Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_33.133891.81ON69469435420.0
KLTH0F02354g1.81ON73357118460.0
SAKL0C02596g1.81ON73452315400.0
Ecym_10851.81ON70552313431e-176
AFR670W1.81ON71752612801e-167
Smik_14.651.81ON79053112791e-166
NCAS0A005801.81ON68961512511e-163
KLLA0C02299g1.81ON65857712471e-163
TDEL0C062001.81ON70051512511e-162
Skud_14.681.81ON75253712531e-162
NDAI0F042301.81ON70153312381e-160
Suva_14.701.81ON75153012341e-159
CAGL0J08228g1.81ON75252112231e-158
YNL272C (SEC2)1.81ON75953712201e-157
ZYRO0F16698g1.81ON77955012191e-157
Kpol_2000.671.81ON82451811991e-153
KAFR0D039601.81ON66452711661e-150
TPHA0B045001.81ON73352411481e-147
TBLA0A054301.81ON79555510881e-137
KNAG0F004601.81ON65453010681e-136
Suva_6.1047.186ON1170175860.10
Ecym_24785.123ON961126810.47
Skud_15.3838.636ON485130780.75
ACL132C5.123ON954132781.1
Smik_15.4028.636ON515158761.6
KLTH0F14498g3.479ON70299761.6
AGR089C8.259ON1370184761.7
Suva_8.2698.636ON485152733.3
KLLA0D06875g8.636ON462139733.3
TDEL0B022605.696ON66290733.5
TPHA0E015005.470ON457124715.6
NDAI0J021804.237ON1108114725.9
YOR216C (RUD3)8.636ON484130716.4
TDEL0A067006.257ON1897123716.5
Suva_16.536.289ON491205716.7
TDEL0D016201.295ON122346717.2
KAFR0E007108.581ON46968708.0
TBLA0A025705.470ON4931246910.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_33.13389
         (694 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_33.13389 s33 complement(197441..199525) [2085 bp, 694 aa] {...  1368   0.0  
KLTH0F02354g Chr6 complement(193705..195906) [2202 bp, 733 aa] {...   715   0.0  
SAKL0C02596g Chr3 complement(238404..240608) [2205 bp, 734 aa] {...   597   0.0  
Ecym_1085 Chr1 complement(170657..172774) [2118 bp, 705 aa] {ON}...   521   e-176
AFR670W Chr6 (1668415..1670568) [2154 bp, 717 aa] {ON} Syntenic ...   497   e-167
Smik_14.65 Chr14 complement(105762..108134) [2373 bp, 790 aa] {O...   497   e-166
NCAS0A00580 Chr1 complement(99945..102014) [2070 bp, 689 aa] {ON...   486   e-163
KLLA0C02299g Chr3 complement(194267..196243) [1977 bp, 658 aa] {...   484   e-163
TDEL0C06200 Chr3 (1128241..1130343) [2103 bp, 700 aa] {ON} Anc_1...   486   e-162
Skud_14.68 Chr14 complement(115311..117569) [2259 bp, 752 aa] {O...   487   e-162
NDAI0F04230 Chr6 (1031871..1033976) [2106 bp, 701 aa] {ON} Anc_1...   481   e-160
Suva_14.70 Chr14 complement(121375..123630) [2256 bp, 751 aa] {O...   479   e-159
CAGL0J08228g Chr10 (815653..817911) [2259 bp, 752 aa] {ON} simil...   475   e-158
YNL272C Chr14 complement(126805..129084) [2280 bp, 759 aa] {ON} ...   474   e-157
ZYRO0F16698g Chr6 (1382642..1384981) [2340 bp, 779 aa] {ON} weak...   474   e-157
Kpol_2000.67 s2000 (144161..146635) [2475 bp, 824 aa] {ON} (1441...   466   e-153
KAFR0D03960 Chr4 (776847..778841) [1995 bp, 664 aa] {ON} Anc_1.8...   453   e-150
TPHA0B04500 Chr2 (1059147..1061348) [2202 bp, 733 aa] {ON} Anc_1...   446   e-147
TBLA0A05430 Chr1 complement(1334141..1336528) [2388 bp, 795 aa] ...   423   e-137
KNAG0F00460 Chr6 complement(64086..66050) [1965 bp, 654 aa] {ON}...   416   e-136
Suva_6.104 Chr6 complement(183396..186908) [3513 bp, 1170 aa] {O...    38   0.10 
Ecym_2478 Chr2 (933106..935991) [2886 bp, 961 aa] {ON} similar t...    36   0.47 
Skud_15.383 Chr15 complement(686554..688011) [1458 bp, 485 aa] {...    35   0.75 
ACL132C Chr3 complement(120950..123814) [2865 bp, 954 aa] {ON} S...    35   1.1  
Smik_15.402 Chr15 complement(697238..698785) [1548 bp, 515 aa] {...    34   1.6  
KLTH0F14498g Chr6 complement(1188459..1190567) [2109 bp, 702 aa]...    34   1.6  
AGR089C Chr7 complement(901437..905549) [4113 bp, 1370 aa] {ON} ...    34   1.7  
Suva_8.269 Chr8 complement(486474..487931) [1458 bp, 485 aa] {ON...    33   3.3  
KLLA0D06875g Chr4 complement(591141..592529) [1389 bp, 462 aa] {...    33   3.3  
TDEL0B02260 Chr2 (408913..410901) [1989 bp, 662 aa] {ON} Anc_5.6...    33   3.5  
TPHA0E01500 Chr5 complement(304130..305503) [1374 bp, 457 aa] {O...    32   5.6  
NDAI0J02180 Chr10 (529566..532892) [3327 bp, 1108 aa] {ON} Anc_4...    32   5.9  
YOR216C Chr15 complement(747525..748979) [1455 bp, 484 aa] {ON} ...    32   6.4  
TDEL0A06700 Chr1 complement(1169248..1174941) [5694 bp, 1897 aa]...    32   6.5  
Suva_16.53 Chr16 complement(80323..81798) [1476 bp, 491 aa] {ON}...    32   6.7  
TDEL0D01620 Chr4 complement(321963..325634) [3672 bp, 1223 aa] {...    32   7.2  
KAFR0E00710 Chr5 (151558..152967) [1410 bp, 469 aa] {ON} Anc_8.5...    32   8.0  
TBLA0A02570 Chr1 complement(622892..624373) [1482 bp, 493 aa] {O...    31   10.0 

>Kwal_33.13389 s33 complement(197441..199525) [2085 bp, 694 aa] {ON}
           YNL272C (SEC2) - GDP/GTP exchange factor for Sec4p
           [contig 118] FULL
          Length = 694

 Score = 1368 bits (3542), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 670/694 (96%), Positives = 670/694 (96%)

Query: 1   MTEEEESKRXXXXXXXXXXXXIESIDKQSHLEEQLLQARKVISSQRDALKSYESVGKRLE 60
           MTEEEESKR            IESIDKQSHLEEQLLQARKVISSQRDALKSYESVGKRLE
Sbjct: 1   MTEEEESKRVSVQVSSLSTQLIESIDKQSHLEEQLLQARKVISSQRDALKSYESVGKRLE 60

Query: 61  ETEAELESVRAQNAKDKEALKAAQSETEAAKDEVSRLNKEVEELTASLFDEANNMVADAR 120
           ETEAELESVRAQNAKDKEALKAAQSETEAAKDEVSRLNKEVEELTASLFDEANNMVADAR
Sbjct: 61  ETEAELESVRAQNAKDKEALKAAQSETEAAKDEVSRLNKEVEELTASLFDEANNMVADAR 120

Query: 121 KETHSIQVKNIKLTEQLQEKSSLLETLEIQLKNLKKVLYDLEEESNSRLQSNRSPVMDTS 180
           KETHSIQVKNIKLTEQLQEKSSLLETLEIQLKNLKKVLYDLEEESNSRLQSNRSPVMDTS
Sbjct: 121 KETHSIQVKNIKLTEQLQEKSSLLETLEIQLKNLKKVLYDLEEESNSRLQSNRSPVMDTS 180

Query: 181 DNSTVSSAIALENTMHALNGTARSPNNVLFSPVLKSLRYDLNLYNEFLKFIAALPTSASI 240
           DNSTVSSAIALENTMHALNGTARSPNNVLFSPVLKSLRYDLNLYNEFLKFIAALPTSASI
Sbjct: 181 DNSTVSSAIALENTMHALNGTARSPNNVLFSPVLKSLRYDLNLYNEFLKFIAALPTSASI 240

Query: 241 KDTASESKLLRRLVHDEIQPLLRLDNASGLGWYFKRSLMTLMMDGLVVVEPVSGINETYR 300
           KDTASESKLLRRLVHDEIQPLLRLDNASGLGWYFKRSLMTLMMDGLVVVEPVSGINETYR
Sbjct: 241 KDTASESKLLRRLVHDEIQPLLRLDNASGLGWYFKRSLMTLMMDGLVVVEPVSGINETYR 300

Query: 301 VSHASGVENTKLQRPRSEQRIEGHLYNYPADSPPVAIQDPCSFCSESRNDILEHGRLYVL 360
           VSHASGVENTKLQRPRSEQRIEGHLYNYPADSPPVAIQDPCSFCSESRNDILEHGRLYVL
Sbjct: 301 VSHASGVENTKLQRPRSEQRIEGHLYNYPADSPPVAIQDPCSFCSESRNDILEHGRLYVL 360

Query: 361 RTLQKTEEGTTEVNSQFPLCHYCLLKVRQTCEIFAFLRSLKSGAWHLESVTVDANSQRSS 420
           RTLQKTEEGTTEVNSQFPLCHYCLLKVRQTCEIFAFLRSLKSGAWHLESVTVDANSQRSS
Sbjct: 361 RTLQKTEEGTTEVNSQFPLCHYCLLKVRQTCEIFAFLRSLKSGAWHLESVTVDANSQRSS 420

Query: 421 TEFKSQSKLSTPERGSERKVKSDRKSKRLSIMAGLTKSFPSKTSYAIEETPGSNSQVTTP 480
           TEFKSQSKLSTPERGSERKVKSDRKSKRLSIMAGLTKSFPSKTSYAIEETPGSNSQVTTP
Sbjct: 421 TEFKSQSKLSTPERGSERKVKSDRKSKRLSIMAGLTKSFPSKTSYAIEETPGSNSQVTTP 480

Query: 481 TTNIQIAWAQLCKLRSTLHWTHIGIWSIGDSVETKLGPMTFPDXXXXXXXXXXXXLTHLQ 540
           TTNIQIAWAQLCKLRSTLHWTHIGIWSIGDSVETKLGPMTFPD            LTHLQ
Sbjct: 481 TTNIQIAWAQLCKLRSTLHWTHIGIWSIGDSVETKLGPMTFPDSAEAVASSSNEVLTHLQ 540

Query: 541 SLASSNNDEFDFEKTTNSSELVDPDVHEEKIMSKSEVSTPTLSPTVIAAPNESETHSADQ 600
           SLASSNNDEFDFEKTTNSSELVDPDVHEEKIMSKSEVSTPTLSPTVIAAPNESETHSADQ
Sbjct: 541 SLASSNNDEFDFEKTTNSSELVDPDVHEEKIMSKSEVSTPTLSPTVIAAPNESETHSADQ 600

Query: 601 KSKVEQENGDAVVLLRQEEPEILNHVTLGSSSEEDQKPDTGHQQSEEKSEEQIAALDNHA 660
           KSKVEQENGDAVVLLRQEEPEILNHVTLGSSSEEDQKPDTGHQQSEEKSEEQIAALDNHA
Sbjct: 601 KSKVEQENGDAVVLLRQEEPEILNHVTLGSSSEEDQKPDTGHQQSEEKSEEQIAALDNHA 660

Query: 661 NSSHSEIENDAPKSQNITDDETVFDDARSGLSQA 694
           NSSHSEIENDAPKSQNITDDETVFDDARSGLSQA
Sbjct: 661 NSSHSEIENDAPKSQNITDDETVFDDARSGLSQA 694

>KLTH0F02354g Chr6 complement(193705..195906) [2202 bp, 733 aa] {ON}
           similar to uniprot|P17065 Saccharomyces cerevisiae
           YNL272C SEC2 Guanyl-nucleotide exchange factor for the
           small G-protein Sec4p located on cytoplasmic vesicles
           essential for post-Golgi vesicle transport
          Length = 733

 Score =  715 bits (1846), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 364/571 (63%), Positives = 429/571 (75%), Gaps = 13/571 (2%)

Query: 1   MTEEEESKRXXXXXXXXXXXXIESIDKQSHLEEQLLQARKVISSQRDALKSYESVGKRLE 60
           MTEEEESKR            IESIDKQSHLEEQLLQARKVI+SQR++L++YE + ++LE
Sbjct: 1   MTEEEESKRVSVQVSSLSTQLIESIDKQSHLEEQLLQARKVIASQRESLQNYEDLRQQLE 60

Query: 61  ETEAELESVRAQNAKDKEALKAAQSETEAAKDEVSRLNKEVEELTASLFDEANNMVADAR 120
           + E+ L+S R+QN K +E L+AA+S    A+ E+ RLNKEVE+LTASLFDEANNMVADAR
Sbjct: 61  QAESNLKSERSQNIKIQEELQAARSGKLTAEGEIDRLNKEVEDLTASLFDEANNMVADAR 120

Query: 121 KETHSIQVKNIKLTEQLQEKSSLLETLEIQLKNLKKVLYDLEEESNSRLQSNRSPVMDTS 180
           +ETHS+QVKN KL EQLQEK +LLETLEIQLKNLKKVLY+LEEESN RL+SN++ V    
Sbjct: 121 RETHSVQVKNSKLAEQLQEKETLLETLEIQLKNLKKVLYNLEEESNDRLKSNQASVA-AE 179

Query: 181 DNSTVSSAIALENTMHALNGTARSPNNVLFSPVLKSLRYDLNLYNEFLKFIAALPTSASI 240
           D+   SS  ALE TM+ALNGTA  P+  LFSP+LKSLRYDL LYNEFLKFIAALP  ASI
Sbjct: 180 DSVASSSESALEKTMNALNGTASPPSPALFSPLLKSLRYDLVLYNEFLKFIAALPQCASI 239

Query: 241 KDTASESKLLRRLVHDEIQPLLRLDNASGLGWYFKRSLMTLMMDGLVVVEPVSGINETYR 300
           +D+ S SKLLRRL+HDEIQP+LRLDNASG+GWY +R+LM+LM+DG +VVEPVSGINETYR
Sbjct: 240 RDSTSYSKLLRRLIHDEIQPVLRLDNASGIGWYLRRNLMSLMIDGSIVVEPVSGINETYR 299

Query: 301 VSHASGVENTKLQRPRSEQRIEGHLYNYPADSPPVAIQDPCSFCSESRNDILEHGRLYVL 360
           V H S       Q    EQ+   HLYNYPADSPPVAI+ PCSFCSESRNDILEHGRLYVL
Sbjct: 300 VGHMSSQVEAVPQFQGPEQQSRPHLYNYPADSPPVAIESPCSFCSESRNDILEHGRLYVL 359

Query: 361 RTLQKTEEGTTEVNSQFPLCHYCLLKVRQTCEIFAFLRSLKSGAWHLESVTVDANSQRSS 420
           +TLQK E G TE +SQFPLCHYCLLKVRQTCEIFAFLRSLKSGAWHLE+VT+   +   S
Sbjct: 360 KTLQKMENGITETSSQFPLCHYCLLKVRQTCEIFAFLRSLKSGAWHLEAVTISKTNNAFS 419

Query: 421 TEFKSQSKLSTPERGSERKVKSDRKSKRLSIMAGLTKSFPSKTSYAIEETPGSNSQVTTP 480
            +  S S   T E   + K+K DRKSKR+S MAGL+K+ P KTSY +E       Q+TTP
Sbjct: 420 VQTNSVSNSPTLESPPD-KMKPDRKSKRMSFMAGLSKTLPLKTSYTVESASPCPEQITTP 478

Query: 481 TTNIQIAWAQLCKLRSTLHWTHIGIWSIGDSVETKLGPMTFPDXXXXXXXXXXXXLTHL- 539
           TTNIQ AWAQLCKLRS+LHW HIGIW++ D VETK+GP+   D            +  L 
Sbjct: 479 TTNIQRAWAQLCKLRSSLHWAHIGIWTLEDVVETKVGPVVAVDRPGNDSIVGDGLVPELG 538

Query: 540 ----QSLASSNNDE------FDFEKTTNSSE 560
               +S +  N +E      FDFEK  ++ E
Sbjct: 539 QEARESFSLHNEEEVDNEEGFDFEKMNSTLE 569

>SAKL0C02596g Chr3 complement(238404..240608) [2205 bp, 734 aa] {ON}
           similar to uniprot|P17065 Saccharomyces cerevisiae
           YNL272C SEC2 Guanyl-nucleotide exchange factor for the
           small G-protein Sec4p located on cytoplasmic vesicles
           essential for post-Golgi vesicle transport
          Length = 734

 Score =  597 bits (1540), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/523 (57%), Positives = 382/523 (73%), Gaps = 13/523 (2%)

Query: 1   MTEEEESKRXXXXXXXXXXXXIESIDKQSHLEEQLLQARKVISSQRDALKSYESVGKRLE 60
           M+++EESKR            IES+DKQS LEEQL +A+K I+SQ ++  SYES+ ++LE
Sbjct: 1   MSDQEESKRVSMQLSSLSTQLIESVDKQSRLEEQLRKAKKTIASQSESAASYESLREQLE 60

Query: 61  ETEAELESVRAQNAKDKEALKAAQSETEAAKDEVSRLNKEVEELTASLFDEANNMVADAR 120
           + + EL S   ++A+ +  L A  +  + A+D++ +LNKEVE+LTASLFDEANNMVADAR
Sbjct: 61  KAQQELASRSRESAELERKLAAETTARKMAQDKIDQLNKEVEDLTASLFDEANNMVADAR 120

Query: 121 KETHSIQVKNIKLTEQLQEKSSLLETLEIQLKNLKKVLYDLEEESNSRLQSNRSPVMDTS 180
           +E H ++V+N KL EQL EK +LLETLE+QLKNLKKVLY LE+E++S  ++ R+    +S
Sbjct: 121 REKHDVEVRNSKLHEQLHEKDALLETLEMQLKNLKKVLYSLEDENSSLAKTKRNSAFLSS 180

Query: 181 DNSTVSSAIALENTMHALNGTA----RSPNNVLFSPVLKSLRYDLNLYNEFLKFIAALPT 236
           D +T SS ++LE T  A  GT+         VLFSPVL+SLRYDL LYNEFLKF+A LP 
Sbjct: 181 DTAT-SSNVSLEKT--ATGGTSLGELSGAGGVLFSPVLQSLRYDLGLYNEFLKFVAMLPI 237

Query: 237 SASIKDTASESKLLRRLVHDEIQPLLRLDNASGLGWYFKRSLMTLMMDGLVVVEPVSGIN 296
             SIK T +ESKLLRRL+HDEIQP+LRLDNASGLGW  +RSLM+LM+DGLVVVEP+SG+N
Sbjct: 238 CRSIKGTTTESKLLRRLMHDEIQPVLRLDNASGLGWLVRRSLMSLMIDGLVVVEPLSGVN 297

Query: 297 ETYRVSHASGVENTKLQRPRSEQRIEGHLYNYPADSPPVAIQDPCSFCSESRNDILEHGR 356
           ETYR+ ++S   + + Q     Q    HLYNYP DSPPVAI + C+FCSESRNDILEHGR
Sbjct: 298 ETYRMGYSSPQLHAQ-QNAHFGQERAAHLYNYPTDSPPVAIHEACAFCSESRNDILEHGR 356

Query: 357 LYVLRTLQKTEEGTTEVNSQFPLCHYCLLKVRQTCEIFAFLRSLKSGAWHLESVTVDANS 416
           LYVL+TLQ+ E+GTTE  +Q+PLCHYCLLKVRQTCEIFAFLRSLK G WHLE VT+ + +
Sbjct: 357 LYVLKTLQRNEDGTTETTNQYPLCHYCLLKVRQTCEIFAFLRSLKEGVWHLEKVTLTSIA 416

Query: 417 QRSSTEFKSQSKLSTPERGSERKVKSDRKSKRLSIMAGLTKSFPSKTSYAIEETPGSNSQ 476
              S++F   +K  TP   +    K D KSKR+S MAGL++   +K    +E  P    Q
Sbjct: 417 TGGSSKFSEVTK--TPHTSA---AKEDAKSKRMSFMAGLSRPSTTKLMPTVEGAPNFAGQ 471

Query: 477 VTTPTTNIQIAWAQLCKLRSTLHWTHIGIWSIGDSVETKLGPM 519
              P TNIQ AWAQLCKLR++LHW HIG+WSI DSV  ++GP+
Sbjct: 472 SGQPVTNIQRAWAQLCKLRASLHWAHIGVWSIEDSVALRIGPL 514

>Ecym_1085 Chr1 complement(170657..172774) [2118 bp, 705 aa] {ON}
           similar to Ashbya gossypii AFR670W
          Length = 705

 Score =  521 bits (1343), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 271/523 (51%), Positives = 363/523 (69%), Gaps = 11/523 (2%)

Query: 1   MTEE-EESKRXXXXXXXXXXXXIESIDKQSHLEEQLLQARKVISSQRDALKSYESVGKRL 59
           MTE+ EESKR            IESIDKQS LEE L QA+K +S+Q+D++  ++S+ ++L
Sbjct: 10  MTEQQEESKRISIQVSSLSTQLIESIDKQSRLEEHLNQAKKALSAQKDSISQFDSLKQQL 69

Query: 60  EETEAELESVRAQNAKDKEALKAAQSETEAAKDEVSRLNKEVEELTASLFDEANNMVADA 119
            +T+ +L     + A  +  L  AQ    AA+    +LNKE+E+LT SLFDEAN+MVA+A
Sbjct: 70  SDTKKQLAYTEEELAVKRRELVEAQEVRVAAERAAEKLNKEIEDLTTSLFDEANSMVANA 129

Query: 120 RKETHSIQVKNIKLTEQLQEKSSLLETLEIQLKNLKKVLYDLEEESNSRLQSNRSPVMDT 179
           RKE H ++V N KL EQL+EK  LL+TL IQL+NLK+VLY +E+E N+     +S +M+ 
Sbjct: 130 RKEKHDVEVLNSKLQEQLREKDMLLDTLSIQLRNLKEVLYKVEDEHNTLNSYRQSIIMEG 189

Query: 180 SDNSTVS-SAIALENTMHALNGTARSPNNVLFSPVLKSLRYDLNLYNEFLKFIAALPTSA 238
           S+ S  S    AL N    L        N+LFSP+ +SLRYD+ LY E+L+F+A LP   
Sbjct: 190 SNGSNASLDKEALGNP--GLIYDHHHHMNLLFSPLAQSLRYDIPLYTEYLRFLAVLPMCK 247

Query: 239 SIKDTASESKLLRRLVHDEIQPLLRLDNASGLGWYFKRSLMTLMMDGLVVVEPVSGINET 298
            IKDT  +SK LRRLV DEIQP+LRLD ASGLGW  +R+LM LM+DGLVVVEP+SGINET
Sbjct: 248 GIKDTRHDSKFLRRLVLDEIQPVLRLDAASGLGWLVRRNLMNLMIDGLVVVEPLSGINET 307

Query: 299 YRVSHASGVENTKLQRPRSEQRIEGHLYNYPADSPPVAIQDPCSFCSESRNDILEHGRLY 358
           YR+ +AS   N+     +  +     ++NYP++SPPVAIQDPC+FCSESRNDILEHGRLY
Sbjct: 308 YRIGYASPQSNSH----KVTEVDNAKMFNYPSNSPPVAIQDPCAFCSESRNDILEHGRLY 363

Query: 359 VLRTLQKTEEGTTEVNSQFPLCHYCLLKVRQTCEIFAFLRSLKSGAWHLESVTVDANSQR 418
           VL+TLQK E+G+T   +Q+PLCHYCLLKVRQTCEIFAFLRSLKSGAW+LE+VT+   ++ 
Sbjct: 364 VLKTLQKNEDGSTTSETQYPLCHYCLLKVRQTCEIFAFLRSLKSGAWNLENVTLSC-ARP 422

Query: 419 SSTEFKSQSKLSTPERGSERKVKSDRKSKRLSIMAGLTK-SFPSKTSYAIEETPGSNSQV 477
            S EF    + ST    S ++  S   SKRLS M+GL++ S  ++ +  IE     + + 
Sbjct: 423 GSDEFTKVDRNSTTNSASNKEANST-SSKRLSFMSGLSRTSSSTRMTPRIETVTDFSERK 481

Query: 478 TTPTTNIQIAWAQLCKLRSTLHWTHIGIWSIGDSVETKLGPMT 520
             P+TN+Q +W  LCKLR++LHW HIG+W++ DS++ K+ PM+
Sbjct: 482 GLPSTNVQRSWVHLCKLRASLHWCHIGVWTLEDSIQLKVAPMS 524

>AFR670W Chr6 (1668415..1670568) [2154 bp, 717 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL272C (SEC2)
          Length = 717

 Score =  497 bits (1280), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 258/526 (49%), Positives = 356/526 (67%), Gaps = 14/526 (2%)

Query: 1   MTEEEESKRXXXXXXXXXXXXIESIDKQSHLEEQLLQARKVISSQRDALKSYESVGKRLE 60
           M+E+EE++R            IESIDKQS LEEQL  A+K +++Q+D +K  ES     +
Sbjct: 10  MSEQEENRRISVQVSSLSTQLIESIDKQSRLEEQLQHAKKALAAQKDVVKQCESARGEAQ 69

Query: 61  ETEAELESVRAQNAKDKEALKAAQSETEAAKDEVSRLNKEVEELTASLFDEANNMVADAR 120
           +  ++L     +  +  E L+ A+    AA+  V RLNKE+E+LT SLFDEAN MV+ AR
Sbjct: 70  QLRSQLADRDTELERQGEELEEARKARLAAELAVERLNKEIEDLTTSLFDEANRMVSKAR 129

Query: 121 KETHSIQVKNIKLTEQLQEKSSLLETLEIQLKNLKKVLYDLEEESNSRLQSNRSPVMDTS 180
           KE H ++  N +L EQL+EK  LL+TL IQLKNLK VLY +E+E N+R  S R  VMD+ 
Sbjct: 130 KEKHVVEQHNARLQEQLREKDMLLDTLTIQLKNLKDVLYKVEDEQNTR--SRRQSVMDSV 187

Query: 181 DNSTVSSAIALENTMHALNGTARSPNNVLFSPVLKSLRYDLNLYNEFLKFIAALPTSASI 240
           + S  S  + ++    A +    S   +LF+P ++SLRYD+ +Y E+L+F+A LP   SI
Sbjct: 188 NPSHTS--LDVDGYASAFDNMLSS--GLLFTPAVQSLRYDIPMYTEYLRFLAVLPMCKSI 243

Query: 241 KDTASESKLLRRLVHDEIQPLLRLDNASGLGWYFKRSLMTLMMDGLVVVEPVSGINETYR 300
           +DT  +SK LRRLV DEIQP+LRLD+A+GLGW  +R+LM LM++GLVVVEP+SGINETYR
Sbjct: 244 RDTRHDSKFLRRLVSDEIQPVLRLDSATGLGWLVRRNLMNLMIEGLVVVEPLSGINETYR 303

Query: 301 VSHASGVENTKLQRPRSEQRIEGHLYNYPADSPPVAIQDPCSFCSESRNDILEHGRLYVL 360
           + +AS   ++     +S +     ++ YP +SPPVAI+ PC+FCSE+RNDILEHGRLYVL
Sbjct: 304 MGYASPQTHS---HSKSSEPAAVKMFTYPVNSPPVAIEAPCAFCSEARNDILEHGRLYVL 360

Query: 361 RTLQKTEEGTTEVNSQFPLCHYCLLKVRQTCEIFAFLRSLKSGAWHLESVTVDANSQRSS 420
           +TLQKTE G     +Q+PLCH+CLLKVRQTCEIFAFLRSLK+G+W+LE+VT+    Q S 
Sbjct: 361 KTLQKTETGELLTENQYPLCHFCLLKVRQTCEIFAFLRSLKTGSWNLENVTLSCAKQESD 420

Query: 421 --TEFKSQSKLSTPERGSERKVKSDRKSKRLSIMAGLTK-SFPSKTSYAIEETPGSNSQV 477
             T+  +  + S      E  + S   SKRLS M+ L++ S  SKT+  IE     N + 
Sbjct: 421 AFTQIPNSVQASPVIHRDENSITS--SSKRLSFMSSLSRVSTTSKTTPRIEAVTDFNEKK 478

Query: 478 TTPTTNIQIAWAQLCKLRSTLHWTHIGIWSIGDSVETKLGPMTFPD 523
             P TN+Q +W  LCKLR++LHW+HIG+W++ D+V+TK+ P++  D
Sbjct: 479 GLPPTNVQRSWVHLCKLRASLHWSHIGVWTLDDAVQTKVVPLSPED 524

>Smik_14.65 Chr14 complement(105762..108134) [2373 bp, 790 aa] {ON}
           YNL272C (REAL)
          Length = 790

 Score =  497 bits (1279), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 254/531 (47%), Positives = 363/531 (68%), Gaps = 33/531 (6%)

Query: 1   MTEEEESKRXXXXXXXXXXXXIESIDKQSHLEEQLLQARKVISSQRDAL-------KSYE 53
           M   EE+KR            IES+DKQSHLEEQL ++ K ISSQ++A+         YE
Sbjct: 1   MDASEEAKRISLQVTSLSTQLIESVDKQSHLEEQLNKSLKTISSQKEAIVNYNRLKTDYE 60

Query: 54  SVGKRLEETEAELESVRAQNAKDKEALKAAQSETEAAKDEVSRLNKEVEELTASLFDEAN 113
           ++ + + E + E+  +R    K+ E    A+       DE  +LNKEVE+LTASLFDEAN
Sbjct: 61  ALKRTVLEKDDEVNKLREDVVKENELRTKAE-------DENDKLNKEVEDLTASLFDEAN 113

Query: 114 NMVADARKETHSIQVKNIKLTEQLQEKSSLLETLEIQLKNLKKVLYDLEEESNSRLQSNR 173
           NMV+DARKE ++I++ N +LTEQL+EK +LL+TL +QLKNLKKV++ L+ ES     SNR
Sbjct: 114 NMVSDARKEKYAIEILNKRLTEQLREKDTLLDTLSLQLKNLKKVMHSLDNESVVTNSSNR 173

Query: 174 SPVMDTSDNSTVSSAIALENTMHALNGTARSP--NNVLFSPVLKSLRYDLNLYNEFLKFI 231
              +   ++S  SS+ +L N +  LN +A     + +++SP + S+RYD++LYNEFLKF+
Sbjct: 174 YSTI--LNDSATSSSTSL-NKVPTLNSSASQDMYSGIVYSPSISSIRYDVSLYNEFLKFV 230

Query: 232 AALPTSASIKDTASESKLLRRLVHDEIQPLLRLDNASGLGWYFKRSLMTLMMDGLVVVEP 291
           AALP   +IK T+SESKL+RRLV+DEIQP+L++DNASG+GW  K++L++L++DGLVV+EP
Sbjct: 231 AALPNCDNIKATSSESKLIRRLVNDEIQPILKIDNASGIGWLVKKTLLSLIIDGLVVMEP 290

Query: 292 VSGINETYRVSH--ASGVENTKLQRPRSEQRIEGHLYNYPADSPPVAIQDPCSFCSESRN 349
           +SG+N TY++ +  +S V+      PR        ++ +P DSPPVA+   CSFC ESR+
Sbjct: 291 LSGVNATYQIGYNSSSPVKQATPNMPR--------MFKFPLDSPPVAVHAACSFCGESRD 342

Query: 350 DILEHGRLYVLRTLQKTEEGTTEVNSQFPLCHYCLLKVRQTCEIFAFLRSLKSGAWHLES 409
           DI+EH R+Y+L+TL K ++GT +V + +PLCH+CLLK+RQTCEIFAFLRSLK GAWHLE 
Sbjct: 343 DIIEHARMYILKTLHKADDGTEQVTNTYPLCHWCLLKLRQTCEIFAFLRSLKVGAWHLEK 402

Query: 410 VTVDANSQRSSTEFKSQSKLSTPERGSERKVKSDRKSKRLSIMAGLTKSFPSKTSYAIEE 469
           +   + ++    +F   S+++   +   R    D+K+KRLS MAGL  +  SK+   +E 
Sbjct: 403 LEAQSITKGDLGKF---SEVTKRTKTDGRVSSQDKKAKRLSFMAGLGINSSSKSKQKMEV 459

Query: 470 -TPGSNSQVTTPTTNIQIAWAQLCKLRSTLHWTHIGIWSIGDSVETKLGPM 519
            +  +N++   PTTNIQ AW QLCKLR  LHW+HIGIW++ DS+ +K+GP 
Sbjct: 460 FSSEANAKPGQPTTNIQRAWLQLCKLRCILHWSHIGIWAVDDSISSKIGPF 510

>NCAS0A00580 Chr1 complement(99945..102014) [2070 bp, 689 aa] {ON}
           Anc_1.81 YNL272C
          Length = 689

 Score =  486 bits (1251), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 275/615 (44%), Positives = 402/615 (65%), Gaps = 31/615 (5%)

Query: 1   MTEE-EESKRXXXXXXXXXXXXIESIDKQSHLEEQLLQARKVISSQRDALKSYESVGKRL 59
           M+E+ EESKR            IESIDKQS LEE+L  A K+I+SQ+ +L  Y ++    
Sbjct: 1   MSEQSEESKRISQQVTALSTQLIESIDKQSKLEEKLNHANKIIASQQPSLDKYSNLKVEF 60

Query: 60  EETEAELESVRAQNAKDKEALKAAQSETEAAKDEVSRLNKEVEELTASLFDEANNMVADA 119
           E+ +   E  + +    K  ++  +   E A+ EV +L+KEVE+LTA+LFDEANNMVADA
Sbjct: 61  EKLKISSEDQQKELDNFKVKIRRERELRENAEQEVEKLSKEVEDLTATLFDEANNMVADA 120

Query: 120 RKETHSIQVKNIKLTEQLQEKSSLLETLEIQLKNLKKVLYDLEEESNSRLQSNRSPVMDT 179
           RK+ ++++V N KL EQL EK +LLETL +QLKNLKKVL  +E+E+NS + +NR  ++  
Sbjct: 121 RKDKYTVEVLNTKLVEQLHEKDNLLETLNLQLKNLKKVLQTVEDENNSLIGNNRYSIIQP 180

Query: 180 SDNSTVSSAIALENTMHALNGTARSPNNV----LFSPVLKSLRYDLNLYNEFLKFIAALP 235
              +T SS  +LE     ++  +++ +N+    ++SP++ S+RYDL LY EFLKFIA +P
Sbjct: 181 DSATTSSSTTSLEKITTTVSSYSQNISNMANGIIYSPIISSIRYDLPLYEEFLKFIAVIP 240

Query: 236 TSASIKDTASESKLLRRLVHDEIQPLLRLDNASGLGWYFKRSLMTLMMDGLVVVEPVSGI 295
              +IKDT+S+SKL+RRLV+DEI P+L+LDNASGLGW  ++++++ MM+GLVVVEP+SG+
Sbjct: 241 HCRTIKDTSSDSKLIRRLVNDEINPVLKLDNASGLGWIVRKTILSTMMEGLVVVEPLSGV 300

Query: 296 NETYRVSHASGVENTKLQRPRSEQRIEGHLYNYPADSPPVAIQDPCSFCSESRNDILEHG 355
           NET+++ +++   N +       Q     L+ +P  SPP+A+ +PCSFC ESR+DI+EH 
Sbjct: 301 NETFQMGNSTQPPNAEASNKNESQSSMPKLFKFPLTSPPIALHEPCSFCGESRDDIIEHA 360

Query: 356 RLYVLRTLQKTEEGTTEVNSQFPLCHYCLLKVRQTCEIFAFLRSLKSGAWHLESVTVDAN 415
           R+YVL+T  K E+GT  V + FPLCH+CL KVRQTCEIFAFLRSLK+G W+LE VT+ + 
Sbjct: 361 RMYVLKTQNKQEDGTIMVTNTFPLCHWCLFKVRQTCEIFAFLRSLKTGVWNLEKVTMKSI 420

Query: 416 SQRSSTEFKSQSKLSTPERGSERKVKSDRKSKRLSIMAGLTKSFPSKTSYAIEETPGSNS 475
           S + S+ F   S +++  R ++ +   DR+SKR+S + GLTK+  +  +  +E T  ++ 
Sbjct: 421 SSKDSSRF---SVVTSAIRQTKTE---DRRSKRMSFIGGLTKNSSAINTAQVEST--TSM 472

Query: 476 QVTT-PTTNIQIAWAQLCKLRSTLHWTHIGIWSIGDSVETKLGP-MTFPDXXXX-XXXXX 532
           ++T  PTTNIQ AW QLCKLRS LHW H+GIWSI DS+ +K+GP +  PD          
Sbjct: 473 EITGLPTTNIQRAWIQLCKLRSILHWAHVGIWSIDDSITSKIGPEIKDPDDKLEPASIEA 532

Query: 533 XXXLTH------LQSLASSNN--DEFDFEKTTNSSELVDPDVHEEKIMSKSEVSTPTLSP 584
              +T       ++S+ S NN  + FDFE + ++S   +    E+ I  +SE        
Sbjct: 533 NIKITKKQIEKDVESIISENNQGESFDFESSASTSGATEASSEEKSIAGESETK------ 586

Query: 585 TVIAAPNESETHSAD 599
            V A+ + SE  SA+
Sbjct: 587 -VHASQDNSEHQSAN 600

>KLLA0C02299g Chr3 complement(194267..196243) [1977 bp, 658 aa] {ON}
           similar to uniprot|P17065 Saccharomyces cerevisiae
           YNL272C SEC2 Guanyl-nucleotide exchange factor for the
           small G-protein Sec4p located on cytoplasmic vesicles
           essential for post-Golgi vesicle transport
          Length = 658

 Score =  484 bits (1247), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 269/577 (46%), Positives = 364/577 (63%), Gaps = 44/577 (7%)

Query: 1   MTEEEESKRXXXXXXXXXXXXIESIDKQSHLEEQLLQARKVISSQRDALKSYESVGKRLE 60
           M ++EESKR            IESIDKQS LEEQLL A+K IS+Q++   SY        
Sbjct: 1   MADQEESKRISLQVTSLSTQLIESIDKQSQLEEQLLVAKKTISTQQNIANSYN------- 53

Query: 61  ETEAELESVRAQNAKDKEALKAAQSETEAAKDEVSRLNKEVEELTASLFDEANNMVADAR 120
           E + EL+S++ Q   DK   K  +     A+ +V+ LN+E+E+LTASLFDEANNMVADAR
Sbjct: 54  ELKQELQSLKLQYETDKTKFKKQEEICADAEKKVATLNQEIEDLTASLFDEANNMVADAR 113

Query: 121 KETHSIQVKNIKLTEQLQEKSSLLETLEIQLKNLKKVLYDLEEESNSRLQSNRSPVMDTS 180
           KE +++++ N KL EQL+EK  LL+TL +QLKNLK VLY  E + NS        V  + 
Sbjct: 114 KEQNAVEILNSKLKEQLKEKDLLLDTLSMQLKNLKNVLYKFENDFNSS-----KNVSLSD 168

Query: 181 DNSTVSSAIALENT-MHALNGTARSPNNVLFSPVLKSLRYDLNLYNEFLKFIAALPTSAS 239
             ++ +++I    T + ++N  + S   VLFSP+L SLRYD+ LY E+LKF+A LP   +
Sbjct: 169 SATSSTTSIDRSTTNLTSVNDNSLSFQGVLFSPLLHSLRYDVPLYTEYLKFLAVLPQCEN 228

Query: 240 IKDTASESKLLRRLVHDEIQPLLRLDNASGLGWYFKRSLMTLMMDGLVVVEPVSGINETY 299
           ++ T SESKLLRRL++ EI P+LRLDNASG+GW  KR+LM LMM+GLV +EP+SGINETY
Sbjct: 229 LQQTTSESKLLRRLINYEISPVLRLDNASGVGWLVKRNLMNLMMEGLVSIEPISGINETY 288

Query: 300 RVSHASGVENTKLQRPRSEQRIEGHLYNYPADSPPVAIQDPCSFCSESRNDILEHGRLYV 359
           R  ++S    +    P  E + + HL++ P +SPPVA+ +PC+FC E+RNDILEHGRLY+
Sbjct: 289 RTGYSSP---SIPDSPEVENK-DSHLFSRPVNSPPVAMVEPCAFCGENRNDILEHGRLYI 344

Query: 360 LRTLQKTEEGTTEVNSQFPLCHYCLLKVRQTCEIFAFLRSLKSGAWHLESVTVDANSQRS 419
            +T QK E G  E+ +QFP+CHYCLLK+RQ CEIFAFLRSL+SGAWHLE V + +  Q  
Sbjct: 345 FKTYQKLENGKNELTNQFPVCHYCLLKLRQVCEIFAFLRSLRSGAWHLEKVALASIHQGK 404

Query: 420 STEFKSQSKLSTPERGSERKVKSDRKSKRLSIMAGLTKSFPSKTSYAIEETPGSNSQVTT 479
              +   +K S P+           KSKRLSI  GL +S    ++  IE  P    +   
Sbjct: 405 VNAYSEVTKASRPK----------MKSKRLSIFQGLKQS--QSSTPIIENGPQFADKNGL 452

Query: 480 PTTNIQIAWAQLCKLRSTLHWTHIGIWSIGDSVETKLGPMTFPDXXXXXXXXXXXXLTHL 539
           PTTNIQ +WA+L +LR++L W+HIG+WS+ +SV T + P T  D            L   
Sbjct: 453 PTTNIQRSWARLSQLRASLQWSHIGVWSLDESVATDIAPST--DISKAKSFEEEQGL--- 507

Query: 540 QSLASSN---------NDEFDFEKTTNSSELVDPDVH 567
             +AS+N         ++ FDFE  T +S  VD  V+
Sbjct: 508 -GIASNNIPVPITHEEDETFDFEADTANSISVDETVN 543

>TDEL0C06200 Chr3 (1128241..1130343) [2103 bp, 700 aa] {ON} Anc_1.81
           YNL272C
          Length = 700

 Score =  486 bits (1251), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 260/515 (50%), Positives = 353/515 (68%), Gaps = 17/515 (3%)

Query: 5   EESKRXXXXXXXXXXXXIESIDKQSHLEEQLLQARKVISSQRDALKSYESVGKRLEETEA 64
           EES+R            IESIDKQ  LEEQL QA++ I SQR++L SY  +  + +  E+
Sbjct: 6   EESRRVSVQISSLSTQLIESIDKQFQLEEQLNQAKRTIQSQRNSLDSYNDLKSKFDGVES 65

Query: 65  ELESVRAQNAKDKEALKAAQSETEAAKDEVSRLNKEVEELTASLFDEANNMVADARKETH 124
            L++      + KE L   ++    A+  V  LNKE+E+LTASLFDEAN MVA ARKE++
Sbjct: 66  SLQTKNQIIEELKEELVKEKTLRTTAERNVDDLNKEIEDLTASLFDEANKMVATARKESY 125

Query: 125 SIQVKNIKLTEQLQEKSSLLETLEIQLKNLKKVLYDLEEESNSRLQSNRSPVMDTSDNST 184
           +I++KN KL EQL EK  +LETL +QLKNLKKV+ +LE+ES +   S  S V   +DNST
Sbjct: 126 TIEIKNNKLKEQLDEKDMILETLNLQLKNLKKVIQNLEKESTTHSGSRSSFV--GNDNST 183

Query: 185 VSSAIALENTMHALNGTARSPNNVLFSPVLKSLRYDLNLYNEFLKFIAALPTSASIKDTA 244
             S+I+L  T  + + +       ++SP + S+RYDLNLY EFLKFIA LP   ++KDT+
Sbjct: 184 --SSISLNKT--STSNSDELSLGPIYSPNITSVRYDLNLYTEFLKFIAVLPYCETLKDTS 239

Query: 245 SESKLLRRLVHDEIQPLLRLDNASGLGWYFKRSLMTLMMDGLVVVEPVSGINETYRVSHA 304
           S+SKLLRRLV+DEIQP LRLDNASGLGW  +R+LM+LMM+GLVVVEP+SG+NE ++  + 
Sbjct: 240 SDSKLLRRLVNDEIQPALRLDNASGLGWIVRRTLMSLMMEGLVVVEPLSGLNENFQYGYT 299

Query: 305 SGVENTKLQRPRSEQRIEGHLYNYPADSPPVAIQDPCSFCSESRNDILEHGRLYVLRTLQ 364
           S V  +    P    + + HL++YP+DSPP+A+ D CSFCSE+R+D++EH R+YVL+T  
Sbjct: 300 SPVLPSSSFNPSMGGK-DSHLFSYPSDSPPIAVHDKCSFCSEARDDVIEHARMYVLKTQT 358

Query: 365 KTEEGTTEVNSQFPLCHYCLLKVRQTCEIFAFLRSLKSGAWHLESVTVDANSQRSSTEFK 424
           + E+G+  V + FPLC YCLLKVRQTCEIFAFLRSLK GAW+LE VT+   ++  S+EF 
Sbjct: 359 RIEDGSLVVTNSFPLCRYCLLKVRQTCEIFAFLRSLKLGAWNLEKVTLTKIAKGESSEFS 418

Query: 425 SQSKLSTPERGSERKVKSDRKSKRLSIMAGLTKSFPSKTSYAIEETPGSNSQVTTPTTNI 484
             S  +   +G +   K +++ +R+S++ G  +S  SK +  + + P    Q+  PTTNI
Sbjct: 419 QVSNGN--HKGPQ---KEEKRLQRMSLITGKNQS--SKLAPQV-DIPV--DQIGAPTTNI 468

Query: 485 QIAWAQLCKLRSTLHWTHIGIWSIGDSVETKLGPM 519
           Q AW QLCKLR TLHW HIGIWS+ D+V  K+GP 
Sbjct: 469 QRAWLQLCKLRITLHWAHIGIWSVEDAVTQKIGPF 503

>Skud_14.68 Chr14 complement(115311..117569) [2259 bp, 752 aa] {ON}
           YNL272C (REAL)
          Length = 752

 Score =  487 bits (1253), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 254/537 (47%), Positives = 361/537 (67%), Gaps = 45/537 (8%)

Query: 1   MTEEEESKRXXXXXXXXXXXXIESIDKQSHLEEQLLQARKVISSQRDALKSYE------- 53
           M   EE+KR            IES+DKQSHLEEQL ++ K I+SQ+ A+++Y        
Sbjct: 1   MDASEEAKRISIQVTSLSTQLIESVDKQSHLEEQLNKSLKTIASQKAAIENYNQLETDHN 60

Query: 54  SVGKRLEETEAELESVRAQNAKDKEALKAAQSETEAAKDEVSRLNKEVEELTASLFDEAN 113
           ++ K L E + E++ +    AK+       Q  T+A +DE  +LN+EVE+LTASLFDEAN
Sbjct: 61  TLKKTLSERDDEVKKLHEDIAKE------TQLRTKA-EDENDKLNREVEDLTASLFDEAN 113

Query: 114 NMVADARKETHSIQVKNIKLTEQLQEKSSLLETLEIQLKNLKKVLYDLEEESNSRLQSNR 173
            MVADAR+E ++I++ N +LTEQL+EK  LLETL +QLKNLKKV++ L+ ES     SNR
Sbjct: 114 TMVADARREKYAIEILNKRLTEQLREKDVLLETLTLQLKNLKKVMHSLDNESTVTNNSNR 173

Query: 174 SPVMDTSDNSTVSSAIALENTMHALNGTARSP--NNVLFSPVLKSLRYDLNLYNEFLKFI 231
              + +   ++ S+++   N +  LN  A     + +++SP + S+RYD++LYNEFLKF+
Sbjct: 174 YSTILSDSATSSSTSL---NKVPTLNSFASQDMYSGIVYSPTISSIRYDISLYNEFLKFV 230

Query: 232 AALPTSASIKDTASESKLLRRLVHDEIQPLLRLDNASGLGWYFKRSLMTLMMDGLVVVEP 291
           AALP   +IK T+SESKL+RRLV+DEIQP+L++DNASG+GW  K++L++L++DGLV+VEP
Sbjct: 231 AALPQCENIKATSSESKLIRRLVNDEIQPILKIDNASGIGWLVKKTLLSLIIDGLVIVEP 290

Query: 292 VSGINETYRVSH--ASGVENTKLQRPRSEQRIEGHLYNYPADSPPVAIQDPCSFCSESRN 349
           +SG+N TY + +  +S V+ +    P+        ++ +P +SPPVA+   CSFC ESR+
Sbjct: 291 LSGVNATYHIGYNSSSPVKQSTANMPK--------MFKFPLNSPPVAVHAACSFCGESRD 342

Query: 350 DILEHGRLYVLRTLQKTEEGTTEVNSQFPLCHYCLLKVRQTCEIFAFLRSLKSGAWHLES 409
           DI+EH R+YVL+TL K ++GT +V + +PLCH+CLLK+RQTCEIFAFLRSLK GAWHLE 
Sbjct: 343 DIIEHARMYVLKTLHKADDGTEQVTNTYPLCHWCLLKLRQTCEIFAFLRSLKVGAWHLEK 402

Query: 410 VTVDANSQRSSTEFKSQSKLSTPERGSERKVKSDRKSKRLSIMAGL-----TKSFPSKTS 464
           + +   ++    +F   S+++   +  +R    D+KSKRLS MAGL      KS P    
Sbjct: 403 LVMQNIAKGDLVKF---SEVTQRTKTEDRVSSHDKKSKRLSFMAGLGINSTAKSKPKMEV 459

Query: 465 YA--IEETPGSNSQVTTPTTNIQIAWAQLCKLRSTLHWTHIGIWSIGDSVETKLGPM 519
           ++  I   PG       PTTNIQ AW QLCKLR  LHWTHIGIW++ DS+ +K+GP+
Sbjct: 460 FSSEINAKPGQ------PTTNIQRAWLQLCKLRCILHWTHIGIWAVDDSISSKIGPL 510

>NDAI0F04230 Chr6 (1031871..1033976) [2106 bp, 701 aa] {ON} Anc_1.81
           YNL272C
          Length = 701

 Score =  481 bits (1238), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 250/533 (46%), Positives = 352/533 (66%), Gaps = 25/533 (4%)

Query: 5   EESKRXXXXXXXXXXXXIESIDKQSHLEEQLLQARKVISSQRDALKSYESVGKRLEETEA 64
           EESKR            IESI KQS LEE+L QA + I+SQ+ +L+    + K+  E E 
Sbjct: 6   EESKRISIQVSSLSTQLIESIGKQSDLEEKLNQANRTITSQKKSLEQSHMLEKKSIELEQ 65

Query: 65  ELESVRAQNAKDKEALKAAQSETEAAKDEVSRLNKEVEELTASLFDEANNMVADARKETH 124
            L +   +  K +E L       E+A+ EV +L+KEVE+LTA+LFDEANNMVADARKE H
Sbjct: 66  SLTARTEEVNKLRERLTREIKLRESAEIEVEKLSKEVEDLTATLFDEANNMVADARKEAH 125

Query: 125 SIQVKNIKLTEQLQEKSSLLETLEIQLKNLKKVLYDLEEESNSRLQSNRSPVMDTSDNST 184
           + ++ N +L  QL+EK +LLETL +QLK+LKKVL ++E E+N          M   D++T
Sbjct: 126 AKEILNSRLMGQLREKDNLLETLTLQLKSLKKVLQNVETENNRY-------SMILPDSAT 178

Query: 185 VSSAIALENTMHALNGTARSP--NNVLFSPVLKSLRYDLNLYNEFLKFIAALPTSASIKD 242
           +S A   + T    +  ++ P  N +++SP + S+RYDL+LY EFLKFIA +P   SIKD
Sbjct: 179 ISGASLDKVTTRTSSSFSQQPMNNGIIYSPNISSIRYDLSLYEEFLKFIAVIPHCKSIKD 238

Query: 243 TASESKLLRRLVHDEIQPLLRLDNASGLGWYFKRSLMTLMMDGLVVVEPVSGINETYRVS 302
           T+S+SKL+RRL+ DEI P+L++DNA+GLGW  K++L++ MM+GLV+VEP+SGINE Y++ 
Sbjct: 239 TSSDSKLIRRLITDEISPVLKIDNANGLGWLVKKTLLSTMMEGLVIVEPLSGINEMYQMG 298

Query: 303 HASGVENTKLQRPRSEQRIEGHLYNYPADSPPVAIQDPCSFCSESRNDILEHGRLYVLRT 362
           H +       Q     QR    ++ +P+ SPPVA++DPC+FC E RNDI+EH R+Y+L+T
Sbjct: 299 HTTPPLGMNTQEEADAQRKVPKMFKFPSSSPPVAVRDPCAFCGEERNDIIEHARMYLLKT 358

Query: 363 LQKTEEGTTEVNSQFPLCHYCLLKVRQTCEIFAFLRSLKSGAWHLESVTVDANSQRSSTE 422
               ++GT  + + +PLCH+CL K+RQTCEIFAFLRSLK+  W+LE V + A S+  S++
Sbjct: 359 QTTQDDGTLIIANTYPLCHWCLFKIRQTCEIFAFLRSLKTDIWNLEKVPLSAISKYGSSK 418

Query: 423 FKSQSKLSTPERGSERKVKS-----DRKSKRLSIMAGLTKSFPSKTSYAIEETPGSNS-- 475
           F   +  +T   GS++ + +     ++KSKR+S MAGL ++  SK + A  E  G+++  
Sbjct: 419 FSEVTTTNT--NGSKKNIAATPKSENKKSKRMSFMAGLGRTHSSKITAARVEPHGNHNNN 476

Query: 476 -------QVTTPTTNIQIAWAQLCKLRSTLHWTHIGIWSIGDSVETKLGPMTF 521
                   +  PTTNIQ AW QLCKLRS LHW HIGIWS+ DSV TK+GP  F
Sbjct: 477 NTNSPIENIGQPTTNIQRAWLQLCKLRSILHWAHIGIWSVDDSVSTKVGPEVF 529

>Suva_14.70 Chr14 complement(121375..123630) [2256 bp, 751 aa] {ON}
           YNL272C (REAL)
          Length = 751

 Score =  479 bits (1234), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 251/530 (47%), Positives = 353/530 (66%), Gaps = 31/530 (5%)

Query: 1   MTEEEESKRXXXXXXXXXXXXIESIDKQSHLEEQLLQARKVISSQRDALKSY-------E 53
           M   EE+KR            IES+DKQSHLEEQL ++ K I+ Q+ A+ +Y       +
Sbjct: 1   MEASEEAKRISIQVTSLSTQLIESVDKQSHLEEQLNKSLKTIAGQKAAIDNYNKLKTDYD 60

Query: 54  SVGKRLEETEAELESVRAQNAKDKEALKAAQSETEAAKDEVSRLNKEVEELTASLFDEAN 113
           ++ K L E + E+  +    AK+       Q  T+A +DE  +LN+EVE+LTASLFDEAN
Sbjct: 61  TLKKTLLERDNEVMKLNGNIAKE------TQLRTKA-EDESDKLNREVEDLTASLFDEAN 113

Query: 114 NMVADARKETHSIQVKNIKLTEQLQEKSSLLETLEIQLKNLKKVLYDLEEESNSRLQSNR 173
           +MVADARKE ++I++ N +LTEQL+EK +LLETL +QLKNLKKV++ L+ ES     S R
Sbjct: 114 HMVADARKEKYAIEILNKRLTEQLREKDALLETLTLQLKNLKKVMHSLDNESTVTNNSGR 173

Query: 174 SPVMDTSDNSTVSSAIALENTMHALNGTARSPNNVLFSPVLKSLRYDLNLYNEFLKFIAA 233
              + +   ++ S+++    T ++        + +++SP + S+RYD NLYNEFLKF+AA
Sbjct: 174 YSTILSDSATSSSTSLNKVPTSNSFTSQDLY-SGIVYSPTISSIRYDSNLYNEFLKFVAA 232

Query: 234 LPTSASIKDTASESKLLRRLVHDEIQPLLRLDNASGLGWYFKRSLMTLMMDGLVVVEPVS 293
           LP   +IK T+SESKL+RRLV+DEIQP+L++DNASG+GW  K++L++L++DG+VVVEP+S
Sbjct: 233 LPHCENIKATSSESKLIRRLVNDEIQPILKIDNASGIGWLVKKTLLSLIIDGMVVVEPLS 292

Query: 294 GINETYRVSH--ASGVENTKLQRPRSEQRIEGHLYNYPADSPPVAIQDPCSFCSESRNDI 351
           G+N TY++ +  +S V+      P+        ++ +P DSPPVA+   CSFC ESR+DI
Sbjct: 293 GVNATYQIGYNSSSPVKQAAPNMPK--------MFKFPLDSPPVAVHAACSFCGESRDDI 344

Query: 352 LEHGRLYVLRTLQKTEEGTTEVNSQFPLCHYCLLKVRQTCEIFAFLRSLKSGAWHLESVT 411
           +EH R+YVL+TL K ++GT  V + +PLCH+CLLKVRQTCEIFAFLRSLK GAWHLE VT
Sbjct: 345 IEHARMYVLKTLHKADDGTEHVTNTYPLCHWCLLKVRQTCEIFAFLRSLKVGAWHLEKVT 404

Query: 412 VDANSQRSSTEFKSQSKLSTPERGSERKVKSDRKSKRLSIMAGLTKSFPSKTSYAIEETP 471
           +    +     F   S+++   +   R    D+ +KRLS MAGL  +  +K+   + E P
Sbjct: 405 MQNIVKGDLERF---SEVTKRTKADGRVSPHDKMAKRLSFMAGLGINSSTKSKPRV-EVP 460

Query: 472 GSNSQVTT--PTTNIQIAWAQLCKLRSTLHWTHIGIWSIGDSVETKLGPM 519
            S   V    PTTNIQ AW QLCKLR  LHW+HIGIW++ DS+ +K+GP 
Sbjct: 461 SSEMTVKPGHPTTNIQRAWIQLCKLRCILHWSHIGIWAVDDSISSKIGPF 510

>CAGL0J08228g Chr10 (815653..817911) [2259 bp, 752 aa] {ON} similar
           to uniprot|P17065 Saccharomyces cerevisiae YNL272c SEC2
           protein transport protein
          Length = 752

 Score =  475 bits (1223), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 247/521 (47%), Positives = 355/521 (68%), Gaps = 23/521 (4%)

Query: 5   EESKRXXXXXXXXXXXXIESIDKQSHLEEQLLQARKVISSQRDALKSYESV---GKRLEE 61
           EES R            IESID+QS LE++L  A+ +I+ Q+  +  +E++    K L +
Sbjct: 6   EESNRISVQVSTLSTQLIESIDRQSELEKRLRDAQIIINKQKHVMHEFETLKQKNKELSD 65

Query: 62  TEAELE-SVRAQNAKDKEALKAAQSETEAAKDEVSRLNKEVEELTASLFDEANNMVADAR 120
            +   E  +RA +A+    L+  +S+  AA+ EV +L +EVE+LTASLFDEANNMV+DAR
Sbjct: 66  GQQSFEEKIRALSAQ----LEEEKSKRLAAEKEVDKLGQEVEDLTASLFDEANNMVSDAR 121

Query: 121 KETHSIQVKNIKLTEQLQEKSSLLETLEIQLKNLKKVLYDLEEESNSRLQSN-RSPVMDT 179
           +E H I+++N +L E L+EK ++LETL +QLKNLKKVL  ++ ES+  + +N RSP+  +
Sbjct: 122 REKHDIEIQNSRLQETLKEKDTVLETLNLQLKNLKKVLQTVDSESS--INANIRSPI--S 177

Query: 180 SDNSTVSSAIALENTMHALNGTARSPNNVLFSPVLKSLRYDLNLYNEFLKFIAALPTSAS 239
           ++NST +SA   + T      +     + LFSP + +LRYD +LYNEFLKF+A LP+S+S
Sbjct: 178 TENSTTTSASGNKLTRRQSQLSISHNESPLFSPYVTTLRYDQSLYNEFLKFLAVLPSSSS 237

Query: 240 IKDTASESKLLRRLVHDEIQPLLRLDNASGLGWYFKRSLMTLMMDGLVVVEPVSGINETY 299
           +K T++ESKLL+RLV DEIQP+L++DNASG+GW  ++SL+T MM+G VVVEP+SGINE Y
Sbjct: 238 LKATSTESKLLKRLVSDEIQPVLKIDNASGIGWLVRKSLLTSMMEGQVVVEPLSGINEAY 297

Query: 300 RVSHASGVENTKLQRPRSEQRIEGHLYNYPADSPPVAIQDPCSFCSESRNDILEHGRLYV 359
           ++ +      TK    ++E     H++N+P +SPP+A++DPC+FC+E R+DI+EH R+YV
Sbjct: 298 QLGYE-----TKEHVSQNEGEEMPHMFNFPLNSPPIAVRDPCAFCAEQRDDIIEHARMYV 352

Query: 360 LRTLQKTEEGTTEVNSQFPLCHYCLLKVRQTCEIFAFLRSLKSGAWHLESVTVDANSQRS 419
           ++T  K  +G+T + + FPLCH+CL+KVRQTCEIFAFLRSLK G WHLE VT++  S+  
Sbjct: 353 MKTFNKENDGSTTITNSFPLCHWCLMKVRQTCEIFAFLRSLKLGTWHLEKVTLNTISKGE 412

Query: 420 STEFKSQSKLSTPERGSERKVKSDRKSKRLSIMAGLTKSFPSKTSYAIEETPGSNSQVTT 479
           S    S+   ST    S  + KS+RK    S +  L K  P K+S  + ET    ++   
Sbjct: 413 SLSKFSEVTKSTNGSTSNEEKKSNRK----SFIPSLPKGSPKKSSPVV-ETHIDTTKAGQ 467

Query: 480 PTTNIQIAWAQLCKLRSTLHWTHIGIWSIGDSVETKLGPMT 520
           PT+NIQ AW  LCKLRS LHW H+GIW++ DS+  K+GP+T
Sbjct: 468 PTSNIQRAWVHLCKLRSMLHWAHVGIWNMEDSISLKMGPIT 508

>YNL272C Chr14 complement(126805..129084) [2280 bp, 759 aa] {ON}
           SEC2Guanyl-nucleotide exchange factor for the small
           G-protein Sec4p; essential for post-Golgi vesicle
           transport and for autophagy; associates with the
           exocyst, via exocyst subunit Sec15p, on secretory
           vesicles
          Length = 759

 Score =  474 bits (1220), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 250/537 (46%), Positives = 364/537 (67%), Gaps = 37/537 (6%)

Query: 1   MTEEEESKRXXXXXXXXXXXXIESIDKQSHLEEQLLQARKVISSQRDALKSYE------- 53
           M   EE+KR            IES+DKQSHLEEQL ++ K I+SQ+ A+++Y        
Sbjct: 1   MDASEEAKRVSIQVTSLSTQLIESVDKQSHLEEQLNKSLKTIASQKAAIENYNQLKEDYN 60

Query: 54  SVGKRLEETEAELESVRAQNAKDKEALKAAQSETEAAKDEVSRLNKEVEELTASLFDEAN 113
           ++ + L + + E++ +R   AK+ E    A+ E +       +LNKEVE+LTASLFDEAN
Sbjct: 61  TLKRELSDRDDEVKRLREDIAKENELRTKAEEEAD-------KLNKEVEDLTASLFDEAN 113

Query: 114 NMVADARKETHSIQVKNIKLTEQLQEKSSLLETLEIQLKNLKKVLYDLEEESNSRLQSNR 173
           NMVADARKE ++I++ N +LTEQL+EK +LL+TL +QLKNLKKV++ L+ ES     SNR
Sbjct: 114 NMVADARKEKYAIEILNKRLTEQLREKDTLLDTLTLQLKNLKKVMHSLDNESTVTNNSNR 173

Query: 174 SPVMDTSDNSTVSSAIALENTMHALNGTARSPNNVLFSPVLKSLRYDLNLYNEFLKFIAA 233
              + +   ++ S+++    T ++L  +    + +++SP + S+RYD++LYNEFLKF+AA
Sbjct: 174 YSTILSDSATSSSTSLNKVPTSYSL-ASQDIYSGIVYSPSISSIRYDISLYNEFLKFVAA 232

Query: 234 LPTSASIKDTASESKLLRRLVHDEIQPLLRLDNASGLGWYFKRSLMTLMMDGLVVVEPVS 293
           LP   +IK T++ESKL+RRLV+DEIQP+L++DNASG+GW  K++L++L++DGLVVVEP+S
Sbjct: 233 LPRCENIKATSTESKLIRRLVNDEIQPILKIDNASGIGWLVKKTLLSLIIDGLVVVEPLS 292

Query: 294 GINETYRVSH--ASGVENTKLQRPRSEQRIEGHLYNYPADSPPVAIQDPCSFCSESRNDI 351
           G+N TY++ +  +S  +      P+        ++ +P DSPPVA+   CSFC ESR+DI
Sbjct: 293 GVNATYQIGYNSSSPAKQATSNMPK--------MFKFPLDSPPVAVHAACSFCGESRDDI 344

Query: 352 LEHGRLYVLRTLQKTEEGTTEVNSQFPLCHYCLLKVRQTCEIFAFLRSLKSGAWHLESVT 411
           +EH R+Y+L+TL KT++G  +V + +PLCH+CLLK+RQTCEIFAFLRSLK GAWHLE +T
Sbjct: 345 IEHARMYILKTLHKTDDGKEQVTNTYPLCHWCLLKLRQTCEIFAFLRSLKVGAWHLEKLT 404

Query: 412 VDANSQRSSTEFKSQSKLSTPERGSERKVKSDRKSKRLSIMAGL-----TKSFPSKTSYA 466
               ++    +F   S+++   +   R    D+K+KRLS MAGL     TK+ P    ++
Sbjct: 405 TQNITKEDLEKF---SEVTKHTKRDGRVSSQDKKTKRLSFMAGLGINSSTKNKPKMEIFS 461

Query: 467 IEETPGSNSQVTTPTTNIQIAWAQLCKLRSTLHWTHIGIWSIGDSVETKLGPMTFPD 523
            E    +N++   PTTNIQ AW QLCKLR  LHWTHIGIW++ DS+ +K+GP+   D
Sbjct: 462 SE----TNAKPGQPTTNIQRAWLQLCKLRCILHWTHIGIWAVDDSISSKIGPLVEDD 514

>ZYRO0F16698g Chr6 (1382642..1384981) [2340 bp, 779 aa] {ON} weakly
           similar to uniprot|P17065 Saccharomyces cerevisiae
           YNL272C SEC2 Guanyl-nucleotide exchange factor for the
           small G-protein Sec4p located on cytoplasmic vesicles
           essential for post-Golgi vesicle transport
          Length = 779

 Score =  474 bits (1219), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 250/550 (45%), Positives = 352/550 (64%), Gaps = 34/550 (6%)

Query: 2   TEEEESKRXXXXXXXXXXXXIESIDKQSHLEEQLLQARKVISSQRDALKSYESVGKRLEE 61
           +E EES+R            IESI++QS LE++L QA K+I     A++ YE + K   E
Sbjct: 5   SEVEESRRVSTQIMSLSTQLIESIERQSTLEKELNQANKIIEGHGGAMQEYEKLKKNFAE 64

Query: 62  TEAELESVRAQNAKDKEALKAAQSETEAAKDEVSRLNKEVEELTASLFDEANNMVADARK 121
            E    +  AQ  K +E L+  +     A     +LN EVEELTASLFDEANNMVADARK
Sbjct: 65  LEKRESNKDAQLNKLREELRKQKEARTEADSNADKLNHEVEELTASLFDEANNMVADARK 124

Query: 122 ETHSIQVKNIKLTEQLQEKSSLLETLEIQLKNLKKVLYDLEEESNSRLQSNRSPVMDTSD 181
            +H+ +++N KL EQL E+ +LLETL +QL++LKKV+  L+++S +  Q     + + SD
Sbjct: 125 ASHATELRNAKLVEQLHERDALLETLNLQLRHLKKVIQTLDDDSMASEQVKT--LANASD 182

Query: 182 NSTVSSAIALENTMHALNGTARSPNNVLFSPVLKSLRYDLNLYNEFLKFIAALPTSASIK 241
           N+ ++++++ +N   +      +P   +FSP + ++RYDL LY+EFLKF+A LP    IK
Sbjct: 183 NANLAASLS-KNLSSSHGRQIEAPLGPIFSPNITAVRYDLGLYHEFLKFLAVLPDYQDIK 241

Query: 242 DTASESKLLRRLVHDEIQPLLRLDNASGLGWYFKRSLMTLMMDGLVVVEPVSGINETYRV 301
           DTAS+SKLLRRLV+DEIQP+L+L+NASGLGW  KR+L+ LM++GLV VEP+SG+NE ++ 
Sbjct: 242 DTASDSKLLRRLVNDEIQPVLKLENASGLGWILKRTLVNLMIEGLVAVEPISGLNEMHQY 301

Query: 302 SHASGVEN--------------------------TKLQRPRSEQRIEG-HLYNYPADSPP 334
            +AS + N                          TK    RS    +  +L+NYP+DSPP
Sbjct: 302 GYASPMLNQHSKMGGNNSNSLENSPATTSNTSTTTKRNHSRSSSMTKSLNLFNYPSDSPP 361

Query: 335 VAIQDPCSFCSESRNDILEHGRLYVLRTLQKTEEGTTEVNSQFPLCHYCLLKVRQTCEIF 394
           VA+++ C+ C E R+D++EH RL++L+T  + ++GT  VN+ FPLC YC+LK+RQTCEIF
Sbjct: 362 VALREKCAICGECRDDLVEHARLHILKTQSRADDGTVTVNNTFPLCKYCVLKIRQTCEIF 421

Query: 395 AFLRSLKSGAWHLESVTVDANSQRSSTEFKSQSKLSTPERGSERKVKS-DRKSKRLSIMA 453
           AFLRSLK GAW LE V++ + S+  S EF   S +++ E    R  K  +RK+ R S MA
Sbjct: 422 AFLRSLKLGAWKLEKVSLTSVSKGDSKEFSQVSMVNSNEDKPNRDSKKENRKTARKSFMA 481

Query: 454 GLTKSFPSKTSYAIEETPGSNSQVTTPTTNIQIAWAQLCKLRSTLHWTHIGIWSIGDSVE 513
           G+  +  SK +    E P   SQ   PTTNIQ AW QLC+LRS LHWTHIGIW++ D + 
Sbjct: 482 GMN-ALNSKNTTVTPEVPV--SQAGAPTTNIQWAWIQLCRLRSMLHWTHIGIWNVDDCIT 538

Query: 514 TKLGPMTFPD 523
           +K+GP+   D
Sbjct: 539 SKIGPLVIND 548

>Kpol_2000.67 s2000 (144161..146635) [2475 bp, 824 aa] {ON}
           (144161..146635) [2475 nt, 825 aa]
          Length = 824

 Score =  466 bits (1199), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 250/518 (48%), Positives = 341/518 (65%), Gaps = 7/518 (1%)

Query: 5   EESKRXXXXXXXXXXXXIESIDKQSHLEEQLLQARKVISSQRDALKSYESVGKRLEETEA 64
           +ESKR            +ESI+KQ+ LE++L ++R+ I  Q+ A++ Y  +  + ++ + 
Sbjct: 6   DESKRFSIQLTTLSTQLMESINKQTQLEDKLQRSRRTIMEQQTAIEQYNDLKVKYDQLDK 65

Query: 65  ELESVRAQNAKDKEALKAAQSETEAAKDEVSRLNKEVEELTASLFDEANNMVADARKETH 124
                + + AK +   K       +A+ +V  LNKEVEELTASLFDEANNMVADAR+   
Sbjct: 66  NFNVTKVKIAKLENESKEEHKLRLSAEQKVDELNKEVEELTASLFDEANNMVADARRGAQ 125

Query: 125 SIQVKNIKLTEQLQEKSSLLETLEIQLKNLKKVLYDLEEESNSRLQSNRSPVMDTSDNST 184
            I +KN KL E L EK ++LET+ +QLKNLK VL+DL+ +  +   SNR+ ++ T+  S 
Sbjct: 126 EIDIKNRKLVEMLHEKDTILETMNLQLKNLKNVLHDLQNDPANIAVSNRNSLISTT--SA 183

Query: 185 VSSAIALENTMHALNGTARSP--NNVLFSPVLKSLRYDLNLYNEFLKFIAALPTSASIKD 242
            SS+++L+ T+ + N T      +N +++P + ++RYDL LYNEFLKFIA LP   SIK 
Sbjct: 184 SSSSVSLKKTITS-NSTTNIDLLSNAIYTPKVPAVRYDLYLYNEFLKFIAVLPFCESIKH 242

Query: 243 TASESKLLRRLVHDEIQPLLRLDNASGLGWYFKRSLMTLMMDGLVVVEPVSGINETYRVS 302
           T SESKLLRRL++DEIQP+LRLDNASGLGW  KR+LM LM++GLVV+EP+SG+NE YR S
Sbjct: 243 TTSESKLLRRLINDEIQPVLRLDNASGLGWIVKRTLMNLMIEGLVVIEPLSGVNENYRFS 302

Query: 303 HASGVENTKLQRPRSEQRIEGHLYNYPADSPPVAIQDPCSFCSESRNDILEHGRLYVLRT 362
            ++ V N              HL+ YP++SPP+A+ +PC+FC E+RND+LEH R+Y+L+T
Sbjct: 303 SSAPVSNVNSNNDPKLTSKNDHLFKYPSNSPPIAVHEPCAFCGENRNDVLEHARMYMLKT 362

Query: 363 LQKTEEGTTEVNSQFPLCHYCLLKVRQTCEIFAFLRSLKSGAWHLESVTVDANSQRSSTE 422
             K E+ T  + +QFPLC  CL+KVRQTCEIFAFLRSLK GAW+LE VT+   ++  S +
Sbjct: 363 QTKNEDNTLSITNQFPLCQMCLIKVRQTCEIFAFLRSLKLGAWNLEKVTLSTIAKGDSKK 422

Query: 423 FKSQSKLSTPERGSERKVKSDRK-SKRLSIMAGLTKSFPSKTSYAIEETP-GSNSQVTTP 480
           F S +  ++    S+ + K D K  KR SIMAG   S  S T+    ET  G   Q   P
Sbjct: 423 FSSVTAATSSISKSKIEEKFDSKLMKRRSIMAGFGISSISNTTTTKSETSVGVVDQSGLP 482

Query: 481 TTNIQIAWAQLCKLRSTLHWTHIGIWSIGDSVETKLGP 518
           TTNIQ AW  L KLRS LHW HIGIW+  ++V TKL P
Sbjct: 483 TTNIQRAWVHLSKLRSMLHWAHIGIWNTDNAVTTKLRP 520

>KAFR0D03960 Chr4 (776847..778841) [1995 bp, 664 aa] {ON} Anc_1.81
           YNL272C
          Length = 664

 Score =  453 bits (1166), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 242/527 (45%), Positives = 351/527 (66%), Gaps = 29/527 (5%)

Query: 5   EESKRXXXXXXXXXXXXIESIDKQSHLEEQLLQARKVISSQR------DALKS-YESVGK 57
           EE+ R            +ESI ++S LEE+L   +KV  SQ       D LK+ Y+ +  
Sbjct: 6   EENNRISAQVTSLSTQLMESIQRESELEEKLKHLKKVALSQEGSIAKYDILKADYDKLKT 65

Query: 58  RLEETEAELESVRAQNAKDKEALKAAQSETEAAKDEVSRLNKEVEELTASLFDEANNMVA 117
            + E   E+++++  N K++  L+++      A+ EV+ L++EVE+LTASLF EAN+MVA
Sbjct: 66  TVSERNREIQNLQV-NLKEESKLRSS------AEAEVATLSQEVEDLTASLFAEANDMVA 118

Query: 118 DARKETHSIQVKNIKLTEQLQEKSSLLETLEIQLKNLKKVLYDLEEESNSRLQSNRSPVM 177
           DAR+E H  ++ N KL EQL+EK +LL+TL++QLKNLKKVL + E+E+ +   S+ +P  
Sbjct: 119 DARREKHITEILNTKLVEQLREKDTLLQTLDLQLKNLKKVLQNFEDENVTNKASSIAPDF 178

Query: 178 DTSDNSTVSSAIALENTMHALNGTARSPNNVLFSPVLKSLRYDLNLYNEFLKFIAALPTS 237
             S+  + S++++        N      N  ++SP + ++RYDL LYNEFLKFIA LP  
Sbjct: 179 LGSEQKSASASLS--------NEVGDPSNKGVYSPYISTIRYDLALYNEFLKFIAVLPYC 230

Query: 238 ASIKDTASESKLLRRLVHDEIQPLLRLDNASGLGWYFKRSLMTLMMDGLVVVEPVSGINE 297
            ++KDT+SESKL+RRL++DEIQP+LR+D+A+G+GW  K+S++TLM+DGLVV+EP+SG+NE
Sbjct: 231 KNLKDTSSESKLMRRLINDEIQPILRIDSANGIGWLAKKSMLTLMIDGLVVIEPLSGVNE 290

Query: 298 TYRVSHASGVENTKLQRPRSEQRIEGHLYNYPADSPPVAIQDPCSFCSESRNDILEHGRL 357
            Y++ H S  + +   RP  E + E HL+NYP DSPPVA+ +PCSFC E+R+DILEH R+
Sbjct: 291 NYQLGHVSSSDQS--NRPSMESKRESHLFNYPTDSPPVAVHEPCSFCGENRDDILEHARM 348

Query: 358 YVLRTLQKTEEGTTEVNSQFPLCHYCLLKVRQTCEIFAFLRSLKSGAWHLESVTVDANSQ 417
           +VL+T  K+E+G+  V + +PLC +CL KVRQTCEIFAFLRSLK G W+LE VT+++ ++
Sbjct: 349 HVLKTQSKSEDGSITVTNSYPLCSWCLTKVRQTCEIFAFLRSLKIGTWNLEKVTLNSIAK 408

Query: 418 RSSTEFKSQSKLSTPERGSERKVKSD-RKSKRLSIMAGLTKSFPSKTSYAIEETPGSNSQ 476
             S +F   ++       S +  KSD +K KR S M GL  +  S  +  +E    +   
Sbjct: 409 GESNKFTEVTRAIK----SNKHGKSDEKKLKRKSFMVGLGINASSNLTPQVEVGASTIGN 464

Query: 477 VTTPTTNIQIAWAQLCKLRSTLHWTHIGIWSIGDSVETKLGPMTFPD 523
              PTTNIQ AW QLCKLRS LHWT++GIWS+ +S+  K+GP    D
Sbjct: 465 AGQPTTNIQRAWVQLCKLRSMLHWTYMGIWSVDESISLKIGPQVKDD 511

>TPHA0B04500 Chr2 (1059147..1061348) [2202 bp, 733 aa] {ON} Anc_1.81
           YNL272C
          Length = 733

 Score =  446 bits (1148), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 238/524 (45%), Positives = 338/524 (64%), Gaps = 18/524 (3%)

Query: 5   EESKRXXXXXXXXXXXXIESIDKQSHLEEQLLQARKVISSQRDALKSYESVGKRLEETEA 64
           +E KR            +ESI+KQS LE++L Q+RK+I  Q+  +  Y  +  + ++ + 
Sbjct: 6   DEDKRVSVQLTSLSTQLLESIEKQSSLEDKLRQSRKIIEEQKTTITQYNELRIKYDQLDK 65

Query: 65  ELESVRAQNAKDKEALKAAQSETEAAKDEVSRLNKEVEELTASLFDEANNMVADARKETH 124
                +    + ++ L+A +     A+ +V  LNKEVEELTASLFDEANNMVADARKET 
Sbjct: 66  NFSKKKVDLQRLEQQLQAEKLGKAEAERKVDELNKEVEELTASLFDEANNMVADARKETD 125

Query: 125 SIQVKNIKLTEQLQEKSSLLETLEIQLKNLKKVLYDLEEESNSRLQSN-----RSPVMDT 179
           SI+ KN KLTEQL EK ++LETL +QLKNLK VL DL+ ES+  + +N     +  V  +
Sbjct: 126 SIETKNKKLTEQLLEKDTILETLNLQLKNLKTVLQDLQTESSMSIINNGNISLKGDVPLS 185

Query: 180 SDNSTVSS-AIALENTMHALNGTARSPNNVLFSPVLKSLRYDLNLYNEFLKFIAALPTSA 238
           ++N   SS ++   +T  +        N  +F+P + ++RYD  LYNEFLKF+A LP   
Sbjct: 186 NENGGSSSHSLKKMSTTTSFQSQQEVVNYAIFTPKITNIRYDTFLYNEFLKFVAVLPHCN 245

Query: 239 SIKDTASESKLLRRLVHDEIQPLLRLDNASGLGWYFKRSLMTLMMDGLVVVEPVSGINET 298
           SIK+T++ESKLLRRL+ DEI P+LRLD ++GLGW  KR+LM  +++GLVV+EP+SGINET
Sbjct: 246 SIKNTSAESKLLRRLISDEIHPVLRLDTSNGLGWLTKRTLMNQIVEGLVVIEPLSGINET 305

Query: 299 YRVSHASGVENTKLQRPRSEQRIEGHLYNYPADSPPVAIQDPCSFCSESRNDILEHGRLY 358
           YR S    V  +K    +S+Q  +  ++N+PADSPP+A++DPC+FC ESR+D + H R+Y
Sbjct: 306 YRQSALYEVSISK-SSIKSDQITKAKMFNFPADSPPIAVRDPCAFCDESRSDCIGHARMY 364

Query: 359 VLRTLQKTEEGTTEVNSQFPLCHYCLLKVRQTCEIFAFLRSLKSGAWHLESVTVDANSQR 418
           +L+T  + ++ T  + +Q+PLC  CL+KVRQTC+IFAFLRSLKSG W LE VT+   S+ 
Sbjct: 365 MLKTQTRNDDDTLSITNQYPLCQACLIKVRQTCDIFAFLRSLKSGVWQLEKVTLSTISKG 424

Query: 419 SSTEFKSQSKLSTPE---RGSERKVKSDRKSKRLSIMAGLTKSFPSKTSYAIEETPGSNS 475
            ++ F     L   E   + +E+    ++K KR SI++ L KS    +SY   +   +  
Sbjct: 425 DTSSF-----LKVAENQFKQNEKATAQEKKQKRKSIISSLGKSH---SSYVNAKLDCTVE 476

Query: 476 QVTTPTTNIQIAWAQLCKLRSTLHWTHIGIWSIGDSVETKLGPM 519
            V  P+TNIQ AW QLCKLRS LHW+HIGI +  D V +   P+
Sbjct: 477 PVGLPSTNIQRAWLQLCKLRSILHWSHIGISNTEDCVTSTFAPV 520

>TBLA0A05430 Chr1 complement(1334141..1336528) [2388 bp, 795 aa]
           {ON} Anc_1.81 YNL272C
          Length = 795

 Score =  423 bits (1088), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 245/555 (44%), Positives = 352/555 (63%), Gaps = 48/555 (8%)

Query: 1   MTEEE---ESKRXXXXXXXXXXXXIESIDKQSHLEEQLLQARKVISSQRDALKS---YES 54
           M+E+E   ES+R            +ESI KQS LE++L QA K +++Q+  ++     ++
Sbjct: 1   MSEQEIADESQRVTDQVTLLSTQLMESISKQSQLEDKLNQANKKLAAQKLTIEKNSQIKA 60

Query: 55  VGKRLEETEAELES-VRAQNAKDKEALKAAQSETEAAKDEVSRLNKEVEELTASLFDEAN 113
            G  L++   +LES ++  NA   E +K  Q   E A+ E + LNKEVE+LTASLFDEAN
Sbjct: 61  TGSALQKNANDLESQLKIANA---ELVKERQLR-EKAEGECTALNKEVEDLTASLFDEAN 116

Query: 114 NMVADARKETHSIQVKNIKLTEQLQEKSSLLETLEIQLKNLKKVLYDLEEE-SNSRLQSN 172
           +MVADARKE  +++++N KL EQL+EK ++LETLE+QLKNLKKVL + ++E SN++  S 
Sbjct: 117 HMVADARKEKAAVELRNTKLMEQLKEKDTVLETLELQLKNLKKVLQEFQDEDSNNKRNSM 176

Query: 173 RSPVMDTSDNSTVSSAIALENTMHALNGTARSPNNVLFSPVLKSLRYDLNLYNEFLKFIA 232
            S V   S +S  + +  + +T ++      S  N+++SP +  +RYDL LY EFLKF+A
Sbjct: 177 LSEVTIHSGSSQRAGSPTIISTTNS-----ESFANIIYSPNISDIRYDLPLYGEFLKFVA 231

Query: 233 ALPTSASIKDTASESKLLRRLVHDEIQPLLRLDNASGLGWYFKRSLMTLMMDGLVVVEPV 292
            LP   +IK T ++SKLLRRLV+DEIQP+LRLDNA GLGW  KR+L+T MM+GLV+VEP+
Sbjct: 232 VLPFVKNIKQTTNDSKLLRRLVNDEIQPVLRLDNADGLGWVVKRTLLTQMMEGLVMVEPL 291

Query: 293 SGINETYRVSH----ASGVENTKLQRPRSEQRIEG-------HLYNYPADSPPVAIQDPC 341
           SG+NE Y  S     A+    T   R  S +   G       HL+N+P +SPPVA+ +PC
Sbjct: 292 SGVNELYTHSRNRRSATSNNTTGSTRDISGKDTNGSSNQKNSHLFNFPTNSPPVAVHEPC 351

Query: 342 SFCSESRNDILEHGRLYVLRTLQKTEEGTTEVNSQFPLCHYCLLKVRQTCEIFAFLRSLK 401
           +FC+E R+D ++H R+++L+T  ++E G   V +QFPLC  C+LKVRQT EIFAFLRSL 
Sbjct: 352 AFCNEKRDDSVQHARIHLLKTQSRSETGKITVTNQFPLCQSCVLKVRQTGEIFAFLRSLA 411

Query: 402 SGAWHLESVTVDANSQRSSTEFKSQSKLSTPERGSERKVKSDRKSKRLSIMAGLTKS--- 458
            G W LE + +   S+   T+ K      +P   ++ K K  +K+KR S + GL  +   
Sbjct: 412 LGTWKLEKIAIANLSKSDPTKIK-----GSPASPTKDKEKEKKKAKRKSFIKGLNMAQTA 466

Query: 459 ---FPSKTSYAIEET---PGSNSQVT------TPTTNIQIAWAQLCKLRSTLHWTHIGIW 506
               P+ ++   ++T   P  ++ +T       PTTNIQ AW QLCKLR  LHW+H+GIW
Sbjct: 467 SVLNPATSNPFFQQTQTNPVGDTSLTDVDTFGQPTTNIQRAWLQLCKLRCMLHWSHMGIW 526

Query: 507 SIGDSVETKLGPMTF 521
           S+ DS+E K  P++ 
Sbjct: 527 SLDDSIEAKFAPLSI 541

>KNAG0F00460 Chr6 complement(64086..66050) [1965 bp, 654 aa] {ON}
           Anc_1.81 YNL272C
          Length = 654

 Score =  416 bits (1068), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 231/530 (43%), Positives = 332/530 (62%), Gaps = 28/530 (5%)

Query: 5   EESKRXXXXXXXXXXXXIESIDKQSHLEEQLLQARKVISSQRDALKSYESVGKRLEETEA 64
           +ESKR            +ESI  QS LEE+L +A K  ++ ++    Y+ +  R+ + EA
Sbjct: 17  DESKRISLQITSMSTQLMESIQNQSLLEEKLNRANKAAAALKEQTVHYDELKGRVAKLEA 76

Query: 65  ELESVRAQNAKDKEALKAAQSETEAAKDEVSRLNKEVEELTASLFDEANNMVADARKETH 124
            L +   + A  K AL   +S+  A+   V  L  EVE+LTASLF EANNMVADARKE H
Sbjct: 77  SLTNRDEEMAALKSALAEEKSKRAASDKSVEELQSEVEDLTASLFSEANNMVADARKEKH 136

Query: 125 SIQVKNIKLTEQLQEKSSLLETLEIQLKNLKKVLYDLEEESNSRLQSNRSPVMDTSDNST 184
           + ++ N KL E + EK + LET++IQLK+L+K+L  ++  S S    +     DT  NS 
Sbjct: 137 TTEILNRKLLEAVNEKDNALETMKIQLKHLRKMLEKVDVGSPSATGRSSMTSADTDTNSL 196

Query: 185 VSSAIALENTMHALNGTARSPNNVLFSPVLKSLRYDLNLYNEFLKFIAALPTSASIKDTA 244
               I   ++  + + TA     V++SP + S+RYDL+LY+EFLKF+ +LP    I+DT 
Sbjct: 197 --KGIVTRSSNQSQSDTAPL---VVYSPSVGSVRYDLSLYSEFLKFLVSLPRCTQIRDTE 251

Query: 245 SESKLLRRLVHDEIQPLLRLDNASGLGWYFKRSLMTLMMDGLVVVEPVSGINETYRVSHA 304
           SESKL+RRL++DEI P+LR+D+A G+GW  K+SLM +M++G+V++EP SG+NE Y+  H+
Sbjct: 252 SESKLVRRLINDEIAPILRIDSAPGIGWMAKKSLMNVMLEGMVIIEPNSGVNENYQHGHS 311

Query: 305 SGVENTKLQRPRSEQRIEG----HLYNYPADSPPVAIQDPCSFCSESRNDILEHGRLYVL 360
           S         P   Q   G    HL++YPADSPP+A  + C+ C ESR+DI EH RL+ +
Sbjct: 312 S---------PSISQHSLGKSQPHLFSYPADSPPIASFESCALCGESRSDIYEHERLHKM 362

Query: 361 RTLQKTEEGTTEVNSQFPLCHYCLLKVRQTCEIFAFLRSLKSGAWHLESVTVDANSQRSS 420
           +  QK ++GT EV + +PLC +CLL+VRQTCEIF+FLRSLK+G W LE  T+      +S
Sbjct: 363 KIQQKRDDGTLEVVNLYPLCLWCLLRVRQTCEIFSFLRSLKTGVWGLE--TIKTRGSPTS 420

Query: 421 TEFKSQSKLSTPERGSERKVKSDRKSKRLSIMAGLTKSFPSKTSYA------IEETPGSN 474
            + K     + P R ++ K  ++R +KR+S MAGL  + P+ +S A      +E +    
Sbjct: 421 AKSKKFDLNNAPIRRNKTKNSANR-TKRMSWMAGLGLNTPTSSSSAPNDVSLMEPSTTFT 479

Query: 475 SQVTTPTTNIQIAWAQLCKLRSTLHWTHIGIWSIGDSVETKLGPMTF-PD 523
            +   P TNI+ AW QLCKLRS LHW HIGIWS+ D+++ K+GP+T  PD
Sbjct: 480 DKNGLPNTNIKRAWLQLCKLRSILHWAHIGIWSVSDALDLKIGPITTDPD 529

>Suva_6.104 Chr6 complement(183396..186908) [3513 bp, 1170 aa] {ON}
           YFR031C (REAL)
          Length = 1170

 Score = 37.7 bits (86), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 46/175 (26%), Positives = 88/175 (50%), Gaps = 14/175 (8%)

Query: 35  LLQARKVISSQRDALKSYES-VGKRLEETEAELESVRAQNAKDKEALKAAQSETEAAKDE 93
           L + R+ +SS    +K Y++  G +L E + EL+S+ A+N +++E      SE+E   D 
Sbjct: 768 LERCRQEVSSIEKDMKEYDNDKGSKLNELKNELKSL-AKNLEEQE------SESEGKYDL 820

Query: 94  VSRLNKEVEELTASLFDEANNMVADARKETHSIQVKNIKLTEQLQEKSSLLETLEIQLKN 153
              L  E E+L++ L D    ++ +  K   S++ +N +L E+++     L T++ +L  
Sbjct: 821 FQNLELETEQLSSEL-DSNKTLLQNYLKSIESLKSENTELEEKIRSIEDNLATIQAKLNE 879

Query: 154 LKKVLYDLEEESNSRLQSNRSPVMDTSDNSTVSSAIALENTMHALNGTARSPNNV 208
            KK L D+++E      +    +M        SS + L+  +H LN    + +N+
Sbjct: 880 EKKRLMDIDDEL-----TELETLMKKKQEKKKSSELELQKLIHDLNKYKSNTDNI 929

>Ecym_2478 Chr2 (933106..935991) [2886 bp, 961 aa] {ON} similar to
           Ashbya gossypii ACL132C
          Length = 961

 Score = 35.8 bits (81), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 36/126 (28%), Positives = 57/126 (45%), Gaps = 1/126 (0%)

Query: 82  AAQSETEAAKDEVSRLNKEVEELTASLFDEANNMVADARKETHSIQVKNIKLTEQLQEKS 141
           A  SE E  +   S+ NKE +EL A L +      +    E  +IQ +   +   L EK+
Sbjct: 717 AVLSELEDLRAHKSKWNKERQELMAKLTN-FQTQTSQLNSENQTIQDQLNDVQIALNEKT 775

Query: 142 SLLETLEIQLKNLKKVLYDLEEESNSRLQSNRSPVMDTSDNSTVSSAIALENTMHALNGT 201
             L + ++Q+  LK  L  LE E ++ L +N SP            AI+    ++A +GT
Sbjct: 776 MALRSKDLQITKLKNRLATLESELDAALNANNSPGTPAKSVLEGIHAISPSQGLNAHSGT 835

Query: 202 ARSPNN 207
               +N
Sbjct: 836 VYGGSN 841

>Skud_15.383 Chr15 complement(686554..688011) [1458 bp, 485 aa] {ON}
           YOR216C (REAL)
          Length = 485

 Score = 34.7 bits (78), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 39/130 (30%), Positives = 63/130 (48%), Gaps = 10/130 (7%)

Query: 42  ISSQRDALKSYESVGKRLEETEAELESVRAQNAKDKEALKAAQSETEAAKDEVSRLNKEV 101
           ISS +      +   K+LEE + +L    +QN K K+ L+A ++E    +  +  LNKE+
Sbjct: 145 ISSMKSIFNKMKEAQKQLEEVQEQLTEYESQNLKLKKKLEATKTENSELQSAIVTLNKEI 204

Query: 102 EEL------TASLFDEANNMVADARKETHS-IQVKNIKLTEQLQEKSSL---LETLEIQL 151
           E L         +F E  + V   + E H  I+  N +L    +EK  L   ++ L I L
Sbjct: 205 EHLENEQENAEDVFLEYESSVEALQGEKHDIIEAHNKELNTYRKEKDQLSVQIQELMIIL 264

Query: 152 KNLKKVLYDL 161
           +N K+ + DL
Sbjct: 265 ENNKQDISDL 274

>ACL132C Chr3 complement(120950..123814) [2865 bp, 954 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR045C
           (STU2)
          Length = 954

 Score = 34.7 bits (78), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 37/132 (28%), Positives = 61/132 (46%), Gaps = 25/132 (18%)

Query: 82  AAQSETEAAKDEVSRLNKEVEELTASL---------FDEANNMVADARKETHSIQVKNIK 132
           A  +E +  K   ++ NKE +EL   L          +  N M+ D        Q+ +++
Sbjct: 708 AVLAELDELKGAKAKWNKERQELMTKLTSFQTQTSQLNSENQMLQD--------QLNDVQ 759

Query: 133 LTEQLQEKSSLLETLEIQLKNLKKVLYDLEEESNSRLQSNRSPVMDTSDNSTVSSAIALE 192
           L   L EK+ LL + ++Q+  LK  L  LE E ++ L +  SP  DT   S +    A+ 
Sbjct: 760 LA--LNEKTMLLRSKDLQITKLKNRLATLESELDTALNAKHSP--DTPVKSVLEGIQAIS 815

Query: 193 NTMHALNGTARS 204
            +    NG+A+S
Sbjct: 816 PS----NGSAQS 823

>Smik_15.402 Chr15 complement(697238..698785) [1548 bp, 515 aa] {ON}
           YOR216C (REAL)
          Length = 515

 Score = 33.9 bits (76), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 41/158 (25%), Positives = 76/158 (48%), Gaps = 18/158 (11%)

Query: 42  ISSQRDALKSYESVGKRLEETEAELESVRAQNAKDKEALKAAQSETEAAKDEVSRLNKEV 101
           ISS +      +   K+LEE + +L    +QN K K+ L+A ++E    +  +  LN E+
Sbjct: 175 ISSMKTIFNKMKEAQKQLEEVQEQLTEYESQNLKLKKKLEATKTENSELQSTIVTLNNEL 234

Query: 102 EEL------TASLF-----------DEANNMVADARKETHSIQVKNIKLTEQLQEKSSLL 144
           E L      T  +F           DE N ++    KE +S + +  +L  Q+QE   +L
Sbjct: 235 ENLEKEQENTEDVFLEYESRIEALQDENNGIIEKHSKELNSYRKEKDQLNIQVQELMIIL 294

Query: 145 ETLEIQLKNLKKVLYDLEEESNSRLQSNRSPVMDTSDN 182
           E  +  + +L+    +L++   SR +S ++ + ++ DN
Sbjct: 295 ENNKQDISDLRAERDELKQALESR-ESEKAVLQNSVDN 331

>KLTH0F14498g Chr6 complement(1188459..1190567) [2109 bp, 702 aa]
           {ON} similar to uniprot|P17119 Saccharomyces cerevisiae
           YPR141C KAR3 Minus-end-directed microtubule motor that
           functions in mitosis and meiosis localizes to the
           spindle pole body and localization is dependent on
           functional Cik1p required for nuclear fusion during
           mating potential Cdc28p substrate
          Length = 702

 Score = 33.9 bits (76), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 33/99 (33%), Positives = 50/99 (50%), Gaps = 7/99 (7%)

Query: 45  QRDALKSYESVGKRLEETEAELESVRAQ-NAKDKEALKAAQSETEAAKDEVSRLNKEVEE 103
           +RD  K+  S+    E  E++L     + N + +E L+  Q E  A  +E S LN+E E+
Sbjct: 201 RRDISKARGSIANNKENFESQLNECEVRHNYRKEEWLRTHQKELNALIEESSTLNRESEK 260

Query: 104 LTASLFDEANNMVADARKETHSIQVKNIKL---TEQLQE 139
           L A L    N + A   K+   I+V N KL    EQL++
Sbjct: 261 LQAVL---DNELKAKLLKKNEEIEVLNSKLLGFQEQLEQ 296

>AGR089C Chr7 complement(901437..905549) [4113 bp, 1370 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YLR086W
            (SMC4)
          Length = 1370

 Score = 33.9 bits (76), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 46/184 (25%), Positives = 84/184 (45%), Gaps = 49/184 (26%)

Query: 53   ESVGKRLEETEAELESVRAQNAKDKEA-------LKAAQSETEAAKDEVSRLNKEVEELT 105
            +++  +++    +++ V A+  KDK A       LK A+ +   AKD++   + E++++ 
Sbjct: 923  QTLNSKVDSLNQQIKIVAAKQKKDKTAQKKAELELKRARKQQITAKDDIEHCDIEIQKMK 982

Query: 106  ASL------FDEANNMVADARKET-----------HSIQVKN----------IKLTEQLQ 138
            +S         E    ++D ++E            H +  KN          I+LTEQLQ
Sbjct: 983  SSYDTISTGMQELQKQLSDLQEEIGTLTDEHAVTKHELDQKNEKIDSYSSIEIELTEQLQ 1042

Query: 139  EKSSLLETLE------------IQLKNLKKVLYDLEEESNSRLQS-NRSPVMDTSDNSTV 185
            +  +L   L+            ++L++L +V+ DLEE  N  LQS + SP  DT   +  
Sbjct: 1043 KLQNLANYLKKEMNEYDSKLSHLKLRDLGQVMLDLEE--NKSLQSFSHSPTPDTKRENIQ 1100

Query: 186  SSAI 189
            SS +
Sbjct: 1101 SSML 1104

>Suva_8.269 Chr8 complement(486474..487931) [1458 bp, 485 aa] {ON}
           YOR216C (REAL)
          Length = 485

 Score = 32.7 bits (73), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 44/152 (28%), Positives = 70/152 (46%), Gaps = 34/152 (22%)

Query: 42  ISSQRDALKSYESVGKRLEETEAELESVRAQNAKDKEALKAAQSETEAAKDEVSRLNKEV 101
           ISS +      +   K+LEE + +L    +QN K K+ L+A + E    +  +  +NKE+
Sbjct: 145 ISSMKSIFNKMKESQKQLEEVQEQLTEYESQNLKLKKKLEATKIENSELQSTIVTINKEL 204

Query: 102 EEL-----------------TASLFDEANNMVADARKETHSIQVK-----NIKLTEQLQE 139
           E L                   +L DE  NM+     ETHS ++K       +L+ Q+QE
Sbjct: 205 ENLEKEQESAEDIFLEYESKIEALQDEQRNMI-----ETHSKELKASRKDKDQLSVQVQE 259

Query: 140 KSSLLETLEIQLKNLKKVLYDLEEESNSRLQS 171
                  L I L+NLK+   DL++E +   Q+
Sbjct: 260 -------LMIILENLKQDKSDLKDERDDLKQA 284

>KLLA0D06875g Chr4 complement(591141..592529) [1389 bp, 462 aa] {ON}
           similar to uniprot|Q12234 YOR216C Saccharomyces
           cerevisiae RUD3 Golgi matrix protein that is involved in
           the structural organization of the cis-Golgi
          Length = 462

 Score = 32.7 bits (73), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 39/139 (28%), Positives = 64/139 (46%), Gaps = 18/139 (12%)

Query: 42  ISSQRDALKSYESVGKRLEETEAELESVRAQNAKDKEALKAAQSETEAAK-------DEV 94
           ISS +      +   + LE T  +L     QN   K+ LK+A SE +  K       DE+
Sbjct: 126 ISSMKTVFSQMKQAQQELENTREQLNEYENQNINLKQKLKSADSEIQEDKQTISILNDEI 185

Query: 95  SRLNKEVEELTASLFDEANNMVADARKETHSIQVKNIKLTEQLQEKSSLLETLEIQLKNL 154
             LNKE E L+        N  ++ + +   ++    KL E   E+S++   L+ ++K+L
Sbjct: 186 VNLNKECENLS--------NECSEFKSKIKELES---KLNEASNEESNITSCLKSEVKSL 234

Query: 155 KKVLYDLEEESNSRLQSNR 173
           K  + +LE   N+  Q  R
Sbjct: 235 KSQIDNLEIIINNEAQDKR 253

>TDEL0B02260 Chr2 (408913..410901) [1989 bp, 662 aa] {ON} Anc_5.696
           YIL144W
          Length = 662

 Score = 32.7 bits (73), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 49/90 (54%), Gaps = 18/90 (20%)

Query: 88  EAAKDEVSRLNKEVEELTASLFDEANNMVADARKETHSIQVKNIKLTEQLQEKSSLLETL 147
           E A+ E+S+L KE++E            V + + E  +I+ K + L  +++EK++ +E L
Sbjct: 503 EKAQQELSKLYKEIQE-----------RVKNCQMENSTIEAKVVDLQREIREKTNAIERL 551

Query: 148 EIQLKNLKKVLYDLEEESNSRLQSNRSPVM 177
           E+QL + K   Y+L      +LQ N S ++
Sbjct: 552 ELQLSDAKSN-YEL------KLQENESSLL 574

>TPHA0E01500 Chr5 complement(304130..305503) [1374 bp, 457 aa] {ON}
           Anc_5.470 YDR388W
          Length = 457

 Score = 32.0 bits (71), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 27/124 (21%), Positives = 55/124 (44%), Gaps = 17/124 (13%)

Query: 65  ELESVRAQNAKDKEALKAAQSETEAAKDEVSRLNKEVEELTASLFDEANNMVADARKETH 124
           +LE+ + Q  KD+E L  AQ+E E A+ E               +D  NN++ D      
Sbjct: 165 KLENKKEQTPKDEEKLYKAQAEMEVAQQE---------------YDYYNNLMKDQLPILF 209

Query: 125 SIQVKNIK--LTEQLQEKSSLLETLEIQLKNLKKVLYDLEEESNSRLQSNRSPVMDTSDN 182
           S++ + ++         + ++  TL  + +++K   +DL  +        R  V + +D+
Sbjct: 210 SLEAQFVQPLFVSFYYMQLNIFYTLYNKFQDMKIPYFDLNSDIIEAFHFKRGNVEEQADS 269

Query: 183 STVS 186
            T++
Sbjct: 270 LTIT 273

>NDAI0J02180 Chr10 (529566..532892) [3327 bp, 1108 aa] {ON}
           Anc_4.237 YLR383W
          Length = 1108

 Score = 32.3 bits (72), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 31/114 (27%), Positives = 55/114 (48%), Gaps = 4/114 (3%)

Query: 53  ESVGKRLEETEAELES-VRAQNAKDKEALKAAQSETEAAKDEVSRLNKEVEELTASLFDE 111
           E++ + +E  E ELE  +     K KE L   Q+E E  +D+V  ++ E+ E+       
Sbjct: 409 ETLNRTIEHLEQELEKQMGGDRGKMKEELAQLQAENEQLRDKVENISNELLEMQDKERTI 468

Query: 112 ANNMVADARKETHSIQVKNIKLTEQLQEKSSLLETLEIQLKNLKKVLYDLEEES 165
           A     D R   H+IQ K  +L +  Q  +S L   +   +N+ ++L  +++ S
Sbjct: 469 AAERQQDLRTIEHNIQSKRNELQKIAQGNNSFLTNFD---QNMDRLLLQIKQRS 519

>YOR216C Chr15 complement(747525..748979) [1455 bp, 484 aa] {ON}
           RUD3Golgi matrix protein involved in the structural
           organization of the cis-Golgi; interacts genetically
           with COG3 and USO1
          Length = 484

 Score = 32.0 bits (71), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 39/130 (30%), Positives = 62/130 (47%), Gaps = 10/130 (7%)

Query: 42  ISSQRDALKSYESVGKRLEETEAELESVRAQNAKDKEALKAAQSETEAAKDEVSRLNKEV 101
           ISS +      +   K+LEE + +L    +QN K K+ L+A ++E    +  +  LN E+
Sbjct: 145 ISSMKSIFNKMKEAQKQLEEVQEQLTEYESQNLKLKKKLEATKTENSELQSTIVTLNTEL 204

Query: 102 EEL------TASLFDEANNMVADARKETHSIQVKNIK-LTEQLQEKSSL---LETLEIQL 151
           E L      T  +F E  + +     E H I  K+ K L    +EK  L   ++ L I L
Sbjct: 205 ENLEKEQESTEEVFLEYESRIEALEDEKHDIIEKHSKELNTYRKEKDQLNLQVQELMIIL 264

Query: 152 KNLKKVLYDL 161
           +N K+ + DL
Sbjct: 265 ENNKQDISDL 274

>TDEL0A06700 Chr1 complement(1169248..1174941) [5694 bp, 1897 aa]
           {ON} Anc_6.257 YPL231W
          Length = 1897

 Score = 32.0 bits (71), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 31/123 (25%), Positives = 50/123 (40%), Gaps = 23/123 (18%)

Query: 181 DNSTVSSAIALENTMHALNGTARSPNNVLFSPVLKSLR----------------YDLNLY 224
           D + V  AI  + + H ++G+  S    ++  ++K L+                 D  L 
Sbjct: 554 DLTRVYKAINAQASKHDISGSTASEFEKIYGDLMKFLQNSKEIDASQTTQLAGVVDDALD 613

Query: 225 NEFLKFIAALPTSASIKDTASESKLLRRLVHDEIQPLLRLDNASGLG-WYFKRSLMTLMM 283
            +  K +A+LP  + I  T S S      +  E  P L L      G W + R L +L +
Sbjct: 614 KDSTKEVASLPNKSEISKTVSSS------IPRETVPFLHLKKKKATGEWLYDRQLSSLFL 667

Query: 284 DGL 286
           DGL
Sbjct: 668 DGL 670

>Suva_16.53 Chr16 complement(80323..81798) [1476 bp, 491 aa] {ON}
           YPL253C (REAL)
          Length = 491

 Score = 32.0 bits (71), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 55/205 (26%), Positives = 92/205 (44%), Gaps = 53/205 (25%)

Query: 23  ESIDKQSHLEEQL---LQARKVISSQRDA-LKSYESVGKRLEETEAELESVRAQNAKDKE 78
           ES+ KQ+ LE Q    LQ +K   + ++A LKS +++  +  E  +++  +++Q  K  E
Sbjct: 224 ESLQKQN-LERQANHELQLKKEFDAFKEAKLKSIDNLTNKNLELLSQVTILQSQTTKLNE 282

Query: 79  ALKAAQSETEAAKDEVSRLNKEVEELTASLFDEANNMVADARKETHSIQVKNIKLTEQLQ 138
            +    ++T+ ++ + S++NK +  L A                      +N  L  Q  
Sbjct: 283 EITQIDTQTQDSQHQFSQINKSLAHLEA----------------------ENNPLLNQSL 320

Query: 139 EKSSLLETLEIQLKNLKKVLYDLEEESNSRLQSNRSPVMDTSDNSTVSSAI----ALENT 194
           E S  LE L+ Q++NLK++    E+  N           DT   STV   +     LEN+
Sbjct: 321 ENSLELENLQQQMENLKEIASQQEKSYN-----------DTY--STVERELLRSRKLENS 367

Query: 195 MHALNGTARS---------PNNVLF 210
           +  LNGT R          P N+LF
Sbjct: 368 IIELNGTMRCYAYVMEQNLPENLLF 392

>TDEL0D01620 Chr4 complement(321963..325634) [3672 bp, 1223 aa] {ON}
           Anc_1.295 YJL074C
          Length = 1223

 Score = 32.0 bits (71), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 30/46 (65%)

Query: 41  VISSQRDALKSYESVGKRLEETEAELESVRAQNAKDKEALKAAQSE 86
           +IS ++   K +ES GK ++E + ELE ++A+  K++  L+ A S+
Sbjct: 870 MISDKQGLEKQFESSGKEVDELQTELEGLKAEKGKNESLLEKANSQ 915

>KAFR0E00710 Chr5 (151558..152967) [1410 bp, 469 aa] {ON} Anc_8.581
           YPL101W
          Length = 469

 Score = 31.6 bits (70), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 25/68 (36%), Positives = 34/68 (50%), Gaps = 3/68 (4%)

Query: 314 RPRSEQRIEGHLYNYPADSP-PVAIQDPCSFCSESRNDILEHGRLYVLRTLQKTEEGTTE 372
           +P  EQ+ E  + N+P   P PV+     S  SE  + IL H  L +  +L   E+ TTE
Sbjct: 74  QPSVEQKQEAAILNHPGVRPSPVSSHLVTSTGSEDLDKILTHMGLPLGNSLLIEEQSTTE 133

Query: 373 VNSQFPLC 380
            NS   LC
Sbjct: 134 FNSI--LC 139

>TBLA0A02570 Chr1 complement(622892..624373) [1482 bp, 493 aa] {ON}
           Anc_5.470 YDR388W
          Length = 493

 Score = 31.2 bits (69), Expect = 10.0,   Method: Compositional matrix adjust.
 Identities = 26/124 (20%), Positives = 55/124 (44%), Gaps = 17/124 (13%)

Query: 65  ELESVRAQNAKDKEALKAAQSETEAAKDEVSRLNKEVEELTASLFDEANNMVADARKETH 124
           ++E+ + Q  KD+E L  AQ+E E A+ E               +D  NNM+ D      
Sbjct: 165 KIENKKEQKPKDEERLYKAQAEMEVAQQE---------------YDYYNNMLKDQLPILF 209

Query: 125 SIQVKNIK--LTEQLQEKSSLLETLEIQLKNLKKVLYDLEEESNSRLQSNRSPVMDTSDN 182
           S++ + ++         + ++  TL  + + ++   +DL  +     Q+ R  + + +D 
Sbjct: 210 SLEAQFVQPLFVSFYYMQLNIFYTLYNKFQEMQIPYFDLNSDILEAFQAKRGNIEEQTDA 269

Query: 183 STVS 186
            T++
Sbjct: 270 LTIT 273

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.308    0.123    0.331 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 68,190,275
Number of extensions: 2936897
Number of successful extensions: 23689
Number of sequences better than 10.0: 1279
Number of HSP's gapped: 23639
Number of HSP's successfully gapped: 1983
Length of query: 694
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 577
Effective length of database: 40,065,477
Effective search space: 23117780229
Effective search space used: 23117780229
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 69 (31.2 bits)