ++ N  F+
Sbjct: 820 NGTPELK--EPE---NLSAVLRNFLD---WCLKVDPEQRASATDLLNDVFI 862

>TBLA0I00280 Chr9 (42870..46820) [3951 bp, 1316 aa] {ON} Anc_2.496
            YHL007C
          Length = 1316

 Score = 95.1 bits (235), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 78/296 (26%), Positives = 132/296 (44%), Gaps = 34/296 (11%)

Query: 515  YEKLELLGRGGTSXXXXXXXXXXXXXXXLKRVSFDEFDDSSIDGFKGEIELLKKLETQPR 574
            Y  L  +G+G +                +K+++ ++   + +     EI ++K+      
Sbjct: 1027 YRNLVKIGQGASGGVYTAYEVGTNASVAVKQMNLEKQPKTEL--IINEIIVMKE-SKHKN 1083

Query: 575  VVKLIDHEMDHGVLYVVMECGDH-DLSQTLAHRSGMPLDVEFVRYHAQEMLKCVKVVHDA 633
            +V  ID  +  G L+VVME  +   L+  + H       +  V    +E L  +K +H  
Sbjct: 1084 IVNFIDSYLLKGDLWVVMEYMEGGSLTDVVTHCILTEGQIGAV---CRETLNGLKFLHSK 1140

Query: 634  GIVHSDLKPANFVF-VKGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNY 692
            G++H D+K  N +  ++G +K+ DFG    + E  V++ R T +GTP +MAPE +     
Sbjct: 1141 GVIHRDIKSDNILLSMQGDIKLTDFGFCAQINE--VHLKRTTMVGTPYWMAPEVV----- 1193

Query: 693  THNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIM---NPEVKIVY 749
                    SR + G   DIWS G +I +MI G PPY        L  I     PE+K   
Sbjct: 1194 --------SRKEYGPKVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIATNGTPELK--E 1243

Query: 750  PEKTSNGDTVPKTAIDTMKACLERNPNKRWTVEEVANGSFVKPVSVTHFFIRDLIE 805
            PEK S+         + + ACL+ +P  R T  E+     +  V+  +  +  L++
Sbjct: 1244 PEKLSS------ILHNFLDACLKVDPEVRATATELLETELITEVASENISLAPLVK 1293

>SAKL0B04488g Chr2 (395136..396242) [1107 bp, 368 aa] {ON} highly
           similar to uniprot|P14681 Saccharomyces cerevisiae
           YGR040W KSS1 Mitogen-activated protein kinase (MAPK)
           involved in signal transduction pathways that control
           filamentous growth and pheromone response
          Length = 368

 Score = 92.0 bits (227), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 73/270 (27%), Positives = 116/270 (42%), Gaps = 54/270 (20%)

Query: 562 EIELLKKLETQPRVVKLID-----HEMDHGVLYVVMECGDHDLSQTLAH---RSGMPLDV 613
           E++LLK       ++ ++D            +Y+V E  + DL + +A+    SG PL  
Sbjct: 59  ELKLLKFFHDHENIISVLDIVRPTSLAKFDAVYLVQELMETDLHRIIANSNGHSGTPLSD 118

Query: 614 EFVRYHAQEMLKCVKVVHDAGIVHSDLKPANFVFVKGI-LKIIDFGIANAVP------EH 666
           + ++Y   +ML+ +K +H A ++H DLKP+N +      LK+ DFG+A  +       E+
Sbjct: 119 DHIQYFVYQMLRALKAMHSAQVIHRDLKPSNLLLNSNCDLKVCDFGLARCLASSSNSREN 178

Query: 667 TVNIYRETQIGTPNYMAPEALVAMN-YTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGR 725
            V    E  + T  Y APE ++    YT                DIWSCGCI+ +MI G+
Sbjct: 179 LVGFMTE-YVATRWYRAPEIMLTFQEYT-------------TAMDIWSCGCILAEMITGK 224

Query: 726 PPYGGFQGQNRLLAIM------------------------NPEVKIVYPEKTSNGDTVPK 761
           P + G    ++L  I+                        N  ++   P K   G  V  
Sbjct: 225 PLFPGRDYHHQLWLILEVLGTPSYQDFEQIKSKRAKEYIANLPLRPRVPWKIVLGQHVNP 284

Query: 762 TAIDTMKACLERNPNKRWTVEEVANGSFVK 791
            AID +   L  NP+KR    E     ++K
Sbjct: 285 DAIDLLDKMLTFNPDKRIGASEALKHPYLK 314

>KAFR0H01530 Chr8 complement(283589..284509) [921 bp, 306 aa] {ON}
           Anc_8.482 YPL031C
          Length = 306

 Score = 90.9 bits (224), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 71/238 (29%), Positives = 117/238 (49%), Gaps = 25/238 (10%)

Query: 511 NGTEYEKLELLGRGGTSXXXXXXXXXXXXXXXLKRVSFDEFDDSSIDGFKGEIELLKKLE 570
           +G+++++LE LG G  +               LK V  D  + +     + EI L+K+L+
Sbjct: 3   SGSQFKQLEKLGNGTYATVYKGLNKTTGEFVALKEVKLDSEEGTPSTAIR-EISLMKELK 61

Query: 571 TQPRVVKLIDHEMDHGVLYVVMECGDHDLSQTLAHRSG----MPLDVEFVRYHAQEMLKC 626
            +  +V+L D       L +V E  D DL + +  R+     + L++  V+Y   ++L+ 
Sbjct: 62  HE-NIVRLYDVIHTENKLTLVFEYMDKDLKKYMDSRTVGNAPVGLELHLVKYFQWQLLEG 120

Query: 627 VKVVHDAGIVHSDLKPANFVF-VKGILKIIDFGIANA--VPEHTVNIYRETQIGTPNYMA 683
           +   H+  I+H DLKP N +   KG LKI DFG+A A  +P +T +    +++ T  Y A
Sbjct: 121 LAFCHENKILHRDLKPQNLLINKKGQLKIGDFGLARAFGIPVNTFS----SEVVTLWYRA 176

Query: 684 PEALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIM 741
           P+ L+            SR       DIWSCGCI+ +MI G+P + G   + +L  I 
Sbjct: 177 PDVLMG-----------SR-TYSTSIDIWSCGCILAEMITGKPLFPGTNEEEQLKLIF 222

>KAFR0D04100 Chr4 complement(809681..813034) [3354 bp, 1117 aa] {ON}
           Anc_1.52 YDR507C
          Length = 1117

 Score = 95.1 bits (235), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 77/281 (27%), Positives = 122/281 (43%), Gaps = 38/281 (13%)

Query: 519 ELLGRGGTSXXXXXXXXXXXXXXXLKRVSFDEFDDSSID------------GFKGEIELL 566
           E LG G T                +K +S   F+++S              G + EI ++
Sbjct: 22  ETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSLTTPDALPYGIEREI-II 80

Query: 567 KKLETQPRVVKLIDHEMDHGVLYVVMECGDHDLSQTLAHRSGMPLDVEFVRYHAQEMLKC 626
            KL   P V++L D    +  LY+V+E  +      L    G   + E +R+  Q ++  
Sbjct: 81  MKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQEAIRFFRQ-IIIG 139

Query: 627 VKVVHDAGIVHSDLKPANFVFV-KGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPE 685
           +   H  GIVH DLKP N +   K  +KI DFG+A    E  +    ET  G+P+Y APE
Sbjct: 140 ISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKL---LETSCGSPHYAAPE 196

Query: 686 ALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQG--QNRLLAIMNP 743
            +  + Y             G  SD+WSCG I++ ++ GR P+    G  +N LL + + 
Sbjct: 197 IVSGIPYH------------GFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSG 244

Query: 744 EVKIVYPEKTSNGDTVPKTAIDTMKACLERNPNKRWTVEEV 784
           E ++       + D +   A D +   L  +P KR    ++
Sbjct: 245 EFEM------PSDDEISHEAQDLLAKILTVDPEKRIRARDI 279

>KLLA0F11143g Chr6 complement(1026129..1028570) [2442 bp, 813 aa]
           {ON} similar to uniprot|P22216 Saccharomyces cerevisiae
           YPL153C RAD53 Protein kinase required for cell-cycle
           arrest in response to DNA damage activated by trans
           autophosphorylation when interacting with
           hyperphosphorylated Rad9p
          Length = 813

 Score = 94.4 bits (233), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 68/199 (34%), Positives = 102/199 (51%), Gaps = 20/199 (10%)

Query: 544 KRVSFDEFDDSSIDGFKGEIELLKKLETQPRVVKLIDHEMDHGVLYVVME-CGDHDLSQT 602
           KR   D+FD     G K E+++L+KL   PR+VKL D   D+   Y++ME     DL   
Sbjct: 225 KRKVMDKFD-----GVKRELDVLQKL-NHPRIVKLKDFFEDNDNYYMLMEFVSGGDLMDF 278

Query: 603 LAHRSGMPLDVEFVRYHAQEMLKCVKVVHDAGIVHSDLKPANFVFVKG---ILKIIDFGI 659
           +A    +  D    R   +++L+ VK +HD GI H DLKP N +  +    ++KI DFG+
Sbjct: 279 VAAHGTVGEDAG--REITRQVLEAVKYMHDQGISHRDLKPDNIMIEQDDPVLIKITDFGL 336

Query: 660 ANAVPEHTVNIYRETQIGTPNYMAPEALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIY 719
           A    ++T   +  T  GT  Y+APE +       N   + +R       D+WS GC++Y
Sbjct: 337 AKVQNQNT---FLNTFCGTLAYVAPEVIDG----KNAEDKTNRDLYSSLVDMWSIGCLVY 389

Query: 720 QMIYGRPPYGGFQGQNRLL 738
            ++ G  P+ G Q QN L 
Sbjct: 390 VILTGHLPFSG-QSQNELF 407

>SAKL0H11638g Chr8 complement(994049..994946,995016..995032) [915
           bp, 304 aa] {ON} highly similar to uniprot|P17157
           Saccharomyces cerevisiae YPL031C PHO85 Cyclin-dependent
           kinase with ten cyclin partners involved in
           environmental stress response in phosphate-rich
           conditions Pho85p-Pho80p complex phosphorylates Pho4p
           which in turn represses PHO5
          Length = 304

 Score = 90.5 bits (223), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 80/307 (26%), Positives = 136/307 (44%), Gaps = 51/307 (16%)

Query: 513 TEYEKLELLGRGGTSXXXXXXXXXXXXXXXLKRVSFDEFDDSSIDGFKGEIELLKKLETQ 572
           +++++LE LG G  +               LK V  D  + +     + EI L+K+L+ +
Sbjct: 5   SQFKQLEKLGNGTYATVYKGLNKTTGVYVALKEVKLDSEEGTPSTAIR-EISLMKELKHE 63

Query: 573 PRVVKLIDHEMDHGVLYVVMECGDHDLSQTLAHRSG----MPLDVEFVRYHAQEMLKCVK 628
             +V+L D       L +V E  D+DL + +  R+       L +  V+Y   ++L+ V 
Sbjct: 64  -NIVRLYDVIHTENKLTLVFEFMDNDLKKYMDSRAVGNTPQGLALPLVKYFEWQLLQGVA 122

Query: 629 VVHDAGIVHSDLKPANFVFV-KGILKIIDFGIANA--VPEHTVNIYRETQIGTPNYMAPE 685
             H+  I+H DLKP N +   KG LK+ DFG+A A  +P +T +    +++ T  Y AP+
Sbjct: 123 FCHENRILHRDLKPQNLLINNKGQLKLGDFGLARAFGIPVNTFS----SEVVTLWYRAPD 178

Query: 686 ALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIM---- 741
            L+            SR       DIWSCGCI+ +MI G+P + G   + +L  I     
Sbjct: 179 VLMG-----------SR-TYSTSIDIWSCGCILVEMITGKPLFPGTSDEEQLKLIFETMG 226

Query: 742 ----------------NPEVKIVYPE------KTSNGDTVPKTAIDTMKACLERNPNKRW 779
                           NP   I  P+      ++   +++    +D +   L+ NP  R 
Sbjct: 227 TPTERTWPGISSLPKYNPNFPIHLPKDLRAFLQSQTRESLDNNVVDLLHGLLQLNPEMRL 286

Query: 780 TVEEVAN 786
           + ++  N
Sbjct: 287 SAKQALN 293

>Kpol_2002.46 s2002 (95107..98478) [3372 bp, 1123 aa] {ON}
           (95107..98478) [3372 nt, 1124 aa]
          Length = 1123

 Score = 94.4 bits (233), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 71/236 (30%), Positives = 113/236 (47%), Gaps = 28/236 (11%)

Query: 553 DSSIDGFKGEIELLKKLETQPRVVKLIDHEMDHGVLYVVMECGDH-DLSQTLAHRSGMPL 611
           DS   G + EI ++ KL   P V++L D    +  LY+V+E  +  +L   L  +  +P 
Sbjct: 70  DSLSYGIEREI-IIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLP- 127

Query: 612 DVEFVRYHAQEMLKCVKVVHDAGIVHSDLKPANFVFVKGI-LKIIDFGIANAVPEHTVNI 670
           + E +R+  Q ++  +   H  GIVH DLKP N +    + +KI DFG+A    E  +  
Sbjct: 128 ENEAIRFFRQ-IIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMAALETEDKL-- 184

Query: 671 YRETQIGTPNYMAPEALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGG 730
             ET  G+P+Y APE +  + Y             G  +D+WSCG I++ ++ GR P+  
Sbjct: 185 -LETSCGSPHYAAPEIVSGLPYH------------GLETDVWSCGVILFALLTGRLPFDE 231

Query: 731 FQG--QNRLLAIMNPEVKIVYPEKTSNGDTVPKTAIDTMKACLERNPNKRWTVEEV 784
             G  +N LL +   E ++         D + K A D +   L  +P KR    E+
Sbjct: 232 EDGNIRNLLLKVQKGEFEM------PGDDEISKEAQDLLYKILVVDPEKRIKSREI 281

>CAGL0I07513g Chr9 (722045..725275) [3231 bp, 1076 aa] {ON} similar
           to uniprot|Q12236 Saccharomyces cerevisiae YOL100w PKH2
          Length = 1076

 Score = 94.4 bits (233), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 65/239 (27%), Positives = 111/239 (46%), Gaps = 32/239 (13%)

Query: 566 LKKLETQPRVVKLIDHEMDHGVLYVVMECGDHDLSQTLAHRSGMPLDVEFVRYHAQEMLK 625
           L++L     +VKL     D   LY ++E   +    ++  + G  L  +  RY++ +++ 
Sbjct: 234 LQRLNNSRGIVKLFFTFQDESSLYFLLEYAPNGDFLSVMKKYG-SLSEDCTRYYSAQIID 292

Query: 626 CVKVVHDAGIVHSDLKPANFVFVKGI-LKIIDFGIANAV---------PEHTVNIYRETQ 675
            +K +H  GI+H D+KP N +  K + +KI DFG A  +         PE  +    ++ 
Sbjct: 293 GIKYLHSKGIIHRDIKPENILLDKDMKVKITDFGTAKILEPKNEDEDNPEFNLLTRSKSF 352

Query: 676 IGTPNYMAPEALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQN 735
           +GT  Y++PE L       N +   +R       DIW+ GC+++QMI G+PP   F+  N
Sbjct: 353 VGTAEYVSPELL-------NDSYVDAR------CDIWAFGCMVFQMIAGKPP---FKATN 396

Query: 736 RLLAIMNPEVKIVYPEKTSNGDTVPKTAIDTMKACLERNPNKRWTVEEVANGSFVKPVS 794
             L      +K+ Y          P    D +K  L + P +R T+ ++    F K +S
Sbjct: 397 EYLTFQKV-MKVQYAFTAG----FPVVVRDLVKRILLKVPEQRLTIPQIEKHHFYKDIS 450

>Skud_16.251 Chr16 complement(457106..458006,458108..458124) [918
           bp, 305 aa] {ON} YPL031C (REAL)
          Length = 305

 Score = 90.1 bits (222), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 70/237 (29%), Positives = 118/237 (49%), Gaps = 25/237 (10%)

Query: 513 TEYEKLELLGRGGTSXXXXXXXXXXXXXXXLKRVSFDEFDDSSIDGFKGEIELLKKLETQ 572
           +++++LE LG G  +               LK V  D  + +     + EI L+K+L+ +
Sbjct: 5   SQFKQLEKLGNGTYATVYKGLNKTTGVYVALKEVKLDSEEGTPSTAIR-EISLMKELKHE 63

Query: 573 PRVVKLIDHEMDHGVLYVVMECGDHDLSQTLAHRS--GMP--LDVEFVRYHAQEMLKCVK 628
             +V+L D       L +V E  D+DL + +  R+    P  L++  V+Y   ++L+ + 
Sbjct: 64  -NIVRLYDVIHTENKLTLVFEFMDNDLKKYMDSRTVGNTPRGLELNLVKYFQWQLLQGLA 122

Query: 629 VVHDAGIVHSDLKPANFVF-VKGILKIIDFGIANA--VPEHTVNIYRETQIGTPNYMAPE 685
             H++ I+H DLKP N +   KG LK+ DFG+A A  +P +T +    +++ T  Y AP+
Sbjct: 123 FCHESKILHRDLKPQNLLINKKGQLKLGDFGLARAFGIPVNTFS----SEVVTLWYRAPD 178

Query: 686 ALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMN 742
            L+            SR       DIWSCGCI+ +MI G+P + G   + +L  I +
Sbjct: 179 VLMG-----------SR-TYSTSIDIWSCGCILAEMITGKPLFPGTNDEEQLKLIFD 223

>NDAI0K02100 Chr11 complement(469575..472304) [2730 bp, 909 aa] {ON}
           Anc_2.496
          Length = 909

 Score = 94.0 bits (232), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 72/231 (31%), Positives = 107/231 (46%), Gaps = 31/231 (13%)

Query: 565 LLKKLETQPRVVKLIDHEMDHGVLYVVMECGDH-DLSQTLAHRSGMPLDVEFVRYHAQEM 623
           L+ K    P +V  ID  +  G L+V+ME  +   L+  + H     L    +    +E 
Sbjct: 674 LVMKGSKHPNIVNFIDSYLLDGDLWVIMEYMEGGSLTDVVTH---CILTEGQIGAVCRET 730

Query: 624 LKCVKVVHDAGIVHSDLKPANFVF-VKGILKIIDFGIANAVPEHTVNIYRETQIGTPNYM 682
           L  ++ +H  G++H D+K  N +  + G +K+ DFG    V E T+   R T +GTP +M
Sbjct: 731 LSGLQFLHSKGVLHRDIKSDNILLSINGNIKLTDFGFCAQVNETTLK--RTTMVGTPYWM 788

Query: 683 APEALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIM- 741
           APE +             SR + G   DIWS G +I +MI G PPY        L  I  
Sbjct: 789 APEVV-------------SRKEYGPKVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIAT 835

Query: 742 --NPEVKIVYPEKTSNGDTVPKTAIDTMKACLERNPNKRWTVEEVANGSFV 790
              PE+K    EK S+   V K  +D    CL  NP++R +  E+    F+
Sbjct: 836 NGTPELK--EREKLSD---VLKHFLD---WCLSVNPDQRASATELLEDVFI 878

>TPHA0C01780 Chr3 complement(407048..407965) [918 bp, 305 aa] {ON}
           Anc_8.482 YPL031C
          Length = 305

 Score = 90.1 bits (222), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 82/304 (26%), Positives = 133/304 (43%), Gaps = 51/304 (16%)

Query: 513 TEYEKLELLGRGGTSXXXXXXXXXXXXXXXLKRVSFDEFDDSSIDGFKGEIELLKKLETQ 572
           +++++LE LG G  +               LK V  D  + +     + EI L+K+L+ +
Sbjct: 6   SQFKQLEKLGNGTYATVYKGLNKTTGIFVALKEVKLDSEEGTPSTAIR-EISLMKELKHE 64

Query: 573 PRVVKLIDHEMDHGVLYVVMECGDHDLSQTLAHR----SGMPLDVEFVRYHAQEMLKCVK 628
             +V+L D       L +V E  D DL   +  R    S   L++  V+Y   ++ + V 
Sbjct: 65  -NIVRLYDVIHTENKLTLVFEYMDKDLKNYMDSRTSGNSTRGLELSLVKYFQWQLFEGVT 123

Query: 629 VVHDAGIVHSDLKPANFVFV-KGILKIIDFGIANA--VPEHTVNIYRETQIGTPNYMAPE 685
             H+  I+H DLKP N +   KG LK+ DFG+A A  +P +T +    T++ T  Y AP+
Sbjct: 124 FCHENKILHRDLKPQNLLINNKGQLKLGDFGLARAFGIPVNTFS----TEVVTLWYRAPD 179

Query: 686 ALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRL---LAIMN 742
            L+            SR       D+WSCGCI+ +MI G+P + G   + +L     IM 
Sbjct: 180 VLMG-----------SR-SYSTSIDMWSCGCILAEMITGKPLFPGTNDEEQLKLIFDIMG 227

Query: 743 PEVKIVYPEKTS-----------------------NGDTVPKTAIDTMKACLERNPNKRW 779
              + ++P  TS                         + V    ID +   L+ NP+ R 
Sbjct: 228 TPDEQLWPAVTSLPKYNRNLPKKEPKDLKKLLQAHTKEIVDDQVIDLVTGLLQLNPDARL 287

Query: 780 TVEE 783
           T ++
Sbjct: 288 TAKQ 291

>NCAS0C02470 Chr3 complement(460460..461378,461483..461499) [936 bp,
           311 aa] {ON} Anc_8.482
          Length = 311

 Score = 90.1 bits (222), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 69/236 (29%), Positives = 118/236 (50%), Gaps = 25/236 (10%)

Query: 513 TEYEKLELLGRGGTSXXXXXXXXXXXXXXXLKRVSFDEFDDSSIDGFKGEIELLKKLETQ 572
           +++++LE LG G  +               LK V  D  + +     + EI L+K+L+ +
Sbjct: 5   SQFKQLEKLGNGTYATVYKGLNKTTGAYVALKEVKLDSEEGTPSTAIR-EISLMKELKHE 63

Query: 573 PRVVKLIDHEMDHGVLYVVMECGDHDLSQTLAHR----SGMPLDVEFVRYHAQEMLKCVK 628
             +V+L D       L +V E  D+DL + +  R    S   L++  V+Y   ++L+ + 
Sbjct: 64  -NIVRLYDVIHTENKLTLVFEYMDNDLKKYMDSRTVGNSPRGLELNLVKYFQWQLLEGLA 122

Query: 629 VVHDAGIVHSDLKPANFVF-VKGILKIIDFGIANA--VPEHTVNIYRETQIGTPNYMAPE 685
             H+  I+H DLKP N +   KG LK+ DFG+A A  +P +T +    +++ T  Y AP+
Sbjct: 123 FCHENKILHRDLKPQNLLINKKGALKLGDFGLARAFGIPVNTFS----SEVVTLWYRAPD 178

Query: 686 ALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIM 741
            L+  + T++ +            DIWSCGCI+ +MI G+P + G   + +L  I 
Sbjct: 179 VLMG-SRTYSTS-----------IDIWSCGCILAEMITGKPLFPGSNDEEQLKLIF 222

>NDAI0F04520 Chr6 complement(1098426..1099895) [1470 bp, 489 aa]
           {ON} Anc_1.24
          Length = 489

 Score = 92.4 bits (228), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 76/302 (25%), Positives = 135/302 (44%), Gaps = 34/302 (11%)

Query: 499 DINGRKRPVVYVNGTEYEKLELLGRGGTSXXXXXXXXXXXXXXXLKRVSFDEFDDSSIDG 558
           D+  +KRP      T Y   + +GRG                  +K V+  E  D  I+ 
Sbjct: 10  DLYNQKRP-----STIYSIQDCVGRGNFGDVYKAIDKLTGEIVAIKVVNL-ESSDEDIEL 63

Query: 559 FKGEIELLKKLETQPRVVKLIDHEMDHGVLYVVME-CGDHDLSQTLAHRSGMPLDVEFVR 617
              EI  L +L++ P +   I   ++   +++VME CG    S  + +     L  + V 
Sbjct: 64  IAQEIFFLAELKS-PYITNYITTMLEDVSMWIVMEYCGGGSCSDLIRYHYNEGLHEDKVA 122

Query: 618 YHAQEMLKCVKVVHDAGIVHSDLKPANFVFVK-GILKIIDFGIANAVPEHTVNIYRETQI 676
           +  + +L+ ++ +H+   +H D+K AN +    G++K+ DFG++  +        R T +
Sbjct: 123 FITKNVLRGLQYLHEQRKIHRDVKAANVLLTDDGLVKLADFGVSGQLRSTA---KRNTFV 179

Query: 677 GTPNYMAPEALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNR 736
           GTP +MAPE +   ++ +N+            +DIWS G  +Y+++ G PPY  +     
Sbjct: 180 GTPYWMAPEIISNSSHGYNE-----------KADIWSLGITVYELLKGCPPYAKYDAGKV 228

Query: 737 LLAIMNPEVKIVYPEKTSNGDTV--PKTAIDTMKACLERNPNKRWTVEEVANGSFVKPVS 794
           +  I         P+K      V     A   + ACL ++P++R T  E+    FVK + 
Sbjct: 229 MRNI---------PKKNLQDCMVSFSDAAKLFISACLIKDPDERPTATELLQQPFVKNIK 279

Query: 795 VT 796
           +T
Sbjct: 280 IT 281

>TDEL0B01540 Chr2 complement(272561..273458,273562..273578) [915 bp,
           304 aa] {ON} Anc_8.482 YPL031C
          Length = 304

 Score = 89.7 bits (221), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 69/236 (29%), Positives = 116/236 (49%), Gaps = 25/236 (10%)

Query: 513 TEYEKLELLGRGGTSXXXXXXXXXXXXXXXLKRVSFDEFDDSSIDGFKGEIELLKKLETQ 572
           +++++LE LG G  +               LK V  D  + +     + EI L+K+L+ +
Sbjct: 5   SQFKQLEKLGNGTYATVYKGLNKTTGVYVALKEVKLDSEEGTPSTAIR-EISLMKELKHE 63

Query: 573 PRVVKLIDHEMDHGVLYVVMECGDHDLSQTLAHRSG----MPLDVEFVRYHAQEMLKCVK 628
             +V+L D       L +V E  D+DL + +  R+       L++  V+Y   ++L+ V 
Sbjct: 64  -NIVRLYDVIHTENKLTLVFEYMDNDLKKYMDSRTVGNNPQGLELSLVKYFHWQLLEGVS 122

Query: 629 VVHDAGIVHSDLKPANFVFV-KGILKIIDFGIANA--VPEHTVNIYRETQIGTPNYMAPE 685
             H++ I+H DLKP N +   KG LK+ DFG+A A  +P +T +    +++ T  Y AP+
Sbjct: 123 FCHESKILHRDLKPQNLLINNKGQLKLGDFGLARAFGIPVNTFS----SEVVTLWYRAPD 178

Query: 686 ALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIM 741
            L+            SR       D+WSCGCI+ +MI G+P + G   + +L  I 
Sbjct: 179 VLMG-----------SR-TYSTSIDMWSCGCILAEMITGKPLFPGTNDEEQLKLIF 222

>CAGL0L12474g Chr12 complement(1347340..1348248) [909 bp, 302 aa]
           {ON} highly similar to uniprot|P17157 Saccharomyces
           cerevisiae YPL031c cyclin-dependent protein kinase
          Length = 302

 Score = 89.4 bits (220), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 69/240 (28%), Positives = 121/240 (50%), Gaps = 25/240 (10%)

Query: 510 VNGTEYEKLELLGRGGTSXXXXXXXXXXXXXXXLKRVSFDEFDDSSIDGFKGEIELLKKL 569
           ++ +++++LE LG G  +               LK V  D  + +     + EI L+K+L
Sbjct: 1   MSSSQFKQLEKLGNGTYATVYKGLNKSTGVYVALKEVKLDSEEGTPSTAIR-EISLMKEL 59

Query: 570 ETQPRVVKLIDHEMDHGVLYVVMECGDHDLSQTLAHRS--GMP--LDVEFVRYHAQEMLK 625
           +    +V+L D       L +V E  D+DL + +  R+    P  L++  V+Y   ++L+
Sbjct: 60  K-HDNIVRLYDVIHTENKLTLVFEYMDNDLKKYMDSRTVGNAPRGLEMNLVKYFQWQLLE 118

Query: 626 CVKVVHDAGIVHSDLKPANFVFVK-GILKIIDFGIANA--VPEHTVNIYRETQIGTPNYM 682
            +   H+  I+H DLKP N +  K G LK+ DFG+A A  +P +T +    +++ T  Y 
Sbjct: 119 GLAFCHENKILHRDLKPQNLLITKRGQLKLGDFGLARAFGIPVNTFS----SEVVTLWYR 174

Query: 683 APEALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMN 742
           AP+ L+  + T++ +            DIWSCGCI+ +MI G+P + G   + +L  I +
Sbjct: 175 APDVLMG-SRTYSTS-----------IDIWSCGCILAEMITGKPLFPGTNDEEQLKLIFD 222

>NDAI0A00660 Chr1 (121773..124841) [3069 bp, 1022 aa] {ON} Anc_1.52
          Length = 1022

 Score = 93.2 bits (230), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 68/231 (29%), Positives = 112/231 (48%), Gaps = 28/231 (12%)

Query: 558 GFKGEIELLKKLETQPRVVKLIDHEMDHGVLYVVMECGDH-DLSQTLAHRSGMPLDVEFV 616
           G + EI ++ KL   P V+ L D    +  LY+++E  +  +L   L  R  +P + E +
Sbjct: 76  GIEREI-IIMKLLRHPNVLSLYDVWETNSKLYMILEYAEKGELFNLLVERGPLP-EKEAI 133

Query: 617 RYHAQEMLKCVKVVHDAGIVHSDLKPANFVFVKGI-LKIIDFGIANAVPEHTVNIYRETQ 675
           R+  Q ++  +   H  GIVH DLKP N +    + +KI DFG+A      T +   ET 
Sbjct: 134 RFFRQ-IIIGISYCHALGIVHRDLKPENLLLDHKLNIKIADFGMAAL---ETKDKMLETS 189

Query: 676 IGTPNYMAPEALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQG-- 733
            G+P+Y APE +  + Y             G  SD+WSCG I++ ++ GR P+    G  
Sbjct: 190 CGSPHYAAPEIVSGVPYH------------GFQSDVWSCGVILFALLTGRLPFDEEDGNI 237

Query: 734 QNRLLAIMNPEVKIVYPEKTSNGDTVPKTAIDTMKACLERNPNKRWTVEEV 784
           +N LL + + E ++       + D + K A D +   L  +P +R    ++
Sbjct: 238 RNLLLKVQSGEYEM------PDDDEISKEAQDLIGRILTVDPEQRIKTRDI 282

>TPHA0I00920 Chr9 (204753..209057) [4305 bp, 1434 aa] {ON} Anc_1.271
            YJL095W
          Length = 1434

 Score = 93.6 bits (231), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 74/301 (24%), Positives = 130/301 (43%), Gaps = 30/301 (9%)

Query: 500  INGRKRPVVYVNGTEYEKLELLGRGGTSXXXXXXXXXXXXXXXLKRVSFDEFDDSS---- 555
            IN  K      N   + K E++G+G                  +K++    +   S    
Sbjct: 1120 INKSKNSRGEYNEFAWMKGEMIGKGSFGAVFLSLNITTGEMMAVKQIEVPSYGSQSETML 1179

Query: 556  --IDGFKGEIELLKKLETQPRVVKLIDHEMDHGVLYVVMECGDHDLSQTLAHRSGMPLDV 613
              ++  K E+  LK L+    +V+ +  EM H +  + +E        +L    G   D 
Sbjct: 1180 NTVEAMKSEVSTLKDLD-HLNIVQYLGFEMKHNIYSLFLEYVAGGSVGSLIRMYGR-FDD 1237

Query: 614  EFVRYHAQEMLKCVKVVHDAGIVHSDLKPANFVFVK-GILKIIDFGIANAVPEHTVNIYR 672
            + +R+   ++L+ +  +H  GI+H D+K  N +  + GI KI DFGI+    + + +IY 
Sbjct: 1238 KLIRHLTNQVLEGLSYLHSQGILHRDMKADNLLLDQDGICKISDFGIS----KKSEDIYS 1293

Query: 673  ETQI---GTPNYMAPEALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYG 729
             +++   GT  +MAPE +V     +N        KV    DIWS GC++ +M  G+ P+ 
Sbjct: 1294 NSEMTMRGTVFWMAPE-MVDTKQGYNA-------KV----DIWSLGCVVLEMFAGKRPWS 1341

Query: 730  GFQGQNRLLAIMNPEVKIVYPEKTSNGDTVPKTAIDTMKACLERNPNKRWTVEEVANGSF 789
             F+    +  I   +     PE T   D +  TA + +  C   +P +R T  ++    F
Sbjct: 1342 NFEVVTAMYKIGQSKSAPPIPEDTK--DLISPTAKNFLNQCFHIDPKERPTAGQLLEHPF 1399

Query: 790  V 790
             
Sbjct: 1400 C 1400

>Kwal_23.6325 s23 complement(1533223..1537851) [4629 bp, 1542 aa] {ON}
            YNR031C (SSK2) - A MAP kinase kinase kinase; activator of
            Pbs2p [contig 17] FULL
          Length = 1542

 Score = 93.6 bits (231), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 70/239 (29%), Positives = 115/239 (48%), Gaps = 30/239 (12%)

Query: 558  GFKGEIELLKKLETQPRVVKLIDHEMDHGVLYVVME-CGDHDLSQTLAHRSGMPLDVEFV 616
              K E+ +L+ L   P VV+    E+    + + ME C    L+Q L H  G   D    
Sbjct: 1294 AIKEEMSVLEML-NHPNVVQYYGVEVHRDKVNLFMEYCEGGSLAQLLEH--GRIEDEMVT 1350

Query: 617  RYHAQEMLKCVKVVHDAGIVHSDLKPANFVF-VKGILKIIDFGIANAVPEHTV---NIYR 672
            + +A +ML+ +  +H + +VH D+KP N +    G++K +DFG A ++  +     N+  
Sbjct: 1351 QIYALQMLEGLAYLHQSSVVHRDIKPENILLDFNGVIKYVDFGAARSLAANGTKAPNVGA 1410

Query: 673  E-------TQIGTPNYMAPEALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGR 725
            E       + +GTP YM+PE++              + K G   DIWS GC+I +M+ GR
Sbjct: 1411 EGKADGVNSMMGTPMYMSPESITG----------AKKGKFGS-GDIWSLGCVILEMVTGR 1459

Query: 726  PPYGGFQGQNRLLAIMNPEVKIVYPEKTSNGDTVPKTAIDTMKACLERNPNKRWTVEEV 784
             P+     +    AIM        P+  +  +  P+  ID +  CL+++PNKR T  E+
Sbjct: 1460 RPWFNLDNE---WAIMYHVAAGHVPQLPTKEELSPQ-GIDFLLRCLKQDPNKRSTAMEL 1514

>Suva_16.286 Chr16 complement(495354..496254,496351..496367) [918
           bp, 305 aa] {ON} YPL031C (REAL)
          Length = 305

 Score = 89.4 bits (220), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 70/237 (29%), Positives = 117/237 (49%), Gaps = 25/237 (10%)

Query: 513 TEYEKLELLGRGGTSXXXXXXXXXXXXXXXLKRVSFDEFDDSSIDGFKGEIELLKKLETQ 572
           +++++LE LG G  +               LK V  D  + +     + EI L+K+L+ +
Sbjct: 5   SQFKQLEKLGNGTYATVYKGLNKTTGVYVALKEVKLDSEEGTPSTAIR-EISLMKELKHE 63

Query: 573 PRVVKLIDHEMDHGVLYVVMECGDHDLSQTLAHRS--GMP--LDVEFVRYHAQEMLKCVK 628
             +V+L D       L +V E  D+DL + +  R+    P  L++  V+Y   ++L+ + 
Sbjct: 64  -NIVRLYDVIHTENKLTLVFEFMDNDLKKYMDSRTVGNTPRGLELNLVKYFQWQLLQGLA 122

Query: 629 VVHDAGIVHSDLKPANFVF-VKGILKIIDFGIANA--VPEHTVNIYRETQIGTPNYMAPE 685
             H+  I+H DLKP N +   KG LK+ DFG+A A  +P +T +    +++ T  Y AP+
Sbjct: 123 FCHENKILHRDLKPQNLLINKKGQLKLGDFGLARAFGIPVNTFS----SEVVTLWYRAPD 178

Query: 686 ALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMN 742
            L+            SR       DIWSCGCI+ +MI G+P + G   + +L  I +
Sbjct: 179 VLMG-----------SR-TYSTSIDIWSCGCILAEMITGKPLFPGTNDEEQLKLIFD 223

>Ecym_1058 Chr1 (105835..109329) [3495 bp, 1164 aa] {ON} similar to
           Ashbya gossypii AFR696C
          Length = 1164

 Score = 93.2 bits (230), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 71/236 (30%), Positives = 110/236 (46%), Gaps = 24/236 (10%)

Query: 558 GFKGEIELLKKLETQPRVVKLIDHEMDHGVLYVVMECGDH-DLSQTLAHRSGMPLDVEFV 616
           G + EI ++K L   P V++L D       LY+V+E  +  +L   L  R  +P + E V
Sbjct: 75  GIEREITIMKLL-NHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLP-ENEAV 132

Query: 617 RYHAQEMLKCVKVVHDAGIVHSDLKPANFVFV-KGILKIIDFGIANAVPEHTVNIYRETQ 675
           R+  Q ++  +   H  GIVH DLKP N +   K  +K+ DFG+A      + +   ET 
Sbjct: 133 RFFRQ-IIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAAL---ESKDKLLETS 188

Query: 676 IGTPNYMAPEALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQN 735
            G+P+Y APE +  + Y             G  SD+WSCG I+Y ++ GR P+    G  
Sbjct: 189 CGSPHYAAPEIVSGLPYH------------GFESDVWSCGVILYALLTGRLPFDEDDGNI 236

Query: 736 RLLAIMNPEVKIVYPEKTSNGDTVPKTAIDTMKACLERNPNKRWTVEEVANGSFVK 791
           R L +     +   P+K    D +   A D +   L  +P+ R    E+     +K
Sbjct: 237 RKLLLKVQSGEFEMPDK----DEISIEAQDLIAKILTVDPSGRIKTREILKHPLLK 288

>Ecym_3586 Chr3 complement(1112070..1115303) [3234 bp, 1077 aa] {ON}
           similar to Ashbya gossypii AFR335C
          Length = 1077

 Score = 92.8 bits (229), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 68/258 (26%), Positives = 112/258 (43%), Gaps = 40/258 (15%)

Query: 573 PRVVKLIDHEMDHGVLYVVMECGDHDLSQTLAHRSGMPLDVEFVRYHAQEMLKCVKVVHD 632
           P ++KL     D   LY ++E   +    ++  + G  L+ E  RY+  ++L  +  +H 
Sbjct: 263 PGIIKLFFTFQDEANLYFLLEYAPNGDFLSIMKKYG-SLNEECARYYGAQILNGIYFLHR 321

Query: 633 AGIVHSDLKPANFVFVKGI-LKIIDFGIA------NAVPEHTVNIYRETQIGTPNYMAPE 685
            GI+H D+KP N +  K + +K+ DFG A      +   E+ +    ++ +GT  Y++PE
Sbjct: 322 HGIIHRDIKPENILLDKSMKVKLTDFGTAKLLNRKDGTEEYDLTTRSKSFVGTAEYVSPE 381

Query: 686 ALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEV 745
            L               W V    DIW+ GCI++QMI G+PP   F+  N  L      +
Sbjct: 382 LL------------NDSW-VDHKCDIWAFGCILFQMIAGKPP---FKATNEYLTFQK-VM 424

Query: 746 KIVYPEKTSNGDTVPKTAIDTMKACLERNPNKRWTVEEVANGSFVKPVSVTHFFIRDL-I 804
           K+ Y          P    D +K  L + P  R T+ ++            H F  D+  
Sbjct: 425 KVQYAFTAG----FPMVVRDLVKQILVKKPEHRLTIPQIEK----------HLFFSDINF 470

Query: 805 ENSVRYGANQKEISSAKV 822
            +   + A   EI+  KV
Sbjct: 471 RDGSLWSAAAPEIAPYKV 488

>KAFR0K00700 Chr11 complement(153981..158126) [4146 bp, 1381 aa] {ON}
            Anc_7.86 YAL017W
          Length = 1381

 Score = 93.2 bits (230), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 69/246 (28%), Positives = 114/246 (46%), Gaps = 39/246 (15%)

Query: 553  DSSIDGFKGEIELLKKLETQPR--VVKLIDHEMDHGVLYVVM----ECGDHDLSQTLAHR 606
            D  +     EI+++  L  +P   +++L+D   D    Y+      E G  DL   +   
Sbjct: 1165 DRKLGTIPSEIQIMATLNKKPHENILRLLDFFEDDEYYYIETPVHGETGSIDLFDLIEFT 1224

Query: 607  SGMPLDVEF-VRYHAQEMLKCVKVVHDAGIVHSDLKPANFVFV-KGILKIIDFGIANAVP 664
            S M    EF ++   ++++  VK +HD GIVH D+K  N +   KG +KIIDFG A  V 
Sbjct: 1225 SNM---TEFEIKLLFKQVVSGVKHLHDQGIVHRDIKDENIIVDNKGFIKIIDFGSAAYVK 1281

Query: 665  EHTVNIYRETQIGTPNYMAPEALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYG 724
                +++    +GT +Y APE L    Y             GKP DIW+ G ++Y +++ 
Sbjct: 1282 SGPFDVF----VGTIDYAAPEVLGGNPYE------------GKPQDIWALGILLYTIVFK 1325

Query: 725  RPPYGGFQGQNRLLAIMNPEVKIVYPEKTSNGDTVPKTAIDTMKACLERNPNKRWTVEEV 784
              P+           I+  ++K   PE  S      +  I+ +K  L RN  KR T++++
Sbjct: 1326 ENPFYNID------EILEGDLKFNDPENIS------QDCIELIKLILNRNVFKRPTIDDI 1373

Query: 785  ANGSFV 790
             N  ++
Sbjct: 1374 YNDKWL 1379

>YPL031C Chr16 complement(492018..492918,493021..493037) [918 bp,
           305 aa] {ON}  PHO85Cyclin-dependent kinase, with ten
           cyclin partners; involved in regulating the cellular
           response to nutrient levels and environmental conditions
           and progression through the cell cycle
          Length = 305

 Score = 89.0 bits (219), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 70/237 (29%), Positives = 117/237 (49%), Gaps = 25/237 (10%)

Query: 513 TEYEKLELLGRGGTSXXXXXXXXXXXXXXXLKRVSFDEFDDSSIDGFKGEIELLKKLETQ 572
           +++++LE LG G  +               LK V  D  + +     + EI L+K+L+ +
Sbjct: 5   SQFKQLEKLGNGTYATVYKGLNKTTGVYVALKEVKLDSEEGTPSTAIR-EISLMKELKHE 63

Query: 573 PRVVKLIDHEMDHGVLYVVMECGDHDLSQTLAHRS--GMP--LDVEFVRYHAQEMLKCVK 628
             +V+L D       L +V E  D+DL + +  R+    P  L++  V+Y   ++L+ + 
Sbjct: 64  -NIVRLYDVIHTENKLTLVFEFMDNDLKKYMDSRTVGNTPRGLELNLVKYFQWQLLQGLA 122

Query: 629 VVHDAGIVHSDLKPANFVFVK-GILKIIDFGIANA--VPEHTVNIYRETQIGTPNYMAPE 685
             H+  I+H DLKP N +  K G LK+ DFG+A A  +P +T +    +++ T  Y AP+
Sbjct: 123 FCHENKILHRDLKPQNLLINKRGQLKLGDFGLARAFGIPVNTFS----SEVVTLWYRAPD 178

Query: 686 ALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMN 742
            L+            SR       DIWSCGCI+ +MI G+P + G   + +L  I +
Sbjct: 179 VLMG-----------SR-TYSTSIDIWSCGCILAEMITGKPLFPGTNDEEQLKLIFD 223

>KNAG0J01290 Chr10 complement(230493..232019) [1527 bp, 508 aa] {ON}
           
          Length = 508

 Score = 91.7 bits (226), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 73/249 (29%), Positives = 118/249 (47%), Gaps = 41/249 (16%)

Query: 549 DEFDDSSIDGFKGEIELLKKLETQPRVVKLIDHEMDHGVLYVVMEC--GDHDLSQTLAHR 606
           D+ D+ +I+    E  +L +LE  P +VKL     D   LY++++   G         H 
Sbjct: 177 DKPDNKNIERTFAEKTILSELE-HPNIVKLFYSFHDVSKLYLILQYVPGGELFFHLKEHG 235

Query: 607 SGMPLDVEFVRYHAQEMLKCVKVVHDAGIVHSDLKPANFVF-VKGILKIIDFGIA----- 660
           +   LD + V ++A E+   +K +HD GIV+ DLKP N +   +G L + DFG++     
Sbjct: 236 T---LDEDTVSFYAAEISCALKFLHDKGIVYRDLKPENCLLNDRGHLVLTDFGLSKKSLE 292

Query: 661 -NAVPEHTVNIYR-ETQIGTPNYMAPEALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCII 718
            N +     +++   + IGTP Y APE L  + Y  N              D +S GC++
Sbjct: 293 DNDMSNQVDDVFTLHSIIGTPEYAAPEILQGLPYNKN-------------CDWYSLGCLL 339

Query: 719 YQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEKTSNGDTVPKTAIDTMK----ACLERN 774
           + M+ G+PPY G           N +V I   +K  NG  +P    + MK      L+++
Sbjct: 340 FDMLVGKPPYTG----------TNHKVIINKIQKDKNGPKIPYYLSEGMKDMLNWLLKKD 389

Query: 775 PNKRWTVEE 783
             KRW V++
Sbjct: 390 KLKRWQVDK 398

>Ecym_2531 Chr2 (1034031..1034047,1034135..1035023) [906 bp, 301 aa]
           {ON} similar to Ashbya gossypii AGL242C 1-intron
          Length = 301

 Score = 89.0 bits (219), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 84/309 (27%), Positives = 139/309 (44%), Gaps = 55/309 (17%)

Query: 513 TEYEKLELLGRGGTSXXXXXXXXXXXXXXXLKRVSFDEFDDSSIDGFKGEIELLKKLETQ 572
           +++++LE LG G  +               LK V  D  + +     + EI L+K+L+ +
Sbjct: 5   SQFKQLEKLGNGTYATVYKGLNKTTGLYVALKEVKLDSEEGTPSTAIR-EISLMKELKHE 63

Query: 573 PRVVKLIDHEMDHGVLYVVMECGDHDLSQTLAHRSG--MP--LDVEFVRYHAQEMLKCVK 628
             +V+L D       L +V E  D+DL + +  R    MP  L++  V+Y   ++L+ V 
Sbjct: 64  -NIVRLYDVIHTENKLTLVFEFMDNDLKKFMDSRVDREMPRGLELSLVKYFQWQLLQGVA 122

Query: 629 VVHDAGIVHSDLKPANFVFV-KGILKIIDFGIANA--VPEHTVNIYRETQIGTPNYMAPE 685
             H+  I+H DLKP N +   KG LK+ DFG+A A  +P +T +    +++ T  Y AP+
Sbjct: 123 FCHENRILHRDLKPQNLLINNKGQLKLGDFGLARAFGIPVNTFS----SEVVTLWYRAPD 178

Query: 686 ALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIM---- 741
            L+            SR       DIWSCGCI+ +MI G+  + G     +L  I     
Sbjct: 179 VLMG-----------SR-SYCTSIDIWSCGCILAEMIMGKALFPGTNDDEQLKLIFETLG 226

Query: 742 ----------------NPEVKIVYPEK--------TSNGDTVPKTAIDTMKACLERNPNK 777
                           NP++ + YP K        T+N + +    I  +   L+ NP+ 
Sbjct: 227 TPTEQMWPGASQLPDYNPQIPL-YPPKDLKQLLQPTTN-EKISDILISLLHGLLQLNPDM 284

Query: 778 RWTVEEVAN 786
           R + ++  N
Sbjct: 285 RLSAQQALN 293

>Kwal_26.7788 s26 (511530..515333) [3804 bp, 1267 aa] {ON} YKL101W
           (HSL1) - Putative protein kinase homologous to S. pombe
           cdr1/nim1 [contig 55] FULL
          Length = 1267

 Score = 92.8 bits (229), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 68/230 (29%), Positives = 112/230 (48%), Gaps = 29/230 (12%)

Query: 558 GFKGEIELLKKLETQPRVVKLIDHEMDHGVLYVVMECGDH-DLSQTLAHRSGMPLDVEFV 616
           G + EI ++ KL + P V+ L +   +   L++V+E  D  +L   L  R  +P + E +
Sbjct: 103 GIEREI-IIMKLISHPNVMGLYEVWENKLELFLVLEYVDGGELFDYLVSRGRLP-EKEAI 160

Query: 617 RYHAQEMLKCVKVVHDAGIVHSDLKPANFVFVKG--ILKIIDFGIANAVPEHTVNIYRET 674
            Y  Q +++     H   I H DLKP N +  K    +KI DFG+A      T N   ET
Sbjct: 161 HYFRQ-IIEGTAYCHGFNICHRDLKPENLLLDKKNKRIKIADFGMAAL---QTSNKLLET 216

Query: 675 QIGTPNYMAPEALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQ 734
             G+P+Y +PE ++  NY             G PSD+WSCG I++ ++ G  P+     +
Sbjct: 217 SCGSPHYASPEIVMGKNYN------------GGPSDVWSCGIILFALLTGHLPFNDDNIK 264

Query: 735 NRLLAIMNPEVKIVYPEKTSNGDTVPKTAIDTMKACLERNPNKRWTVEEV 784
             LL +   + ++  P+  S+G      A D +   L  +P+KR ++ E+
Sbjct: 265 RLLLKVQAGKYQM--PQSVSSG------AQDLISRILVVDPDKRISINEI 306

>TDEL0C06490 Chr3 complement(1191461..1194922) [3462 bp, 1153 aa]
           {ON} Anc_1.52 YDR507C
          Length = 1153

 Score = 92.8 bits (229), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 85/303 (28%), Positives = 129/303 (42%), Gaps = 40/303 (13%)

Query: 500 INGRKRPVVYVNGTEYEKL-ELLGRGGTSXXXXXXXXXXXXXXXLKRVSFDEFD------ 552
           ++ R  P V  N     KL E LG G T                +K +S   F+      
Sbjct: 4   MSNRSVPTVKGNKIGPWKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKGSVK 63

Query: 553 DSSID---------GFKGEIELLKKLETQPRVVKLIDHEMDHGVLYVVMECGDH-DLSQT 602
           DSS+          G + EI ++ KL   P V++L D    +  LY+V+E     +L   
Sbjct: 64  DSSVAASTPDSLPYGIEREI-IIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNL 122

Query: 603 LAHRSGMPLDVEFVRYHAQEMLKCVKVVHDAGIVHSDLKPANFVFV-KGILKIIDFGIAN 661
           L  R  +P + E +R+  Q ++  +   H  GIVH DLKP N +   K  +KI DFG+A 
Sbjct: 123 LVERGPLP-EKEAIRFFRQ-IVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAA 180

Query: 662 AVPEHTVNIYRETQIGTPNYMAPEALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQM 721
              E  +    ET  G+P+Y APE +  + Y             G  SD+WSCG I++ +
Sbjct: 181 LETEDKL---LETSCGSPHYAAPEIVSGIPYH------------GFASDVWSCGVILFAL 225

Query: 722 IYGRPPYGGFQGQNRLLAIMNPEVKIVYPEKTSNGDTVPKTAIDTMKACLERNPNKRWTV 781
           + GR P+    G  R L +     +   P      D +   A D +   L  +P +R   
Sbjct: 226 LTGRLPFDDEDGNIRNLLLQVQSGRYEMP----GDDEISPDAQDLIARILTVDPEQRIKA 281

Query: 782 EEV 784
            ++
Sbjct: 282 RDI 284

>TBLA0I01150 Chr9 complement(235187..240424) [5238 bp, 1745 aa] {ON}
           Anc_2.479 YKL101W
          Length = 1745

 Score = 93.2 bits (230), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 71/236 (30%), Positives = 112/236 (47%), Gaps = 29/236 (12%)

Query: 558 GFKGEIELLKKLETQPRVVKLIDHEMDHGVLYVVMECGDH-DLSQTLAHRSGMPLDVEFV 616
           G + EI ++K L + P V+ L +   +   LY+V+E  D  +L   L  R  +P + E V
Sbjct: 145 GIEREIVIMK-LISHPNVMGLYEVWENKSELYLVLEYVDGGELFDYLVSRGKLP-EREAV 202

Query: 617 RYHAQEMLKCVKVVHDAGIVHSDLKPANFVFVKG--ILKIIDFGIANAVPEHTVNIYRET 674
            Y  Q +++ V   H   I H DLKP N +  K   I+KI DFG+A        +    T
Sbjct: 203 HYFKQ-IIQGVAYCHAFNICHRDLKPENLLLDKKNKIIKIADFGMAAL---EVSDKLLST 258

Query: 675 QIGTPNYMAPEALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQ 734
             G+P+Y +PE ++  +Y             G P+D+WSCG I++ ++ G  P+     +
Sbjct: 259 SCGSPHYASPEIVMGKSYH------------GSPTDVWSCGIILFALLTGHLPFNHDNIK 306

Query: 735 NRLLAIMNPEVKIVYPEKTSNGDTVPKTAIDTMKACLERNPNKRWTVEEVANGSFV 790
             LL + +     VY   +   D  P  A D +   L  +P+KR T  E+ N S +
Sbjct: 307 KLLLKVQSG----VYHMPS---DLSPD-AKDLISKILVVDPDKRLTTTEILNHSLI 354

>TDEL0A02550 Chr1 (457841..461950) [4110 bp, 1369 aa] {ON} Anc_2.479
           YKL101W
          Length = 1369

 Score = 92.4 bits (228), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 70/230 (30%), Positives = 108/230 (46%), Gaps = 29/230 (12%)

Query: 558 GFKGEIELLKKLETQPRVVKLIDHEMDHGVLYVVMECGDH-DLSQTLAHRSGMPLDVEFV 616
           G + EI ++K L +   V+ L +   +   LY+V+E  D  +L   L  R G   + E V
Sbjct: 162 GIEREIVIMK-LISHANVLGLYEVWENKSELYLVLEYVDGGELFDYLVSR-GRLCEREAV 219

Query: 617 RYHAQEMLKCVKVVHDAGIVHSDLKPANFVFVK--GILKIIDFGIANAVPEHTVNIYRET 674
            Y  Q +++ V   H   I H DLKP N +  K    +KI DFG+A        N   +T
Sbjct: 220 HYFKQ-IIQGVSYCHAFNICHRDLKPENLLLDKKNSTIKIADFGMAAL---EVSNKLLQT 275

Query: 675 QIGTPNYMAPEALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQ 734
             G+P+Y +PE ++   Y             G PSD+WSCG I++ ++ G  P+     +
Sbjct: 276 SCGSPHYASPEIVMGKQYH------------GGPSDVWSCGIILFALLTGHLPFNDDSIK 323

Query: 735 NRLLAIMNPEVKIVYPEKTSNGDTVPKTAIDTMKACLERNPNKRWTVEEV 784
             LL + + + ++  P+  S      K A D +   L  NP KR T EE+
Sbjct: 324 KLLLKVQSGKYQM--PQNLS------KEAQDLIAKILTVNPAKRLTTEEI 365

>Ecym_5505 Chr5 (1027605..1030616) [3012 bp, 1003 aa] {ON} similar
           to Ashbya gossypii ACL104C
          Length = 1003

 Score = 92.0 bits (227), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 69/279 (24%), Positives = 122/279 (43%), Gaps = 26/279 (9%)

Query: 515 YEKLELLGRGGTSXXXXXXXXXXXXXXXLKRVSFDEFDDSSIDGFKGEIELLKKLETQPR 574
           + + E++GRG                  +K ++ D  +D  ++  + E++ L  L+  P 
Sbjct: 23  FRRTEIVGRGKFGVVYKAYHVKTKQVYAIKVLNLDCPEDE-VEDVQKEVQFLSSLKQVPN 81

Query: 575 VVKLIDHEMDHGVLYVVME-CGDHDLSQTLAHRSGMPLDVEFVRYHAQEMLKCVKVVHDA 633
           + +     +    L+V+ME C    L   L  R G  +D +++    + +L  +  +H  
Sbjct: 82  ITQYYGSFLYETKLWVIMEYCAGGSLRTLL--RPG-KIDEKYLGVIVRNLLVALLYIHKD 138

Query: 634 GIVHSDLKPANFVFVKGI-LKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNY 692
            ++H D+K AN +   G  +K+ DFG+A  +   T N  R+T  GTP +MAPE ++   Y
Sbjct: 139 NVIHRDIKAANVLITNGGHVKLCDFGVAAQL--TTANHKRQTMAGTPYWMAPEVIMEGVY 196

Query: 693 THNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEK 752
            + +A            DIWS G   Y++  G PPY   +    +  I   +     P +
Sbjct: 197 YNTKA------------DIWSLGITTYEIATGNPPYCDVEALRAMQLITKSK-----PPR 239

Query: 753 TSNGDTVPKTAIDTMKACLERNPNKRWTVEEVANGSFVK 791
               +  P    + +  CL+ +P  R T EE+     VK
Sbjct: 240 LEGRNYSPLLK-EFIALCLDEDPEARPTAEELLTTKLVK 277

>SAKL0C09174g Chr3 complement(833618..836833) [3216 bp, 1071 aa]
           {ON} similar to uniprot|Q12236 YOL100W Saccharomyces
           cerevisiae YOL100W PKH2 Serine/threonine protein kinase
           involved in sphingolipid-mediated signaling pathway that
           controls endocytosis
          Length = 1071

 Score = 92.0 bits (227), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 67/240 (27%), Positives = 110/240 (45%), Gaps = 32/240 (13%)

Query: 562 EIELLKKLETQPRVVKLIDHEMDHGVLYVVMECGDHDLSQTLAHRSGMPLDVEFVRYHAQ 621
           E   L++L     V+KL     D   LY ++E   +    ++  + G  L+ E  RY+  
Sbjct: 230 EKNTLQRLNNSRGVIKLYFTFQDEASLYFLLEYAPNGDFLSVMKKFG-SLNEECCRYYGA 288

Query: 622 EMLKCVKVVHDAGIVHSDLKPANFVFVKGI-LKIIDFGIANAV---PEHTVNIYRETQ-- 675
           +ML  +  +H  G+VH D+KP N +  + + +K+ DFG A  +    +   N+ ++++  
Sbjct: 289 QMLDAIDFIHKNGVVHRDIKPENILLDEHMKVKLTDFGTAKLLDRDEKSGYNLLKKSRSF 348

Query: 676 IGTPNYMAPEALV--AMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQG 733
           +GT  Y++PE L    +NY                 DIW+ GCI+YQMI G+PP   F+ 
Sbjct: 349 VGTAEYVSPELLNDNCVNYK---------------CDIWAFGCILYQMIAGKPP---FKA 390

Query: 734 QNRLLAIMNPEVKIVYPEKTSNGDTVPKTAIDTMKACLERNPNKRWTVEEVANGSFVKPV 793
            N  L      +K+ Y          P    D +K  L ++P  R    +V +  F K V
Sbjct: 391 TNEYLTFQK-VMKVQYAFTAG----FPLVIRDLVKQLLVKSPEARLNASQVKSHHFFKSV 445

>Ecym_7392 Chr7 complement(803240..807544) [4305 bp, 1434 aa] {ON}
           similar to Ashbya gossypii ABL034W
          Length = 1434

 Score = 92.0 bits (227), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 70/230 (30%), Positives = 110/230 (47%), Gaps = 29/230 (12%)

Query: 558 GFKGEIELLKKLETQPRVVKLIDHEMDHGVLYVVME-CGDHDLSQTLAHRSGMPLDVEFV 616
           G + EI ++ KL + P V+ L +   +   LY+V+E     +L   L  R  +P + E V
Sbjct: 113 GIEREI-IIMKLISHPNVMALYEVWENKPELYLVLEYVEGGELFDYLISRGKLP-EQEAV 170

Query: 617 RYHAQEMLKCVKVVHDAGIVHSDLKPANFVFVKGIL--KIIDFGIANAVPEHTVNIYRET 674
            Y  Q +++ V   H   I H DLKP N +  K  L  KI DFG+A      T +   ET
Sbjct: 171 HYFKQ-IVQGVSYCHHFNICHRDLKPENLLLDKKNLSVKIADFGMAAL---ETTDKLLET 226

Query: 675 QIGTPNYMAPEALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQ 734
             G+P+Y +PE ++   Y             G PSD+WSCG I++ ++ G  P+     +
Sbjct: 227 SCGSPHYASPEIVMGQKYH------------GSPSDVWSCGIILFALLTGHLPFNDDNVK 274

Query: 735 NRLLAIMNPEVKIVYPEKTSNGDTVPKTAIDTMKACLERNPNKRWTVEEV 784
             LL + + + ++  P+  SN       A D +   L  +P  R T++EV
Sbjct: 275 KLLLKVQSGKYQM--PQNISN------EAKDLIAKILIVDPAMRITIDEV 316

>KLLA0E21693g Chr5 complement(1936438..1939488) [3051 bp, 1016 aa]
           {ON} weakly similar to uniprot|P38692 Saccharomyces
           cerevisiae YHR102W KIC1 Protein kinase of the PAK/Ste20
           kinase family required for cell integrity possibly
           through regulating 1 6-beta-glucan levels in the wall
           physically interacts with Cdc31p (centrin) which is a
           component of the spindle pole body
          Length = 1016

 Score = 91.7 bits (226), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 65/279 (23%), Positives = 122/279 (43%), Gaps = 26/279 (9%)

Query: 515 YEKLELLGRGGTSXXXXXXXXXXXXXXXLKRVSFDEFDDSSIDGFKGEIELLKKLETQPR 574
           +++ E++GRG                  +K ++ D  +D  ++  + EI+ L  L+  P 
Sbjct: 16  FKRKEIIGRGKFGVVYKAFHVKTQQVYAIKVLNLDNTEDE-VEDIRKEIQFLSSLKQTPN 74

Query: 575 VVKLIDHEMDHGVLYVVME-CGDHDLSQTLAHRSGMPLDVEFVRYHAQEMLKCVKVVHDA 633
           +       +    L+V+ME C    L   L  R G+ ++ +++    +E+L  +  +H  
Sbjct: 75  ITHYYGSYLIDTKLWVIMEYCAGGSLRTLL--RPGI-IEEKYIGVIMREILVALISIHRD 131

Query: 634 GIVHSDLKPANFVFVK-GILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNY 692
            ++H D+K AN +    G +K+ DFG+A  + +  +   R+T  GTP +MAPE ++   Y
Sbjct: 132 NVIHRDIKAANILIANNGSVKLCDFGVAAQLSQSMLK--RQTMAGTPYWMAPEVIMEGVY 189

Query: 693 THNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEK 752
              +             DIWS G   Y++  G PPY   +    +  I   +     P +
Sbjct: 190 YDTKV------------DIWSLGITAYEIATGNPPYCHMEAIRAMQMITKSK-----PPR 232

Query: 753 TSNGDTVPKTAIDTMKACLERNPNKRWTVEEVANGSFVK 791
              G    +   + +  CL+ +P +R   EE+     +K
Sbjct: 233 LE-GREYSQPLKEFIALCLDEDPKERPYAEELFKSKLIK 270

>TPHA0E03640 Chr5 complement(769962..773375) [3414 bp, 1137 aa] {ON}
           Anc_1.52 YDR507C
          Length = 1137

 Score = 92.0 bits (227), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 69/230 (30%), Positives = 105/230 (45%), Gaps = 26/230 (11%)

Query: 558 GFKGEIELLKKLETQPRVVKLIDHEMDHGVLYVVMECGDHDLSQTLAHRSGMPLDVEFVR 617
           G + EI ++ KL     V++L D    +  LY+V+E  +      L    G   + E VR
Sbjct: 89  GIEREI-IIMKLLNHTNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLAENEAVR 147

Query: 618 YHAQEMLKCVKVVHDAGIVHSDLKPANFVFV-KGILKIIDFGIANAVPEHTVNIYRETQI 676
           +  Q ++  +   H  GIVH DLKP N +   K  +KI DFG+A    E  +    ET  
Sbjct: 148 FFRQ-IIIGMSYCHALGIVHRDLKPENILLDHKSNIKIADFGMAALETEDKL---LETSC 203

Query: 677 GTPNYMAPEALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQG--Q 734
           G+P+Y APE +  + Y             G  +DIWSCG I++ ++ GR P+    G  +
Sbjct: 204 GSPHYAAPEIVSGLPYN------------GLETDIWSCGVILFALLTGRLPFDEEDGNIR 251

Query: 735 NRLLAIMNPEVKIVYPEKTSNGDTVPKTAIDTMKACLERNPNKRWTVEEV 784
           N LL +   E ++         D +   A D +   L  NP +R    E+
Sbjct: 252 NLLLKVQKGEFEM------PGSDELSLEAQDLIGKILTVNPKQRIKTREI 295

>TDEL0A06220 Chr1 (1088622..1091006) [2385 bp, 794 aa] {ON}
           Anc_8.676 YPL153C
          Length = 794

 Score = 91.3 bits (225), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 71/248 (28%), Positives = 114/248 (45%), Gaps = 17/248 (6%)

Query: 554 SSIDGFKGEIELLKKLETQPRVVKLIDHEMDHGVLYVVME-CGDHDLSQTLAHRSGMPLD 612
            ++DG   E+E+L+KL   P++V+L     D    Y++ME     DL   +A    +  D
Sbjct: 231 GNMDGVTRELEVLRKL-NHPKIVRLKGFYEDDEFYYLLMEFVSGGDLMDFVAAHGSVGED 289

Query: 613 VEFVRYHAQEMLKCVKVVHDAGIVHSDLKPANFVFVKG---ILKIIDFGIANAVPEHTVN 669
               R   +++L+ VK +H  GI H DLKP N +  +    ++KI DFG+A      T  
Sbjct: 290 AG--REITRQVLEGVKYIHSQGISHRDLKPDNILIEQDDPVLVKITDFGLAKVQGNGT-- 345

Query: 670 IYRETQIGTPNYMAPEALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYG 729
            + +T  GT  Y+APE +       N    + R +     D+WS GC++Y ++ G  P+ 
Sbjct: 346 -FMKTFCGTLAYVAPEVIAG---KANAEENEKRNEYSSLVDMWSMGCLVYVILTGHLPFS 401

Query: 730 GFQGQNRLLAIMNPEVKIVYPEKTSNGDTVPKTAIDTMKACLERNPNKRWTVEEVANGSF 789
           G   +     I N      Y E       +   A D + + L+ NPN R T ++     +
Sbjct: 402 GSTQEQLYKQIKNGS----YHEGPLKDFRISDEARDFIDSLLQVNPNARPTAKKALEHPW 457

Query: 790 VKPVSVTH 797
           +K   V H
Sbjct: 458 IKMGHVAH 465

>KLLA0C01650g Chr3 (128119..131457) [3339 bp, 1112 aa] {ON} similar
           to uniprot|Q12263 Saccharomyces cerevisiae YDR507C
          Length = 1112

 Score = 91.7 bits (226), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 70/229 (30%), Positives = 106/229 (46%), Gaps = 24/229 (10%)

Query: 558 GFKGEIELLKKLETQPRVVKLIDHEMDHGVLYVVMECGDH-DLSQTLAHRSGMPLDVEFV 616
           G + EI ++ KL   P V++L D       LY+V+E  +  +L   L  R  +P + E V
Sbjct: 72  GIEREI-IIMKLLNHPNVLRLYDVWETSKDLYMVLEYVEKGELFNLLVERGPLP-ENEAV 129

Query: 617 RYHAQEMLKCVKVVHDAGIVHSDLKPANFVFV-KGILKIIDFGIANAVPEHTVNIYRETQ 675
           R+  Q ++  +   H  GIVH DLKP N +   K  +K+ DFG+A      + +   ET 
Sbjct: 130 RFFRQ-IIIGISYCHALGIVHRDLKPENLLLDHKFNVKLADFGMAAL---ESKDKLLETS 185

Query: 676 IGTPNYMAPEALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQN 735
            G+P+Y APE +  + Y             G  SD+WSCG I+Y ++ GR P+    G  
Sbjct: 186 CGSPHYAAPEIVSGLPYH------------GFESDVWSCGVILYALLTGRLPFDEEDGNI 233

Query: 736 RLLAIMNPEVKIVYPEKTSNGDTVPKTAIDTMKACLERNPNKRWTVEEV 784
           R L +     K   P      D +   A D +   L  +P +R    E+
Sbjct: 234 RNLLLKVQSGKFEMP----GDDEISSEAQDLIARILTVDPEQRIKTREI 278

>Kwal_26.7355 s26 (326867..331207) [4341 bp, 1446 aa] {ON} YJL095W
            (BCK1) - MEKK serine/threonine kinase [contig 48] FULL
          Length = 1446

 Score = 91.7 bits (226), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 74/304 (24%), Positives = 128/304 (42%), Gaps = 36/304 (11%)

Query: 497  SDDINGRKRPVVYVNGTEYEKLELLGRGGTSXXXXXXXXXXXXXXXLKRV------SFDE 550
            S + NG  +   ++ G      E++G+G                  +K+V      S DE
Sbjct: 1134 SKNSNGEYKEFAWIKG------EMIGKGSFGSVFLGLNVTTGEMIAVKQVEVPRYGSQDE 1187

Query: 551  FDDSSIDGFKGEIELLKKLETQPRVVKLIDHEMDHGVLYVVMECGDHDLSQTLAHRSGMP 610
               S ++  + E+  LK L+    +V+ +  E  + V  + +E        +L    G  
Sbjct: 1188 TTLSVLEALRSEVATLKDLD-HTNIVQYLGFENKNYVYSLFLEYVAGGSVGSLIRLYGK- 1245

Query: 611  LDVEFVRYHAQEMLKCVKVVHDAGIVHSDLKPANFVF-VKGILKIIDFGIANAVPEHTVN 669
             D   +R+ A ++L+ +  +H   I+H D+K  N +  V GI KI DFGI+    + + N
Sbjct: 1246 FDENLIRFLAVQVLRGLSYLHSKKILHRDMKADNLLLDVDGICKISDFGIS----KKSNN 1301

Query: 670  IYRETQI---GTPNYMAPEALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRP 726
            IY  + +   GT  +MAPE +             ++       DIWS GC++ +M  G+ 
Sbjct: 1302 IYSNSDMTMRGTVFWMAPEMV------------DTKQGYSAKVDIWSLGCVVLEMFAGKR 1349

Query: 727  PYGGFQGQNRLLAIMNPEVKIVYPEKTSNGDTVPKTAIDTMKACLERNPNKRWTVEEVAN 786
            P+   +    +  I   +     PE T     +     + + AC E NP KR T +E+ +
Sbjct: 1350 PWSNLEVVAAMFKIGKFKSAPPIPEDTQK--IISAEGKEFLDACFEINPEKRPTADELLS 1407

Query: 787  GSFV 790
              F 
Sbjct: 1408 HPFC 1411

>ZYRO0A03894g Chr1 (307915..309273) [1359 bp, 452 aa] {ON} similar
           to uniprot|P38070 Saccharomyces cerevisiae YBR028C
           Hypothetical ORF
          Length = 452

 Score = 89.7 bits (221), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 70/226 (30%), Positives = 106/226 (46%), Gaps = 42/226 (18%)

Query: 572 QPRVVKLIDHEMDHGVLYVVME-CGDHDLSQTLAHRSGMPLDVEFVRYHAQEMLKCVKVV 630
            P VVKL     D+  LY++++     +L   L  R    LD +   ++A E+   +K +
Sbjct: 144 HPNVVKLFYTFHDNSRLYLLLQYIPGGELFYHLKERG--TLDEDTAAFYAAEISCALKFL 201

Query: 631 HDAGIVHSDLKPANFVF-VKGILKIIDFGIAN---------AVPEHTVNIYRETQIGTPN 680
           H+ GIV+ DLKP N +    G L + DFG++          + PE    ++  + IGTP 
Sbjct: 202 HEKGIVYRDLKPENCLLDADGHLVLTDFGLSKKSVDDNNSLSAPEDVSVLH--SIIGTPE 259

Query: 681 YMAPEALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAI 740
           Y APE L    YT N              D +S GC++Y M+ G+PPY G          
Sbjct: 260 YCAPEILKGEPYTRN-------------CDWYSLGCLVYDMLVGKPPYTG---------- 296

Query: 741 MNPEVKIVYPEKTSNGDTVPKTAIDTMK----ACLERNPNKRWTVE 782
           +N +V +   +K   G  +P    D MK    A L+++ NKRW V+
Sbjct: 297 VNHKVILNKIQKEKQGPRLPYYLSDGMKDWLGALLKKDCNKRWDVD 342

>NCAS0B08600 Chr2 (1649375..1652728) [3354 bp, 1117 aa] {ON}
           Anc_5.591 YDR466W
          Length = 1117

 Score = 91.3 bits (225), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 68/231 (29%), Positives = 111/231 (48%), Gaps = 28/231 (12%)

Query: 558 GFKGEIELLKKLETQPRVVKLIDHEMDHGVLYVVMECGDH-DLSQTLAHRSGMPLDVEFV 616
           G + EI ++ KL     V+ L D    +  LY+++E  +  +L   L  +  +P + E V
Sbjct: 80  GIEREI-IIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLP-EKEAV 137

Query: 617 RYHAQEMLKCVKVVHDAGIVHSDLKPANFVFV-KGILKIIDFGIANAVPEHTVNIYRETQ 675
           R+  Q ++  +   H  GIVH DLKP N +   K  +KI DFG+A    E  +    ET 
Sbjct: 138 RFFRQ-IIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKL---LETS 193

Query: 676 IGTPNYMAPEALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQG-- 733
            G+P+Y APE +  + Y             G  SD+WSCG I++ ++ GR P+    G  
Sbjct: 194 CGSPHYAAPEIVSGIPYH------------GFESDVWSCGVILFALLTGRLPFDEEDGNI 241

Query: 734 QNRLLAIMNPEVKIVYPEKTSNGDTVPKTAIDTMKACLERNPNKRWTVEEV 784
           +N LL + + + ++       + D + + A D +   L  +P KR    E+
Sbjct: 242 RNLLLKVQSGQFEM------PDDDEMSRDAQDLISRILTVDPTKRIKTREI 286

>Skud_8.39 Chr8 complement(76730..79501) [2772 bp, 923 aa] {ON}
           YHL007C (REAL)
          Length = 923

 Score = 91.3 bits (225), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 67/244 (27%), Positives = 112/244 (45%), Gaps = 27/244 (11%)

Query: 565 LLKKLETQPRVVKLIDHEMDHGVLYVVMECGDH-DLSQTLAHRSGMPLDVEFVRYHAQEM 623
           L+ K    P +V  ID  +  G L+V+ME  +   L+  + H     L    +    +E 
Sbjct: 646 LVMKGSKHPNIVNFIDSYVLKGDLWVIMEYMEGGSLTDVVTH---CILTEGQIGAVCRET 702

Query: 624 LKCVKVVHDAGIVHSDLKPANFVF-VKGILKIIDFGIANAVPEHTVNIYRETQIGTPNYM 682
           L  +K +H  G++H D+K  N +  ++G +K+ DFG    + E  +N+ R T +GTP +M
Sbjct: 703 LSGLKFLHSKGVLHRDIKSDNILLSMEGDIKLTDFGFCAQINE--LNLKRTTMVGTPYWM 760

Query: 683 APEALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRL-LAIM 741
           APE +             SR + G   DIWS G +I +MI G PPY        L L   
Sbjct: 761 APEVV-------------SRKEYGPKVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIAT 807

Query: 742 NPEVKIVYPEKTSNGDTVPKTAIDTMKACLERNPNKRWTVEEVANGSFVKPVSVTHFFIR 801
           N   K+  PE  S+      +    +  CL   P +R +  E+ +  ++  ++  +  + 
Sbjct: 808 NGTPKLKEPENLSS------SLKKFLDWCLCVEPEERASATELLHDEYITEIAEANSSLA 861

Query: 802 DLIE 805
            L++
Sbjct: 862 PLVK 865

>Ecym_2499 Chr2 complement(976395..981020) [4626 bp, 1541 aa] {ON}
            similar to Ashbya gossypii AER264C
          Length = 1541

 Score = 91.7 bits (226), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 75/264 (28%), Positives = 119/264 (45%), Gaps = 39/264 (14%)

Query: 559  FKGEIELLKKLETQPRVVKLIDHEMDHGVLYVVME-CGDHDLSQTLAHRSGMPLDVEFVR 617
             K E+ +L+ L   P +V+    E+    + + ME C    L+  L H  G   D    +
Sbjct: 1290 IKDEMTVLEML-NHPNIVQYYGVEVHRDRVNIFMEYCEGGSLASLLEH--GRIEDEMVTQ 1346

Query: 618  YHAQEMLKCVKVVHDAGIVHSDLKPANFVF-VKGILKIIDFGIANAVPEHTVNIYRE--- 673
             ++ ++L+ +  +H++G+ H D+KP N +    GI+K +DFG A  +  +   +  E   
Sbjct: 1347 VYSLQLLEGLAYLHESGVHHRDIKPENILLDFNGIIKYVDFGAAKLIATNGSKVLTEDNG 1406

Query: 674  -----TQIGTPNYMAPEALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPY 728
                   IGTP YM+PE++ A  Y           K G   DIWS GC++ +M+ GR P+
Sbjct: 1407 RDSTDKMIGTPMYMSPESISASGYG----------KFGS-DDIWSLGCVVLEMVTGRRPW 1455

Query: 729  GGFQGQNRLLAIMNPEVKIVYPEKTSNGDTVPKTAIDTMKACLERNPNKR---------- 778
                 Q    AIM        P   +  +  P T I  +  CL ++PN R          
Sbjct: 1456 ANLDNQ---WAIMYQVAAGQIPSFPTKHEMSP-TGIKFLSRCLIQDPNMRSSAVELLMDP 1511

Query: 779  WTVEEVANGSFVKPVSVTHFFIRD 802
            W V E+ N +F + V+   F  RD
Sbjct: 1512 WIV-EIRNIAFGEDVNEEIFRERD 1534

>TBLA0C02940 Chr3 complement(706091..711022) [4932 bp, 1643 aa] {ON}
            Anc_1.271 YJL095W
          Length = 1643

 Score = 91.7 bits (226), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 71/288 (24%), Positives = 124/288 (43%), Gaps = 36/288 (12%)

Query: 515  YEKLELLGRGGTSXXXXXXXXXXXXXXXLKRVSFDEFDD------SSIDGFKGEIELLKK 568
            + K EL+G+G                  +K+V   EF        S+++  + E+ LLK 
Sbjct: 1338 WVKGELIGKGSFGSVYLSLNVTTGEMMAVKQVEVPEFGSQNEAIVSTVEALRSEVTLLKD 1397

Query: 569  LETQPRVVKLIDHEMDHGVLYVVMECGDHDLSQTLAHRSGMPLDVEFVRYHAQEMLKCVK 628
            L+    +V+ +  E  + +  + +E        +L    G   D   +R+   ++L  + 
Sbjct: 1398 LD-HINIVQYLGFEKKNNIYSLFLEYVAGGSIGSLIRMYGR-FDESLIRHSTTQILAGLS 1455

Query: 629  VVHDAGIVHSDLKPANFVF-VKGILKIIDFGIANAVPEHTVNIYRETQI---GTPNYMAP 684
             +H  GI+H D+K  N +   +GI KI DFGI+      + +IY  +++   GT  +MAP
Sbjct: 1456 YLHSKGILHRDMKADNILLDGEGICKISDFGIS----RKSKDIYSNSEMTMRGTVFWMAP 1511

Query: 685  EALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPE 744
            E +             ++       DIWS GCII +M  G+ P+   +    +  I   +
Sbjct: 1512 EMV------------DTKQGYSAKVDIWSLGCIILEMFAGKRPWSNLEVVAAMFKIGQSK 1559

Query: 745  VKIVYPEKTSNGDTVP---KTAIDTMKACLERNPNKRWTVEEVANGSF 789
                 PE     DT+P   +   D +  C + +P KR T E++ +  F
Sbjct: 1560 SAPPIPE-----DTLPLISQDGRDFLDDCFKIDPEKRPTAEQMLDHLF 1602

>Smik_15.57 Chr15 (92331..95576) [3246 bp, 1081 aa] {ON} YOL100W
           (REAL)
          Length = 1081

 Score = 91.3 bits (225), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 64/248 (25%), Positives = 114/248 (45%), Gaps = 42/248 (16%)

Query: 566 LKKLETQPRVVKLIDHEMDHGVLYVVMECGDHDLSQTLAHRSGMPLDVEFVRYHAQEMLK 625
           L+KL     VV+L     D   LY ++E   +    +L  + G  +D     Y+A +++ 
Sbjct: 232 LQKLNNSLSVVRLFSTFQDESSLYFLLEYAPNGDFLSLMKKYG-SIDENCACYYAAQIID 290

Query: 626 CVKVVHDAGIVHSDLKPANFVFVKGI-LKIIDFGIANAV---------PEHTVNIYRETQ 675
            +  +H  GI+H D+KP N +  + + +K+ DFG A  +         P++ ++   ++ 
Sbjct: 291 AIDYLHSNGIIHRDIKPENILLDEEMRIKLTDFGTAKLLSPTSNSVSKPKYDLSTRSKSF 350

Query: 676 IGTPNYMAPEALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQN 735
           +GT  Y++PE L       N +    R       DIW+ GCI++QMI G+PP   F+  N
Sbjct: 351 VGTAEYVSPELL-------NDSFTDYRC------DIWAFGCILFQMIAGKPP---FKATN 394

Query: 736 RLLAIMNPEVKIVYPEKTSNGDTVPKTAIDTMKACLERNPNKRWTVEEVANGSFVKPVSV 795
             L      +K+ Y    +     P    D +K  L +N ++R T+ ++           
Sbjct: 395 EYLTFQKV-MKVQY----AFTPGFPLVIRDLVKRILVKNLDQRLTINQIKE--------- 440

Query: 796 THFFIRDL 803
            H+F +D+
Sbjct: 441 -HYFFKDM 447

>Skud_2.141 Chr2 complement(264097..265677) [1581 bp, 526 aa] {ON}
           YBR028C (REAL)
          Length = 526

 Score = 89.7 bits (221), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 69/240 (28%), Positives = 111/240 (46%), Gaps = 46/240 (19%)

Query: 561 GEIELLKKLETQPRVVKLIDHEMDHGVLYVVMEC--GDHDLSQTLAHRSGMPLDVEFVRY 618
            E  +L ++E  P +VKL     D+  LY++++   G         H +   LD   V +
Sbjct: 202 AERSILSEIE-HPNIVKLFYSFHDNSKLYLLLQYIPGGELFYHLKEHGT---LDETTVSF 257

Query: 619 HAQEMLKCVKVVHDAGIVHSDLKPANFVF-VKGILKIIDFGIANAV----------PEHT 667
           +A E+   +K +H  G+V+ DLKP N +   +G L + DFG++             PE+ 
Sbjct: 258 YAAEISCALKFLHSKGVVYRDLKPENCLLNQRGHLVLTDFGLSKKSAHDSMADEEDPENV 317

Query: 668 VNIYRETQIGTPNYMAPEALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPP 727
             +Y  + IGTP Y APE L+   YT N              D +S GC++Y M+ G+PP
Sbjct: 318 KALY--SIIGTPEYCAPEILLGKAYTQN-------------CDWYSLGCLLYDMLVGKPP 362

Query: 728 YGGFQGQNRLLAIMNPEVKIVYPEKTSNGDTVP----KTAIDTMKACLERNPNKRWTVEE 783
           Y G           N +V I   ++   G  +P    +   D + A L++  +KRW V++
Sbjct: 363 YTG----------NNHKVIINKIQQNKQGPKIPFYLSEGMKDILNALLKKETSKRWNVDK 412

>Skud_3.39 Chr3 (66201..69254) [3054 bp, 1017 aa] {ON} YCL024W
           (REAL)
          Length = 1017

 Score = 90.9 bits (224), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 65/236 (27%), Positives = 104/236 (44%), Gaps = 37/236 (15%)

Query: 565 LLKKLETQPRVVKLIDHEMDHGVLYVVMECGDH-DLSQTLAHRSGMPLDVEFVRYHAQEM 623
           ++ KL + P V+ L D    +  LY+++E  +  +L   L  R  +P          +E 
Sbjct: 79  VIMKLLSHPNVLGLYDVWETNNNLYLILEYAEKGELFNLLVDRGALP---------EREA 129

Query: 624 LKC-------VKVVHDAGIVHSDLKPANFVFVKGI-LKIIDFGIANAVPEHTVNIYRETQ 675
           +KC       V   H  GIVH DLKP N +      +K+ DFG+A      T     ET 
Sbjct: 130 MKCFRQIIIAVSYCHALGIVHRDLKPENLLLDSDYNIKVADFGMAAL---QTDAALLETS 186

Query: 676 IGTPNYMAPEALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQN 735
            G+P+Y APE +  + Y             G  SD+WSCG I++ ++ GR P+    G  
Sbjct: 187 CGSPHYAAPEIVSGLPYE------------GFSSDVWSCGVILFALLTGRLPFDEENGNI 234

Query: 736 RLLAIMNPEVKIVYPEKTSNGDTVPKTAIDTMKACLERNPNKRWTVEEVANGSFVK 791
           R L +     +   P+ T     + K A D +   L  +P +R  + ++ +   +K
Sbjct: 235 RTLLLKVQRGQFEMPDDTE----ISKDAQDLISKILVVDPAQRIKIRDILSHPLLK 286

>Smik_2.146 Chr2 complement(275270..276850) [1581 bp, 526 aa] {ON}
           YBR028C (REAL)
          Length = 526

 Score = 89.7 bits (221), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 69/240 (28%), Positives = 111/240 (46%), Gaps = 46/240 (19%)

Query: 561 GEIELLKKLETQPRVVKLIDHEMDHGVLYVVMEC--GDHDLSQTLAHRSGMPLDVEFVRY 618
            E  +L ++E  P +VKL     D+  LY++++   G         H +   LD   V +
Sbjct: 202 AERSILSEIE-HPNIVKLFYSFHDNSKLYLLLQYIPGGELFYHLKEHGT---LDETTVSF 257

Query: 619 HAQEMLKCVKVVHDAGIVHSDLKPANFVF-VKGILKIIDFGIANAV----------PEHT 667
           +A E+   ++ +H  G+V+ DLKP N +   +G L + DFG++             PE+ 
Sbjct: 258 YAAEISCALRFLHTKGVVYRDLKPENCLLNQRGHLVLTDFGLSKKSANDSVVDEEDPENV 317

Query: 668 VNIYRETQIGTPNYMAPEALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPP 727
             +Y  + IGTP Y APE L+   YT N              D +S GC++Y M+ G+PP
Sbjct: 318 NALY--SIIGTPEYCAPEILLGRAYTQN-------------CDWYSLGCLLYDMLVGKPP 362

Query: 728 YGGFQGQNRLLAIMNPEVKIVYPEKTSNGDTVP----KTAIDTMKACLERNPNKRWTVEE 783
           Y G           N +V I   ++   G  +P    +   D + A L+R  +KRW V++
Sbjct: 363 YTG----------SNHKVIINKIQQNKQGPKIPFYLSEGMKDILNALLKRETSKRWNVDK 412

>KLLA0C04191g Chr3 (384198..386591) [2394 bp, 797 aa] {ON} weakly
           similar to uniprot|P27636 Saccharomyces cerevisiae
           YAR019C CDC15 Protein kinase of the Mitotic Exit Network
           that is localized to the spindle pole bodies at late
           anaphase promotes mitotic exit by directly switching on
           the kinase activity of Dbf2p
          Length = 797

 Score = 90.5 bits (223), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 75/285 (26%), Positives = 130/285 (45%), Gaps = 35/285 (12%)

Query: 511 NGTEYEKLELLGRGGTSXXXXXXXXXXXXXXXLKRVSFDEFDDSSIDGFKGEIELLKKLE 570
           +GT Y   +++GRG                  +K++ F+  D+S ++    EI+LLK L 
Sbjct: 7   HGT-YALKQVIGRGAYGVVYRAVKRGTNKPCAIKQIEFE--DESELNEHMLEIDLLKNLR 63

Query: 571 TQPRVVKLIDHEMDHGVLYVVME-CGDHDLSQTLAHRSGMPLDVEFVRYHAQEMLKCVKV 629
            Q  +V+          LY+++E C    L   L H  G  L+ + V Y  Q +   ++ 
Sbjct: 64  HQ-NIVEYRGFIQKAHELYIILEYCARGSLRDILKH--GPLLEDDTVNYVTQTLYG-LQY 119

Query: 630 VHDAGIVHSDLKPANFVFVK-GILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALV 688
           +H+ G++H D+K AN +  + GI+K+ DFG++  +     N    T  G+PN+MAPE + 
Sbjct: 120 LHEQGVIHRDIKAANLLLTEEGIVKLADFGVSTRI-----NRMAMTYAGSPNWMAPEVMT 174

Query: 689 AMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIV 748
                               SDIWS G  + +++ G PP+     ++   AI+N E    
Sbjct: 175 GQG-------------ASTVSDIWSLGATVVELLTGNPPFHNLVNESACYAIVNEE---Y 218

Query: 749 YPEKTSNGDTVPKTAIDTMKACLERNPNKRWTVEEVANGSFVKPV 793
            P  T + +       D +  C ++N  KR T +E+    ++K +
Sbjct: 219 IPPLTLSAE-----CKDFLSRCFQKNMFKRATAQELLAHIWLKKI 258

>SAKL0C01716g Chr3 (143880..147527) [3648 bp, 1215 aa] {ON} similar
           to uniprot|Q12263 Saccharomyces cerevisiae YDR507C
          Length = 1215

 Score = 90.9 bits (224), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 70/231 (30%), Positives = 109/231 (47%), Gaps = 28/231 (12%)

Query: 558 GFKGEIELLKKLETQPRVVKLIDHEMDHGVLYVVMECGDH-DLSQTLAHRSGMPLDVEFV 616
           G + EI ++ KL     V++L D       LY+V+E  +  +L   L  R  +P + E V
Sbjct: 85  GIEREI-IIMKLLNHTNVLRLYDVWETKSNLYMVLEYVEKGELFNLLVERGPLP-ENEAV 142

Query: 617 RYHAQEMLKCVKVVHDAGIVHSDLKPANFVFV-KGILKIIDFGIANAVPEHTVNIYRETQ 675
           R+  Q ++  +   H  GIVH DLKP N +   K  +KI DFG+A      + +   ET 
Sbjct: 143 RFFRQ-IIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAAL---ESKDKLLETS 198

Query: 676 IGTPNYMAPEALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQN 735
            G+P+Y APE +  + Y             G  SD+WSCG I+Y ++ GR P+    G  
Sbjct: 199 CGSPHYAAPEIVSGLPYH------------GFESDVWSCGVILYALLTGRLPFDEDNGNI 246

Query: 736 R--LLAIMNPEVKIVYPEKTSNGDTVPKTAIDTMKACLERNPNKRWTVEEV 784
           R  LL + + E ++         D +   A D +   L  +P++R    E+
Sbjct: 247 RSLLLKVQSGEYEM------PGNDEISSEAQDLIAKILTVDPDRRIKTREI 291

>Smik_8.42 Chr8 complement(74075..76894) [2820 bp, 939 aa] {ON}
           YHL007C (REAL)
          Length = 939

 Score = 90.5 bits (223), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 69/244 (28%), Positives = 113/244 (46%), Gaps = 27/244 (11%)

Query: 565 LLKKLETQPRVVKLIDHEMDHGVLYVVMECGDH-DLSQTLAHRSGMPLDVEFVRYHAQEM 623
           L+ K    P +V  ID  +  G L+V+ME  +   L+  + H     L    +    +E 
Sbjct: 669 LVMKGSRHPNIVNFIDSYVLKGDLWVIMEYMEGGSLTDVVTH---CILTEGQIGAVCRET 725

Query: 624 LKCVKVVHDAGIVHSDLKPANFVF-VKGILKIIDFGIANAVPEHTVNIYRETQIGTPNYM 682
           L  +K +H  G++H D+K  N +  ++G +K+ DFG    + E  +N+ R T +GTP +M
Sbjct: 726 LSGLKFLHSKGVLHRDIKSDNILLSMEGDIKLTDFGFCAQINE--LNLKRTTMVGTPYWM 783

Query: 683 APEALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRL-LAIM 741
           APE +             SR + G   DIWS G +I +MI G PPY        L L   
Sbjct: 784 APEVV-------------SRKEYGPKVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIAT 830

Query: 742 NPEVKIVYPEKTSNGDTVPKTAIDTMKACLERNPNKRWTVEEVANGSFVKPVSVTHFFIR 801
           N   K+  PE  S+     K  +D    CL   P +R +  E+ +  ++  ++  +  + 
Sbjct: 831 NGTPKLKEPENLSSSL---KKFLD---WCLCVEPEERASATELLHDEYITEIAEANSSLA 884

Query: 802 DLIE 805
            L++
Sbjct: 885 PLVK 888

>AGL242C Chr7 complement(246896..247790,247838..247854) [912 bp, 303
           aa] {ON} Syntenic homolog of Saccharomyces cerevisiae
           YPL031C (PHO85); 1-intron
          Length = 303

 Score = 87.0 bits (214), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 80/303 (26%), Positives = 136/303 (44%), Gaps = 53/303 (17%)

Query: 515 YEKLELLGRGGTSXXXXXXXXXXXXXXXLKRVSFDEFDDSSIDGFKGEIELLKKLETQPR 574
           +++LE LG G  +               LK V  D  + +     + EI L+K+L+ +  
Sbjct: 9   FKQLERLGNGTYATVYKGLNKTTGLYVALKEVKLDSEEGTPSTAIR-EISLMKELKHE-N 66

Query: 575 VVKLIDHEMDHGVLYVVMECGDHDLSQTLAHRSG--MP--LDVEFVRYHAQEMLKCVKVV 630
           +V+L D       L +V E  D+DL + +  R    MP  L++  V+Y   ++L+ V   
Sbjct: 67  IVRLYDVIHTENKLTLVFEFMDNDLKKFMDSRLDREMPRGLELSLVKYFQWQLLQGVAFC 126

Query: 631 HDAGIVHSDLKPANFVFV-KGILKIIDFGIANA--VPEHTVNIYRETQIGTPNYMAPEAL 687
           H+  I+H DLKP N +   KG LK+ DFG+A A  +P +T +    +++ T  Y AP+ L
Sbjct: 127 HENRILHRDLKPQNLLINNKGQLKLGDFGLARAFGIPVNTFS----SEVVTLWYRAPDVL 182

Query: 688 VAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIM------ 741
           +            SR       DIWSCGCI+ +MI G+  + G     +L  I       
Sbjct: 183 MG-----------SR-TYCTSIDIWSCGCILAEMIMGKALFPGTNDDEQLKLIFETMGTP 230

Query: 742 --------------NPEVKIVYPEK-------TSNGDTVPKTAIDTMKACLERNPNKRWT 780
                         NP++ + YP K        +  + +    ++ ++  L+ NP+ R +
Sbjct: 231 TEQTWVGVSQLPKYNPQIPL-YPNKDIKQLLQATTKEQISDVLVNLIQGLLQLNPSMRLS 289

Query: 781 VEE 783
            ++
Sbjct: 290 AQQ 292

>TPHA0A04170 Chr1 (937692..939233) [1542 bp, 513 aa] {ON} Anc_3.229
           YBR028C
          Length = 513

 Score = 89.4 bits (220), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 75/233 (32%), Positives = 113/233 (48%), Gaps = 42/233 (18%)

Query: 565 LLKKLETQPRVVKLIDHEMDHGVLYVVME-CGDHDLSQTLAHRSGMPLDVEFVRYHAQEM 623
           +L +LE  P +VKL     DH  LY++++     +L   L  +  +  DV  V ++  E+
Sbjct: 193 ILSELE-HPNIVKLFYAFHDHSKLYLILQYIPGGELFFHLKEQGTLNEDV--VAFYGAEI 249

Query: 624 LKCVKVVHDAGIVHSDLKPANFVF-VKGILKIIDFGIAN--------AVPEHTVNIYRET 674
              +K +H+ GIV+ DLKP N +    G L + DFG++            E    +Y  +
Sbjct: 250 SCALKFLHEKGIVYRDLKPENCLLNYTGHLVLTDFGLSKKGVKKEIPGADEDVAELY--S 307

Query: 675 QIGTPNYMAPEALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQ 734
            IGTP Y APE L  + YT N              D +S GC+IY M+ G+PP   F G 
Sbjct: 308 IIGTPEYCAPEILEGLPYTQN-------------CDWYSLGCLIYDMLVGKPP---FVGA 351

Query: 735 NRLLAIMNPEVKIVYPEKTSNGDTVPKTAIDTMK--AC--LERNPNKRWTVEE 783
           N  + I+N   KI   +K   G  +P    D MK   C  L+++ +KRW V++
Sbjct: 352 NHKI-ILN---KI---KKDKTGAKIPYYLSDGMKDILCWLLKKDCSKRWDVDK 397

>Kpol_1072.16 s1072 complement(37585..39972) [2388 bp, 795 aa] {ON}
           complement(37585..39972) [2388 nt, 796 aa]
          Length = 795

 Score = 90.1 bits (222), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 71/247 (28%), Positives = 120/247 (48%), Gaps = 17/247 (6%)

Query: 554 SSIDGFKGEIELLKKLETQPRVVKLIDHEMDHGVLYVVME-CGDHDLSQTLAHRSGMPLD 612
            ++DG   E+++L+KL+  PR+V+L     D    Y++ME     DL   +A    +  D
Sbjct: 231 GNMDGVTRELDVLRKLD-HPRIVRLKGFYEDEDSYYLLMEFVSGGDLMDFVAAHGSVGED 289

Query: 613 VEFVRYHAQEMLKCVKVVHDAGIVHSDLKPANFVFVKG---ILKIIDFGIANAVPEHTVN 669
               R   +++L+ VK +H  GI H DLKP N +  +    ++KI DFG+A      T  
Sbjct: 290 AG--REITRQILEAVKYIHLQGISHRDLKPDNILIEQDDPVLVKITDFGLAKVQGNGT-- 345

Query: 670 IYRETQIGTPNYMAPEALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYG 729
            + +T  GT  Y+APE +   N   +    + R +     D+WS GC++Y ++ G  P+ 
Sbjct: 346 -FMKTFCGTLAYVAPEVIGGKN---SAEENEDRIEYSSLVDMWSIGCLVYVILTGHLPFS 401

Query: 730 GFQGQNRLLAIMNPEVKIVYPEKTSNGDTVPKTAIDTMKACLERNPNKRWTVEEVANGSF 789
           G   Q++L   +    +  Y E       +   A D + + L+ +PNKR T  +  N  +
Sbjct: 402 G-STQDQLYKQI---CRGSYHEGPLKDFRISDEARDFIDSLLQVSPNKRLTAIKALNHPW 457

Query: 790 VKPVSVT 796
           +K  + T
Sbjct: 458 IKMGTYT 464

>TBLA0A03570 Chr1 (892930..895857) [2928 bp, 975 aa] {ON} Anc_5.406
           YHR102W
          Length = 975

 Score = 90.5 bits (223), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 72/295 (24%), Positives = 136/295 (46%), Gaps = 30/295 (10%)

Query: 515 YEKLELLGRGGTSXXXXXXXXXXXXXXXLKRVSFDEFDDSSIDGFKGEIELLKKLETQPR 574
           + + E++GRG                  +K +S  E D   +   + EI+ L  L+  P 
Sbjct: 42  FRRTEIIGRGKFGVVYKGYHMKTKGVYAIKVLSL-ESDLDEVADIQREIQFLVSLKQVPN 100

Query: 575 VVKLIDHEMDHGVLYVVME-CGDHDLSQTLAHRSGMPLDVEFVRYHAQEMLKCVKVVHDA 633
           + +     +    L+++ME C    +   L  R G  +D +++    +E+L  +  +H  
Sbjct: 101 ITRYYASYLKDTSLWIIMEYCAGGSVRTLL--RPG-KIDEKYIAVIMRELLVALHYIHKD 157

Query: 634 GIVHSDLKPANFVFV-KGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALV-AMN 691
            ++H D+K AN +   +G +K+ DFG+A  + ++T  + R+T  GTP +MAPE ++  ++
Sbjct: 158 NVIHRDIKAANLLITNEGNVKLCDFGVAAQLNQNT--MRRQTMAGTPYWMAPEVIMEGIS 215

Query: 692 YTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPE 751
           Y                +DIWS G   Y++  G PP+   +    +  I   +   +   
Sbjct: 216 Y-------------DTKADIWSVGITAYEIATGNPPFCEMEALRAMQVISKSKPARL--- 259

Query: 752 KTSNGDTVPKTAIDTMKACLERNPNKRWTVEEVANGS-FVKPVSVTHF-FIRDLI 804
           +  N D + K  I     CL+ +P +R T +++ + S F+K    TH   +++LI
Sbjct: 260 EGKNHDPLLKEFI---AMCLDEDPQERPTADKLLHESAFIKHYKNTHTSVLKELI 311

>KLTH0A06776g Chr1 complement(562932..567503) [4572 bp, 1523 aa] {ON}
            similar to uniprot|P53599 Saccharomyces cerevisiae
            YNR031C SSK2 Suppressor of Sensor Kinase (SLN1) A MAP
            kinase kinase kinase activator of Pbs2p
          Length = 1523

 Score = 90.9 bits (224), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 68/239 (28%), Positives = 112/239 (46%), Gaps = 30/239 (12%)

Query: 558  GFKGEIELLKKLETQPRVVKLIDHEMDHGVLYVVME-CGDHDLSQTLAHRSGMPLDVEFV 616
              K E+ +L+ L   P VV+    E+    + + ME C    L+Q L H  G   D    
Sbjct: 1278 AIKEEMSVLEML-NHPNVVQYYGVEVHRDKVNLFMEYCEGGSLAQLLEH--GRIEDEMVT 1334

Query: 617  RYHAQEMLKCVKVVHDAGIVHSDLKPANFVF-VKGILKIIDFGIANAVPEHTVNIYRE-- 673
            + +A +ML+ +  +H + +VH D+KP N +    G++K +DFG A ++  +   +     
Sbjct: 1335 QVYALQMLEGLAYLHQSSVVHRDIKPENILLDFNGVIKYVDFGAARSLAANGTKVANNGS 1394

Query: 674  --------TQIGTPNYMAPEALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGR 725
                    + +GTP YM+PE++              + K G  SDIWS GC+I +M  GR
Sbjct: 1395 EGKTDGVNSMMGTPMYMSPESVTG----------AKKGKFGS-SDIWSLGCVILEMATGR 1443

Query: 726  PPYGGFQGQNRLLAIMNPEVKIVYPEKTSNGDTVPKTAIDTMKACLERNPNKRWTVEEV 784
             P+     +    AIM        P+  S  +  P+   D +  CL+++P+KR T  E+
Sbjct: 1444 RPWFNLDNE---WAIMYHVAAGHVPQLPSRDEISPQ-GTDFLLKCLKQDPDKRATAMEL 1498

>SAKL0H06534g Chr8 complement(575439..577853) [2415 bp, 804 aa] {ON}
           similar to uniprot|P22216 Saccharomyces cerevisiae
           YPL153C RAD53 Protein kinase required for cell-cycle
           arrest in response to DNA damage activated by trans
           autophosphorylation when interacting with
           hyperphosphorylated Rad9p
          Length = 804

 Score = 90.1 bits (222), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 70/242 (28%), Positives = 119/242 (49%), Gaps = 17/242 (7%)

Query: 554 SSIDGFKGEIELLKKLETQPRVVKLIDHEMDHGVLYVVME-CGDHDLSQTLAHRSGMPLD 612
            +IDG   E+E+L++L   PR+V+L     D    Y++ME     DL   +A    +  D
Sbjct: 226 GNIDGVTRELEVLRRL-NHPRIVRLKGFYEDDESYYLLMEFVSGGDLMDFVAAHGSVGED 284

Query: 613 VEFVRYHAQEMLKCVKVVHDAGIVHSDLKPANFVFVKG---ILKIIDFGIANAVPEHTVN 669
               R   +++L+ VK +H  GI H DLKP N +  +    ++KI DFG+A      T  
Sbjct: 285 AG--REITKQVLEAVKYIHGMGISHRDLKPDNILIEQDDPVMVKITDFGLAKIQGNGT-- 340

Query: 670 IYRETQIGTPNYMAPEALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYG 729
            + +T  GT  Y+APE +   N   ++   Q++ K     D+WS GC++Y ++ G  P+ 
Sbjct: 341 -FMKTFCGTLAYVAPEVISGKN---SEDKSQNKNKYSSLVDMWSIGCLVYVILTGHLPFS 396

Query: 730 GFQGQNRLLAIMNPEVKIVYPEKTSNGDTVPKTAIDTMKACLERNPNKRWTVEEVANGSF 789
           G   Q++L   ++   +  Y E       +   A + + + L+ NP  R T E+  +  +
Sbjct: 397 G-STQDQLYKQIS---RGSYHEGPLKDFRISDEARNFIDSLLQVNPKDRLTAEKALDHPW 452

Query: 790 VK 791
           +K
Sbjct: 453 IK 454

>TBLA0B02310 Chr2 (539362..541821) [2460 bp, 819 aa] {ON} Anc_3.92
           YDR490C
          Length = 819

 Score = 90.1 bits (222), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 62/232 (26%), Positives = 98/232 (42%), Gaps = 31/232 (13%)

Query: 566 LKKLETQPRVVKLIDHEMDHGVLYVVMECGDHDLSQTLAHRSGMPLDVEFVRYHAQEMLK 625
           L +L   P VV+L     D   LY V+E   H     L  R G  L      ++A ++L 
Sbjct: 197 LVRLRDCPGVVRLHATFQDRESLYFVLEYAPHGDLLALLRRHGS-LSRAVTCHYAAQLLS 255

Query: 626 CVKVVHDAGIVHSDLKPANFVFVKGI-LKIIDFGIANAVPEHTVNIYRETQ------IGT 678
            +  +H  G++H D+KP N +       K+ DFG A  +P+   N+ + ++      +GT
Sbjct: 256 AIGALHSVGVIHRDIKPENVLLDSHYRAKLTDFGTAALLPQTHSNLEQVSRHVTTSFVGT 315

Query: 679 PNYMAPEALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLL 738
             Y+ PE L A +                  D+W+  C+++Q+I GRPP   FQ +N  L
Sbjct: 316 AEYVPPELLAAGH-------------ADGTCDLWAWACVVFQLIAGRPP---FQARNEFL 359

Query: 739 AIMNP-EVKIVYPEKTSNGDTVPKTAIDTMKACLERNPNKRWTVEEVANGSF 789
              N   V+  YP         P    D ++  L   P +R    ++    F
Sbjct: 360 TFQNVMAVRYTYPPG------FPSDLKDLLRRVLRHEPRQRLLQPQITQHQF 405

>KLTH0D11242g Chr4 (918232..920619) [2388 bp, 795 aa] {ON} similar
           to uniprot|P22216 Saccharomyces cerevisiae YPL153C RAD53
           Protein kinase required for cell-cycle arrest in
           response to DNA damage activated by trans
           autophosphorylation when interacting with
           hyperphosphorylated Rad9p
          Length = 795

 Score = 90.1 bits (222), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 71/250 (28%), Positives = 112/250 (44%), Gaps = 19/250 (7%)

Query: 554 SSIDGFKGEIELLKKLETQPRVVKLIDHEMDHGVLYVVME-CGDHDLSQTLAHRSGMPLD 612
            ++DG   E+E+L++L   PR+V L     D    Y+VME     DL   +A    +  D
Sbjct: 226 GNMDGVTRELEVLRRL-NHPRIVSLKGFYEDKESYYLVMEFVSGGDLMDFVAAHGSVGED 284

Query: 613 VEFVRYHAQEMLKCVKVVHDAGIVHSDLKPANFVFVKG---ILKIIDFGIANAVPEHTVN 669
               R   +++L+ VK +H  GI H DLKP N +  +    ++KI DFG+A      T  
Sbjct: 285 AG--REITRQVLEAVKYIHAMGISHRDLKPDNILIERDDPVLVKITDFGLAKIQDNGT-- 340

Query: 670 IYRETQIGTPNYMAPEALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYG 729
            + +T  GT  Y+APE +   N     + E+   K     D+WS GC++Y ++ G  P+ 
Sbjct: 341 -FMKTFCGTLAYVAPEVISGKN-----SEEKEGNKYSSLVDMWSIGCLVYVILTGHLPFS 394

Query: 730 GFQGQNRLLAIMNPEVKIVYPEKTSNGDTVPKTAIDTMKACLERNPNKRWTVEEVANGSF 789
           G   Q     I        Y E       +   A D +++ L+ NP  R T E+     +
Sbjct: 395 GSTQQELYKQISAGS----YHEGPLKDYRISDDARDFIESFLQVNPRDRMTAEQALKHPW 450

Query: 790 VKPVSVTHFF 799
           ++      F 
Sbjct: 451 IRTADSQSFI 460

>NDAI0G04290 Chr7 complement(1030530..1033871) [3342 bp, 1113 aa]
           {ON} Anc_3.92
          Length = 1113

 Score = 90.5 bits (223), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 63/234 (26%), Positives = 109/234 (46%), Gaps = 32/234 (13%)

Query: 566 LKKLETQPRVVKLIDHEMDHGVLYVVMECGDHDLSQTLAHRSGMPLDVEFVRYHAQEMLK 625
           L++L     +++L     D   LY ++E   +    ++  + G  L+ E   Y+  ++L 
Sbjct: 222 LQRLNNSRSIIRLFFTFQDEASLYFLLEYAPNGDFLSVMKKYG-SLNEECACYYGAQILD 280

Query: 626 CVKVVHDAGIVHSDLKPANFVFVKGI-LKIIDFGIANAVPEHT---------VNIYRETQ 675
            +  +H  GI+H D+KP N +  K + +KI DFG A  + E T         +    ++ 
Sbjct: 281 AIGFMHTRGIIHRDIKPENILMDKDMKVKITDFGTAKILDEKTNGNNKTSYELLTRSKSF 340

Query: 676 IGTPNYMAPEALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQN 735
           +GT  Y++PE L+  NY+ ++             DIW+ GCI+YQMI G+PP   F+  N
Sbjct: 341 VGTAEYVSPE-LLNDNYSDSRC------------DIWAFGCILYQMIAGKPP---FKATN 384

Query: 736 RLLAIMNPEVKIVYPEKTSNGDTVPKTAIDTMKACLERNPNKRWTVEEVANGSF 789
             L      +K+ Y          P    D +K  L + P +R T+ ++ +  F
Sbjct: 385 EYLTFQKV-MKVQYAFTAG----FPTIIRDLIKRILLKVPEQRLTIGQIKSHLF 433

>Kpol_1055.24 s1055 complement(57430..60243) [2814 bp, 937 aa] {ON}
           complement(57430..60243) [2814 nt, 938 aa]
          Length = 937

 Score = 90.1 bits (222), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 63/223 (28%), Positives = 105/223 (47%), Gaps = 27/223 (12%)

Query: 575 VVKLIDHEMDHGVLYVVMECGDH-DLSQTLAHRSGMPLDVEFVRYHAQEMLKCVKVVHDA 633
           +V  ID  +  G L+V+ME  +   L+  + H       V  V    +E L  ++ +H  
Sbjct: 707 IVNFIDSYLLKGDLWVIMEYMEGGSLTDVVTHCLLTEAQVGAV---CRETLSGLQFLHSK 763

Query: 634 GIVHSDLKPANFVF-VKGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNY 692
           G++H D+K  N +  ++G +K+ DFG    + E  +N+ R T +GTP +MAPE +     
Sbjct: 764 GVIHRDIKSDNILLSMRGDIKLTDFGFCAQINE--LNLKRTTMVGTPYWMAPEVV----- 816

Query: 693 THNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAI-MNPEVKIVYPE 751
                   SR + G   DIWS G +I +MI G PPY        L  I  N    +  PE
Sbjct: 817 --------SRKEYGPKVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIATNGTPSLKEPE 868

Query: 752 KTSNGDTVPKTAIDTMKACLERNPNKRWTVEEVANGSFVKPVS 794
             S+         + +  CL+ NP++R + +++    F+  ++
Sbjct: 869 ALSDALN------NFLGWCLKVNPDERASAKDLLLDPFITEIA 905

>KNAG0A02310 Chr1 complement(216545..217453) [909 bp, 302 aa] {ON}
           Anc_8.482 YPL031C
          Length = 302

 Score = 86.7 bits (213), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 84/304 (27%), Positives = 138/304 (45%), Gaps = 51/304 (16%)

Query: 513 TEYEKLELLGRGGTSXXXXXXXXXXXXXXXLKRVSFDEFDDSSIDGFKGEIELLKKLETQ 572
           +++++LE LG G  +               LK V  D  + +     + EI L+K+L+  
Sbjct: 5   SQFKQLEKLGNGTYATVYKGLNKTTGVYVALKEVKLDSEEGTPSTAIR-EISLMKELK-H 62

Query: 573 PRVVKLIDHEMDHGVLYVVMECGDHDLSQTLAHR--SGMP--LDVEFVRYHAQEMLKCVK 628
             +V+L D       L +V E  D+DL + +  R     P  L++  V+Y   ++L+ + 
Sbjct: 63  DNIVRLYDVIHTENKLTLVFEYMDNDLKKYMDSRIVGNTPRGLELHLVKYFQWQLLEGLA 122

Query: 629 VVHDAGIVHSDLKPANFVF-VKGILKIIDFGIANA--VPEHTVNIYRETQIGTPNYMAPE 685
             H+  I+H DLKP N +   KG LK+ DFG+A A  +P +T +    +++ T  Y AP+
Sbjct: 123 FCHENKILHRDLKPQNLLINKKGQLKLGDFGLARAFGIPVNTFS----SEVVTLWYRAPD 178

Query: 686 ALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAI---MN 742
            L+            SR       DIWSCGCI+ +MI G+P + G   + +L  I   M 
Sbjct: 179 VLMG-----------SR-TYSTSIDIWSCGCILAEMITGKPLFLGSNDEEQLKLIFDTMG 226

Query: 743 PEVKIVYPEKTS----NGDT---VPK----------------TAIDTMKACLERNPNKRW 779
              +  +P  TS    N +    +PK                T ID +   L+ NP+ R 
Sbjct: 227 TPNEATWPGVTSLPKYNANFQQRLPKDLKMILQPYCESPLDDTVIDLLHGLLQLNPDMRL 286

Query: 780 TVEE 783
           + ++
Sbjct: 287 SAKQ 290

>Kpol_541.49 s541 complement(156530..159514) [2985 bp, 994 aa] {ON}
           complement(156530..159514) [2985 nt, 995 aa]
          Length = 994

 Score = 90.1 bits (222), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 75/280 (26%), Positives = 114/280 (40%), Gaps = 66/280 (23%)

Query: 556 IDGFKGEIELLKKLETQPRVVKLIDHEMDHGVLYVVME-CGDHDLSQTLAHRSGM----- 609
           ++  + EI +LKK++  P +V+LI+ E      Y++ME C   DL+  +  R  +     
Sbjct: 73  LENLEVEIAILKKIK-HPHIVRLIECERTSTDFYLIMEYCALGDLTFLIKKRQEIMENHP 131

Query: 610 -----------------PLDVEFVRYHAQEMLKCVKVVHDAGIVHSDLKPANFV----FV 648
                             L   F+  + Q++   +K +    +VH D+KP N +    FV
Sbjct: 132 LLKSVFKRFPPPSKNHNGLHRAFILNYLQQLSSSLKFLRSKNLVHRDIKPQNLLLATPFV 191

Query: 649 KG------------------ILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAM 690
                               ILKI DFG A  +P  ++    ET  G+P YMAPE L   
Sbjct: 192 DYHDSKSFHDLGYVGISSLPILKIADFGFARFLPNTSM---AETLCGSPLYMAPEIL--- 245

Query: 691 NYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYP 750
           NY           K    +D+WS G ++Y+M YG+PP+           I      I Y 
Sbjct: 246 NYQ----------KYNAKADLWSVGTVLYEMCYGKPPFKASNHLELYKKIKKANNTISY- 294

Query: 751 EKTSNGDTVPKTAIDTMKACLERNPNKRWTVEEVANGSFV 790
              SN   +     D + A L  +PNKR   +E  +   V
Sbjct: 295 ---SNDCEIEDDLKDLINALLTFDPNKRIGFQEFFDNKLV 331

>KLTH0C10912g Chr3 (898372..900465) [2094 bp, 697 aa] {ON} highly
           similar to uniprot|P32562 Saccharomyces cerevisiae
           YMR001C
          Length = 697

 Score = 89.7 bits (221), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 68/228 (29%), Positives = 111/228 (48%), Gaps = 37/228 (16%)

Query: 575 VVKLIDHEMDHGVLYVVME-CGDHDLSQTLAHRSGMPLDVEFVRYHAQEMLKCVKVVHDA 633
           +V+ ID   D   +Y+++E C +  L   L  R    L    VR+   +++  VK +H  
Sbjct: 138 IVQFIDCFEDDTNVYILLEICPNGSLMDLLKRRK--VLTEPEVRFFTTQIVGAVKYMHSR 195

Query: 634 GIVHSDLKPANFVFVKGI-LKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNY 692
            ++H DLK  N  F K   LKI DFG+A  +       Y  T  GTPNY+APE L   + 
Sbjct: 196 RVIHRDLKLGNIFFDKHYNLKIGDFGLAAVLANDRERKY--TVCGTPNYIAPEVLTGKHT 253

Query: 693 THNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEK 752
            H+       ++V    DIWSCG +IY ++ G+PP   FQ +         EV I+Y E+
Sbjct: 254 GHS-------YEV----DIWSCGVMIYALLIGKPP---FQAK---------EVNIIY-ER 289

Query: 753 TSNGD-------TVPKTAIDTMKACLERNPNKRWTVEEVANGSFVKPV 793
              GD        + + A+  ++  L  +P +R +++E+ +  + + +
Sbjct: 290 IKCGDYVFPRDKCISQEALTLIRDILSIDPLERPSLDEIIDYVWFRGI 337

>NCAS0A08080 Chr1 complement(1594221..1596092) [1872 bp, 623 aa]
           {ON} Anc_5.611
          Length = 623

 Score = 89.7 bits (221), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 74/295 (25%), Positives = 124/295 (42%), Gaps = 36/295 (12%)

Query: 515 YEKLELLGRGGTSXXXXXXXXXXXXXXXLKRVSFDEFDDSSIDG-FKGEIELLKKLETQP 573
           Y+ ++ LG G                  LK ++      S + G  + EI  L+ L   P
Sbjct: 46  YQIVKTLGEGSFGKVKLAYHMTTGQKVALKIINKKVLAKSDMQGRIEREISYLRLLR-HP 104

Query: 574 RVVKLIDHEMDHGVLYVVMECGDHDLSQTLAHRSGMPLDVEFVRYHAQEMLKCVKVVHDA 633
            ++KL D       + +VME   ++L   +  R  M  D    R   Q+++  V+  H  
Sbjct: 105 HIIKLYDVIKSKDEIIMVMEYAGNELFDYIVQRDKMSEDE--ARRFFQQIISAVEYCHRH 162

Query: 634 GIVHSDLKPANFVFVKGI-LKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNY 692
            IVH DLKP N +  + + +KI DFG++N + +     + +T  G+PNY APE +    Y
Sbjct: 163 KIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGN---FLKTSCGSPNYAAPEVISGKLY 219

Query: 693 THNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEK 752
                        G   D+WSCG I+Y M+  R P+             +  + +++   
Sbjct: 220 A------------GPEVDVWSCGVILYVMLCRRLPFD------------DESIPVLFKNI 255

Query: 753 TSNGDTVPK----TAIDTMKACLERNPNKRWTVEEVANGSFVKPVSVTHFFIRDL 803
            +   T+PK     A   +K  L  NP  R +++E+    + K     +   +DL
Sbjct: 256 NNGVYTIPKFLSQGASTLIKKMLIVNPLNRISIQEIMQDEWFKAGLPEYLIPQDL 310

>Kpol_499.3 s499 complement(6075..7199) [1125 bp, 374 aa] {ON}
           complement(6075..7199) [1125 nt, 375 aa]
          Length = 374

 Score = 87.8 bits (216), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 67/270 (24%), Positives = 120/270 (44%), Gaps = 54/270 (20%)

Query: 562 EIELLKKLETQPRVVKLIDH----EMDH-GVLYVVMECGDHDLSQTLAH--RSGMPLDVE 614
           E++LLK       ++ ++D      +D+   +Y+V E  + DL + + +  R   PL  +
Sbjct: 59  ELKLLKYFHNHENIISILDKVRPISIDNLNAVYIVQELMETDLQKVIVNNNRKNTPLSDD 118

Query: 615 FVRYHAQEMLKCVKVVHDAGIVHSDLKPANFVFVKGI-LKIIDFGIANAVP-----EHTV 668
            ++Y   ++L+ +K +H A ++H DLKP+N +      LKI DFG++  +      + T+
Sbjct: 119 HIQYFTYQVLRALKSIHSAKVIHRDLKPSNLLLNSNCDLKICDFGLSRCLASSSDSKETL 178

Query: 669 NIYRETQIGTPNYMAPEALVAMN-YTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPP 727
             +    + T  Y APE ++    YT                DIWSCGCI+ +M+ G+P 
Sbjct: 179 VGFMTEYVATRWYRAPEIMLTFQEYT-------------TAMDIWSCGCILAEMVSGKPL 225

Query: 728 YGGFQGQNRLLAIM------------------------NPEVKIVYPEKTSNG---DTVP 760
           + G    ++L  I+                        N   K   P +   G   DT+ 
Sbjct: 226 FPGRDYHHQLWLILEVLGTPSYDDFEQIKSKRAKEYIANLPFKSRLPWEMVLGREKDTLN 285

Query: 761 KTAIDTMKACLERNPNKRWTVEEVANGSFV 790
              +D ++  L  NP+KR + E+  N  ++
Sbjct: 286 PGILDLLEKMLTFNPHKRISAEDALNHPYL 315

>NDAI0G05470 Chr7 (1340175..1344842) [4668 bp, 1555 aa] {ON} Anc_1.271
          Length = 1555

 Score = 90.5 bits (223), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 72/288 (25%), Positives = 126/288 (43%), Gaps = 36/288 (12%)

Query: 515  YEKLELLGRGGTSXXXXXXXXXXXXXXXLKRV------SFDEFDDSSIDGFKGEIELLKK 568
            + K E++G+G                  +K+V      S DE   S++D  K E+  LK 
Sbjct: 1254 WMKGEMIGKGSFGAVYLCLNVTTGEMMAVKQVEVPKYSSQDEAIMSTVDAIKSEVSTLKD 1313

Query: 569  LETQPRVVKLIDHEMDHGVLYVVMECGDHDLSQTLAHRSGMPLDVEFVRYHAQEMLKCVK 628
            L+    +V+ +  E    +  + +E        +L    G   D   +R+   ++L+ + 
Sbjct: 1314 LD-HLNIVQYLGFENKDNIYSLFLEYVAGGSVGSLIRIYGR-FDEPLIRHLNIQVLRGLA 1371

Query: 629  VVHDAGIVHSDLKPANFVFVK-GILKIIDFGIANAVPEHTVNIYRETQI---GTPNYMAP 684
             +H  GI+H D+K  N +  + G+ KI DFGI+      + +IY  + +   GT  +MAP
Sbjct: 1372 YLHARGILHRDMKADNLLLDQDGVCKISDFGIS----RKSKDIYSNSDMTMRGTVFWMAP 1427

Query: 685  EALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPE 744
            E +             ++       DIWS GCI+ +M  G+ P+  F+    +  I   +
Sbjct: 1428 EMV------------DTKQGYSAKVDIWSLGCIVLEMFAGKRPWSNFEVVAAMFKIGKSK 1475

Query: 745  VKIVYPEKTSNGDTVPKTAIDT---MKACLERNPNKRWTVEEVANGSF 789
                 PE     DT+P  + +    + AC E +P+KR T +E+   +F
Sbjct: 1476 SAPPIPE-----DTLPLISAEGREFLDACFEIDPDKRPTADELLYHTF 1518

>KLLA0B13607g Chr2 (1191592..1194561) [2970 bp, 989 aa] {ON} similar
           to uniprot|Q03497 Saccharomyces cerevisiae YHL007C STE20
           Signal transducing kinase of the PAK (p21- activated
           kinase) family involved in pheromone response and
           pseudohyphal/invasive growth pathways activated by
           Cdc42p binds Ste4p at a GBB motif present in
           noncatalytic domains of PAK kinases
          Length = 989

 Score = 90.1 bits (222), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 69/233 (29%), Positives = 107/233 (45%), Gaps = 27/233 (11%)

Query: 565 LLKKLETQPRVVKLIDHEMDHGVLYVVMECGDH-DLSQTLAHRSGMPLDVEFVRYHAQEM 623
           L+ K      +V  ID  +  G L+VVME  +   L+  + H     L    +   ++E 
Sbjct: 745 LVMKGSKHNNIVNFIDSYLFRGDLWVVMEYMEGGSLTDVVTH---CILTEGQIGAVSRET 801

Query: 624 LKCVKVVHDAGIVHSDLKPANFVF-VKGILKIIDFGIANAVPEHTVNIYRETQIGTPNYM 682
           LK ++ +H  G++H D+K  N +  + G +K+ DFG    + E  VN+ R T +GTP +M
Sbjct: 802 LKGLQFLHSKGVIHRDIKSDNILLSMNGDIKLTDFGFCAQINE--VNLKRTTMVGTPYWM 859

Query: 683 APEALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAI-M 741
           APE +             SR + G   DIWS G +I +MI G PPY        L  I  
Sbjct: 860 APEVV-------------SRKEYGPKVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIAT 906

Query: 742 NPEVKIVYPEKTSNGDTVPKTAIDTMKACLERNPNKRWTVEEVANGSFVKPVS 794
           N   K+  P     G+   K A+  +  CL  +P  R T  ++    F+  ++
Sbjct: 907 NGTPKLKDP-----GNLSHKMAM-FLNWCLMVDPEDRGTAADLLEDPFITEIA 953

>Kpol_1007.17 s1007 (32671..32687,32861..33767) [924 bp, 307 aa]
           {ON} (32671..32687,32861..33767) [924 nt, 308 aa]
          Length = 307

 Score = 86.7 bits (213), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 81/305 (26%), Positives = 135/305 (44%), Gaps = 53/305 (17%)

Query: 513 TEYEKLELLGRGGTSXXXXXXXXXXXXXXXLKRVSFDEFDDSSIDGFKGEIELLKKLETQ 572
           +++++LE LG G  +               LK V  D  + +     + EI L+K+L+  
Sbjct: 5   SQFKQLEKLGNGTYATVYKGLNKTTGVYVALKEVKLDSEEGTPSTAIR-EISLMKELK-H 62

Query: 573 PRVVKLIDHEMDHGVLYVVMECGDHDLSQTLAHR----SGMPLDVEFVRYHAQEMLKCVK 628
             +V+L D       L +V E  D DL + +  R    S   L++  V+Y   ++ + + 
Sbjct: 63  DNIVRLYDVIHTENKLTLVFEYMDKDLKKYMDSRTTGNSPQGLELSLVKYFQWQLFEGIS 122

Query: 629 VVHDAGIVHSDLKPANFVFV-KGILKIIDFGIANA--VPEHTVNIYRETQIGTPNYMAPE 685
             H+  I+H DLKP N +   KG LK+ DFG+A A  +P +T +    +++ T  Y AP+
Sbjct: 123 FCHENKILHRDLKPQNLLINNKGQLKLGDFGLARAFGIPVNTFS----SEVVTLWYRAPD 178

Query: 686 ALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMN--- 742
            L+            SR       D+WSCGCI+ +M+ G+P + G   + +L  I +   
Sbjct: 179 VLMG-----------SR-SYSTSIDMWSCGCILAEMLTGKPLFPGTNDEEQLKLIFDMMG 226

Query: 743 -------PEVKIVYPEKTSNGDT-VPK----------------TAIDTMKACLERNPNKR 778
                  P V  + P+  SN    VPK                  ID +   L+ NP+ R
Sbjct: 227 TPTESTWPTVTTL-PKYNSNFSIQVPKDLKKLLQPFTKEQLDDIVIDLLNGLLQLNPSMR 285

Query: 779 WTVEE 783
            + ++
Sbjct: 286 LSAKQ 290

>TDEL0A02720 Chr1 complement(491618..494365) [2748 bp, 915 aa] {ON}
           Anc_2.496 YHL007C
          Length = 915

 Score = 90.1 bits (222), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 69/237 (29%), Positives = 109/237 (45%), Gaps = 38/237 (16%)

Query: 562 EIELLKKLETQPRVVKLIDHEMDHGVLYVVMECGDH-DLSQTLAHRSGMPLDVEFVRYHA 620
           EI ++K  + Q  +V  ID  +  G L+VVME  +   L+  + H     L    +    
Sbjct: 668 EILVMKGSKHQ-NIVNFIDSYVLKGDLWVVMEYMEGGSLTDVVTH---CILTEAQIGAVC 723

Query: 621 QEMLKCVKVVHDAGIVHSDLKPANFVF-VKGILKIIDFGIANAVPEHTVNIYRETQIGTP 679
           +E L+ ++ +H  G++H D+K  N +  + G +K+ DFG    + E  +N+ R T +GTP
Sbjct: 724 RETLRGLQFLHSKGVIHRDIKSDNILLSMNGEIKLTDFGFCAQINE--INLKRTTMVGTP 781

Query: 680 NYMAPEALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLA 739
            +MAPE +             SR + G   DIWS G +I +MI G PPY        L  
Sbjct: 782 YWMAPEVV-------------SRKEYGPKVDIWSLGIMIIEMIEGEPPYLNETPLRALYL 828

Query: 740 IM---NPEVK---IVYPEKTSNGDTVPKTAIDTMKACLERNPNKRWTVEEVANGSFV 790
           I     P++K   ++ PE  S            +  CL  NP+ R +  E+    F+
Sbjct: 829 IATNGTPKLKEPEVLSPELKS-----------FLAWCLNVNPDTRASATELLRDVFI 874

>YHL007C Chr8 complement(95118..97937) [2820 bp, 939 aa] {ON}
           STE20Cdc42p-activated signal transducing kinase of the
           PAK (p21-activated kinase) family; involved in pheromone
           response, pseudohyphal/invasive growth, vacuole
           inheritance, down-regulation of sterol uptake; GBB motif
           binds Ste4p
          Length = 939

 Score = 89.7 bits (221), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 61/218 (27%), Positives = 102/218 (46%), Gaps = 23/218 (10%)

Query: 513 TEYEKLELLGRGGTSXXXXXXXXXXXXXXXLKRVSFDEFDDSSIDGFKGEIELLKKLETQ 572
           T+Y  L  +G+G +                +K+++ ++     +     EI L+ K    
Sbjct: 618 TKYANLVKIGQGASGGVYTAYEIGTNVSVAIKQMNLEKQPKKEL--IINEI-LVMKGSKH 674

Query: 573 PRVVKLIDHEMDHGVLYVVMECGDH-DLSQTLAHRSGMPLDVEFVRYHAQEMLKCVKVVH 631
           P +V  ID  +  G L+V+ME  +   L+  + H     L    +    +E L  ++ +H
Sbjct: 675 PNIVNFIDSYVLKGDLWVIMEYMEGGSLTDVVTH---CILTEGQIGAVCRETLSGLEFLH 731

Query: 632 DAGIVHSDLKPANFVF-VKGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAM 690
             G++H D+K  N +  ++G +K+ DFG    + E  +N+ R T +GTP +MAPE +   
Sbjct: 732 SKGVLHRDIKSDNILLSMEGDIKLTDFGFCAQINE--LNLKRTTMVGTPYWMAPEVV--- 786

Query: 691 NYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPY 728
                     SR + G   DIWS G +I +MI G PPY
Sbjct: 787 ----------SRKEYGPKVDIWSLGIMIIEMIEGEPPY 814

>Suva_8.47 Chr8 complement(91615..94557) [2943 bp, 980 aa] {ON}
           YHL007C (REAL)
          Length = 980

 Score = 89.7 bits (221), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 54/166 (32%), Positives = 83/166 (50%), Gaps = 20/166 (12%)

Query: 565 LLKKLETQPRVVKLIDHEMDHGVLYVVMECGDH-DLSQTLAHRSGMPLDVEFVRYHAQEM 623
           L+ K    P +V  ID  +  G L+V+ME  +   L+  + H     L    +    +E 
Sbjct: 708 LVMKGSKHPNIVNFIDSYVLKGDLWVIMEYMEGGSLTDVVTH---CILTEGQIGAVCRET 764

Query: 624 LKCVKVVHDAGIVHSDLKPANFVF-VKGILKIIDFGIANAVPEHTVNIYRETQIGTPNYM 682
           L  +K +H  G++H D+K  N +  ++G +K+ DFG    + E  +N+ R T +GTP +M
Sbjct: 765 LSGLKFLHSKGVLHRDIKSDNILLSMEGDIKLTDFGFCAQINE--LNLKRTTMVGTPYWM 822

Query: 683 APEALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPY 728
           APE +             SR + G   DIWS G +I +MI G PPY
Sbjct: 823 APEVV-------------SRKEYGPKVDIWSLGIMIIEMIEGEPPY 855

>Kwal_56.22693 s56 complement(239982..242936) [2955 bp, 984 aa] {ON}
           YDR490C (PKH1) - Ser/Thr protein kinase [contig 184]
           FULL
          Length = 984

 Score = 89.7 bits (221), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 66/235 (28%), Positives = 108/235 (45%), Gaps = 29/235 (12%)

Query: 566 LKKLETQPRVVKLIDHEMDHGVLYVVMECGDHDLSQTLAHRSGMPLDVEFVRYHAQEMLK 625
           L++L     V+KL     D   LY ++E   +    ++  + G  L  E   Y++ ++L 
Sbjct: 210 LQRLNDGRGVIKLYFTFQDEASLYFLLEYAPNGDFLSVIKKFG-SLSQECAVYYSAQILD 268

Query: 626 CVKVVHDAGIVHSDLKPANFVFVKGI-LKIIDFGIANAVPE----HTVNIYRETQ--IGT 678
            +  +H  GIVH D+KP N +  K + +K+ DFG A  + +     T N+   ++  +GT
Sbjct: 269 AIDYLHHKGIVHRDIKPENILLDKDMKVKLTDFGTARILEKDETTQTFNLLERSKSFVGT 328

Query: 679 PNYMAPEALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLL 738
             Y++PE L+  NY            V    DIW+ GCI++QMI G+PP   F+  N  L
Sbjct: 329 AEYVSPE-LLNDNY------------VDYKCDIWAFGCILFQMIAGKPP---FKATNEYL 372

Query: 739 AIMNPEVKIVYPEKTSNGDTVPKTAIDTMKACLERNPNKRWTVEEVANGSFVKPV 793
                 +K+ Y          P    D +K  L ++P +R    ++    F K V
Sbjct: 373 TFQK-VMKVQYAFTAG----FPLVIRDLIKKILVKSPEQRLDASQIKKHHFFKDV 422

>Kwal_56.22476 s56 complement(145039..147132) [2094 bp, 697 aa] {ON}
           YMR001C (CDC5) - protein kinase which functions at the
           G(sub)2/M boundary [contig 185] FULL
          Length = 697

 Score = 89.4 bits (220), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 72/233 (30%), Positives = 115/233 (49%), Gaps = 36/233 (15%)

Query: 562 EIELLKKLETQPRVVKLIDHEMDHGVLYVVMECGDHDLSQTLAHRSGMPLDVEFVRYHAQ 621
           EI++ K +     +V+ +D   D   +Y+++E   +     L  R  M  + E VR+   
Sbjct: 126 EIQIHKSMR-HTNIVQFVDCFEDDTNVYILLEICPNGSLMDLLKRRKMLTEPE-VRFFTT 183

Query: 622 EMLKCVKVVHDAGIVHSDLKPANFVFVKGI-LKIIDFGIANAVPEHTVNIYRETQIGTPN 680
           +++  VK +H   ++H DLK  N  F K   LK+ DFG+A  +       Y  T  GTPN
Sbjct: 184 QIVGAVKYMHSRRVIHRDLKLGNIFFDKHYNLKVGDFGLAAVLANDRERKY--TVCGTPN 241

Query: 681 YMAPEALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAI 740
           Y+APE L   +  H+       ++V    DIWSCG +IY ++ G+PP   FQ +      
Sbjct: 242 YIAPEVLTGKHTGHS-------YEV----DIWSCGVMIYALLIGKPP---FQAK------ 281

Query: 741 MNPEVKIVYPEKTSNGDTV-PK------TAIDTMKACLERNPNKRWTVEEVAN 786
              EV I+Y E+   GD V PK       A+  +K  L  +P +R +++E+ +
Sbjct: 282 ---EVNIIY-ERIKCGDFVFPKDKFISPEALVLIKDILSIDPLERPSLDEIID 330

>ZYRO0F08074g Chr6 (654009..654025,654107..655004) [915 bp, 304 aa]
           {ON} highly similar to uniprot|P17157 Saccharomyces
           cerevisiae YPL031C PHO85 Cyclin-dependent kinase with
           ten cyclin partners involved in environmental stress
           response in phosphate-rich conditions Pho85p-Pho80p
           complex phosphorylates Pho4p which in turn represses
           PHO5
          Length = 304

 Score = 86.3 bits (212), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 76/304 (25%), Positives = 136/304 (44%), Gaps = 51/304 (16%)

Query: 513 TEYEKLELLGRGGTSXXXXXXXXXXXXXXXLKRVSFDEFDDSSIDGFKGEIELLKKLETQ 572
           +++++LE LG G  +               LK V  D  + +     + EI L+K+L+  
Sbjct: 5   SQFKQLEKLGNGTYATVYKGLNKTTGVYVALKEVKLDSEEGTPSTAIR-EISLMKELK-H 62

Query: 573 PRVVKLIDHEMDHGVLYVVMECGDHDLSQTLAHRSG----MPLDVEFVRYHAQEMLKCVK 628
             VV+L D       L +V E  D+DL + +  R+       L++  V+Y   ++++   
Sbjct: 63  DNVVRLYDVIHTENKLTLVFEYMDNDLKKYMDSRTVGNNPQGLELNLVKYFQWQLMEGAA 122

Query: 629 VVHDAGIVHSDLKPANFVFV-KGILKIIDFGIANA--VPEHTVNIYRETQIGTPNYMAPE 685
             H+  I+H DLKP N +   KG LK+ DFG+A A  +P +T +    +++ T  Y AP+
Sbjct: 123 FCHENKILHRDLKPQNLLINNKGQLKLGDFGLARAFGIPVNTFS----SEVVTLWYRAPD 178

Query: 686 ALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMN--- 742
            L+            SR       D+WSCGCI+ +M+ G+P + G   + +L  I +   
Sbjct: 179 VLMG-----------SR-TYSTSIDMWSCGCILAEMVTGKPLFPGTNDEEQLKLIFDIMG 226

Query: 743 -------------PEVKIVYPEK----------TSNGDTVPKTAIDTMKACLERNPNKRW 779
                        P+  + +P+K            + + +    ID +   L+ NP+ R 
Sbjct: 227 TPNESTWPGVSSLPKFNLNFPQKLPRDLRSILQVCSKEPLDDNLIDLLHGLLQLNPDMRL 286

Query: 780 TVEE 783
           + ++
Sbjct: 287 SAKQ 290

>ZYRO0B06512g Chr2 complement(521075..524410) [3336 bp, 1111 aa]
           {ON} similar to uniprot|Q12236 YOL100W Saccharomyces
           cerevisiae YOL100W PKH2 Serine/threonine protein kinase
           involved in sphingolipid-mediated signaling pathway that
           controls endocytosis
          Length = 1111

 Score = 89.7 bits (221), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 64/250 (25%), Positives = 113/250 (45%), Gaps = 41/250 (16%)

Query: 562 EIELLKKLETQPRVVKLIDHEMDHGVLYVVMECGDHDLSQTLAHRSGMPLDVEFVRYHAQ 621
           E   L++L     +++L     D   LY ++E   +    ++  + G  L+ E   Y++ 
Sbjct: 218 EKNALQRLNNSRGIIRLYFTFQDEASLYFLLEYAPNGDFLSIMKKYG-SLNEECTCYYSA 276

Query: 622 EMLKCVKVVHDAGIVHSDLKPANFVFVKGI-LKIIDFGIANAV------PEHTVNIYRET 674
           +++  +K +H  GI+H D+KP N +  K + +K+ DFG A  +         T +++  +
Sbjct: 277 QIIDAIKFLHQRGIIHRDIKPENILLDKEMKVKLTDFGTAKLLDGKSQASGETYDLHTRS 336

Query: 675 Q--IGTPNYMAPEALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQ 732
           +  +GT  Y++PE L               W V    DIW+ GCI++QMI G+PP   F+
Sbjct: 337 KSFVGTAEYVSPELL------------NDNW-VDYRCDIWAFGCIVFQMIAGKPP---FK 380

Query: 733 GQNRLLAIMNPEVKIVYPEKTSNGDTVPKTAIDTMKACLERNPNKRWTVEEVANGSFVKP 792
             N  L      +K+ Y          P    D +K  L R P++R ++ ++        
Sbjct: 381 ATNEYLTFQK-VMKVQYAFTAG----FPVVVRDLVKRILLRQPDQRLSIPQIER------ 429

Query: 793 VSVTHFFIRD 802
               H+F RD
Sbjct: 430 ----HYFYRD 435

>CAGL0K02167g Chr11 complement(192297..195785) [3489 bp, 1162 aa]
           {ON} similar to uniprot|P38990 Saccharomyces cerevisiae
           YER129w Serine/threonine-protein kinase
          Length = 1162

 Score = 89.7 bits (221), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 79/278 (28%), Positives = 126/278 (45%), Gaps = 33/278 (11%)

Query: 544 KRVSFDEFDDSSIDGFKGEIELLKKLETQPRVVKLID--HEMDHGVLYVVME-CGDH--- 597
           K  SF +   +  D  K EI ++KK      VVKLI+   ++    +Y+V+E C      
Sbjct: 181 KFFSFKKPGKTENDKIKREIAIMKKCH-HKHVVKLIEVLDDLKSRKIYLVLEYCSRGEVK 239

Query: 598 ----DLSQTLAHRSGMPLDVEFVRYHAQEMLKCVKVVHDAGIVHSDLKPANFVFVK-GIL 652
               D  +T A +   PL  +F R   + ++  ++ +H  GI+H D+KPAN +  + GI+
Sbjct: 240 WCPPDCLETEA-KGPSPLSFQFTREILRGVVLGLEYLHYQGIIHRDIKPANLLLSETGIV 298

Query: 653 KIIDFGIANAVPEHTVNIYRET--------QIGTPNYMAPEALVAMN-YTHNQAPEQSRW 703
           KI DFG++ A     V+   ET          GTP + APE  +  + +   Q   +  +
Sbjct: 299 KISDFGVSLAASSSNVDGSDETIDELELAKTAGTPAFFAPEICLGEDAFEKYQLDREELF 358

Query: 704 K---VGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKI-VYPEKTSNGDTV 759
           K   +    DIW+ G  +Y +++G  P+           I+N  VK   Y +   N   +
Sbjct: 359 KGSCISFKIDIWALGVTLYCLVFGMLPFVSSFELELFEKIVNDPVKFPKYSDMLKNNQVL 418

Query: 760 PKT-------AIDTMKACLERNPNKRWTVEEVANGSFV 790
             T       A D +   LE+NP KR  +EE+    FV
Sbjct: 419 QMTEEAEYEAAKDLLTRLLEKNPIKRINIEEIKRHPFV 456

>SAKL0E02860g Chr5 complement(228726..232859) [4134 bp, 1377 aa]
           {ON} similar to uniprot|Q75DQ1 Ashbya gossypii ABL034W
           ABL034Wp and weakly similar to YKL101W uniprot|P34244
           Saccharomyces cerevisiae YKL101W HSL1 Nim1p-related
           protein kinase that regulates the morphogenesis and
           septin checkpoints associates with the assembled septin
           filament required along with Hsl7p for bud neck
           recruitment phosphorylation and degradation of Swe1p
          Length = 1377

 Score = 89.7 bits (221), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 67/230 (29%), Positives = 110/230 (47%), Gaps = 29/230 (12%)

Query: 558 GFKGEIELLKKLETQPRVVKLIDHEMDHGVLYVVME-CGDHDLSQTLAHRSGMPLDVEFV 616
           G + EI ++ KL + P ++ L +   +   L++V+E     +L   L  +  +P + E V
Sbjct: 116 GIEREI-IIMKLISHPNIMALYEVWENKSELFLVLEYVEGGELFDYLVSKGKLP-EQEAV 173

Query: 617 RYHAQEMLKCVKVVHDAGIVHSDLKPANFVFVKG--ILKIIDFGIANAVPEHTVNIYRET 674
            Y  Q +++ V   H+  I H DLKP N +  K    +KI DFG+A      T N   ET
Sbjct: 174 HYFRQ-IIQGVAYCHNYNICHRDLKPENLLVDKKNHQIKIADFGMAAL---ETTNKLLET 229

Query: 675 QIGTPNYMAPEALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQ 734
             G+P+Y +PE ++  NY             G PSD+WSCG I++ ++ G  P+     +
Sbjct: 230 SCGSPHYASPEIVMGKNYH------------GSPSDVWSCGIILFALLTGHLPFNDDNIK 277

Query: 735 NRLLAIMNPEVKIVYPEKTSNGDTVPKTAIDTMKACLERNPNKRWTVEEV 784
             LL + + +  +  P+  S+       A D +   L  +P  R T+ EV
Sbjct: 278 KLLLKVQSGKYHM--PQNISS------EAQDLISKILIVDPRGRITINEV 319

>TDEL0A07560 Chr1 complement(1316498..1321225) [4728 bp, 1575 aa] {ON}
            Anc_6.341 YNR031C
          Length = 1575

 Score = 89.7 bits (221), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 70/253 (27%), Positives = 114/253 (45%), Gaps = 44/253 (17%)

Query: 559  FKGEIELLKKLETQPRVVKLIDHEMDHGVLYVVME-CGDHDLSQTLAHRSGMPLDVEFVR 617
             K E+ +L+ L + P VV+    E+    + + ME C    ++  L H  G   D    +
Sbjct: 1309 IKEEMSVLEML-SHPNVVQYYGVEVHRDKVNIFMEYCEGGSMASLLEH--GRIEDEMVTQ 1365

Query: 618  YHAQEMLKCVKVVHDAGIVHSDLKPANFVF-VKGILKIIDFGIANAVPEHTVN------- 669
             +  E+L+ +  +H +G+VH D+KP N +    GI+K +DFG A  + ++  +       
Sbjct: 1366 VYTLELLEGLAYLHQSGVVHRDIKPENILLDFNGIIKYVDFGAAKKIAKNGTDTRGFARS 1425

Query: 670  ------------------IYRETQIGTPNYMAPEALVAMNYTHNQAPEQSRWKVGKPSDI 711
                              +  +  +GTP YMAPE++         +P + R  +G   DI
Sbjct: 1426 VASDSSTGSADNTSEQDGLALQDMMGTPMYMAPESITG-------SPNKGR--LG-ADDI 1475

Query: 712  WSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEKTSNGDTVPKTAIDTMKACL 771
            WS GC+I +MI GR P+     +    AIM        P+  SN D V       ++ CL
Sbjct: 1476 WSLGCVILEMITGRRPWAKLDNE---WAIMYHVAAGHIPQLPSN-DEVSSAGKKFLRRCL 1531

Query: 772  ERNPNKRWTVEEV 784
            + NP KR +  E+
Sbjct: 1532 QENPFKRASAVEL 1544

>TBLA0I01800 Chr9 complement(401728..403617) [1890 bp, 629 aa] {ON}
           Anc_3.229 YBR028C
          Length = 629

 Score = 89.0 bits (219), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 72/246 (29%), Positives = 111/246 (45%), Gaps = 49/246 (19%)

Query: 565 LLKKLETQPRVVKLIDHEMDHGVLYVVME-CGDHDLSQTLAHRSGMPLDVEFVRYHAQEM 623
           +L +LE  P +VKL     D   LY++++     +L   L  +    LD + V ++A E+
Sbjct: 233 ILSELE-HPNIVKLFYSFRDDSKLYLLLQYIPGGELFYHLKEQG--TLDEDTVAFYAAEI 289

Query: 624 LKCVKVVHDAGIVHSDLKPANFVF-VKGILKIIDFGI-----------------ANAVPE 665
              +K +H+ GIV+ DLKP N +   KG L + DFG+                 A  +  
Sbjct: 290 SCALKFLHEKGIVYRDLKPENCLLNEKGHLVLTDFGLSKKSLSESRTPSAVDLKAKLISN 349

Query: 666 HTVNIYRETQ--------IGTPNYMAPEALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCI 717
              +I  E +        IGTP Y APE L+   YT N              D +S GC+
Sbjct: 350 EDYSIVSEEEDVVALHSIIGTPEYCAPEILMGQPYTQN-------------CDWYSLGCL 396

Query: 718 IYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEKTSNGDTVPKTAIDTMKACLERNPNK 777
           IY M+ G+PP+ G   +  L  I   +V    P   S+G        D + A L+++ +K
Sbjct: 397 IYDMLVGKPPFTGNNHKVILNKIQKEKVGPKIPYYLSDG------MKDMLGALLKKDNSK 450

Query: 778 RWTVEE 783
           RW V++
Sbjct: 451 RWNVDK 456

>NCAS0A10290 Chr1 complement(2051582..2053111) [1530 bp, 509 aa]
           {ON} Anc_3.229
          Length = 509

 Score = 88.2 bits (217), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 73/244 (29%), Positives = 114/244 (46%), Gaps = 47/244 (19%)

Query: 561 GEIELLKKLETQPRVVKLIDHEMDHGVLYVVME-CGDHDLSQTLAHRSGMPLDVEFVRYH 619
            E  +L +LE  P +VKL     D+  LY++++     +L   L  +    LD + V ++
Sbjct: 184 AEKSILAELE-HPNIVKLFYSFHDNSKLYLLLQYIPGGELFFHLKEQG--TLDEDTVAFY 240

Query: 620 AQEMLKCVKVVHDAGIVHSDLKPANFVF-VKGILKIIDFGIA-NAVPEHTVNIYRETQ-- 675
           A E+   +K +HD GIV+ DLKP N +   KG L + DFG++  +V +++ N    T   
Sbjct: 241 AAEISCALKFLHDKGIVYRDLKPENCLLNDKGHLVLTDFGLSKKSVTQNSANPSEVTSLN 300

Query: 676 ------------IGTPNYMAPEALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIY 723
                       IGTP Y APE L  + Y  N              D +S GC+IY M+ 
Sbjct: 301 EPSEDLSTLHSIIGTPEYCAPEILQGLPYNKN-------------CDWYSLGCLIYDMLS 347

Query: 724 GRPPYGGFQGQNRLLAIMNPEVKIVYPEKTSNGDTVPKTAIDTMK----ACLERNPNKRW 779
           G+PPY G           N +V +   +K   G  +P    + MK      L+++ +KRW
Sbjct: 348 GKPPYTG----------ANHKVILNKIQKDKQGPKIPYYLSEGMKDMLNWLLKKDQSKRW 397

Query: 780 TVEE 783
            V++
Sbjct: 398 DVDK 401

>AFR696C Chr6 complement(1722130..1725558) [3429 bp, 1142 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR507C
           (GIN4) and YCL024W (KCC4)
          Length = 1142

 Score = 89.7 bits (221), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 70/231 (30%), Positives = 109/231 (47%), Gaps = 28/231 (12%)

Query: 558 GFKGEIELLKKLETQPRVVKLIDHEMDHGVLYVVMECGDH-DLSQTLAHRSGMPLDVEFV 616
           G + EI ++ KL   P V++L D       LY+V+E  +  +L   L  R  +P + E V
Sbjct: 74  GIEREI-IIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLP-ENEAV 131

Query: 617 RYHAQEMLKCVKVVHDAGIVHSDLKPANFVFV-KGILKIIDFGIANAVPEHTVNIYRETQ 675
           R+  Q ++  +   H  GIVH DLKP N +   K  +K+ DFG+A      + +   ET 
Sbjct: 132 RFFRQ-IIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAAL---ESKDKLLETS 187

Query: 676 IGTPNYMAPEALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQG-- 733
            G+P+Y APE +  + Y             G  SD+WSCG I+Y ++ GR P+    G  
Sbjct: 188 CGSPHYAAPEIVSGLPYH------------GFESDVWSCGVILYALLTGRLPFDEEDGNI 235

Query: 734 QNRLLAIMNPEVKIVYPEKTSNGDTVPKTAIDTMKACLERNPNKRWTVEEV 784
           +N LL + + + +I         D +   A D +   L   P +R    E+
Sbjct: 236 RNLLLKVQSGKYEI------PGEDEISPEARDLIVQILTVEPEQRIKTREI 280

>AFR335C Chr6 complement(1046756..1049857) [3102 bp, 1033 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL100W
           (PKH2) and YDR490C (PKH1)
          Length = 1033

 Score = 89.4 bits (220), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 60/228 (26%), Positives = 105/228 (46%), Gaps = 29/228 (12%)

Query: 573 PRVVKLIDHEMDHGVLYVVMECGDHDLSQTLAHRSGMPLDVEFVRYHAQEMLKCVKVVHD 632
           P V+KL     D   LY ++E   +    ++  R G  L  E  +Y+  ++L  +  +H 
Sbjct: 261 PGVIKLYFTFQDEANLYFLLEYAPNGDFLSVMKRFGT-LSEECTKYYGAQILDAIHHLHK 319

Query: 633 AGIVHSDLKPANFVFVKGI-LKIIDFGIANAVPE------HTVNIYRETQIGTPNYMAPE 685
            GI+H D+KP N +  K + +K+ DFG A  +        + +N   ++ +GT  Y++PE
Sbjct: 320 QGIIHRDVKPENILLDKTMKIKLTDFGTAKLIGREDENKPYDLNTRSKSFVGTAEYVSPE 379

Query: 686 ALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEV 745
            L+  NY  ++             DIW+ GCI++QM+ G+PP   F+  N  L      +
Sbjct: 380 -LLNDNYVDSRC------------DIWAFGCILFQMVAGKPP---FKATNEYLTFQKV-M 422

Query: 746 KIVYPEKTSNGDTVPKTAIDTMKACLERNPNKRWTVEEVANGSFVKPV 793
           ++ Y          P    D +K  L + P +R T+ ++    F   +
Sbjct: 423 RVQYAFTAG----FPMILRDLIKQLLVKKPEQRLTILQIEKHHFFNDI 466

>Ecym_1030 Chr1 (56043..57365) [1323 bp, 440 aa] {ON} similar to
           Ashbya gossypii AFR724C
          Length = 440

 Score = 87.8 bits (216), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 77/298 (25%), Positives = 131/298 (43%), Gaps = 35/298 (11%)

Query: 514 EYEKLELLGRGGTSXXXXXXXXXXXXXXXLKRVSFDEFDDSSIDGFKGEIELLKKLE--- 570
           +YE L+ +GRG                  +K V+ ++ D+  ID    EI  L +L    
Sbjct: 19  QYEILQCIGRGNFGDVYKARYLATNEIVAIKVVNLEDTDEP-IDLLAQEIFFLSELRSPY 77

Query: 571 -TQPRVVKLIDHEMDHGVLYVVME-CGDHDLSQTLAHRSGMPLDVEFVRYHAQEMLKCVK 628
            T  +   L+D  M     ++VME CG    ++ L +     L  +   +   E+L  + 
Sbjct: 78  ITNYKTAFLVDVSM-----WIVMEYCGGGSCAELLKYTPEHKLTEDQCAFIVSEVLVGLD 132

Query: 629 VVHDAGIVHSDLKPANFVFV-KGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEAL 687
            +H    +H D+K AN +    G +K+ DFG++    +  V   R+T +GTP +MAPE +
Sbjct: 133 YLHSQRKIHRDIKSANILLTDNGHVKLGDFGVSG---QMMVTRKRDTFVGTPFWMAPEVI 189

Query: 688 VAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKI 747
                 +N+            +DIWS G  + +++ G PP   +     L+AI   +   
Sbjct: 190 DRNKKGYNEM-----------ADIWSLGITVIELLMGHPPLDKYDAMKALMAIPKRD--- 235

Query: 748 VYPEKTSNGDTVPKTAIDTMKACLERNPNKRWTVEEVANGSFVKPVSVTHFFIRDLIE 805
             P K          A D +  CL ++P++R T  E+    FVK V +  + +RD ++
Sbjct: 236 --PPKLDK--RFSSHAKDFVAQCLIKDPSQRPTASELLKHRFVKRVRL--YNLRDQVD 287

>TBLA0B08250 Chr2 complement(1968879..1972922) [4044 bp, 1347 aa]
           {ON} Anc_3.92 YDR490C
          Length = 1347

 Score = 89.7 bits (221), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 60/229 (26%), Positives = 102/229 (44%), Gaps = 34/229 (14%)

Query: 575 VVKLIDHEMDHGVLYVVMECGDHDLSQTLAHRSGMPLDVEFVRYHAQEMLKCVKVVHDAG 634
           ++KL     D   LY ++E   +    TL  + G   D     Y   +++  +  +H  G
Sbjct: 321 IIKLYCTFQDEANLYFLLEYASNGDLLTLLKKYG-SFDETSTIYFTAQIIDSIHYIHSMG 379

Query: 635 IVHSDLKPANFVFVKGI-LKIIDFGIANAVPEHT---------VNIYRETQ--IGTPNYM 682
           I+H D+KP N +  K   +K+ DFG A  +              N+   ++  +GT  Y+
Sbjct: 380 IIHRDIKPENILLTKDFKIKLTDFGTAKILDPSQPSQSQSQPHFNLLERSKSFVGTAEYV 439

Query: 683 APEALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMN 742
           +PE L+  +YT ++             DIW+ GCI++Q+I G+PP   F+  N  L    
Sbjct: 440 SPE-LLTDSYTDSRC------------DIWAFGCILFQLIAGKPP---FKATNEYLTFQK 483

Query: 743 PEVKIVYPEKTSNGDTVPKTAIDTMKACLERNPNKRWTVEEVANGSFVK 791
             +K+ Y          P    D +K  L +NPN R T+ ++ +  F +
Sbjct: 484 I-IKLQYAFTAG----FPTILRDLIKKILIKNPNNRLTIHQIKSHLFYR 527

>Suva_1.50 Chr1 (96474..100556) [4083 bp, 1360 aa] {ON} YAL017W (REAL)
          Length = 1360

 Score = 89.7 bits (221), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 65/245 (26%), Positives = 115/245 (46%), Gaps = 37/245 (15%)

Query: 553  DSSIDGFKGEIELLKKLETQPR--VVKLIDHEMDHGVLYVVM----ECGDHDLSQTLAHR 606
            D  +     EI+++  L   P   +++L+D   D    Y+      E G  DL   +  +
Sbjct: 1144 DRKLGTIPSEIQIMATLNKTPHENILRLLDFFEDDDYYYIETPVHGETGCIDLFDLIEFK 1203

Query: 607  SGMPLDVEFVRYHAQEMLKCVKVVHDAGIVHSDLKPANFVF-VKGILKIIDFGIANAVPE 665
            + M  + E  +   ++++  +K +HD GIVH D+K  N +   KG +KIIDFG A  V  
Sbjct: 1204 TNMT-ECE-AKLIVKQVVAGIKHLHDQGIVHRDIKDENVIVDSKGFVKIIDFGSAAYVKS 1261

Query: 666  HTVNIYRETQIGTPNYMAPEALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGR 725
               +++    +GT +Y APE L    Y             GKP DIW+ G ++Y +++  
Sbjct: 1262 GPFDVF----VGTIDYAAPEVLGGNPYE------------GKPQDIWAIGILLYTVVFKE 1305

Query: 726  PPYGGFQGQNRLLAIMNPEVKIVYPEKTSNGDTVPKTAIDTMKACLERNPNKRWTVEEVA 785
             P+           I+  ++K       +N + V +  I+ +K+ L R   KR T++++ 
Sbjct: 1306 NPFYNID------EILEGDLKF------NNAEEVSEDCIELIKSILNRCVPKRPTIDDIN 1353

Query: 786  NGSFV 790
            NG ++
Sbjct: 1354 NGKWL 1358

>Kpol_463.8 s463 complement(18696..23039) [4344 bp, 1447 aa] {ON}
            complement(18696..23039) [4344 nt, 1448 aa]
          Length = 1447

 Score = 89.4 bits (220), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 73/305 (23%), Positives = 133/305 (43%), Gaps = 36/305 (11%)

Query: 500  INGRKRPVVYVNGTEYEKLELLGRGGTSXXXXXXXXXXXXXXXLKRVSF------DEFDD 553
            IN  K      N   + K E++G+G                  +K+V        +E   
Sbjct: 1125 INKSKNSKGEYNEFAWMKGEMIGKGSFGAVFLAMNITTGEMMAVKQVEVPKYGLQNETVV 1184

Query: 554  SSIDGFKGEIELLKKLETQPRVVKLIDHEMDHGVLYVVMECGDHDLSQTLAHRSGMPLDV 613
            +++D  + E+  LK L+    +V+ +  E  +G+  + +E        +L    G   D+
Sbjct: 1185 NTVDALRLEVSTLKDLD-HLNIVQYLGFEAKNGIYSLFLEYVAGGSVGSLIRMYGRFDDI 1243

Query: 614  EFVRYHAQEMLKCVKVVHDAGIVHSDLKPANFVFVK-GILKIIDFGIANAVPEHTVNIYR 672
              +R+   ++L+ +  +H  GI+H D+K  N +  + G+ KI DFGI+      + +IY 
Sbjct: 1244 -LIRHLTIQVLQGLSYLHSRGILHRDMKADNLLLDQDGVCKISDFGIS----RKSNDIYS 1298

Query: 673  ETQI---GTPNYMAPEALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYG 729
             +++   GT  +MAPE +             ++       DIWS GCI+ +M  G+ P+ 
Sbjct: 1299 NSEMTMKGTVFWMAPEMV------------DTKQGYSAKVDIWSLGCIVLEMFAGKRPWS 1346

Query: 730  GFQGQNRLLAIMNPEVKIVYPEKTSNGDTVP---KTAIDTMKACLERNPNKRWTVEEVAN 786
             F+    +  I   +     PE     DT+P   + A + +  C E +P KR T +++ +
Sbjct: 1347 NFEVVAAMFKIGQAKSAPPIPE-----DTLPLISENAKEFLDCCFEIDPEKRPTADKLLS 1401

Query: 787  GSFVK 791
              F K
Sbjct: 1402 HPFSK 1406

>YBR028C Chr2 complement(294425..296002) [1578 bp, 525 aa] {ON}
           YPK3An AGC kinase phosphorylated by cAMP-dependent
           protein kinase (PKA) in a TORC1-dependent manner
          Length = 525

 Score = 88.2 bits (217), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 69/240 (28%), Positives = 113/240 (47%), Gaps = 46/240 (19%)

Query: 561 GEIELLKKLETQPRVVKLIDHEMDHGVLYVVMEC--GDHDLSQTLAHRSGMPLDVEFVRY 618
            E  +L ++E  P +VKL     D+  LY++++   G         H +   LD   V +
Sbjct: 201 AERSILSEIE-HPNIVKLFYSFHDNSKLYLLLQYIPGGELFYHLKEHGT---LDETTVSF 256

Query: 619 HAQEMLKCVKVVHDAGIVHSDLKPANFVF-VKGILKIIDFGIA------NAV----PEHT 667
           +A E+   ++ +H  G+V+ DLKP N +   +G L + DFG++      +AV    PE+ 
Sbjct: 257 YAAEISCALRFLHTKGVVYRDLKPENCLLNQRGHLVLTDFGLSKKSANDSAVDEEDPENV 316

Query: 668 VNIYRETQIGTPNYMAPEALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPP 727
             +Y  + IGTP Y APE L+   Y+ N              D +S GC++Y M+ G+PP
Sbjct: 317 NALY--SIIGTPEYCAPEILLGKAYSQN-------------CDWYSLGCLLYDMLVGKPP 361

Query: 728 YGGFQGQNRLLAIMNPEVKIVYPEKTSNGDTVP----KTAIDTMKACLERNPNKRWTVEE 783
           Y G           N +V I   ++   G  +P    +   D + A L++   KRW V++
Sbjct: 362 YTG----------SNHKVIINKIQQNKQGPKIPFYLSEGMKDILNALLKKETAKRWNVDK 411

>Kpol_1018.65 s1018 (189779..191584) [1806 bp, 601 aa] {ON}
           (189779..191584) [1806 nt, 602 aa]
          Length = 601

 Score = 88.6 bits (218), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 79/324 (24%), Positives = 138/324 (42%), Gaps = 36/324 (11%)

Query: 515 YEKLELLGRGGTSXXXXXXXXXXXXXXXLKRVSFDEFDDSSIDG-FKGEIELLKKLETQP 573
           Y+ ++ LG G                  LK ++      S + G  + EI  L+ L   P
Sbjct: 42  YQIIKTLGEGSFGKVKLAYHVTTNQRVALKIINKKILAKSDMQGRIEREISYLRLLR-HP 100

Query: 574 RVVKLIDHEMDHGVLYVVMECGDHDLSQTLAHRSGMPLDVEFVRYHAQEMLKCVKVVHDA 633
            ++KL D       + +V+E  DH+L   +  R  M  +    R   Q+++  V+  H  
Sbjct: 101 HIIKLYDVIKSKEDIIMVIEYADHELFDYIVQRDKMSENE--ARKFFQQIISAVEYCHRH 158

Query: 634 GIVHSDLKPANFVFVKGI-LKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNY 692
            IVH DLKP N +  + + +KI DFG++N + +     + +T  G+PNY APE +    Y
Sbjct: 159 KIVHRDLKPENLLLDEELNVKIADFGLSNIMTDGN---FLKTSCGSPNYAAPEVISGKLY 215

Query: 693 THNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEK 752
                        G   D+WSCG I+Y M+  R P+             +  + +++   
Sbjct: 216 A------------GPEVDVWSCGVILYVMLCRRLPFD------------DDSIPVLFKNI 251

Query: 753 TSNGDTVPK----TAIDTMKACLERNPNKRWTVEEVANGSFVKPVSVTHFFIRDLIENSV 808
           ++   T+PK     A + +K  L  NP  R ++ E+    + +     +   +D+   S 
Sbjct: 252 SNGIYTLPKFLSPGAANLIKRMLIVNPLNRISMNEIMEDEWFRVDFPEYLEPQDMKLKSS 311

Query: 809 RYGANQKEISSAKVEELAEDVWHR 832
           +   N  + SS ++ E   D+  R
Sbjct: 312 KDNNNSNDGSSEEINEDLVDILSR 335

>TPHA0C00470 Chr3 (81482..83377) [1896 bp, 631 aa] {ON} Anc_5.611
           YDR477W
          Length = 631

 Score = 88.6 bits (218), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 85/322 (26%), Positives = 142/322 (44%), Gaps = 34/322 (10%)

Query: 515 YEKLELLGRGGTSXXXXXXXXXXXXXXXLKRVSFDEFDDSSIDG-FKGEIELLKKLETQP 573
           Y+ ++ LG G                  LK ++      S + G  + EI  L+ L   P
Sbjct: 30  YQIVKTLGEGSFGKVKLAFHSTTRQKVALKIINKKVLSKSDMQGRIEREISYLRLLR-HP 88

Query: 574 RVVKLIDHEMDHGVLYVVMECGDHDLSQTLAHRSGMPLDVEFVRYHAQEMLKCVKVVHDA 633
            ++KL D       + +V+E  DH+L   +  R  M  + E  R+  Q+++  V+  H  
Sbjct: 89  HIIKLYDVIKSKDEIIMVIEYADHELFDYIVQREKMS-ENEGRRFF-QQIISAVEYCHRH 146

Query: 634 GIVHSDLKPANFVFVKGI-LKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNY 692
            IVH DLKP N +  +   +KI DFG++N + +     + +T  G+PNY APE +    Y
Sbjct: 147 KIVHRDLKPENLLLDEHYNVKITDFGLSNIITDGN---FLKTSCGSPNYAAPEVISGKLY 203

Query: 693 THNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEK 752
                        G   D+WSCG I+Y ++  R P+   +    L   +N  V  + P  
Sbjct: 204 A------------GPEVDVWSCGVILYVLLCRRLPFDD-ESIPTLFKNINNGVYTI-PNF 249

Query: 753 TSNGDTVPKTAIDTMKACLERNPNKRWTVEEVANGSFVKPVSVTHFFI---RDLIE-NSV 808
            S G      A   +K  L  NP  R T+ ++    + K V +  + +   +D I+ N  
Sbjct: 250 LSEG------AASLIKKMLIVNPMNRITIGDIIQDPWFK-VDLPEYLVPSEKDAIKINGT 302

Query: 809 RYGA-NQKEISSAKVEELAEDV 829
              A N + +++A ++E A D+
Sbjct: 303 NNNAENLQNLTAADIDEEAIDI 324

>KLTH0F01672g Chr6 (127277..130771) [3495 bp, 1164 aa] {ON} similar
           to uniprot|Q12263 Saccharomyces cerevisiae YDR507C
          Length = 1164

 Score = 89.0 bits (219), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 68/223 (30%), Positives = 105/223 (47%), Gaps = 24/223 (10%)

Query: 558 GFKGEIELLKKLETQPRVVKLIDHEMDHGVLYVVMECGDH-DLSQTLAHRSGMPLDVEFV 616
           G + EI ++ KL   P V++L D    +  LY+V+E  +  +L   L  R  +P + E V
Sbjct: 83  GIEREI-IIMKLLNHPNVLRLYDVWETNSSLYMVLEYVEKGELFNLLVDRGPLP-ENEAV 140

Query: 617 RYHAQEMLKCVKVVHDAGIVHSDLKPANFVFV-KGILKIIDFGIANAVPEHTVNIYRETQ 675
           R+  Q ++  +   H  GIVH DLKP N +   K  +KI DFG+A      + +   ET 
Sbjct: 141 RFFRQ-IIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAAL---ESKDKLLETS 196

Query: 676 IGTPNYMAPEALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQN 735
            G+P+Y APE +  + Y             G  SD+WSCG I++ ++ GR P+    G  
Sbjct: 197 CGSPHYAAPEIVSGLPYH------------GFESDVWSCGIILFALLTGRLPFDEEDGNI 244

Query: 736 RLLAIMNPEVKIVYPEKTSNGDTVPKTAIDTMKACLERNPNKR 778
           R L +     K   P+     + +   A D +   L  +P  R
Sbjct: 245 RNLLLKVQSGKFEMPDT----NEISGEAQDLIAKILTVDPAAR 283

>Skud_11.126 Chr11 (235011..239567) [4557 bp, 1518 aa] {ON} YKL101W
           (REAL)
          Length = 1518

 Score = 89.4 bits (220), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 65/237 (27%), Positives = 109/237 (45%), Gaps = 29/237 (12%)

Query: 558 GFKGEIELLKKLETQPRVVKLIDHEMDHGVLYVVMECGDH-DLSQTLAHRSGMPLDVEFV 616
           G + EI ++K L +   V+ L +   +   LY+V+E  D  +L   L  +  +P + E +
Sbjct: 160 GIEREIVIMK-LISHANVMALFEVWENKSELYLVLEYVDGGELFDYLVSKGKLP-EREAI 217

Query: 617 RYHAQEMLKCVKVVHDAGIVHSDLKPANFVFVKG--ILKIIDFGIANAVPEHTVNIYRET 674
            Y  Q +++ V   H   I H DLKP N +  K    +KI DFG+A        N   +T
Sbjct: 218 HYFKQ-IVEGVSFCHSFNICHRDLKPENLLLDKKNRKIKIADFGMAAL---ELPNKLLKT 273

Query: 675 QIGTPNYMAPEALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQ 734
             G+P+Y +PE ++   Y             G PSD+WSCG +++ ++ G  P+     +
Sbjct: 274 SCGSPHYASPEIVMGRPYH------------GGPSDVWSCGIVLFALLTGHLPFNDDNIK 321

Query: 735 NRLLAIMNPEVKIVYPEKTSNGDTVPKTAIDTMKACLERNPNKRWTVEEVANGSFVK 791
             LL + + + ++           +   A D +   L  NP KR T +E+ N   +K
Sbjct: 322 KLLLKVQSGKYQMPM--------NLSAEARDLISKILVINPEKRITTQEILNHPLIK 370

>KAFR0H02430 Chr8 complement(464446..466800) [2355 bp, 784 aa] {ON}
           Anc_8.676 YPL153C
          Length = 784

 Score = 88.6 bits (218), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 71/246 (28%), Positives = 122/246 (49%), Gaps = 16/246 (6%)

Query: 554 SSIDGFKGEIELLKKLETQPRVVKLIDHEMDHGVLYVVME-CGDHDLSQTLAHRSGMPLD 612
            ++DG   E+E+LK+L   PR+V L     D+   Y+VME     DL   +A    +  D
Sbjct: 225 GNLDGVTRELEVLKRL-NHPRIVSLKGFYEDNESYYMVMEFVSGGDLMDFVAAHGAVGED 283

Query: 613 VEFVRYHAQEMLKCVKVVHDAGIVHSDLKPANFVFVKG---ILKIIDFGIANAVPEHTVN 669
               +  ++++L+ VK +H  GI H DLKP N +  +    ++KI DFG+A      T  
Sbjct: 284 AG--KEISRQILEAVKYIHSMGISHRDLKPDNILIEQDDPVLVKITDFGLAKVQGNGT-- 339

Query: 670 IYRETQIGTPNYMAPEALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYG 729
            + +T  GT  Y+APE ++  +  +N+  E+ R +     D+WS GC++Y ++ G  P+ 
Sbjct: 340 -FMKTFCGTLAYVAPE-VIGSSSKYNEEDEE-RNEYSSLVDMWSMGCLVYVILTGHLPFS 396

Query: 730 GFQGQNRLLAIMNPEVKIVYPEKTSNGDTVPKTAIDTMKACLERNPNKRWTVEEVANGSF 789
           G   Q +L   ++   +  Y E       +   A D + + L+ +P+ R T        +
Sbjct: 397 G-STQEQLYKQIS---RGSYHEGPLKDYRISDEARDFIDSLLQVDPSNRLTAARALEHPW 452

Query: 790 VKPVSV 795
           +K VS+
Sbjct: 453 IKMVSL 458

>TDEL0D05320 Chr4 complement(965082..968255) [3174 bp, 1057 aa] {ON}
           Anc_3.92 YDR490C
          Length = 1057

 Score = 89.0 bits (219), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 63/238 (26%), Positives = 108/238 (45%), Gaps = 30/238 (12%)

Query: 562 EIELLKKLETQPRVVKLIDHEMDHGVLYVVMECGDHDLSQTLAHRSGMPLDVEFVRYHAQ 621
           E   L++L     +VKL     D   LY ++E   +    ++  + G  L+ +   Y++ 
Sbjct: 215 EKNALQRLNNSRGIVKLYFTFQDESSLYFLLEYAPNGDFLSIMKKYG-SLNEDCACYYSA 273

Query: 622 EMLKCVKVVHDAGIVHSDLKPANFVFVKGI-LKIIDFGIA-------NAVPEHTVNIYRE 673
           +++  +  +H  GIVH D+KP N +  K   +K+ DFG A       N    + +    +
Sbjct: 274 QIIDAIDFLHSKGIVHRDIKPENILLDKDFKVKLTDFGTAKILEPKPNTTDSYDLLSRSK 333

Query: 674 TQIGTPNYMAPEALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQG 733
           + +GT  Y++PE L+  NY   +             DIW+ GCI++QMI G+PP   F+ 
Sbjct: 334 SFVGTAEYVSPE-LLNDNYVDYRC------------DIWAFGCILFQMIAGKPP---FKA 377

Query: 734 QNRLLAIMNPEVKIVYPEKTSNGDTVPKTAIDTMKACLERNPNKRWTVEEVANGSFVK 791
            N  L      +K+ Y          P    D +K  L + P +R T+ ++ +  F K
Sbjct: 378 TNEYLTFQK-VMKVQYAFTAG----FPLVVRDLVKGILIKQPAQRLTIPQIKSHHFFK 430

>YPL153C Chr16 complement(261727..264192) [2466 bp, 821 aa] {ON}
           RAD53Protein kinase, required for cell-cycle arrest in
           response to DNA damage; activated by trans
           autophosphorylation when interacting with
           hyperphosphorylated Rad9p; also interacts with ARS1 and
           plays a role in initiation of DNA replication
          Length = 821

 Score = 88.6 bits (218), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 68/242 (28%), Positives = 118/242 (48%), Gaps = 14/242 (5%)

Query: 554 SSIDGFKGEIELLKKLETQPRVVKLIDHEMDHGVLYVVME-CGDHDLSQTLAHRSGMPLD 612
            ++DG   E+E+L+KL   PR+V+L     D    Y+VME     DL   +A    +  D
Sbjct: 236 GNMDGVTRELEVLQKL-NHPRIVRLKGFYEDTESYYMVMEFVSGGDLMDFVAAHGAVGED 294

Query: 613 VEFVRYHAQEMLKCVKVVHDAGIVHSDLKPANFVFVKG---ILKIIDFGIANAVPEHTVN 669
               R  ++++L  +K +H  GI H DLKP N +  +    ++KI DFG+A      +  
Sbjct: 295 AG--REISRQILTAIKYIHSMGISHRDLKPDNILIEQDDPVLVKITDFGLAKVQGNGS-- 350

Query: 670 IYRETQIGTPNYMAPEALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYG 729
            + +T  GT  Y+APE +   + + +    + R +     D+WS GC++Y ++ G  P+ 
Sbjct: 351 -FMKTFCGTLAYVAPEVIRGKDTSVSPDEYEERNEYSSLVDMWSMGCLVYVILTGHLPFS 409

Query: 730 GFQGQNRLLAIMNPEVKIVYPEKTSNGDTVPKTAIDTMKACLERNPNKRWTVEEVANGSF 789
           G   Q++L   +    +  Y E       + + A D + + L+ +PN R T  +  N  +
Sbjct: 410 G-STQDQLYKQIG---RGSYHEGPLKDFRISEEARDFIDSLLQVDPNNRSTAAKALNHPW 465

Query: 790 VK 791
           +K
Sbjct: 466 IK 467

>NCAS0A05370 Chr1 complement(1061671..1066197) [4527 bp, 1508 aa] {ON}
            
          Length = 1508

 Score = 89.0 bits (219), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 70/248 (28%), Positives = 118/248 (47%), Gaps = 39/248 (15%)

Query: 559  FKGEIELLKKLETQPRVVKLIDHEMDHGVLYVVME-CGDHDLSQTLAHRSGMPLDVEFVR 617
             K E+ +L+ L + P +V+    E+    + + ME C    L+  L H  G   D    +
Sbjct: 1254 IKEEMNVLEML-SHPNIVQYYGVEVHRDRVNIFMEYCEGGSLASLLEH--GRIEDEMVTQ 1310

Query: 618  YHAQEMLKCVKVVHDAGIVHSDLKPANFVF-VKGILKIIDFGIANAVPEH-TVNIYRET- 674
             +  ++L+ +  +H++GIVH D+KP N +    GI+K +DFG A  + ++ T  + RE  
Sbjct: 1311 VYTLQLLEGLAYLHESGIVHRDIKPENILLDFNGIIKYVDFGAARKIAKNGTRVVTREMP 1370

Query: 675  ------------------QIGTPNYMAPEALVAMNYTHNQAPEQSRWKVGKPSDIWSCGC 716
                               IGTP YMAPEA+         +P++    +G   DIW+ GC
Sbjct: 1371 DENDDENGKVVGRNNFNDIIGTPMYMAPEAITG-------SPKKGH--LG-ADDIWALGC 1420

Query: 717  IIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEKTSNGDTVPKTAIDTMKACLERNPN 776
            ++ +MI G+ P+     +    AIM        P+  +N D V    +  +K CL++NP 
Sbjct: 1421 VVLEMITGKRPWANLDNE---WAIMYHVAAGQIPQLPTN-DEVSPAGMHFLKRCLKQNPA 1476

Query: 777  KRWTVEEV 784
            +R +  E+
Sbjct: 1477 QRASAVEL 1484

>Skud_15.54 Chr15 (88576..91824) [3249 bp, 1082 aa] {ON} YOL100W
           (REAL)
          Length = 1082

 Score = 89.0 bits (219), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 63/238 (26%), Positives = 110/238 (46%), Gaps = 32/238 (13%)

Query: 566 LKKLETQPRVVKLIDHEMDHGVLYVVMECGDHDLSQTLAHRSGMPLDVEFVRYHAQEMLK 625
           L+KL     VV+L     D   LY ++E   +    +L  ++G  LD     Y+  +++ 
Sbjct: 233 LQKLNNSHSVVRLFSTFQDESSLYFLLEYAPNGDFLSLMKKNG-SLDENCACYYGAQIID 291

Query: 626 CVKVVHDAGIVHSDLKPANFVFVKGI-LKIIDFGIANAV---------PEHTVNIYRETQ 675
            +  +H  GI+H D+KP N +  + + +K+ DFG A  +          ++ ++   ++ 
Sbjct: 292 AIDYLHSNGIIHRDIKPENILLDEEMRIKLTDFGTAKLLDSTVSSTSKQKYDLSTRSKSF 351

Query: 676 IGTPNYMAPEALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQN 735
           +GT  Y++PE L       N +    R       DIW+ GCI++QMI G+PP   F+  N
Sbjct: 352 VGTAEYVSPELL-------NDSFTDYRC------DIWAFGCILFQMIAGKPP---FKATN 395

Query: 736 RLLAIMNPEVKIVYPEKTSNGDTVPKTAIDTMKACLERNPNKRWTVEEVANGSFVKPV 793
             L      +K+ Y    +     P    D +K  L +N ++R T+ ++    F K V
Sbjct: 396 EYLTFQK-VMKVQY----AFTPGFPLIIRDLVKKILIKNLDQRLTISQIKEHYFFKEV 448

>Ecym_3547 Chr3 complement(1034494..1036107) [1614 bp, 537 aa] {ON}
           similar to Ashbya gossypii AEL083W
          Length = 537

 Score = 87.8 bits (216), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 71/237 (29%), Positives = 111/237 (46%), Gaps = 36/237 (15%)

Query: 561 GEIELLKKLETQPRVVKLIDHEMDHGVLYVVME-CGDHDLSQTLAHRSGMPLDVEFVRYH 619
            E  +L +LE  P +VKL     DH  LY++++     +L   L  +    LD   V ++
Sbjct: 213 AERSILSQLE-HPNIVKLFYSFHDHHRLYLLLQYIPGGELFYHLKEQG--TLDETTVAFY 269

Query: 620 AQEMLKCVKVVHDAGIVHSDLKPANFVF-VKGILKIIDFGIANA--------VPEHTVN- 669
           A E+   +K +H  GIV+ DLKP N +   +G L + DFG++          +   +VN 
Sbjct: 270 AAELSCALKFLHGKGIVYRDLKPENCLLNERGHLVLTDFGLSKKSVHQPDYPISGESVNE 329

Query: 670 IYRETQIGTPNYMAPEALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYG 729
           +Y  + IGTP Y APE L  + YT N              D +S G + Y M+ G+PP+ 
Sbjct: 330 LY--SIIGTPEYCAPEILEGLPYTQN-------------CDWYSLGSLAYDMLIGKPPFT 374

Query: 730 GFQGQNRLLAIMNPEVKIVYPEKTSNGDTVPKTAIDTMKACLERNPNKRWTVEEVAN 786
           G      +L+ +  E  +  P   S+G        D + A L+++  KRW V+   N
Sbjct: 375 GIN-HKVILSKIQREKSVKLPSYLSDG------MKDYLNALLKKDTLKRWDVDIFWN 424

>KLLA0F13552g Chr6 complement(1252906..1256709) [3804 bp, 1267 aa]
           {ON} weakly similar to uniprot|P34244 Saccharomyces
           cerevisiae YKL101W HSL1 Nim1p-related protein kinase
           that regulates the morphogenesis and septin checkpoints
           associates with the assembled septin filament required
           along with Hsl7p for bud neck recruitment
           phosphorylation and degradation of Swe1p
          Length = 1267

 Score = 89.0 bits (219), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 65/230 (28%), Positives = 111/230 (48%), Gaps = 29/230 (12%)

Query: 558 GFKGEIELLKKLETQPRVVKLIDHEMDHGVLYVVME-CGDHDLSQTLAHRSGMPLDVEFV 616
           G + EI ++ KL + P V+ L +   +   LY+V+E     +L   L  +  +P + E +
Sbjct: 120 GIEREI-IIMKLISHPNVMGLYEVWENKSELYLVLEYVEGGELFDYLVSKGKLP-ESEAI 177

Query: 617 RYHAQEMLKCVKVVHDAGIVHSDLKPANFVFVKG--ILKIIDFGIANAVPEHTVNIYRET 674
            Y  Q +++ V   H   I H DLKP N +  K    +KI DFG+A      T +   ET
Sbjct: 178 HYFKQ-IVQAVAYCHGFNICHRDLKPENLLLDKKKRSIKIADFGMAAL---ETSDKLLET 233

Query: 675 QIGTPNYMAPEALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQ 734
             G+P+Y +PE ++   Y             G PSD+WSCG I++ ++ G  P+     +
Sbjct: 234 SCGSPHYASPEIVLGRKYH------------GSPSDVWSCGIILFALLTGHLPFNDDNVK 281

Query: 735 NRLLAIMNPEVKIVYPEKTSNGDTVPKTAIDTMKACLERNPNKRWTVEEV 784
             LL + + + ++  P+  S        A D +   L  +PN+R T++++
Sbjct: 282 KLLLKVQSGKYQM--PQWLS------VEAKDLISRILVVDPNRRITIDQI 323

>Kpol_431.9 s431 complement(22310..26968) [4659 bp, 1552 aa] {ON}
           complement(22310..26968) [4659 nt, 1553 aa]
          Length = 1552

 Score = 89.0 bits (219), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 64/230 (27%), Positives = 108/230 (46%), Gaps = 29/230 (12%)

Query: 558 GFKGEIELLKKLETQPRVVKLIDHEMDHGVLYVVMECGDH-DLSQTLAHRSGMPLDVEFV 616
           G + EI ++K L + P V+ L +   ++  LY+V+E  D  +L   L  + G   + E V
Sbjct: 181 GIEREIVIMKLL-SHPNVMALYEVWENNNELYLVLEYVDGGELFDYLVSK-GKLTESEAV 238

Query: 617 RYHAQEMLKCVKVVHDAGIVHSDLKPANFVFVKG--ILKIIDFGIANAVPEHTVNIYRET 674
            Y  Q ++  +   H   I H DLKP N +  K   I+KI DFG+A        N   +T
Sbjct: 239 HYFKQ-IINGISYCHSFNICHRDLKPENLLLDKKRRIIKIADFGMAAL---QVSNRLLQT 294

Query: 675 QIGTPNYMAPEALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQ 734
             G+P+Y +PE ++   Y             G PSDIWSCG I++ ++ G  P+     +
Sbjct: 295 SCGSPHYASPEIVMGKCYN------------GAPSDIWSCGIILFALLTGHLPFNDDNIK 342

Query: 735 NRLLAIMNPEVKIVYPEKTSNGDTVPKTAIDTMKACLERNPNKRWTVEEV 784
             L+ + N   ++           + + A + +   L  +P+KR + E++
Sbjct: 343 KLLIKVQNGRYQM--------PSYISQEAKNLISRILVVDPSKRISTEQI 384

>KLTH0C09548g Chr3 (792218..795199) [2982 bp, 993 aa] {ON} similar
           to uniprot|Q12236 YOL100W Saccharomyces cerevisiae
           YOL100W PKH2 Serine/threonine protein kinase involved in
           sphingolipid-mediated signaling pathway that controls
           endocytosis
          Length = 993

 Score = 88.6 bits (218), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 64/233 (27%), Positives = 108/233 (46%), Gaps = 29/233 (12%)

Query: 566 LKKLETQPRVVKLIDHEMDHGVLYVVMECGDHDLSQTLAHRSGMPLDVEFVRYHAQEMLK 625
           L++L     ++KL     D   LY ++E   +    ++  + G  L+ +   Y++ ++L 
Sbjct: 215 LQRLNDGRGIIKLYFTFQDEASLYFLLEYAPNGDFLSVIKKYG-SLNQDCSVYYSAQILD 273

Query: 626 CVKVVHDAGIVHSDLKPANFVFVKGI-LKIIDFGIANAVPE----HTVNIYRETQ--IGT 678
            +  +H  G++H D+KP N +  K + +K+ DFG A  V +     T N+   ++  +GT
Sbjct: 274 AIDYLHQKGVIHRDIKPENILLDKDMKVKLTDFGTAKLVEKDETTQTYNLLERSKSFVGT 333

Query: 679 PNYMAPEALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLL 738
             Y++PE L+  NY            V    DIW+ GCI++QMI G+PP   F+  N  L
Sbjct: 334 AEYVSPE-LLNDNY------------VDYKCDIWAFGCILFQMIAGKPP---FKATNEYL 377

Query: 739 AIMNPEVKIVYPEKTSNGDTVPKTAIDTMKACLERNPNKRWTVEEVANGSFVK 791
                 +K+ Y          P    D +K  L +NP +R    +V    F K
Sbjct: 378 TFQK-VMKVQYAFTAG----FPLIIRDLIKQILVKNPEQRLDTLQVKKHHFFK 425

>NDAI0I00340 Chr9 (65047..70557) [5511 bp, 1836 aa] {ON} Anc_6.341
          Length = 1836

 Score = 89.0 bits (219), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 73/264 (27%), Positives = 112/264 (42%), Gaps = 51/264 (19%)

Query: 559  FKGEIELLKKLETQPRVVKLIDHEMDHGVLYVVME-CGDHDLSQTLAHRSGMPLDVEFVR 617
             K E+ +L+ L   P +V+    E+    + + ME C    L+  L H  G   D    +
Sbjct: 1575 IKEEMTVLEMLN-HPNIVQYYGVEVHRDKVNIFMEYCEGGSLASLLEH--GRIEDEMVTQ 1631

Query: 618  YHAQEMLKCVKVVHDAGIVHSDLKPANFVF-VKGILKIIDFGIANAVPEHTVNI------ 670
             +  E+L+ +  +H AG+VH D+KP N +    GI+K +DFG A  + ++   I      
Sbjct: 1632 IYTLELLEGLAYLHQAGVVHRDIKPENILLDFNGIIKYVDFGAARKIAKNGTRIPNLNKK 1691

Query: 671  --------------YRETQIGTPNYMAPEALVAMNYTHNQAPEQSRWKVGKPSDIWSCGC 716
                               +GTP YMAPE++     T          K G   DIWS GC
Sbjct: 1692 NGAEPEVEEDADGGKVHDMMGTPMYMAPESITGPGNTG---------KFGS-DDIWSLGC 1741

Query: 717  IIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEKTSNGDTVPKTAIDTMKACLERNPN 776
            ++ +M+ GR P+     +    AIM   V   +  +  N D V       ++ CL ++P 
Sbjct: 1742 VVLEMVTGRRPWANLDNE---WAIM-YHVAAGHTPQLPNADEVTPAGRAFLQRCLVQDPK 1797

Query: 777  KR----------WTVE--EVANGS 788
             R          W VE  E+A GS
Sbjct: 1798 SRATAVELLIDPWIVEIREIAFGS 1821

>ZYRO0F17402g Chr6 complement(1445685..1449254) [3570 bp, 1189 aa]
           {ON} similar to uniprot|Q12263 Saccharomyces cerevisiae
           YDR507C
          Length = 1189

 Score = 88.6 bits (218), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 70/229 (30%), Positives = 104/229 (45%), Gaps = 24/229 (10%)

Query: 558 GFKGEIELLKKLETQPRVVKLIDHEMDHGVLYVVMECGDH-DLSQTLAHRSGMPLDVEFV 616
           G + EI ++ KL   P V++L D    +  LY+V+E  +  +L   L     +P + E V
Sbjct: 78  GIEREI-IIMKLLNHPNVLRLYDVWETNPSLYMVLEYAEKGELFNLLVENGPLP-ENEAV 135

Query: 617 RYHAQEMLKCVKVVHDAGIVHSDLKPANFVFVKGI-LKIIDFGIANAVPEHTVNIYRETQ 675
            +  Q ++  V   H  GIVH DLKP N +    + +KI DFG+A      T +   ET 
Sbjct: 136 CFFRQ-IIIGVSYCHALGIVHRDLKPENLLLDHDLNIKIADFGMAAL---ETEDKLLETS 191

Query: 676 IGTPNYMAPEALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQN 735
            G+P+Y APE +  + Y             G  SDIWSCG I + ++ GR P+    G  
Sbjct: 192 CGSPHYAAPEIVSGIPYH------------GFASDIWSCGVIFFALLTGRLPFDEEDGNI 239

Query: 736 RLLAIMNPEVKIVYPEKTSNGDTVPKTAIDTMKACLERNPNKRWTVEEV 784
           R L +     K   P+     D +   A D +   L  +P  R    E+
Sbjct: 240 RNLLLKVQSGKFEMPDD----DEISPEAQDLLAKILTVDPECRIKPREI 284

>NCAS0F01580 Chr6 complement(313801..317949) [4149 bp, 1382 aa] {ON}
            Anc_7.86
          Length = 1382

 Score = 88.6 bits (218), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 66/246 (26%), Positives = 113/246 (45%), Gaps = 39/246 (15%)

Query: 553  DSSIDGFKGEIELLKKLETQPR--VVKLIDHEMDHGVLYVVM----ECGDHDLSQTLAHR 606
            D  +     EI+++  L  +P   ++ L+D   D    Y+      E G  DL   +  +
Sbjct: 1166 DRQLGTIPSEIQIMATLNKKPHDNILSLLDFFEDDDYYYIETPVHGETGCIDLFDLIEFK 1225

Query: 607  SGMPLDVEF-VRYHAQEMLKCVKVVHDAGIVHSDLKPANFVF-VKGILKIIDFGIANAVP 664
            + M    EF  +   ++++  +K +HD GIVH D+K  N +   KG +KIIDFG A  V 
Sbjct: 1226 TNM---TEFEAKLIFKQIVSGIKHLHDQGIVHRDIKDENVIVDSKGCVKIIDFGSAAYVK 1282

Query: 665  EHTVNIYRETQIGTPNYMAPEALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYG 724
                +++    +GT +Y APE L    Y             GKP DIW+ G ++Y +++ 
Sbjct: 1283 SGPFDVF----VGTIDYAAPEVLSGEPYE------------GKPQDIWAIGILLYTIVFK 1326

Query: 725  RPPYGGFQGQNRLLAIMNPEVKIVYPEKTSNGDTVPKTAIDTMKACLERNPNKRWTVEEV 784
              P+           I+  E+K       +N + + +  I+ +K  L R+  KR  +EE+
Sbjct: 1327 ENPFYNID------EILEGELKF------NNSNDISEDCIELIKKILIRSVPKRPLIEEI 1374

Query: 785  ANGSFV 790
             N  ++
Sbjct: 1375 FNDKWL 1380

>Kwal_56.22788 s56 complement(281404..282951) [1548 bp, 515 aa] {ON}
           YBR028C - Hypothetical ORF [contig 184] FULL
          Length = 515

 Score = 87.4 bits (215), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 69/239 (28%), Positives = 111/239 (46%), Gaps = 40/239 (16%)

Query: 565 LLKKLETQPRVVKLIDHEMDHGVLYVVME-CGDHDLSQTLAHRSGMPLDVEFVRYHAQEM 623
           +L +LE  P +VKL     DH  LY++++     +L   L  +    LD + V ++A E+
Sbjct: 190 ILSQLE-HPNIVKLFYSFHDHHKLYLILQFIPGGELFYHLKEQG--TLDEDTVAFYAAEI 246

Query: 624 LKCVKVVHDAGIVHSDLKPANFVF-VKGILKIIDFGIA------NAVPEHTVN------- 669
              ++ +H  G+V+ DLKP N +   +G L + DFG++      ++     VN       
Sbjct: 247 SCALRFLHKRGVVYRDLKPENCLLDERGHLVLTDFGLSKVSASDDSADGGDVNTNGHEGE 306

Query: 670 --IYRETQIGTPNYMAPEALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPP 727
                 + IGTP Y APE L    YT N              D +S GC+I+ M+ G+PP
Sbjct: 307 SVCTLHSIIGTPEYCAPEILEGKPYTQN-------------CDWYSLGCLIFDMLIGKPP 353

Query: 728 YGGFQGQNRLLAIMNPEVKIVYPEKTSNGDTVPKTAIDTMKACLERNPNKRWTVEEVAN 786
           Y G   +  L  I+  ++  + P   S G        D + A L+++  KRW V++  N
Sbjct: 354 YTGVNHKVILNKILKDKIPKI-PSYLSEG------MKDFLAALLKKDVTKRWDVDKFWN 405

>ZYRO0G03366g Chr7 (261014..265864) [4851 bp, 1616 aa] {ON} similar
           to uniprot|P34244 Saccharomyces cerevisiae YKL101W HSL1
           Nim1p-related protein kinase that regulates the
           morphogenesis and septin checkpoints associates with the
           assembled septin filament required along with Hsl7p for
           bud neck recruitment phosphorylation and degradation of
           Swe1p
          Length = 1616

 Score = 88.6 bits (218), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 74/246 (30%), Positives = 109/246 (44%), Gaps = 36/246 (14%)

Query: 558 GFKGEIELLKKLETQPRVVKLIDHEMDHGVLYVVMECGDH-DLSQTLAHRSGMPLDVEFV 616
           G + EI ++K L +   ++ L +   +   LY+V+E  D  +L   L  R G   + E V
Sbjct: 188 GIEREIVIMK-LISHSNILGLYEVWENKSELYLVLEYVDGGELFDYLVSR-GKLGEREAV 245

Query: 617 RYHAQEMLKCVKVVHDAGIVHSDLKPANFVFVKG--ILKIIDFGIANAVPEHTVNIYRET 674
            Y  Q +++ V   H   I H DLKP N +  K    +KI DFG+A        N   +T
Sbjct: 246 HYFKQ-IVQGVSYCHSFNICHRDLKPENLLLDKKNKSIKIADFGMAAL---EVSNKLLQT 301

Query: 675 QIGTPNYMAPEALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQ 734
             G+P+Y +PE ++   Y             G PSD+WSCG I++ ++ G  P+     +
Sbjct: 302 SCGSPHYASPEIVMGRPYH------------GGPSDVWSCGIILFALLTGHLPFNDDNIK 349

Query: 735 NRLLAIMNPEVKIVYPEKTSNGDTVPKTAIDTMKACLERNPNKRWTVEEVAN-------G 787
             LL + +   K   P+  S        A D M   L  NP KR   EE+ N        
Sbjct: 350 KLLLKVQSG--KFHMPQNLS------AEAKDLMSKILVVNPFKRIATEEILNHPLLTKYD 401

Query: 788 SFVKPV 793
             VKPV
Sbjct: 402 KLVKPV 407

>AFR724C Chr6 complement(1770338..1771660) [1323 bp, 440 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR523C
           (SPS1)
          Length = 440

 Score = 86.7 bits (213), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 76/298 (25%), Positives = 133/298 (44%), Gaps = 35/298 (11%)

Query: 514 EYEKLELLGRGGTSXXXXXXXXXXXXXXXLKRVSFDEFDDSSIDGFKGEIELLKKLE--- 570
           +YE L+ +GRG                  +K V+ ++ D+  ID    EI  L +L    
Sbjct: 19  QYEILQCIGRGNFGDVYKARDLTSNEIVAIKVVNLEDTDEP-IDLLAQEIFFLSELRSPY 77

Query: 571 -TQPRVVKLIDHEMDHGVLYVVME-CGDHDLSQTLAHRSGMPLDVEFVRYHAQEMLKCVK 628
            T  +   L+D  M     ++VME CG    ++ L +     +  E   +   E+L  + 
Sbjct: 78  ITNYKTAFLVDVSM-----WIVMEYCGGGSCAELLKYTPEHKVTEEQCAFIVSEVLIGLD 132

Query: 629 VVHDAGIVHSDLKPANFVFV-KGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEAL 687
            +H    +H D+K AN +    G +K+ DFG++    +  V   R+T +GTP +MAPE +
Sbjct: 133 YLHSQRKIHRDIKSANILLTDNGHVKLGDFGVSG---QMMVTRKRDTFVGTPFWMAPEVI 189

Query: 688 VAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKI 747
                      ++++    + +DIWS G  + +++ G PP   +     L+AI   +   
Sbjct: 190 -----------DRNKQGYNEMADIWSLGITVIELLMGHPPLDKYDAMKALMAIPKRD--- 235

Query: 748 VYPEKTSNGDTVPKTAIDTMKACLERNPNKRWTVEEVANGSFVKPVSVTHFFIRDLIE 805
             P K          A D +  CL ++P++R T  E+    FVK V +  + +RD ++
Sbjct: 236 --PPKLDK--RFSSHARDFVAQCLIKDPSQRPTAAELLKHRFVKRVRL--YNLRDQVD 287

>KAFR0C01440 Chr3 complement(295468..298755) [3288 bp, 1095 aa] {ON}
           Anc_3.92 YDR490C
          Length = 1095

 Score = 88.6 bits (218), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 71/268 (26%), Positives = 118/268 (44%), Gaps = 39/268 (14%)

Query: 562 EIELLKKLETQPRVVKLIDHEMDHGVLYVVME-CGDHDLSQTLAHRSGMPLDVEFVRYHA 620
           E   L+++     +VKL     D   LY ++E C + D   +L  + G  L+     Y++
Sbjct: 227 EKNALQRINNSKMIVKLFFTFQDESSLYFLLEYCPNGDF-LSLMKKYG-SLNETVACYYS 284

Query: 621 QEMLKCVKVVHDAGIVHSDLKPANFVFVKGI-LKIIDFGIANAVPEHTVNIY-----RET 674
            +++  +  +H  GI+H D+KP N +  K   +K+ DFG A  +   T N +      ++
Sbjct: 285 AQVIDAIDYLHTNGIIHRDIKPENILLDKEFKIKLTDFGTAKILDSSTNNKFDLLTRSKS 344

Query: 675 QIGTPNYMAPEALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQ 734
            +GT  Y+APE L       N +    R       D+W+ GCI+YQMI G+PP   F+  
Sbjct: 345 FVGTAEYVAPELL-------NDSFVDYR------CDVWAFGCILYQMIAGKPP---FKAT 388

Query: 735 NRLLAIMNPEVKIVYPEKTSNGDTVPKTAIDTMKACLERNPNKRWTVEEVANGSFVKPVS 794
           N  L      +K+ Y          P    D +K  L ++ N+R ++ ++          
Sbjct: 389 NEYLTFQKV-MKVQYAFTAG----FPLIIRDLVKKILVKDLNQRPSISQIEKH------- 436

Query: 795 VTHFFIRDLIENSVRYGANQKEISSAKV 822
             HFF     +N   +     EIS  K+
Sbjct: 437 --HFFREKNFQNGSVWSDPVPEISGFKI 462

>Skud_16.129 Chr16 complement(233341..235824) [2484 bp, 827 aa] {ON}
           YPL153C (REAL)
          Length = 827

 Score = 88.2 bits (217), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 68/242 (28%), Positives = 117/242 (48%), Gaps = 14/242 (5%)

Query: 554 SSIDGFKGEIELLKKLETQPRVVKLIDHEMDHGVLYVVME-CGDHDLSQTLAHRSGMPLD 612
            ++DG   E+E+L+KL   PR+V+L     D    Y+VME     DL   +A    +  D
Sbjct: 236 GNMDGVTRELEVLQKL-NHPRIVRLKGFYEDAESYYMVMEFVSGGDLMDFVAAHGAVGED 294

Query: 613 VEFVRYHAQEMLKCVKVVHDAGIVHSDLKPANFVFVKG---ILKIIDFGIANAVPEHTVN 669
               R  ++++L  VK +H  GI H DLKP N +  +    ++KI DFG+A      +  
Sbjct: 295 AG--REISRQILAAVKYIHSMGISHRDLKPDNILIEQDDPVLVKITDFGLAKVQGNGS-- 350

Query: 670 IYRETQIGTPNYMAPEALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYG 729
            + +T  GT  Y+APE +   + + +    + R +     D+WS GC++Y ++ G  P+ 
Sbjct: 351 -FMKTFCGTLAYVAPEVIRGKDSSVSPDECEERNEYSSLVDMWSMGCLVYVILTGHLPFS 409

Query: 730 GFQGQNRLLAIMNPEVKIVYPEKTSNGDTVPKTAIDTMKACLERNPNKRWTVEEVANGSF 789
           G   Q++L   +    +  Y E       + + A D +   L+ +PN R T  +  +  +
Sbjct: 410 G-STQDQLYKQIG---RGSYHEGPLKDFRISEEARDFIDLLLQVDPNNRLTAAKALDHPW 465

Query: 790 VK 791
           +K
Sbjct: 466 IK 467

>TPHA0G03290 Chr7 (702953..705874) [2922 bp, 973 aa] {ON} Anc_2.496
           YHL007C
          Length = 973

 Score = 88.2 bits (217), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 67/219 (30%), Positives = 101/219 (46%), Gaps = 27/219 (12%)

Query: 575 VVKLIDHEMDHGVLYVVMECGDH-DLSQTLAHRSGMPLDVEFVRYHAQEMLKCVKVVHDA 633
           +V  ID  +  G L+VVME  +   L+  + H     L    +    +E L  +  +H  
Sbjct: 735 IVNFIDSYLMKGDLWVVMEYMEGGSLTDVVTH---CILTEGQIGTVCKETLGGLAFLHSK 791

Query: 634 GIVHSDLKPANFVF-VKGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNY 692
           G++H D+K  N +  + G +K+ DFG    + E  V++ R T +GTP +MAPE +     
Sbjct: 792 GVIHRDIKSDNILLSMNGDIKLTDFGFCAQINE--VHLKRTTMVGTPYWMAPEVV----- 844

Query: 693 THNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAI-MNPEVKIVYPE 751
                   SR + G   DIWS G +I +MI G PPY        L  I  N   ++  PE
Sbjct: 845 --------SRKEYGPKVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIATNGTPQLKDPE 896

Query: 752 KTSNGDTVPKTAIDTMKACLERNPNKRWTVEEVANGSFV 790
              N   + K  +D    CL  NP +R T  E+ +  F+
Sbjct: 897 ---NLGEILKKFLD---WCLTVNPEERATALELLSHPFI 929

>CAGL0M08910g Chr13 complement(887703..889541) [1839 bp, 612 aa]
           {ON}
          Length = 612

 Score = 87.8 bits (216), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 77/321 (23%), Positives = 141/321 (43%), Gaps = 39/321 (12%)

Query: 515 YEKLELLGRGGTSXXXXXXXXXXXXXXXLKRVSFDEFDDSSIDG-FKGEIELLKKLETQP 573
           Y+ ++ LG G                  LK ++      S + G  + EI  L+ L   P
Sbjct: 39  YQIVKTLGEGSFGKVKLAYHVTTGQKVALKIINKKVLAKSDMQGRIEREISYLRLLR-HP 97

Query: 574 RVVKLIDHEMDHGVLYVVMECGDHDLSQTLAHRSGMPLDVEFVRYHAQEMLKCVKVVHDA 633
            ++KL D       + +V+E   ++L   +  R+ M    +  R   Q+++  V+  H  
Sbjct: 98  HIIKLYDVIKSKDEIIMVIEYAGNELFDYIVQRNKMS--EQEARRFFQQIISAVEYCHRH 155

Query: 634 GIVHSDLKPANFVFVKGI-LKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNY 692
            IVH DLKP N +  + + +KI DFG++N + +     + +T  G+PNY APE +    Y
Sbjct: 156 KIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGN---FLKTSCGSPNYAAPEVISGKLY 212

Query: 693 THNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEK 752
                        G   D+WSCG I+Y M+  R P+             +  + +++   
Sbjct: 213 A------------GPEVDVWSCGVILYVMLCRRLPFD------------DESIPVLFKNI 248

Query: 753 TSNGDTVPK----TAIDTMKACLERNPNKRWTVEEVANGSFVKPVSVTHFFIRDLIENSV 808
           ++   T+PK     A D +K  L  NP  R ++ E+    + K V +  + +   ++   
Sbjct: 249 SNGVYTLPKFLSPGASDLIKRMLIVNPLNRISIHEIMQDEWFK-VDLAEYLVPQDLKQQE 307

Query: 809 RYGANQKEISSAKVEELAEDV 829
           ++  N+K  +   VEE+ +++
Sbjct: 308 QF--NKKSGNEENVEEIDDEM 326

>KAFR0D03390 Chr4 (667896..670292) [2397 bp, 798 aa] {ON} Anc_2.496
           YHL007C
          Length = 798

 Score = 88.2 bits (217), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 64/219 (29%), Positives = 101/219 (46%), Gaps = 27/219 (12%)

Query: 575 VVKLIDHEMDHGVLYVVMECGDH-DLSQTLAHRSGMPLDVEFVRYHAQEMLKCVKVVHDA 633
           VV  I+  +  G L++VME  +   L+  + H     L    +    +E L+ +K +H  
Sbjct: 574 VVNFINAHLSKGNLWIVMEYMEGGSLTDVVTH---CLLSEGQIGAVCRETLEGLKFLHSK 630

Query: 634 GIVHSDLKPANFVF-VKGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNY 692
           G++H D+K  N +  +KG +K+ DFG    +  + +++ R T +GTP +MAPE +     
Sbjct: 631 GVIHRDIKSDNVLLSMKGDIKLTDFGFCAQI--NDIDLNRTTMVGTPYWMAPEVV----- 683

Query: 693 THNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAI-MNPEVKIVYPE 751
                   SR + G   DIWS G +I +MI G PPY        L  I  N   K+  PE
Sbjct: 684 --------SRKEYGPKVDIWSLGIMIIEMIEGEPPYLNEAPLKALYLIATNGTPKLKEPE 735

Query: 752 KTSNGDTVPKTAIDTMKACLERNPNKRWTVEEVANGSFV 790
             S+         + +  CL   P +R +  E+    FV
Sbjct: 736 NLSD------VFSNFLDRCLRVEPEERASAIELLADEFV 768

>KLLA0C12485g Chr3 (1060167..1062944) [2778 bp, 925 aa] {ON} similar
           to uniprot|Q12236 YOL100W Saccharomyces cerevisiae
           YOL100W PKH2 Serine/threonine protein kinase involved in
           sphingolipid-mediated signaling pathway that controls
           endocytosis
          Length = 925

 Score = 88.2 bits (217), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 60/236 (25%), Positives = 108/236 (45%), Gaps = 30/236 (12%)

Query: 566 LKKLETQPRVVKLIDHEMDHGVLYVVMECGDHDLSQTLAHRSGMPLDVEFVRYHAQEMLK 625
           L++L+    ++ L     D   LY ++E   +    +L  + G  ++ +  +Y+A +++ 
Sbjct: 207 LQRLKNTKGIISLYFTFQDESSLYFLLEYAPNGDLLSLMRKHG-SVNEKCTQYYAAQIID 265

Query: 626 CVKVVHDAGIVHSDLKPANFVF-VKGILKIIDFGIANAVP-------EHTVNIYRETQIG 677
            +  +HD G++H DLKP N +  V   +K+ DFG A  +        ++ +     + +G
Sbjct: 266 ALGFMHDKGVIHRDLKPENILLDVDMKVKLTDFGTARLLDSTSEDDLKYDLLTRSNSFVG 325

Query: 678 TPNYMAPEALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRL 737
           T  Y++PE L+  NY   +             DIW+ GCI++QMI G+PP   F+  N  
Sbjct: 326 TAEYVSPE-LLNDNYVDFRC------------DIWAFGCILFQMIAGKPP---FKANNEY 369

Query: 738 LAIMNPEVKIVYPEKTSNGDTVPKTAIDTMKACLERNPNKRWTVEEVANGSFVKPV 793
           L         V   + +     P T  D +K  L +NP +R  + ++    F   V
Sbjct: 370 LTFQK-----VMKVQFAFTAGFPMTVRDLVKNILIKNPERRLLINQIKAHQFFADV 420

>Kpol_1037.52 s1037 complement(128841..130379) [1539 bp, 512 aa]
           {ON} complement(128841..130379) [1539 nt, 513 aa]
          Length = 512

 Score = 87.0 bits (214), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 68/242 (28%), Positives = 107/242 (44%), Gaps = 46/242 (19%)

Query: 561 GEIELLKKLETQPRVVKLIDHEMDHGVLYVVMEC--GDHDLSQTLAHRSGMPLDVEFVRY 618
            E  +L  LE  P +VKL     D   LY++++   G         H +   L  + V +
Sbjct: 187 AEKTILSDLE-HPNIVKLFYAFHDESKLYLLLQYIPGGELFFHLKEHGT---LQEDTVAF 242

Query: 619 HAQEMLKCVKVVHDAGIVHSDLKPANFVF-VKGILKIIDFGIANAVPEHTVNIYRETQ-- 675
           +  E+   +K +H  GIV+ DLKP N +   +G L + DFG++    E   ++  + +  
Sbjct: 243 YTAEISCALKFLHSKGIVYRDLKPENCLLNERGHLVLTDFGLSKIAVEQNEDVGEDHEAE 302

Query: 676 ----------IGTPNYMAPEALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGR 725
                     IGTP Y APE L  + Y+ N              D +S GC+IY M+ G+
Sbjct: 303 GENITELYSIIGTPEYCAPEILQGLPYSQN-------------CDWYSLGCLIYDMLIGK 349

Query: 726 PPYGGFQGQNRLLAIMNPEVKIVYPEKTSNGDTVPKTAIDTMK----ACLERNPNKRWTV 781
           PPY G          +N ++ +   +K   G  +P    D MK    A L++   KRW V
Sbjct: 350 PPYTG----------VNHKIILNKIQKDKQGPKLPYYLSDGMKDVLGALLKKESKKRWDV 399

Query: 782 EE 783
           ++
Sbjct: 400 DQ 401

>NCAS0A12350 Chr1 complement(2446237..2447236,2447319..2448559)
           [2241 bp, 746 aa] {ON} Anc_2.352 YDL101C
          Length = 746

 Score = 87.8 bits (216), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 75/297 (25%), Positives = 127/297 (42%), Gaps = 39/297 (13%)

Query: 515 YEKLELLGRGGTSXXXXXXXXXXXXXXXLKRVSFDEFDDSSIDGFKGEIELLKKLETQPR 574
           Y KL+ +G G +                +K++  D      +     E+ +LK+ +  P 
Sbjct: 469 YRKLKRIGEGASGIVYTAYEIGTDISVAIKQI--DLKIQPRLQMIWTEMLVLKEYQ-HPN 525

Query: 575 VVKLIDHEMDHGVLYVVMECGDH-DLSQTLAHRSGMPLDVEFVRYHAQEMLKCVKVVHDA 633
           ++  I+  + H  L++VME  D   L+  ++  +  P + +      +E L  +  +H  
Sbjct: 526 IINFINSYLLHDTLWIVMEYMDGGSLADIVSFFT--PTEEQMATI-CRETLFGLNFLHSR 582

Query: 634 GIVHSDLKPANFVF-VKGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNY 692
           GIVH D+K  N +  + G +KI DFG    + E   N  R T +GTP +MAPE + +  Y
Sbjct: 583 GIVHRDIKSDNILLSMNGDIKITDFGFCGQLTES--NTKRTTMVGTPYWMAPEVIASKEY 640

Query: 693 THNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEK 752
                        G   D+WS G +I +MI G PPY   +   R L ++    K +  E 
Sbjct: 641 -------------GPKVDVWSLGIMIIEMIEGEPPY-LHETPVRALYLITTNGKPILKEP 686

Query: 753 TSNGDTVPKTAIDTMKACLERNPNKRWTVEEVANGSFV-----------KPVSVTHF 798
              G  +     + M  CL  +P  R +  ++    F+           + VS+T+F
Sbjct: 687 EKVGPVLK----NFMDECLRVDPEARLSTPQLLKHEFILEKAERTESLAQLVSMTYF 739

>Kwal_26.8796 s26 (946406..948796) [2391 bp, 796 aa] {ON} YPL153C
           (RAD53) - protein kinase, Mec1p and Tel1p regulate
           rad53p phosphorylation [contig 68] FULL
          Length = 796

 Score = 87.8 bits (216), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 70/240 (29%), Positives = 111/240 (46%), Gaps = 19/240 (7%)

Query: 556 IDGFKGEIELLKKLETQPRVVKLIDHEMDHGVLYVVME-CGDHDLSQTLAHRSGMPLDVE 614
           +DG   E+E+L++L+  PR+V L     D    Y+VME     DL   +A    +  D  
Sbjct: 228 MDGVARELEVLQRLD-HPRIVSLKGFYEDKDSHYLVMEFVSGGDLMDFVAAHGSVGEDAG 286

Query: 615 FVRYHAQEMLKCVKVVHDAGIVHSDLKPANFVFVKG---ILKIIDFGIANAVPEHTVNIY 671
             R   +++L+ VK +H  GI H DLKP N +  +    ++KI DFG+A      T   +
Sbjct: 287 --REITRQILEAVKYIHSMGISHRDLKPDNILIERDDPVLVKITDFGLAKIQGNGT---F 341

Query: 672 RETQIGTPNYMAPEALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGF 731
            +T  GT  Y+APE +   N    +    S        D+WS GC++Y ++ G  P+ G 
Sbjct: 342 MKTFCGTLAYVAPEVISGKNSGEKEGNTYSSL-----VDMWSIGCLVYVILTGHLPFSG- 395

Query: 732 QGQNRLLAIMNPEVKIVYPEKTSNGDTVPKTAIDTMKACLERNPNKRWTVEEVANGSFVK 791
             QN L   +       Y E       +   A D +++ L+ +P  R T E+     ++K
Sbjct: 396 STQNDLYKQITAG---SYHEGPLKDYRISDDARDFIESFLQVDPRNRMTAEQALRHPWIK 452

>Kwal_26.7154 s26 (237387..241028) [3642 bp, 1213 aa] {ON} YOL045W -
            Hypothetical ORF [contig 47] FULL
          Length = 1213

 Score = 88.2 bits (217), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 75/327 (22%), Positives = 138/327 (42%), Gaps = 58/327 (17%)

Query: 493  PPASSDDINGRKRPVVYVNGT---------------EYEKLELLGRGGTSXXXXXXXXXX 537
            PP+ + + +GR RP+     T               ++E L+ +G G             
Sbjct: 916  PPSHATNPHGRGRPIPTFLATPEANIGSMKHIKKFSDFEVLQKMGEGAYGKVDLCMHKKD 975

Query: 538  XXXXXLK-----RVSFDEF-DDSSIDGFKGEIELLKKLETQPR--VVKLIDHEMDHGVLY 589
                 +K     R+  D +  D  +     EI+++  L  +P   ++ L+D   D    Y
Sbjct: 976  RYIVVIKLIFKERILVDTWVRDRKLGTIPSEIQIMATLNAKPHENILMLLDFFEDDDYYY 1035

Query: 590  VVMECGDHDLSQTLAHRSGMPLDVEFVRYHAQEMLK----CVKVVHDAGIVHSDLKPANF 645
            +  E   H  S ++     + +  +   + A  + K     +K +HD GIVH D+K  N 
Sbjct: 1036 I--ETAVHGTSGSIDLFDLIEMKTDMTEHEAMLIFKQIASGIKNLHDNGIVHRDIKDENV 1093

Query: 646  VF-VKGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNYTHNQAPEQSRWK 704
            +    G +KI+DFG A  V     +++    +GT +Y APE L    Y            
Sbjct: 1094 IVDCNGFVKIVDFGSAAYVKSGPFDVF----VGTIDYAAPEVLGGEPYE----------- 1138

Query: 705  VGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEKTSNGDTVPKTAI 764
             GKP DIW+ G ++Y +IY   P+           I++ ++++   E+ S+        I
Sbjct: 1139 -GKPQDIWAIGVLLYTIIYKENPFYNID------EILDADLRVNSSERISDD------CI 1185

Query: 765  DTMKACLERNPNKRWTVEEVANGSFVK 791
              ++  L R+ +KR +++E+ N  +++
Sbjct: 1186 ALIRKILNRSVSKRPSIDEICNHKWLE 1212

>ZYRO0B01166g Chr2 complement(97168..100059) [2892 bp, 963 aa] {ON}
           weakly similar to uniprot|Q03497 Saccharomyces
           cerevisiae YHL007C STE20 Signal transducing kinase of
           the PAK (p21-activated kinase) family involved in
           pheromone response and pseudohyphal/invasive growth
           pathways activated by Cdc42p binds Ste4p at a GBB motif
           present in noncatalytic domains of PAK kinases
          Length = 963

 Score = 87.8 bits (216), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 65/234 (27%), Positives = 107/234 (45%), Gaps = 27/234 (11%)

Query: 575 VVKLIDHEMDHGVLYVVMECGDH-DLSQTLAHRSGMPLDVEFVRYHAQEMLKCVKVVHDA 633
           +V  ID  +  G L+VVME  +   L+  + H     L    +    +E L  ++ +H  
Sbjct: 712 IVNFIDSYLLKGDLWVVMEYMEGGSLTDVVTH---CILTEGQIGAVCRETLAGLQFLHSK 768

Query: 634 GIVHSDLKPANFVF-VKGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNY 692
           G++H D+K  N +  + G +K+ DFG    + E  +N+ R T +GTP +MAPE +     
Sbjct: 769 GVIHRDIKSDNILLSMTGEIKLTDFGFCAQINE--INLKRTTMVGTPYWMAPEVV----- 821

Query: 693 THNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRL-LAIMNPEVKIVYPE 751
                   SR + G   DIWS G +I +MI G PPY        L L   N   K+  P 
Sbjct: 822 --------SRKEYGPKVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIATNGTPKLKEP- 872

Query: 752 KTSNGDTVPKTAIDTMKACLERNPNKRWTVEEVANGSFVKPVSVTHFFIRDLIE 805
                D + +   + +  CL   P++R +  ++    FV  V+  +  +  L++
Sbjct: 873 -----DNLGEELQNFLDWCLTVEPDQRASSSQLLKDPFVTQVAEENSSLAPLVK 921

>KNAG0D00390 Chr4 (53459..58429) [4971 bp, 1656 aa] {ON} Anc_6.341
            YNR031C
          Length = 1656

 Score = 88.2 bits (217), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 65/243 (26%), Positives = 107/243 (44%), Gaps = 35/243 (14%)

Query: 560  KGEIELLKKLETQPRVVKLIDHEMDHGVLYVVME-CGDHDLSQTLAHRSGMPLDVEFVRY 618
            K E+ +++ L   P +++    E+    + + ME C    L+  L H  G   D    + 
Sbjct: 1405 KEEMSVMEML-NHPNIIQYYGVEVHRDKVNIFMEYCEGGSLASLLEH--GRIEDEMVTQV 1461

Query: 619  HAQEMLKCVKVVHDAGIVHSDLKPANFVF-VKGILKIIDFGIANAVPEHTVNIYRET--- 674
            +  E+L+ +  +H++GIVH D+KP N +    GI+K +DFG A  +  +   I       
Sbjct: 1462 YTLELLEGLAYLHESGIVHRDIKPENILLDFNGIIKYVDFGAARKIASNETKIRTAGSGS 1521

Query: 675  -------------QIGTPNYMAPEALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQM 721
                          IGTP YMAPE +            +++   G   D+WS GC++ +M
Sbjct: 1522 SPGTSSSTDNLRDMIGTPMYMAPETITG---------SKTKGSFG-VDDVWSLGCVVLEM 1571

Query: 722  IYGRPPYGGFQGQNRLLAIMNPEVKIVYPEKTSNGDTVPKTAIDTMKACLERNPNKRWTV 781
            + GR P+     +    AIM        P+  +  D + +      K CL  +PNKR T 
Sbjct: 1572 VTGRRPWSNLDNE---WAIMYHVAAGHIPQLPAK-DEISEAGAKFFKRCLVYDPNKRATA 1627

Query: 782  EEV 784
             E+
Sbjct: 1628 VEL 1630

>NDAI0D04050 Chr4 (952438..953538) [1101 bp, 366 aa] {ON} Anc_4.184
          Length = 366

 Score = 85.1 bits (209), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 75/332 (22%), Positives = 136/332 (40%), Gaps = 68/332 (20%)

Query: 505 RPVVYVNGTEYEKLELLGRGGTSXXXXXXXXXXXXXXXLKRVSFDEFDDSS-IDGFKGEI 563
           R + +   ++Y+ ++L+G G                  +K++    F  +  +     EI
Sbjct: 3   RTITFDIPSQYQLVDLIGEGAYGTVCSAIHKPSGVKVAIKKIQ--PFSKAMFVTRTLREI 60

Query: 564 ELLKKLETQPRVVKLIDHEMDHGV-----LYVVMECGDHDLSQTLAHRSGMPLDVEFVRY 618
           +LL        ++ ++D      V     +Y+V E  + DL + + + +  PL  + ++Y
Sbjct: 61  KLLTYFHNHENIISILDKVKPISVNKLNAVYLVQELMETDLQKIIMNSNNNPLSDDHIQY 120

Query: 619 HAQEMLKCVKVVHDAGIVHSDLKPANFVFVKGI-LKIIDFGIANAVPEHTVNIYRETQIG 677
              ++L+ +K +H A ++H DLKP+N +      LK+ DFG++  +   + +  RET +G
Sbjct: 121 FTYQILRALKAIHSAQVIHRDLKPSNLLLNSNCDLKVCDFGLSRCLTSSSDS--RETLVG 178

Query: 678 -------TPNYMAPEALVAMN-YTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYG 729
                  T  Y APE ++    YT                DIWS GCI+ +M+ GRP + 
Sbjct: 179 FMTEYVATRWYRAPEIMLTFQEYT-------------TAMDIWSVGCILAEMVSGRPLFP 225

Query: 730 GFQGQNRLLAIMN-------------------------------PEVKIVYPEKTSNGDT 758
           G    ++L  I+                                P V ++  ++  N D 
Sbjct: 226 GRDYHHQLWLILEVLGTPSLEDFAQIKSKRAKEYISNLPMRSPMPWVNVLNTQRNLNPD- 284

Query: 759 VPKTAIDTMKACLERNPNKRWTVEEVANGSFV 790
                +D +   L  NPNKR T  E  N  ++
Sbjct: 285 ----MLDLLTKMLLFNPNKRITAAEALNHPYL 312

>CAGL0K06479g Chr11 (637125..640100) [2976 bp, 991 aa] {ON} some
           similarities with uniprot|Q03306 Saccharomyces
           cerevisiae YDR466w
          Length = 991

 Score = 87.8 bits (216), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 70/251 (27%), Positives = 114/251 (45%), Gaps = 45/251 (17%)

Query: 560 KGEIELLKKLETQPRVVKLIDHEMDHGVLYVVMECGDHDLSQTLAHRSGMPLDVEFVRYH 619
           K  + LL +    P +VKL     D   LY V++        +L H+ G   D  + ++ 
Sbjct: 61  KNTLNLLAR-GNHPGIVKLYYTFHDEENLYFVLDYASGGELLSLLHKMGTFTD-SWAKHF 118

Query: 620 AQEMLKCVKVVHDAGIVHSDLKPANFVFVK-GILKIIDFGIA--------------NA-- 662
           A +++  ++ +H  G++H DLKP N +  K GIL I DFG A              NA  
Sbjct: 119 AAQLVDTLEFMHARGVIHRDLKPENVLLSKEGILMITDFGAAATQNNFSDKDNTRSNANE 178

Query: 663 ------VPEHTVNIYRETQIGTPNYMAPEALVAMNYTHNQAPEQSRWKVGKPSDIWSCGC 716
                 VP         + +GT  Y++PE L+     +N        K    SDIW+ GC
Sbjct: 179 GIPKDDVPSSGDKTECSSFVGTAEYVSPELLL-----YN--------KCSFGSDIWALGC 225

Query: 717 IIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVY---PEKTSNGDTVPKTAIDTMKACLER 773
           ++YQ I G PP   F+G+N  L      V + Y   PE+ +N  T+    ++ ++  L  
Sbjct: 226 MVYQFIQGFPP---FRGENE-LKTFEKIVSLDYSWNPERQTNFGTINIQVVNLVRRMLTI 281

Query: 774 NPNKRWTVEEV 784
           +  +R T++++
Sbjct: 282 DTTQRATIDQI 292

>Suva_16.157 Chr16 complement(270891..273389) [2499 bp, 832 aa] {ON}
           YPL153C (REAL)
          Length = 832

 Score = 87.4 bits (215), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 68/242 (28%), Positives = 118/242 (48%), Gaps = 14/242 (5%)

Query: 554 SSIDGFKGEIELLKKLETQPRVVKLIDHEMDHGVLYVVME-CGDHDLSQTLAHRSGMPLD 612
            ++DG   E+E+L+KL   PR+V+L     D    Y+VME     DL   +A    +  D
Sbjct: 236 GNMDGVTRELEVLQKLH-HPRIVRLKGFYEDTESYYMVMEFVSGGDLMDFVAAHGAVGED 294

Query: 613 VEFVRYHAQEMLKCVKVVHDAGIVHSDLKPANFVFVKG---ILKIIDFGIANAVPEHTVN 669
               R  ++++L+ VK +H  GI H DLKP N +  +    ++KI DFG+A      +  
Sbjct: 295 AG--REISRQILEAVKYIHSMGISHRDLKPDNILIEQDDPVLVKITDFGLAKVQGNGS-- 350

Query: 670 IYRETQIGTPNYMAPEALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYG 729
            + +T  GT  Y+APE +   + + +    + R +     D+WS GC++Y ++ G  P+ 
Sbjct: 351 -FMKTFCGTLAYVAPEVIRGKDSSVSPDEYEERNEYSSLVDMWSMGCLVYVILTGHLPFS 409

Query: 730 GFQGQNRLLAIMNPEVKIVYPEKTSNGDTVPKTAIDTMKACLERNPNKRWTVEEVANGSF 789
           G   Q++L   +    +  Y E       + + A D + + L+ +PN R T  +     +
Sbjct: 410 G-STQDQLYKQIG---RGSYHEGPLKDFRISEEARDFIDSLLQVDPNNRLTAAKALCHPW 465

Query: 790 VK 791
           +K
Sbjct: 466 IK 467

>TBLA0A02050 Chr1 (495735..497039) [1305 bp, 434 aa] {ON} 
          Length = 434

 Score = 85.9 bits (211), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 91/362 (25%), Positives = 159/362 (43%), Gaps = 39/362 (10%)

Query: 433 KYSDYNPQEFGRLPRPSLENRSPISNKEEPQFK-HRSPPLIPGKHVEIVEPIRTKESIPL 491
           KY  Y+P +  R    S+  RSP+   +  Q K +RS   IP K  +++ P  +  +   
Sbjct: 101 KYLPYSPSKSNRF---SMSKRSPLREMQNIQRKSYRSGSSIPTKE-KLLLPSISSSNSGN 156

Query: 492 KPPASSDDINGRKRPVVYVNGTEYEKLELLGRGGTSXXXXXXXXXXXXXXXLKRVSFDEF 551
              A S+ IN + +    +  +++E    LG+G                  LK +   E 
Sbjct: 157 NDHAISN-INSKNK----LQFSDFEIGRGLGKGKFGKVYCVKHKQSGFISALKVMKKKEI 211

Query: 552 DDSSIDG-FKGEIELLKKLETQPRVVKLIDHEMDHGVLYVVME-CGDHDLSQTLAHRSGM 609
              + +  FK E+E+   L   P +VK+     D   +Y++ME   + +L ++L + +G 
Sbjct: 212 VSYNAEKQFKREVEVQNSL-NHPNIVKIFGFFQDEIFVYLIMEYLINGELYKSLKNNNG- 269

Query: 610 PLDVEFVRYHAQEMLKCVKVVHDAGIVHSDLKPANFVF-VKGILKIIDFGIANAVPEHTV 668
           P +      +  ++   +K +H   I+H D+KP N V      +K+ DFG +   P    
Sbjct: 270 PFNDILASNYIYQIADALKYMHSKHIIHRDIKPENIVLGFNNKIKLADFGWSICTPP--- 326

Query: 669 NIYRETQIGTPNYMAPEALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPY 728
           N+ R+T  GT +Y+APE +    Y +N              DIW+ G + Y++I G PP+
Sbjct: 327 NLRRKTICGTIDYLAPELVTFKEYDYN-------------VDIWALGILTYELIVGNPPF 373

Query: 729 GGFQGQNRLLAIMNPEVKIVYPEKTSNGDTVPKTAIDTMKACLERNPNKRWTVEEVANGS 788
                      I+N  V + +P+      TV   A D +   L  +P+KR  + +V    
Sbjct: 374 EEETKDLTYKRIIN--VDLNFPQ------TVSMDARDLITRLLRFDPSKRMPLVDVMKHP 425

Query: 789 FV 790
           ++
Sbjct: 426 WI 427

>CAGL0G04609g Chr7 complement(437162..440059) [2898 bp, 965 aa] {ON}
           similar to uniprot|Q12236 Saccharomyces cerevisiae
           YOL100w PKH2
          Length = 965

 Score = 87.4 bits (215), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 63/229 (27%), Positives = 109/229 (47%), Gaps = 32/229 (13%)

Query: 566 LKKLETQPRVVKLIDHEMDHGVLYVVMECGDHDLSQTLAHRSGMPLDVEFVRYHAQEMLK 625
           L+ L++   V+ L     D   LY ++E   +    +L  + G  L+ E   Y++ +++ 
Sbjct: 171 LQNLKSVTGVINLSFTFQDEANLYFLLEYAPNGDFLSLIKKFGT-LNEECTIYYSAQIID 229

Query: 626 CVKVVHDAGIVHSDLKPANFVFVKGI-LKIIDFGIA---------NAVPEHTVNIYRETQ 675
            +  +H  GI+H D+KP N +    + +K+ DFG A         N  P + +     + 
Sbjct: 230 AIGSMHSHGIIHRDIKPENILLDGNMKIKLTDFGTAKLLQKKSDKNGKPHYNLLTRSSSF 289

Query: 676 IGTPNYMAPEALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQN 735
           +GT  Y++PE L++ NYT  +             DIW+ GC++YQMI G+PP   F+  N
Sbjct: 290 VGTAEYVSPE-LLSDNYTDYKC------------DIWAFGCLVYQMIAGKPP---FKATN 333

Query: 736 RLLAIMNPEVKIVYPEKTSNGDTVPKTAIDTMKACLERNPNKRWTVEEV 784
             L     +V  V    T+   T+ +   D +K  L + P KR T+ ++
Sbjct: 334 EYLTFQ--KVMKVQFAFTAGFPTIIR---DLVKNILVKQPEKRLTIPQI 377

>Suva_2.157 Chr2 complement(275484..277064) [1581 bp, 526 aa] {ON}
           YBR028C (REAL)
          Length = 526

 Score = 86.7 bits (213), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 69/239 (28%), Positives = 107/239 (44%), Gaps = 44/239 (18%)

Query: 561 GEIELLKKLETQPRVVKLIDHEMDHGVLYVVMEC--GDHDLSQTLAHRSGMPLDVEFVRY 618
            E  +L ++E  P +VKL     D+  LY++++   G         H +   LD   V +
Sbjct: 202 AERSILSEIE-HPNIVKLFYSFHDNSKLYLLLQYIPGGELFYHLKEHGT---LDETTVSF 257

Query: 619 HAQEMLKCVKVVHDAGIVHSDLKPANFVFVK-GILKIIDFGI---------ANAVPEHTV 668
           +A E+   ++ +H  G+V+ DLKP N +  + G L + DFG+         AN      V
Sbjct: 258 YAAEISCALRFLHTKGVVYRDLKPENCLLNQNGHLVLTDFGLSKKSADDSMANEEDPENV 317

Query: 669 NIYRETQIGTPNYMAPEALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPY 728
           N      IGTP Y APE L    YT N              D +S GC++Y M+ G+PPY
Sbjct: 318 NTLHSI-IGTPEYCAPEILSGQAYTQN-------------CDWYSLGCLLYDMLVGKPPY 363

Query: 729 GGFQGQNRLLAIMNPEVKIVYPEKTSNGDTVP----KTAIDTMKACLERNPNKRWTVEE 783
            G           N +V I   ++   G  +P    +   D + A L++  +KRW V++
Sbjct: 364 TG----------NNHKVIINKIQQNKQGPKIPFYLSEGMKDMLNALLKKETSKRWNVDK 412

>KAFR0C03010 Chr3 (598970..601342) [2373 bp, 790 aa] {ON} Anc_8.141
           YGL180W
          Length = 790

 Score = 87.4 bits (215), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 71/281 (25%), Positives = 113/281 (40%), Gaps = 63/281 (22%)

Query: 556 IDGFKGEIELLKKLETQPRVVKLIDHEMDHGVLYVVME-CGDHDLSQTLAHRSGMP---- 610
           ++  + EI +LKK++    +V LID E +    Y++ME C   DL+  +  R  +     
Sbjct: 76  LENLEIEIAILKKIK-HNHIVSLIDCERNSDYFYLIMEYCSLGDLTFLIKRRKELTNYHP 134

Query: 611 ----------------LDVEFVRYHAQEMLKCVKVVHDAGIVHSDLKPANFVFVKG---- 650
                           L   F+  + Q++   +K +    ++H D+KP N +        
Sbjct: 135 LLQKIFESYPSPNEYGLHHAFILNYLQQLASALKFLRSKNLIHRDIKPQNLLLCTPLIGY 194

Query: 651 ------------------ILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNY 692
                             ILKI DFG A  +P  ++    ET  G+P YMAPE L   NY
Sbjct: 195 TDADTFHKLGYVGIYNLPILKIADFGFARFLPNSSM---AETLCGSPLYMAPEIL---NY 248

Query: 693 THNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEK 752
                      K    +D+WS G ++++M  GRPP+           I      I +PE 
Sbjct: 249 Q----------KYNAKADLWSVGTVLFEMYCGRPPFKASNHLELYKKIKRSNDVIQFPEL 298

Query: 753 TSNGDTVPKTAIDT---MKACLERNPNKRWTVEEVANGSFV 790
            +NGD   +  ++    +   L  +P  R T +E  N   V
Sbjct: 299 IANGDDKDQEDLEIRALISKLLTFDPTNRITFDEFFNHKLV 339

>NDAI0G03450 Chr7 (822716..825562) [2847 bp, 948 aa] {ON} Anc_8.141
          Length = 948

 Score = 87.4 bits (215), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 61/220 (27%), Positives = 92/220 (41%), Gaps = 62/220 (28%)

Query: 556 IDGFKGEIELLKKLETQPRVVKLIDHEMDHGVLYVVME-CGDHDLSQTLAHRSGM----- 609
           ++  + EI +LKK+   P +VKLID E      Y++ME C   DL+  +  R  +     
Sbjct: 88  LENLEIEIAILKKI-NHPHIVKLIDCERTTTDFYLIMEYCALGDLTFLIKKRHELIKNHP 146

Query: 610 -----------------PLDVEFVRYHAQEMLKCVKVVHDAGIVHSDLKPANFVFVKG-- 650
                             L   F+  + Q++   +K +    +VH D+KP N + +    
Sbjct: 147 LLEKIFEKYPSPNENYNGLHRAFILNYLQQLASALKFLRSKNLVHRDIKPQNLLLLTPLI 206

Query: 651 --------------------ILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAM 690
                               ILKI DFG A  +P  ++    ET  G+P YMAPE L   
Sbjct: 207 NYNDSKAFKKLGFIGIYELPILKIADFGFARFLPNTSM---AETLCGSPLYMAPEIL--- 260

Query: 691 NYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGG 730
           NY           K    +D+WS G ++Y+M YG PP+  
Sbjct: 261 NYQ----------KYNAKADLWSVGTVLYEMCYGTPPFKA 290

>Smik_6.350 Chr6 (559997..562465) [2469 bp, 822 aa] {ON} YPL153C
           (REAL)
          Length = 822

 Score = 87.4 bits (215), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 67/242 (27%), Positives = 118/242 (48%), Gaps = 14/242 (5%)

Query: 554 SSIDGFKGEIELLKKLETQPRVVKLIDHEMDHGVLYVVME-CGDHDLSQTLAHRSGMPLD 612
            ++DG   E+E+L+KL   PR+V+L     D    Y+VME     DL   +A    +  D
Sbjct: 236 GNMDGVTRELEVLQKL-NHPRIVRLKGFYEDADSYYMVMEFVSGGDLMDFVAAHGAVGED 294

Query: 613 VEFVRYHAQEMLKCVKVVHDAGIVHSDLKPANFVFVKG---ILKIIDFGIANAVPEHTVN 669
               R  ++++L  VK +H  GI H DLKP N +  +    ++KI DFG+A      +  
Sbjct: 295 AG--REISRQILTAVKYIHSMGISHRDLKPDNILIEQDDPVLVKITDFGLAKVQGNGS-- 350

Query: 670 IYRETQIGTPNYMAPEALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYG 729
            + +T  GT  Y+APE +   + + +    + R +     D+WS GC++Y ++ G  P+ 
Sbjct: 351 -FMKTFCGTLAYVAPEVIRGKDSSASPDEYEERNEYSSLVDMWSMGCLVYVILTGHLPFS 409

Query: 730 GFQGQNRLLAIMNPEVKIVYPEKTSNGDTVPKTAIDTMKACLERNPNKRWTVEEVANGSF 789
           G   Q++L   +    +  Y E       + + A D + + L+ +P+ R T  +  +  +
Sbjct: 410 G-STQDQLYKQIG---RGSYHEGPLKDFRISEEARDFIDSLLQVDPSNRLTAAKALDHPW 465

Query: 790 VK 791
           +K
Sbjct: 466 IK 467

>KNAG0D03980 Chr4 (721049..722170) [1122 bp, 373 aa] {ON} Anc_4.184
           YGR040W
          Length = 373

 Score = 85.1 bits (209), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 56/194 (28%), Positives = 94/194 (48%), Gaps = 32/194 (16%)

Query: 562 EIELLKKLETQPRVVKLIDHEMDHGV-----LYVVMECGDHDLSQTLAHRSGMPLDVEFV 616
           EI+LL+       ++ ++D      V     +Y+V E  + DL + LA +    L  + +
Sbjct: 59  EIKLLRFFHAHENIISILDQVTPQTVQELQAVYIVQELMETDLHRVLAAQR---LSDDHI 115

Query: 617 RYHAQEMLKCVKVVHDAGIVHSDLKPANFVFVKGI-LKIIDFGIANAVPEHTVNIYRETQ 675
           +Y   + L+ +K +H AG++H D+KP+N +      LK+ DFG+A  +   + +  RET 
Sbjct: 116 QYFVYQTLRALKAIHSAGVIHRDIKPSNLLLNSNCDLKVCDFGLARCLQSSSAS--RETM 173

Query: 676 IG-------TPNYMAPEALVAMN-YTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPP 727
            G       T  Y APE +++   YT                DIWS GCI+ +M+ GRP 
Sbjct: 174 FGFMTEYVATRWYRAPEIMLSFQEYT-------------TAMDIWSVGCILAEMLLGRPL 220

Query: 728 YGGFQGQNRLLAIM 741
           + G    ++L  I+
Sbjct: 221 FPGRDYHHQLWLIL 234

>YJL095W Chr10 (247255..251691) [4437 bp, 1478 aa] {ON}
            BCK1Mitogen-activated protein (MAP) kinase kinase kinase
            acting in the protein kinase C signaling pathway, which
            controls cell integrity; upon activation by Pkc1p
            phosphorylates downstream kinases Mkk1p and Mkk2p
          Length = 1478

 Score = 87.4 bits (215), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 68/288 (23%), Positives = 123/288 (42%), Gaps = 36/288 (12%)

Query: 515  YEKLELLGRGGTSXXXXXXXXXXXXXXXLKRVSFDEFDD------SSIDGFKGEIELLKK 568
            + K E++G+G                  +K+V   ++        S+++  + E+  LK 
Sbjct: 1175 WMKGEMIGKGSFGAVYLCLNVTTGEMMAVKQVEVPKYSSQNEAILSTVEALRSEVSTLKD 1234

Query: 569  LETQPRVVKLIDHEMDHGVLYVVMECGDHDLSQTLAHRSGMPLDVEFVRYHAQEMLKCVK 628
            L+    +V+ +  E  + +  + +E        +L    G   D   +++   ++LK + 
Sbjct: 1235 LD-HLNIVQYLGFENKNNIYSLFLEYVAGGSVGSLIRMYGR-FDEPLIKHLTTQVLKGLA 1292

Query: 629  VVHDAGIVHSDLKPANFVFVK-GILKIIDFGIANAVPEHTVNIYRETQI---GTPNYMAP 684
             +H  GI+H D+K  N +  + GI KI DFGI+      + +IY  + +   GT  +MAP
Sbjct: 1293 YLHSKGILHRDMKADNLLLDQDGICKISDFGIS----RKSKDIYSNSDMTMRGTVFWMAP 1348

Query: 685  EALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPE 744
            E +             ++       DIWS GCI+ +M  G+ P+   +    +  I   +
Sbjct: 1349 EMV------------DTKQGYSAKVDIWSLGCIVLEMFAGKRPWSNLEVVAAMFKIGKSK 1396

Query: 745  VKIVYPEKTSNGDTVP---KTAIDTMKACLERNPNKRWTVEEVANGSF 789
                 PE     DT+P   +   + + AC E NP KR T  E+ +  F
Sbjct: 1397 SAPPIPE-----DTLPLISQIGRNFLDACFEINPEKRPTANELLSHPF 1439

>KNAG0B01780 Chr2 (326438..331180) [4743 bp, 1580 aa] {ON} Anc_1.271
            YJL095W
          Length = 1580

 Score = 87.4 bits (215), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 65/288 (22%), Positives = 124/288 (43%), Gaps = 36/288 (12%)

Query: 515  YEKLELLGRGGTSXXXXXXXXXXXXXXXLKRVSFDEFDDS------SIDGFKGEIELLKK 568
            + K E++G+G                  +K+V   ++         +++  + E+  LK 
Sbjct: 1275 WMKGEMIGKGSFGAVYLCLNLTTGEMMAVKQVEVPKYSAQDQNILDTVEALRSEVSTLKD 1334

Query: 569  LETQPRVVKLIDHEMDHGVLYVVMECGDHDLSQTLAHRSGMPLDVEFVRYHAQEMLKCVK 628
            L+    +V+ +  E DH +  + +E        +L    G   D   +R+   ++L+ + 
Sbjct: 1335 LD-HLNIVQYLGFENDHDIYSLFLEYVGGGSVGSLIRLYGR-FDEALIRFLTVQVLEGLA 1392

Query: 629  VVHDAGIVHSDLKPANFVF-VKGILKIIDFGIANAVPEHTVNIYRETQI---GTPNYMAP 684
             +H  GI+H D+K  N +  + G+ KI DFGI+      + +IY  + +   GT  +MAP
Sbjct: 1393 YLHSKGILHRDMKADNLLLDLDGVCKISDFGIS----RKSKDIYSNSDMTMRGTVFWMAP 1448

Query: 685  EALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPE 744
            E +             ++       DIWS GC++ +M  G+ P+   +    +  I   +
Sbjct: 1449 EMV------------DTKQGYSAKVDIWSLGCVVLEMFAGKRPWSNLEVVAAMFKIGKNK 1496

Query: 745  VKIVYPEKTSNGDTVPKTAIDT---MKACLERNPNKRWTVEEVANGSF 789
                 PE     DT+P  + D    + AC E +P+ R T +++ +  F
Sbjct: 1497 SAPPIPE-----DTLPLISQDGRQFLNACFEIDPDLRPTADKLLSHPF 1539

>Skud_15.112 Chr15 (202308..205613) [3306 bp, 1101 aa] {ON} YOL045W
            (REAL)
          Length = 1101

 Score = 87.4 bits (215), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 69/250 (27%), Positives = 111/250 (44%), Gaps = 45/250 (18%)

Query: 553  DSSIDGFKGEIELLKKLE--TQPRVVKLIDHEMDHGVLYVVM----ECGDHDLSQTLAHR 606
            D  +     EI+++  L   +Q  ++KL+D   D    Y+      E G  DL   +  +
Sbjct: 885  DRKLGTIPSEIQIMATLNKNSQKNILKLLDFFEDDDYYYIETPVHGETGSIDLFDVIEFK 944

Query: 607  SGMPLDVEFVRYHAQEMLK----CVKVVHDAGIVHSDLKPANFVF-VKGILKIIDFGIAN 661
              M      V + A+ + K     +K +H+ GIVH D+K  N +    G +K+IDFG A 
Sbjct: 945  KDM------VEHEAKLVFKQVVASIKHLHNQGIVHRDIKDENVIVDSHGFVKLIDFGSAA 998

Query: 662  AVPEHTVNIYRETQIGTPNYMAPEALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQM 721
             V     +++    +GT +Y APE L   +Y             GKP DIW+ G ++Y +
Sbjct: 999  YVKSGPFDVF----VGTMDYAAPEVLGGSSYK------------GKPQDIWALGVLLYTI 1042

Query: 722  IYGRPPYGGFQGQNRLLAIMNPEVKIVYPEKTSNGDTVPKTAIDTMKACLERNPNKRWTV 781
            IY   PY           I+  E++    EK S G       I  +K  L R  +KR T+
Sbjct: 1043 IYKENPYYNID------EILEGELRFDKAEKVSEG------CIGLIKRILTREVDKRPTI 1090

Query: 782  EEVANGSFVK 791
            +E+    +++
Sbjct: 1091 DEIYEDKWLR 1100

>KLTH0C08932g Chr3 (749308..750867) [1560 bp, 519 aa] {ON} similar
           to uniprot|P38070 Saccharomyces cerevisiae YBR028C
           Hypothetical ORF
          Length = 519

 Score = 86.3 bits (212), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 73/245 (29%), Positives = 115/245 (46%), Gaps = 48/245 (19%)

Query: 565 LLKKLETQPRVVKLIDHEMDHGVLYVVME-CGDHDLSQTLAHRSGMPLDVEFVRYHAQEM 623
           +L +LE  P +VKL     DH  LY+V++     +L   L  +    LD   V ++A E+
Sbjct: 191 ILSQLE-HPNIVKLFYSFHDHHKLYLVLQFIPGGELFYHLKEQG--TLDENTVTFYAAEI 247

Query: 624 LKCVKVVHDAGIVHSDLKPANFVF-VKGILKIIDFGIA-----------------NAVPE 665
              +K +H+ GIV+ DLKP N +   +G L + DFG++                 +A+  
Sbjct: 248 SCALKFLHERGIVYRDLKPENCLLDERGHLVLTDFGLSKKSAADSDTPERSDIDGDALNS 307

Query: 666 HT---VN-IYRETQIGTPNYMAPEALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQM 721
           H+   VN +Y  + IGTP Y APE L    YT N              D +S GC+++ M
Sbjct: 308 HSGEPVNKLY--SIIGTPEYCAPEILEGKPYTQN-------------CDWYSLGCLVFDM 352

Query: 722 IYGRPPYGGFQGQNRLLAIMNPEVKIVYPEKTSNGDTVPKTAIDTMKACLERNPNKRWTV 781
           + G+PPY G   +  L  I+  +   + P   S G        D + A L+++  KRW V
Sbjct: 353 LIGKPPYTGVNHKVILGKILKDKTPKI-PSYLSEG------MKDYLGALLKKDVTKRWDV 405

Query: 782 EEVAN 786
           ++  +
Sbjct: 406 DKFWD 410

>SAKL0E01584g Chr5 complement(121830..123917) [2088 bp, 695 aa] {ON}
           highly similar to uniprot|P32562 Saccharomyces
           cerevisiae YMR001C
          Length = 695

 Score = 86.7 bits (213), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 70/241 (29%), Positives = 118/241 (48%), Gaps = 38/241 (15%)

Query: 562 EIELLKKLETQPRVVKLIDHEMDHGVLYVVME-CGDHDLSQTLAHRSGMPLDVEFVRYHA 620
           EI++ K ++  P +V+ ID   D   +Y+++E C +  L   L  R    L    VRY  
Sbjct: 124 EIQIHKSMK-HPNIVQFIDCFEDDTNVYILLEICPNGSLMDLLKKRK--VLTEPEVRYFT 180

Query: 621 QEMLKCVKVVHDAGIVHSDLKPANFVFVKGI-LKIIDFGIANAVPEHTVNIYRETQIGTP 679
            +++  +K +H+  ++H DLK  N  F     LKI DFG+A  +       Y  T  GTP
Sbjct: 181 TQIVGAIKYMHNRRVIHRDLKLGNIFFDSNYNLKIGDFGLAAVLANDRERKY--TVCGTP 238

Query: 680 NYMAPEALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLA 739
           NY+APE L   +  H+       ++V    DIWS G +IY ++ G+PP   FQ +     
Sbjct: 239 NYIAPEVLAGKHSGHS-------YEV----DIWSIGVMIYALLIGKPP---FQAK----- 279

Query: 740 IMNPEVKIVYPEKTSNGDTV-------PKTAIDTMKACLERNPNKRWTVEEVANGSFVKP 792
               EV I+Y E+  +GD +        K  +  ++  L  +P +R +++E+ +  + + 
Sbjct: 280 ----EVNIIY-ERIKSGDYIFPREKPTSKEVMVLIQDILSIDPIERPSLDEIMDYVWFRG 334

Query: 793 V 793
           +
Sbjct: 335 I 335

>KLTH0D05566g Chr4 (498055..501441) [3387 bp, 1128 aa] {ON} weakly
           similar to uniprot|P34244 Saccharomyces cerevisiae
           YKL101W HSL1 Nim1p-related protein kinase that regulates
           the morphogenesis and septin checkpoints associates with
           the assembled septin filament required along with Hsl7p
           for bud neck recruitment phosphorylation and degradation
           of Swe1p
          Length = 1128

 Score = 87.0 bits (214), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 69/230 (30%), Positives = 110/230 (47%), Gaps = 29/230 (12%)

Query: 558 GFKGEIELLKKLETQPRVVKLIDHEMDHGVLYVVMECGDH-DLSQTLAHRSGMPLDVEFV 616
           G + EI ++ KL + P V+ L +   +   L++V+E  D  +L   L  R G   + E +
Sbjct: 103 GIEREI-IIMKLISHPNVMGLYEVWENKLELFLVLEYVDGGELFDYLVSR-GRLSEKEAI 160

Query: 617 RYHAQEMLKCVKVVHDAGIVHSDLKPANFVFVKG--ILKIIDFGIANAVPEHTVNIYRET 674
            Y  Q +++     H   I H DLKP N +  K    +KI DFG+A      T N   ET
Sbjct: 161 HYFRQ-IIEGTAYCHSFNICHRDLKPENLLLDKKNKRIKIADFGMAAL---QTSNKLLET 216

Query: 675 QIGTPNYMAPEALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQ 734
             G+P+Y +PE  + M  T+N          G PSD+WSCG I++ ++ G  P+     +
Sbjct: 217 SCGSPHYASPE--IVMGKTYN----------GGPSDVWSCGIILFALLTGHLPFNDDNIK 264

Query: 735 NRLLAIMNPEVKIVYPEKTSNGDTVPKTAIDTMKACLERNPNKRWTVEEV 784
             LL +   + ++  P+  S        A D +   L  +PNKR T+ ++
Sbjct: 265 RLLLKVQAGKYQM--PQAIS------LEAQDLISRILVVDPNKRITINDI 306

>Kpol_2002.24 s2002 (48405..49868) [1464 bp, 487 aa] {ON}
           (48405..49868) [1464 nt, 488 aa]
          Length = 487

 Score = 85.9 bits (211), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 76/281 (27%), Positives = 130/281 (46%), Gaps = 31/281 (11%)

Query: 515 YEKLELLGRGGTSXXXXXXXXXXXXXXXLKRVSFDEFDDSSIDGFKGEIELLKKLETQPR 574
           Y   E +GRG                  +K V+  E  +  ID    EI  L +L + P 
Sbjct: 15  YSIQECVGRGNFGDVYKAFDKTNGAIVAVKVVNL-EHTEEDIDLLAQEIFFLAELRS-PY 72

Query: 575 VVKLIDHEMDHGVLYVVME-CGD---HDLSQTLAHRSGMPLDVEFVRYHAQEMLKCVKVV 630
           +   I   ++   +++VME CG     DL +T+ + +G+P +   V +  +E+LK +K +
Sbjct: 73  ITNYITTMIEDVSMWIVMEYCGGGACSDLIKTV-YINGLPENK--VGFITREVLKGLKYL 129

Query: 631 HDAGIVHSDLKPANFVFV-KGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVA 689
           HD   +H D+K AN +   +G +K+ DFG++  +      + R T +GTP +MAPE +  
Sbjct: 130 HDQKKIHRDIKAANILLTDEGKVKLGDFGVSGQI---RATMKRGTFVGTPYWMAPEVVNK 186

Query: 690 MNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVY 749
            +  +N+            +DIWS G  +Y+++ G PP         ++++  P  K   
Sbjct: 187 ESNGYNEK-----------ADIWSLGITVYELLKGLPPLSKCDPMKVMVSL--PRRKP-- 231

Query: 750 PEKTSNGDTVPKTAIDTMKACLERNPNKRWTVEEVANGSFV 790
           P+       V K  +    ACL ++PN R + E +    FV
Sbjct: 232 PKLHGQYSDVAKGFV---AACLVKDPNLRPSAEMLLTNEFV 269

>Smik_3.54 Chr3 (80309..83407) [3099 bp, 1032 aa] {ON} YCL024W
           (REAL)
          Length = 1032

 Score = 87.0 bits (214), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 62/229 (27%), Positives = 106/229 (46%), Gaps = 23/229 (10%)

Query: 565 LLKKLETQPRVVKLIDHEMDHGVLYVVMECGDH-DLSQTLAHRSGMPLDVEFVRYHAQEM 623
           ++ KL + P V+ L D       LY+++E  +  +L   L  R  +P + E ++   Q +
Sbjct: 79  VIMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLP-EREAIKCFKQ-I 136

Query: 624 LKCVKVVHDAGIVHSDLKPANFVFVKGI-LKIIDFGIANAVPEHTVNIYRETQIGTPNYM 682
           +  +   H  GIVH DLKP N +      +KI DFG+A    +  +    ET  G+P+Y 
Sbjct: 137 IIAISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMAALQTDAGM---LETSCGSPHYA 193

Query: 683 APEALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMN 742
           APE +  + Y             G  SD+WSCG I++ ++ GR P+    G  R L +  
Sbjct: 194 APEIVSGLPYE------------GFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKV 241

Query: 743 PEVKIVYPEKTSNGDTVPKTAIDTMKACLERNPNKRWTVEEVANGSFVK 791
            + +   P    N   +   A D ++  L  +P +R  + ++ +   +K
Sbjct: 242 QKGQFEMP----NNAEISGDAQDLIRRILVVDPTQRIKIRDILSHPLLK 286

>AEL083W Chr5 (470964..472574) [1611 bp, 536 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBR028C
          Length = 536

 Score = 86.3 bits (212), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 71/233 (30%), Positives = 106/233 (45%), Gaps = 36/233 (15%)

Query: 561 GEIELLKKLETQPRVVKLIDHEMDHGVLYVVME-CGDHDLSQTLAHRSGMPLDVEFVRYH 619
            E  +L +LE  P +VKL     DH  LY+V++     +L   L  +    LD   V ++
Sbjct: 213 AERTILSQLE-HPNIVKLFYSFHDHHKLYLVLQYIPGGELFYHLKEQG--TLDEVTVSFY 269

Query: 620 AQEMLKCVKVVHDAGIVHSDLKPANFVF-VKGILKIIDFGIAN---------AVPEHTVN 669
           A E+   +K +H  GIV+ DLKP N +   KG L + DFG++             E    
Sbjct: 270 AAEISCALKFLHSKGIVYRDLKPENCLLDDKGHLVLTDFGLSKRGVNQADSPLGGEQVEE 329

Query: 670 IYRETQIGTPNYMAPEALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYG 729
           +Y  + IGTP Y APE L    YT N              D +S G + Y M+ G+PP+ 
Sbjct: 330 LY--SIIGTPEYCAPEILCGQPYTQN-------------CDWYSLGSLTYDMLIGKPPFT 374

Query: 730 GFQGQNRLLAIMNPEVKIVYPEKTSNGDTVPKTAIDTMKACLERNPNKRWTVE 782
           G      +L+ +  +  I  P   S+G        D + A L+++  KRW V+
Sbjct: 375 G-ANHKVILSKIKQDKGIKIPHYLSDG------MKDYLNALLKKDIGKRWDVD 420

>KNAG0J01700 Chr10 (309962..312424) [2463 bp, 820 aa] {ON} 
          Length = 820

 Score = 86.7 bits (213), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 70/232 (30%), Positives = 107/232 (46%), Gaps = 15/232 (6%)

Query: 554 SSIDGFKGEIELLKKLETQPRVVKLIDHEMDHGVLYVVME-CGDHDLSQTLAHRSGMPLD 612
            ++DG   E+ +L+KL+  P +V L     D    Y+VME     DL   +A     P+ 
Sbjct: 240 GNLDGVTRELTVLQKLD-HPSIVTLKGFYEDKDNYYMVMEFVSGGDLMDFVAAHG--PVG 296

Query: 613 VEFVRYHAQEMLKCVKVVHDAGIVHSDLKPANFVFVKG---ILKIIDFGIANAVPEHTVN 669
            +  R   +++L+ VK +H  GI H DLKP N +  +    ++KI DFG+A  + EH   
Sbjct: 297 EDAGREITRQILEAVKYIHSVGISHRDLKPDNILIKQDDPVLVKITDFGLAK-MQEH--G 353

Query: 670 IYRETQIGTPNYMAPEALVAMNYTHNQA-PEQSRWKVGKPSDIWSCGCIIYQMIYGRPPY 728
            +  T  GT  Y+APE +     T   A P+  R       D+WS GC++Y ++ G  P+
Sbjct: 354 AFMNTFCGTLAYVAPEVVNGRQQTSEPAVPKGERSHYSSLVDMWSMGCLVYVILTGHLPF 413

Query: 729 GGFQGQNRLLAIMNPEVKIVYPEKTSNGDTVPKTAIDTMKACLERNPNKRWT 780
            G   Q     I     K  Y E       +   A D +   L+ +PN R +
Sbjct: 414 SGSTPQQLYEQIG----KASYHEVPLKDCRISDQARDFIDCLLQVDPNNRLS 461

>SAKL0A01254g Chr1 (119884..124560) [4677 bp, 1558 aa] {ON} similar to
            uniprot|P53599 Saccharomyces cerevisiae YNR031C SSK2
            Suppressor of Sensor Kinase (SLN1) A MAP kinase kinase
            kinase activator of Pbs2p
          Length = 1558

 Score = 87.0 bits (214), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 66/255 (25%), Positives = 118/255 (46%), Gaps = 34/255 (13%)

Query: 559  FKGEIELLKKLETQPRVVKLIDHEMDHGVLYVVME-CGDHDLSQTLAHRSGMPLDVEFV- 616
             K E+ +L+ L   P +V+    E+    + + ME C    L+  L H     ++ E V 
Sbjct: 1308 IKDEMTVLEML-NHPNIVQYYGVEVHRDKVNIFMEYCEGGSLANLLEHSR---VEDEMVT 1363

Query: 617  RYHAQEMLKCVKVVHDAGIVHSDLKPANFVF-VKGILKIIDFGIANAVPEHTV--NIYR- 672
            + +A ++L+ +  +H +G+VH D+KP N +    GI+K +DFG A  + +++   NI   
Sbjct: 1364 QVYALQLLEGLAYLHQSGVVHRDIKPENILLDFNGIIKYVDFGAAKLLAKNSTKGNIDAT 1423

Query: 673  ---------ETQIGTPNYMAPEALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIY 723
                      T +GTP YM+PE++              + K G   DIWS GC+I +M+ 
Sbjct: 1424 SSEAKQDRINTMMGTPMYMSPESITG----------TIKGKFGS-DDIWSLGCVILEMVT 1472

Query: 724  GRPPYGGFQGQNRLLAIMNPEVKIVYPEKTSNGDTVPKTAIDTMKACLERNPNKRWTVEE 783
            GR P+     +  ++  +       +P +    D + +     +  CL ++PNKR T  E
Sbjct: 1473 GRRPWANLDNEWAIMYHVAAGHAPQFPAR----DEISRAGRKFLSRCLIQDPNKRATAVE 1528

Query: 784  VANGSFVKPVSVTHF 798
            +    ++  +    F
Sbjct: 1529 LLMDPWIAEIRKIAF 1543

>TPHA0D02840 Chr4 (591733..593637) [1905 bp, 634 aa] {ON} 
          Length = 634

 Score = 86.3 bits (212), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 70/283 (24%), Positives = 123/283 (43%), Gaps = 36/283 (12%)

Query: 515 YEKLELLGRGGTSXXXXXXXXXXXXXXXLKRVSFDEFDDSSIDG-FKGEIELLKKLETQP 573
           Y+ ++ LG G                  LK ++      S + G  + EI  L+ L   P
Sbjct: 68  YQIIKTLGEGSFGKVKLAYHVTTNQKVALKIINKKVLAKSDMQGRVEREISFLRLLR-HP 126

Query: 574 RVVKLIDHEMDHGVLYVVMECGDHDLSQTLAHRSGMPLDVEFVRYHAQEMLKCVKVVHDA 633
            ++KL D       + +V+E  +++L + +  R  M  +    R   Q+++  V+  H  
Sbjct: 127 HIIKLYDVIKSKDEIIMVIEYANNELFEYIVQRDKMTENE--ARKFFQQIISAVEYCHRH 184

Query: 634 GIVHSDLKPANFVFVKGI-LKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNY 692
            IVH DLKP N +  + + +KI DFG++N + +     + +T  G+PNY APE +    Y
Sbjct: 185 KIVHRDLKPENLLLDENLNVKIADFGLSNIMTDGN---FLKTSCGSPNYAAPEVISGKLY 241

Query: 693 THNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEK 752
                        G   D+WSCG I+Y M+  R P+             +  +  ++   
Sbjct: 242 A------------GPEVDVWSCGVILYVMLCRRLPFD------------DDSIPALFKNI 277

Query: 753 TSNGDTVPK----TAIDTMKACLERNPNKRWTVEEVANGSFVK 791
           ++   T+PK     A + +K  L  NP  R ++ E+ +  + K
Sbjct: 278 SNGIYTLPKFLSEGAANLIKKMLIVNPLNRISMTEIIHDEWFK 320

>Suva_3.190 Chr3 (288639..288813,288870..291766) [3072 bp, 1024 aa]
           {ON} YDR507C (REAL)
          Length = 1024

 Score = 87.0 bits (214), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 75/284 (26%), Positives = 120/284 (42%), Gaps = 33/284 (11%)

Query: 519 ELLGRGGTSXXXXXXXXXXXXXXXLKRVSFDEFDDSSIDG---------FKGEIELLKKL 569
           E LG G T                +K +S   FD     G          + EI ++K L
Sbjct: 17  ETLGSGSTGRVQLAQHERTGHKTAVKVISKTIFDTEDGGGXXXLALPYNIEREIVVMKLL 76

Query: 570 ETQPRVVKLIDHEMDHGVLYVVMECGDH-DLSQTLAHRSGMPLDVEFVRYHAQEMLKCVK 628
            + P V+ L D    +  LY+++E  +  +L   L  R  +P + E V+   Q ++  + 
Sbjct: 77  -SHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDRGPLP-EKEAVKCFRQ-IIIAIS 133

Query: 629 VVHDAGIVHSDLKPANFVFVKGI-LKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEAL 687
             H  GIVH DLKP N +      +KI DFG+A    +  +    ET  G+P+Y APE +
Sbjct: 134 YCHALGIVHRDLKPENLLLDNDYNIKIADFGMAALQTDARL---LETSCGSPHYAAPEIV 190

Query: 688 VAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKI 747
             + Y             G  SD+WSCG I++ ++ GR P+    G  R L +     + 
Sbjct: 191 SGLPYR------------GFASDVWSCGVILFALLTGRLPFDEDNGNVRDLLLKVQRGQF 238

Query: 748 VYPEKTSNGDTVPKTAIDTMKACLERNPNKRWTVEEVANGSFVK 791
             P+ T     + K A + +   L  +P +R    ++     +K
Sbjct: 239 EMPDATE----ISKDAQNLISRILVVDPTQRMKTRDILTHPLLK 278

>CAGL0L03520g Chr12 complement(403100..407443) [4344 bp, 1447 aa] {ON}
            similar to uniprot|Q01389 Saccharomyces cerevisiae
            YJL095w BCK1
          Length = 1447

 Score = 87.0 bits (214), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 67/287 (23%), Positives = 121/287 (42%), Gaps = 30/287 (10%)

Query: 515  YEKLELLGRGGTSXXXXXXXXXXXXXXXLKRVSF------DEFDDSSIDGFKGEIELLKK 568
            + K E++G+G                  +K+V        +E     ++  K E+  LK 
Sbjct: 1151 WMKGEMIGKGSFGAVYLSLNITTGEMMAVKQVEVPKYGTQNELVKDMVEALKSEVATLKD 1210

Query: 569  LETQPRVVKLIDHEMDHGVLYVVMECGDHDLSQTLAHRSGMPLDVEFVRYHAQEMLKCVK 628
            L+    +V+ +  E+   +  + +E        +L    G   D + +R+   ++L  +K
Sbjct: 1211 LD-HLNIVQYLGSEIRGNIYSLFLEYVAGGSVGSLIRLYGR-FDEKLIRHLNTQVLSGLK 1268

Query: 629  VVHDAGIVHSDLKPANFVFVK-GILKIIDFGIANAVPEHTVNIYRETQI---GTPNYMAP 684
             +H  GI+H D+K  N +  + GI KI DFGI+    + + NIY  + +   GT  +MAP
Sbjct: 1269 YLHSKGILHRDMKADNLLLDEDGICKISDFGIS----KKSKNIYSNSDMTMRGTVFWMAP 1324

Query: 685  EALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPE 744
            E +             ++       DIWS GC++ +M  G+ P+   +    +  I   +
Sbjct: 1325 EMV------------DTKQGYSAKVDIWSLGCVVLEMFAGKRPWSNLEVVAAMFQIGKSK 1372

Query: 745  VKIVYPEKTSNGDTVPKTAIDTMKACLERNPNKRWTVEEVANGSFVK 791
                 P+ T     +     D +  C E +P KR T +++   SF K
Sbjct: 1373 SAPPIPDDTIQ--LISSKGKDFLSKCFEIDPEKRPTADDLLEHSFSK 1417

>TBLA0I02400 Chr9 complement(548975..554167) [5193 bp, 1730 aa] {ON}
            Anc_6.341 YNR031C
          Length = 1730

 Score = 87.0 bits (214), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 74/274 (27%), Positives = 120/274 (43%), Gaps = 61/274 (22%)

Query: 559  FKGEIELLKKLETQPRVVKLIDHEMDHGVLYVVME-CGDHDLSQTLAHRSGMPLDVEFVR 617
             K E+ +L+ L   P +V+    E+    + + ME C    L+  L H  G   D    +
Sbjct: 1455 IKKEMTVLEML-NHPNIVQYYGVEVHRDKVNIFMEYCEGGSLASLLEH--GRIEDEMVTQ 1511

Query: 618  YHAQEMLKCVKVVHDAGIVHSDLKPANFVF-VKGILKIIDFGIANAVPEHTVNI------ 670
             +  E+L+ +  +H +GIVH D+KP N +    GI+K +DFG A  + +    I      
Sbjct: 1512 VYTLELLEGLSYLHQSGIVHRDIKPENILLDFNGIIKYVDFGAARKIAKDHTRIASFSKD 1571

Query: 671  -------------YRETQ-----------IGTPNYMAPEALVAMNYTHNQAPEQSRWKVG 706
                           ET+           +GTP YMAPEA+         +P ++++   
Sbjct: 1572 GKDNKESKKIDDTLLETEEAGVGTGLYDMVGTPMYMAPEAISG-------SPNKNKF--- 1621

Query: 707  KPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEKTSNGDTVPKTAIDT 766
               D+WS GC++ +MI GR P+     +    AIM   V   +  +  + D V     + 
Sbjct: 1622 GSDDVWSLGCVVLEMITGRRPWANLDNE---WAIM-YHVAAGHSPQLPSKDEVSTNGNNF 1677

Query: 767  MKACLERNPNKR----------WTVE--EVANGS 788
            +K CL+++P KR          W VE  E+A G+
Sbjct: 1678 LKRCLQQDPYKRATAVDLLMDVWIVEIRELAFGT 1711

>SAKL0C00946g Chr3 (84995..86689) [1695 bp, 564 aa] {ON} similar to
           uniprot|Q751V1 Ashbya gossypii AFR724C AFR724Cp and some
           similarites with YDR523C uniprot|P08458 Saccharomyces
           cerevisiae YDR523C SPS1 dispensable for mitosis involved
           in middle/late stage of meiosis required for spore wall
           formation serine/threonine kinase homologous to Ste20p
           expressed in middle/late meiosis
          Length = 564

 Score = 86.3 bits (212), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 73/282 (25%), Positives = 123/282 (43%), Gaps = 25/282 (8%)

Query: 515 YEKLELLGRGGTSXXXXXXXXXXXXXXXLKRVSFDEFDDSSIDGFKGEIELLKKLETQPR 574
           YE  E +G+G                  +K V+ +E DD  ID    EI  L +L + P 
Sbjct: 34  YEVQECVGKGNFGDVYKAIDKSTGNTVAIKVVNLEETDDE-IDLLAQEIYFLAELHS-PY 91

Query: 575 VVKLIDHEMDHGVLYVVME-CGDHDLSQTLAHRSGMPLDVEFVRYHAQEMLKCVKVVHDA 633
           +       ++   +++VME CG    S  L       L  E V +  +E+L+ ++ +H  
Sbjct: 92  ITNYFSTFVEDVSMWIVMEYCGGGSCSDLLKCLPRGTLTEEKVAFITREILRGLEYLHSQ 151

Query: 634 GIVHSDLKPANFVFVK-GILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNY 692
             +H D+K AN +    G +K+ DFG++    +      R+T +GTP +MAPE +     
Sbjct: 152 RKIHRDIKAANILLTDDGKVKLGDFGVSG---QMMATRRRDTFVGTPFWMAPEVIARSEQ 208

Query: 693 THNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEK 752
            +N+            +DIWS G  +++++ G+PP         L++I  P  +   P K
Sbjct: 209 GYNE-----------KADIWSLGITVFELLKGQPPLSQHDPMKVLMSI--PSRR---PPK 252

Query: 753 TSNGDTVPKTAIDTMKACLERNPNKRWTVEEVANGSFVKPVS 794
               D       + +  CL ++P KR T  E+    F+  V 
Sbjct: 253 LE--DRYSHAIREFVSLCLNKDPAKRPTASELLKHRFIARVG 292

>TBLA0D02230 Chr4 (557816..561280) [3465 bp, 1154 aa] {ON} Anc_8.141
           YGL180W
          Length = 1154

 Score = 87.0 bits (214), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 73/286 (25%), Positives = 119/286 (41%), Gaps = 67/286 (23%)

Query: 556 IDGFKGEIELLKKLETQPRVVKLIDHEMDHGVLYVVME-CGDHDLSQTLAHRSGM----- 609
           ++  + EI +LKKL     +V LID + +     ++ME C   DL+  +  R+ +     
Sbjct: 175 LENLEIEISILKKLN-HKHIVNLIDCQRNKNDFLLIMEYCSLGDLTFLIKKRNELIINHP 233

Query: 610 -----------------PLDVEFVRYHAQEMLKCVKVVHDAGIVHSDLKPANFVF----- 647
                             L++ FV  + Q++   +K +    ++H D+KP N +      
Sbjct: 234 LLNQIFQKFPSPNPDCNGLNIAFVLNYLQQLASALKFLRSRNLIHRDIKPQNLLLSTPYT 293

Query: 648 -----------------VKGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAM 690
                               ILKI DFG A  +P  ++    ET  G+P YMAPE L   
Sbjct: 294 DYHDQQTFKKLGYIGISCLPILKIADFGFARFLPNTSL---AETLCGSPLYMAPEIL--- 347

Query: 691 NYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYP 750
           NY           K    +D+WS G ++Y+M+YG+PP+        L  I      I +P
Sbjct: 348 NYQ----------KYNAKADLWSVGTVLYEMVYGKPPFKANNHLELLKKIKRTNDNIPFP 397

Query: 751 EKTSNGDTVPKTAIDTMKACLERNPNKRWTVEE-VANGSFVKPVSV 795
                 D + K  I  +   L+ +P KR + +E   N   +K +S+
Sbjct: 398 SYIEIDDDM-KFLISRL---LKFDPIKRMSFQEFFENNLILKDLSI 439

>YAL017W Chr1 (120225..124295) [4071 bp, 1356 aa] {ON}  PSK1One of two
            (see also PSK2) PAS domain containing S/T protein
            kinases; coordinately regulates protein synthesis and
            carbohydrate metabolism and storage in response to a
            unknown metabolite that reflects nutritional status
          Length = 1356

 Score = 87.0 bits (214), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 64/246 (26%), Positives = 115/246 (46%), Gaps = 39/246 (15%)

Query: 553  DSSIDGFKGEIELLKKLETQPR--VVKLIDHEMDHGVLYVVM----ECGDHDLSQTLAHR 606
            D  +     EI+++  L  +P   +++L+D   D    Y+      E G  DL   +  +
Sbjct: 1140 DRKLGTIPSEIQIMATLNKKPHENILRLLDFFEDDDYYYIETPVHGETGCIDLFDLIEFK 1199

Query: 607  SGMPLDVEF-VRYHAQEMLKCVKVVHDAGIVHSDLKPANFVF-VKGILKIIDFGIANAVP 664
            + M    EF  +   ++++  +K +HD GIVH D+K  N +   KG +KIIDFG A  V 
Sbjct: 1200 TNM---TEFEAKLIFKQVVAGIKHLHDQGIVHRDIKDENVIVDSKGFVKIIDFGSAAYVK 1256

Query: 665  EHTVNIYRETQIGTPNYMAPEALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYG 724
                +++    +GT +Y APE L    Y             G+P DIW+ G ++Y +++ 
Sbjct: 1257 SGPFDVF----VGTIDYAAPEVLGGNPYE------------GQPQDIWAIGILLYTVVFK 1300

Query: 725  RPPYGGFQGQNRLLAIMNPEVKIVYPEKTSNGDTVPKTAIDTMKACLERNPNKRWTVEEV 784
              P+           I+  ++K       +N + V +  I+ +K+ L R   KR T++++
Sbjct: 1301 ENPFYNID------EILEGDLKF------NNAEEVSEDCIELIKSILNRCVPKRPTIDDI 1348

Query: 785  ANGSFV 790
             N  ++
Sbjct: 1349 NNDKWL 1354

>Smik_1.50 Chr1 (103132..107205) [4074 bp, 1357 aa] {ON} YAL017W
            (REAL)
          Length = 1357

 Score = 87.0 bits (214), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 64/246 (26%), Positives = 115/246 (46%), Gaps = 39/246 (15%)

Query: 553  DSSIDGFKGEIELLKKLETQPR--VVKLIDHEMDHGVLYVVM----ECGDHDLSQTLAHR 606
            D  +     EI+++  L  +P   +++L+D   D    Y+      E G  DL   +  +
Sbjct: 1141 DRKLGTIPSEIQIMATLNKKPHENILRLLDFFEDDDYYYIETPVHGETGCIDLFDLIEFK 1200

Query: 607  SGMPLDVEF-VRYHAQEMLKCVKVVHDAGIVHSDLKPANFVF-VKGILKIIDFGIANAVP 664
            + M    EF  +   ++++  +K +HD GIVH D+K  N +   KG +KIIDFG A  V 
Sbjct: 1201 TNM---TEFEAKLIFKQVVAGIKHLHDQGIVHRDIKDENVIVDSKGFVKIIDFGSAAYVK 1257

Query: 665  EHTVNIYRETQIGTPNYMAPEALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYG 724
                +++    +GT +Y APE L    Y             G+P DIW+ G ++Y +++ 
Sbjct: 1258 SGPFDVF----VGTIDYAAPEVLGGNPYE------------GQPQDIWAIGILLYTVVFK 1301

Query: 725  RPPYGGFQGQNRLLAIMNPEVKIVYPEKTSNGDTVPKTAIDTMKACLERNPNKRWTVEEV 784
              P+           I+  ++K       +N + V +  I+ +K+ L R   KR T++++
Sbjct: 1302 ENPFYNID------EILEGDLKF------NNAEGVSEDCIELIKSILNRCVPKRPTIDDI 1349

Query: 785  ANGSFV 790
             N  ++
Sbjct: 1350 NNDKWL 1355

>ZYRO0A06446g Chr1 complement(513126..515957) [2832 bp, 943 aa] {ON}
           weakly similar to uniprot|P38692 Saccharomyces
           cerevisiae YHR102W KIC1 Protein kinase of the PAK/Ste20
           kinase family required for cell integrity possibly
           through regulating 1 6-beta-glucan levels in the wall
           physically interacts with Cdc31p (centrin) which is a
           component of the spindle pole body
          Length = 943

 Score = 86.7 bits (213), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 62/280 (22%), Positives = 126/280 (45%), Gaps = 28/280 (10%)

Query: 515 YEKLELLGRGGTSXXXXXXXXXXXXXXXLKRVSFDEFDDSSIDGFKGEIELLKKLETQPR 574
           +++ E++G G                  +K ++ D  D+  ++  + E++ L  ++  P 
Sbjct: 29  FKRTEVIGTGKFGVVYKGHHARTKQVYAIKVLNLDS-DEDEVEDVQREVQFLASMKQTPN 87

Query: 575 VVKLIDHEMDHGVLYVVME-CGDHDLSQTLAHRSGMPLDVEFVRYHAQEMLKCVKVVHDA 633
           +       +    L++++E C    L   L  R G  +D +++    +E+L  +K +H  
Sbjct: 88  ITHYYGSYLKDTTLWIIIEYCAGGSLRTLL--RPGK-IDEKYIGIIMREVLIALKYIHKD 144

Query: 634 GIVHSDLKPANFVFV-KGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALV-AMN 691
            ++H D+K AN +   +G +K+ DFG+A  + + +  + R+T  GTP +MAPE ++  ++
Sbjct: 145 NVIHRDIKAANVLITNEGHVKLCDFGVAAQLNQSS--LKRQTMAGTPYWMAPEVIMEGVS 202

Query: 692 YTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPE 751
           Y           KV    DIWS G   Y++  G PPY   +    +  I   +     P 
Sbjct: 203 Y---------DTKV----DIWSLGITTYEIATGNPPYCDVEALRAMQLITKSK-----PP 244

Query: 752 KTSNGDTVPKTAIDTMKACLERNPNKRWTVEEVANGSFVK 791
           +       P    + +  CL+ +P +R + +++     +K
Sbjct: 245 RLEGRHYSPMLK-EFIALCLDEDPKERLSADDLLKSKLIK 283

>NDAI0E03170 Chr5 complement(677441..678392,678524..678543) [972 bp,
           323 aa] {ON} Anc_8.482
          Length = 323

 Score = 83.6 bits (205), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 65/226 (28%), Positives = 110/226 (48%), Gaps = 27/226 (11%)

Query: 513 TEYEKLELLGRGGTSXXXXXXXXXXXXXXXLKRVSFDEFDDSSIDGFKGEIELLKKLETQ 572
           +++++LE LG G  +               LK V  D  + +     + EI L+K+L+ +
Sbjct: 6   SQFKQLEKLGNGTYATVYKGLNKSTGAFVALKEVKLDSEEGTPSTAIR-EISLMKELKHE 64

Query: 573 PRVVKLIDHEMDHGVLYVVMECGDHDLSQTLAHRSG----MPLDVEFVRYHAQEMLKCVK 628
             +V+L D       L +V E  D+DL + +  +S       L++  V+Y   ++ + + 
Sbjct: 65  -NIVRLYDVIHTENKLTLVFEYMDNDLKKYMDSQSTGNTPRGLELNLVKYFQWQLFEGLA 123

Query: 629 VVHDAGIVHSDLKPANFVF-VKGILKIIDFGIANA--VPEHTVNIYRETQIGTPNYMAPE 685
             H+  I+H DLKP N +   KG LK+ DFG+A A  +P +T +    +++ T  Y AP+
Sbjct: 124 FCHENKILHRDLKPQNLLINKKGQLKLGDFGLARAFGIPVNTFS----SEVVTLWYRAPD 179

Query: 686 ALVA-MNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGG 730
            L+    YT +              DIWSCGCI+ +MI G+  + G
Sbjct: 180 VLMGSRTYTTS-------------IDIWSCGCILAEMITGKALFPG 212

>CAGL0B04301g Chr2 (420544..422172) [1629 bp, 542 aa] {ON} similar
           to uniprot|P38070 Saccharomyces cerevisiae YBR028c
          Length = 542

 Score = 85.9 bits (211), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 69/236 (29%), Positives = 111/236 (47%), Gaps = 42/236 (17%)

Query: 565 LLKKLETQPRVVKLIDHEMDHGVLYVVMEC--GDHDLSQTLAHRSGMPLDVEFVRYHAQE 622
           +L +LE  P +VKL     D   LY++++   G         H +   L+ + V ++A E
Sbjct: 223 ILSQLE-HPNIVKLFYSFHDTSKLYLLLQYIPGGELFFHLKEHGT---LEEDTVAFYAAE 278

Query: 623 MLKCVKVVHDAGIVHSDLKPANFVFVK-GILKIIDFGI----ANAVPEHTVNIYRETQ-- 675
           +   +K +H  G+V+ DLKP N +  + G L + DFG+    A+   +  +    E +  
Sbjct: 279 ISCALKFLHSKGVVYRDLKPENCLLNQNGHLVLTDFGLSKSSASNASQEDLGAGNEGEDV 338

Query: 676 ------IGTPNYMAPEALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYG 729
                 IGTP Y APE L+   YT N              D +S GC++Y M+ G+PPY 
Sbjct: 339 NELHSIIGTPEYCAPEILLGQPYTAN-------------CDWYSLGCLLYDMLTGKPPYT 385

Query: 730 GFQGQNRLLA--IMNPEVKIVYPEKTSNGDTVPKTAIDTMKACLERNPNKRWTVEE 783
           G    ++++A  I N +     P   S+G        D + A L+ +P KRW V++
Sbjct: 386 G--ANHKVIANKIKNDKQGPKIPYYLSDG------MKDVLGALLKSDPKKRWDVDK 433

>TBLA0E03360 Chr5 complement(838512..840476) [1965 bp, 654 aa] {ON}
           Anc_5.611 YDR477W
          Length = 654

 Score = 86.3 bits (212), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 70/283 (24%), Positives = 119/283 (42%), Gaps = 36/283 (12%)

Query: 515 YEKLELLGRGGTSXXXXXXXXXXXXXXXLKRVSFDEFDDSSIDG-FKGEIELLKKLETQP 573
           Y+ ++ LG G                  LK ++      S + G  + EI  L+ L   P
Sbjct: 44  YQIIKTLGEGSFGKVKLAYHATTGQKVALKIINRKVLAKSDMQGRIEREISYLRLLR-HP 102

Query: 574 RVVKLIDHEMDHGVLYVVMECGDHDLSQTLAHRSGMPLDVEFVRYHAQEMLKCVKVVHDA 633
            ++KL D       + +V+E  D++L   +  R  M    +  R   Q+++  V   H  
Sbjct: 103 HIIKLYDVIKSKDEIIMVIEYADNELFDYIVQRDKM--SEQEARRFFQQIISAVDYCHRH 160

Query: 634 GIVHSDLKPANFVFVKGI-LKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNY 692
            IVH DLKP N +  + + +KI DFG++N + +     + +T  G+PNY APE +    Y
Sbjct: 161 KIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGN---FLKTSCGSPNYAAPEVISGKLY 217

Query: 693 THNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEK 752
                        G   D+WSCG I+Y M+  R P+             +  + +++   
Sbjct: 218 A------------GPEVDVWSCGVILYVMLCRRLPFD------------DESIPVLFKNI 253

Query: 753 TSNGDTVPK----TAIDTMKACLERNPNKRWTVEEVANGSFVK 791
            +   T+P+     A   +K  L  NP  R ++ E+    + K
Sbjct: 254 NNGIYTLPRFLSEGASSLIKKMLIVNPLNRISIHEIMQDEWFK 296

>NDAI0A07190 Chr1 (1636773..1638380) [1608 bp, 535 aa] {ON}
           Anc_3.229
          Length = 535

 Score = 85.5 bits (210), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 73/248 (29%), Positives = 111/248 (44%), Gaps = 51/248 (20%)

Query: 561 GEIELLKKLETQPRVVKLIDHEMDHGVLYVVMECGDHDLSQTLAH-RSGMPLDVEFVRYH 619
            E  +L +LE  P +VKL     D+  LY++++       +   H +    LD   V Y+
Sbjct: 207 AERSILSELE-HPNIVKLFYSFHDNSKLYLLLQYIPG--GELFFHLKEYGTLDETTVAYY 263

Query: 620 AQEMLKCVKVVHDAGIVHSDLKPANFVFVK-GILKIIDFGIANAVPEHTVNIYRETQ--- 675
           A E+   +K +HD GIV+ DLKP N +  + G L + DFG++       VN    ++   
Sbjct: 264 AAEISCALKFLHDKGIVYRDLKPENCLLNETGHLVLTDFGLSKKSVSQEVNSELNSEDTD 323

Query: 676 ----------------IGTPNYMAPEALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIY 719
                           IGTP Y APE L  + Y  N              D +S GC++Y
Sbjct: 324 TPTEQIGENVDTLHSIIGTPEYCAPEILKGLPYDRN-------------CDWYSLGCLLY 370

Query: 720 QMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEKTSNGDTVPKTAIDTMK----ACLERNP 775
            M+ G+PPY G   +     I+N   KI   +K   G  +P    D MK      L+++ 
Sbjct: 371 DMLSGKPPYTGVDHK----VILN---KI---QKDKTGPKIPFYLSDGMKDMLTWLLKKDR 420

Query: 776 NKRWTVEE 783
           +KRW V++
Sbjct: 421 SKRWDVDK 428

>Smik_4.754 Chr4 (1333667..1335565) [1899 bp, 632 aa] {ON} YDR477W
           (REAL)
          Length = 632

 Score = 85.9 bits (211), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 70/283 (24%), Positives = 120/283 (42%), Gaps = 36/283 (12%)

Query: 515 YEKLELLGRGGTSXXXXXXXXXXXXXXXLKRVSFDEFDDSSIDG-FKGEIELLKKLETQP 573
           Y+ ++ LG G                  LK ++      S + G  + EI  L+ L   P
Sbjct: 55  YQIVKTLGEGSFGKVKLAYHTTTGQKVALKIINKKVLAKSDMQGRIEREISYLRLLR-HP 113

Query: 574 RVVKLIDHEMDHGVLYVVMECGDHDLSQTLAHRSGMPLDVEFVRYHAQEMLKCVKVVHDA 633
            ++KL D       + +V+E   ++L   +  R  M    +  R   Q+++  V+  H  
Sbjct: 114 HIIKLYDVIKSKDEIIMVIEYAGNELFDYIVQRDKM--SEQEARRFFQQIISAVEYCHRH 171

Query: 634 GIVHSDLKPANFVFVKGI-LKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNY 692
            IVH DLKP N +  + + +KI DFG++N + +     + +T  G+PNY APE +    Y
Sbjct: 172 KIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGN---FLKTSCGSPNYAAPEVISGKLY 228

Query: 693 THNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEK 752
                        G   D+WSCG I+Y M+  R P+             +  + +++   
Sbjct: 229 A------------GPEVDVWSCGVILYVMLCRRLPFD------------DESIPVLFKNI 264

Query: 753 TSNGDTVPK----TAIDTMKACLERNPNKRWTVEEVANGSFVK 791
           ++   T+PK     A   +K  L  NP  R ++ E+    + K
Sbjct: 265 SNGVYTLPKFLSPGAAGLIKRMLIVNPLNRISIHEIMQDDWFK 307

>Suva_15.124 Chr15 (215781..219101) [3321 bp, 1106 aa] {ON} YOL045W
            (REAL)
          Length = 1106

 Score = 86.3 bits (212), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 66/250 (26%), Positives = 109/250 (43%), Gaps = 45/250 (18%)

Query: 553  DSSIDGFKGEIELLKKLETQPR--VVKLIDHEMDHGVLYVVM----ECGDHDLSQTLAHR 606
            D  +     EI+++  L   P+  +++L+D   D    Y+      E G  DL   +  +
Sbjct: 890  DRKLGTIPSEIQIMATLNKNPQENILRLLDFFEDDDYYYIETPVHGETGSIDLFDVIEFK 949

Query: 607  SGMPLDVEFVRYHAQEMLK----CVKVVHDAGIVHSDLKPANFVF-VKGILKIIDFGIAN 661
              M      V + A+ + K     +K +HD GIVH D+K  N +    G +K+IDFG A 
Sbjct: 950  KDM------VEHEAKLVFKQVVSSIKHLHDQGIVHRDIKDENIIVDSHGFVKLIDFGSAA 1003

Query: 662  AVPEHTVNIYRETQIGTPNYMAPEALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQM 721
                   +++    +GT +Y APE L   +Y             GKP DIW+ G ++Y +
Sbjct: 1004 YTKSGPFDVF----VGTMDYAAPEVLGGSSYK------------GKPQDIWALGVLLYTI 1047

Query: 722  IYGRPPYGGFQGQNRLLAIMNPEVKIVYPEKTSNGDTVPKTAIDTMKACLERNPNKRWTV 781
            IY   PY           I+  E++        N + V    I  +K  L R  +KR T+
Sbjct: 1048 IYKENPYYNID------EILEGELRF------DNAENVSDECISLIKGILTREVDKRPTI 1095

Query: 782  EEVANGSFVK 791
            +++    ++K
Sbjct: 1096 DDIYQDKWLK 1105

>YDR477W Chr4 (1412373..1414274) [1902 bp, 633 aa] {ON}
           SNF1AMP-activated serine/threonine protein kinase found
           in a complex containing Snf4p and members of the
           Sip1p/Sip2p/Gal83p family; required for transcription of
           glucose-repressed genes, thermotolerance, sporulation,
           and peroxisome biogenesis
          Length = 633

 Score = 85.9 bits (211), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 70/283 (24%), Positives = 120/283 (42%), Gaps = 36/283 (12%)

Query: 515 YEKLELLGRGGTSXXXXXXXXXXXXXXXLKRVSFDEFDDSSIDG-FKGEIELLKKLETQP 573
           Y+ ++ LG G                  LK ++      S + G  + EI  L+ L   P
Sbjct: 55  YQIVKTLGEGSFGKVKLAYHTTTGQKVALKIINKKVLAKSDMQGRIEREISYLRLLR-HP 113

Query: 574 RVVKLIDHEMDHGVLYVVMECGDHDLSQTLAHRSGMPLDVEFVRYHAQEMLKCVKVVHDA 633
            ++KL D       + +V+E   ++L   +  R  M    +  R   Q+++  V+  H  
Sbjct: 114 HIIKLYDVIKSKDEIIMVIEYAGNELFDYIVQRDKM--SEQEARRFFQQIISAVEYCHRH 171

Query: 634 GIVHSDLKPANFVFVKGI-LKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNY 692
            IVH DLKP N +  + + +KI DFG++N + +     + +T  G+PNY APE +    Y
Sbjct: 172 KIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGN---FLKTSCGSPNYAAPEVISGKLY 228

Query: 693 THNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEK 752
                        G   D+WSCG I+Y M+  R P+             +  + +++   
Sbjct: 229 A------------GPEVDVWSCGVILYVMLCRRLPFD------------DESIPVLFKNI 264

Query: 753 TSNGDTVPK----TAIDTMKACLERNPNKRWTVEEVANGSFVK 791
           ++   T+PK     A   +K  L  NP  R ++ E+    + K
Sbjct: 265 SNGVYTLPKFLSPGAAGLIKRMLIVNPLNRISIHEIMQDDWFK 307

>Smik_10.147 Chr10 (239101..243537) [4437 bp, 1478 aa] {ON} YJL095W
            (REAL)
          Length = 1478

 Score = 86.3 bits (212), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 72/298 (24%), Positives = 126/298 (42%), Gaps = 37/298 (12%)

Query: 515  YEKLELLGRGGTSXXXXXXXXXXXXXXXLKRVSFDEFDD------SSIDGFKGEIELLKK 568
            + K E++G+G                  +K+V   ++        S+++  + E+  LK 
Sbjct: 1175 WMKGEMIGKGSFGAVYLCLNVTTGEMMAVKQVEVPKYSSQNEAILSTVEALRSEVSTLKD 1234

Query: 569  LETQPRVVKLIDHEMDHGVLYVVMECGDHDLSQTLAHRSGMPLDVEFVRYHAQEMLKCVK 628
            L+    +V+ +  E    +  + +E        +L    G   D   +++   ++LK + 
Sbjct: 1235 LD-HLNIVQYLGFENKDNIYSLFLEYVAGGSVGSLIRMYGR-FDEPLIKHLTTQVLKGLA 1292

Query: 629  VVHDAGIVHSDLKPANFVFVK-GILKIIDFGIANAVPEHTVNIYRETQI---GTPNYMAP 684
             +H  GI+H D+K  N +  + GI KI DFGI+      + +IY  + +   GT  +MAP
Sbjct: 1293 YLHSKGILHRDMKADNLLLDQDGICKISDFGIS----RKSKDIYSNSDMTMRGTVFWMAP 1348

Query: 685  EALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPE 744
            E +             ++       DIWS GCI+ +M  G+ P+   +    +  I   +
Sbjct: 1349 EMV------------DTKQGYSAKVDIWSLGCIVLEMFAGKRPWSNLEVVAAMFKIGKSK 1396

Query: 745  VKIVYPEKTSNGDTVP---KTAIDTMKACLERNPNKRWTVEEVANGSFVKPVSVTHFF 799
                 PE     DT+P   +     + AC E NP KR T  E+ +  F   V+VT  F
Sbjct: 1397 SAPPIPE-----DTLPLISQVGRGFLDACFEINPEKRPTATELLSHRF-SVVNVTFDF 1448

>Skud_10.119 Chr10 (215299..219744) [4446 bp, 1481 aa] {ON} YJL095W
            (REAL)
          Length = 1481

 Score = 86.3 bits (212), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 67/288 (23%), Positives = 121/288 (42%), Gaps = 36/288 (12%)

Query: 515  YEKLELLGRGGTSXXXXXXXXXXXXXXXLKRVSFDEFDD------SSIDGFKGEIELLKK 568
            + K E++G+G                  +K+V   ++         +++  + E+  LK 
Sbjct: 1178 WMKGEMIGKGSFGAVYLCLNVTTGEMMAVKQVEVPKYSSQNEAILGTVEALRSEVSTLKD 1237

Query: 569  LETQPRVVKLIDHEMDHGVLYVVMECGDHDLSQTLAHRSGMPLDVEFVRYHAQEMLKCVK 628
            L+    +V+ +  E  + +  + +E        +L    G   D   +R+   ++LK + 
Sbjct: 1238 LD-HLNIVQYLGFENKNNIYSLFLEYVAGGSVGSLIRMYGR-FDESLIRHLTTQVLKGLA 1295

Query: 629  VVHDAGIVHSDLKPANFVFVK-GILKIIDFGIANAVPEHTVNIYRETQI---GTPNYMAP 684
             +H  GI+H D+K  N +  + GI KI DFGI+      + +IY  + +   GT  +MAP
Sbjct: 1296 YLHSKGILHRDMKADNLLLDQDGICKISDFGIS----RKSKDIYSNSDMTMRGTVFWMAP 1351

Query: 685  EALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPE 744
            E +             ++       DIWS GCI+ +M  G+ P+   +    +  I   +
Sbjct: 1352 EMV------------DTKQGYSAKVDIWSLGCIVLEMFAGKRPWSNLEVVAAMFKIGKSK 1399

Query: 745  VKIVYPEKTSNGDTVP---KTAIDTMKACLERNPNKRWTVEEVANGSF 789
                 PE     DT+P   +     + AC E NP +R T  E+ +  F
Sbjct: 1400 SAPPIPE-----DTLPLISQVGRSFLDACFEINPEERPTATELLSHQF 1442

>NCAS0C04100 Chr3 (834997..837714) [2718 bp, 905 aa] {ON} Anc_8.141
          Length = 905

 Score = 85.9 bits (211), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 64/227 (28%), Positives = 96/227 (42%), Gaps = 65/227 (28%)

Query: 556 IDGFKGEIELLKKLETQPRVVKLIDHEMDHGVLYVVME-CGDHDLSQTLAHRSGM----- 609
           ++  + EI +LKK+ + P +VKLID E      Y++ME C   DL+  +  R  +     
Sbjct: 97  LENLEIEIAILKKI-SHPHIVKLIDFERTSKDFYLIMEYCSLGDLTFLIKKRQQLIKNHP 155

Query: 610 -----------------PLDVEFVRYHAQEMLKCVKVVHDAGIVHSDLKPANF------- 645
                             L   F+  + Q++   +K +    +VH D+KP N        
Sbjct: 156 LLEKIFKKYPPPNEKYNGLHKAFILNYLQQLSSALKFLRSKNLVHRDIKPQNLLLSAPLI 215

Query: 646 ---------------VFVKGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAM 690
                          ++   ILKI DFG A  +P  ++    ET  G+P YMAPE L   
Sbjct: 216 NYNDPKSFHDLGFVGIYNLPILKIADFGFARFLPNTSM---AETLCGSPLYMAPEIL--- 269

Query: 691 NYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRL 737
           NY           K    +D+WS G ++Y+M YG PP   F+  N L
Sbjct: 270 NYQ----------KYNAKADLWSVGTVLYEMCYGNPP---FKASNHL 303

>Suva_2.651 Chr2 (1164264..1166165) [1902 bp, 633 aa] {ON} YDR477W
           (REAL)
          Length = 633

 Score = 85.5 bits (210), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 70/283 (24%), Positives = 120/283 (42%), Gaps = 36/283 (12%)

Query: 515 YEKLELLGRGGTSXXXXXXXXXXXXXXXLKRVSFDEFDDSSIDG-FKGEIELLKKLETQP 573
           Y+ ++ LG G                  LK ++      S + G  + EI  L+ L   P
Sbjct: 54  YQIVKTLGEGSFGKVKLAYHTTTGQKVALKIINKKVLAKSDMQGRIEREISYLRLLR-HP 112

Query: 574 RVVKLIDHEMDHGVLYVVMECGDHDLSQTLAHRSGMPLDVEFVRYHAQEMLKCVKVVHDA 633
            ++KL D       + +V+E   ++L   +  R  M  D    R   Q+++  V+  H  
Sbjct: 113 HIIKLYDVIKSKDEIIMVIEYAGNELFDYIVQRDKMSEDE--ARRFFQQIISAVEYCHRH 170

Query: 634 GIVHSDLKPANFVFVKGI-LKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNY 692
            IVH DLKP N +  + + +KI DFG++N + +     + +T  G+PNY APE +    Y
Sbjct: 171 KIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGN---FLKTSCGSPNYAAPEVISGKLY 227

Query: 693 THNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEK 752
                        G   D+WSCG I+Y M+  R P+             +  + +++   
Sbjct: 228 A------------GPEVDVWSCGVILYVMLCRRLPFD------------DESIPVLFKNI 263

Query: 753 TSNGDTVPK----TAIDTMKACLERNPNKRWTVEEVANGSFVK 791
           ++   ++PK     A   +K  L  NP  R ++ E+    + K
Sbjct: 264 SNGVYSLPKFLSPGAASLIKRMLIVNPLNRISIHEIMQDDWFK 306

>NCAS0A05770 Chr1 (1132854..1137239) [4386 bp, 1461 aa] {ON}
           Anc_2.479
          Length = 1461

 Score = 86.3 bits (212), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 66/237 (27%), Positives = 111/237 (46%), Gaps = 31/237 (13%)

Query: 558 GFKGEIELLKKLETQPRVVKLIDHEMDHGVLYVVMECGDH-DLSQTLAHRSGMPLDVEFV 616
           G + EI ++K L + P V+ L +   +   LY+V+E  D  +L   L  +  +  + E V
Sbjct: 182 GIEREIVIMK-LISHPNVMALYEVWENKSELYLVLEYVDGGELFDYLVSKGKLS-EKEAV 239

Query: 617 RYHAQEMLKCVKVVHDAGIVHSDLKPANFVFVKG--ILKIIDFGIANA-VPEHTVNIYRE 673
            Y  Q +++ V   H   I H DLKP N +  K    +KI DFG+A   +P    N   +
Sbjct: 240 HYFKQ-IIQGVSYCHSFNICHRDLKPENLLLDKKNKSIKIADFGMAALELP----NKLLQ 294

Query: 674 TQIGTPNYMAPEALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQG 733
           T  G+P+Y +PE ++  +Y             G PSD+WSCG I++ ++ G  P+     
Sbjct: 295 TSCGSPHYASPEIVMGKSYH------------GGPSDVWSCGIILFALLTGHLPFNDDNI 342

Query: 734 QNRLLAIMNPEVKIVYPEKTSNGDTVPKTAIDTMKACLERNPNKRWTVEEVANGSFV 790
           +  LL +   + ++          T+   A D +   L  +P+KR T + + N   +
Sbjct: 343 KKLLLKVQAGKFRM--------PSTLSPEAQDLISRILVIDPSKRITTDRILNHPLI 391

>Ecym_2434 Chr2 complement(843308..846676) [3369 bp, 1122 aa] {ON}
            similar to Ashbya gossypii ABR014W
          Length = 1122

 Score = 86.3 bits (212), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 65/235 (27%), Positives = 103/235 (43%), Gaps = 31/235 (13%)

Query: 565  LLKKLETQPRVVKLIDHEMDHGVLYVVMECGDH-DLSQTLAHRSGMPLDVEFVRYHAQEM 623
            L+ K      +V  ID  +  G L+VVME  +   L+  + H     L    +   ++E 
Sbjct: 883  LVMKGSKHKNIVNFIDSYLLKGDLWVVMEYMEGGSLTDVVTH---CILTEGQIAAVSRET 939

Query: 624  LKCVKVVHDAGIVHSDLKPANFVF-VKGILKIIDFGIANAVPEHTVNIYRETQIGTPNYM 682
            L+ +  +H  G++H D+K  N +  + G +K+ DFG    + E   N+ R T +GTP +M
Sbjct: 940  LRGLHFLHSKGVIHRDIKSDNILLSMDGNIKLTDFGFCAQINES--NLKRTTMVGTPYWM 997

Query: 683  APEALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIM- 741
            APE +             SR + G   DIWS G +I +MI G PPY        L  I  
Sbjct: 998  APEVV-------------SRKEYGPKVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIAT 1044

Query: 742  --NPEVKIVYPEKTSNGDTVPKTAIDTMKACLERNPNKRWTVEEVANGSFVKPVS 794
               P++K        +  ++       +  CL  NP  R T  E+ +   +  V+
Sbjct: 1045 NGTPKLK--------DAGSLSSVLKRFLNWCLHVNPENRATAVELLSDKLITEVA 1091

>KLLA0A03806g Chr1 complement(338807..340615) [1809 bp, 602 aa] {ON}
           highly similar to uniprot|P06782 Saccharomyces
           cerevisiae YDR477W SNF1 Protein serine/threonine kinase
           required for release from glucose repression invertase
           expression sporulation and for expression of catabolite-
           repressed genes when glucose is limiting regulates
           Adr1p- dependent transcription primarily at the level of
           chromatin binding
          Length = 602

 Score = 85.5 bits (210), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 71/284 (25%), Positives = 120/284 (42%), Gaps = 36/284 (12%)

Query: 514 EYEKLELLGRGGTSXXXXXXXXXXXXXXXLKRVSFDEFDDSSIDG-FKGEIELLKKLETQ 572
           +Y+ ++ LG G                  LK ++      S + G  + EI  L+ L   
Sbjct: 34  KYQIIKTLGEGSFGKVKLAYHISTGQKVALKIINKKVLAKSDMQGRIEREISYLRLLR-H 92

Query: 573 PRVVKLIDHEMDHGVLYVVMECGDHDLSQTLAHRSGMPLDVEFVRYHAQEMLKCVKVVHD 632
           P ++KL D       + +V+E   ++L   +  R  MP   +  R   Q+++  V   H 
Sbjct: 93  PHIIKLYDVIKSKDEIIMVIEYAGNELFDYIVQRDKMP--EQEARRFFQQIISAVDYCHR 150

Query: 633 AGIVHSDLKPANFVFVKGI-LKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMN 691
             IVH DLKP N +  + + +KI DFG++N + +     + +T  G+PNY APE +    
Sbjct: 151 HKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGN---FLKTSCGSPNYAAPEVISGKL 207

Query: 692 YTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPE 751
           Y             G   D+WS G I+Y M+  R P+             +  + +++  
Sbjct: 208 YA------------GPEVDVWSSGVILYVMLCRRLPFD------------DESIPVLFKN 243

Query: 752 KTSNGDTVP----KTAIDTMKACLERNPNKRWTVEEVANGSFVK 791
            ++   T+P    + A   +K  L  NP  R TV E+    + K
Sbjct: 244 ISNGVYTIPNFLSQGAASLIKKMLIVNPVNRITVHEIMQDEWFK 287

>Kpol_1054.2 s1054 complement(4365..7655) [3291 bp, 1096 aa] {ON}
           complement(4365..7655) [3291 nt, 1097 aa]
          Length = 1096

 Score = 85.9 bits (211), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 74/303 (24%), Positives = 127/303 (41%), Gaps = 36/303 (11%)

Query: 502 GRKRPVVYVNGTEYEKL-ELLGRGGTSXXXXXXXXXXXXXXXLKRVSFDEF-DDSSIDGF 559
           G K   V + G +  K  E+LG G  S               +K +S +       +   
Sbjct: 197 GSKSKQVILKGIKDFKFGEVLGDGSYSTVMLATSIETKKKYAVKVLSKEYLIKQKKVKYV 256

Query: 560 KGEIELLKKLETQPRVVKLIDHEMDHGVLYVVMECGDHDLSQTLAHRSGMPLDVEFVRYH 619
             E   L+KL     +V+L     D   LY ++E   +    +L  + G  ++ +   Y+
Sbjct: 257 NIEKNALQKLNNSRGIVRLFFTFQDEASLYFLLEYAPNGDFLSLIKKFG-SMNEDCASYY 315

Query: 620 AQEMLKCVKVVHDAGIVHSDLKPANFVFVKGI-LKIIDFGIANAV---------PEHTVN 669
           + +++  +  VH  GI+H D+KP N +    + +K+ DFG A  +            T +
Sbjct: 316 SAQIIDAIHFVHSRGIIHRDIKPENILLDSEMKVKLTDFGTAKILEPKSSSSSSKHETYD 375

Query: 670 IYRETQ--IGTPNYMAPEALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPP 727
           +   ++  +GT  Y++PE L       N +   SR       DIW+ GCI++QMI G+PP
Sbjct: 376 LLTRSKSFVGTAEYVSPELL-------NDSYADSR------CDIWAFGCIVFQMIAGKPP 422

Query: 728 YGGFQGQNRLLAIMNPEVKIVYPEKTSNGDTVPKTAIDTMKACLERNPNKRWTVEEVANG 787
              F+  N  L      +K+ Y          P    D +K  L + P +R T+ ++   
Sbjct: 423 ---FKATNEYLTFQK-VMKVQYAFTAG----FPLVIRDLVKRILIKAPEQRLTISQIKKH 474

Query: 788 SFV 790
            F+
Sbjct: 475 HFL 477

>TBLA0B03840 Chr2 complement(881914..884490) [2577 bp, 858 aa] {ON}
           Anc_8.676 YPL153C
          Length = 858

 Score = 85.5 bits (210), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 67/242 (27%), Positives = 114/242 (47%), Gaps = 17/242 (7%)

Query: 554 SSIDGFKGEIELLKKLETQPRVVKLIDHEMDHGVLYVVME-CGDHDLSQTLAHRSGMPLD 612
            ++ G   E+E+L+KL+  PR+V+L     D    Y+VME     DL   +A    +  D
Sbjct: 235 GNLSGVTRELEILRKLD-HPRIVRLKGFYEDEESYYLVMEFVSGGDLMDFVAAHGSVGED 293

Query: 613 VEFVRYHAQEMLKCVKVVHDAGIVHSDLKPANFVFVKG---ILKIIDFGIANAVPEHTVN 669
               R   +++L+ V  +H+ GI H D+KP N +  +    ++KI DFG+A      T  
Sbjct: 294 AG--REITRQILEAVAYMHEKGISHRDIKPDNILIEQDDPVLVKITDFGLAKVQGNGT-- 349

Query: 670 IYRETQIGTPNYMAPEALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYG 729
            + +T  GT  Y+APE +   N          R +     D+WS GC++Y ++    P+ 
Sbjct: 350 -FMKTFCGTLAYVAPEVISGKNAA---TENDDRIEYSSLVDMWSIGCLVYVILTAHLPFS 405

Query: 730 GFQGQNRLLAIMNPEVKIVYPEKTSNGDTVPKTAIDTMKACLERNPNKRWTVEEVANGSF 789
           G   Q  L   +N   +  Y E       V + A D +++ ++ +PN R T ++     +
Sbjct: 406 G-STQQELYEQIN---RGSYHEGPLKDYRVSEEARDFIESLIQVDPNNRLTAKDALKHEW 461

Query: 790 VK 791
           +K
Sbjct: 462 IK 463

>Suva_11.65 Chr11 complement(134606..136120) [1515 bp, 504 aa] {ON}
           YKL161C (REAL)
          Length = 504

 Score = 84.7 bits (208), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 71/255 (27%), Positives = 118/255 (46%), Gaps = 48/255 (18%)

Query: 562 EIELLKKLETQPRVVKLIDHEM---DHGVL---YVVMECGDHDLSQTLAHRSGMPLDVEF 615
           E++LL+     P ++ L D ++    +GVL   Y+  E  + DLSQ L  RSG  L+   
Sbjct: 72  ELKLLRHFRGHPNIIWLFDTDIVFYPYGVLNGVYLYEELMECDLSQVL--RSGQRLENAH 129

Query: 616 VRYHAQEMLKCVKVVHDAGIVHSDLKPANFVFVKGI-LKIIDFGIANAVPEHTV--NIYR 672
            +    ++L  +K +H AG++H DLKP N +      LKI +FG++    E+    N + 
Sbjct: 130 YQSFIYQILCALKYIHSAGVLHRDLKPKNLLVNSDCQLKICNFGLSRGYSENYEENNHFL 189

Query: 673 ETQIGTPNYMAPEALVAM-NYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGG- 730
              + T  Y APE +++   YT             K  D+WS GCI+ +++ G+P + G 
Sbjct: 190 TEFVATRWYRAPEIMLSYQGYT-------------KAIDVWSTGCILAELLGGKPIFDGK 236

Query: 731 --FQGQNRLLAIMNP----EVKIVYPEKTSN----GDTVPKT------------AIDTMK 768
                 N +L I+       ++ +  EK  N       +P+T             +D ++
Sbjct: 237 DYVDQLNHILQILGTPSKETLQEISSEKVQNYIFQFGNIPRTPFESLLPRANSEGLDLLQ 296

Query: 769 ACLERNPNKRWTVEE 783
             LE +P +R TV E
Sbjct: 297 KMLEFDPKRRVTVNE 311

>TBLA0A08430 Chr1 complement(2075682..2076773) [1092 bp, 363 aa]
           {ON} Anc_4.184 YGR040W
          Length = 363

 Score = 83.2 bits (204), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 72/325 (22%), Positives = 136/325 (41%), Gaps = 58/325 (17%)

Query: 505 RPVVYVNGTEYEKLELLGRGGTSXXXXXXXXXXXXXXXLKRVS-FDE--FDDSSIDGFKG 561
           R + +     Y+ L+L+G G                  +KR+  F +  F   ++     
Sbjct: 3   RKITFDIPAHYQLLDLVGEGAYGTVCSACHLPTGTTVAIKRIQPFSKPLFVTRTL----R 58

Query: 562 EIELLKKLETQPRVVKLIDHEMDHGV-----LYVVMECGDHDLSQTLAHRSGMPLDVEFV 616
           EI+LLK       ++ ++D    + +     +Y+V E  + DL + + ++    L  + +
Sbjct: 59  EIKLLKYFNDHENIISILDQVKPNSIETFNSVYLVQELMETDLQKIIVNQK---LSYDHI 115

Query: 617 RYHAQEMLKCVKVVHDAGIVHSDLKPANFVFVKGI-LKIIDFGIANAVP-----EHTVNI 670
           +Y   ++L+ +K +H A ++H DLKP+N +      LK+ DFG++  +      + T+  
Sbjct: 116 QYFIYQILRALKSIHSAQVIHRDLKPSNLLLNSNCDLKVCDFGLSRCLASSDNSKDTLVG 175

Query: 671 YRETQIGTPNYMAPEALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGG 730
           +    + T  Y APE ++               K     DIWSCGCI+ +MI G+P + G
Sbjct: 176 FMTEYVATRWYRAPEIMLTFQ------------KYTTAMDIWSCGCILAEMISGKPLFPG 223

Query: 731 FQGQNRLLAIM------------------------NPEVKIVYPEKTSNG-DTVPKTAID 765
               +++  I+                        N   K   P + + G D +    ID
Sbjct: 224 RDYHHQIWLILEVLGTPSNDDFDDITSNRAKEYIENLPFKSKLPYEVALGRDDMDPLLID 283

Query: 766 TMKACLERNPNKRWTVEEVANGSFV 790
            +   L  NP+KR + +E  +  ++
Sbjct: 284 LLDKMLTFNPHKRISAKEALSHPYL 308

>Suva_15.65 Chr15 (102271..105513) [3243 bp, 1080 aa] {ON} YOL100W
           (REAL)
          Length = 1080

 Score = 85.9 bits (211), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 62/238 (26%), Positives = 108/238 (45%), Gaps = 32/238 (13%)

Query: 566 LKKLETQPRVVKLIDHEMDHGVLYVVMECGDHDLSQTLAHRSGMPLDVEFVRYHAQEMLK 625
           L+KL     VV+L     D   LY ++E   +    +L  + G  LD     Y+  +++ 
Sbjct: 235 LQKLNNSHSVVRLFSTFQDESSLYFLLEYAPNGDFLSLMKKYG-SLDENCACYYGSQIID 293

Query: 626 CVKVVHDAGIVHSDLKPANFVFVKGI-LKIIDFGIANAV---------PEHTVNIYRETQ 675
            +  +H +GI+H D+KP N +    + +K+ DFG A  +          ++ ++   ++ 
Sbjct: 294 AIDHLHVSGIIHRDIKPENILLDGEMRIKLTDFGTAKLLEPTNNSSSKSKYDLSTRSKSF 353

Query: 676 IGTPNYMAPEALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQN 735
           +GT  Y++PE L       N +    R       DIW+ GCI++QMI G+PP   F+  N
Sbjct: 354 VGTAEYVSPELL-------NDSFTDYRC------DIWAFGCILFQMIAGKPP---FKATN 397

Query: 736 RLLAIMNPEVKIVYPEKTSNGDTVPKTAIDTMKACLERNPNKRWTVEEVANGSFVKPV 793
             L      +K+ Y          P    D +K  L +N ++R T+ ++    F K +
Sbjct: 398 EYLTFQKV-MKVQYAFTPG----FPLIIRDLVKKILIKNLDQRLTINQIKEHPFFKEI 450

>KNAG0K01240 Chr11 (243154..246096) [2943 bp, 980 aa] {ON} Anc_3.177
           YAR019C
          Length = 980

 Score = 85.5 bits (210), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 71/282 (25%), Positives = 126/282 (44%), Gaps = 29/282 (10%)

Query: 511 NGTEYEKLELLGRGGTSXXXXXXXXXXXXXXXLKRVSFDEFDDSSIDGFKGEIELLKKLE 570
           N T+Y+  +++G+G                  +K +++    D  ++    EI+LLK L 
Sbjct: 27  NSTKYQLNQVIGKGSYGIVYKAVNKSTKQVVAIKEINYTS--DEELNEIMIEIDLLKNLH 84

Query: 571 TQPRVVKLIDHEMDHGVLYVVMECGDH-DLSQTLAHRSGMPLDVEFVRYHAQEMLKCVKV 629
               +VK          LY+++E   H  L   L+ R G  LD    + + ++ L  +  
Sbjct: 85  -HINIVKYHGFIQKMSNLYIILEYAAHGSLKGLLSSRIGHLLDEAETKIYVRQTLDGLAY 143

Query: 630 VHDAGIVHSDLKPANFVF-VKGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALV 688
           +H+ G++H D+K AN +      +K+ DFG++       VN   +T  G+ N+MAPE + 
Sbjct: 144 LHEQGVIHRDIKAANLLLDSTNTVKLADFGVSTK-----VNNTAKTLAGSLNWMAPEIV- 197

Query: 689 AMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIV 748
               T+  A           SDIWS G  I +++ G+PP+      N   A+ N   +  
Sbjct: 198 ----TNKGA--------STLSDIWSLGATIVELMTGKPPFHNLLDINIYYAMENDN-ECY 244

Query: 749 YPEKTSNGDTVPKTAIDTMKACLERNPNKRWTVEEVANGSFV 790
           YP       ++P+ A   +  C ++N  KR T + +   S++
Sbjct: 245 YPPA-----SLPEGAKQFLALCFQKNMFKRPTAKSLLKHSWL 281

>Ecym_6145 Chr6 complement(266766..267863) [1098 bp, 365 aa] {ON}
           similar to Ashbya gossypii ACL191C
          Length = 365

 Score = 83.2 bits (204), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 66/270 (24%), Positives = 121/270 (44%), Gaps = 57/270 (21%)

Query: 562 EIELLKKLETQPRVVKLID-------HEMDHGVLYVVMECGDHDLSQTLAHRSGMPLDVE 614
           E++LLK   +   ++ ++D        E D   +Y+V E  + DL + ++  +    D +
Sbjct: 59  ELKLLKFFHSHENIISVLDIVRPTSYQEFD--AVYLVQELMETDLQRIISQTNNFLSD-D 115

Query: 615 FVRYHAQEMLKCVKVVHDAGIVHSDLKPANFVFVKGI-LKIIDFGIANAVP------EHT 667
            ++Y   ++L+ +K +H A ++H DLKP+N +      LK+ DFG++  +       E+ 
Sbjct: 116 HIQYFTYQILRALKSLHSAQVIHRDLKPSNLLLNSSCDLKLCDFGLSRCLASSDRSRENM 175

Query: 668 VNIYRETQIGTPNYMAPEALVAMN-YTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRP 726
           V    E  + T  Y APE +++   YT                DIWSCGCI+ +MI G+P
Sbjct: 176 VGFMTE-YVATRWYRAPEIMLSFQEYT-------------TAMDIWSCGCILAEMISGKP 221

Query: 727 PYGGFQGQNRLLA------------------------IMNPEVKIVYPEKTSNG-DTVPK 761
            + G    ++L                          I+N  +++  P   + G + +  
Sbjct: 222 LFPGRDYHHQLWVILEILGTPSYEDFAQIKSKRAKAYILNLPMRLKIPWNVALGTNDINP 281

Query: 762 TAIDTMKACLERNPNKRWTVEEVANGSFVK 791
            A+D +   L  NP+KR + EE     +++
Sbjct: 282 LAMDLLDKMLTFNPDKRISAEEALKHPYLE 311

>TDEL0D02650 Chr4 complement(505536..506636) [1101 bp, 366 aa] {ON}
           Anc_4.184 YGR040W
          Length = 366

 Score = 83.2 bits (204), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 61/252 (24%), Positives = 115/252 (45%), Gaps = 32/252 (12%)

Query: 505 RPVVYVNGTEYEKLELLGRGGTSXXXXXXXXXXXXXXXLKRVSFDEFDDSS-IDGFKGEI 563
           R + +   ++Y+ L L+G G                  +K++    F  +  +     EI
Sbjct: 3   RTITFDIPSQYQLLALVGEGAYGTVCSAIHKPTGIHVAIKKIQ--PFSKTMFVTRTLREI 60

Query: 564 ELLKKLETQPRVVKLIDH----EMD-HGVLYVVMECGDHDLSQTLAHRSGMPLDVEFVRY 618
           +LL+       ++ ++D      +D    +Y+V E  + DL + +   +  PL  + ++Y
Sbjct: 61  KLLRYFHDHENIISILDMIRPTTIDKMNAVYLVQELMETDLQRIINSHAANPLSDDHIQY 120

Query: 619 HAQEMLKCVKVVHDAGIVHSDLKPANFVFVKGI-LKIIDFGIANAVPEHTVNIYRETQIG 677
              ++L+ +K +H A ++H DLKP+N +      LK+ DFG++  +   + +  RET +G
Sbjct: 121 FTYQILRALKSIHSAQVIHRDLKPSNLLLNSNCDLKVCDFGLSRCLASSSDS--RETLVG 178

Query: 678 -------TPNYMAPEALVAM-NYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYG 729
                  T  Y APE ++    YT                DIWSCGCI+ +++ G+P + 
Sbjct: 179 FMTEYVATRWYRAPEIMLTFREYT-------------TAMDIWSCGCILAELVSGKPLFP 225

Query: 730 GFQGQNRLLAIM 741
           G    ++L  I+
Sbjct: 226 GRDYHHQLWLIL 237

>SAKL0C08844g Chr3 (811712..813307) [1596 bp, 531 aa] {ON} similar
           to uniprot|P38070 Saccharomyces cerevisiae YBR028C
           Hypothetical ORF
          Length = 531

 Score = 84.7 bits (208), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 72/237 (30%), Positives = 110/237 (46%), Gaps = 44/237 (18%)

Query: 565 LLKKLETQPRVVKLIDHEMDHGVLYVVME-CGDHDLSQTLAHRSGMPLDVEFVRYHAQEM 623
           +L +LE  P +VKL     D   LY+V++     +L   L  +    LD + V ++A E+
Sbjct: 204 ILSQLE-HPNIVKLFYSFHDSHRLYLVLQYIPGGELFYHLKEQG--TLDEQTVSFYAAEI 260

Query: 624 LKCVKVVHDAGIVHSDLKPANFVF-VKGILKIIDFGIA-----------------NAVPE 665
              +K +HD GIV+ DLKP N +   KG L + DFG++                 N   E
Sbjct: 261 SCALKFLHDRGIVYRDLKPENCLLNDKGHLVLTDFGLSKKSVGEAGSPAATATETNHDGE 320

Query: 666 HTVNIYRETQIGTPNYMAPEALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGR 725
               +Y  + IGTP Y APE L  + YT             +  D +S GC++Y M+ G+
Sbjct: 321 PVTALY--SIIGTPEYCAPEILQGVPYT-------------QICDWYSLGCLVYDMLIGK 365

Query: 726 PPYGGFQGQNRLLAIMNPEVKIVYPEKTSNGDTVPKTAIDTMKACLERNPNKRWTVE 782
           PPY G   +  L  I+  +   + P   S+G        D + A L+++  KRW V+
Sbjct: 366 PPYTGANHKVILHKIVKDKTPKI-PMYLSDG------MKDFLGALLKKDVGKRWDVD 415

>Skud_1.44 Chr1 (95573..99643) [4071 bp, 1356 aa] {ON} YAL017W (REAL)
          Length = 1356

 Score = 85.5 bits (210), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 63/246 (25%), Positives = 114/246 (46%), Gaps = 39/246 (15%)

Query: 553  DSSIDGFKGEIELLKKLETQPR--VVKLIDHEMDHGVLYVVM----ECGDHDLSQTLAHR 606
            D  +     EI+++  L  +P   +++L+D   D    Y+      E G  DL   +  +
Sbjct: 1140 DRKLGTIPSEIQIMATLNKKPHENILRLLDFFEDDDYYYIETPVHGETGCIDLFDLIEFK 1199

Query: 607  SGMPLDVEF-VRYHAQEMLKCVKVVHDAGIVHSDLKPANFVF-VKGILKIIDFGIANAVP 664
            + M    EF  +   ++++  +K +HD GIVH D+K  N +   KG +KIIDFG A  V 
Sbjct: 1200 TNM---TEFEAKLIFKQVVAGIKHLHDQGIVHRDIKDENVIVDSKGFVKIIDFGSAAYVK 1256

Query: 665  EHTVNIYRETQIGTPNYMAPEALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYG 724
                +++    +GT +Y APE L    Y             G+P DIW+ G ++Y +++ 
Sbjct: 1257 SGPFDVF----VGTIDYAAPEVLGGNPYE------------GQPQDIWAIGILLYTVVFK 1300

Query: 725  RPPYGGFQGQNRLLAIMNPEVKIVYPEKTSNGDTVPKTAIDTMKACLERNPNKRWTVEEV 784
              P+           I+  ++K       +N + V +  I+ +K+ L R    R T++++
Sbjct: 1301 ENPFYNID------EILEGDLKF------NNAEEVSEDCIELIKSILNRRVPNRPTIDDI 1348

Query: 785  ANGSFV 790
             N  ++
Sbjct: 1349 NNDKWL 1354

>Skud_4.751 Chr4 (1332135..1334039) [1905 bp, 634 aa] {ON} YDR477W
           (REAL)
          Length = 634

 Score = 84.7 bits (208), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 70/283 (24%), Positives = 120/283 (42%), Gaps = 36/283 (12%)

Query: 515 YEKLELLGRGGTSXXXXXXXXXXXXXXXLKRVSFDEFDDSSIDG-FKGEIELLKKLETQP 573
           Y+ ++ LG G                  LK ++      S + G  + EI  L+ L   P
Sbjct: 56  YQIVKTLGEGSFGKVKLAYHTTTGQKVALKIINKKVLAKSDMQGRIEREISYLRLLR-HP 114

Query: 574 RVVKLIDHEMDHGVLYVVMECGDHDLSQTLAHRSGMPLDVEFVRYHAQEMLKCVKVVHDA 633
            ++KL D       + +V+E   ++L   +  R  M    +  R   Q+++  V+  H  
Sbjct: 115 HIIKLYDVIKSKDEIIMVIEYAGNELFDYIVQRDKM--SEQEARRFFQQIISAVEYCHRH 172

Query: 634 GIVHSDLKPANFVFVKGI-LKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNY 692
            IVH DLKP N +  + + +KI DFG++N + +     + +T  G+PNY APE +    Y
Sbjct: 173 KIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGN---FLKTSCGSPNYAAPEVISGKLY 229

Query: 693 THNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEK 752
                        G   D+WSCG I+Y M+  R P+             +  + +++   
Sbjct: 230 A------------GPEVDVWSCGVILYVMLCRRLPFD------------DESIPVLFKNI 265

Query: 753 TSNGDTVPK----TAIDTMKACLERNPNKRWTVEEVANGSFVK 791
           ++   T+PK     A   +K  L  NP  R ++ E+    + K
Sbjct: 266 SNGVYTLPKFLSPGAAGLIKRMLIVNPLNRISIHEIMQDDWFK 308

>SAKL0C07722g Chr3 (717419..720157) [2739 bp, 912 aa] {ON} similar
           to uniprot|P27636 Saccharomyces cerevisiae YAR019C CDC15
           Protein kinase of the Mitotic Exit Network that is
           localized to the spindle pole bodies at late anaphase
           promotes mitotic exit by directly switching on the
           kinase activity of Dbf2p
          Length = 912

 Score = 85.1 bits (209), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 66/282 (23%), Positives = 122/282 (43%), Gaps = 34/282 (12%)

Query: 511 NGTEYEKLELLGRGGTSXXXXXXXXXXXXXXXLKRVSFDEFDDSSIDGFKGEIELLKKLE 570
           N T Y   +++G+G                  +K + +D  ++  ++    EI+LLK L 
Sbjct: 36  NKTHYALKQVIGKGAYGIVYKAVNRQTRKEVAIKVIEYD--NEEELNDHMLEIDLLKNLR 93

Query: 571 TQPRVVKLIDHEMDHGVLYVVME-CGDHDLSQTLAHRSGMPLDVEFVRYHAQEMLKCVKV 629
             P +VK          L +++E C    L          P+D +  R + Q+ L+ ++ 
Sbjct: 94  -HPNIVKYHGFIQKRHQLCILLEYCSRGSLRDVFKQH---PIDEQQARVYVQQTLQGLQY 149

Query: 630 VHDAGIVHSDLKPANFVF-VKGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALV 688
           +H  G++H D+K AN +   +  +K+ DFG++       VN    T  G+PN+M+PE ++
Sbjct: 150 LHSQGVIHRDIKAANLLLDAQNTVKLADFGVST-----RVNSLAMTYAGSPNWMSPEVML 204

Query: 689 AMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIV 748
               T               SD+WS G  + +++ G PP+     +    AI+N    + 
Sbjct: 205 GKGAT-------------TVSDVWSLGATVVEILTGNPPFHNLVNEAACYAIVN---DVY 248

Query: 749 YPEKTSNGDTVPKTAIDTMKACLERNPNKRWTVEEVANGSFV 790
           YP        + +   D +  C ++N  KR +  E+   ++V
Sbjct: 249 YPPA-----WLSRPCCDFIHRCFQKNMFKRPSATELLKHAWV 285

>ACR142W Chr3 (597519..600032) [2514 bp, 837 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL153C (RAD53)
          Length = 837

 Score = 85.1 bits (209), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 69/245 (28%), Positives = 111/245 (45%), Gaps = 17/245 (6%)

Query: 554 SSIDGFKGEIELLKKLETQPRVVKLIDHEMDHGVLYVVME-CGDHDLSQTLAHRSGMPLD 612
            ++DG   E+E+L++L   PR+V L     D    Y++ME     DL   +A    +  D
Sbjct: 255 GNVDGVTRELEVLRRL-NHPRIVSLKGFYEDDESYYLLMEFVSGGDLMDFVAAHGSVGED 313

Query: 613 VEFVRYHAQEMLKCVKVVHDAGIVHSDLKPANFVFVKG---ILKIIDFGIANAVPEHTVN 669
               R   +++L+ V+ +H+ GI H DLKP N +  +    ++KI DFG+A      T  
Sbjct: 314 AG--REITRQILEAVRYIHEQGISHRDLKPDNILIEQDDPVLVKITDFGLAKIQDNTT-- 369

Query: 670 IYRETQIGTPNYMAPEALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYG 729
            + +T  GT  Y+APE +   N   N A       +    D+WS GC++Y ++ G  P+ 
Sbjct: 370 -FMKTFCGTLAYVAPEVIGGKNPEGNGANGNLYSSL---VDMWSIGCLVYVILTGHLPFS 425

Query: 730 GFQGQNRLLAIMNPEVKIVYPEKTSNGDTVPKTAIDTMKACLERNPNKRWTVEEVANGSF 789
           G   +     I N      Y E       +   A D + + L+ NP  R T E      +
Sbjct: 426 GSTQEQLYKQIANGS----YHEGPLKDYWISDEARDFIDSLLQINPVDRLTAERALQHPW 481

Query: 790 VKPVS 794
           + P +
Sbjct: 482 LHPCT 486

>ZYRO0A12826g Chr1 (1014651..1015751) [1101 bp, 366 aa] {ON} highly
           similar to uniprot|P14681 Saccharomyces cerevisiae
           YGR040W KSS1 Mitogen-activated protein kinase (MAPK)
           involved in signal transduction pathways that control
           filamentous growth and pheromone response
          Length = 366

 Score = 82.8 bits (203), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 54/194 (27%), Positives = 97/194 (50%), Gaps = 29/194 (14%)

Query: 562 EIELLKKLETQPRVVKLIDH----EMD-HGVLYVVMECGDHDLSQTLAHRSGMPLDVEFV 616
           EI+LL        ++ ++D      +D    +Y+V E  + DL + +++ S  PL  + +
Sbjct: 59  EIKLLSYFHDHENIISILDKVRPTSIDKMNAVYLVQELMETDLQRIISNISTNPLSDDHI 118

Query: 617 RYHAQEMLKCVKVVHDAGIVHSDLKPANFVFVKGI-LKIIDFGIANAVPEHTVNIYRETQ 675
           +Y   ++L+ +K +H A ++H DLKP+N +      LK+ DFG++  +   + +  RET 
Sbjct: 119 QYFTYQILRALKSIHSAQVIHRDLKPSNLLLNSNCDLKVCDFGLSRCLASSSDS--RETL 176

Query: 676 IG-------TPNYMAPEALVAMN-YTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPP 727
           +G       T  Y APE ++    YT                DIWSCGCI+ +++ G+P 
Sbjct: 177 VGFMTEYVATRWYRAPEIMLTFQEYT-------------TAMDIWSCGCILAELVSGKPL 223

Query: 728 YGGFQGQNRLLAIM 741
           + G    ++L  I+
Sbjct: 224 FPGRDYHHQLWLIL 237

>NCAS0A00280 Chr1 (40406..42013) [1608 bp, 535 aa] {ON} Anc_1.24
          Length = 535

 Score = 84.3 bits (207), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 72/286 (25%), Positives = 131/286 (45%), Gaps = 33/286 (11%)

Query: 519 ELLGRGGTSXXXXXXXXXXXXXXXLKRVSFDEFDDSSIDGFKGEIELLKKLETQPRVVKL 578
           E +GRG                  +K V  +  ++  ++    EI  L +L++ P ++  
Sbjct: 26  ECVGRGNFGDVYRAIDRTTNKVVAIKVVDLENTNER-LEVLAQEIFFLAELKS-PYIINY 83

Query: 579 IDHEMDHGVLYVVME-CGDHDLSQTLAHRSGMPLDVEFVRYHAQEMLKCVKVVHDAGIVH 637
           I   ++   +++VME CG    S  L +     L  + V Y  +E+LK ++ +H+   +H
Sbjct: 84  ITTLLEDASMWIVMEYCGGGSCSDLLKYYFNNGLPEKKVAYITREILKGLQYLHEQKKIH 143

Query: 638 SDLKPANFVFV-KGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNYTHNQ 696
            D+K AN +   +G +K+ DFG++  +      + R T +GTP +MAPE         +Q
Sbjct: 144 RDIKAANILLTEEGHVKLGDFGVSGQLKS---TLRRGTIVGTPYWMAPEV-------ASQ 193

Query: 697 APEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMN----PEVKIVYPEK 752
             E    K+    DIWS G  +++++ G PP        R+LA ++    P ++  Y + 
Sbjct: 194 NIEGYDEKI----DIWSLGITVFELLKGVPPLVKLD-PIRVLANLSRKSAPRLQGAYSD- 247

Query: 753 TSNGDTVPKTAIDTMKACLERNPNKRWTVEEVANGSFVKPVSVTHF 798
                     A   +  CL +NPN+R    ++    FV+ ++VT+ 
Sbjct: 248 ---------AAKSFVALCLIKNPNERPAAVDLLKFPFVRFITVTNL 284

>TBLA0D05640 Chr4 (1380616..1383066) [2451 bp, 816 aa] {ON}
           Anc_1.225 YJL128C
          Length = 816

 Score = 85.1 bits (209), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 78/283 (27%), Positives = 123/283 (43%), Gaps = 36/283 (12%)

Query: 514 EYEKLELLGRGGTSXXXXXXXXXXXXXXXLKRVSFDEFDDSSIDGFKGEIELLKKLETQP 573
           E E L  LG G                  +K V   E D++       E+E+L K ++ P
Sbjct: 506 ELEFLSDLGHGNYGNVSKVLHKPTQVIMAMKEVRL-ELDEAKFRQILMELEVLHKCQS-P 563

Query: 574 RVVKLIDHEMDHGVLYVVMECGD-------HDLSQTLAHRSGMPLDVEFVRYHAQEMLKC 626
            +V         G +Y+ ME  D       +D++  +       L   F+       L+ 
Sbjct: 564 YIVDFYGAFFIEGAVYMCMEYMDGSSLDKIYDITPEIGGIDEPQL--AFISNAVIRGLRE 621

Query: 627 VKVVHDAGIVHSDLKPANFVF--VKGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAP 684
           +K VH+  I+H D+KP N +    +G +K+ DFG++  +    V    +T IG  +YMAP
Sbjct: 622 LKDVHN--IIHRDVKPTNILCSATQGTVKLCDFGVSGNL----VASMAKTNIGCQSYMAP 675

Query: 685 EALVAMNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQN---RLLAIM 741
           E + ++N      P+ + + V   SD+WS G  I +M  GR PY      N   +L AI+
Sbjct: 676 ERIKSLN------PDMTTYSV--QSDVWSLGLSILEMALGRYPYPPETFDNIFSQLSAIV 727

Query: 742 NPEVKIVYPEKTSNGDTVPKTAIDTMKACLERNPNKRWTVEEV 784
           +       P  T   D   K A D +  CL +NP +R T  ++
Sbjct: 728 DG------PPPTLPLDRFSKDAYDFVAVCLRKNPERRPTYSQL 764

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.313    0.129    0.371 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 93,542,028
Number of extensions: 4335086
Number of successful extensions: 19861
Number of sequences better than 10.0: 2495
Number of HSP's gapped: 18086
Number of HSP's successfully gapped: 2724
Length of query: 838
Length of database: 53,481,399
Length adjustment: 118
Effective length of query: 720
Effective length of database: 39,950,811
Effective search space: 28764583920
Effective search space used: 28764583920
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 70 (31.6 bits)