Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_33.133861.80ON46946922090.0
KLTH0F02332g1.80ON46946817330.0
SAKL0C02574g1.80ON47345615280.0
Ecym_10841.80ON49546314300.0
KLLA0C02277g1.80ON46543613041e-177
TDEL0C062101.80ON47945512661e-171
AFR671W1.80ON48842711981e-161
Suva_5.31.80ON48346811691e-156
NCAS0J018401.80ON44545211501e-154
YEL064C (AVT2)1.80ON48047011431e-153
ZYRO0F16720g1.80ON49243811411e-152
Skud_5.251.80ON48343011281e-150
Smik_5.231.80ON48345110751e-142
NDAI0I001301.80ON44442210471e-139
KNAG0C007801.80ON5134628961e-115
ZYRO0B04026g7.420ON4364161811e-13
Kpol_1045.207.420ON4663181741e-12
Kwal_27.107027.420ON4673341695e-12
TDEL0C028207.420ON4543081562e-10
Smik_2.317.420ON4594741543e-10
SAKL0F13134g7.420ON5102991519e-10
CAGL0G03619g7.420ON4603191445e-09
YBL089W (AVT5)7.420ON4594641436e-09
TPHA0C034602.295ON4733151436e-09
Smik_11.905.252ON6804231446e-09
TPHA0B029802.177ON7494541439e-09
KAFR0L019107.420ON4453111421e-08
KLTH0C06006g7.420ON4452091411e-08
NCAS0B062102.295ON4813051401e-08
Suva_5.2407.420ON4483061392e-08
AER380C2.177ON7163261374e-08
KNAG0B021907.420ON4613231357e-08
Suva_2.287.420ON4593181348e-08
Skud_11.815.252ON7124271358e-08
Smik_5.2647.420ON4482951331e-07
TBLA0C030305.252ON5234461312e-07
Skud_2.197.420ON4594711302e-07
KAFR0H036605.252ON6464121313e-07
YER119C (AVT6)7.420ON4482951293e-07
Suva_11.795.252ON7194191303e-07
Skud_5.2607.420ON4483021293e-07
CAGL0H04587g7.420ON4453181275e-07
Kpol_1032.885.252ON5754421276e-07
NCAS0E024407.420ON4953211277e-07
NDAI0E040107.420ON4713301277e-07
NCAS0F023105.252ON6684341261e-06
TPHA0K006707.420ON4643201251e-06
Kpol_505.52.177ON6874171261e-06
YKL146W (AVT3)5.252ON6924121251e-06
Ecym_71337.420ON4573111241e-06
KLLA0C13277g2.177ON7213111242e-06
CAGL0M06611g2.295ON4852991232e-06
ZYRO0A10538g5.252ON6084331242e-06
ZYRO0B09548g2.177ON7183041214e-06
Kwal_26.84012.177ON7204901215e-06
KNAG0H023305.252ON6434301205e-06
SAKL0G11462g5.252ON6164101188e-06
NDAI0C037905.252ON7214151171e-05
Kpol_1003.442.295ON4701801161e-05
SAKL0E07392g2.295ON4721641161e-05
NDAI0B035102.295ON4962031143e-05
Suva_9.1122.295ON4911221124e-05
Ecym_54082.177ON7153111125e-05
Ecym_82495.252ON6274501116e-05
Kwal_23.28395.252ON6144311108e-05
SAKL0E10362g2.177ON7333181109e-05
Suva_14.2382.177ON7163601101e-04
TDEL0F013202.177ON7154371091e-04
KNAG0A053802.295ON4741911081e-04
KLLA0E06931g7.420ON4563191072e-04
CAGL0E06468g5.252ON6814111072e-04
AGL285C7.420ON4401861053e-04
Smik_14.2242.177ON7153571044e-04
KLLA0E13795g5.252ON5734111036e-04
ZYRO0A02112g2.295ON467901026e-04
TDEL0G022502.295ON4672981026e-04
Smik_9.972.295ON4901051028e-04
Kpol_1029.62.177ON7673621029e-04
KAFR0J013202.295ON4791311010.001
YNL101W (AVT4)2.177ON7133571000.001
TPHA0F017002.177ON444139980.002
TBLA0F014007.420ON453267980.002
KAFR0D020002.177ON714336980.002
TBLA0F01390singletonON428395970.003
Skud_14.2292.177ON713360970.003
Kwal_27.114852.295ON471297960.003
KLTH0D09042g2.177ON718437960.004
YIL088C (AVT7)2.295ON490113950.004
TPHA0B025305.252ON596158950.005
KLLA0E08559g2.295ON460164950.005
TBLA0F03230singletonON561334950.005
KLTH0G10604g2.295ON468305940.007
TDEL0E037405.252ON613415940.008
Skud_9.862.295ON490214930.009
KNAG0C033807.420ON545213900.022
ADL205C2.295ON46890890.023
NDAI0I020305.220ON616205850.076
TBLA0B072102.295ON497312830.14
KNAG0I019702.177ON736167830.15
YJR001W (AVT1)5.220ON602218810.23
Smik_10.2795.220ON602216810.26
Skud_10.2235.220ON602216800.28
KAFR0J012005.220ON609223800.35
TBLA0C056302.177ON742318780.56
NDAI0F026602.177ON710204780.56
ZYRO0B10032g5.220ON609174770.74
TDEL0E040905.220ON633174770.80
CAGL0B04455g2.177ON605220761.1
SAKL0G12452g5.220ON602213732.0
ACR051C5.252ON678280732.0
NCAS0D028705.220ON609192732.1
CAGL0D03036g5.220ON622206713.5
Ecym_33352.295ON474288713.7
KLTH0G07502g5.252ON601336713.9
Suva_12.835.220ON603227689.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_33.13386
         (469 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_33.13386 s33 complement(195919..197328) [1410 bp, 469 aa] {...   855   0.0  
KLTH0F02332g Chr6 complement(192112..193521) [1410 bp, 469 aa] {...   672   0.0  
SAKL0C02574g Chr3 complement(236779..238200) [1422 bp, 473 aa] {...   593   0.0  
Ecym_1084 Chr1 complement(168749..170236) [1488 bp, 495 aa] {ON}...   555   0.0  
KLLA0C02277g Chr3 complement(192607..194004) [1398 bp, 465 aa] {...   506   e-177
TDEL0C06210 Chr3 (1130473..1131912) [1440 bp, 479 aa] {ON} Anc_1...   492   e-171
AFR671W Chr6 (1670758..1672224) [1467 bp, 488 aa] {ON} Syntenic ...   466   e-161
Suva_5.3 Chr5 complement(5485..6936) [1452 bp, 483 aa] {ON} YEL0...   454   e-156
NCAS0J01840 Chr10 (346195..347532) [1338 bp, 445 aa] {ON} Anc_1....   447   e-154
YEL064C Chr5 complement(29797..31239) [1443 bp, 480 aa] {ON}  AV...   444   e-153
ZYRO0F16720g Chr6 (1385158..1386636) [1479 bp, 492 aa] {ON} simi...   444   e-152
Skud_5.25 Chr5 complement(28970..30421) [1452 bp, 483 aa] {ON} Y...   439   e-150
Smik_5.23 Chr5 complement(32195..33646) [1452 bp, 483 aa] {ON} Y...   418   e-142
NDAI0I00130 Chr9 (12635..13969) [1335 bp, 444 aa] {ON} Anc_1.80 ...   407   e-139
KNAG0C00780 Chr3 complement(137135..138676) [1542 bp, 513 aa] {O...   349   e-115
ZYRO0B04026g Chr2 complement(339245..340555) [1311 bp, 436 aa] {...    74   1e-13
Kpol_1045.20 s1045 (42443..43843) [1401 bp, 466 aa] {ON} (42445....    72   1e-12
Kwal_27.10702 s27 (455802..457205) [1404 bp, 467 aa] {ON} YER119...    70   5e-12
TDEL0C02820 Chr3 complement(500004..501368) [1365 bp, 454 aa] {O...    65   2e-10
Smik_2.31 Chr2 (43199..44578) [1380 bp, 459 aa] {ON} YBL089W (REAL)    64   3e-10
SAKL0F13134g Chr6 complement(1038673..1040205) [1533 bp, 510 aa]...    63   9e-10
CAGL0G03619g Chr7 complement(349789..351171) [1383 bp, 460 aa] {...    60   5e-09
YBL089W Chr2 (49574..50953) [1380 bp, 459 aa] {ON}  AVT5Putative...    60   6e-09
TPHA0C03460 Chr3 complement(757629..759050) [1422 bp, 473 aa] {O...    60   6e-09
Smik_11.90 Chr11 (157718..159760) [2043 bp, 680 aa] {ON} YKL146W...    60   6e-09
TPHA0B02980 Chr2 (679253..681502) [2250 bp, 749 aa] {ON} Anc_2.1...    60   9e-09
KAFR0L01910 Chr12 complement(362409..363746) [1338 bp, 445 aa] {...    59   1e-08
KLTH0C06006g Chr3 (518793..520130) [1338 bp, 445 aa] {ON} simila...    59   1e-08
NCAS0B06210 Chr2 (1171270..1172715) [1446 bp, 481 aa] {ON} Anc_2...    59   1e-08
Suva_5.240 Chr5 complement(375238..376584) [1347 bp, 448 aa] {ON...    58   2e-08
AER380C Chr5 complement(1349610..1351760) [2151 bp, 716 aa] {ON}...    57   4e-08
KNAG0B02190 Chr2 (418852..420237) [1386 bp, 461 aa] {ON} Anc_7.4...    57   7e-08
Suva_2.28 Chr2 (46134..47513) [1380 bp, 459 aa] {ON} YBL089W (REAL)    56   8e-08
Skud_11.81 Chr11 (157889..160027) [2139 bp, 712 aa] {ON} YKL146W...    57   8e-08
Smik_5.264 Chr5 complement(408587..409933) [1347 bp, 448 aa] {ON...    56   1e-07
TBLA0C03030 Chr3 (732818..734389) [1572 bp, 523 aa] {ON} Anc_5.2...    55   2e-07
Skud_2.19 Chr2 (33154..34533) [1380 bp, 459 aa] {ON} YBL089W (REAL)    55   2e-07
KAFR0H03660 Chr8 (698211..700151) [1941 bp, 646 aa] {ON} Anc_5.2...    55   3e-07
YER119C Chr5 complement(399496..400842) [1347 bp, 448 aa] {ON}  ...    54   3e-07
Suva_11.79 Chr11 (157798..159957) [2160 bp, 719 aa] {ON} YKL146W...    55   3e-07
Skud_5.260 Chr5 (420651..421997) [1347 bp, 448 aa] {ON} YER119C ...    54   3e-07
CAGL0H04587g Chr8 (431944..433281) [1338 bp, 445 aa] {ON} simila...    54   5e-07
Kpol_1032.88 s1032 complement(188477..190204) [1728 bp, 575 aa] ...    54   6e-07
NCAS0E02440 Chr5 (477113..478600) [1488 bp, 495 aa] {ON} Anc_7.420     54   7e-07
NDAI0E04010 Chr5 (888700..890115) [1416 bp, 471 aa] {ON} Anc_7.420     54   7e-07
NCAS0F02310 Chr6 complement(458165..460171) [2007 bp, 668 aa] {O...    53   1e-06
TPHA0K00670 Chr11 (132771..134165) [1395 bp, 464 aa] {ON} Anc_7....    53   1e-06
Kpol_505.5 s505 complement(5011..7074) [2064 bp, 687 aa] {ON} co...    53   1e-06
YKL146W Chr11 (171783..173861) [2079 bp, 692 aa] {ON}  AVT3Vacuo...    53   1e-06
Ecym_7133 Chr7 (264196..265569) [1374 bp, 457 aa] {ON} similar t...    52   1e-06
KLLA0C13277g Chr3 (1135255..1137420) [2166 bp, 721 aa] {ON} simi...    52   2e-06
CAGL0M06611g Chr13 complement(681693..683150) [1458 bp, 485 aa] ...    52   2e-06
ZYRO0A10538g Chr1 (852296..854122) [1827 bp, 608 aa] {ON} simila...    52   2e-06
ZYRO0B09548g Chr2 complement(742965..745121) [2157 bp, 718 aa] {...    51   4e-06
Kwal_26.8401 s26 complement(767440..769602) [2163 bp, 720 aa] {O...    51   5e-06
KNAG0H02330 Chr8 (425024..426955) [1932 bp, 643 aa] {ON} Anc_5.2...    51   5e-06
SAKL0G11462g Chr7 (980180..982030) [1851 bp, 616 aa] {ON} simila...    50   8e-06
NDAI0C03790 Chr3 complement(863178..865343) [2166 bp, 721 aa] {O...    50   1e-05
Kpol_1003.44 s1003 complement(104836..106248) [1413 bp, 470 aa] ...    49   1e-05
SAKL0E07392g Chr5 (602503..603921) [1419 bp, 472 aa] {ON} simila...    49   1e-05
NDAI0B03510 Chr2 (882507..883997) [1491 bp, 496 aa] {ON} Anc_2.295     49   3e-05
Suva_9.112 Chr9 complement(191885..193360) [1476 bp, 491 aa] {ON...    48   4e-05
Ecym_5408 Chr5 complement(838376..840523) [2148 bp, 715 aa] {ON}...    48   5e-05
Ecym_8249 Chr8 (510061..511944) [1884 bp, 627 aa] {ON} similar t...    47   6e-05
Kwal_23.2839 s23 (38499..40343) [1845 bp, 614 aa] {ON} YKL146W -...    47   8e-05
SAKL0E10362g Chr5 complement(860653..862854) [2202 bp, 733 aa] {...    47   9e-05
Suva_14.238 Chr14 (431876..434026) [2151 bp, 716 aa] {ON} YNL101...    47   1e-04
TDEL0F01320 Chr6 (235988..238135) [2148 bp, 715 aa] {ON} Anc_2.1...    47   1e-04
KNAG0A05380 Chr1 (791957..793381) [1425 bp, 474 aa] {ON} Anc_2.2...    46   1e-04
KLLA0E06931g Chr5 (628083..629453) [1371 bp, 456 aa] {ON} simila...    46   2e-04
CAGL0E06468g Chr5 (647086..649131) [2046 bp, 681 aa] {ON} simila...    46   2e-04
AGL285C Chr7 complement(175831..177153) [1323 bp, 440 aa] {ON} S...    45   3e-04
Smik_14.224 Chr14 (414661..416808) [2148 bp, 715 aa] {ON} YNL101...    45   4e-04
KLLA0E13795g Chr5 complement(1216938..1218659) [1722 bp, 573 aa]...    44   6e-04
ZYRO0A02112g Chr1 complement(171184..172587) [1404 bp, 467 aa] {...    44   6e-04
TDEL0G02250 Chr7 complement(441289..442692) [1404 bp, 467 aa] {O...    44   6e-04
Smik_9.97 Chr9 complement(176731..178203) [1473 bp, 490 aa] {ON}...    44   8e-04
Kpol_1029.6 s1029 (11352..13655) [2304 bp, 767 aa] {ON} (11352.....    44   9e-04
KAFR0J01320 Chr10 (241859..243298) [1440 bp, 479 aa] {ON} Anc_2....    44   0.001
YNL101W Chr14 (434999..437140) [2142 bp, 713 aa] {ON}  AVT4Vacuo...    43   0.001
TPHA0F01700 Chr6 complement(387868..389202) [1335 bp, 444 aa] {O...    42   0.002
TBLA0F01400 Chr6 complement(345013..346374) [1362 bp, 453 aa] {O...    42   0.002
KAFR0D02000 Chr4 (407474..409618) [2145 bp, 714 aa] {ON} Anc_2.1...    42   0.002
TBLA0F01390 Chr6 complement(342433..343719) [1287 bp, 428 aa] {O...    42   0.003
Skud_14.229 Chr14 (425174..427315) [2142 bp, 713 aa] {ON} YNL101...    42   0.003
Kwal_27.11485 s27 (819908..821323) [1416 bp, 471 aa] {ON} YIL088...    42   0.003
KLTH0D09042g Chr4 complement(746802..748958) [2157 bp, 718 aa] {...    42   0.004
YIL088C Chr9 complement(197931..199403) [1473 bp, 490 aa] {ON}  ...    41   0.004
TPHA0B02530 Chr2 (580212..582002) [1791 bp, 596 aa] {ON} Anc_5.2...    41   0.005
KLLA0E08559g Chr5 complement(766878..768260) [1383 bp, 460 aa] {...    41   0.005
TBLA0F03230 Chr6 (785400..787085) [1686 bp, 561 aa] {ON}               41   0.005
KLTH0G10604g Chr7 complement(895162..896568) [1407 bp, 468 aa] {...    41   0.007
TDEL0E03740 Chr5 (707081..708922) [1842 bp, 613 aa] {ON} Anc_5.2...    41   0.008
Skud_9.86 Chr9 complement(173889..175361) [1473 bp, 490 aa] {ON}...    40   0.009
KNAG0C03380 Chr3 (665325..666962) [1638 bp, 545 aa] {ON} Anc_7.4...    39   0.022
ADL205C Chr4 complement(341897..343303) [1407 bp, 468 aa] {ON} S...    39   0.023
NDAI0I02030 Chr9 (472696..474546) [1851 bp, 616 aa] {ON} Anc_5.2...    37   0.076
TBLA0B07210 Chr2 (1705801..1707294) [1494 bp, 497 aa] {ON} Anc_2...    37   0.14 
KNAG0I01970 Chr9 complement(379931..382141) [2211 bp, 736 aa] {O...    37   0.15 
YJR001W Chr10 (436802..438610) [1809 bp, 602 aa] {ON}  AVT1Vacuo...    36   0.23 
Smik_10.279 Chr10 (433747..435555) [1809 bp, 602 aa] {ON} YJR001...    36   0.26 
Skud_10.223 Chr10 (404376..406184) [1809 bp, 602 aa] {ON} YJR001...    35   0.28 
KAFR0J01200 Chr10 (218990..220819) [1830 bp, 609 aa] {ON} Anc_5....    35   0.35 
TBLA0C05630 Chr3 (1364052..1366280) [2229 bp, 742 aa] {ON} Anc_2...    35   0.56 
NDAI0F02660 Chr6 complement(649723..651855) [2133 bp, 710 aa] {O...    35   0.56 
ZYRO0B10032g Chr2 complement(783526..785355) [1830 bp, 609 aa] {...    34   0.74 
TDEL0E04090 Chr5 complement(761896..763797) [1902 bp, 633 aa] {O...    34   0.80 
CAGL0B04455g Chr2 (435437..437254) [1818 bp, 605 aa] {ON} some s...    34   1.1  
SAKL0G12452g Chr7 complement(1058250..1060058) [1809 bp, 602 aa]...    33   2.0  
ACR051C Chr3 complement(448844..450880) [2037 bp, 678 aa] {ON} S...    33   2.0  
NCAS0D02870 Chr4 complement(545123..546952) [1830 bp, 609 aa] {O...    33   2.1  
CAGL0D03036g Chr4 complement(314724..316592) [1869 bp, 622 aa] {...    32   3.5  
Ecym_3335 Chr3 complement(639655..641079) [1425 bp, 474 aa] {ON}...    32   3.7  
KLTH0G07502g Chr7 (608628..610433) [1806 bp, 601 aa] {ON} simila...    32   3.9  
Suva_12.83 Chr12 (119404..121215) [1812 bp, 603 aa] {ON} YJR001W...    31   9.1  

>Kwal_33.13386 s33 complement(195919..197328) [1410 bp, 469 aa] {ON}
           YEL064C - Hypothetical ORF [contig 118] FULL
          Length = 469

 Score =  855 bits (2209), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 426/469 (90%), Positives = 426/469 (90%)

Query: 1   MSKEAANEASIQEETFSDRDELLGSSFQLSSFDRNSQRNSERLIDGSEDESTTAFLRENR 60
           MSKEAANEASIQEETFSDRDELLGSSFQLSSFDRNSQRNSERLIDGSEDESTTAFLRENR
Sbjct: 1   MSKEAANEASIQEETFSDRDELLGSSFQLSSFDRNSQRNSERLIDGSEDESTTAFLRENR 60

Query: 61  SKSNIFMAFMNMANSILGAGVIGQPFAIKNCGLVGGIFAVILLSVLVDWTIRLIVVNMKI 120
           SKSNIFMAFMNMANSILGAGVIGQPFAIKNCGLVGGIFAVILLSVLVDWTIRLIVVNMKI
Sbjct: 61  SKSNIFMAFMNMANSILGAGVIGQPFAIKNCGLVGGIFAVILLSVLVDWTIRLIVVNMKI 120

Query: 121 TGKTTYQDSVEFAMGRKGKLLILLSNGLFAXXXXXXXXXXXXDTIPHVLRAFFPGHENLF 180
           TGKTTYQDSVEFAMGRKGKLLILLSNGLFA            DTIPHVLRAFFPGHENLF
Sbjct: 121 TGKTTYQDSVEFAMGRKGKLLILLSNGLFAFGGCVGFCIIIGDTIPHVLRAFFPGHENLF 180

Query: 181 HRNIIIILVTCFISFPLSLNRNISKLSKASMLAXXXXXXXXXXXXXKGPMIDDAYKGSFN 240
           HRNIIIILVTCFISFPLSLNRNISKLSKASMLA             KGPMIDDAYKGSFN
Sbjct: 181 HRNIIIILVTCFISFPLSLNRNISKLSKASMLALVSMVFIVVIVLVKGPMIDDAYKGSFN 240

Query: 241 TTELFFTPRIFQGISVISFALVCHHNTSFIYFSLKTPSLKRFDRLTHFSCFVAMIFCFLM 300
           TTELFFTPRIFQGISVISFALVCHHNTSFIYFSLKTPSLKRFDRLTHFSCFVAMIFCFLM
Sbjct: 241 TTELFFTPRIFQGISVISFALVCHHNTSFIYFSLKTPSLKRFDRLTHFSCFVAMIFCFLM 300

Query: 301 GYTGFLVFKDRTKGNILNNFPGSDNVVNVARFCFGFNMLTTFPLEIFVLRDVIRDFMFFN 360
           GYTGFLVFKDRTKGNILNNFPGSDNVVNVARFCFGFNMLTTFPLEIFVLRDVIRDFMFFN
Sbjct: 301 GYTGFLVFKDRTKGNILNNFPGSDNVVNVARFCFGFNMLTTFPLEIFVLRDVIRDFMFFN 360

Query: 361 SKDTNQSQELSLKLHXXXXXXXXXXXXXXXXXXCNLGALFELTGATTASLMAYILPPSVN 420
           SKDTNQSQELSLKLH                  CNLGALFELTGATTASLMAYILPPSVN
Sbjct: 361 SKDTNQSQELSLKLHVILTTILVMTTMLISLTTCNLGALFELTGATTASLMAYILPPSVN 420

Query: 421 LLLIGKRSTVREKLPHYACIIFGFTIMVVSSSQTIIAYIRGGDQKHCEV 469
           LLLIGKRSTVREKLPHYACIIFGFTIMVVSSSQTIIAYIRGGDQKHCEV
Sbjct: 421 LLLIGKRSTVREKLPHYACIIFGFTIMVVSSSQTIIAYIRGGDQKHCEV 469

>KLTH0F02332g Chr6 complement(192112..193521) [1410 bp, 469 aa] {ON}
           similar to uniprot|P39981 Saccharomyces cerevisiae
           YEL064C AVT2 Putative transporter member of a family of
           seven S. cerevisiae genes (AVT1-7) related to vesicular
           GABA-glycine transporters
          Length = 469

 Score =  672 bits (1733), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 330/468 (70%), Positives = 372/468 (79%)

Query: 1   MSKEAANEASIQEETFSDRDELLGSSFQLSSFDRNSQRNSERLIDGSEDESTTAFLRENR 60
           MSK+  NE  IQ     D+   LG +F+LSSFDR+++   ERL   SED  T+ FL E R
Sbjct: 1   MSKDPFNEPFIQGRGSHDQRGPLGDNFELSSFDRSTEVRPERLSVDSEDRFTSTFLHEQR 60

Query: 61  SKSNIFMAFMNMANSILGAGVIGQPFAIKNCGLVGGIFAVILLSVLVDWTIRLIVVNMKI 120
           SKSNI MAFMNMANSILGAG+IGQPFA+KNCGL+GG+ A++LLS+LVDWTIRLIVVN++I
Sbjct: 61  SKSNILMAFMNMANSILGAGIIGQPFAVKNCGLLGGVLAIVLLSLLVDWTIRLIVVNLRI 120

Query: 121 TGKTTYQDSVEFAMGRKGKLLILLSNGLFAXXXXXXXXXXXXDTIPHVLRAFFPGHENLF 180
           +GKTTYQDSVE AMGRKGKLLILLSNGLFA            DTIPHVLRAFF GH+NLF
Sbjct: 121 SGKTTYQDSVELAMGRKGKLLILLSNGLFAFGGCIGFCIIIGDTIPHVLRAFFSGHDNLF 180

Query: 181 HRNIIIILVTCFISFPLSLNRNISKLSKASMLAXXXXXXXXXXXXXKGPMIDDAYKGSFN 240
           HRNI+I++VTC ISFPLSLNR+ISKLSKASMLA             KGP  D AYKGSFN
Sbjct: 181 HRNIVIVVVTCLISFPLSLNRDISKLSKASMLALASMVVIVVIVVIKGPGTDSAYKGSFN 240

Query: 241 TTELFFTPRIFQGISVISFALVCHHNTSFIYFSLKTPSLKRFDRLTHFSCFVAMIFCFLM 300
           ++ L  TPRIFQG+SVISFALVCHHNTSFIYFSLKTPSLKRFDRLTHFSCF+AMIFCFLM
Sbjct: 241 SSNLLITPRIFQGLSVISFALVCHHNTSFIYFSLKTPSLKRFDRLTHFSCFIAMIFCFLM 300

Query: 301 GYTGFLVFKDRTKGNILNNFPGSDNVVNVARFCFGFNMLTTFPLEIFVLRDVIRDFMFFN 360
           G+TGFLVFKD+TKGNILNNFPG+DN VNVARFCFGFNMLTTFPLEIFVLRDVI+D MFFN
Sbjct: 301 GFTGFLVFKDKTKGNILNNFPGNDNAVNVARFCFGFNMLTTFPLEIFVLRDVIKDLMFFN 360

Query: 361 SKDTNQSQELSLKLHXXXXXXXXXXXXXXXXXXCNLGALFELTGATTASLMAYILPPSVN 420
           S+  +Q + LSLKLH                  CNLGALFEL GATTASLMAYILPP VN
Sbjct: 361 SEPKSQPRVLSLKLHVIISTALVFGTMAISLTTCNLGALFELIGATTASLMAYILPPWVN 420

Query: 421 LLLIGKRSTVREKLPHYACIIFGFTIMVVSSSQTIIAYIRGGDQKHCE 468
           L L+G     R+++PHY CI FGF IM++SS+QTII+YI GGDQKHCE
Sbjct: 421 LKLVGGNLKWRDRIPHYVCIGFGFAIMLISSTQTIISYINGGDQKHCE 468

>SAKL0C02574g Chr3 complement(236779..238200) [1422 bp, 473 aa] {ON}
           similar to uniprot|P39981 Saccharomyces cerevisiae
           YEL064C AVT2 Putative transporter member of a family of
           seven S. cerevisiae genes (AVT1-7) related to vesicular
           GABA-glycine transporters
          Length = 473

 Score =  593 bits (1528), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/456 (64%), Positives = 343/456 (75%), Gaps = 14/456 (3%)

Query: 27  FQLSSFDRNSQ-----------RNSERLIDGS---EDESTTAFLRENRSKSNIFMAFMNM 72
           F+LSSFD++ Q            +  + +D     ED   +  + EN++KSNI+MAFMNM
Sbjct: 17  FELSSFDQHMQPAHASGSAADEDDETKFVDTGADVEDPLVSGIVTENQTKSNIYMAFMNM 76

Query: 73  ANSILGAGVIGQPFAIKNCGLVGGIFAVILLSVLVDWTIRLIVVNMKITGKTTYQDSVEF 132
           ANSILGAG+IGQPFAI NCGL GG+ A++LL++LVDWTIRLIVVN+K+TGKTTYQDSVEF
Sbjct: 77  ANSILGAGIIGQPFAINNCGLAGGVAAIVLLTLLVDWTIRLIVVNLKLTGKTTYQDSVEF 136

Query: 133 AMGRKGKLLILLSNGLFAXXXXXXXXXXXXDTIPHVLRAFFPGHENLFHRNIIIILVTCF 192
           AMGR+GKLLIL +NGLFA            DTIPHVLRAFFP H  LFHRN II  VT F
Sbjct: 137 AMGRRGKLLILAANGLFAFGGCIGFCIIIGDTIPHVLRAFFPAHTALFHRNAIIFFVTLF 196

Query: 193 ISFPLSLNRNISKLSKASMLAXXXXXXXXXXXXXKGPMIDDAYKGSFNTTELFFTPRIFQ 252
           +S+PLSLNR+ISKLSKASMLA             KGPM+D AYKGS   ++LF TPRIFQ
Sbjct: 197 VSYPLSLNRDISKLSKASMLALASMLLIVVIVIVKGPMLDAAYKGSLTASKLFITPRIFQ 256

Query: 253 GISVISFALVCHHNTSFIYFSLKTPSLKRFDRLTHFSCFVAMIFCFLMGYTGFLVFKDRT 312
           GISVISFALVCHHNTSFIYFSLK PSLKRF++LTH SC V+M+ CF+MGY+GFLVFKD+T
Sbjct: 257 GISVISFALVCHHNTSFIYFSLKNPSLKRFNKLTHLSCLVSMVVCFVMGYSGFLVFKDKT 316

Query: 313 KGNILNNFPGSDNVVNVARFCFGFNMLTTFPLEIFVLRDVIRDFMFFNSKDTNQSQELSL 372
           KGNILNNFP  DNV+NVARFCFGFNMLTTFPLEIFVLRDV+RD   F+S +     ELS 
Sbjct: 317 KGNILNNFPSDDNVINVARFCFGFNMLTTFPLEIFVLRDVVRDLAHFHSGEATAPAELST 376

Query: 373 KLHXXXXXXXXXXXXXXXXXXCNLGALFELTGATTASLMAYILPPSVNLLLIGKRSTVRE 432
           K H                  CNLGALFEL GATTAS+MAYILPP  NLLL G+  T+R+
Sbjct: 377 KKHVAVTSALVFLTMTVSLTTCNLGALFELIGATTASMMAYILPPLTNLLLTGRAKTLRQ 436

Query: 433 KLPHYACIIFGFTIMVVSSSQTIIAYIRGGDQKHCE 468
           KLP+Y CI+FGF +MV+SS+QTI+A I GG+QKHCE
Sbjct: 437 KLPYYGCIVFGFAVMVISSTQTILAAINGGEQKHCE 472

>Ecym_1084 Chr1 complement(168749..170236) [1488 bp, 495 aa] {ON}
           similar to Ashbya gossypii AFR671W
          Length = 495

 Score =  555 bits (1430), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 272/463 (58%), Positives = 334/463 (72%), Gaps = 4/463 (0%)

Query: 6   ANEASIQEETFSDRDELLGSSFQLSSFDRNSQRNSERLIDGSEDESTTAFLRENRSKSNI 65
           +++   +  TF D + L  +S   +  ++N Q N E  +   ED + +     NR KSN+
Sbjct: 36  SSDLQFELSTFHDYELLPTTSGARN--NKNVQNNVELNLQ-FEDPNVSQLTNPNRGKSNM 92

Query: 66  FMAFMNMANSILGAGVIGQPFAIKNCGLVGGIFAVILLSVLVDWTIRLIVVNMKITGKTT 125
           +MAFMNMANSILGAGVIGQPFAIKNCGL+GG+  ++LL+++VDWTIRLIV+N+K+TGKTT
Sbjct: 93  YMAFMNMANSILGAGVIGQPFAIKNCGLIGGVCLIVLLTIIVDWTIRLIVINLKLTGKTT 152

Query: 126 YQDSVEFAMGRKGKLLILLSNGLFAXXXXXXXXXXXXDTIPHVLRAFFPGHENLFHRNII 185
           YQDSVEFAMG KGKLLIL  NGLFA            D+IPHVL+AFFP H  LF RN++
Sbjct: 153 YQDSVEFAMGTKGKLLILFVNGLFAFGGCVGFCIIIGDSIPHVLKAFFPSHSELFRRNVV 212

Query: 186 IILVTCFISFPLSLNRNISKLSKASMLAXXXXXXXXXXXXXKGPMIDDAYKGSFNTTELF 245
           I +VT FIS+PLSLNRNISKLSKASMLA             + P ++D YKG F   E F
Sbjct: 213 ISVVTLFISYPLSLNRNISKLSKASMLALVSLLLIVALVIIRAPKVEDEYKGQFTWEEAF 272

Query: 246 FTPRIFQGISVISFALVCHHNTSFIYFSLKTPSLKRFDRLTHFSCFVAMIFCFLMGYTGF 305
            TPR+FQGIS+ISFALVCHHNTSFI+FSLK PSLKRF  LTH SC ++M+ C + GY GF
Sbjct: 273 ITPRVFQGISIISFALVCHHNTSFIFFSLKNPSLKRFGNLTHISCIISMLVCLIAGYVGF 332

Query: 306 LVFKDRTKGNILNNFPGSDNVVNVARFCFGFNMLTTFPLEIFVLRDVIRDFMFFNSKDTN 365
           L FKD+TKGNILNNFP +DN +N ARFCFGFNMLTTFPLEIFVLRDV+RD ++F S D+ 
Sbjct: 333 LTFKDKTKGNILNNFPSNDNFINFARFCFGFNMLTTFPLEIFVLRDVVRDLLYFQSADS- 391

Query: 366 QSQELSLKLHXXXXXXXXXXXXXXXXXXCNLGALFELTGATTASLMAYILPPSVNLLLIG 425
           +S  L+ K H                  CNLGAL EL G+TTASL AYILPP+  L L G
Sbjct: 392 ESIILTTKEHFIVTSVLVFISMSISLTTCNLGALLELVGSTTASLTAYILPPATTLALTG 451

Query: 426 KRSTVREKLPHYACIIFGFTIMVVSSSQTIIAYIRGGDQKHCE 468
           K  T++E+ P+YACI+FGF+IM+VSS+QTI++ I G + KHCE
Sbjct: 452 KTKTLKERTPYYACIMFGFSIMIVSSTQTILSAIYGTEIKHCE 494

>KLLA0C02277g Chr3 complement(192607..194004) [1398 bp, 465 aa] {ON}
           similar to uniprot|P39981 Saccharomyces cerevisiae
           YEL064C AVT2 Putative transporter member of a family of
           seven S. cerevisiae genes (AVT1-7) related to vesicular
           GABA-glycine transporters
          Length = 465

 Score =  506 bits (1304), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 252/436 (57%), Positives = 314/436 (72%), Gaps = 8/436 (1%)

Query: 27  FQLSSFDRNSQRNSERLID------GSEDESTTAFLRENRSKSNIFMAFMNMANSILGAG 80
            +L+SFD ++ + ++  +D        ED  T      N +KSN +MAFMNMANSILG+G
Sbjct: 28  LELTSFD-DTAKTADSAVDQNIFNVNEEDPLTDDIYLSNEAKSNRYMAFMNMANSILGSG 86

Query: 81  VIGQPFAIKNCGLVGGIFAVILLSVLVDWTIRLIVVNMKITGKTTYQDSVEFAMGRKGKL 140
           VIGQPFA+KNCG++GG+FA IL+S+LVDWTIRLIV+N+K+TGK+TYQ SVE AMG+ G L
Sbjct: 87  VIGQPFAMKNCGIIGGLFATILMSILVDWTIRLIVINLKLTGKSTYQASVETAMGQWGGL 146

Query: 141 LILLSNGLFAXXXXXXXXXXXXDTIPHVLRAFFPGHENLFHRNIIIILVTCFISFPLSLN 200
           LIL+SNGLFA            D+IPHVL AFFP H +LFHRN+II LVT FISFPLSLN
Sbjct: 147 LILVSNGLFAFGGCVGFCIIIGDSIPHVLSAFFPSHTDLFHRNVIITLVTLFISFPLSLN 206

Query: 201 RNISKLSKASMLAXXXXXXXXXXXXXKGPMIDDAYKGSFNTTELFFTPRIFQGISVISFA 260
           R+ISKLSK SMLA             K P++   YKG+F+  +LF TPRIFQGISVISFA
Sbjct: 207 RDISKLSKTSMLALLGLIAIVIIIVVKAPLVSGEYKGTFHLHQLFITPRIFQGISVISFA 266

Query: 261 LVCHHNTSFIYFSLKTPSLKRFDRLTHFSCFVAMIFCFLMGYTGFLVFKDRTKGNILNNF 320
           LVCHHNTSFI+FSL+ PSLKRF++LTH S  ++ I C    Y+GFL FKD+T GNILNNF
Sbjct: 267 LVCHHNTSFIFFSLRNPSLKRFNQLTHVSLILSCIVCLTTAYSGFLNFKDKTVGNILNNF 326

Query: 321 PGSDNVVNVARFCFGFNMLTTFPLEIFVLRDVIRDFMFFNSKDTNQSQELSLKLHXXXXX 380
           P  DNV+N AR   GFNMLTTFPLEIFVLRDVIRD +++N KD  +  +L+ K+H     
Sbjct: 327 PSDDNVINFARLLLGFNMLTTFPLEIFVLRDVIRDIIYYN-KDDPEPVKLTTKMHALITS 385

Query: 381 XXXXXXXXXXXXXCNLGALFELTGATTASLMAYILPPSVNLLLIGKRSTVREKLPHYACI 440
                         NLGAL E+ GAT+ASLMAYILPP  NL++ GK+ +++EKLP+  CI
Sbjct: 386 GLVLIIMCIALSTSNLGALLEIIGATSASLMAYILPPLTNLVITGKKKSLKEKLPYCGCI 445

Query: 441 IFGFTIMVVSSSQTII 456
           +FG  +M VS++QTI+
Sbjct: 446 VFGVILMFVSTAQTIL 461

>TDEL0C06210 Chr3 (1130473..1131912) [1440 bp, 479 aa] {ON} Anc_1.80
           YEL064C
          Length = 479

 Score =  492 bits (1266), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 248/455 (54%), Positives = 316/455 (69%), Gaps = 5/455 (1%)

Query: 18  DRDELLGSSFQLSSFDRNSQRNSERLIDGSEDESTTA-FLRENRSKSNIFMAFMNMANSI 76
           D D   G+S +    D N  + S    + + DES     LR+N  KS +  AFMNMANSI
Sbjct: 27  DFDAKPGASDETEENDSNEAKASSS--NSAIDESMVINLLRDNDKKSTMRWAFMNMANSI 84

Query: 77  LGAGVIGQPFAIKNCGLVGGIFAVILLSVLVDWTIRLIVVNMKITGKTTYQDSVEFAMGR 136
           LGAGV+GQPFAI+NCG++GGI A I+L +LVDWT+RLIV+N+ + GK TYQD+VEFA+GR
Sbjct: 85  LGAGVVGQPFAIRNCGIIGGILAYIILVLLVDWTLRLIVINLTLAGKKTYQDTVEFALGR 144

Query: 137 KGKLLILLSNGLFAXXXXXXXXXXXXDTIPHVLRAFFPGHENLFHRNIIIILVTCFISFP 196
           KG++L+LLSNGLFA            DTIPH L++ F      F RN++I +VT FIS+P
Sbjct: 145 KGRILVLLSNGLFAFGGCIGFCIIIGDTIPHFLQSIFHSSNFFFRRNVVITIVTLFISYP 204

Query: 197 LSLNRNISKLSKASMLAXXXXXXXXXXXXXKGPMIDDAYKGS-FNTTELFFTPRIFQGIS 255
           LSL RNI+ LSKAS LA             +GP +D + KG  ++ T++F +  IF+GIS
Sbjct: 205 LSLQRNIAALSKASFLALISMVVIVFSVVVQGPRVDMSLKGDKWSLTDIFISSAIFRGIS 264

Query: 256 VISFALVCHHNTSFIYFSLKTPSLKRFDRLTHFSCFVAMIFCFLMGYTGFLVFKDRTKGN 315
           VISFALVCHHNTSFI+FS+K  SL++F RLTH S F++MIFC LMGY+G+ VF+D+TKGN
Sbjct: 265 VISFALVCHHNTSFIFFSIKNRSLQKFARLTHISTFISMIFCMLMGYSGYSVFRDKTKGN 324

Query: 316 ILNNFPGSDNVVNVARFCFGFNMLTTFPLEIFVLRDVIRDFMF-FNSKDTNQSQELSLKL 374
           ILNNFP  D V+N+AR CFGFNMLTTFPLEIFVLRDVI  F++    +D  ++  LS + 
Sbjct: 325 ILNNFPQDDLVINIARLCFGFNMLTTFPLEIFVLRDVIAAFLYGKKEEDETEAPPLSTRK 384

Query: 375 HXXXXXXXXXXXXXXXXXXCNLGALFELTGATTASLMAYILPPSVNLLLIGKRSTVREKL 434
                              CNLGALFEL GATTAS MAYILPP  NL+L  + +T R+K+
Sbjct: 385 LFIITTVCVVSTMSISLTTCNLGALFELIGATTASTMAYILPPYTNLVLSKEANTFRQKV 444

Query: 435 PHYACIIFGFTIMVVSSSQTIIAYIRGGDQKHCEV 469
           PHY CI FGF +M+VSS+QTII  ++G DQ+HCE+
Sbjct: 445 PHYLCIFFGFMVMIVSSTQTIIEVVKGSDQRHCEL 479

>AFR671W Chr6 (1670758..1672224) [1467 bp, 488 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL064C (AVT2)
          Length = 488

 Score =  466 bits (1198), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 234/427 (54%), Positives = 289/427 (67%), Gaps = 6/427 (1%)

Query: 45  DGSEDESTTAFLRENRSKSNIFMAFMNMANSI-LGAGVIGQPFAIKNCGLVGGIFAVILL 103
           D  ED    A ++E++ K             + L     G    +KNCGL+GG+   +LL
Sbjct: 64  DLEEDSVLGAIVQESKGKVQYVYGLHEHGEQVSLELVWSGSRLRLKNCGLLGGLVLTMLL 123

Query: 104 SVLVDWTIRLIVVNMKITGKTTYQDSVEFAMGRKGKLLILLSNGLFAXXXXXXXXXXXXD 163
           +V+VDWTIRLI++N+K+TGKTTYQD+VEFAMGR GK  +L +NG+FA            D
Sbjct: 124 TVIVDWTIRLIIINLKLTGKTTYQDTVEFAMGRPGKYAVLFANGMFAFGGCVGFCIIIGD 183

Query: 164 TIPHVLRAFFPGHENLFHRNIIIILVTCFISFPLSLNRNISKLSKASMLAXXXXXXXXXX 223
           +IPHVLRAFFP +   F+RN+II +VT F+S+PLSLNRNISKLSKASMLA          
Sbjct: 184 SIPHVLRAFFPNYIEYFNRNMIITIVTIFVSYPLSLNRNISKLSKASMLALVSLLLIVVI 243

Query: 224 XXXKGPMIDDAYKGSFNTTELFFTPRIFQGISVISFALVCHHNTSFIYFSLKTPSLKRFD 283
              +GP + + Y+GSF+  ELF  PR+FQGISVISFALVC HNTSFIYFSL+ PSL+RF+
Sbjct: 244 IVVRGPTVGNDYRGSFDLEELFVKPRLFQGISVISFALVCLHNTSFIYFSLRKPSLRRFN 303

Query: 284 RLTHFSCFVAMIFCFLMGYTGFLVFKDRTKGNILNNFPGSDNVVNVARFCFGFNMLTTFP 343
            LTH SC ++M+ C + GY+GFL FK +TKGNILNNFP SDN +N ARFCFGFNMLTTFP
Sbjct: 304 SLTHISCTISMVVCLIAGYSGFLTFKSKTKGNILNNFPSSDNYINFARFCFGFNMLTTFP 363

Query: 344 LEIFVLRDVIRDFMFFNSKDTNQSQ--ELSLKLHXXXXXXXXXXXXXXXXXXCNLGALFE 401
           LEIFVLRDVIRD +   S +T + +   LS K H                  CNLGAL E
Sbjct: 364 LEIFVLRDVIRDLI---STETPKGEPLRLSTKRHFIITTALVLSTMGISLTTCNLGALLE 420

Query: 402 LTGATTASLMAYILPPSVNLLLIGKRSTVREKLPHYACIIFGFTIMVVSSSQTIIAYIRG 461
           L G+TTASL AYILPP  NL+L G+R   +EKLPHYACI+FGF+IMV+SS+Q II  I  
Sbjct: 421 LVGSTTASLSAYILPPMTNLILTGERRAAKEKLPHYACILFGFSIMVISSTQAIITAIHS 480

Query: 462 GDQKHCE 468
                C+
Sbjct: 481 DKSSQCD 487

>Suva_5.3 Chr5 complement(5485..6936) [1452 bp, 483 aa] {ON} YEL064C
           (REAL)
          Length = 483

 Score =  454 bits (1169), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 233/468 (49%), Positives = 306/468 (65%), Gaps = 17/468 (3%)

Query: 19  RDELLGSSFQLSSFDRNSQRNSER----------LIDGSEDESTTAFLRENRSKSNIFMA 68
           R E   ++F LS    N   +  +          +I  ++D+     LREN  KS++ MA
Sbjct: 16  RTEFELTNFPLSGITDNDSDDGSQGKDFPNTIYPIISDTDDQLVNNVLRENDKKSSMRMA 75

Query: 69  FMNMANSILGAGVIGQPFAIKNCGLVGGIFAVILLSVLVDWTIRLIVVNMKITGKTTYQD 128
           FMN+ANSILGAG+I QPFAIKN G++GG+ + I L  +VDWT+RLIV+N+ + GK TYQ 
Sbjct: 76  FMNLANSILGAGIITQPFAIKNAGIIGGLISYIALGFIVDWTLRLIVINLTLAGKRTYQG 135

Query: 129 SVEFAMGRKGKLLILLSNGLFAXXXXXXXXXXXXDTIPHVLRAFFPGHENLFH----RNI 184
           +VE+ MG+KGKLLIL +NGLFA            DTIPHVLRA F  ++   H    RN+
Sbjct: 136 TVEYVMGKKGKLLILFTNGLFAFGGCIGYCIIIGDTIPHVLRAVFSQNDGEVHFWLRRNV 195

Query: 185 IIILVTCFISFPLSLNRNISKLSKASMLAXXXXXXXXXXXXXKGPMIDDAYKG-SFNTTE 243
           III+VT FISFPLSL RNI  LSKAS LA             +GPM+   ++G +   ++
Sbjct: 196 IIIMVTIFISFPLSLKRNIEGLSKASFLAVLSMIVIVLTVVIRGPMLPYDWRGHTLKLSD 255

Query: 244 LFFTPRIFQGISVISFALVCHHNTSFIYFSLKTPSLKRFDRLTHFSCFVAMIFCFLMGYT 303
           +F    IF+ +SVISFALVCHHNTSFI+FS++  S+ +F +LTH S  +++I C LMGY+
Sbjct: 256 IFIKTTIFRSLSVISFALVCHHNTSFIFFSMRNRSVAKFTKLTHISIVISVICCGLMGYS 315

Query: 304 GFLVFKDRTKGNILNNFPGSDNVVNVARFCFGFNMLTTFPLEIFVLRDVIRDFMFFNS-- 361
           GF  FK++TKGN+LN+FPG+D  +NVAR CFGFNMLTTFP+EIFVLRDV+ + +      
Sbjct: 316 GFAAFKEKTKGNVLNSFPGTDTAINVARLCFGFNMLTTFPMEIFVLRDVVGNLLHECHLI 375

Query: 362 KDTNQSQELSLKLHXXXXXXXXXXXXXXXXXXCNLGALFELTGATTASLMAYILPPSVNL 421
           K+ ++  +LS K H                  CNLGALFEL GATTAS MAYILPP  NL
Sbjct: 376 KNYDEHTQLSNKQHTIITSMLVFITMGISLTTCNLGALFELIGATTASTMAYILPPYTNL 435

Query: 422 LLIGKRSTVREKLPHYACIIFGFTIMVVSSSQTIIAYIRGGDQKHCEV 469
           LL  K+   + KLP+Y CI FGF IM+VSS+QTI+  + G D +HC++
Sbjct: 436 LLTSKKKNWKAKLPYYFCICFGFMIMIVSSTQTILDAVNGPDGQHCQI 483

>NCAS0J01840 Chr10 (346195..347532) [1338 bp, 445 aa] {ON} Anc_1.80
           YEL064C
          Length = 445

 Score =  447 bits (1150), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 233/452 (51%), Positives = 297/452 (65%), Gaps = 16/452 (3%)

Query: 26  SFQLSSFDRNSQRNSERLIDGSEDESTTAFLRENRSKSNIFMAFMNMANSILGAGVIGQP 85
           S+ +   D  SQ     L D SE E     + EN  KSN++MAFMNMANSILGAG+I QP
Sbjct: 2   SYSMIPLDEESQ-----LPDTSE-ELAKELIEENEKKSNVYMAFMNMANSILGAGIITQP 55

Query: 86  FAIKNCGLVGGIFAVILLSVLVDWTIRLIVVNMKITGKTTYQDSVEFAMGRKGKLLILLS 145
            A+KN G++G I   ILL  +VDWT+RL+V+N+ ++ K TYQD+VE  MG+KGK LIL  
Sbjct: 56  LAVKNAGILGSIICYILLGFIVDWTLRLLVINITLSSKQTYQDTVEHVMGKKGKFLILGC 115

Query: 146 NGLFAXXXXXXXXXXXXDTIPHVLRAFFPGHENLFHRNIIIILVTCFISFPLSLNRNISK 205
           NGLFA            DTIPHVLR FF   +    RN++I L T FIS+PLSL RNI+ 
Sbjct: 116 NGLFALGGCIGFSIIIGDTIPHVLRIFFNSEK--ITRNMVIFLTTLFISYPLSLLRNIAA 173

Query: 206 LSKASMLAXXXXXXXXXXXXXKGPMIDDAYKGS-FNTTELFFTPRIFQGISVISFALVCH 264
           LSKAS LA             +GP +    KG   + + LFF+P +F+ +S+ISFALVCH
Sbjct: 174 LSKASFLALVSMVVIVFTVVIRGPALPSELKGEPLSHSSLFFSPSLFKSLSIISFALVCH 233

Query: 265 HNTSFIYFSLKTPSLKRFDRLTHFSCFVAMIFCFLMGYTGFLVFKDRTKGNILNNFPGSD 324
           HNTSFI+ S++  SL +F +LTH S F+++ FC LMGY+GF +F D+TKGNILNNFP  D
Sbjct: 234 HNTSFIFHSIRNKSLTKFTKLTHISVFISVAFCMLMGYSGFFIFTDKTKGNILNNFPAKD 293

Query: 325 NVVNVARFCFGFNMLTTFPLEIFVLRDVIRDFM----FFNSKDTNQ-SQELSLKLHXXXX 379
           N++N+AR CFGFNMLTTFPLEIFVLRDV+   +       S++ N     LS K H    
Sbjct: 294 NIINIARICFGFNMLTTFPLEIFVLRDVVAVILLECHLVPSEENNPLLPYLSRKWHFCIT 353

Query: 380 XXXXXXXXXXXXXXCNLGALFELTGATTASLMAYILPPSVNLLLIGKRSTVR--EKLPHY 437
                         CNLGALFEL G+TTAS+MAYILPP VNLLL  +R+ +    KLPHY
Sbjct: 354 TGLVFLSMGISLMTCNLGALFELIGSTTASVMAYILPPYVNLLLRQQRNELSFTTKLPHY 413

Query: 438 ACIIFGFTIMVVSSSQTIIAYIRGGDQKHCEV 469
            CI FGFT+M++SS++TI+  + G +QKHCE+
Sbjct: 414 FCIFFGFTVMIISSTETILDAVFGTEQKHCEI 445

>YEL064C Chr5 complement(29797..31239) [1443 bp, 480 aa] {ON}
           AVT2Putative transporter, member of a family of seven S.
           cerevisiae genes (AVT1-7) related to vesicular
           GABA-glycine transporters
          Length = 480

 Score =  444 bits (1143), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 236/470 (50%), Positives = 312/470 (66%), Gaps = 19/470 (4%)

Query: 19  RDELLGSSFQLSSF----------DRNSQ-RNSERLIDGSEDES-TTAFLRENRSKSNIF 66
            ++ L + F+L++F          D  SQ +NS  +I    D++     LREN  KS++ 
Sbjct: 11  ENKELRTEFELTNFPFPGTTDNDSDDGSQGQNSLNIITPDMDDTLVNDVLRENDKKSSMR 70

Query: 67  MAFMNMANSILGAGVIGQPFAIKNCGLVGGIFAVILLSVLVDWTIRLIVVNMKITGKTTY 126
           MAFMN+ANSILGAG+I QPFAIKN G++GG+ + + L  +VDWT+RLIV+N+ + GK TY
Sbjct: 71  MAFMNLANSILGAGIITQPFAIKNAGILGGLLSYVALGFIVDWTLRLIVINLTLAGKRTY 130

Query: 127 QDSVEFAMGRKGKLLILLSNGLFAXXXXXXXXXXXXDTIPHVLRAFFPGHENLFH----R 182
           Q +VE  MG+KGKLLIL +NGLFA            DTIPHVLRA F  ++   H    R
Sbjct: 131 QGTVEHVMGKKGKLLILFTNGLFAFGGCIGYCIIIGDTIPHVLRAIFSQNDGNVHFWLRR 190

Query: 183 NIIIILVTCFISFPLSLNRNISKLSKASMLAXXXXXXXXXXXXXKGPMIDDAYKG-SFNT 241
           N+II++VT FISFPLS+ RNI  LSKAS LA             +GPM+   +KG S   
Sbjct: 191 NVIIVMVTTFISFPLSMKRNIEALSKASFLAVISMIIIVLTVVIRGPMLPYDWKGHSLKL 250

Query: 242 TELFFTPRIFQGISVISFALVCHHNTSFIYFSLKTPSLKRFDRLTHFSCFVAMIFCFLMG 301
           ++ F    IF+ +SVISFALVCHHNTSFI+FS++  S+ +F RLTH S  +++I C LMG
Sbjct: 251 SDFFMKATIFRSLSVISFALVCHHNTSFIFFSMRNRSVAKFTRLTHISIIISVICCALMG 310

Query: 302 YTGFLVFKDRTKGNILNNFPGSDNVVNVARFCFGFNMLTTFPLEIFVLRDVIRDFMFFNS 361
           Y+GF VFK++TKGN+LN+FPG+D  +N+AR CFGFNMLTTFP+EIFVLRDV+ + +   +
Sbjct: 311 YSGFAVFKEKTKGNVLNSFPGTDTAINIARLCFGFNMLTTFPMEIFVLRDVVGNLLHECN 370

Query: 362 --KDTNQSQELSLKLHXXXXXXXXXXXXXXXXXXCNLGALFELTGATTASLMAYILPPSV 419
             K+ ++  +LS K H                  CNLGALFEL GATTAS MAYILPP  
Sbjct: 371 LIKNYDEHTQLSGKQHVVITSSLVFITMGISLTTCNLGALFELIGATTASTMAYILPPYT 430

Query: 420 NLLLIGKRSTVREKLPHYACIIFGFTIMVVSSSQTIIAYIRGGDQKHCEV 469
           NLLL  K+ + +E+LP Y CI FGF IM++SS+QTII  + G D +HC++
Sbjct: 431 NLLLTSKKKSWKERLPFYLCICFGFMIMIISSTQTIIDAVNGSDGQHCQI 480

>ZYRO0F16720g Chr6 (1385158..1386636) [1479 bp, 492 aa] {ON} similar
           to uniprot|P39981 Saccharomyces cerevisiae YEL064C AVT2
           Putative transporter member of a family of seven S.
           cerevisiae genes (AVT1-7) related to vesicular
           GABA-glycine transporters
          Length = 492

 Score =  444 bits (1141), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 231/438 (52%), Positives = 288/438 (65%), Gaps = 6/438 (1%)

Query: 35  NSQRNSERLIDGS---EDESTTAFLRENRSKSNIFMAFMNMANSILGAGVIGQPFAIKNC 91
           N   N E  ID +   +DE     +REN  KS +  AFMNMANSILGAGVIGQP AIKN 
Sbjct: 58  NDTTNLEYGIDDNYDNDDEFVNDVIRENNKKSTMKWAFMNMANSILGAGVIGQPIAIKNS 117

Query: 92  GLVGGIFAVILLSVLVDWTIRLIVVNMKITGKTTYQDSVEFAMGRKGKLLILLSNGLFAX 151
           G+VG I A ++L VLVDWT+RLIV+N+ + GK TYQD+V FAMG++G++ +L +NGLFA 
Sbjct: 118 GIVGAIIAYLVLFVLVDWTLRLIVINLTLAGKKTYQDTVAFAMGKRGRIAVLTANGLFAF 177

Query: 152 XXXXXXXXXXXDTIPHVLRAFFPGHENLFHRNIIIILVTCFISFPLSLNRNISKLSKASM 211
                      DT+PHV RAF   +     R +II +VT  IS+PL+L RNI+ LSKAS 
Sbjct: 178 GGCIGFCIIIGDTLPHVFRAFIHQNSVFLSRRLIITIVTICISYPLALQRNIAALSKASF 237

Query: 212 LAXXXXXXXXXXXXXKGPMIDDAYKGSFNTTELFFTPRIFQGISVISFALVCHHNTSFIY 271
           LA             +GP I  A +      ++  TPRIF+GISVISFALVCHHNTSFIY
Sbjct: 238 LALISMVIIVFTVIIRGPEI-HAKRDPLTWEDILVTPRIFRGISVISFALVCHHNTSFIY 296

Query: 272 FSLKTPSLKRFDRLTHFSCFVAMIFCFLMGYTGFLVFKDRTKGNILNNFPGSDNVVNVAR 331
           FS+K  SL++F+RLTH S  ++++FC +MG++GF  F   TKGN+LNNF   D  VN+AR
Sbjct: 297 FSIKNRSLRKFNRLTHISTSISVVFCMIMGFSGFAAFGQNTKGNVLNNFSADDKAVNIAR 356

Query: 332 FCFGFNMLTTFPLEIFVLRDVIRDFMFFNSKDTNQSQELSLKLHXXXXXXXXXXXXXXXX 391
            CFGFNMLTTFPLEIFVLRDVI  F+    +       LS   H                
Sbjct: 357 LCFGFNMLTTFPLEIFVLRDVIASFI-GGHQPNGDPNVLSKSNHFIITTILVFGTMSISL 415

Query: 392 XXCNLGALFELTGATTASLMAYILPPSVNLLLIGKRSTVREKLPHYACIIFGFTIMVVSS 451
             CNLGA+FEL GATTAS+MAYILPP VNLLL   + T R+KLPH+ACI FGF+IM++SS
Sbjct: 416 LTCNLGAIFELIGATTASMMAYILPPWVNLLLTSDK-TFRQKLPHFACIAFGFSIMLISS 474

Query: 452 SQTIIAYIRGGDQKHCEV 469
            QTI+  + G D+K CE+
Sbjct: 475 IQTILDTMNGTDEKQCEL 492

>Skud_5.25 Chr5 complement(28970..30421) [1452 bp, 483 aa] {ON}
           YEL064C (REAL)
          Length = 483

 Score =  439 bits (1128), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 229/430 (53%), Positives = 289/430 (67%), Gaps = 7/430 (1%)

Query: 47  SEDESTTAFLRENRSKSNIFMAFMNMANSILGAGVIGQPFAIKNCGLVGGIFAVILLSVL 106
           ++D    + LREN  KS++ MAFMN+ANSILGAG+I QP AIKN G++GG+ A I L  +
Sbjct: 54  TDDPLVNSVLRENDKKSSMRMAFMNLANSILGAGIITQPVAIKNAGILGGLIAYIALGFI 113

Query: 107 VDWTIRLIVVNMKITGKTTYQDSVEFAMGRKGKLLILLSNGLFAXXXXXXXXXXXXDTIP 166
           VDWT+RLIV+N+ + GK TYQ +VE  MG+KGKLLIL +NGLFA            DTIP
Sbjct: 114 VDWTLRLIVINLTLAGKRTYQGTVEHVMGKKGKLLILFTNGLFAFGGCIGYCIIIGDTIP 173

Query: 167 HVLRAFFPGHENLFH----RNIIIILVTCFISFPLSLNRNISKLSKASMLAXXXXXXXXX 222
           HVLRA F  ++   H    RN+II+LVT FISFPLSL RNI  LSKAS LA         
Sbjct: 174 HVLRAVFSQNDGEVHFWLRRNVIIVLVTIFISFPLSLKRNIEGLSKASFLAVISMIIIVL 233

Query: 223 XXXXKGPMIDDAYKG-SFNTTELFFTPRIFQGISVISFALVCHHNTSFIYFSLKTPSLKR 281
               +GPM+   +KG S    +      IF+ +SVISFALVCHHNTSFI+FS++  S+ +
Sbjct: 234 TVVIRGPMLPYDWKGHSLKWPDFLVKTTIFRSLSVISFALVCHHNTSFIFFSMRNRSVAK 293

Query: 282 FDRLTHFSCFVAMIFCFLMGYTGFLVFKDRTKGNILNNFPGSDNVVNVARFCFGFNMLTT 341
           F RLTH S  +++I C LMG++GF  FK++TKGN+LNNFPG+D  +NVAR CFGFNMLTT
Sbjct: 294 FTRLTHISIIISVICCGLMGFSGFAAFKEKTKGNVLNNFPGTDTAINVARLCFGFNMLTT 353

Query: 342 FPLEIFVLRDVIRDFMFFNS--KDTNQSQELSLKLHXXXXXXXXXXXXXXXXXXCNLGAL 399
           FP+EIFVLRDV+ + +      K  ++  +LS K H                  CNLGAL
Sbjct: 354 FPMEIFVLRDVVGNSLHECHLIKSYDEHTQLSDKQHTIITSLLVFITMSISLTTCNLGAL 413

Query: 400 FELTGATTASLMAYILPPSVNLLLIGKRSTVREKLPHYACIIFGFTIMVVSSSQTIIAYI 459
           FEL G+TTAS MAYILPP  NLLL  K+   + KLP+Y CI FGF IM+VSS+QTI+  I
Sbjct: 414 FELIGSTTASTMAYILPPYTNLLLTSKKKNWKAKLPYYLCICFGFMIMIVSSTQTILDAI 473

Query: 460 RGGDQKHCEV 469
            G D++HCE+
Sbjct: 474 NGADEQHCEI 483

>Smik_5.23 Chr5 complement(32195..33646) [1452 bp, 483 aa] {ON}
           YEL064C (REAL)
          Length = 483

 Score =  418 bits (1075), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 232/451 (51%), Positives = 297/451 (65%), Gaps = 11/451 (2%)

Query: 30  SSFDRNSQRNSERLI----DGSEDESTTAFLRENRSKSNIFMAFMNMANSILGAGVIGQP 85
           +S DR+  ++S + I      ++D      L EN  KS++ MAFMN+ANSILGAG+I QP
Sbjct: 33  NSDDRSQGKDSLKAIYPIASDTDDTLVNKVLLENDKKSSMRMAFMNLANSILGAGIITQP 92

Query: 86  FAIKNCGLVGGIFAVILLSVLVDWTIRLIVVNMKITGKTTYQDSVEFAMGRKGKLLILLS 145
           FAIKN G++GG+ + I L  +VDWT+RLIV+N+ + GK TYQ +VE  MG+KGKLLIL +
Sbjct: 93  FAIKNAGILGGLISYIALGFIVDWTLRLIVINLTLAGKRTYQGTVEHVMGKKGKLLILFT 152

Query: 146 NGLFAXXXXXXXXXXXXDTIPHVLRAFFPGHENLFH----RNIIIILVTCFISFPLSLNR 201
           NGLFA            DTIPHVLRA F   +   H    RN+III+VT FISFPLSL R
Sbjct: 153 NGLFAFGGCIGYCIIIGDTIPHVLRAIFSQKDGDIHFWLRRNVIIIIVTIFISFPLSLKR 212

Query: 202 NISKLSKASMLAXXXXXXXXXXXXXKGPMIDDAYKG-SFNTTELFFTPRIFQGISVISFA 260
           NI  LSKAS LA             +GPM+   +KG S    + F    IF+ +SVISFA
Sbjct: 213 NIEALSKASFLAVISMIIIVVTVVIRGPMLPYDWKGHSLQLRDFFVKTTIFRSLSVISFA 272

Query: 261 LVCHHNTSFIYFSLKTPSLKRFDRLTHFSCFVAMIFCFLMGYTGFLVFKDRTKGNILNNF 320
           LVCHHNTSFI+FS++  S+ +F RLTH S  +++I C LMGY+GF  FK++TKGNILN+F
Sbjct: 273 LVCHHNTSFIFFSMRNRSVAKFTRLTHISIIISVICCGLMGYSGFAAFKEKTKGNILNSF 332

Query: 321 PGSDNVVNVARFCFGFNMLTTFPLEIFVLRDVIRDFMFFNS--KDTNQSQELSLKLHXXX 378
           PG+D  +N+AR CFGFNMLTTFP+EIFVLRDV+ + +      K+ ++  +LS K H   
Sbjct: 333 PGTDTAINIARLCFGFNMLTTFPMEIFVLRDVVGNLLHECKIIKNYDEHTQLSGKQHIVI 392

Query: 379 XXXXXXXXXXXXXXXCNLGALFELTGATTASLMAYILPPSVNLLLIGKRSTVREKLPHYA 438
                          CNLGALFEL GATTAS MAYILPP  NLLL  K+ +   KLP Y 
Sbjct: 393 TSLLVFITMGISLTTCNLGALFELIGATTASTMAYILPPYTNLLLTSKKKSWSAKLPFYL 452

Query: 439 CIIFGFTIMVVSSSQTIIAYIRGGDQKHCEV 469
           CI FGF IM++SS+QTI+  + G D +HC++
Sbjct: 453 CICFGFMIMIISSTQTILDAVNGSDGQHCQI 483

>NDAI0I00130 Chr9 (12635..13969) [1335 bp, 444 aa] {ON} Anc_1.80
           YEL064C
          Length = 444

 Score =  407 bits (1047), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 210/422 (49%), Positives = 271/422 (64%), Gaps = 10/422 (2%)

Query: 56  LRENRSKSNIFMAFMNMANSILGAGVIGQPFAIKNCGLVGGIFAVILLSVLVDWTIRLIV 115
           + EN  KSNI+MAF+NMANSILGAG+I QP A+KN GL   I   I+L  +VDWT+RL++
Sbjct: 25  IDENNKKSNIYMAFVNMANSILGAGIITQPLAVKNAGLCASIVIYIMLGFIVDWTLRLLI 84

Query: 116 VNMKITGKTTYQDSVEFAMGRKGKLLILLSNGLFAXXXXXXXXXXXXDTIPHVLRAFFPG 175
            N+ ++ K TY D+VE+ MGRKGK LIL  NGLFA            DTIPHVLR F   
Sbjct: 85  TNITLSSKLTYGDTVEYTMGRKGKYLILCCNGLFALGGCIGFCIIIGDTIPHVLRIFI-- 142

Query: 176 HENLFHRNIIIILVTCFISFPLSLNRNISKLSKASMLAXXXXXXXXXXXXXKGPMIDDAY 235
           H +   RN +I   T FIS+PLSL R+IS LS  S LA              GP +    
Sbjct: 143 HSHFVTRNSVIFFSTLFISYPLSLLRDISALSSTSFLALISMTVIVMTVVVFGPSLPAEL 202

Query: 236 KGS-FNTTELFFTPRIFQGISVISFALVCHHNTSFIYFSLKTPSLKRFDRLTHFSCFVAM 294
           KGS   ++    +P +F+ +S++SFALVCHHNTSFI+ S++  SL +F +LTH S F+++
Sbjct: 203 KGSGIPSSSYVASPSLFRSLSIVSFALVCHHNTSFIFHSIRNKSLTKFTKLTHLSVFISV 262

Query: 295 IFCFLMGYTGFLVFKDRTKGNILNNFPGSDNVVNVARFCFGFNMLTTFPLEIFVLRDVIR 354
           IFC +MGY GF +F  +TKGNILNNFP +   +N+AR CFGFNMLTT PLE+FVLRDVI 
Sbjct: 263 IFCMIMGYAGFFIFTGKTKGNILNNFPPNGVAINIARVCFGFNMLTTLPLELFVLRDVIA 322

Query: 355 DFMFFNSKDTNQSQE-----LSLKLHXXXXXXXXXXXXXXXXXXCNLGALFELTGATTAS 409
             +  N    +  ++     L+ K H                  CNLGALFEL GATTAS
Sbjct: 323 VILLENEWIPSIEEKPGMPILTRKWHFIVTTIIVFLTMSVSLLTCNLGALFELVGATTAS 382

Query: 410 LMAYILPPSVNLLLIGKRS--TVREKLPHYACIIFGFTIMVVSSSQTIIAYIRGGDQKHC 467
           +MAYILPP VNLLL  ++    ++ K+PHY CI+FGFT+M+VSS QTI+  +   +QKHC
Sbjct: 383 VMAYILPPYVNLLLRQEKEPLPIKSKIPHYFCILFGFTVMIVSSFQTIVEALADNEQKHC 442

Query: 468 EV 469
           E+
Sbjct: 443 EI 444

>KNAG0C00780 Chr3 complement(137135..138676) [1542 bp, 513 aa] {ON}
           Anc_1.80 YEL064C
          Length = 513

 Score =  349 bits (896), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 198/462 (42%), Positives = 260/462 (56%), Gaps = 47/462 (10%)

Query: 48  EDESTTAFLRENRSKSNIFMAFMNMANSILGAGVIGQPFAIKNCGLVGGIFAVILLSVLV 107
           E+      +  N  KS + MAFMNMANSILGAG+I QPFA++  G++G     I L  LV
Sbjct: 23  ENPLIAGIIETNEEKSPLHMAFMNMANSILGAGIISQPFAVREAGVLGAFVVYIALGFLV 82

Query: 108 DWTIRLIVVNMKITGKTTYQDSVEFAMGRKGKLLILLSNGLFAXXXXXXXXXXXXDTIPH 167
           DWT+RLIV N+ ITG  TYQ+SV  A+G  G+L ILL+NGLFA            DTIPH
Sbjct: 83  DWTLRLIVQNLVITGTETYQESVAVALGEPGRLAILLANGLFAFGGCVAFCIIIGDTIPH 142

Query: 168 VLRAFFPGHENLFHRNIIIILVTCFISFPLSLNRNISKLSKASMLAXXXXXXXXXXXXXK 227
           VLR   P       RN +II+VT  IS PLSL++ I +L +AS LA             +
Sbjct: 143 VLRTVCP--PQYIERNWVIIVVTLLISLPLSLSKKIKQLERASFLALVSMAVIVVTVAVR 200

Query: 228 GPMIDDAYKG--SFNTTELFFTPRIFQGISVISFALVCHHNTSFIYFSLKTPSLKRFDRL 285
           GP +    K   S    + +F   IF+ +S++SFALVCHHNTSFI+ SL+  S+ +F+RL
Sbjct: 201 GPFLPSELKSQVSLFAPQWWFRKTIFKSVSIVSFALVCHHNTSFIFHSLRNKSIYKFNRL 260

Query: 286 THFSCFVAMIFCFLMGYTGFLVFKDRTKGNILNNFPGSDNVVNVARFCFGFNMLTTFPLE 345
           TH+SC V++  C LMGYTGF  FK++TKGN+LNNF G D  +NVAR  FGFNMLTTFPLE
Sbjct: 261 THWSCAVSVSVCMLMGYTGFHTFKEKTKGNVLNNFSGDDGWINVARLFFGFNMLTTFPLE 320

Query: 346 IFVLRDVIRDFMFFNSKDTNQSQ------------------------------------- 368
           IFVLR+V+ D     +    Q +                                     
Sbjct: 321 IFVLRNVVLDIWAGPTHRWYQHRRHHPPRGGHTATQQPPPPEPHGSSPARGPAGPHPGLP 380

Query: 369 ---ELSLKLHXXXXXXXXXXXXXXXXXXCNLGALFELTGATTASLMAYILPPSVNLLLIG 425
              E S + H                  CNLGAL E+ G+TT +L AYILPP  ++LL  
Sbjct: 381 PDPEPSEQPHTAVTVVLVLATMGVALVTCNLGALLEVIGSTTGALTAYILPPLTHVLLTR 440

Query: 426 KRS---TVREKLPHYACIIFGFTIMVVSSSQTIIAYIRGGDQ 464
           +R    T RE+L H  C++FG T+M+VS++QT++ + R   +
Sbjct: 441 RRPQPHTARERLGHCCCVVFGCTVMLVSTTQTLLDWSRSAGR 482

>ZYRO0B04026g Chr2 complement(339245..340555) [1311 bp, 436 aa] {ON}
           similar to uniprot|P40074 Saccharomyces cerevisiae
           YER119C AVT6 Vacuolar transporter exports aspartate and
           glutamate from the vacuole and to YBL089W uniprot|P38176
           Saccharomyces cerevisiae YBL089W AVT5 Putative
           transporter, members of a family of seven S. cerevisiae
           genes (AVT1-7) related to vesicular GABA-glycine
           transporters
          Length = 436

 Score = 74.3 bits (181), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 92/416 (22%), Positives = 160/416 (38%), Gaps = 39/416 (9%)

Query: 78  GAGVIGQPFAIKNCGLVGGIFAVILLSVLVDWTIRLIV-VNMKITGKTTYQDSVEFAMGR 136
           GAG++  P+  K  GL  GI A+   S+     + L   V   +  +T    S+   +  
Sbjct: 18  GAGILAMPYGFKTLGLTFGILALGFCSLCAMTGLLLQAQVARYVPERTASFFSLTQLIHP 77

Query: 137 KGKLLILLSNGLFAXXXXXXXXXXXXDTIPHVLRAFFPGHENLFHRNIIIILVTCFISFP 196
           K  ++  L+  +              D IP +   F   ++ L  RN  I +V  F+  P
Sbjct: 78  KLSVVFDLAIAIKCFGVGVSYMIVVGDLIPQIFTTF-TSNKILLERNFHITMVMLFLVSP 136

Query: 197 LSLNRNISKLSKASMLAXXXXXXXXXXXXXK--GPMID-DAYKGSFNTTELFFTPRIFQG 253
           L   + ++ L KAS++A                 P  + D  KG  +       P     
Sbjct: 137 LCFMKRLTSLRKASLVALSSVAYLCCLVVVHFIWPSNEIDQRKGKVSIGFPRNEPTPLTT 196

Query: 254 ISVISFALVCHHNTSFIYFSLKTPSLKRFDRLTHFSCFVAMIFCFLMGYTGFLVFKDRTK 313
           + +  FA  CHHN   +Y   K  S ++ +++  +   +A +   ++G  G+L F D   
Sbjct: 197 LPIFVFAYTCHHNAFSVYNEQKDTSTRQLNKIGRYGMSIAFVLYTIIGGAGYLTFGDHIA 256

Query: 314 GNILNNFPGSDNVVNVARFCFGFNMLTTFPLEIFVLRDVIRDFMF-FNSKDTN------- 365
           GNI+  +P S +   + R      ++  FPL+    R  I + ++ F S + N       
Sbjct: 257 GNIITLYPPSLS-TTIGRVAIVLLVMLAFPLQCHPARSSINNILYSFQSVEKNLQGQTEN 315

Query: 366 ----------QSQ-------ELSLKLHXXXXXXXXXXXXXXXXXXCNLGALFELTGATTA 408
                     +SQ        L  K                     +L  L  + G+T +
Sbjct: 316 SNLISEEESVESQAHGPPVPPLQGKRFTVITLVILIASYLLAISVTSLARLLAIVGSTGS 375

Query: 409 SLMAYILPPSVNLLLIGKRSTVRE-----KLPHYACI---IFGFTIMVVSSSQTII 456
           + +++ILP      LIG   T  E     K   +A +   I+GF +M+ S + +I+
Sbjct: 376 TSISFILPGIFGYWLIGSEYTPEELPRNLKFAKFAGLLLAIWGFIVMIASLAASIL 431

>Kpol_1045.20 s1045 (42443..43843) [1401 bp, 466 aa] {ON}
           (42445..43845) [1401 nt, 467 aa]
          Length = 466

 Score = 71.6 bits (174), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 74/318 (23%), Positives = 129/318 (40%), Gaps = 17/318 (5%)

Query: 62  KSNIFMAFMNMANSILGAGVIGQPFAIKNCGLVGGIFAVILLSVLVDWTIRLIVVNMKIT 121
            S++    + + ++  GAG++  P+A K  GL+ G   +I+  +     + L     +++
Sbjct: 2   SSSVRSGVLTLLHTACGAGILAMPYAFKPYGLITGFIMIIICGICAMIGLLL---QSRVS 58

Query: 122 GKTTYQDSVEFAMGR--KGKLLIL--LSNGLFAXXXXXXXXXXXXDTIPHVLRAFFPGHE 177
                +++  F + +     L I+  L+  +              D +P VL  F   HE
Sbjct: 59  SYVPVRNASFFTLTQITNPNLSIVFDLAIAIKCFGVGVSYMIVVGDVLPQVLSTF-TNHE 117

Query: 178 NLFHRNIIIILVTCFISFPLSLNRNISKLSKASMLAXXXXXXXXXXXXXKGPMIDDA--- 234
            L +RN+ I LV  FI  PL   +N++ L  ASMLA                M +D    
Sbjct: 118 WLLNRNVNITLVMLFIVTPLCFLKNLNSLRYASMLAISSVAYLCALVLIHFIMPNDETHN 177

Query: 235 YKG--SFNTTELFFTPRIFQGISVISFALVCHHNTSFIYFSLKTPSLKRFDRLTHFSCFV 292
           +KG  S+   +    P     + +  FA  CHHN   +      P+     ++   S  +
Sbjct: 178 FKGDVSWGLPKNGLNP--LTTLPIYVFAYTCHHNMFSVINEQMDPTYNSVKKIAIISMIL 235

Query: 293 AMIFCFLMGYTGFLVFKDRTKGNILNNFPGSDNVVNVARFCFGFNMLTTFPLEIFVLRDV 352
           A     L+G  G+L F D   GNI+  +P + +   + R    F +   FPL+    R  
Sbjct: 236 AGFLYILIGGAGYLTFGDHITGNIITLYPQNIS-TTIGRIAIIFLVTLAFPLQCHPARAS 294

Query: 353 IRDFM-FFNSKDTNQSQE 369
           I   + +F     N++  
Sbjct: 295 INHIIHYFKPAQDNKNSN 312

>Kwal_27.10702 s27 (455802..457205) [1404 bp, 467 aa] {ON} YER119C -
           Hypothetical ORF [contig 33] FULL
          Length = 467

 Score = 69.7 bits (169), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 74/334 (22%), Positives = 127/334 (38%), Gaps = 29/334 (8%)

Query: 58  ENRSKSNIFMAFMNMANSILGAGVIGQPFAIKNCGLVGGIFAVILLSVLVDWTIRLIVVN 117
            N   S++    + + ++  GAG++  P+A K  GLV G   ++         + L    
Sbjct: 21  PNAMSSSVGSGVLTLLHTACGAGILAMPYAFKPFGLVLGFCMIVFCGACSATGLML---Q 77

Query: 118 MKITGKTTYQDSVEFAMGR----KGKLLILLSNGLFAXXXXXXXXXXXXDTIPHVLRAFF 173
            +++     +++  FA+ +    +  ++  L+  +              D +P +  A F
Sbjct: 78  ARVSKYAKERNASFFALSQITYPQLSVVFDLAIAVKCFGVGVSYLVVVGDLMPRIF-ATF 136

Query: 174 PGHENLFHRNIIIILVTCFISFPLSLNRNISKLSKASMLAXXXXXXXXXXXXX------- 226
             H  L +RN  I LV   I  PL   R +  L  ASM+A                    
Sbjct: 137 TSHSLLLNRNFHITLVMALIVSPLCFMRRLDSLRYASMIAVSSVAYLCVLVVVHFLFPSE 196

Query: 227 -----KGPMIDDAYKGSFNTTELFFTPRIFQGISVISFALVCHHNTSFIYFSLKTPSLKR 281
                KG +      GSF+         +     +  FA  CHHN   I   L+  SLK 
Sbjct: 197 ELRELKGYVSIQKPAGSFSA--------LLSCFPIFVFAYTCHHNMFSIINELRDNSLKG 248

Query: 282 FDRLTHFSCFVAMIFCFLMGYTGFLVFKDRTKGNILNNFPGSDNVVNVARFCFGFNMLTT 341
             ++   S  ++M    L+G +G+  F D   GNI+  +P S     + R      ++  
Sbjct: 249 IYKVCAISVALSMTLYLLIGGSGYATFGDNVPGNIITLYPQSTT-TTIGRVAIALLVMLA 307

Query: 342 FPLEIFVLRDVIRDFMFFNSKDTNQSQELSLKLH 375
           FPL+    R  I   + + SK ++   + S   H
Sbjct: 308 FPLQCHPARASIDHIIQYFSKASDNPLQNSEASH 341

>TDEL0C02820 Chr3 complement(500004..501368) [1365 bp, 454 aa] {ON}
           Anc_7.420 YER119C
          Length = 454

 Score = 64.7 bits (156), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 64/308 (20%), Positives = 122/308 (39%), Gaps = 14/308 (4%)

Query: 70  MNMANSILGAGVIGQPFAIKNCGLVGGIFAVILLSVLVDWTIRLIVVNMKITGKTTYQDS 129
           + + ++  GAGV+  P+  K  GL+ G+  +I  ++    ++  +++  K+      + +
Sbjct: 10  ITLLHTACGAGVLAMPYGFKPFGLIPGLLVIIFCALC---SLGGLLLQAKVARYVPEKSA 66

Query: 130 VEFAMGR----KGKLLILLSNGLFAXXXXXXXXXXXXDTIPHVLRAFFPGHENLFHRNII 185
             F + +       ++  ++  +              D  P +   F   H  L  RN+ 
Sbjct: 67  SFFTLTQIINPNLSVIFDIAIAIKCFGVGVSYMIVVGDLTPQIASVFTSNHL-LLDRNVH 125

Query: 186 IILVTCFISFPLSLNRNISKLSKASMLAXXXXXXXXXXX----XXKGPMIDDAYKGSFNT 241
           I L+  FI  PL   + +S L  AS++A                     I D  KG  + 
Sbjct: 126 ITLIMLFIVSPLCFLKRLSSLRYASLIALLSVAYLCVLIFIHFVWPSEEIHD-LKGHVSL 184

Query: 242 TELFFTPRIFQGISVISFALVCHHNTSFIYFSLKTPSLKRFDRLTHFSCFVAMIFCFLMG 301
                       + +  FA  CHHN   +    K  S +   ++  ++ F+A+    L+G
Sbjct: 185 WIPHDETNPLTTLPIFVFAYTCHHNMFSVINEQKDTSFRHIKKVAIYAMFLALSLYLLIG 244

Query: 302 YTGFLVFKDRTKGNILNNFPGSDNVVNVARFCFGFNMLTTFPLEIFVLRDVIRDFMFFNS 361
             G+L F D   GNI+  +P   +   V R      ++  FPL+    R  I   +F+  
Sbjct: 245 GMGYLTFGDHIIGNIIKLYPQFAS-TTVGRIAIVLLVMLAFPLQCHPARASINHILFYLQ 303

Query: 362 KDTNQSQE 369
           +  +QS++
Sbjct: 304 EHLSQSKQ 311

>Smik_2.31 Chr2 (43199..44578) [1380 bp, 459 aa] {ON} YBL089W (REAL)
          Length = 459

 Score = 63.9 bits (154), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 100/474 (21%), Positives = 171/474 (36%), Gaps = 103/474 (21%)

Query: 62  KSNIFMAFMNMANSILGAGVIGQPFAIKNCGLVGGIFAVILLSVLVDWTIRLIVVNMKIT 121
            SN+    + + ++  GAGV+  PFA K  GL+ G+  +    +    ++  +++  +I 
Sbjct: 2   SSNVLSGVLTLLHTACGAGVLAMPFAFKPFGLMPGLITLTFCGI---CSLCGLLLQTRIA 58

Query: 122 GKTTYQDSVEFAMGRKGKLLILLSNGL-----FAXXXX-----XXXXXXXXDTIPHVLRA 171
                 ++  FA     KL  L++  L     FA                 D +P ++++
Sbjct: 59  KYVPKSENASFA-----KLTQLINPSLSIVFDFAIAVKCFGVGVSYLIIVGDLVPQIVQS 113

Query: 172 FF----------PGHENLFHRNIIIILVTCFISFPLSLNRNISKLSKASMLAXXXXXXXX 221
            F            H  L  R + I LV  F+  PL   R+++ L  ASM+A        
Sbjct: 114 IFYHNDDSTGGLQEHHRLLDRRLYITLVMMFVIAPLCFKRSLNSLRYASMIAIISVAYLS 173

Query: 222 XXXXX---------KG------PMIDDAYKGSFNTTELFFTPRIFQGISVISFALVCHHN 266
                         +G      P  D +      T  +F             FA  CHHN
Sbjct: 174 GLIIYHFLNRHQLERGQVYFMVPHRDSSSHSPLTTLPIFV------------FAYTCHHN 221

Query: 267 TSFIYFSLKTPSLKRFDRLTHFSCFVAMIFCFLMGYTGFLVFKDRTKGNILNNFPGSDNV 326
              +       + +   R+  F+   A I   ++G  G++ F +   GNIL  +P S + 
Sbjct: 222 MFSVINEQTDKTFRILRRIPIFAISFAYILYLIIGGAGYMTFGENIVGNILTLYPNSIS- 280

Query: 327 VNVARFCFGFNMLTTFPLEIFVLRDVIRD-FMF---------------------FNSKDT 364
             + R      ++  FPL+    R  I++ F+F                     FNS++ 
Sbjct: 281 TTIGRLAMLLLVMLAFPLQCHPCRSSIKNIFIFIEDFRKGRLHDNRTGFIPLDDFNSEEP 340

Query: 365 NQSQELSLKLHXXXXXXXXXXXXXXXXXXC-------------NLGALFELTGATTASLM 411
           +   ELS +                    C             +L  +  + GAT ++ +
Sbjct: 341 H--DELSQQSSEGPTLRSESQRHTNVITLCVLVFSYILAISITSLAKVLAIVGATGSTSI 398

Query: 412 AYILPPSVNLLLIGKRSTVR-EKLP---------HYACIIFGFTIMVVSSSQTI 455
           ++ILP      LIG   T R E++P           +  I+G  IM+ S S T+
Sbjct: 399 SFILPGLFGYKLIGSEFTNRNERVPVSIKIFKYLGLSLFIWGLVIMIASLSATV 452

>SAKL0F13134g Chr6 complement(1038673..1040205) [1533 bp, 510 aa]
           {ON} similar to uniprot|P40074 Saccharomyces cerevisiae
           YER119C AVT6 Vacuolar transporter exports aspartate and
           glutamate from the vacuole and to YBL089W uniprot|P38176
           Saccharomyces cerevisiae YBL089W AVT5 Putative
           transporter, members of a family of seven S. cerevisiae
           genes (AVT1-7) related to vesicular GABA-glycine
           transporters
          Length = 510

 Score = 62.8 bits (151), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 65/299 (21%), Positives = 120/299 (40%), Gaps = 15/299 (5%)

Query: 68  AFMNMANSILGAGVIGQPFAIKNCGLVGGIFAVILLSVLVDWTIRLIVVNMKITGKTTYQ 127
             + + ++  GAG++  P+A K  GL+ G   ++L  V   ++   +++  +++     +
Sbjct: 50  GIVTLLHTACGAGILAMPYAFKAYGLLPGFLVLVLCGV---FSTTGLLLQGQVSKYVPRR 106

Query: 128 DSVEFAMGR----KGKLLILLSNGLFAXXXXXXXXXXXXDTIPHVLRAFFPGHENLFHRN 183
            +  F++ +    +  ++  L+  +              D +P +  + F  HE L  RN
Sbjct: 107 QASFFSLAQITYPQLSIIFDLAIAVKCLGVGVSYMVVIGDLLPQIF-SNFTSHEILLERN 165

Query: 184 IIIILVTCFISFPLSLNRNISKLSKASMLAXXXXXXXXXXXXXKGPMIDDAYKGSFNTTE 243
             I +V  FI  PL   + +  L  ASM+A                      K    T  
Sbjct: 166 FHITVVMIFIVAPLCFMKRLDSLRYASMIAISAVGYLCVLVVAHFLFPSQEIKDLKGTVS 225

Query: 244 LFFTPR-----IFQGISVISFALVCHHNTSFIYFSLKTPSLKRFDRLTHFSCFVAMIFCF 298
           LF  P+     +     +  FA  CHHNT  I   LK  S++   ++   +  +A+    
Sbjct: 226 LF-RPKGLHTSMLSSFPIFVFAYTCHHNTFSIVNELKDNSVENVRKVVIGAMGLAVCLYI 284

Query: 299 LMGYTGFLVFKDRTKGNILNNFPGSDNVVNVARFCFGFNMLTTFPLEIFVLRDVIRDFM 357
            +G +G+  F D   GNI+  +P S +   V R      ++  FPL+    R  I   +
Sbjct: 285 AIGGSGYGTFGDNIGGNIIMLYPHSTS-TTVGRIAIVLLVMLAFPLQCHPARASINHII 342

>CAGL0G03619g Chr7 complement(349789..351171) [1383 bp, 460 aa] {ON}
           similar to uniprot|P40074 Saccharomyces cerevisiae
           YER119c or uniprot|P38176 Saccharomyces cerevisiae
           YBL089w or uniprot|P40501 Saccharomyces cerevisiae
           YIL088c
          Length = 460

 Score = 60.1 bits (144), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 65/319 (20%), Positives = 122/319 (38%), Gaps = 17/319 (5%)

Query: 63  SNIFMAFMNMANSILGAGVIGQPFAIKNCGLVGGIFAVILLSVLVDWTIRLIVVNMKITG 122
           S +    + + ++  GAG++  P+A K  GL+ GI  ++   +    ++  +++  ++ G
Sbjct: 3   STVGSGVLTLLHTACGAGILAMPYAFKPFGLIFGILMIMFCGL---CSMMTLLIQARVAG 59

Query: 123 KTTYQDSVEF-----AMGRKGKLLILLSNGLFAXXXXXXXXXXXXDTIPHVLRAFFPGHE 177
                 +  F      + +   ++  L+  +              D +P +  +      
Sbjct: 60  YAPDSKNASFFSLTQVINKNLSVIFDLAIAIKCLGVGISYLIVVGDLLPQIAGSI-TTKP 118

Query: 178 NLFHRNIIIILVTCFISFPLSLNRNISKLSKASMLAXXXXXXXXXXXXXKGPMID---DA 234
            L +R+  I LV  F+  PL L + ++ L   S LA                  D   + 
Sbjct: 119 LLLNRDFHITLVMIFVVTPLCLKKRLNSLRHTSSLAIMSVAYLCVLVIIHLVSSDGDIEQ 178

Query: 235 YKGSFNTTELFFTPRIFQGISVISFALVCHHNTSFIYFSLKTPSLKRFDRLTHFSCFVAM 294
            KG  +       P     + +  FA  CHHN   +    K    K    +   S  +A 
Sbjct: 179 MKGHVSIGLPHHGPSPLTTLPIFVFAYTCHHNMFSVINEQKDNRFKTTKYIPLISTSLAC 238

Query: 295 IFCFLMGYTGFLVFKDRTKGNILNNFPGSDNVVNVARFCFGFNMLTTFPLEIFVLRDVIR 354
           I   L+G  G++ F D+  GNI+  +P S + + + R      +   FPL+    R  I 
Sbjct: 239 ILYILIGGCGYMTFGDKIVGNIITLYPHSVSSI-IGRIAIALLVTLAFPLQCHPARSSIH 297

Query: 355 DFM--FFNS--KDTNQSQE 369
           + +  F+ S   D   +QE
Sbjct: 298 NILAFFYPSLNPDLKNTQE 316

>YBL089W Chr2 (49574..50953) [1380 bp, 459 aa] {ON}  AVT5Putative
           transporter, member of a family of seven S. cerevisiae
           genes (AVT1-7) related to vesicular GABA-glycine
           transporters
          Length = 459

 Score = 59.7 bits (143), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 94/464 (20%), Positives = 166/464 (35%), Gaps = 83/464 (17%)

Query: 62  KSNIFMAFMNMANSILGAGVIGQPFAIKNCGLVGGIFAVILLSVLVDWTIRLIVVNMKIT 121
            SN+    + + ++  GAGV+  PFA K  GL+ G+  +    +    ++  +++  +I 
Sbjct: 2   PSNVRSGVLTLLHTACGAGVLAMPFAFKPFGLMPGLITLTFCGI---CSLCGLLLQTRIA 58

Query: 122 GKTTYQDSVEFAMGRKGKLLILLSNGL-----FAXXXX-----XXXXXXXXDTIPHVLRA 171
                 ++  FA     KL  L++  +     FA                 D +P ++++
Sbjct: 59  KYVPKSENASFA-----KLTQLINPSISVVFDFAIAVKCFGVGVSYLIIVGDLVPQIVQS 113

Query: 172 FF----------PGHENLFHRNIIIILVTCFISFPLSLNRNISKLSKASMLAXXXXXXXX 221
            F            H     R + I L+  F+  PL   R+++ L  ASM+A        
Sbjct: 114 IFYRNDDNMSGSQEHHMFLDRRLYITLIIVFVISPLCFKRSLNSLRYASMIAIVSVAYLS 173

Query: 222 XXXXXKGPMIDDAYKGSFNTTELFFTPR-------IFQGISVISFALVCHHNTSFIYFSL 274
                         +G       F  P            + +  FA  CHHN   +    
Sbjct: 174 GLIIYHFVNRHQLERGQV----YFMVPHGDSQSHSPLTTLPIFVFAYTCHHNMFSVINEQ 229

Query: 275 KTPSLKRFDRLTHFSCFVAMIFCFLMGYTGFLVFKDRTKGNILNNFPGSDNVVNVARFCF 334
              S K   R+  F+  +A     ++G TG++ F +   GNIL  +P S +   + R   
Sbjct: 230 VDKSFKVIRRIPIFAIVLAYFLYIIIGGTGYMTFGENIVGNILTLYPNSIS-TTIGRLAM 288

Query: 335 GFNMLTTFPLEIFVLRDVIRDFMF----------------------FNSKD-----TNQS 367
              ++  FPL+    R  +++ +                       FNS+D     T Q+
Sbjct: 289 LLLVMLAFPLQCHPCRSSVKNIIIFIENFRKGKLYDNRASFIPLDNFNSEDPQEAPTQQN 348

Query: 368 QE------LSLKLHXXXXXXXXXXXXXXXXXXCNLGALFELTGATTASLMAYILPPSVNL 421
            E       SL+                     +L  +  + GAT ++ +++ILP     
Sbjct: 349 NEEPNLRSESLRHINIITLCILLFSYLLAISITSLAKVLAIVGATGSTSISFILPGLFGY 408

Query: 422 LLIGKRST-VREKLP---------HYACIIFGFTIMVVSSSQTI 455
            LIG   T   E++P           +  I+G  +MV S S  +
Sbjct: 409 KLIGSEFTGTNERVPTSIKIFKYLSLSLFIWGIAVMVASLSAIV 452

>TPHA0C03460 Chr3 complement(757629..759050) [1422 bp, 473 aa] {ON}
           Anc_2.295 YIL088C
          Length = 473

 Score = 59.7 bits (143), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 66/315 (20%), Positives = 128/315 (40%), Gaps = 27/315 (8%)

Query: 68  AFMNMANSILGAGVIGQPFAIKNCGLVGGIFAVILLSVLVDWTIRLIVVNMKITGKTTYQ 127
           + +N+  +I+GAG++  PF  +N G++ G+   +L +    + +  +    K+       
Sbjct: 10  SIVNLVKTIVGAGLLAIPFVFQNDGILFGVLLTLLAATTSGFGLFALAKCSKVMLNPRNA 69

Query: 128 DSVEFAMGRKGKLLILLSNGLFAXXXXXXXXXXXXDTIPHVLRAFFPGHENLFHRNIIII 187
                 +    KL ++  N L                +  +    F G  N +      I
Sbjct: 70  SFFTVCLMTNHKLSVI--NDLAMIVQCFGVGVSYVVLVGDLFPIVFGGERNTW------I 121

Query: 188 LVTCFISFPLSLNRNISKLSKASMLAXXXXXXXXXXXXXKGPMIDDA--------YKGSF 239
           + +  +  PL L R+++ L  +S+L                  +DD         ++G  
Sbjct: 122 IASLVVILPLCLLRSMNSLKYSSILGLFALTYLTLLVISN--FLDDVILTDKFMQHRGDV 179

Query: 240 NTTELFFTPRIFQGI----SVISFALVCHHNTSFIYFSLKTPSLKRFDRLTHFSCFVAMI 295
           N  ++    R ++G     ++I FA     N   I   L+  S+K    + ++S  ++ I
Sbjct: 180 NWIKI----RDYKGFVTTFNIIIFAFTGAMNLFSIINELEENSMKNISHVINYSIGISTI 235

Query: 296 FCFLMGYTGFLVFKDRTKGNILNNFPGSDNVVNVARFCFGFNMLTTFPLEIFVLRDVIRD 355
               +G TG+L F   T GNI+ N+  +    NV  FC G  ++ +FPL    LRD + +
Sbjct: 236 LFLSVGITGYLTFGSNTVGNIMLNYDPNSVWTNVGNFCLGAMVILSFPLLFHPLRDAVNN 295

Query: 356 FM-FFNSKDTNQSQE 369
            + ++    +N  Q+
Sbjct: 296 IIVYYQYYKSNNDQD 310

>Smik_11.90 Chr11 (157718..159760) [2043 bp, 680 aa] {ON} YKL146W
           (REAL)
          Length = 680

 Score = 60.1 bits (144), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 106/423 (25%), Positives = 162/423 (38%), Gaps = 35/423 (8%)

Query: 51  STTAFLRENR---SKSNIFMAFMNMANSILGAGVIGQPFAIKNCGLVGGIFAVILLS-VL 106
           ST    RE+     KS+   A + +  S +G GV+  P A  N G   G  A+ LLS  L
Sbjct: 270 STQLISREHERHPHKSSTVKAVLLLLKSFVGTGVLFLPKAFHNGGW--GFSAICLLSCAL 327

Query: 107 VDWT--IRLIVVNMKITGKTTYQDSVEFAMGRKGKLLILLSNGLFAXXXXXXXXXXXXDT 164
           V +   + LI    K+ G   Y D      G K K  ILLS  L                
Sbjct: 328 VSYGCFVSLITTKDKV-GVDGYGDMGRILYGPKMKFAILLSIALSQIGFSAAYTVFTATN 386

Query: 165 IPHVLRAFF---PGHENLFHRNIIIILVTCFISFPLSLNRNISKLSKASMLAXXXXXXXX 221
           +      FF   PG  +L       I     I  PLSL RNI+KLS  +++A        
Sbjct: 387 LQVFCENFFHLKPGSISL----ATYIFAQVLIFVPLSLTRNIAKLSGTALIADLFILLGL 442

Query: 222 XXXXXKGPMIDDAYKGSFNTTELFFTP---RIFQGISVISF---ALVCHHNTSFIYFSLK 275
                   +   A  G  + T L F      +F G ++ +F    L+       I  S+K
Sbjct: 443 VYVYVYS-IYYIAVNGIASDTMLMFNKADWSLFIGTAIFTFEGIGLLIP-----IQESMK 496

Query: 276 TPSLKRFDRLTHFSCFVAMIF--CFLMGYTGFLVFKDRTKGNILNNFPGSDNVVNVARFC 333
            P+  R   L+   C VA++F  C L+ Y     F    K  +L NFP   +     +  
Sbjct: 497 HPNHFR-PSLSAVMCIVAVVFISCGLLCYAA---FGSDVKTVVLLNFPQDTSYTLTVQLL 552

Query: 334 FGFNMLTTFPLEIFVLRDVIRDFMFFNSKDTNQSQELSLKLHXXXXXXXXXXXXXXXXXX 393
           +   +L + PL++F    ++ ++ F ++     + ++    +                  
Sbjct: 553 YALAILLSTPLQLFPAIRILENWTFPSNASGKHNPKVKWLKNYFRCAIVVLTSVLAWVGA 612

Query: 394 CNLGALFELTGATTASLMAYILPPSVNLLLIGKRSTVREK-LPHYACIIFGFTIMVVSSS 452
            +L     L G+     + YI PP ++        T R + L     I+FG  +MV +S 
Sbjct: 613 NDLDKFVSLVGSFACIPLIYIYPPLLHYKASSISGTSRARLLLDLIVIVFGVAVMVYTSW 672

Query: 453 QTI 455
           QTI
Sbjct: 673 QTI 675

>TPHA0B02980 Chr2 (679253..681502) [2250 bp, 749 aa] {ON} Anc_2.177
           YNL101W
          Length = 749

 Score = 59.7 bits (143), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 103/454 (22%), Positives = 173/454 (38%), Gaps = 38/454 (8%)

Query: 18  DRDELLGSSFQLSSFDRNSQRNSERLIDGSEDESTTAFLRENRSKSNIFMAFMNMANSIL 77
           D+  L G+  Q+      S++   R+  G     +   ++  + K+    AF+ +  S +
Sbjct: 296 DKQYLTGTPGQIEEVPLLSRKGISRVTSGVR--VSKPMIQTAKGKTPTTKAFLLLLKSFI 353

Query: 78  GAGVIGQPFAIKNCGLVGGIFAVILLSVLVDWTIRLIVVNMKITGKTTYQDSVEFAMGRK 137
           G G++  P A    GL+  I  ++   +   W   +++ + +IT  +++ D      GR 
Sbjct: 354 GTGILFLPNAFSKGGLLFSIGMLLFFGLYSYWCYFILIRSKQITKVSSFGDIGLILYGRW 413

Query: 138 GKLLILLSNGLFAXXXXXXXXXXXXDTIPHVLRAFFPGHENLFHRNIIIILVTCFISF-P 196
            K +IL S  L                    LRAF     N    NI  +++   I F P
Sbjct: 414 MKTIILCSLVLTQIGFSAAYVIFCAKN----LRAFIINVFNFPDFNISYLMIFQLIVFIP 469

Query: 197 LSLNRNISKLSKASMLAXXXXXXXXXXXX---XKGPMIDDAYKGSFNTTELFFTP---RI 250
           LS  RN+SKLS  S++A                K   ID   K         F P    +
Sbjct: 470 LSFVRNVSKLSLTSLMANFMIMGGLLIVLFFCIKHLFIDLQMKPEAGVI-YGFNPDLWSV 528

Query: 251 FQGISVISF---ALVCHHNTSFIYFSLKTPSLKRFDRLTHFSCFVAMIFCFLMGYTGFLV 307
           F G ++ +F    L+       +  S+K P  + F  +       A +   L+G  G+L 
Sbjct: 529 FIGTAIFAFEGIGLIIP-----VQDSMKHP--EHFPFVLFLVILTATVLFILIGTIGYLA 581

Query: 308 FKDRTKGNILNNFPGSDNVVNVARFCFGFNMLTTFPLEIFVLRDVIRDFMF--FNSKDTN 365
           +    +  IL N   S+  VN+ +  +   +L + PL++F    +I + MF  F S D  
Sbjct: 582 YGKYIETVILMNLSQSNVFVNLVQLFYSVAILLSTPLQLFPAIKIIENRMFTSFRSTDNG 641

Query: 366 QSQELSLKLHXXXXXXXXXXXXXXXXXXC----------NLGALFELTGATTASLMAYIL 415
            SQ LS                      C          NL     L G+     + Y+ 
Sbjct: 642 SSQFLSNSGKLNWRIKWRKNCLRSIIVSCVILIAYLGYNNLDKFVSLIGSFACIPLVYMY 701

Query: 416 PPSVNLLLIGKRSTVREKLPHYACIIFGFTIMVV 449
           PP ++L      S  + K      +IF F+++V+
Sbjct: 702 PPMLHLKSYSIPSLKQHKFNF--TVIFDFSLIVL 733

>KAFR0L01910 Chr12 complement(362409..363746) [1338 bp, 445 aa] {ON}
           Anc_7.420 YER119C
          Length = 445

 Score = 59.3 bits (142), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 65/311 (20%), Positives = 123/311 (39%), Gaps = 9/311 (2%)

Query: 62  KSNIFMAFMNMANSILGAGVIGQPFAIKNCGLVGG--IFAVILLSVLVDWTIRLIVVNMK 119
            S+I    + + ++  GAG++  P+A K  GLV G  + A+     L    ++  V    
Sbjct: 2   PSSIRSGVITLLHTACGAGILAMPYAFKPFGLVPGFLMIAICGFCALSGLILQAQVAKYT 61

Query: 120 ITGKTTYQDSVEFAMGRKGKLLILLSNGLFAXXXXXXXXXXXXDTIPHVLRAFFPGHENL 179
            +G  ++    +  +     ++  L+  +              D +P +   F   H  L
Sbjct: 62  ASGSASFFTLSQL-ISPSLSVVFDLAIAVKCFGVGVSYMIVVGDLMPQIFAVFTTSHI-L 119

Query: 180 FHRNIIIILVTCFISFPLSLNRNISKLSKASMLAXXXXXXXXXXXXXKGP-MIDDAY--K 236
            +R+  I L+  FI  PL   R ++ L  ASM+A                   +D +  K
Sbjct: 120 LNRDFHISLIMLFIVSPLCFLRKLNSLRYASMIAISAVAYLCVLVVAHFIFQTEDVHDLK 179

Query: 237 GSFNTTELFFTPRIFQGISVISFALVCHHNTSFIYFSLKTPSLKRFDRLTHFSCFVAMIF 296
           G  +       P     + +  FA  CHHN   +       +     ++   +  +A + 
Sbjct: 180 GVVSIGLPKHEPSPLTTLPIFVFAYTCHHNFFSVINEQSNIAFTHIKKIPIIAMILAYLL 239

Query: 297 CFLMGYTGFLVFKDRTKGNILNNFPGSDNVVNVARFCFGFNMLTTFPLEIFVLRDVIRD- 355
             L+G++G+L F D   GNI+  +P + +   + R    F ++  FPL+    R  I   
Sbjct: 240 YILIGFSGYLTFGDNIVGNIITLYPRTAS-STIGRLAIVFLVMLAFPLQCHPCRASIHHI 298

Query: 356 FMFFNSKDTNQ 366
           + +   K++N+
Sbjct: 299 WHYIQEKNSNE 309

>KLTH0C06006g Chr3 (518793..520130) [1338 bp, 445 aa] {ON} similar
           to uniprot|P40074 Saccharomyces cerevisiae YER119C AVT6
           Vacuolar transporter exports aspartate and glutamate
           from the vacuole and to YBL089W uniprot|P38176
           Saccharomyces cerevisiae YBL089W AVT5 Putative
           transporter, members of a family of seven S. cerevisiae
           genes (AVT1-7) related to vesicular GABA-glycine
           transporters
          Length = 445

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 53/209 (25%), Positives = 79/209 (37%), Gaps = 22/209 (10%)

Query: 163 DTIPHVLRAFFPGHENLFHRNIIIILVTCFISFPLSLNRNISKLSKASMLAXXXXXXXXX 222
           D +P +  A F  H  L  RN+ I LV  F+  PL   + +  L  ASM+A         
Sbjct: 104 DLMPRIF-ATFTSHGLLLSRNLHITLVMLFVVSPLCFMKRLDSLRYASMVAISSVAYLCV 162

Query: 223 XXXXKGPMIDDAYK------------GSFNTTELFFTPRIFQGISVISFALVCHHNTSFI 270
                     D  +            GSF          +     +  FA  CHHN   I
Sbjct: 163 LVLVHYVWPSDEIRELRGHVSLGKPVGSFAA--------LLSCFPIFVFAYTCHHNMFSI 214

Query: 271 YFSLKTPSLKRFDRLTHFSCFVAMIFCFLMGYTGFLVFKDRTKGNILNNFPGSDNVVNVA 330
              L+  SLK   +++  S  +AM    L+G +G+  F D   GNI+  +P S     V 
Sbjct: 215 VNELRDNSLKGIYKVSIISVALAMSLYLLIGGSGYATFGDNVAGNIIMLYPQS-AATTVG 273

Query: 331 RFCFGFNMLTTFPLEIFVLRDVIRDFMFF 359
           R      ++  FPL+    R  +   + +
Sbjct: 274 RVAIALLVMLAFPLQCHPARASVDHILHY 302

>NCAS0B06210 Chr2 (1171270..1172715) [1446 bp, 481 aa] {ON}
           Anc_2.295
          Length = 481

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 67/305 (21%), Positives = 125/305 (40%), Gaps = 18/305 (5%)

Query: 70  MNMANSILGAGVIGQPFAIKNCGLVGGIFAVILLSVLVDWTIRLIVVNMKITGKTTYQDS 129
           +N+  +I+GAG+   PFA KN G++ GI  ++L +V   + + ++    K          
Sbjct: 12  VNLVKTIVGAGLFAIPFAFKNDGILVGILLIMLAAVTSGFGLFILAKCSKTLINPRNASF 71

Query: 130 VEFAMGRKGKLLILLSNGLFAXXXXXXXXXXXXDTIPHVLRAFFPGHENLFHRNIIIILV 189
               M     L  L    +                +  +  + F G+ + +      I+ 
Sbjct: 72  FSICMLTYPSLSPLFDLAMIVQCFGVGLSYLVL--MGDIFPSLFGGNRDYW------IVA 123

Query: 190 TCFISFPLSLNRNISKLSKASML---AXXXXXXXXXXXXXKGPMIDDA--YKGSFNTTEL 244
           + FI  PL   + +  L  +S+L   A             K  +I+     +G  +   +
Sbjct: 124 SAFIVVPLCCLKKLDNLKYSSILGNIALIYLALFIFGVFVKDILIEGNTFARGEISWIRI 183

Query: 245 FFTPRIFQGISVISFALVCHHNTSFIYFSLKTPSLKRFDRLTHFSCFVAMIFCFLMGYTG 304
           +    +    S+I FA V   N   I   L+  S++   ++ + S  ++ IF  L+G +G
Sbjct: 184 YDGKGLLSTFSIIIFAYVGAMNLFSICRELENDSMENILKVINGSIGISSIFFLLVGISG 243

Query: 305 FLVFKDRTKGNILNNFPGSDNVVNVARFCFGFNMLTTFPLEIFVLRDVIRDF-----MFF 359
           +L F    +GNI+ N+  +   + + +FC  F +L +FPL    LR  + +      M F
Sbjct: 244 YLTFGSNVQGNIILNYDPNSIWIYLGKFCLAFMLLLSFPLLFHPLRIAVNNLVVWFGMTF 303

Query: 360 NSKDT 364
            + DT
Sbjct: 304 GADDT 308

>Suva_5.240 Chr5 complement(375238..376584) [1347 bp, 448 aa] {ON}
           YER119C (REAL)
          Length = 448

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 62/306 (20%), Positives = 118/306 (38%), Gaps = 11/306 (3%)

Query: 70  MNMANSILGAGVIGQPFAIKNCGLVGGIFAVILLSV--LVDWTIRLIVVNMKITGKTTYQ 127
           + + ++  GAG++  P+A K  GLV G+  +++     +    I+  V      GK ++ 
Sbjct: 10  LTLLHTACGAGILAMPYAFKPFGLVPGVVMIVICGACAMQSLLIQARVARYVAPGKASFS 69

Query: 128 DSVEFAMGRKGKLLILLSNGLFAXXXXXXXXXXXXDTIPHVLRAFFPGHENLFHRNIIII 187
                 +  +  ++  L+  +              D +P ++ ++  G+  L  RN+ I 
Sbjct: 70  TLTRL-INPRLSIVFDLAIAVKCFGVGVSYMIVVGDLMPQIMSSW-TGNAWLLSRNVQIS 127

Query: 188 LVTCFISFPLSLNRNISKLSKASMLAXXXXXXXXXXXXXKGPMIDDAYKGSFNTTELFFT 247
           L+  F   PLS  + ++ L  ASM+A                +  D            F 
Sbjct: 128 LIMLFFVAPLSFLKKLNSLRYASMVAISSVAYLCVLVLVHYVVPSDEILRLKGRVSYLFP 187

Query: 248 PR-----IFQGISVISFALVCHHNTSFIYFSLKTPSLKRFDRLTHFSCFVAMIFCFLMGY 302
            +         + +  FA  CHHN   I    K+   +   ++   S  +A+     +G 
Sbjct: 188 QQSHDLNFLNTLPIFVFAYTCHHNMFSIINEQKSVRFEHVMKIPLISISLALALYIAIGC 247

Query: 303 TGFLVFKDRTKGNILNNFPGSDNVVNVARFCFGFNMLTTFPLEIFVLRDVIRDFM-FFNS 361
            G+L F D   GNI+  +P + +   V R      ++  FPL+    R  I   + +F  
Sbjct: 248 AGYLTFGDNIIGNIIMLYPQTVS-STVGRIAIVLLVMLAFPLQCHPARASIHQILQYFTE 306

Query: 362 KDTNQS 367
           ++   S
Sbjct: 307 ENATTS 312

>AER380C Chr5 complement(1349610..1351760) [2151 bp, 716 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL101W
           (AVT4)
          Length = 716

 Score = 57.4 bits (137), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 78/326 (23%), Positives = 130/326 (39%), Gaps = 29/326 (8%)

Query: 45  DGSEDESTTAFLRENRSKSNIFMAFMNMANSILGAGVIGQPFAIKNCGLVGGIFAVILLS 104
           D  + +   A LR    K++ F AF+ M  S +G GV+  P A  N GL   I  +   S
Sbjct: 284 DPEQQQQVPAHLR---VKTSTFKAFLLMIKSFIGTGVLFLPNAFSNGGLAFSISMLFFFS 340

Query: 105 VLVDWTIRLIVVNMKITGKTTYQDSVEFAMGRKGKLLILLSNGLFAXXXXXXXXXXXXDT 164
               W   ++V +   TG +++ D      G   K +IL S  L                
Sbjct: 341 AYSYWCYYILVRSKDATGVSSFGDIGGILFGSWMKFIILFSLVLTQMGFAGAYVVFTAKN 400

Query: 165 IPHVLRAFFPGHENLFHRNII----IILVTCFISFPLSLNRNISKLSKASMLAXXXXXXX 220
               L AF    +N+F+   I    ++L   FI  PLS  RN+SKLS  S+ A       
Sbjct: 401 ----LIAFL---DNVFNWPDIPVKYLLLTQLFIFIPLSFVRNVSKLSITSLFANFFIISG 453

Query: 221 XXXXXXKGP---MIDDAYKGSFNTTELFFTPR--IFQGISVISF---ALVCHHNTSFIYF 272
                       M D ++K +     +F   R  +F G ++ +F    L+       +  
Sbjct: 454 LIIVVYYTACRWMYDLSFKPAEGVIMVFNPNRWSLFIGTAIFAFEGIGLIIP-----VQE 508

Query: 273 SLKTPSLKRFDRLTHFSCFVAMIFCFLMGYTGFLVFKDRTKGNILNNFPGSDNVVNVARF 332
           S++ P  + F ++         +    +G  G+L +  + +  IL N P     VN+ + 
Sbjct: 509 SMRHP--EEFPKVLGLVIITTTVLFITIGTLGYLAYGSQIQSVILLNLPQDALSVNMIQL 566

Query: 333 CFGFNMLTTFPLEIFVLRDVIRDFMF 358
            +   +L + PL++F    +I +  F
Sbjct: 567 FYSMAILLSTPLQLFPAIGIIENKFF 592

>KNAG0B02190 Chr2 (418852..420237) [1386 bp, 461 aa] {ON} Anc_7.420
           YER119C
          Length = 461

 Score = 56.6 bits (135), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 64/323 (19%), Positives = 126/323 (39%), Gaps = 28/323 (8%)

Query: 70  MNMANSILGAGVIGQPFAIKNCGLVGGIFAVILLSVLVDWTIRLIVVNMKITGKTTY--- 126
           + + ++  GAG++  PFA K  GLV G+        ++ W        + +  + +    
Sbjct: 10  ITLLHTACGAGILAMPFAFKPFGLVLGL-------TMITWCGLCAFAGLLLQCRVSRYAP 62

Query: 127 QDSVEF-----AMGRKGKLLILLSNGLFAXXXXXXXXXXXXDTIPHVLRAFFPGHENLFH 181
           +  V F      + R   ++   +  +              D +P +  + +  ++ L +
Sbjct: 63  EKGVSFFVLSSLINRNLSVVFDCAIAVKCFGVGVSYMIVVGDLLPQI-WSVWTSNKLLLN 121

Query: 182 RNIIIILVTCFISFPLSLNRNISKLSKASMLAXXXXXXXXXXXXX----KGPMIDDAY-- 235
           R+  I +V  FI  PL   + ++ L  ASM+A                 + P  +D +  
Sbjct: 122 RDFHITMVMIFIVAPLCFMKKLNSLRYASMIAISAVAYLCVLVIYHFIFQDP--NDTHFQ 179

Query: 236 --KGSFNTTELFFTPRIFQGISVISFALVCHHNTSFIYFSLKTPSLKRFDRLTHFSCFVA 293
             KG  +       P I   + +  FA  CHHN   +             ++  +S  +A
Sbjct: 180 DLKGRISIGLPRDEPPILTTLPIFVFAYTCHHNMFSVINEQVDQKFNVITKIAKYSMSLA 239

Query: 294 MIFCFLMGYTGFLVFKDRTKGNILNNFPGSDNVVNVARFCFGFNMLTTFPLEIFVLRDVI 353
            +   ++GY+G+L F D+  GNI+  +P + +   + R      +  TFPL+    R  I
Sbjct: 240 FLLYIVIGYSGYLTFGDKIVGNIVTLYPNNAS-STIGRIAIAILVTLTFPLQCHPARASI 298

Query: 354 RDFM-FFNSKDTNQSQELSLKLH 375
              + FF ++        ++ L+
Sbjct: 299 HHIIHFFQARSAENGNGSAMVLN 321

>Suva_2.28 Chr2 (46134..47513) [1380 bp, 459 aa] {ON} YBL089W (REAL)
          Length = 459

 Score = 56.2 bits (134), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 69/318 (21%), Positives = 121/318 (38%), Gaps = 42/318 (13%)

Query: 70  MNMANSILGAGVIGQPFAIKNCGLVGGIFAVILLSVLVDWTIRLIVVNMKITGKTTYQDS 129
           + + ++  GAGV+  PFA K  GL+    A+I L+     ++  +++  +I       ++
Sbjct: 10  LTLLHTACGAGVLAMPFAFKPFGLLP---ALITLTFCGICSLCGLLLQTRIVKYVPKSEN 66

Query: 130 VEFAMGRKGKLLILLSNGL-----FAXXXX-----XXXXXXXXDTIPHVLRAFF------ 173
             FA     KL  L++  L     FA                 D +P +L +        
Sbjct: 67  ASFA-----KLTQLINPSLSIVFDFAIAVKCFGVGVSYLIIVGDLMPQILSSILYRNDDS 121

Query: 174 ----PGHENLFHRNIIIILVTCFISFPLSLNRNISKLSKASMLAXXXXXXXXXXXXXKGP 229
                 H     R + I LV  F+  PL   ++++ L  ASM+A                
Sbjct: 122 TGDSQEHHMFLDRRLCISLVMMFVIAPLCFKKSLNSLRHASMIAIVSVAYLCGLI----- 176

Query: 230 MIDDAYKGSFNTTELFF-TPR-------IFQGISVISFALVCHHNTSFIYFSLKTPSLKR 281
           +    Y+      +++F TP            + +  FA  CHHN   +       S K 
Sbjct: 177 IFHFLYRSELERGQVYFMTPHQDAQSHSPLTTLPIFVFAYTCHHNMFSVINEQADKSFKI 236

Query: 282 FDRLTHFSCFVAMIFCFLMGYTGFLVFKDRTKGNILNNFPGSDNVVNVARFCFGFNMLTT 341
             R+   +  +A +   ++G TG++ F D   GNI+  +P S     + R      +   
Sbjct: 237 LRRIPILAISLAYVLYVVIGGTGYMTFGDNIVGNIITLYPNSI-YTTIGRLAMLLLVTLA 295

Query: 342 FPLEIFVLRDVIRDFMFF 359
           FPL+    R  I++ + F
Sbjct: 296 FPLQCHPCRSSIKNMIVF 313

>Skud_11.81 Chr11 (157889..160027) [2139 bp, 712 aa] {ON} YKL146W
           (REAL)
          Length = 712

 Score = 56.6 bits (135), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 106/427 (24%), Positives = 164/427 (38%), Gaps = 43/427 (10%)

Query: 51  STTAFLRENR---SKSNIFMAFMNMANSILGAGVIGQPFAIKNCGLVGGIFAVILLS-VL 106
           ST    RE+     KS+   A + +  S +G GV+  P A  N G   G  A+ LLS  L
Sbjct: 302 STQLVPREHERHPHKSSTVKAVLLLLKSFVGTGVLFLPRAFHNGGW--GFSALCLLSCAL 359

Query: 107 VDWT--IRLIVVNMKITGKTTYQDSVEFAMGRKGKLLILLSNGLFAXXXXXXXXXXXXDT 164
           V +   + LI    K+ G   Y D      G K K  ILLS  L                
Sbjct: 360 VSYGCFVSLISTKDKV-GVDGYGDMGRILYGPKMKFAILLSIALSQIGFSAAYTVFTATN 418

Query: 165 IPHVLRAFFPGHENLFHRN------IIIILVTCFISFPLSLNRNISKLSKASMLAXXXXX 218
               L+ FF   EN FH           I     I  PLSL RNI+KLS  +++A     
Sbjct: 419 ----LQVFF---ENFFHLKPGSINLATYIFAQVLIFVPLSLTRNIAKLSGTALIADLFIL 471

Query: 219 XXXXXXXXKGPMIDDAYKGSFNTTELFFTP---RIFQGISVISFA----LVCHHNTSFIY 271
                      +   +  G  + T L F      +F G ++ +F     L+       I 
Sbjct: 472 LGLVYVYVYS-IYYISVNGIASDTMLMFNKADWSLFIGTAIFTFEGIGLLIP------IQ 524

Query: 272 FSLKTPSLKRFDRLTHFSCFVAMIF--CFLMGYTGFLVFKDRTKGNILNNFPGSDNVVNV 329
            S++ P+  R   L+   C VA++F  C L+ Y     F    K  +L NFP + +    
Sbjct: 525 ESMRHPNHFR-PSLSAVMCIVAVVFISCGLLCYAA---FGADVKTVVLLNFPQNSSYTLT 580

Query: 330 ARFCFGFNMLTTFPLEIFVLRDVIRDFMFFNSKDTNQSQELSLKLHXXXXXXXXXXXXXX 389
            +  +   +L + PL++F    ++ ++ F ++     + ++    +              
Sbjct: 581 VQLLYALAILLSTPLQLFPAIRILENWTFPSNASGKHNPKVKWLKNYFRCAIVLLTSILA 640

Query: 390 XXXXCNLGALFELTGATTASLMAYILPPSVNLLLIGKRSTVREKLPHYACII-FGFTIMV 448
                +L     L G+     + YI PP ++        T R +L     +I FG  +MV
Sbjct: 641 WVGANDLDKFVSLVGSFACVPLIYIYPPLLHFKASSISGTSRGRLLLDLIVISFGVAVMV 700

Query: 449 VSSSQTI 455
            +S QTI
Sbjct: 701 YTSWQTI 707

>Smik_5.264 Chr5 complement(408587..409933) [1347 bp, 448 aa] {ON}
           YER119C (REAL)
          Length = 448

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 58/295 (19%), Positives = 114/295 (38%), Gaps = 10/295 (3%)

Query: 70  MNMANSILGAGVIGQPFAIKNCGLVGGIFAVILLSVLVDWT--IRLIVVNMKITGKTTYQ 127
           + + ++  GAG++  P+A K  GLV G+  +++       +  I+  V      G+ ++ 
Sbjct: 10  LTLLHTACGAGILAMPYAFKPFGLVPGMIMIVICGACAMQSLFIQARVAKYVPQGRASFS 69

Query: 128 DSVEFAMGRKGKLLILLSNGLFAXXXXXXXXXXXXDTIPHVLRAFFPGHENLFHRNIIII 187
                 +     ++  L+  +              D +P ++ + +  +  L  RN+ I 
Sbjct: 70  TLTRL-INPSLSIVFDLAIAVKCFGVGVSYMIVVGDLMPQIM-SVWTNNAWLLSRNVQIS 127

Query: 188 LVTCFISFPLSLNRNISKLSKASMLAXXXXXXXXXXXXXKGPMIDDAYKGSFNTTELFFT 247
           L+  F   PL   + ++ L  ASM+A                   +           FF 
Sbjct: 128 LIMLFFVTPLCFLKKLNSLRYASMIAISSVAYLCALVLVHYIAPSEDILRLRGQISYFFP 187

Query: 248 PR-----IFQGISVISFALVCHHNTSFIYFSLKTPSLKRFDRLTHFSCFVAMIFCFLMGY 302
           P+     +   + +  FA  CHHN   I    ++   +   ++   +  +A+I    +G 
Sbjct: 188 PQSHDLNVLNTLPIFVFAYTCHHNMFSIINEQRSSRFEHIMKIPLIAVSLALILYIAIGC 247

Query: 303 TGFLVFKDRTKGNILNNFPGSDNVVNVARFCFGFNMLTTFPLEIFVLRDVIRDFM 357
           TG+L F D   GNI+  +P + +   V R      ++  FPL+    R  I   +
Sbjct: 248 TGYLTFGDNIIGNIIMLYPQTVS-STVGRIAIVLLVMLAFPLQCHPARASIHQIL 301

>TBLA0C03030 Chr3 (732818..734389) [1572 bp, 523 aa] {ON} Anc_5.252
           YKL146W
          Length = 523

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 99/446 (22%), Positives = 171/446 (38%), Gaps = 47/446 (10%)

Query: 33  DRNSQRNSERLIDGSEDESTTAFLRENRSKSNIFMAFMNMANSILGAGVIGQPFAIKNCG 92
           D +   N E      E E T    + N+S +    A + +  S +G GV+  P A  N G
Sbjct: 103 DLSESDNEEE----QELEPTPPSSQHNKSSTT--KAILLLLKSFIGTGVLFLPKAFSNGG 156

Query: 93  LVGGIFAVILLSVLVDWTIRLIVVNMKITGKTTYQD---SVEFAMGRKGKLL-ILLSNGL 148
            V  + ++I+ S++  +   L++          Y D   ++  ++ +K  LL I+LS   
Sbjct: 157 YVFSLVSLIICSLISYYCFILLLDTKSKLNVNGYGDLGLTLYGSILQKSILLSIVLSQLG 216

Query: 149 FAXXXXXXXXXXXXDTIPHVLRAFFPGHENLFHRNIIIILVTCFISFPLSLNRNISKLSK 208
           FA                H L      +   F      IL+  F+  PLS  RNI+KLS 
Sbjct: 217 FAAAYNVFTATNL-----HSLSTSLITNPPDFITIPFCILLQTFLFIPLSFTRNITKLSS 271

Query: 209 ASMLA--------XXXXXXXXXXXXXKGPMIDDAYKGSFNTTE--LFFTPRIF--QGISV 256
            +++A                     KGP  D      FNT +  LF    IF  +GI +
Sbjct: 272 TALIADLFIFIGLIYLYYYPIKIIATKGP--DWQTMTPFNTKDWSLFIGTAIFTYEGIGL 329

Query: 257 ISFALVCHHNTSFIYFSLKTPSLKRFDRLTHFSCFVAMIFCFLMGYTGFLVFKDRTKGNI 316
           +            I  S+K+P    F +       +  +    +G  G+  F       +
Sbjct: 330 L----------IPIQESMKSP--HHFKKSLILVLVIITLVFITIGLLGYSAFGSNVDTVL 377

Query: 317 LNNFPGSDNVVNVARFCFGFNMLTTFPLEIFVLRDVIRDFMFFNSKDTNQSQELSLKL-- 374
           L NFP  +   ++ +  +   +L + PL++F    ++ +++F  SKD +     S+K   
Sbjct: 378 LQNFPQDNPCTSLVQLLYSLAILLSTPLQLFPAIKILENWIF--SKDASGKYNHSIKWAK 435

Query: 375 HXXXXXXXXXXXXXXXXXXCNLGALFELTGATTASLMAYILPPSVNLLLIGKRSTVREK- 433
           +                   +L     L G+     + Y+ PP ++       +T   K 
Sbjct: 436 NYFRSTIVILTSLISYLGANDLNKFVALVGSFACIPLIYVYPPLLHYKATQLDNTFTWKT 495

Query: 434 -LPHYACIIFGFTIMVVSSSQTIIAY 458
            L  ++ + FG   M+ +S QTII +
Sbjct: 496 LLADFSLLTFGIITMIYTSLQTIILW 521

>Skud_2.19 Chr2 (33154..34533) [1380 bp, 459 aa] {ON} YBL089W (REAL)
          Length = 459

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 94/471 (19%), Positives = 165/471 (35%), Gaps = 99/471 (21%)

Query: 63  SNIFMAFMNMANSILGAGVIGQPFAIKNCGLVGGIFAVILLSVLVDWTIRLIVVNMKITG 122
           SN+    + + ++  GAGV+  PFA K  GL+ G+   I L++    ++  +++  +I  
Sbjct: 3   SNVRSGVLTLLHTACGAGVLAMPFAFKPFGLMPGL---ITLTICGICSLCGLLLQTRIAK 59

Query: 123 KTTYQDSVEFAMGRKGKLLILLSNGL-----FAXXXX-----XXXXXXXXDTIPHVLRAF 172
                ++V FA     KL  L++  L     FA                 D +P ++ + 
Sbjct: 60  YVPKSENVSFA-----KLTQLINPSLSIVFDFAIAVKCFGVGVSYLIIVGDLMPQIVSSI 114

Query: 173 F----------PGHENLFHRNIIIILVTCFISFPLSLNRNISKLSKASMLAXXXXXXXX- 221
                        H  +  R + I L+  F+  PL   ++++ L  ASM+A         
Sbjct: 115 LYRDHDSTGGPQEHHGILDRRLYISLIMLFVIAPLCFKKSLNSLRHASMIAIISVAYLSG 174

Query: 222 --------XXXXXKG------PMIDDAYKGSFNTTELFFTPRIFQGISVISFALVCHHNT 267
                        +G      P  D        T  +F             FA  CHHN 
Sbjct: 175 LIIYHFLNRHQLERGQVYFMVPHRDTESHAPLTTLPIFV------------FAYTCHHNM 222

Query: 268 SFIYFSLKTPSLKRFDRLTHFSCFVAMIFCFLMGYTGFLVFKDRTKGNILNNFPGSDNVV 327
             +         +   R+   +  +A +   ++G  G++ F     GNIL  +P S +  
Sbjct: 223 FSVINEQADKGFRILKRIPIIAISLAFVLYVIIGGAGYMTFGKNIVGNILTLYPNSVS-T 281

Query: 328 NVARFCFGFNMLTTFPLEIFVLRDVIRDFMFF-----------NSKD---------TNQS 367
            + R      ++  FPL+    R  I++ + F           N  D          N  
Sbjct: 282 TIGRLAMLLLVMLAFPLQCHPCRSSIKNIIIFIENFRKGKLQENRDDCIPLDVLSSVNSQ 341

Query: 368 QELSLKLHXXXXXXXXXXXXXXXXXXCNLGA-------------LFELTGATTASLMAYI 414
           +E   + +                  C LG+             +  + GAT ++ +++I
Sbjct: 342 EESRQQNNEQQNFPSESSRHTNIITLCILGSSYLLAISITSLAKVLAIVGATGSTSISFI 401

Query: 415 LPPSVNLLLIGKRSTVR-EKLPHYACI---------IFGFTIMVVSSSQTI 455
           LP      LIG     R E++P    I         I+G  +M+ S S T+
Sbjct: 402 LPGLFGYKLIGSEYISRDERVPASVKILKYLGLLLFIWGIVVMIASLSATV 452

>KAFR0H03660 Chr8 (698211..700151) [1941 bp, 646 aa] {ON} Anc_5.252
           YKL146W
          Length = 646

 Score = 55.1 bits (131), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 91/412 (22%), Positives = 157/412 (38%), Gaps = 37/412 (8%)

Query: 62  KSNIFMAFMNMANSILGAGVIGQPFAIKNCGLVGGIFAVILLSVLVDWTIRLIVVNMKIT 121
           K++ F A + +  S +G GV+  P A  N G       +++ +VL  +   L+++     
Sbjct: 252 KTSTFKAVLLLLKSFVGTGVLFLPKAFSNGGWGFSSLCLLMCAVLSYYCFILLIITKDKV 311

Query: 122 GKTTYQDSVEFAMGRKGKLLILLSNGLFAXXXXXXXXXXXXDTIPHVLRAFFPGHENLFH 181
           G   Y D  E   G K KL IL S  L                    L+ F  G  NL  
Sbjct: 312 GVAGYGDMGEVLYGSKMKLAILASIALSQIGFSAAYTVFTATN----LQVFCQGALNLPD 367

Query: 182 RNI---IIILVTCFISFPLSLNRNISKLSKASMLAXXXXXXXXXXXXXKGPM------ID 232
            ++   I I++   I  PLSL RNI+KLS  ++LA                       I 
Sbjct: 368 GSLGLGIFIVLQALIFIPLSLTRNIAKLSVTALLADLFILLGLIYVYYYAIYYVAKNSIA 427

Query: 233 DAYKGSFNTTELFFTPRIFQGISVISFALVCHHNTSFIYFSLKTPSLKRFDRLTHFSCFV 292
            A    FN ++      +F G ++ +F  +       I  S++ P  K    L    C V
Sbjct: 428 TATMVWFNNSDW----SLFIGTAIFTFEGIGLLIP--IQESMRHPE-KFQSSLFGVMCIV 480

Query: 293 AMIF--CFLMGYTGFLVFKDRTKGNILNNFPGSDNVVNVARFCFGFNMLTTFPLEIFVLR 350
           +++F  C L+ Y+    F    +  +L NFP       + +  +   +L + PL++F   
Sbjct: 481 SVVFISCGLLCYSA---FGSNVQTVVLLNFPQDSPYTLLVQLFYSMAILLSTPLQLFPAI 537

Query: 351 DVIRDFMFFNSKDTNQSQELSLKLHXXXXXXXXXXXXXXXXXXCNLGALFELTGATTASL 410
            ++  + F ++     + ++  + +                   NL     L G+     
Sbjct: 538 RILEHWTFPSNASGKYNPKIKWRKNYFRCIIVVLTSVLAWVGASNLDKFVSLVGSLACIP 597

Query: 411 MAYILPPSVNLLLIGKRSTVREKLPHYACII-------FGFTIMVVSSSQTI 455
           + YI PP     L+  ++   ++   Y  +I       FG  +M  +S QT+
Sbjct: 598 LIYIHPP-----LLHFKAFKDDQDTRYWSLICDILLLAFGVGVMTYTSVQTL 644

>YER119C Chr5 complement(399496..400842) [1347 bp, 448 aa] {ON}
           AVT6Vacuolar aspartate and glutamate exporter; member of
           a family of seven genes (AVT1-7) related to vesicular
           GABA-glycine transporters; involved in
           compartmentalizing acidic amino acids in response to
           nitrogen starvation
          Length = 448

 Score = 54.3 bits (129), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 57/295 (19%), Positives = 113/295 (38%), Gaps = 10/295 (3%)

Query: 70  MNMANSILGAGVIGQPFAIKNCGLVGGIFAVILLSVLVDWT--IRLIVVNMKITGKTTYQ 127
           + + ++  GAG++  P+A K  GL+ G+  ++L       +  I+  V      G+ ++ 
Sbjct: 10  LTLLHTACGAGILAMPYAFKPFGLIPGVIMIVLCGACAMQSLFIQARVAKYVPQGRASFS 69

Query: 128 DSVEFAMGRKGKLLILLSNGLFAXXXXXXXXXXXXDTIPHVLRAFFPGHENLFHRNIIII 187
                     G ++  L+  +              D +P ++ + +  +  L +RN+ I 
Sbjct: 70  ALTRLINPNLG-IVFDLAIAIKCFGVGVSYMIVVGDLMPQIM-SVWTRNAWLLNRNVQIS 127

Query: 188 LVTCFISFPLSLNRNISKLSKASMLAXXXXXXXXXXXXXKGPMIDDAYKGSFNTTELFFT 247
           L+  F   PLS  + ++ L  ASM+A                   D              
Sbjct: 128 LIMLFFVAPLSFLKKLNSLRYASMVAISSVAYLCVLVLLHYVAPSDEILRLKGRISYLLP 187

Query: 248 PR-----IFQGISVISFALVCHHNTSFIYFSLKTPSLKRFDRLTHFSCFVAMIFCFLMGY 302
           P+     +   + +  FA  CHHN   I    ++   +   ++   +  +A+I    +G 
Sbjct: 188 PQSHDLNVLNTLPIFVFAYTCHHNMFSIINEQRSSRFEHVMKIPLIAISLALILYIAIGC 247

Query: 303 TGFLVFKDRTKGNILNNFPGSDNVVNVARFCFGFNMLTTFPLEIFVLRDVIRDFM 357
            G+L F D   GNI+  +P + +   + R      ++  FPL+    R  I   +
Sbjct: 248 AGYLTFGDNIIGNIIMLYPQAVS-STIGRIAIVLLVMLAFPLQCHPARASIHQIL 301

>Suva_11.79 Chr11 (157798..159957) [2160 bp, 719 aa] {ON} YKL146W
           (REAL)
          Length = 719

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 98/419 (23%), Positives = 152/419 (36%), Gaps = 41/419 (9%)

Query: 57  RENRS-KSNIFMAFMNMANSILGAGVIGQPFAIKNCGLVGGIFAV-ILLSVLVDWT--IR 112
           R+ R  KS+   A + +  S +G GV+  P A  N G   G   V +LL  +V +   + 
Sbjct: 317 RDRRPHKSSTAKAVLLLLKSFVGTGVLFLPKAFHNGGW--GFSGVSLLLCAIVSYGCFVS 374

Query: 113 LIVVNMKITGKTTYQDSVEFAMGRKGKLLILLSNGLFAXXXXXXXXXXXXDTIPHVLRAF 172
           LI    K+ G   Y D      G K KL ILLS  L                +      F
Sbjct: 375 LITTKDKV-GVDGYGDMGRVLYGPKMKLAILLSIALSQIGFSAAYTVFTATNLQVFCEHF 433

Query: 173 F---PGHENLFHRNIIIILVTCFISFPLSLNRNISKLSKASMLAXXXXXXXXXXXXXKGP 229
           F   PG  NL       I     I  PLSL RNI+KLS  +++A                
Sbjct: 434 FHLKPGSINL----ATYIFAQVLIFVPLSLTRNIAKLSGTALIADVFILLGLVYVYYYS- 488

Query: 230 MIDDAYKGSFNTTELFFTP---RIFQGISVISFALVCHHNTSFIYFSLKTPSLKRFDRLT 286
           +   A  G  + T L F      +F G ++ +F  +           L  P  +      
Sbjct: 489 IYHIAVNGIASDTMLMFNKADWSLFIGTAIFTFEGI----------GLLIPIQESMKHPN 538

Query: 287 HFS-------CFVAMIF--CFLMGYTGFLVFKDRTKGNILNNFPGSDNVVNVARFCFGFN 337
           HF        C VA++F  C L+ Y     F    K  +L NFP   +     +  +   
Sbjct: 539 HFQPSLSAVMCIVAVVFISCGLLCYAA---FGADVKTVVLLNFPQDSSYTLTVQLLYALA 595

Query: 338 MLTTFPLEIFVLRDVIRDFMFFNSKDTNQSQELSLKLHXXXXXXXXXXXXXXXXXXCNLG 397
           +L + PL++F    ++ ++ F ++     + ++    +                   +L 
Sbjct: 596 ILLSTPLQLFPAIRILENWTFPSNASGKHNPKVKWLKNYFRCAIVLLTSVLAWVGANDLD 655

Query: 398 ALFELTGATTASLMAYILPPSVNLLLIGKRSTVREK-LPHYACIIFGFTIMVVSSSQTI 455
               L G+     + YI PP ++          R + L     + FG  +M  +S QTI
Sbjct: 656 KFVSLVGSFACIPLIYIYPPMLHYKAFSLSGISRARLLLDLVVLSFGVVVMAYTSWQTI 714

>Skud_5.260 Chr5 (420651..421997) [1347 bp, 448 aa] {ON} YER119C
           (REAL)
          Length = 448

 Score = 54.3 bits (129), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 67/302 (22%), Positives = 125/302 (41%), Gaps = 24/302 (7%)

Query: 70  MNMANSILGAGVIGQPFAIKNCGLVGGIFAVILLSVLVDWTIRLIVVNMKITGKTTYQDS 129
           + + ++  GAG++  P+A K  GL+ G   VI+++V     ++ + +  ++  K   Q  
Sbjct: 10  LTLLHTACGAGILAMPYAFKPFGLMPG---VIMIAVCGVCAMQSLFIQARV-AKYVPQGR 65

Query: 130 VEF-AMGR--KGKLLIL--LSNGLFAXXXXXXXXXXXXDTIPHVLRAFFPGHENLFHRNI 184
             F A+ R     L I+  L+  +              D +P ++ + +  +  L  RN+
Sbjct: 66  ASFSALTRLINPNLSIVFDLAIAIKCFGVGVSYMIVVGDLMPQIM-SVWTRNAWLLSRNV 124

Query: 185 IIILVTCFISFPLSLNRNISKLSKASMLAXXXXXXXXXXXXXK--GPMIDDAY-KGSFNT 241
            I L+  F+  PLS  + ++ L  ASM+A                 P  +  + KG  + 
Sbjct: 125 QISLIMVFLVAPLSFLKKLNSLRYASMIAISSVAYLCVLVLVHYIAPSEEILHMKGRIS- 183

Query: 242 TELFFTPR------IFQGISVISFALVCHHNTSFIYFSLKTPSLKRFDRLTHFSCFVAMI 295
              +F P+      I     +  FA  CHHN   I    ++   +   ++   +  +A+I
Sbjct: 184 ---YFFPKQSHDLNILNTFPIFVFAYTCHHNMFSIINEQRSSRFEHVMKIPLIAISLALI 240

Query: 296 FCFLMGYTGFLVFKDRTKGNILNNFPGSDNVVNVARFCFGFNMLTTFPLEIFVLRDVIRD 355
               +G  G+L F D   GNI+  +P + +   V R      ++  FPL+    R  I  
Sbjct: 241 LYVAIGCAGYLTFGDNIIGNIIMLYPQTTS-STVGRVAIVLLVMLAFPLQCHPARASIHQ 299

Query: 356 FM 357
            +
Sbjct: 300 IL 301

>CAGL0H04587g Chr8 (431944..433281) [1338 bp, 445 aa] {ON} similar
           to uniprot|P40074 Saccharomyces cerevisiae YER119c
          Length = 445

 Score = 53.5 bits (127), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 68/318 (21%), Positives = 110/318 (34%), Gaps = 47/318 (14%)

Query: 179 LFHRNIIIILVTCFISFPLSLNRNISKLSKASMLAXXXXXXXXXXXXXKGPMIDDAY--- 235
           L  RN+ I LV  FI  PL   R ++ L  ASM+A                         
Sbjct: 118 LLSRNVNITLVMLFIVGPLCFMRRLNSLRYASMIAIGSVAYLCILVIVHFAHQTTELREL 177

Query: 236 KGSFNTTELFFTPRIFQGISVISFALVCHHNTSFIYFSLKTPSLKRFDRLTHFSCFVAMI 295
           KG  +       P     + +  FA  CHHN   +    K         +   S  VA +
Sbjct: 178 KGEVSVGLPHGEPTPLTTLPIFVFAYTCHHNMFSVINEQKNTGFTYVRYIAIVSILVAFV 237

Query: 296 FCFLMGYTGFLVFKDRTKGNILNNFPGSDNVVNVARFCFGFNMLTTFPLEIFVLRDVIRD 355
              ++G TG+L F D   GNI+  +P + +   + R      ++  FPL+    R+ I +
Sbjct: 238 LYVVIGSTGYLTFGDNITGNIIALYPDTLS-TTIGRIAIVLLVMLAFPLQCHPARESINN 296

Query: 356 FMFF------------------------------NSKDTNQSQE-LSLKLHXXXXXXXXX 384
            + +                              NS+  ++ +E +  K           
Sbjct: 297 MIKYVQDRYSPQTSYELTAVDADNLEINNDVTSINSRANDKEEECMDTKRFMIITACILF 356

Query: 385 XXXXXXXXXCNLGALFELTGATTASLMAYILPPSVNLLLIG------------KRSTVRE 432
                     +L  +  + GAT ++ +++ILP      LIG            ++STV  
Sbjct: 357 CSYLLAISVTSLARVLAIVGATGSTTISFILPGYFGWSLIGTEYTSNGNQLPLRKSTVIF 416

Query: 433 KLPHYACIIFGFTIMVVS 450
           K       I+G  IM+ S
Sbjct: 417 KYIGLVMTIWGIIIMITS 434

>Kpol_1032.88 s1032 complement(188477..190204) [1728 bp, 575 aa]
           {ON} complement(188477..190204) [1728 nt, 576 aa]
          Length = 575

 Score = 53.5 bits (127), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 94/442 (21%), Positives = 166/442 (37%), Gaps = 49/442 (11%)

Query: 35  NSQRNSERLIDGSEDESTTAFLRENRSKSNIFMAFMNMANSILGAGVIGQPFAIKNCGLV 94
           ++ R     +D S+  STT              A + +  S +G G++  P    N G  
Sbjct: 165 DTTRTQAAPVDKSKKVSTTK-------------AILLLLKSFVGTGILFLPKGFSNGGYS 211

Query: 95  GGIFAVILLSVLVDWTIRLIVVNMKIT-GKTTYQDSVEFAMGRKGKLLILLSNGLFAXXX 153
               +++L SV+  +   L++     T G   Y D  +   GR  K  ILLS  L     
Sbjct: 212 FSTISLLLCSVISYYCFVLLISTKDTTHGINGYGDLGQHLFGRPMKFAILLSIVLSQIGF 271

Query: 154 XXXXXXXXXDTIPHVLRAFFPGHENLFHRNIIIILVTCFISFPLSLNRNISKLSKASMLA 213
                      +  +  + F   ENL       I+    +  PLS  RNI+KL+  +++A
Sbjct: 272 SAAYTVFVATNLKTLCNSVF---ENLDSSIKFFIIFQAILFIPLSFTRNITKLTATALIA 328

Query: 214 ------------XXXXXXXXXXXXXKGPMI--DDAYKGSFNTTELFFTPRIFQGISVISF 259
                                    +G M+  ++     F  T +F     F+GI ++  
Sbjct: 329 DFFILIGLLYIYYYPISYISYNGIARGTMVPFNNKSWSLFIGTAIF----TFEGIGLLIP 384

Query: 260 ALVCHHNTSFIYFSLKTPSLKRFDRLTHFSCFVAMIFCFLMGYTGFLVFKDRTKGNILNN 319
                     I  S+  P L R   L+     V +IF   +G   +  F    +  +L N
Sbjct: 385 ----------IQESMAKPHLFRLS-LSLVMVIVTLIFVS-VGLLCYSAFGSDVETVVLLN 432

Query: 320 FPGSDNVVNVARFCFGFNMLTTFPLEIFVLRDVIRDFMFFNSKDTNQSQELSLKLHXXXX 379
           FP       + +  +   +L + PL++F    ++ +++F +      + ++    +    
Sbjct: 433 FPQDSPYTLIVQLLYSLAILLSTPLQLFPAIRILENWVFKSRYSGKYNPKIKWAKNYFRT 492

Query: 380 XXXXXXXXXXXXXXCNLGALFELTGATTASLMAYILPPSVNLLLIGKRSTVRE-KLPHYA 438
                          +L     L G+     + YI PP +++  + +  TV    L   +
Sbjct: 493 LVVIGTSFIAWIGADDLDKFVSLVGSFACIPLIYIYPPLLHIKALKRNGTVTNLHLIVDS 552

Query: 439 C-IIFGFTIMVVSSSQTIIAYI 459
           C IIFGFTI++ +S QTI  +I
Sbjct: 553 CMIIFGFTILIYTSCQTIKLWI 574

>NCAS0E02440 Chr5 (477113..478600) [1488 bp, 495 aa] {ON} Anc_7.420
          Length = 495

 Score = 53.5 bits (127), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 67/321 (20%), Positives = 127/321 (39%), Gaps = 17/321 (5%)

Query: 63  SNIFMAFMNMANSILGAGVIGQPFAIKNCGLVGGIFAVILLSVLVDWTIRLIVVNMKITG 122
           SN     + + ++  GAG++  PFA K  GLV G FA  +L++    ++  +++  ++  
Sbjct: 7   SNTRSGVITLLHTACGAGILAMPFAFKPFGLVPG-FA--MLTICGLCSLLGLLLQARVYR 63

Query: 123 KTTYQDSVEFAMGRKG----KLLILLSNGLFAXXXXXXXXXXXXDTIPHVLRAFFPGHEN 178
               + +  F++ +K      ++  L+  +              D +P ++      +  
Sbjct: 64  YAPERAASFFSLTQKINPNLSVVFDLAIAIKCFGVGVSYMIVVGDLMPQIVSGL-TKNAL 122

Query: 179 LFHRNIIIILVTCFISFPLSLNRNISKLSKASMLAXXXXXXXXXXXXX----KGPMIDDA 234
           L  R   I L+  F++ PL L +N++ L  ASM+A                     I D 
Sbjct: 123 LLDRVFHITLIMAFVAGPLCLLKNLNSLRYASMVAISAVAYLCILVLVHFIFPSQEIKD- 181

Query: 235 YKGSFNTTELFFTPRIFQGISVISFALVCHHNTSFIYFSLKTPSLKRFDRLTHFSCFVAM 294
            KG F              + +  FA  CHHN   +    K         +   +  +A+
Sbjct: 182 LKGDFAVWFPHNEGSPLSTLPIFVFAYTCHHNVFAVINEQKKTRFAHVKVIAIIAMLLAL 241

Query: 295 IFCFLMGYTGFLVFKDRTKGNILNNFPGSDNVVNVARFCFGFNMLTTFPLEIFVLRDVIR 354
           +   L+G  G+  F +   GNI+  +P S     + R    F +   FPL+    R  I 
Sbjct: 242 VLYVLIGGAGYFTFGNHIVGNIITLYPHSIT-STIGRVAIVFLVTLAFPLQCHPARASIH 300

Query: 355 DFMFF---NSKDTNQSQELSL 372
             + +    +K  +Q+Q++ +
Sbjct: 301 HIICYIKHKAKKRDQNQQIKV 321

>NDAI0E04010 Chr5 (888700..890115) [1416 bp, 471 aa] {ON} Anc_7.420
          Length = 471

 Score = 53.5 bits (127), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 70/330 (21%), Positives = 122/330 (36%), Gaps = 28/330 (8%)

Query: 63  SNIFMAFMNMANSILGAGVIGQPFAIKNCGLVGGIFAVILLSVLVDWTIRLIVVNMKITG 122
           S I    + + ++  GAG++  P+A K  GL+ G   + +  +   W +   ++  ++T 
Sbjct: 3   STIRYGVLTLLHTACGAGILAMPYAFKPFGLIPGFIMIAICGLCSLWGL---ILQARVTK 59

Query: 123 KTTYQDSVEFAMGRKGKLLIL-------------LSNGLFAXXXXXXXXXXXXDTIPHVL 169
            +   D+ + A  R      L             L+  +              D +P +L
Sbjct: 60  YSKTDDNDDTANDRSVSFFSLTQIINPNLSVIFDLAIAIKCFGVGVSYMIVVGDLMPQIL 119

Query: 170 RAFFP----GHENLFHRNI-IIILVTCFISFPLSLNRNISKLSKASMLAXXXXXXXXXXX 224
               P        L  RN  I I++ C +S PL   +N+S L  ASM+A           
Sbjct: 120 SHLIPESHSTSSLLLSRNFHITIMMLCIVS-PLCFMKNLSSLRYASMVAISSVVYLCVLV 178

Query: 225 X----XKGPMIDDAYKGSFNTTELFFTPRIFQGISVISFALVCHHNTSFIYFSLKTPSLK 280
                     I D  KG  +       P     + +  FA  CHHN   +       S  
Sbjct: 179 VFHFLSPSQEIKD-LKGELSYWLPNNEPSPLVTLPIFVFAYTCHHNMFSVINEQIDNSFH 237

Query: 281 RFDRLTHFSCFVAMIFCFLMGYTGFLVFKDRTKGNILNNFPGSDNVVNVARFCFGFNMLT 340
              +L   +  +A     ++G +G+  F D   GNI+  +P S +   + R    F +  
Sbjct: 238 NIKKLAIIAMSLAFSLYIIIGGSGYYTFGDNIVGNIITLYPQSVS-STIGRMAIVFLVTL 296

Query: 341 TFPLEIFVLRDVIRDFMFFNSKDTNQSQEL 370
            FPL+    R  I   + + +   N ++E+
Sbjct: 297 AFPLQCHPARASIHHIILYITMKINDAKEI 326

>NCAS0F02310 Chr6 complement(458165..460171) [2007 bp, 668 aa] {ON}
           Anc_5.252 YKL146W
          Length = 668

 Score = 53.1 bits (126), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 92/434 (21%), Positives = 161/434 (37%), Gaps = 50/434 (11%)

Query: 52  TTAFLRENRSKSNIFMAFMNMANSILGAGVIGQPFAIKNCGLVGGIFAVILLSVLVDWTI 111
           TT+   +N+ KS+ F A + +  S +G GV+  P A  N G  G     +    L+ +  
Sbjct: 260 TTSRRHKNKHKSSTFRAILLLLKSFVGTGVLFLPKAFHNGGY-GFSSLSLFFCALISYGC 318

Query: 112 RLIVVNMKITGKTT-YQDSVEFAMGRKGKLLILLSNGLFAXXXXXXXXXXXXDTIPHVLR 170
            L ++  K   K   Y D  +   G+K K  IL S  L                    L+
Sbjct: 319 FLTLIQTKDKVKVDGYGDMGQIIYGKKMKFAILWSIVLSQIGFSAAYTVFTATN----LQ 374

Query: 171 AFFPGHENLFHRNIII---------ILVTCFISFPLSLNRNISKLSKASMLAXXXXXXXX 221
            F    EN+F  +            IL+   +  PLSL RNI+KLS  +++A        
Sbjct: 375 VFC---ENVFFSSSSPSSSSSLAPYILLQQLVFVPLSLTRNIAKLSGTALIADLFILLGL 431

Query: 222 XXXXXKGPMIDDAY--KGSFNTTELFFTPR----IFQGISVISFALVCHHNTSFIYFSLK 275
                       +Y  K   ++  + +  +    +F G ++ +F  +           L 
Sbjct: 432 VYVY----FYSTSYIIKNGISSKTMLWLNKSDWSLFIGTAIFTFEGI----------GLL 477

Query: 276 TPSLKRFDRLTHFS-------CFVAMIF--CFLMGYTGFLVFKDRTKGNILNNFPGSDNV 326
            P  +      HFS       C V +IF  C L+ Y+ F     + +  +L NFP     
Sbjct: 478 IPIQESMSHPQHFSKCLSMVMCIVTVIFISCGLLCYSAF---GSKVETVVLLNFPHDSPY 534

Query: 327 VNVARFCFGFNMLTTFPLEIFVLRDVIRDFMFFNSKDTNQSQELSLKLHXXXXXXXXXXX 386
             + +  +   +L + PL++F    ++ ++ F  S     + ++    +           
Sbjct: 535 TLMVQLLYALAILLSTPLQLFPAIKILENWCFPISASGKNNPKVKWLKNYFRCIIVLLTA 594

Query: 387 XXXXXXXCNLGALFELTGATTASLMAYILPPSVNLLLIGKRSTVREKLPHYACIIFGFTI 446
                   +L     L G+     + YI PP ++L       T+   +     +IFG  +
Sbjct: 595 FIAYVGANDLDKFVSLVGSFACIPLIYIYPPLLHLKAYWGEQTILRMVLDSLVLIFGVAV 654

Query: 447 MVVSSSQTIIAYIR 460
           M  +S QTI  ++ 
Sbjct: 655 MGYTSWQTIAMWLH 668

>TPHA0K00670 Chr11 (132771..134165) [1395 bp, 464 aa] {ON} Anc_7.420
           YER119C
          Length = 464

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 64/320 (20%), Positives = 122/320 (38%), Gaps = 35/320 (10%)

Query: 70  MNMANSILGAGVIGQPFAIKNCGLVGGIFAVILLSVLVDWTIRLIVVNMKITGKTTYQDS 129
           + + ++  GAG++  P+A +  G+  G+F   L++      +  +++   +      +++
Sbjct: 10  LTLLHTACGAGILAMPYAFQPFGVFPGLF---LIAFCGACAMLGLILQSTVAKYVPERNA 66

Query: 130 VEFAMGR----KGKLLILLSNGLFAXXXXXXXXXXXXDTIPHVLRAFFPGHENLFHRNII 185
             FA+ +    K  +L  ++  +              D +P +L  F    E   +RN+ 
Sbjct: 67  SFFALSQVTNPKFSVLFDIAIAVKCFGVGVSYMIVVGDVMPQILGTF-TDTEFFLNRNVN 125

Query: 186 IILVTCFISFPLSLNRNISKLSKASMLAXXXXXXXXXXXX------------XKGPMIDD 233
           I +V  FI  PL   +N++ L  AS+ A                         +GP+   
Sbjct: 126 ITIVMLFIVTPLCFLKNLNSLRYASIAAISAVIYLCFLVMFHFFIPNEEIRDTRGPVSWG 185

Query: 234 AYKGSFNTTELFFTPRIFQGISVISFALVCHHNTSFIYFSLKTPSLKRFDRLTHFSCFVA 293
             K   N             + +  FA  CHHN   +    +     +  ++  F+  +A
Sbjct: 186 FPKDGLNP---------LNTLPIFVFAYTCHHNMFSVINEQQDIHFNKLKQICIFAMLLA 236

Query: 294 MIFCFLMGYTGFLVFKDRTKGNILNNFPGSDNVVNVARFCFGFNMLTTFPLEIFVLR--- 350
                ++G +G+L F +   GNI+  +  S     V R      ++  FPL+    R   
Sbjct: 237 CTLYIIIGGSGYLTFGNAITGNIITLYSNSA-ATTVGRIAIVILVMLAFPLQCHPARASI 295

Query: 351 -DVIRDFMFFNSKDTNQSQE 369
             ++  F   N  D NQ QE
Sbjct: 296 NHILHYFQLINC-DNNQVQE 314

>Kpol_505.5 s505 complement(5011..7074) [2064 bp, 687 aa] {ON}
           complement(5011..7074) [2064 nt, 688 aa]
          Length = 687

 Score = 53.1 bits (126), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 98/417 (23%), Positives = 157/417 (37%), Gaps = 55/417 (13%)

Query: 77  LGAGVIGQPFAIKNCGLVGGIFAVILLSVLVDWTIRLIVVNMKITGKTTYQDSVEFAMGR 136
           +G GV+  P A  N GL   I  ++   V   W   L+V    ITG T++ +  +   G 
Sbjct: 286 VGTGVLFLPSAFHNGGLFFSIVMIMFFGVYSFWCYYLLVRVKTITGLTSFGNMGQRVFGP 345

Query: 137 KGKLLILLSNGLFAXXXXXXXXXXXXDTIPHVLRAFFPGHENLFHRNIIIILVTCFISF- 195
             K +ILLS  L                     +AF     N+   NII  ++  FI F 
Sbjct: 346 WMKFIILLSLILSQLGFGSTYVIFTAKN----FKAFIENVTNIKDFNIIYPILLQFIIFV 401

Query: 196 PLSLNRNISKLSKASMLAX------XXXXXXXXXXXXKGPMIDDAYKGS---FNTTE--L 244
           PLS  R +SKL+  S++A                    G +      G    FNT    L
Sbjct: 402 PLSYIRRVSKLTLPSLIANGFILIGLSLVIYFSIDHLAGDLHGKPADGIISFFNTKHWTL 461

Query: 245 FFTPRI--FQGISVISFALVCHHNTSFIYFSLKTPSLKRFDRLTHFSCFVAMIFCFLMGY 302
           F    I  F+GI +I    +   N      S++ PS  +F  +         +   ++  
Sbjct: 462 FIGTAIFAFEGIGLI----IPLQN------SMRDPS--KFPLVLGLVMICTTVMFIIIAT 509

Query: 303 TGFLVFKDRTKGNILNNFPGSDNVVNVARFCFGFNMLTTFPLEIFVLRDVIRDFMF---- 358
            G+L +   T+  IL NFP  + VVN+ +  +   +L + PL+IF   +++ D +F    
Sbjct: 510 IGYLSYGSSTETIILQNFPQKNIVVNLIQLFYALAILLSTPLQIFPAIEIVEDKIFPKPG 569

Query: 359 --------------FNSKDTNQSQELSLKLHXXXXXXXXXXXXXXXXXXCNLGALFELTG 404
                         +N+        +    +                   NL  L  + G
Sbjct: 570 SDPECKDEIPITTIYNANSGGLDWRIKWFKNMIRTMIVTCVILLAYFGSNNLDKLVAIIG 629

Query: 405 ATTASLMAYILPPSVNL------LLIGKRSTVREKLPHYACIIFGFTIMVVSSSQTI 455
           +     + Y+ PP ++L      +  GKR T  +    Y  I+FG   MV ++ Q+I
Sbjct: 630 SLACIPLVYMYPPMLHLKTYSIPMSKGKRFTWSKSF-DYILIVFGGVSMVYTTYQSI 685

>YKL146W Chr11 (171783..173861) [2079 bp, 692 aa] {ON}  AVT3Vacuolar
           transporter, exports large neutral amino acids from the
           vacuole; member of a family of seven S. cerevisiae genes
           (AVT1-7) related to vesicular GABA-glycine transporters
          Length = 692

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 101/412 (24%), Positives = 154/412 (37%), Gaps = 38/412 (9%)

Query: 62  KSNIFMAFMNMANSILGAGVIGQPFAIKNCGLVGGIFAVILLS-VLVDWT--IRLIVVNM 118
           KS+   A + +  S +G GV+  P A  N G   G  A+ LLS  L+ +   + LI    
Sbjct: 296 KSSTVKAVLLLLKSFVGTGVLFLPKAFHNGGW--GFSALCLLSCALISYGCFVSLITTKD 353

Query: 119 KITGKTTYQDSVEFAMGRKGKLLILLSNGLFAXXXXXXXXXXXXDTIPHVLRAFFPGHEN 178
           K+ G   Y D      G K K  IL S  L                    L+ F    EN
Sbjct: 354 KV-GVDGYGDMGRILYGPKMKFAILSSIALSQIGFSAAYTVFTATN----LQVF---SEN 405

Query: 179 LFHRN------IIIILVTCFISFPLSLNRNISKLSKASMLAXXXXXXXXXXXXXKGPMID 232
            FH           I     I  PLSL RNI+KLS  +++A                +  
Sbjct: 406 FFHLKPGSISLATYIFAQVLIFVPLSLTRNIAKLSGTALIADLFILLGLVYVYVYS-IYY 464

Query: 233 DAYKGSFNTTELFFTP---RIFQGISVISF---ALVCHHNTSFIYFSLKTPSLKRFDRLT 286
            A  G  + T L F      +F G ++ +F    L+       I  S+K P   R   L+
Sbjct: 465 IAVNGVASDTMLMFNKADWSLFIGTAIFTFEGIGLLIP-----IQESMKHPKHFR-PSLS 518

Query: 287 HFSCFVAMIF--CFLMGYTGFLVFKDRTKGNILNNFPGSDNVVNVARFCFGFNMLTTFPL 344
              C VA+IF  C L+ Y     F    K  +L NFP   +     +  +   +L + PL
Sbjct: 519 AVMCIVAVIFISCGLLCYAA---FGSDVKTVVLLNFPQDTSYTLTVQLLYALAILLSTPL 575

Query: 345 EIFVLRDVIRDFMFFNSKDTNQSQELSLKLHXXXXXXXXXXXXXXXXXXCNLGALFELTG 404
           ++F    ++ ++ F ++     + ++    +                   +L     L G
Sbjct: 576 QLFPAIRILENWTFPSNASGKYNPKVKWLKNYFRCAIVVLTSILAWVGANDLDKFVSLVG 635

Query: 405 ATTASLMAYILPPSVNLLLIGKRSTVREK-LPHYACIIFGFTIMVVSSSQTI 455
           +     + YI PP ++        T R + L     I+FG  +M  +S QTI
Sbjct: 636 SFACIPLIYIYPPLLHYKASILSGTSRARLLLDLIVIVFGVAVMAYTSWQTI 687

>Ecym_7133 Chr7 (264196..265569) [1374 bp, 457 aa] {ON} similar to
           Ashbya gossypii AGL285C
          Length = 457

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 64/311 (20%), Positives = 118/311 (37%), Gaps = 14/311 (4%)

Query: 62  KSNIFMAFMNMANSILGAGVIGQPFAIKNCGLVGGIFAVIL--LSVLVDWTIRLIVVNMK 119
           +S++    + + ++  GAG++  P+A ++ GL+ G   ++    S L    ++  V    
Sbjct: 2   RSSVQSGVLTLLHTACGAGILAMPYAFRSFGLLPGFLIIVFCGFSALTGLVLQSYVSKYV 61

Query: 120 ITGKTTYQDSVEFAMGRKGKLLILLSNGLFAXX--XXXXXXXXXXDTIPHVLRAFFPGHE 177
                ++    E A     +L I+    +                D +P ++  F   ++
Sbjct: 62  APRHVSF---FELAQISYPELSIVFDCAIAVKCFGVGISYMVVVGDLMPQIVSTF-TSNQ 117

Query: 178 NLFHRNIIIILVTCFISFPLSLNRNISKLSKASMLAXXXXXXXXXXXXXKGPMIDDAYKG 237
            L  R + I L   FI  PL   R +  L  ASM+A                      + 
Sbjct: 118 WLLERTLQITLCMLFIVTPLCFMRKLDSLRYASMVAISSVAYLCVLVVYHFLFPSSDIRQ 177

Query: 238 SFNTTELFF-----TPRIFQGISVISFALVCHHNTSFIYFSLKTPSLKRFDRLTHFSCFV 292
           +     + F        +     +  FA  CHHN   I   L+  SL    R+   +  +
Sbjct: 178 AKGIVSIGFPENNSAASMLSSFPIFVFAYTCHHNMFSIVNELRDNSLTNCVRVVLIAMGL 237

Query: 293 AMIFCFLMGYTGFLVFKDRTKGNILNNFPGSDNVVNVARFCFGFNMLTTFPLEIFVLRDV 352
           A+    ++G +G+L F D   GNI+  +P S +   +AR      ++  FPL+    R  
Sbjct: 238 AVSLYTVIGGSGYLTFGDNITGNIVTIYPRSVS-STLARIAIVLLVMLAFPLQCHPARAS 296

Query: 353 IRDFMFFNSKD 363
           I +   + S+ 
Sbjct: 297 INNIWCYFSES 307

>KLLA0C13277g Chr3 (1135255..1137420) [2166 bp, 721 aa] {ON} similar
           to uniprot|P50944 Saccharomyces cerevisiae YNL101W AVT4
           Vacuolar transporter exports large neutral amino acids
           from the vacuole member of a family of seven S.
           cerevisiae genes (AVT1-7) related to vesicular GABA-
           glycine transporters
          Length = 721

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 79/311 (25%), Positives = 133/311 (42%), Gaps = 42/311 (13%)

Query: 57  RENRSKSNIFMAFMNMANSILGAGVIGQPFAIKNCGLVGGIFAVILLS---VLVDWTIRL 113
           R ++ K++ F AF+ M  S +G GV+  P A  N GL   IF+V++LS   +   W   +
Sbjct: 299 RPSQVKTSTFKAFLLMLKSFIGTGVLFLPSAFANGGL---IFSVLMLSFFGMYSYWCYYI 355

Query: 114 IVVNMKITGKTTYQDSVEFAMGRKGKLLILLSNGLFAXXXXXXXXXXXXDTIPHVLRAFF 173
           ++ +   TG +++ D      G   +  IL S  L                    L AFF
Sbjct: 356 LIRSKVATGVSSFGDIGIKLYGPWMRYAILASLILTQLGFSAAYVVFTCKN----LLAFF 411

Query: 174 PGHENLFHRNII----IILVTCFISFPLSLNRNISKLSKASMLA---XXXXXXXXXXXXX 226
              +N+FH + +    ++++   I  PL+  RN+SKLS  S+LA                
Sbjct: 412 ---QNVFHLHSLRIEHLLILQTIIFIPLAFIRNVSKLSLTSLLANFFTMAGLIIIVFFVV 468

Query: 227 KGPMIDDAYKGS------FNTTE--LFFTPRI--FQGISVISFALVCHHNTSFIYFSLKT 276
           K  +ID   K        FN+++  LF    I  F+GI +I            +  S++ 
Sbjct: 469 KHLVIDLDLKPEAGIIYGFNSSKWSLFIGTAIFAFEGIGLI----------IPVQDSMRK 518

Query: 277 PSLKRFDRLTHFSCFVAMIFCFLMGYTGFLVFKDRTKGNILNNFPGSDNVVNVARFCFGF 336
           P  ++F  +       A +    +   G+L F    +  IL N P  +  VN+ +F +  
Sbjct: 519 P--EKFPLVLGLVILTATVLFISIAALGYLAFGRYIETVILLNLPQDNIFVNLVQFFYSL 576

Query: 337 NMLTTFPLEIF 347
            +L + PL++F
Sbjct: 577 AILLSTPLQLF 587

>CAGL0M06611g Chr13 complement(681693..683150) [1458 bp, 485 aa]
           {ON} similar to uniprot|P40501 Saccharomyces cerevisiae
           YIL088c
          Length = 485

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 67/299 (22%), Positives = 116/299 (38%), Gaps = 22/299 (7%)

Query: 71  NMANSILGAGVIGQPFAIKNCGLVGGIFAVILLSVLVDWTIRLIVVNMKITGKTTYQDSV 130
           N+  +I+GAG+   PFA KN G+  G+  + L +V   + + L+    K           
Sbjct: 15  NLVKTIVGAGLFAIPFAFKNDGVAVGLLLIFLAAVTSSFGLILLAKCSKTLINPRNSSFF 74

Query: 131 EFAMGRKGKLLILLSNGLFAXXXXXXXXXXXXDTIPHVLRAFFP---GHENLFHRNIIII 187
              M     L  L    +                   ++  FFP   G E  +      I
Sbjct: 75  TICMLTYPSLAPLFDLAMVVQCFGVGLSYLV------LVGDFFPDLFGGERKYW-----I 123

Query: 188 LVTCFISFPLSLNRNISKLSKASMLAXXXXXXXXXXXXXKGPMIDDAYKG--SFNTTEL- 244
           L++  +  PL   + +  L  +S++              +  + D A+    SF   E+ 
Sbjct: 124 LLSAILVVPLCCLKKLDNLKYSSIVGVIALLYLSLLIGFRY-LTDVAFAPEISFERGEIS 182

Query: 245 FFTPRIFQGI----SVISFALVCHHNTSFIYFSLKTPSLKRFDRLTHFSCFVAMIFCFLM 300
           +F    ++G+    S+I FA V   N   I   L+  S+    ++   S  ++ I    +
Sbjct: 183 WFKVYDYKGLLSTFSIIIFAYVGAMNIFTIVNELQDNSMTNVRKVVDSSILISTILFLFV 242

Query: 301 GYTGFLVFKDRTKGNILNNFPGSDNVVNVARFCFGFNMLTTFPLEIFVLRDVIRDFMFF 359
           G  G+L F   T GNIL N+      + + +FC    ++ TFPL    LR  I + + +
Sbjct: 243 GLFGYLTFGSLTMGNILLNYDSDSLAIGIGKFCLAMMLILTFPLLFHPLRTAINNIVVW 301

>ZYRO0A10538g Chr1 (852296..854122) [1827 bp, 608 aa] {ON} similar
           to uniprot|P36062 Saccharomyces cerevisiae YKL146W AVT3
           Vacuolar transporter exports large neutral amino acids
           from the vacuole member of a family of seven S.
           cerevisiae genes (AVT1-7) related to vesicular GABA-
           glycine transporters
          Length = 608

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 88/433 (20%), Positives = 159/433 (36%), Gaps = 36/433 (8%)

Query: 46  GSEDESTTAFLR-------ENRSKSNIFMAFMNMANSILGAGVIGQPFAIKNCGLVGGIF 98
           G EDE +    R       + + K+  F A + +  S +G GV+  P A  N G      
Sbjct: 190 GHEDEESVLLERVPTRDSKKQQRKATTFKAILLLLKSFVGTGVLFLPRAFHNGGWAFSTG 249

Query: 99  AVILLSVLVDWTIRLIVVNMKITGKTTYQDSVEFAMGRKGKLLILLSNGLFAXXXXXXXX 158
            ++  ++       L++      G + Y D  +   G K +  IL S  L          
Sbjct: 250 CLLFCAIASSLAFVLLIKTKDKVGVSGYGDLGKALYGPKVEFSILFSIALSQLGFSAAYT 309

Query: 159 XXXXDTIPHVLRAFFPGHENLFHRNIII---ILVTCFISFPLSLNRNISKLSKASMLAXX 215
                     L+ FF    N    ++ +   I++   I  PLSL RNI+KLS  +++A  
Sbjct: 310 VFTATN----LKVFFENAFNFPADSVPLSAYIILQALIFIPLSLTRNITKLSGTALIADL 365

Query: 216 XXXXXXXXXXXKGPMIDDAYKGSFNTTELFFTP---RIFQGISVISFALVCHHNTSFIYF 272
                        P +  A  G    + LFF      +F G ++ +F  +          
Sbjct: 366 FILLGLLYVYYY-PALYIAKHGIATDSVLFFNRSDWSLFIGTAIFTFEGI---------- 414

Query: 273 SLKTPSLKRFDRLTHFSC---FVAMIFCFLMGYTG---FLVFKDRTKGNILNNFPGSDNV 326
            L  P  +   +  HF     FV  I  F+   +G   +L F  + +  +L NFP  D++
Sbjct: 415 GLLIPIQESMKKPEHFYPSLGFVMSIVTFIFVSSGLLCYLAFGAKVETVVLLNFP-QDSI 473

Query: 327 VNVA-RFCFGFNMLTTFPLEIFVLRDVIRDFMFFNSKDTNQSQELSLKLHXXXXXXXXXX 385
             ++ +  +   +L + PL++F    +   + F ++     +  +    +          
Sbjct: 474 ATISVQLIYSLAILLSTPLQLFPAIRIFETWTFPSNASGKHNHRVKWLKNYFRTGVVIFT 533

Query: 386 XXXXXXXXCNLGALFELTGATTASLMAYILPPSVNLLLIGKRSTVREKLPHYACIIFGFT 445
                    +L     L G+     + YI PP ++L     +++    L       FG  
Sbjct: 534 ALLAWVGANDLDKFVSLVGSFACIPLIYIYPPLLHLKSSDTQTSKFIILGDLLIFFFGVG 593

Query: 446 IMVVSSSQTIIAY 458
           +M  +S Q I+ +
Sbjct: 594 VMAYTSYQNIVLW 606

>ZYRO0B09548g Chr2 complement(742965..745121) [2157 bp, 718 aa] {ON}
           similar to uniprot|P50944 Saccharomyces cerevisiae
           YNL101W AVT4 Vacuolar transporter exports large neutral
           amino acids from the vacuole member of a family of seven
           S. cerevisiae genes (AVT1-7) related to vesicular GABA-
           glycine transporters
          Length = 718

 Score = 51.2 bits (121), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 73/304 (24%), Positives = 126/304 (41%), Gaps = 27/304 (8%)

Query: 68  AFMNMANSILGAGVIGQPFAIKNCGLVGGIFAVILLSVLVDWTIRLIVVNMKITGKTTYQ 127
           AF+ +  S +G GV+  P A  N GL   I  ++   +   W   +++   ++ G T++ 
Sbjct: 307 AFLLLLKSFIGTGVLFLPHAFSNGGLFFSIVMLLFFGLYSFWCYYILIRAKEVVGVTSFG 366

Query: 128 DSVEFAMGRKGKLLILLSNGLFAXXXXXXXXXXXXDTIPHVLRAFFPGHENLFH--RNII 185
           D      G   K +IL S                 +     L+AF     N+ H   NI 
Sbjct: 367 DIGLRLYGPWVKFIILFSLVFTQLGFSGAYVIFTAEN----LKAFC---SNVLHFSENIP 419

Query: 186 II---LVTCFISFPLSLNRNISKLSKASMLA---XXXXXXXXXXXXXKGPMIDDAYKGSF 239
           I+   L    I  PLS  RN+SKLS  S+LA                K   ++   K + 
Sbjct: 420 ILYFMLAQFAIFIPLSFIRNVSKLSLPSLLANFFVMGGLVIVLFFSLKQLALESHMKPAE 479

Query: 240 NTTELFFTPR--IFQGISVISF---ALVCHHNTSFIYFSLKTPSLKRFDRLTHFSCFVAM 294
               LF T R  +F G ++ +F    LV       +  S++ P  ++F  +       + 
Sbjct: 480 GVVLLFNTNRWTMFIGTAIFAFEGIGLVIP-----VQDSMRHP--EKFPLVLGMVIITST 532

Query: 295 IFCFLMGYTGFLVFKDRTKGNILNNFPGSDNVVNVARFCFGFNMLTTFPLEIFVLRDVIR 354
           +    +G  G+L +  + K  IL N P ++  VN+ +F +   ++ + PL++F    +I 
Sbjct: 533 VLFITIGSIGYLAYGYKIKTVILLNLPQANISVNLIQFFYSLAIMLSTPLQLFPAIKIIE 592

Query: 355 DFMF 358
           + +F
Sbjct: 593 NKVF 596

>Kwal_26.8401 s26 complement(767440..769602) [2163 bp, 720 aa] {ON}
           YNL101W - Hypothetical ORF [contig 60] FULL
          Length = 720

 Score = 51.2 bits (121), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 104/490 (21%), Positives = 183/490 (37%), Gaps = 72/490 (14%)

Query: 4   EAANEASIQEETFSDRDELLGSSFQLSSFDRNSQRNSERLIDGSEDESTTAFLRENRSKS 63
           E   E S  +E   +R  LL          R      +R+      + TT+ ++      
Sbjct: 263 EFYTEESTSDEGIDERSPLLA---------RTQAETGKRIYVPKSAKGTTSTMK------ 307

Query: 64  NIFMAFMNMANSILGAGVIGQPFAIKNCGLVGGIFAVILLSVLVDWTIRLIVVNMKITGK 123
               AF+ M  S +G GV+  P A  N GLV  +  +I       W   ++  +   T  
Sbjct: 308 ----AFLLMIKSFIGTGVLFLPGAFSNGGLVFSLIMLIFFGTYSFWCYYILTQSKVATRV 363

Query: 124 TTYQDSVEFAMGRKGKLLILLSNGL----FAXXXXXXXXXXXXDTIPHVLRAFFPGHENL 179
            ++ D      G   K +ILLS  +    F+              + +V   ++PG    
Sbjct: 364 ASFGDIGLTLYGPWMKFIILLSLVMTQLGFSGAYVVFTAKNLLAFVNNVF--YWPG---- 417

Query: 180 FHRNIIIILVTCFISF-PLSLNRNISKLSKASMLAXXXXXXXXXXX---XXKGPMIDDAY 235
               I+ +L    + F PLS  RNI+KLS +S++A                K    D  +
Sbjct: 418 --VTIVHLLALQLVIFIPLSFIRNIAKLSLSSLVANFLVMGGIVIVIGFTAKHLFFDLNF 475

Query: 236 KGSFNTTELFFTPR--IFQGISVISF---ALVCHHNTSFIYFSLKTPSLKRFDRLTHFSC 290
           K + +    F + R  ++ G ++ +F    L+       I  S+K P  ++F  +     
Sbjct: 476 KPAEDIVMGFNSSRWTLYVGTAIFAFEGIGLIIP-----IQGSMKHP--EKFPLVLALVI 528

Query: 291 FVAMIFCFLMGYTGFLVFKDRTKGNILNNFPGSDNVVNVARFCFGFNMLTTFPLEIFVLR 350
             A +    +G  G+L +  +T+  IL N P  + +VN+ +F +   +L + PL++F   
Sbjct: 529 ISATVLFVTVGTLGYLSYGAKTETVILLNLPQGNILVNLIQFFYSSAILLSTPLQLFPAI 588

Query: 351 DVIRDFMFFNSKDTNQSQELSLKLHXXXXXXXXXXXXXXXXXXC---------------- 394
            +I + +F         +    K+H                                   
Sbjct: 589 AIIENKVFPKFTKIYVKRSDHTKVHYKPNSGKLDWRVKWLKNFVRSLIVSLVVIAAYFGA 648

Query: 395 -NLGALFELTGATTASLMAYILPPSVNLLLIGK-----RSTVREKLP---HYACIIFGFT 445
            +L     + G+     + YI PP ++L    +      +++ +K P    Y  IIFG  
Sbjct: 649 DHLDTFVSIVGSFACIPLVYIYPPMLHLESCSRPACQNETSIWKKWPMAVDYVLIIFGAI 708

Query: 446 IMVVSSSQTI 455
            MV +S Q+I
Sbjct: 709 GMVYTSYQSI 718

>KNAG0H02330 Chr8 (425024..426955) [1932 bp, 643 aa] {ON} Anc_5.252
           YKL146W
          Length = 643

 Score = 50.8 bits (120), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 93/430 (21%), Positives = 159/430 (36%), Gaps = 28/430 (6%)

Query: 47  SEDESTTAFLREN---RSKSNIFMAFMNMANSILGAGVIGQPFAIKNCGLVGGIFAVILL 103
           SE+E T      +   R K+    A + +  S +G GV+  P A  N G       ++  
Sbjct: 227 SENEGTPLVATRSTSERHKTTTVKAVLLLLKSFVGTGVLFLPKAFSNGGWGFSSLCLLFC 286

Query: 104 SVLVDWTIRLIVVNMKITGKTTYQDSVEFAMGRKGKLLILLSNGLFAXXXXXXXXXXXXD 163
           ++L  +   L+++     G   Y +      G K KL ILLS  L               
Sbjct: 287 AILSYYCFVLLIITKDKVGVKGYGEIGMKLYGGKMKLAILLSVALSQIGFAAAYTVFTAT 346

Query: 164 TIPHVLRAFFPGHENLFHRNIIIILVTCFISFPLSLNRNISKLSKASMLAXXXXXXXXXX 223
            +   +   F   E++      I L    I  PLSL RNI+KLS  +++A          
Sbjct: 347 NLKLFMDNVFNLSEDVLGLGWFIWLQAA-IFIPLSLTRNIAKLSGTALVADLFILLGLIY 405

Query: 224 XXXKGPMIDDAYKGSFNTTELFFTPR---IFQGISVISFALVCHHNTSFIYFSLKTPSLK 280
                     +  G   +T ++F      +F G ++ +F  +       I  S+K P + 
Sbjct: 406 VYYYATYYVIS-NGVATSTMVWFNKSDWTLFIGTAIFTFEGIGLLIP--IQESMKHPEVF 462

Query: 281 RFDRLTHFSCFVAMIF--CFLMGYTGFLVFKDRTKGNILNNFPGSDNVVNVARFCFGFNM 338
           R   L+     V +IF  C L+ Y+ F    D     +L NFP       + +  +   +
Sbjct: 463 R-KSLSGVMVIVTVIFISCGLLCYSAFGSHVDTV---VLVNFPQDSYTTAIVQLLYALAI 518

Query: 339 LTTFPLEIFVLRDVIRDFMFFNSKDTNQSQELSLKLHXXXXXXXXXXXXXXXXXXCNLGA 398
           L + PL++F    ++  + F ++     +  +    +                   +L  
Sbjct: 519 LLSTPLQLFPAIRILEQWTFNSNASGKHNPRVKWLKNYFRCGVVIFTTVLAWVGASDLDK 578

Query: 399 LFELTGATTASLMAYILPPSVNLLLIGKRSTVREKLPHYA-------CIIFGFTIMVVSS 451
              L G+     + YI PP     L+  R++  +               IFGF++MV +S
Sbjct: 579 FVSLVGSLACIPLIYIHPP-----LLHHRASRSDGTSSRGILILDLLICIFGFSVMVYTS 633

Query: 452 SQTIIAYIRG 461
            Q I  +I G
Sbjct: 634 WQAITLWIFG 643

>SAKL0G11462g Chr7 (980180..982030) [1851 bp, 616 aa] {ON} similar
           to uniprot|P36062 Saccharomyces cerevisiae YKL146W AVT3
           Vacuolar transporter exports large neutral amino acids
           from the vacuole member of a family of seven S.
           cerevisiae genes (AVT1-7) related to vesicular GABA-
           glycine transporters
          Length = 616

 Score = 50.1 bits (118), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 89/410 (21%), Positives = 153/410 (37%), Gaps = 27/410 (6%)

Query: 60  RSKSNIFMAFMNMANSILGAGVIGQPFAIKNCGLVGGIFAVILLSVLVDWTIRLIVVNMK 119
           + K+ +F   + +  S +G GV+  P    N G      A++  SV+  W   L++    
Sbjct: 221 QHKATVFKTIILLIKSFVGTGVLFLPKGFHNGGWGFSSVALLFCSVVSYWCFMLLINTKN 280

Query: 120 ITGKTTYQDSVEFAMGRKGKLLIL----LSNGLFAXXXXXXXXXXXXDTIPHVLRAFFPG 175
                 Y D      GRK K  IL    LS   FA                  L+AFF  
Sbjct: 281 KIRVNGYGDLGGQLYGRKMKFAILSSIVLSQIGFAAAYTVFTATN--------LQAFF-- 330

Query: 176 HENLFHRNI---IIILVTCFISFPLSLNRNISKLSKASMLAXXXXXXXXXXXXXKGPMID 232
             N+FH +    I IL+   +  PLSL R+I+KLS   ++A                   
Sbjct: 331 -ANIFHWDYPLAIYILLQMVVYIPLSLTRSIAKLSGTVLIADFFILVGLLYLYYYCAYYV 389

Query: 233 DAYKGSFNTTELFFTPR--IFQGISVISFALVCHHNTSFIYFSLKTPSLKRFDRLTHFSC 290
             +  + ++  LF +    +F G ++ ++  +       I  S+K P  ++F R   F  
Sbjct: 390 SVHGIASDSMVLFNSSNWTLFIGTAIFTYEGIGLLIP--IQESMKQP--EKFPRCL-FGV 444

Query: 291 FVAMIFCFL-MGYTGFLVFKDRTKGNILNNFPGSDNVVNVARFCFGFNMLTTFPLEIFVL 349
            + +   F+  G   +  F    K  IL NFP         +F +   +L + PL++F  
Sbjct: 445 MLGITVIFISCGCLCYSAFGADVKTVILLNFPQDSIFTGGVQFSYALAILLSTPLQLFPA 504

Query: 350 RDVIRDFMFFNSKDTNQSQELSLKLHXXXXXXXXXXXXXXXXXXCNLGALFELTGATTAS 409
             ++ + +F +      + ++    +                   +L     L G+    
Sbjct: 505 IRILENAVFPSHASGKHNPKVKWLKNYFRCFVVIASVAIAWVGANDLDKFVSLVGSLACI 564

Query: 410 LMAYILPPSVNLLLIGKRSTVREKLP-HYACIIFGFTIMVVSSSQTIIAY 458
            + YI PP ++       +  R  L      + FG  IMV  S QT++ +
Sbjct: 565 PLIYIYPPMLHYKAFRGTNISRHDLVLDQVVLWFGIAIMVYISLQTVLMW 614

>NDAI0C03790 Chr3 complement(863178..865343) [2166 bp, 721 aa] {ON}
           Anc_5.252
          Length = 721

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 90/415 (21%), Positives = 158/415 (38%), Gaps = 28/415 (6%)

Query: 62  KSNIFMAFMNMANSILGAGVIGQPFAIKNCGLVGGIFAVILLSVLVDWTIRLIVVNMKIT 121
           KS+ F A + +  S +G GV+  P A  N G       ++L +++  W    ++V     
Sbjct: 319 KSSTFKAILLLLKSFVGTGVLFLPKAFHNGGWAFSSLCLLLCAIISYWCFLTLIVTKDKI 378

Query: 122 GKTTYQDSVEFAMGRKGKLLILLSNGL----FAXXXXXXXXXXXXDTIPHVL---RAFFP 174
               Y D  E   G   KL IL S  L    F+              + +VL       P
Sbjct: 379 HVDGYGDMGERLYGHPMKLAILWSIVLSQIGFSAAYTVFTATNLKVFVENVLVRTATMNP 438

Query: 175 GHENLFHRNIIIILVTCFISFPLSLNRNISKLSKASMLAXXXXXXXXXXXXXKGPMIDDA 234
              NL    +  I++   I  PLSL R I+KLS  +++A                     
Sbjct: 439 TGYNL----VWYIILQQLIFIPLSLTRKIAKLSGTALIADLFILLGLIYVYYYS-SYYIL 493

Query: 235 YKGSFNTTELFFTP---RIFQGISVISFALVCHHNTSFIYFSLKTPSLKRFDR-LTHFSC 290
             G  + + L+       +F G ++ +F  +       I  S++ P +  F + L+   C
Sbjct: 494 SNGIASESMLWLNKADWSLFIGTAIFTFEGIGLLIP--IQESMQNPQV--FPKCLSLVMC 549

Query: 291 FVAMIF--CFLMGYTGFLVFKDRTKGNILNNFPGSDNVVNVARFCFGFNMLTTFPLEIFV 348
            V +IF  C L+ Y+    F ++ +  +L NFP       + +  +   +L + PL++F 
Sbjct: 550 IVTIIFISCGLICYSA---FGEKVETVVLLNFPQDSAFTLMVQLLYSLAILLSTPLQLFP 606

Query: 349 LRDVIRDFMFFNSKDTNQSQELSLKLHXXXXXXXXXXXXXXXXXXCNLGALFELTGATTA 408
              ++ ++ F        +  +  K +                   +L     L G+   
Sbjct: 607 AIKILENWTFPIHASGKHNSRIKWKKNYFRCIMVIFTAMVAWVGANDLDKFVSLVGSFAC 666

Query: 409 SLMAYILPPSVNL--LLIGKRSTVREKLP-HYACIIFGFTIMVVSSSQTIIAYIR 460
             + YI PP ++    L     T+R +L       +FG  IMV +S +TI  ++ 
Sbjct: 667 IPLIYIYPPLLHFKAFLNDTSKTMRFRLGLDMLVFVFGIIIMVYTSWETISMWVH 721

>Kpol_1003.44 s1003 complement(104836..106248) [1413 bp, 470 aa]
           {ON} complement(104836..106248) [1413 nt, 471 aa]
          Length = 470

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 41/180 (22%), Positives = 76/180 (42%), Gaps = 6/180 (3%)

Query: 196 PLSLNRNISKLSKASML---AXXXXXXXXXXXXXKGPMIDDAY---KGSFNTTELFFTPR 249
           PL L +N++ L  +S+L   A                 + D Y   +G  N   ++    
Sbjct: 133 PLCLLKNLNSLRYSSILGLFALAYLTILVIVIYINNVFLTDNYLETRGDVNWFSVYDWTG 192

Query: 250 IFQGISVISFALVCHHNTSFIYFSLKTPSLKRFDRLTHFSCFVAMIFCFLMGYTGFLVFK 309
           +    S+I FA     N   I   L+  S++   ++ + S  ++     L+G +G+L F 
Sbjct: 193 LCSTFSIIIFAFTGAMNLFSIINELENNSIRNITKVINRSIGISTFLFLLVGISGYLTFG 252

Query: 310 DRTKGNILNNFPGSDNVVNVARFCFGFNMLTTFPLEIFVLRDVIRDFMFFNSKDTNQSQE 369
             T GNI+ N+        + +FC G  ++ +FPL    LR  + + + F   +   ++E
Sbjct: 253 SNTLGNIMLNYDPDSKWCYIGKFCLGSMIVLSFPLLFHPLRIAVNNMVIFYQINYGSNKE 312

>SAKL0E07392g Chr5 (602503..603921) [1419 bp, 472 aa] {ON} similar
           to uniprot|P40501 Saccharomyces cerevisiae YIL088C AVT7
           Putative transporter member of a family of seven S.
           cerevisiae genes (AVT1-7) related to vesicular
           GABA-glycine transporters
          Length = 472

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 42/164 (25%), Positives = 68/164 (41%), Gaps = 6/164 (3%)

Query: 187 ILVTCFISFPLSLNRNISKLSKASML---AXXXXXXXXXXXXXKGPMIDDAYK---GSFN 240
           IL +  +  PL L R++  L  +S+L   A              G ++ D YK   G   
Sbjct: 122 ILGSALLIIPLCLLRHLDSLKYSSILGLFALAYLVTLVIGTFVYGVVLHDDYKYTRGDVF 181

Query: 241 TTELFFTPRIFQGISVISFALVCHHNTSFIYFSLKTPSLKRFDRLTHFSCFVAMIFCFLM 300
             +++    +    S+I FA  C  N   I   L   S+    ++ + S  +A      +
Sbjct: 182 WVKVYDYNGLISTFSIIIFAYTCTMNIFSIINELTDNSVSNVTKVANSSIGIATFLILSV 241

Query: 301 GYTGFLVFKDRTKGNILNNFPGSDNVVNVARFCFGFNMLTTFPL 344
           G TG+L F     GNI+ N+        V +FC G  ++ +FPL
Sbjct: 242 GITGYLTFGSNVLGNIILNYDPDSIWTRVGKFCLGCMVVLSFPL 285

>NDAI0B03510 Chr2 (882507..883997) [1491 bp, 496 aa] {ON} Anc_2.295
          Length = 496

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 43/203 (21%), Positives = 84/203 (41%), Gaps = 14/203 (6%)

Query: 165 IPHVLRAFFPGHENLFHRNIIIILVTCFISFPLSLNRNISKLSKASM--------LAXXX 216
           I  +    F GH + +      I+ + FI  PLS  + +  L  +S+        L+   
Sbjct: 105 IGDIFPGLFGGHRDYW------IISSAFIIVPLSCLKKLDSLKYSSIVGLFALAYLSMFI 158

Query: 217 XXXXXXXXXXKGPMIDDAYKGSFNTTELFFTPRIFQGISVISFALVCHHNTSFIYFSLKT 276
                     K P   D+ +G      ++    +    S+I FA     N   +   L+ 
Sbjct: 159 FVMFLHNTVFKLPNEGDSTRGEVYWFHVYDFRGLLSTFSIIIFAYTGAMNLFSMIRELED 218

Query: 277 PSLKRFDRLTHFSCFVAMIFCFLMGYTGFLVFKDRTKGNILNNFPGSDNVVNVARFCFGF 336
            S++    + + S  ++     L+G +G+L F    +GNI+ N+  + N + + +FC G 
Sbjct: 219 ISMQNIKNVINGSIIISTGLFLLVGISGYLTFGSNVEGNIILNYNPNSNWIYIGKFCLGT 278

Query: 337 NMLTTFPLEIFVLRDVIRDFMFF 359
            ++ +FPL    LR  + + + +
Sbjct: 279 MLILSFPLLFHPLRIAVNNLVVW 301

>Suva_9.112 Chr9 complement(191885..193360) [1476 bp, 491 aa] {ON}
           YIL088C (REAL)
          Length = 491

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 30/122 (24%), Positives = 61/122 (50%), Gaps = 5/122 (4%)

Query: 255 SVISFALVCHHNTSFIYFSLKTPSLKRFDRLTHFSCFVAMIFCFLMGYTGFLVFKDRTKG 314
           S+I FA     N   +   LK  S++    + + S  ++ I   ++G +G+L F ++T G
Sbjct: 195 SIIIFAYTGSMNLFPMINELKDNSMENITLVINNSITLSTILFLIVGLSGYLTFGNKTSG 254

Query: 315 NILNNFPGSDNVVNVARFCFGFNMLTTFPLEIFVLRDVIRDFMF-----FNSKDTNQSQE 369
           N++ N+  +   + + +FC G  ++ +FPL    LR  + + +      F + D N+  +
Sbjct: 255 NLMLNYDPNSIWIVIGKFCLGSMLILSFPLLFQPLRVAVNNVIIWLEITFGNADPNEDTQ 314

Query: 370 LS 371
           +S
Sbjct: 315 VS 316

>Ecym_5408 Chr5 complement(838376..840523) [2148 bp, 715 aa] {ON}
           similar to Ashbya gossypii AER380C
          Length = 715

 Score = 47.8 bits (112), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 80/311 (25%), Positives = 134/311 (43%), Gaps = 26/311 (8%)

Query: 60  RSKSNIFMAFMNMANSILGAGVIGQPFAIKNCGLVGGIFAVILLSVLVDWTIRLIVVNMK 119
           R K++ F AF+ +  S +G GV+  P A  N GL   I  + + S    W   ++V    
Sbjct: 295 RVKTSTFKAFLLLIKSFVGTGVLFLPNAFSNGGLAFSIIMLFIFSGYSYWCYYILVRTKV 354

Query: 120 ITGKTTYQDSVEFAMGRKGKLLILLSNGLFAXXXXXXXXXXXXDTIPHVLRAFFPGHENL 179
            TG +++ D      G   K +IL S  +FA                  L AF    +N+
Sbjct: 355 STGVSSFGDIGAMLYGPWMKYIILFSL-VFAQLGFSSAYVVFTS---KNLIAFI---QNV 407

Query: 180 FHRNII----IILVTCFISFPLSLNRNISKLSKASMLAXXXX---XXXXXXXXXKGPMID 232
           FH   I    ++L+   I  PLS  RN+SKLS +S+LA                K  ++D
Sbjct: 408 FHYPDIPMAYMLLLQLIIFIPLSFVRNVSKLSLSSLLANFLIICGLFIVVLYSAKHLIVD 467

Query: 233 DAYKGSFNTTELFFTPR--IFQGISVISF---ALVCHHNTSFIYFSLKTPSLKRFDRLTH 287
            ++K       LF + +  +F G ++ ++    L+     S  +   K P +  +  +T 
Sbjct: 468 LSFKPEEGVIFLFNSKKWTLFVGTAIFAYEGIGLIIPVQDSMAH-PEKFPMVLGWVIITT 526

Query: 288 FSCFVAMIFCFLMGYTGFLVFKDRTKGNILNNFPGSDNVVNVARFCFGFNMLTTFPLEIF 347
            + FV      L+G  G+L +    +  IL N P     VN+ +F +   +L + PL++F
Sbjct: 527 TALFV------LVGSLGYLAYGKYIQSVILLNLPQKSLSVNLIQFFYSMAILLSTPLQLF 580

Query: 348 VLRDVIRDFMF 358
               +I + +F
Sbjct: 581 PAIAIIENKIF 591

>Ecym_8249 Chr8 (510061..511944) [1884 bp, 627 aa] {ON} similar to
           Ashbya gossypii ACR051C
          Length = 627

 Score = 47.4 bits (111), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 89/450 (19%), Positives = 164/450 (36%), Gaps = 44/450 (9%)

Query: 33  DRNS---QRNSERLIDGSEDESTTAFLRENR-SKSNIFMAFMNMANSILGAGVIGQPFAI 88
           DR S       E L+   E+ S++A     R  K+++F   + +  + +G GV+  P   
Sbjct: 200 DRESVLLSDEEEPLLGTVEERSSSATRSGGRKGKASVFKTVLLLLKAFVGTGVLFMPKGF 259

Query: 89  KNCGLVGGIFAVILLSVLVDWTIRLIVVNMKITGKTTYQDSVEFAMGRKGKLLILLSNGL 148
           +N G +     +I   V+  +   L++          Y D    A G+       +  G+
Sbjct: 260 QNGGWLFSCGCLIFFGVVSCFCFLLLIEAKTEACVNGYGDLGRVAYGKS------MQRGI 313

Query: 149 FAXXXXXXXXXXXXDTI--PHVLRAFFPGHENLFHRNIIIILVTCFISFPLSLNRNISKL 206
            A             TI     L+ FF       HR  + I +   +  PL+L R IS+L
Sbjct: 314 LASIVLSQIGFSAAYTIFTATNLQVFFGEVFGWSHRLSVYIFLQLVVYLPLALTRRISRL 373

Query: 207 SKASMLAXXXXXXXXXXXXXKGPMIDDAYKGSFNTTELF----FTPRIFQGISVISFALV 262
           S  ++ A                +    Y  +  + ++F    +T  +F G ++ ++  +
Sbjct: 374 SGTALAADVLILFGLVYVYGYSAVYVLRYGVASQSMKMFNRQDWT--LFVGTAIFTYEGI 431

Query: 263 CHHNTSFIYFSLKTPSLKRFDRLTHF-SCFVAMIF--------CFLMGYTGFLVFKDRTK 313
                      L  P  +   R   F SC V +I         C L+ Y+    F  R +
Sbjct: 432 ----------GLLVPIQESMSRPGRFASCLVWVIAAVTSIFISCGLLCYSA---FGSRVE 478

Query: 314 GNILNNFPGSDNVVNVARFCFGFNMLTTFPLEIFVLRDVIRDFMFFNSKDTNQSQELSLK 373
             IL NFP    + +  +F +   ++ + PL++F    ++   +  +S        +   
Sbjct: 479 TVILLNFPKDSVLSSSVQFLYAMAIMLSTPLQLFPAIRILEHGIISSSVSGKHDPRVKWA 538

Query: 374 LHXXXXXXXXXXXXXXXXXXCNLGALFELTGATTASLMAYILPPSVNLLLI---GKRSTV 430
            +                   +L     L G+     + YI PP ++ +L    G+ S  
Sbjct: 539 KNWFRVLVVFVTVSIAWVGADDLDKFVSLIGSFACVPLIYIYPPLLHYMLFKGTGRVSNA 598

Query: 431 REKLPHYACIIFGFTIMVVSSSQTIIAYIR 460
              L     + FG   M  +SSQT+  +++
Sbjct: 599 ALFLDQLV-VWFGVIGMFYTSSQTVKQWLQ 627

>Kwal_23.2839 s23 (38499..40343) [1845 bp, 614 aa] {ON} YKL146W -
           Hypothetical ORF [contig 246] FULL
          Length = 614

 Score = 47.0 bits (110), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 94/431 (21%), Positives = 151/431 (35%), Gaps = 37/431 (8%)

Query: 43  LIDGSEDESTTAFLRENRSKSNIFMAFMNMANSILGAGVIGQPFAIKNCGLVGGIFAVIL 102
           LIDGS      A       KS+ F A + +  S +G GV+  P A  N G        +L
Sbjct: 204 LIDGSRQRKRAA--HRQAHKSSTFKAVLLLLKSFVGTGVLFLPRAFHNGGWAFST-GCLL 260

Query: 103 LSVLVDWTIRLIVVNMKITGKTT-YQDSVEFAMGRKGKLLILLSNGLFAXXXXXXXXXXX 161
              +V +   L+++N K   K   Y D      G K +  IL S  L             
Sbjct: 261 ACGVVSYYCFLLLINAKTKQKVNGYGDLGASVFGSKMEKAILGSIVLSQVGFVAAYSVFT 320

Query: 162 XDTIPHVLRAFFPGHENLFHRNIIIILVTCFISFPLSLNRNISKLSKASMLAXX------ 215
                  L+ FF             +L+   +  PLSL RNI+KLS  +++A        
Sbjct: 321 ATN----LQVFFANVFKFKASMAFWLLIQLPVYLPLSLTRNIAKLSGTALIADAFILFGL 376

Query: 216 --XXXXXXXXXXXKGPMIDDAYKGSFNTTELFFTPRIF--QGISVISFALVCHHNTSFIY 271
                         G   D     + N   LF    IF  +GI ++            I 
Sbjct: 377 LYVYYYCSHYVVDHGVASDSMLLFNKNDWTLFIGTAIFTYEGIGLL----------IPIQ 426

Query: 272 FSLKTPSLKRFDRL---THFSCFVAMIFCFLMGYTGFLVFKDRTKGNILNNFPGSDNVVN 328
            S+K P  ++F +       S  VA I C L+ Y+    F D  K  IL NFP    +  
Sbjct: 427 ESMKHP--EKFSKCLFGVMASVSVAFIVCGLLCYSA---FGDSVKIVILLNFPRDSAMTA 481

Query: 329 VARFCFGFNMLTTFPLEIFVLRDVIRDFMFFNSKDTNQSQELSLKLHXXXXXXXXXXXXX 388
             +  +   +L + PL++F +  ++   +F        +  +    +             
Sbjct: 482 TVQLLYALAILLSTPLQLFPIIRILETSIFPKDASGKYNPRVKWMKNYFRVAIVLLNMLI 541

Query: 389 XXXXXCNLGALFELTGATTASLMAYILPPSVNLLLIGKRSTVREKLPHYACI-IFGFTIM 447
                 +L     L G+     + YI PP ++     +    +  L     I  FG  +M
Sbjct: 542 AWLGANDLDKFVSLVGSFACIPLIYIYPPMLHYKTFAQGGASKLALLGDQLIAFFGVAVM 601

Query: 448 VVSSSQTIIAY 458
           + ++ Q +  +
Sbjct: 602 IYTTYQAVYLW 612

>SAKL0E10362g Chr5 complement(860653..862854) [2202 bp, 733 aa] {ON}
           similar to uniprot|P50944 Saccharomyces cerevisiae
           YNL101W AVT4 Vacuolar transporter exports large neutral
           amino acids from the vacuole member of a family of seven
           S. cerevisiae genes (AVT1-7) related to vesicular GABA-
           glycine transporters
          Length = 733

 Score = 47.0 bits (110), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 76/318 (23%), Positives = 130/318 (40%), Gaps = 34/318 (10%)

Query: 57  RENRSKSNIFMAFMNMANSILGAGVIGQPFAIKNCGLVGGIFAVILLSV--LVDWTIRLI 114
           R  +  ++ F AF+ M  S +G GV+  P A  N GL    F+V +LS   +  +    I
Sbjct: 310 RSAKGTTSTFKAFLLMIKSFIGTGVLFLPNAFANGGLT---FSVCMLSFFGIYSYWCYYI 366

Query: 115 VVNMKITGKTTYQDSVEFAM-GRKGKLLILLSNGLFAXXXXXXXXXXXXDTIPHVLRAFF 173
           ++  K+  K +    + F + G   K +IL S  L                +   L   F
Sbjct: 367 LIQSKVATKVSSFGDIGFRLYGTWMKFVILFSLVLTQLGFSGAYVVFTAKNLIAFLDNVF 426

Query: 174 PGHENLFHRNIIIILVTCFISFPLSLNRNISKLSKASMLAXXXXXXXXXXXXXKGPMIDD 233
             H+      ++ + +  FI  PLS  RN+SKLS  S++A              G +I  
Sbjct: 427 RWHDVPIEY-LLFLQLAIFI--PLSFIRNVSKLSLTSLIANFLVMA--------GLIIVV 475

Query: 234 AYKGSFNTTELFFTPR--IFQGISVISFALVCHHNTSFIYF-----------SLKTPSLK 280
            +       +L FTP   +  G +  S++L     T+   F           S+K P  +
Sbjct: 476 FFVLKHLILDLHFTPAEGVIMGFNSSSWSLFI--GTAIFAFEGIGLIIPVQDSMKHP--E 531

Query: 281 RFDRLTHFSCFVAMIFCFLMGYTGFLVFKDRTKGNILNNFPGSDNVVNVARFCFGFNMLT 340
           +F  +       A +    +   G+L +   T+  IL N P  +  VN+ +F +   +L 
Sbjct: 532 KFPLVLGLVIGAATVLFVTIATLGYLSYGQNTETVILLNLPQGNLCVNLIQFFYSLAILL 591

Query: 341 TFPLEIFVLRDVIRDFMF 358
           + PL++F    +I + +F
Sbjct: 592 STPLQLFPAIAIIENKVF 609

>Suva_14.238 Chr14 (431876..434026) [2151 bp, 716 aa] {ON} YNL101W
           (REAL)
          Length = 716

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 79/360 (21%), Positives = 131/360 (36%), Gaps = 50/360 (13%)

Query: 27  FQLSSFDRNSQRNSERLIDGSEDESTTAFLRENRSK--------SNIFMAFMNMANSILG 78
           F   SF+ +   +S  L+   EDE +    R +  K        ++    F+ +  S +G
Sbjct: 256 FAGESFEDDFISDSSNLLLQGEDERSALLSRPDHMKVLPSAKGTTSTRKVFLILLKSFIG 315

Query: 79  AGVIGQPFAIKNCGLVGGIFAVILLSVLVDWTIRLIVVNMKITGKTTYQDSVEFAMGRKG 138
            GV+  P A  N GL   +  +    +   W   ++V      G +++ D      G   
Sbjct: 316 TGVLFLPNAFHNGGLFFSVSMLTFFGIYSYWCYYILVQAKSSCGVSSFGDIGLKLYGPWM 375

Query: 139 KLLILLSNGLFAXXXXXXXXXXXXDTIPHVLRAFFPGHENLFHRNII----IILVTCFIS 194
           K++IL S  +                    L+AF    EN+FH   +    ++     I 
Sbjct: 376 KIIILFSLVITQVGFSGAYMIFTAKN----LQAFL---ENVFHVGALPLSYLMAFQTVIF 428

Query: 195 FPLSLNRNISKLSKASMLAXXXXXXXXXXXXXKGPMIDDAYKGSFNTTELFFTPRIFQGI 254
            PLS  RNISKLS  S+LA                         F    LFF  +    +
Sbjct: 429 IPLSFIRNISKLSLPSLLANFFIMAGLIIVII------------FTAKRLFFDLKAVPAM 476

Query: 255 SVISFALVCHHNTSFI----------------YFSLKTPSLKRFDRLTHFSCFVAMIFCF 298
            V+ + L     T FI                  S+K P  ++F  +       A +   
Sbjct: 477 GVV-YGLNSDRWTLFIGTAIFAFEGIGLIIPVQDSMKHP--EKFPLVLGLVILTATVLFI 533

Query: 299 LMGYTGFLVFKDRTKGNILNNFPGSDNVVNVARFCFGFNMLTTFPLEIFVLRDVIRDFMF 358
            +   G+L +    K  IL N P S+  VN+ +  +   ++ + PL++F    +I +  F
Sbjct: 534 SIATLGYLAYGSDVKTAILLNLPQSNIFVNLIQLFYSIAIMLSTPLQLFPAIKIIENKFF 593

>TDEL0F01320 Chr6 (235988..238135) [2148 bp, 715 aa] {ON} Anc_2.177
           YNL101W
          Length = 715

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 91/437 (20%), Positives = 166/437 (37%), Gaps = 49/437 (11%)

Query: 56  LRENRSKSNIFMAFMNMANSILGAGVIGQPFAIKNCGLVGGIFAVILLSVLVDWTIRLIV 115
           L+  +  +    AF  +  S +G GV+  P A  N GL   I  +        W   +++
Sbjct: 292 LQSVKGNTPTMTAFFLLLKSFIGTGVLFLPNAFSNGGLSFSIVMLSFFGAYSYWCYFILI 351

Query: 116 VNMKITGKTTYQDSVEFAMGRKGKLLILLSNGLFAXXXXXXXXXXXXDTIPHVLRAFFPG 175
              KITG T++ D      G   K +IL S  L              +     L+AF   
Sbjct: 352 RAKKITGVTSFGDIGLRLFGPWMKFVILFSLVLTQIGFSGAYVIFTAEN----LKAF--- 404

Query: 176 HENLFHRNIIII----LVTCFISFPLSLNRNISKLSKASMLA---XXXXXXXXXXXXXKG 228
            +N+F  + + I    ++   +  PLS  RN+SKLS  S+LA                K 
Sbjct: 405 TKNVFLVSDVPISYFMIIQLIVFIPLSFIRNVSKLSLPSLLANFFVMAGLAIVLFFSTKH 464

Query: 229 PMIDDAYKGSFNTTELFFTPR--IFQGISVISF---ALVCHHNTSFIYFSLKTPSLKRFD 283
            +ID   + +      F   R  +F G ++ +F    L+       +  S++ P  ++F 
Sbjct: 465 LVIDLGMRAADGVIVGFNQSRWSMFVGTAIFAFEGIGLIIP-----VQDSMRHP--EKFP 517

Query: 284 RLTHFSCFVAMIFCFLMGYTGFLVFKDRTKGNILNNFPGSDNVVNVARFCFGFNMLTTFP 343
            +       + +    +   G+L +    +  IL N P  +  VN+ +F +   ++ + P
Sbjct: 518 MVLALVIGSSTVLFITIASIGYLAYGSAIETVILLNLPQKNVFVNLIQFFYSLAIMLSTP 577

Query: 344 LEIFVLRDVIRDFMF------FNSKDTN--------QSQELSLKL----HXXXXXXXXXX 385
           L++F    +I + +F      +  KD +         S +L+ K+    +          
Sbjct: 578 LQLFPAIKIIENKVFPKFTKIYVKKDDDTTDIQLRPNSGKLNWKVKWLKNSVRAIIVALV 637

Query: 386 XXXXXXXXCNLGALFELTGATTASLMAYILPPSVNLLLIGKRSTVREKLPHYAC-----I 440
                     L     + G+     + Y+ PP ++L    +  +  +K P  +      I
Sbjct: 638 ILMAYYGADKLDKFVSIIGSFACIPLVYMYPPMLHLQSYSRPRSAGQKFPWRSIVDCVLI 697

Query: 441 IFGFTIMVVSSSQTIIA 457
           +FG   M  +S Q+I A
Sbjct: 698 VFGGVSMCYTSYQSIFA 714

>KNAG0A05380 Chr1 (791957..793381) [1425 bp, 474 aa] {ON} Anc_2.295
           YIL088C
          Length = 474

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 45/191 (23%), Positives = 81/191 (42%), Gaps = 6/191 (3%)

Query: 187 ILVTCFISFPLSLNRNISKLSKASML---AXXXXXXXXXXXXXKGPMIDDAYK---GSFN 240
           I+ +  I  PL   + +  L  +S+L   A             K  ++ D YK   G+  
Sbjct: 123 IVASAVIIGPLCSLKKLDHLKYSSVLGLFALAYLAVLVLSMFVKDVILTDNYKVVRGTIL 182

Query: 241 TTELFFTPRIFQGISVISFALVCHHNTSFIYFSLKTPSLKRFDRLTHFSCFVAMIFCFLM 300
             E++    +    S+I FA V   N   I   L   ++    ++ + S  ++ +    +
Sbjct: 183 WFEIYSGKGLLSTFSIIIFAYVGAMNLFTIINELSDNNITNISKIINRSIAISTVAFLSV 242

Query: 301 GYTGFLVFKDRTKGNILNNFPGSDNVVNVARFCFGFNMLTTFPLEIFVLRDVIRDFMFFN 360
           G TG+L F   T GNI+ N+  +   VN+ +F     +L +FPL    LR    + + + 
Sbjct: 243 GITGYLTFGSNTLGNIILNYDPNSIWVNIGKFSLASMLLLSFPLLFHPLRIACNNLVVWF 302

Query: 361 SKDTNQSQELS 371
             + N++Q  S
Sbjct: 303 EINFNEAQPSS 313

>KLLA0E06931g Chr5 (628083..629453) [1371 bp, 456 aa] {ON} similar
           to uniprot|P40074 Saccharomyces cerevisiae YER119C AVT6
           Vacuolar transporter exports aspartate and glutamate
           from the vacuole and to YBL089W uniprot|P38176
           Saccharomyces cerevisiae YBL089W AVT5 Putative
           transporter, members of a family of seven S. cerevisiae
           genes (AVT1-7) related to vesicular GABA-glycine
           transporters
          Length = 456

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 63/319 (19%), Positives = 113/319 (35%), Gaps = 25/319 (7%)

Query: 62  KSNIFMAFMNMANSILGAGVIGQPFAIKNCGLVGGIFAVILLSVLVDWTIRL--IVVNMK 119
            S++    + + ++  GAG++  P+A K  GL+ G+  +I   +     + L   V    
Sbjct: 2   SSSVQSGVITLLHTACGAGILAMPYAFKPFGLILGLSMIIFCGLCSSTGLYLQSYVSKYV 61

Query: 120 ITGKTTYQDSVEFAMGR--KGKLLILLSNGLFAXX--XXXXXXXXXXDTIPHVLRAFFPG 175
             G  ++     F + R  + +L ++    +                D +P ++  F   
Sbjct: 62  PPGHASF-----FTLCRLTRPELSVVFDAAIAVKCFGVGVSYLVVVGDLLPQIMSTF-TT 115

Query: 176 HENLFHRNIIIILVTCFISFPLSLNRNISKLSKASMLAXXXXXXXXXXXXXKGPMID--- 232
           H  L  R   I  VT  I  PL   + +  L   S +A                + +   
Sbjct: 116 HGWLLSRQFHITAVTLIIVTPLCFIKKLDSLRYTSSIAITAVGYLCVLVVFHFAVPNSEI 175

Query: 233 DAYKGSFNTTELFFTPR-----IFQGISVISFALVCHHNTSFIYFSLKTPSLKRFDRLTH 287
           D  +G  +     + P      +     +  FA  CHHN   I       SL    +L  
Sbjct: 176 DHLRGHVS----IWKPSDVDSSMLSSFPIFVFAYTCHHNMFSIINEQSDKSLDSITKLIR 231

Query: 288 FSCFVAMIFCFLMGYTGFLVFKDRTKGNILNNFPGSDNVVNVARFCFGFNMLTTFPLEIF 347
            +  +AM     +G  G+  F D   GNI+  +P S +   + R      ++  FPL+  
Sbjct: 232 IAITLAMSLYISIGALGYCTFGDHITGNIITLYPNSIS-STIGRIAIALLVILAFPLQCH 290

Query: 348 VLRDVIRDFMFFNSKDTNQ 366
             R  +   + + SK    
Sbjct: 291 PARASVNHILHYFSKGNTH 309

>CAGL0E06468g Chr5 (647086..649131) [2046 bp, 681 aa] {ON} similar
           to uniprot|P36062 Saccharomyces cerevisiae YKL146w or
           uniprot|P50944 Saccharomyces cerevisiae YNL101w
          Length = 681

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 81/411 (19%), Positives = 145/411 (35%), Gaps = 32/411 (7%)

Query: 62  KSNIFMAFMNMANSILGAGVIGQPFAIKNCGLVGGIFAVILLSVLVD-WTIRLIVVNMKI 120
           KS+   A + +  S +G GV+  P A  N G  G   +V+L+  L+  W   L++     
Sbjct: 289 KSSTTKAVLLLLKSFVGTGVLFLPRAFHNGGW-GFSSSVLLICALISYWCFVLLIDTKNH 347

Query: 121 TGKTTYQDSVEFAMGRKGKLLILLSNGLFAXXXXXXXXXXXXDTIPHVLRAFFPGHENLF 180
            G   Y D      G   KL IL S  L                    L+ F     N+F
Sbjct: 348 VGLDGYGDMGNHLYGSSMKLAILWSIALSQIGFSSAYTVFTATN----LQVF---TNNVF 400

Query: 181 HRN---IIIILVTCFISFPLSLNRNISKLSKASMLAXXXXXXXXXXXXXKGPMIDDAYKG 237
            +     I I++      PL+L RNI+KLS  +++A                +   +  G
Sbjct: 401 KQEYGITIFIIIQVLFFLPLALTRNIAKLSGTALIADLFILLGLVYVYWFS-ISHVSTHG 459

Query: 238 SFNTTELFFTP---RIFQGISVISFALVCHHNTSFIYFSLKTPSLKRFDRLTHFSCFVAM 294
             + T L F      +F G ++ +F  +           L  P  +   +  HF   ++ 
Sbjct: 460 VASETMLMFNKADWSLFIGTAIFTFEGI----------GLLIPIQESMKKPEHFHASLSG 509

Query: 295 IFCFLM------GYTGFLVFKDRTKGNILNNFPGSDNVVNVARFCFGFNMLTTFPLEIFV 348
           + C +       G   +  F    +  +L NFP         +  +   +L + PL++F 
Sbjct: 510 VMCVVTVVFISCGLICYCAFGADVETVVLLNFPQESIYTRAVQLLYALAILLSTPLQLFP 569

Query: 349 LRDVIRDFMFFNSKDTNQSQELSLKLHXXXXXXXXXXXXXXXXXXCNLGALFELTGATTA 408
              ++ ++ F        + ++    +                   +L     L G+   
Sbjct: 570 AIKILENWTFSPHSSGKHNPKVKWLKNYFRAAIVCFSALIAWAGANDLDKFVSLVGSFAC 629

Query: 409 SLMAYILPPSVNLLLIGKRSTVREKLPHYACIIFGFTIMVVSSSQTIIAYI 459
             + YI PP ++     K  +          + FG  +M+ +S QTI  ++
Sbjct: 630 IPLIYIYPPMLHFKAFKKDKSKLFMASDIFLLFFGIIVMIYTSLQTIGMWL 680

>AGL285C Chr7 complement(175831..177153) [1323 bp, 440 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER119C
           (AVT6) and YBL089W (AVT5)
          Length = 440

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 44/186 (23%), Positives = 67/186 (36%), Gaps = 6/186 (3%)

Query: 179 LFHRNIIIILVTCFISFPLSLNRNISKLSKASMLAXXXXXXXXXXXXXKGPMIDDAYKGS 238
           L  RN+ I   T  +  PL   R++  L  ASM+A             +        +  
Sbjct: 119 LLDRNVQITFWTAAVIAPLCCMRHLHSLKYASMVAVAAVAYLGALVAARAAWPSPELERL 178

Query: 239 FNTTELFFTPRIFQGISVISF-----ALVCHHNTSFIYFSLKTPSLKRFDRLTHFSCFVA 293
                L   P    G  + SF     A  CHHN   I   L+  SL    R+   +  +A
Sbjct: 179 RGPVSLGLPPGTSGGAMLSSFPIFVFAYTCHHNMFSIVNELRDNSLGACLRVVVAAIALA 238

Query: 294 MIFCFLMGYTGFLVFKDRTKGNILNNFPGSDNVVNVARFCFGFNMLTTFPLEIFVLRDVI 353
           +     +G  G+L F D   GNI+  +P +     + R      ++  FPL+    R  I
Sbjct: 239 VALYATIGGAGYLTFGDHITGNIIAQYPPAP-ATTLGRAAIAVLVMLAFPLQCHPARASI 297

Query: 354 RDFMFF 359
                +
Sbjct: 298 NHIWHY 303

>Smik_14.224 Chr14 (414661..416808) [2148 bp, 715 aa] {ON} YNL101W
           (REAL)
          Length = 715

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 75/357 (21%), Positives = 135/357 (37%), Gaps = 44/357 (12%)

Query: 27  FQLSSFDRNSQRNSERLIDGSEDESTTAFLRENRSK--------SNIFMAFMNMANSILG 78
           F   SF+ +   +S  ++   EDE +    R +  K        ++    F+ +  S +G
Sbjct: 255 FAGESFEDDFIPDSSNMMIRGEDEGSPLLSRPDHMKVLPSAKGTTSTRKVFLILLKSFIG 314

Query: 79  AGVIGQPFAIKNCGLVGGIFAVILLSVLVDWTIRLIVVNMKITGKTTYQDSVEFAMGRKG 138
            GV+  P A  N GL   +  +    +   W   ++V      G +++ D      G   
Sbjct: 315 TGVLFLPNAFHNGGLFFSVSMLAFFGLYSYWCYYILVQAKASCGVSSFGDIGLKLYGPWM 374

Query: 139 KLLILLSNGLFAXXXXXXXXXXXXDTIPHVLRAFFPGHENLFHRNII----IILVTCFIS 194
           +++IL S  +                    L+AF    +N+FH  ++    +++    I 
Sbjct: 375 RIIILFSLVITQVGFSGAYMIFTAKN----LQAFL---DNVFHAGVLPLSFLMIFQTIIF 427

Query: 195 FPLSLNRNISKLSKASMLAXXXXXXXXXXX-----------XXKGPMIDDAYKGSFNTTE 243
            PLS  RNISKLS  S+LA                          P +   Y  + +   
Sbjct: 428 IPLSFIRNISKLSLPSLLANFFIMAGLVIVIIFTAKRLFFDLKASPAMGVVYGLNMDRWT 487

Query: 244 LFFTPRI--FQGISVISFALVCHHNTSFIYFSLKTPSLKRFDRLTHFSCFVAMIFCFLMG 301
           LF    I  F+GI +I            +  S++ P  ++F  +       A I    + 
Sbjct: 488 LFIGTAIFAFEGIGLI----------IPVQDSMRNP--EKFPLVLALVILTATILFISIA 535

Query: 302 YTGFLVFKDRTKGNILNNFPGSDNVVNVARFCFGFNMLTTFPLEIFVLRDVIRDFMF 358
             G+L +    +  IL N P S+  VN+ +  +   ++ + PL++F    +I +  F
Sbjct: 536 TLGYLAYGSNVQTVILLNLPQSNIFVNLIQLFYSIAIMLSTPLQLFPAIKIIENKFF 592

>KLLA0E13795g Chr5 complement(1216938..1218659) [1722 bp, 573 aa]
           {ON} similar to uniprot|P36062 Saccharomyces cerevisiae
           YKL146W AVT3 Vacuolar transporter exports large neutral
           amino acids from the vacuole member of a family of seven
           S. cerevisiae genes (AVT1-7) related to vesicular GABA-
           glycine transporters
          Length = 573

 Score = 44.3 bits (103), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 88/411 (21%), Positives = 154/411 (37%), Gaps = 44/411 (10%)

Query: 68  AFMNMANSILGAGVIGQPFAIKNCGLVGGIFAVILLSVLVDWTIRLIVVNMKITGKTTYQ 127
           A + +  S +G GV+  P A  N G +     ++  + +  +   L++      G   Y 
Sbjct: 189 AVLLLLKSFVGTGVLFLPRAFHNGGWLFSTLCLLFCATVSFYCFILLIDTKTAVGVDGYG 248

Query: 128 DSVEFAMGRKGKLLIL----LSNGLFAXXXXXXXXXXXXDTIPHVLRAFFPGHENLFHRN 183
           +      G K K  +L    LS   FA                  L+AFF    +L +  
Sbjct: 249 ELGSRLFGPKLKFTVLSSIVLSQIGFAAAYTVFTATN--------LQAFFKHVFSLEYSL 300

Query: 184 IIIILVTCFISFPLSLNRNISKLSKASMLA--------XXXXXXXXXXXXXKGPMIDDAY 235
           I  I++      PLSL RNI++LS  +++A                      G   D   
Sbjct: 301 IFWIMIQLAFYLPLSLTRNIARLSATALVADLFILLGLVYVYYYSSFYIWNHGIASDSMV 360

Query: 236 KGSFNTTE--LFFTPRIF--QGISVISFALVCHHNTSFIYFSLKTPSLKRFDRLTHFSCF 291
             SFN ++  LF    IF  +GI +    L+  H       S++ P+  +   L +    
Sbjct: 361 --SFNKSDWTLFIGTAIFTYEGIGL----LIPIHE------SMEKPAHFK-PALMYVILV 407

Query: 292 VAMIF--CFLMGYTGFLVFKDRTKGNILNNFPGSDNVVNVARFCFGFNMLTTFPLEIFVL 349
           V +IF  C L+ Y+    F  + +  IL NFP +    N  +  +   +L + PL++F  
Sbjct: 408 VTIIFISCGLICYSA---FGAKVETVILLNFPSNSIFTNAVQLIYALAILLSTPLQLFPA 464

Query: 350 RDVIRDFMFFNSKDTNQSQELSLKLHXXXXXXXXXXXXXXXXXXCNLGALFELTGATTAS 409
             ++ + +F  +       ++  + +                   +L     L G+    
Sbjct: 465 IKILENKIFHKNASGKFDAKVKWRKNYFRAFVVLIAVIIAWIGANDLDKFVSLIGSFACI 524

Query: 410 LMAYILPPSVNLLLIGKRSTVREKLPHYACIIFGFTIMVVSSSQTIIAYIR 460
            + YI PP  +  +      ++      A +IFG  +M  +S QTI  +I 
Sbjct: 525 PLIYIYPPLFHYKVFENNKKLQAI--DLAILIFGALVMSYTSWQTIALWIH 573

>ZYRO0A02112g Chr1 complement(171184..172587) [1404 bp, 467 aa] {ON}
           similar to uniprot|P40501 Saccharomyces cerevisiae
           YIL088C AVT7 Putative transporter member of a family of
           seven S. cerevisiae genes (AVT1-7) related to vesicular
           GABA-glycine transporters
          Length = 467

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 26/90 (28%), Positives = 44/90 (48%)

Query: 255 SVISFALVCHHNTSFIYFSLKTPSLKRFDRLTHFSCFVAMIFCFLMGYTGFLVFKDRTKG 314
           S+I FA     N   I   L+  ++     + + S  +A +F   +   G+L F   T G
Sbjct: 194 SIIIFAYTGSMNLFSIVNELRNNTMTNITAVVNRSIAIATVFFIAVALAGYLTFGSNTLG 253

Query: 315 NILNNFPGSDNVVNVARFCFGFNMLTTFPL 344
           NI+ N+  +   V++ +FC G  ++ TFPL
Sbjct: 254 NIMLNYDDTSIYVHIGKFCLGSMVVLTFPL 283

>TDEL0G02250 Chr7 complement(441289..442692) [1404 bp, 467 aa] {ON}
           Anc_2.295 YIL088C
          Length = 467

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 62/298 (20%), Positives = 111/298 (37%), Gaps = 16/298 (5%)

Query: 70  MNMANSILGAGVIGQPFAIKNCGLVGGIFAVILLSVLVDWTIRLIVVNMKITGKTTYQDS 129
           +N+  +I+GAG++  PFA +N G+V G    ++ +V   + + ++    K          
Sbjct: 12  VNLVKTIIGAGLLAIPFAFRNDGVVIGALLTLIAAVTSGFGLFILAKCSKTLINPRNSSF 71

Query: 130 VEFAMGRKGKLLILLSNGLFAXXXXXXXXXXXXDTIPHVLRAFFPGHENLFHRNIIIILV 189
               M     L  L    +                I  +    F G    +      IL+
Sbjct: 72  FTLCMLTYPSLSPLFDLAMIVQCFGVGLSYLVL--IGDLFPGLFGGEPRFW------ILL 123

Query: 190 TCFISFPLSLNRNISKLSKASML---AXXXXXXXXXXXXXKGPMIDDAYKGSFNTTELFF 246
           +  I  PL   + +  L  +S++   A                ++   YK S+     +F
Sbjct: 124 SSLIIVPLCCLKKLDSLRYSSIIGLFALAYLSLLIVTYFAHDTLLTHDYK-SYRGEVCWF 182

Query: 247 TPRIFQGI----SVISFALVCHHNTSFIYFSLKTPSLKRFDRLTHFSCFVAMIFCFLMGY 302
               F+G+    S+I FA     N   I   LK  S+     + + S  ++      +G 
Sbjct: 183 KVYDFKGLLSTFSIIVFAYTGSMNLFSIINELKENSMANITSVINTSITISTAVFLAVGI 242

Query: 303 TGFLVFKDRTKGNILNNFPGSDNVVNVARFCFGFNMLTTFPLEIFVLRDVIRDFMFFN 360
            G+L F   T GNI+ N+      V V + C G  ++ +FPL     R  I + + ++
Sbjct: 243 CGYLTFGSNTLGNIMLNYDPDSTWVYVGKLCLGSMVMLSFPLLFHPCRIAINNLVVWS 300

>Smik_9.97 Chr9 complement(176731..178203) [1473 bp, 490 aa] {ON}
           YIL088C (REAL)
          Length = 490

 Score = 43.9 bits (102), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 25/105 (23%), Positives = 53/105 (50%)

Query: 255 SVISFALVCHHNTSFIYFSLKTPSLKRFDRLTHFSCFVAMIFCFLMGYTGFLVFKDRTKG 314
           S+I FA     N   +   LK  S++    + + S  ++     ++G +G+L F ++T G
Sbjct: 195 SIIIFAYTGSMNLFPMINELKDNSMENITSVINNSISLSTALFLIVGLSGYLTFGNKTLG 254

Query: 315 NILNNFPGSDNVVNVARFCFGFNMLTTFPLEIFVLRDVIRDFMFF 359
           N++ N+  +   + + +FC G  ++ +FPL    LR  + + + +
Sbjct: 255 NLILNYDPTSIWIVIGKFCLGLMLILSFPLLFQPLRIAVNNVIIW 299

>Kpol_1029.6 s1029 (11352..13655) [2304 bp, 767 aa] {ON}
           (11352..13655) [2304 nt, 768 aa]
          Length = 767

 Score = 43.9 bits (102), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 78/362 (21%), Positives = 137/362 (37%), Gaps = 43/362 (11%)

Query: 19  RDELLGSSFQLSSFDRNSQR-----NSERLIDGSEDESTTAFLRENRSKSNIFMAFMNMA 73
            D+ +    + +  +R+ +R         L+  SE   T   ++     +    AF  + 
Sbjct: 304 EDDFITEEIEQADVERDERRPLLYGGPSHLV--SESVVTKPMIQSVVGNTPTIKAFFLLL 361

Query: 74  NSILGAGVIGQPFAIKNCGLVGGIFAVILLSVLVDWTIRLIVVNMKITGKTTYQDSVEFA 133
            S +G G++  P A  N GL+  I  ++   +   W   +++ +  IT  T++ D     
Sbjct: 362 KSFIGTGILFLPRAFDNGGLIFSICMLLFFGIYSYWCYYILIRSKNITQVTSFGDIGYKL 421

Query: 134 MGRKGKLLILLSNGL----FAXXXXXXXXXXXXDTIPHVLRAFFPGHENLFHRNIIIILV 189
            GR  K +IL S  L    FA              + +V R   P  +  +     +++ 
Sbjct: 422 YGRWMKFVILFSLVLTQLGFAGAYVIFTAKNLKAFVENVFRV--PDFDLKY-----LMIF 474

Query: 190 TCFISFPLSLNRNISKLSKASMLA-----------XXXXXXXXXXXXXKGPMIDDAYKGS 238
             FI  PLS  RN+SKLS  S++A                          P     Y  +
Sbjct: 475 QLFIFTPLSYVRNVSKLSFPSLVANFFIMSGLAIVIVFTMKHLFYDLNMRPEEGVIYGFN 534

Query: 239 FNTTELFFTPRI--FQGISVISFALVCHHNTSFIYFSLKTPSLKRFDRLTHFSCFVAMIF 296
            N   LF    I  F+GI +I            I  S+K P  + F  +       A + 
Sbjct: 535 SNGWTLFIGTAIFAFEGIGLI----------IPIQDSMKHP--EHFPLVLGLVIMTATVL 582

Query: 297 CFLMGYTGFLVFKDRTKGNILNNFPGSDNVVNVARFCFGFNMLTTFPLEIFVLRDVIRDF 356
              +   G+L +    +  IL N P S+  VN+ +  +   ++ + PL++F    +I + 
Sbjct: 583 FVTIATIGYLAYGKLIETVILLNLPKSNIFVNLIQLFYSMAIMLSTPLQLFPAIKIIENK 642

Query: 357 MF 358
           +F
Sbjct: 643 VF 644

>KAFR0J01320 Chr10 (241859..243298) [1440 bp, 479 aa] {ON} Anc_2.295
           YIL088C
          Length = 479

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 36/131 (27%), Positives = 61/131 (46%), Gaps = 4/131 (3%)

Query: 245 FFTPRIFQGI----SVISFALVCHHNTSFIYFSLKTPSLKRFDRLTHFSCFVAMIFCFLM 300
           +FT   F+G+    S+I FA     N   I   LK  S++    + + S  ++ I    +
Sbjct: 181 WFTVYDFKGLLSTFSIIIFAYTGAMNLFSIINELKNNSMENVSSIINHSISISTILFLTV 240

Query: 301 GYTGFLVFKDRTKGNILNNFPGSDNVVNVARFCFGFNMLTTFPLEIFVLRDVIRDFMFFN 360
           G  G+L F   T GNIL N+      V++A+FC    ++ +FPL    LR  + + + + 
Sbjct: 241 GIAGYLTFGCNTLGNILLNYDADSVWVSIAKFCLAIMLVLSFPLLFHPLRIAVNNLVVWL 300

Query: 361 SKDTNQSQELS 371
             +    Q+ S
Sbjct: 301 EINYGTPQQRS 311

 Score = 34.3 bits (77), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 26/36 (72%)

Query: 70  MNMANSILGAGVIGQPFAIKNCGLVGGIFAVILLSV 105
           +N+  +I+GAG++  P+A KN G++ G+F  +L +V
Sbjct: 12  INLVKTIVGAGLLAIPYAFKNDGVLVGLFLTLLAAV 47

>YNL101W Chr14 (434999..437140) [2142 bp, 713 aa] {ON}  AVT4Vacuolar
           transporter, exports large neutral amino acids from the
           vacuole; member of a family of seven S. cerevisiae genes
           (AVT1-7) related to vesicular GABA-glycine transporters
          Length = 713

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 75/357 (21%), Positives = 135/357 (37%), Gaps = 44/357 (12%)

Query: 27  FQLSSFDRNSQRNSERLIDGSEDESTTAFLRENRSK--------SNIFMAFMNMANSILG 78
           F   SF+ +   +S  ++   EDE +    R +  K        ++    F+ +  S +G
Sbjct: 253 FAGESFEDDFIPDSSNMMIRGEDERSALLSRPDHMKVLPSAKGTTSTKKVFLILLKSFIG 312

Query: 79  AGVIGQPFAIKNCGLVGGIFAVILLSVLVDWTIRLIVVNMKITGKTTYQDSVEFAMGRKG 138
            GV+  P A  N GL   +  +    +   W   ++V      G +++ D      G   
Sbjct: 313 TGVLFLPNAFHNGGLFFSVSMLAFFGIYSYWCYYILVQAKSSCGVSSFGDIGLKLYGPWM 372

Query: 139 KLLILLSNGLFAXXXXXXXXXXXXDTIPHVLRAFFPGHENLFHRNII----IILVTCFIS 194
           +++IL S  +                    L+AF    +N+FH  ++    +++    I 
Sbjct: 373 RIIILFSLVITQVGFSGAYMIFTAKN----LQAFL---DNVFHVGVLPLSYLMVFQTIIF 425

Query: 195 FPLSLNRNISKLSKASMLAXXXXXXXXXXX-----------XXKGPMIDDAYKGSFNTTE 243
            PLS  RNISKLS  S+LA                          P +   Y  + +   
Sbjct: 426 IPLSFIRNISKLSLPSLLANFFIMAGLVIVIIFTAKRLFFDLMGTPAMGVVYGLNADRWT 485

Query: 244 LFFTPRI--FQGISVISFALVCHHNTSFIYFSLKTPSLKRFDRLTHFSCFVAMIFCFLMG 301
           LF    I  F+GI +I            +  S++ P  ++F  +       A I    + 
Sbjct: 486 LFIGTAIFAFEGIGLI----------IPVQDSMRNP--EKFPLVLALVILTATILFISIA 533

Query: 302 YTGFLVFKDRTKGNILNNFPGSDNVVNVARFCFGFNMLTTFPLEIFVLRDVIRDFMF 358
             G+L +    +  IL N P S+  VN+ +  +   ++ + PL++F    +I +  F
Sbjct: 534 TLGYLAYGSNVQTVILLNLPQSNIFVNLIQLFYSIAIMLSTPLQLFPAIKIIENKFF 590

>TPHA0F01700 Chr6 complement(387868..389202) [1335 bp, 444 aa] {ON}
           Anc_2.177 YNL101W
          Length = 444

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 39/139 (28%), Positives = 65/139 (46%), Gaps = 19/139 (13%)

Query: 239 FNTTE--LFFTPRI--FQGISVISFALVCHHNTSFIYFSLKTPSLKRFDRLTHFSCFVAM 294
           FN+ E  LF    I  F+G+ ++   +  H+N S         S K F ++         
Sbjct: 204 FNSNEWTLFIGTAIYAFEGVGLL---IPIHNNMS---------SPKDFPKILLLVMLTMS 251

Query: 295 IFCFLMGYTGFLVFKDRTKGNILNNF-PGSDNVVNVARFCFGFNMLTTFPLEIFVLRDVI 353
           I   L+G  G+L + ++ K  IL +F PG    VN+   CF   +L + PL++F L  ++
Sbjct: 252 IIFILIGTCGYLSYGEKIKVIILQSFAPGI--FVNIIIVCFTIGILLSTPLQLFSLTSLL 309

Query: 354 RDFMFFNSKDTNQSQELSL 372
            DF+F   K     ++L +
Sbjct: 310 EDFLFTKKKIAVADEDLKV 328

>TBLA0F01400 Chr6 complement(345013..346374) [1362 bp, 453 aa] {ON}
           Anc_7.420 YER119C
          Length = 453

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 58/267 (21%), Positives = 105/267 (39%), Gaps = 29/267 (10%)

Query: 70  MNMANSILGAGVIGQPFAIKNCGLVGGIFAVILLSVLVDWTIRLIVVNMKITGKTTYQDS 129
           + + ++  GAG++  P+A K  G++ G+   ++L V     I  +++ +K+T  T   + 
Sbjct: 8   ITLLHTACGAGILAVPYAFKPFGVIPGM---LILLVCSSTAILGLLLQVKVTKYTPVGEK 64

Query: 130 ---VEFAMGRKGKLLIL--LSNGLFAXXXXXXXXXXXXDTIPHVLRAFFPGHENLFHRNI 184
               E A     +L +L  ++  +              D +P +L      H +  +R +
Sbjct: 65  HSFFELASKIHPRLAVLFDIAIAIKCFGVATSYLIAVGDLLPTLL------HSS--NRFL 116

Query: 185 IIILVTCFISFPLSLNRNISKLSKASMLAXXXXXXXXXXXXXKGPMIDDAYKGSFNTTEL 244
           +I LV  FI  PLS  + I+ L   S LA                              L
Sbjct: 117 LITLVWGFIIAPLSFLKKITALRYTSFLAVVSVIYLSILVTFHYADPSQEIIDLRGNVSL 176

Query: 245 FF-------TPRIFQGISVISFALVCHHNTSFIYFSLKTPSLKRFDRLTHF---SCFVAM 294
           FF       +   F+ + +  FA  CHHN   ++  L   S   F +L +    +  +A 
Sbjct: 177 FFPGEDQHNSVSPFKTLPIFVFAYTCHHN---MFAVLNEQSTNEFSKLKYIPLTAISIAC 233

Query: 295 IFCFLMGYTGFLVFKDRTKGNILNNFP 321
           I   ++G  G++ F      NI+  +P
Sbjct: 234 IMYLIVGTFGYVTFGSNITSNIVAQYP 260

>KAFR0D02000 Chr4 (407474..409618) [2145 bp, 714 aa] {ON} Anc_2.177
           YNL101W
          Length = 714

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 75/336 (22%), Positives = 130/336 (38%), Gaps = 36/336 (10%)

Query: 49  DESTTAFLRENRSKSNIFMAFMNMANSILGAGVIGQPFAIKNCGLVGGIFAVILLSVLVD 108
           D  T A +   +  ++   AF+ +  S +G GV+  P A  N GL   I  + L+ +   
Sbjct: 285 DSVTRANVETIKGTTSTRKAFLLLLKSFVGTGVLFLPDAFHNGGLAFSIIVLTLVGLYSY 344

Query: 109 WTIRLIVVNMKITGKTTYQDSVEFAMGRKGKLLILLSNGLFAXXXXXXXXXXXXDTIPHV 168
           W   ++V         ++ D      G+  K +IL++  +F                   
Sbjct: 345 WCYYILVQTKVKVKACSFGDIGSQLYGKWMKSVILVA--IFVSQLGFSAAYMIFTA--KN 400

Query: 169 LRAFFPGHENLFHR---NIIIILVTCFISF-PLSLNRNISKLSKASMLAXX---XXXXXX 221
           L AF    +N+FH    N+  I++   I F PLS  RNISKLS  S++A           
Sbjct: 401 LGAFL---QNIFHLKDFNLGYIMIIQLIFFVPLSFIRNISKLSLPSLIANVFIMLGLLII 457

Query: 222 XXXXXKGPMIDDAYKGSFNTTELFFTPR---IFQGISVISFALVCHHNTSFIYFSLKTPS 278
                K   +D     +    E    PR   +F G ++ SF  +           L  P 
Sbjct: 458 LIFASKHLFLDLGVHPAAG-VEYGIDPRRWTLFVGTAIFSFEGI----------GLIIPV 506

Query: 279 LKRFDRLTHFSCFVAMIF------CFLMGYTGFLVFKDRTKGNILNNFPGSDNVVNVARF 332
                R   FS  + ++          +   G+L +    +  +L N P  +  VN+ +F
Sbjct: 507 QDSMKRPEKFSLVLKLVMITTTIIFITIATVGYLAYGSEIQTVVLLNLPQGNLFVNLIQF 566

Query: 333 CFGFNMLTTFPLEIFVLRDVIRDFMF--FNSKDTNQ 366
            +   ++ + PL++F    ++   +F  +N K + Q
Sbjct: 567 LYSLAIMLSTPLQLFPAIKILEGKVFYRYNKKVSRQ 602

>TBLA0F01390 Chr6 complement(342433..343719) [1287 bp, 428 aa] {ON} 
          Length = 428

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 80/395 (20%), Positives = 140/395 (35%), Gaps = 48/395 (12%)

Query: 70  MNMANSILGAGVIGQPFAIKNCGLVGGIFAVILLSVLVDWTIRLIVVNMKITGKTTYQDS 129
           + + ++  GAG++  PFA K  GL  G+  +++  +   + + L    +K T        
Sbjct: 8   VTLLHTACGAGILAIPFAFKPFGLFPGLMVLVVCGIAAIFGLLLQAKIIKYTPTNEKHSF 67

Query: 130 VEFAMGRKGKLLIL--LSNGLFAXXXXXXXXXXXXDTIPHVLRAFFPGHENLFHRNIIII 187
              A      L IL  L+  +              D +  +L       +N +  N I  
Sbjct: 68  FILATKLHPTLAILFDLAIAVKCFGVSTSYLIAIGDFLAVLL-------DNEYRMNTIT- 119

Query: 188 LVTCFISFPLSLNRNISKLSKASMLAXXXXXXXXXXXXXKGPMIDDAYKGSFNTTELFFT 247
            V  FI  PLS  R I+ L   S+LA                   +       T  LF  
Sbjct: 120 FVWLFIILPLSYLRKINALRYTSLLAVTSVFYLCILVTYHYCKPSEEISELRGTVSLFL- 178

Query: 248 PR-----IFQGISVISFALVCHHNTSFIYFSLKTPSLKRFDRLTHFSCFVAMIFCFLMGY 302
           P+      F+ + +  FA  CHHN   +    K    KR   +   +  +A I   ++G 
Sbjct: 179 PKSSGISPFKTLPIFVFAYTCHHNMFAVINEQKHTDFKRLKFIPLIAISIACILYLIVGC 238

Query: 303 TGFLVFKDRTKGNILNNFPGSDNVVNVARFCFGFNMLT-TFPLEIFVLRDVIRDFMFF-- 359
            G+  F      NI+  +P +++V+ V        ++T  +PL+    R  I + ++   
Sbjct: 239 LGYATFGANITSNIVAKYP-TNSVLTVLGQTAMLTVVTLAYPLQCQPARASILNILYALF 297

Query: 360 -----NSKDTNQS-----------------------QELSLKLHXXXXXXXXXXXXXXXX 391
                N  D  ++                        E S+ LH                
Sbjct: 298 PKLKNNKSDVEEASMNDGYQVDLEENKQQSEPERIISEPSIILHSIVTSLILFGSWCIAV 357

Query: 392 XXCNLGALFELTGATTASLMAYILPPSVNLLLIGK 426
              +L  +  + GAT ++ +++ILP    ++LI K
Sbjct: 358 SVNSLAQVLAIVGATGSTFISFILPGLFAVVLIPK 392

>Skud_14.229 Chr14 (425174..427315) [2142 bp, 713 aa] {ON} YNL101W
           (REAL)
          Length = 713

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 75/360 (20%), Positives = 132/360 (36%), Gaps = 50/360 (13%)

Query: 27  FQLSSFDRNSQRNSERLIDGSEDESTTAFLRENRSK--------SNIFMAFMNMANSILG 78
           F   SF+ +   +S  ++   EDE +    R +  K        ++    F+ +  S +G
Sbjct: 253 FAGESFEDDFIPDSSNMMIQGEDERSALLSRPDHMKVLPSAKGTTSTRKVFLILLKSFIG 312

Query: 79  AGVIGQPFAIKNCGLVGGIFAVILLSVLVDWTIRLIVVNMKITGKTTYQDSVEFAMGRKG 138
            GV+  P A  N GL   +  +    V   W   ++V      G +++ D      G   
Sbjct: 313 TGVLFLPNAFHNGGLFFSVSMLAFFGVYSYWCYYILVQAKSSCGVSSFGDIGLKLYGPWM 372

Query: 139 KLLILLSNGLFAXXXXXXXXXXXXDTIPHVLRAFFPGHENLFHRNII----IILVTCFIS 194
           +++IL S  +                    L+AF    +N+FH  ++    +++    + 
Sbjct: 373 RIIILFSLVITQVGFSGAYMIFTAKN----LQAFL---DNVFHVGVLPLSYLMVFQTIVF 425

Query: 195 FPLSLNRNISKLSKASMLAXXXXXXXXXXXXXKGPMIDDAYKGSFNTTELFFTPRIFQGI 254
            PLS  RNISKLS  S+LA                         F    LFF  +     
Sbjct: 426 IPLSFIRNISKLSLPSLLANFFIMAGLVIVII------------FTAKRLFFDLKATPAA 473

Query: 255 SVISFALVCHHNTSFI----------------YFSLKTPSLKRFDRLTHFSCFVAMIFCF 298
            VI + L     T FI                  S++ P  ++F  +       A +   
Sbjct: 474 GVI-YGLNTDRWTLFIGTAIFAFEGIGLIIPVQDSMRNP--EKFPLVLGLVILTATLLFI 530

Query: 299 LMGYTGFLVFKDRTKGNILNNFPGSDNVVNVARFCFGFNMLTTFPLEIFVLRDVIRDFMF 358
            +   G+L +    +  IL N P S+  VN+ +  +   ++ + PL++F    +I +  F
Sbjct: 531 SIATLGYLAYGSSVRTVILLNLPQSNIFVNLIQLFYSIAIMLSTPLQLFPAIKIIENKFF 590

>Kwal_27.11485 s27 (819908..821323) [1416 bp, 471 aa] {ON} YIL088C -
           Hypothetical ORF [contig 27] FULL
          Length = 471

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 53/297 (17%), Positives = 114/297 (38%), Gaps = 18/297 (6%)

Query: 56  LRENRSKSNIFMAFMNMANSILGAGVIGQPFAIKNCGLVGGIFAVILLSVLVDWTIRLIV 115
           +  N   +  F + +N+  +I+GAG++  P+A ++ G++ GI   ++ ++   + + ++ 
Sbjct: 1   MNTNTGTATAFFSTINLVKTIVGAGMLAIPYAFRSDGVLVGIVLTLIAALTSGFGLFVLA 60

Query: 116 VNMKITGKTTYQDSVEFAMGRKGKLLILLSNGLF--AXXXXXXXXXXXXDTIPHVLRAFF 173
              K                    L ++    +F               D  P ++    
Sbjct: 61  KCSKTLTNPRASSFFTLCSITYPSLSLVFDFSMFIQCYGVGLSYLVLIGDLFPGIVG--- 117

Query: 174 PGHENLFHRNIIIILVTCFISFPLSLNRNISKLSKASML---AXXXXXXXXXXXXXKGPM 230
            G  N++      I+ +  I  PLSL + +  L  +S+L   A             +  +
Sbjct: 118 -GSRNMW------IMASALIIVPLSLVKKLDSLKYSSILGLFAIAYLVCLIVGAFLRDVV 170

Query: 231 IDDAY---KGSFNTTELFFTPRIFQGISVISFALVCHHNTSFIYFSLKTPSLKRFDRLTH 287
             D Y   +G  +   ++    +    +++ FA     N   I   LK  S+   +++  
Sbjct: 171 FTDNYTAIRGDVSWIRVYDFKGLISTFTIVIFAYTGSMNMFSIINELKDNSMTNINKVVS 230

Query: 288 FSCFVAMIFCFLMGYTGFLVFKDRTKGNILNNFPGSDNVVNVARFCFGFNMLTTFPL 344
            +  ++      +G  G+L F   T GNI+ N+  +       + C G  ++ +FPL
Sbjct: 231 TTITISSFLFLAVGLCGYLTFGSNTLGNIMLNYDPNSAWTTTGKLCLGSMVILSFPL 287

>KLTH0D09042g Chr4 complement(746802..748958) [2157 bp, 718 aa] {ON}
           similar to uniprot|P50944 Saccharomyces cerevisiae
           YNL101W AVT4 Vacuolar transporter exports large neutral
           amino acids from the vacuole member of a family of seven
           S. cerevisiae genes (AVT1-7) related to vesicular GABA-
           glycine transporters
          Length = 718

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 94/437 (21%), Positives = 160/437 (36%), Gaps = 75/437 (17%)

Query: 68  AFMNMANSILGAGVIGQPFAIKNCGLVGGIFAVILLSVLVDWTIRLIVVNMKITGKTTYQ 127
           AF+ M  S +G GV+  P A  N GL   +  ++   +   W   ++  +   T  +++ 
Sbjct: 306 AFLLMIKSFVGTGVLFLPGAFSNGGLFFSLAMLVFFGIYSYWCYYILTKSKIATKVSSFG 365

Query: 128 DSVEFAMGRKGKLLILLSNGLFAXXXXXXXXXXXXDTIPHVLRAFFPGHENLFHR---NI 184
           D      G   K +IL S                  T  ++L AF    EN+F+     I
Sbjct: 366 DIGLTLYGPWMKFIILFS---LVMTQLGFSGAYVVFTAKNLL-AFV---ENVFYWPGVTI 418

Query: 185 IIILVTCFISF-PLSLNRNISKLSKASMLAXXXXXXXXXXXXXKGPMIDDAYKGSFNTTE 243
           + +L    + F PLS  RNI+KLS +S++A                         F    
Sbjct: 419 VHLLALQLVVFIPLSFIRNIAKLSFSSLVANFLVMGGIVIVI------------GFTAKH 466

Query: 244 LFF-----------------TPRIFQGISVISF---ALVCHHNTSFIYFSLKTPSLKRFD 283
           LFF                 +  +F G ++ +F    L+       I  S+K P  ++F 
Sbjct: 467 LFFDLNCKPAEGIVTGFNSQSWTLFVGTAIFAFEGIGLIIP-----IQSSMKHP--EKFP 519

Query: 284 RLTHFSCFVAMIFCFLMGYTGFLVFKDRTKGNILNNFPGSDNVVNVARFCFGFNMLTTFP 343
            +       A +    +   G+L +   T+  IL N P    +VN+ +F +   +L + P
Sbjct: 520 LVMALVIITATVLFVSVATLGYLSYGAETQTVILLNLPQDSILVNLIQFFYSSAILLSTP 579

Query: 344 LEIFVLRDVIRDFMF-------FNSKDTNQSQ------ELSLKLHXXXXXXXXXXXXXXX 390
           L++F    +I + +F           D  + Q      +L  ++                
Sbjct: 580 LQLFPAIAIIENKVFPKFTKIYVKRSDHTKIQYKPNSGKLDWRIKWLKNFVRSLIVSSVV 639

Query: 391 XXXC----NLGALFELTGATTASLMAYILPPSVNLLLIGK-----RSTVREKLP---HYA 438
                   +L A   + G+     + YI PP ++L    K       +V  K P    Y 
Sbjct: 640 IAAYFGANHLDAFVAIVGSLACIPLVYIYPPMLHLRSCSKPRFAGEKSVWRKWPILLDYV 699

Query: 439 CIIFGFTIMVVSSSQTI 455
            ++FG   MV +S Q+I
Sbjct: 700 LVVFGAIGMVYTSYQSI 716

>YIL088C Chr9 complement(197931..199403) [1473 bp, 490 aa] {ON}
           AVT7Putative transporter, member of a family of seven S.
           cerevisiae genes (AVT1-7) related to vesicular
           GABA-glycine transporters
          Length = 490

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 27/113 (23%), Positives = 56/113 (49%), Gaps = 4/113 (3%)

Query: 251 FQGI----SVISFALVCHHNTSFIYFSLKTPSLKRFDRLTHFSCFVAMIFCFLMGYTGFL 306
           F+G+    S+I FA     N   +   LK  S++    + + S  ++     ++G +G+L
Sbjct: 187 FKGLLSTFSIIIFAFTGSMNLFPMINELKDNSMENITFVINNSISLSTALFLIVGLSGYL 246

Query: 307 VFKDRTKGNILNNFPGSDNVVNVARFCFGFNMLTTFPLEIFVLRDVIRDFMFF 359
            F + T GN++ N+  +   + + +FC G  ++ +FPL    LR  + + + +
Sbjct: 247 TFGNETLGNLMLNYDPNSIWIVIGKFCLGSMLILSFPLLFHPLRIAVNNVIIW 299

>TPHA0B02530 Chr2 (580212..582002) [1791 bp, 596 aa] {ON} Anc_5.252
           YKL146W
          Length = 596

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 39/158 (24%), Positives = 71/158 (44%), Gaps = 5/158 (3%)

Query: 58  ENRSKSNIFMAFMNMANSILGAGVIGQPFAIKNCGLVGGIFAVILLSVLVDWT-IRLIVV 116
           +N  K++ F A + +  S +G G++  P    N G      ++++ S+L  +  I LI  
Sbjct: 195 DNNKKASTFKAILLLLKSFVGTGILFLPKGFSNGGYTFSTISLLVCSLLSYYCFILLIST 254

Query: 117 NMKITGKTTYQDSVEFAMGRKGKLLILLSNGLFAXXXXXXXXXXXXDTIPHVLRAFFPGH 176
             ++ G   Y D      G+  KL ILLS  L                +  + +  F  +
Sbjct: 255 KDQMKGINGYGDLGNHLYGKNMKLAILLSIVLSQIGFSAAYTVFVATNLKTLCQNLFSNN 314

Query: 177 ENLFHRNIII-ILVTCFISFPLSLNRNISKLSKASMLA 213
           +   H +I++ I+    +  PLS  RNI+KL+  +++A
Sbjct: 315 Q---HFSIVLFIIFQTLLFIPLSFTRNITKLTATALVA 349

>KLLA0E08559g Chr5 complement(766878..768260) [1383 bp, 460 aa] {ON}
           similar to uniprot|P40501 Saccharomyces cerevisiae
           YIL088C AVT7 Putative transporter member of a family of
           seven S. cerevisiae genes (AVT1-7) related to vesicular
           GABA-glycine transporters
          Length = 460

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 43/164 (26%), Positives = 72/164 (43%), Gaps = 13/164 (7%)

Query: 187 ILVTCFISFPLSLNRNISKLSKASMLAXXXXXXXXXXXXXKGPMIDDAYK-GSFNTTEL- 244
           IL++  I  PLSL R+   L   S++               G +I  +Y  G++   ++ 
Sbjct: 121 ILLSAIIIVPLSLLRHFDSLKYTSVIGLLALGYI-------GLLIIGSYSFGNYPKPKVD 173

Query: 245 FFTPRIFQGI----SVISFALVCHHNTSFIYFSLKTPSLKRFDRLTHFSCFVAMIFCFLM 300
           +F+     G+    S+I FA     N   I   LK  S+    ++ + S  V+     ++
Sbjct: 174 WFSISDRSGVLTTFSIIVFAFTGSMNLFSIINELKENSMTNIKKIINNSIVVSSACFIIL 233

Query: 301 GYTGFLVFKDRTKGNILNNFPGSDNVVNVARFCFGFNMLTTFPL 344
           G  G+L F   T GN++ N+      V  ARF  G  ++ +FPL
Sbjct: 234 GLFGYLTFGKETLGNVILNYDADKLSVRFARFNLGLMVVLSFPL 277

>TBLA0F03230 Chr6 (785400..787085) [1686 bp, 561 aa] {ON} 
          Length = 561

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 70/334 (20%), Positives = 137/334 (41%), Gaps = 41/334 (12%)

Query: 49  DESTTAFLRENRSKSNIFMAFMNMANSILGAGVIGQPFAIKNCGLVGGIFAVILLSVLVD 108
           +E++ A  +E  S S +F   +    S +G GV+  P A ++ GL+     ++   +   
Sbjct: 120 EENSPAAKKEGTSNSKVFFILLK---SFVGTGVLFLPSAFQSGGLLFSNLLLLFFGIYSF 176

Query: 109 WTIRLIVVNMKITGKTTYQDSVEFAMGRKGKLLILLSNGLFAXXXXXXXXXXXXDTIPHV 168
           W   ++ +  K+T    +++   +  G   K +I++S  L              + I  V
Sbjct: 177 WCYYILTLAKKVTNVNNFENIGSYLYGNWLKFIIVVSVVLSQLGFAGTYVIFTAENIKLV 236

Query: 169 LRAFFPGHENLFHRNIIIILVTCFISF-PLSLNRNISKLSKASMLAXXXXXXXXXXXXXK 227
           L        N+ +  I I++ +  I F PLS  R ISKL+  +++A              
Sbjct: 237 LEHVC----NVKNLPIEILIFSQLIIFIPLSFLRKISKLAIPTLIANVLTLVGLILVVVL 292

Query: 228 ---------------GPMIDDAYKGSFNTTELFFTPRIFQGISVISF---ALVCHHNTSF 269
                          GP +   +  S  TT        F GI++ SF    L+       
Sbjct: 293 LLQHLISQGKINNGIGPDVIFYFNSSQWTT--------FVGIAIFSFEGVGLIIP----- 339

Query: 270 IYFSLKTPSLKRFDRLTHFSCFVAMIFCFLMGYTGFLVFKDRTKGNILNNFPGSDNVVNV 329
           +  S++ P  ++F  +      V      L+G  G+L F       IL++F   +  V++
Sbjct: 340 VEDSMRNP--EKFPLVLSLVLLVCTAIFMLIGTLGYLTFGKDITPVILSSFNQKNKFVSI 397

Query: 330 ARFCFGFNMLTTFPLEIFVLRDVIRDFMFFNSKD 363
           A+ C+   +L + P+++F +  ++ + +F  +K+
Sbjct: 398 AQLCYSIAILLSTPIQLFPVYKMVEEAIFKKNKN 431

>KLTH0G10604g Chr7 complement(895162..896568) [1407 bp, 468 aa] {ON}
           similar to uniprot|P40501 Saccharomyces cerevisiae
           YIL088C AVT7
          Length = 468

 Score = 40.8 bits (94), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 58/305 (19%), Positives = 115/305 (37%), Gaps = 14/305 (4%)

Query: 61  SKSNIFMAFMNMANSILGAGVIGQPFAIKNCGLVGGIFAVILLSVLVDWTIRLIVVNMKI 120
           + +  F + +NM  +I+GAG++  P+A K+ G++ G    I+ +V   + + ++    K 
Sbjct: 3   AGATAFFSTVNMVKTIVGAGMLAVPYAFKSDGILVGTALTIVGAVTSGFGLFVLAKCSKT 62

Query: 121 TGKTTYQDSVEFAMGRKGKLLILLSNGLFAXXXXXXXXXXXXDTIPHVLRAFFPGHENLF 180
                              L ++    +F                  ++   FPG     
Sbjct: 63  LINPRASSFFTLCSITYPSLSLIFDFAMFVQCYGVGLSYLV------LVGDLFPGVVGGT 116

Query: 181 HRNIIIILVTCFISFPLSLNRNISKLSKASML---AXXXXXXXXXXXXXKGPMIDDAYK- 236
            R  II   +   + PLSL + +  L  +S+L   A             K  ++ + Y+ 
Sbjct: 117 RRGWII--GSTLATVPLSLIKRLDGLKYSSILGLFAVAYLVCLILGSFLKDVVLSENYRE 174

Query: 237 --GSFNTTELFFTPRIFQGISVISFALVCHHNTSFIYFSLKTPSLKRFDRLTHFSCFVAM 294
             G  +   ++    +    ++I FA     N   I   LK  S++  +++   S   + 
Sbjct: 175 FRGDVSWIGVYDKKGLVSTFTIIVFAFTASMNLFSIINELKDNSMQNINKVITSSISTSA 234

Query: 295 IFCFLMGYTGFLVFKDRTKGNILNNFPGSDNVVNVARFCFGFNMLTTFPLEIFVLRDVIR 354
                +G  G+L F     GNI+ N+        + + C G  ++ +FPL +   R    
Sbjct: 235 ALFLSVGVCGYLTFGSNVVGNIMLNYDPESIWTTIGKLCLGTMVILSFPLLLHPCRIAAN 294

Query: 355 DFMFF 359
           + M +
Sbjct: 295 NMMHW 299

>TDEL0E03740 Chr5 (707081..708922) [1842 bp, 613 aa] {ON} Anc_5.252
           YKL146W
          Length = 613

 Score = 40.8 bits (94), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 85/415 (20%), Positives = 151/415 (36%), Gaps = 28/415 (6%)

Query: 57  RENRSKSNIFMAFMNMANSILGAGVIGQPFAIKNCGLVGGIFAVILLSVLVDWT----IR 112
              R K++ F A + +  S +G GV+  P A  N G     F+V+ L V    +    I 
Sbjct: 212 EHERHKASTFKAVLLLLKSFIGTGVLFLPKAFDNGGWA---FSVVCLFVCAVASFFCFIS 268

Query: 113 LIVVNMKITGKTTYQDSVEFAMGRKGKLLILLSNGLFAXXXXXXXXXXXXDTIPHVLRAF 172
           LI    K+ G   Y D      G K K  ILLS  L                +       
Sbjct: 269 LISTKEKV-GVNGYGDLGLRLFGPKMKFSILLSIALSQIGFSAAYIVFTATNLKVFCENV 327

Query: 173 FPGHENLFHRNIIIILVTCFISFPLSLNRNISKLSKASMLAXXXXXXXXXXXXXKGPMID 232
                + F     IIL T  I  PLS  RNI+KLS  +++A                   
Sbjct: 328 LGVKPDSFGLATYIILQT-LIFIPLSFTRNITKLSGTTLVADLFILLGLLYVYYYPSYYI 386

Query: 233 DAYKGSFNTTELFFTP--RIFQGISVISFALVCHHNTSFIYFSLKTPSLKRFDRLTHFS- 289
             +  + ++ +LF      +F G ++ +F  +           L  P  +  ++  HF+ 
Sbjct: 387 IKHGIATSSMKLFNKSDWSLFVGTAIFTFEGI----------GLLIPIQESMEKPQHFNK 436

Query: 290 CFVAMI----FCFLM-GYTGFLVFKDRTKGNILNNFPGSDNVVNVARFCFGFNMLTTFPL 344
           C + ++    F F+  G   +  F  + +  +L NFP        A+  +   +L + PL
Sbjct: 437 CLLGVMSGVAFVFITSGLICYSAFGSKVETVVLLNFPQDSPFTKSAQLLYVLAILLSTPL 496

Query: 345 EIFVLRDVIRDFMFFNSKDTNQSQELSLKLHXXXXXXXXXXXXXXXXXXCNLGALFELTG 404
           ++F    ++ ++ F        +  +    +                   +L     L G
Sbjct: 497 QLFPAIRILENWTFPVDASGKHNPHIKWLKNYFRSAIVIATSLIAWGGANDLDKFVSLVG 556

Query: 405 ATTASLMAYILPPSVNLLLIGKRSTVREKLPHYACII-FGFTIMVVSSSQTIIAY 458
           +     + YI PP+++      ++  +  L     I   G  IM+ ++ Q+I+ +
Sbjct: 557 SFACVPLIYIYPPALHFKAFKDKNASKISLVTDVVIASVGVIIMLYNTYQSILMW 611

>Skud_9.86 Chr9 complement(173889..175361) [1473 bp, 490 aa] {ON}
           YIL088C (REAL)
          Length = 490

 Score = 40.4 bits (93), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 47/214 (21%), Positives = 88/214 (41%), Gaps = 19/214 (8%)

Query: 172 FFPGHENLF--HRNIIIILVTCFISFPLSLNRNISKLSKASMLAXXXXXXXXXXX----- 224
            FPG   LF   RN  +I  T  I  PL L + + +L  +S+L                 
Sbjct: 108 LFPG---LFGGERNYWVIASTAII-IPLCLVKKLDQLKYSSILGLFALAYISILVFSHFV 163

Query: 225 --XXKGPMIDDAYKGSFNTTELFFTPRIFQGISVISFALVCHHNTSFIYFSLKTPSLKRF 282
               KG +  +  K   +  ++     +    S+I FA     N   +   LK  S+   
Sbjct: 164 FELAKGEL-TEVLKNDVSWWKIHDFKGLLSTFSIIIFAYTGSMNLFPMINELKDNSMGNI 222

Query: 283 DRLTHFSCFVAMIFCFLMGYTGFLVFKDRTKGNILNNFPGSDNVVNVARFCFGFNMLTTF 342
             + + S  ++     ++G +G+L F + T GN++ N+  +   + + +FC G  ++ +F
Sbjct: 223 TLVINNSISLSTALFLIVGLSGYLTFGNSTLGNLILNYDPNSVWIIIGKFCLGSMLILSF 282

Query: 343 PLEIFVLRDVIRDFMF-----FNSKDTNQSQELS 371
           PL    LR  + + +      F + D  +  ++S
Sbjct: 283 PLLFQPLRVAVNNVIIWIEITFGNADPEEDPQVS 316

>KNAG0C03380 Chr3 (665325..666962) [1638 bp, 545 aa] {ON} Anc_7.420
           YER119C
          Length = 545

 Score = 39.3 bits (90), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 48/213 (22%), Positives = 83/213 (38%), Gaps = 17/213 (7%)

Query: 168 VLRAFFPGHENLFHRNIIIILVTCFISFPLSLNRNISKLSKASMLAXXXXXXXXXXXXX- 226
           +L   FP  + +  R + I+LV   ++ PLS    +S L  + +L+              
Sbjct: 107 LLPQLFPA-QCIPARWLCILLVAACLALPLSCIHGLSVLGYSPILSSTLTAVLAVCMPLF 165

Query: 227 ---KGPMIDDAYKGSFNTTELFFTPRIFQGISVISFALVCHHNTSFIYFSLKTPSLKRFD 283
               G    DA  G+         PR+  G+ ++ F   CH N        +   LK   
Sbjct: 166 YLFGGVSPFDA--GTVTRATSNGAPRLL-GLPLLMFMFTCHQNIFPTLNCARERGLKHTL 222

Query: 284 R--LTHFSCFVAMIFCFLMGYTGFLVFKDRTK---GNILNNFPGSDNVVNVARFCFGFNM 338
           R  LT+ + + A+  C + G TG+L F   T+    N+L  +P    +  + R     ++
Sbjct: 223 RVPLTYLAAYAAV--CLICGITGYLTFHKSTRTIPSNVLLLYPQGSILGTLCRVTTLLSV 280

Query: 339 LTTFPLEIFVLRDVIRDFM--FFNSKDTNQSQE 369
             +FPL     R  +      +   +D+  SQ 
Sbjct: 281 TLSFPLLCHPTRAALNHIWAHWGRGQDSQASQP 313

>ADL205C Chr4 complement(341897..343303) [1407 bp, 468 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL088C
          Length = 468

 Score = 38.9 bits (89), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 37/90 (41%)

Query: 255 SVISFALVCHHNTSFIYFSLKTPSLKRFDRLTHFSCFVAMIFCFLMGYTGFLVFKDRTKG 314
           S+I FA     N   I   L   S++   R+ ++S   +     L+G  G+L F      
Sbjct: 194 SIIVFAFTGSMNMFSIINELGDNSMRNIQRIVYYSIAASTALFILVGMAGYLTFGSNVAQ 253

Query: 315 NILNNFPGSDNVVNVARFCFGFNMLTTFPL 344
           N++ NF        V     G  +L +FPL
Sbjct: 254 NVILNFDPDAVSTQVGSLALGLMVLLSFPL 283

>NDAI0I02030 Chr9 (472696..474546) [1851 bp, 616 aa] {ON} Anc_5.220
           YJR001W
          Length = 616

 Score = 37.4 bits (85), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 48/205 (23%), Positives = 83/205 (40%), Gaps = 16/205 (7%)

Query: 4   EAANEASIQEETFSDRDELLGSSFQLSSFDRNSQRNSERLIDGSEDESTTAFLRENRSKS 63
            A N++S+   + S  D +  ++F  S  +       +R ++G + +  T    ++    
Sbjct: 168 SAENQSSLLRPSISFADLISNANFDTSIINDTDSITLKR-VEGKDGKIVTLIAGQSTGPQ 226

Query: 64  NIFMAFMNMANSILGAGVIGQPFAIKNCGLVGGIFAVILLSVLVDWTIRLIVVNMKITGK 123
            IF    N  N ++G G++  P  +K  G V G+  ++  +     T  L+   +  T  
Sbjct: 227 TIF----NSINVLIGIGLLALPLGLKYAGWVIGLILLMTFAFGTFCTAELLSRCLD-TDP 281

Query: 124 T--TYQDSVEFAMGRKGKLLI--LLSNGLFAXXXXXXXXXXXXDTIPHVLRAFFPGHENL 179
           T  +Y D    A G KG+ LI  L +  L                    L A FP +   
Sbjct: 282 TLMSYADLGYAAFGTKGRALISCLFTTDLLGCGVSLIILFADS------LNALFPNYSVT 335

Query: 180 FHRNIIIILVTCFISFPLSLNRNIS 204
           F + +   +VT  +  PLS+  NIS
Sbjct: 336 FFKFVAFFIVTPPVFLPLSILSNIS 360

>TBLA0B07210 Chr2 (1705801..1707294) [1494 bp, 497 aa] {ON}
           Anc_2.295 YIL088C
          Length = 497

 Score = 36.6 bits (83), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 61/312 (19%), Positives = 119/312 (38%), Gaps = 42/312 (13%)

Query: 61  SKSNIFMAFMNMANSILGAGVIGQPFAIKNCGLVGGIFAVILLSVLVDWTIRLIVVNMKI 120
           + ++I  + +N+  +I+GAG++  PFA +N G++ GI   +L ++   + +         
Sbjct: 4   ATASIHSSIINLTKTIVGAGMLAIPFAFRNDGILVGILLTLLAAITSGFGL--------- 54

Query: 121 TGKTTYQDSVEFAMGRKGKLLILLSNG-LFAXXXXXXXXXXXXDTIPHVLRAF------- 172
                      F + +  K LI   N   F               I  +++ F       
Sbjct: 55  -----------FVLAKCSKTLINPRNSSFFQLTMIAFPNLSPLSDISMIVQCFGVGLSYI 103

Query: 173 ------FPGHENLFHRNIIIILVTCFISFPLSLNRNISKLSKASML---AXXXXXXXXXX 223
                 FP   N +      IL +  +  PL L + +  L  +S++   A          
Sbjct: 104 VLIGDLFPTIFNNYGSRNFYILTSTIVIVPLCLLKRLDHLKYSSIVGLFALSYLSFLIVF 163

Query: 224 XXXKGPMIDDAY----KGSFNTTELFFTPRIFQGISVISFALVCHHNTSFIYFSLKTPSL 279
              K  ++ +      +GS N   ++    +    ++I FA     N   I   L    +
Sbjct: 164 VFIKDIILTNNLPPFERGSINWVSIYDFNGLLSTFTIIIFAYTGSMNLFTIINELNYNDI 223

Query: 280 KRFDRLTHFSCFVAMIFCFLMGYTGFLVFKDRTKGNILNNFPGSDNV-VNVARFCFGFNM 338
                + + S  ++ I   ++   G+L F   T GNI+ N+  S+++ + + +   G  +
Sbjct: 224 DSIKIVINHSIAISTIIFLIISIFGYLTFGTLTLGNIMLNYNYSNSLYIILGKLALGIMV 283

Query: 339 LTTFPLEIFVLR 350
           + TFPL    LR
Sbjct: 284 ILTFPLLFHPLR 295

>KNAG0I01970 Chr9 complement(379931..382141) [2211 bp, 736 aa] {ON}
           Anc_2.177 YNL101W
          Length = 736

 Score = 36.6 bits (83), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 45/167 (26%), Positives = 70/167 (41%), Gaps = 11/167 (6%)

Query: 51  STTAFLRENRSKSNIFMAFMNMANSILGAGVIGQPFAIKNCGLVGGIFAVILLSVLVDWT 110
           S  A + E R  ++    F+ +  S +G GV+  P    N GL+  I  ++   V   W 
Sbjct: 306 SVKALVSEVRGTASTGKVFLLLLKSFIGTGVLFLPSGFANGGLLFSIAMLVFFGVYSYWC 365

Query: 111 IRLIVVNMKITGKTTYQDSVEFAMGRKGKLLILLSNGLFAXXXXXXXXXXXXDTIPHVLR 170
             +++ +   T   ++ D      G   K +IL +                  T  + L 
Sbjct: 366 YYILIESKIATKVKSFGDIGLKLYGPWLKFVILFA---IVSTQVGFSGAYMIFTAKN-LS 421

Query: 171 AFFPGHENLFHRNII----IILVTCFISFPLSLNRNISKLSKASMLA 213
           AF    EN+FH + I    I+L    +  PLS  RNISKLS  S++A
Sbjct: 422 AFV---ENVFHVSDINLPMIMLFQLVVYVPLSFVRNISKLSLPSLVA 465

>YJR001W Chr10 (436802..438610) [1809 bp, 602 aa] {ON}  AVT1Vacuolar
           transporter, imports large neutral amino acids into the
           vacuole; member of a family of seven S. cerevisiae genes
           (AVT1-7) related to vesicular GABA-glycine transporters
          Length = 602

 Score = 35.8 bits (81), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 51/218 (23%), Positives = 86/218 (39%), Gaps = 21/218 (9%)

Query: 1   MSKEAANEASIQEETFSDRDELLGSSFQLSS---------FDRNSQRN-SERLIDGSEDE 50
           M+    +  SIQ  T  D   +L  +  L+          F  N   +   + ++G + +
Sbjct: 140 MAIHDDDYGSIQNSTIGDSGSILRPTASLTEMMSGGAGRRFTNNDMDSIVVKRVEGVDGK 199

Query: 51  STTAFLRENRSKSNIFMAFMNMANSILGAGVIGQPFAIKNCGLVGGIFAVILLSVLVDWT 110
             T    ++ +   IF    N  N ++G G++  P  +K  G V G+  + + ++    T
Sbjct: 200 VVTLLAGQSTAPQTIF----NSINVLIGIGLLALPLGLKYAGWVIGLTMLAIFALATFCT 255

Query: 111 IRLIVVNMKITGKT--TYQDSVEFAMGRKGKLLILLSNGLFAXXXXXXXXXXXXDTIPHV 168
             L+   +  T  T  +Y D    A G KG+ LI     L              D+    
Sbjct: 256 AELLSRCLD-TDPTLISYADLGYAAFGTKGRALISALFTLDLLGSGVSLVILFGDS---- 310

Query: 169 LRAFFPGHENLFHRNIIIILVTCFISFPLSLNRNISKL 206
           L A FP +   F + +   +VT  +  PLS+  NIS L
Sbjct: 311 LNALFPQYSTTFFKIVSFFIVTPPVFIPLSVLSNISLL 348

>Smik_10.279 Chr10 (433747..435555) [1809 bp, 602 aa] {ON} YJR001W
           (REAL)
          Length = 602

 Score = 35.8 bits (81), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 48/216 (22%), Positives = 85/216 (39%), Gaps = 21/216 (9%)

Query: 1   MSKEAANEASIQEETFSDRDELLGSSFQL----------SSFDRNSQRNSERLIDGSEDE 50
           M+    +  SIQ  T  D   +L  +  L          S  + + +    + ++G + +
Sbjct: 140 MAIHDDDYGSIQNSTIEDSGSILRPTASLTEMMSGGAGRSCINNDMESIVVKRVEGVDGK 199

Query: 51  STTAFLRENRSKSNIFMAFMNMANSILGAGVIGQPFAIKNCGLVGGIFAVILLSVLVDWT 110
             T    ++ +   IF    N  N ++G G++  P  +K  G V G+  + + ++    T
Sbjct: 200 VVTLLAGQSTAPQTIF----NSINVLIGIGLLALPLGLKYAGWVLGLTMLAIFAIGTFCT 255

Query: 111 IRLIVVNMKITGKT--TYQDSVEFAMGRKGKLLILLSNGLFAXXXXXXXXXXXXDTIPHV 168
             L+   +  T  T  +Y D    A G KG+ LI     L              D+    
Sbjct: 256 AELLSRCLD-TDPTLISYADLGYAAFGSKGRALISALFTLDLLGSGVSLVILFGDS---- 310

Query: 169 LRAFFPGHENLFHRNIIIILVTCFISFPLSLNRNIS 204
           L A FP +   F + +   ++T  +  PLS+  NIS
Sbjct: 311 LNALFPQYSTTFFKIVSFFVITPPVFIPLSVLSNIS 346

>Skud_10.223 Chr10 (404376..406184) [1809 bp, 602 aa] {ON} YJR001W
           (REAL)
          Length = 602

 Score = 35.4 bits (80), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 48/216 (22%), Positives = 87/216 (40%), Gaps = 21/216 (9%)

Query: 1   MSKEAANEASIQEETFSDRDELLGSSFQLS---------SFDRNSQRN-SERLIDGSEDE 50
           M+    +  SIQ  T  D   +L  +  L+         S+  N   +   + ++G++ +
Sbjct: 140 MAIHDDDYGSIQNSTIGDSGSILRPTASLTEMMSGGAGRSYTNNDMESIVVKRVEGADGK 199

Query: 51  STTAFLRENRSKSNIFMAFMNMANSILGAGVIGQPFAIKNCGLVGGIFAVILLSVLVDWT 110
             T    ++ +   IF    N  N ++G G++  P  +K  G + G+  + + ++    T
Sbjct: 200 VVTLLAGQSTAPQTIF----NSINVLIGIGLLALPLGLKYAGWIFGLTMLTIFALGTFCT 255

Query: 111 IRLIVVNMKITGKT--TYQDSVEFAMGRKGKLLILLSNGLFAXXXXXXXXXXXXDTIPHV 168
             L+   +  T  T  +Y D    A G KG+ LI     L              D+    
Sbjct: 256 AELLSRCLD-TDPTLISYADLGYAAFGSKGRALISALFTLDLLGSGVSLVILFGDS---- 310

Query: 169 LRAFFPGHENLFHRNIIIILVTCFISFPLSLNRNIS 204
           L A FP +   F + +   ++T  +  PLS+  NIS
Sbjct: 311 LNALFPQYSTTFFKIVSFFVITPPVFIPLSVLSNIS 346

>KAFR0J01200 Chr10 (218990..220819) [1830 bp, 609 aa] {ON} Anc_5.220
           YJR001W
          Length = 609

 Score = 35.4 bits (80), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 53/223 (23%), Positives = 87/223 (39%), Gaps = 32/223 (14%)

Query: 4   EAANEASIQEETFSDRDELLGSSFQLSSFDRNSQRNSE----------------RLIDGS 47
           E+ +  SI    F ++  LL SS  ++   +N  R+                  + I+G 
Sbjct: 145 ESVDYGSIYSNNFENQ-SLLRSSISMAELAQNLTRDGYGGNVNAIAADTESIVLKRIEGK 203

Query: 48  EDESTTAFLRENRSKSNIFMAFMNMANSILGAGVIGQPFAIKNCGLVGGIFAVILLSVLV 107
           + +  T    ++ +   IF    N  N ++G G++  P  +   G V GI  + + +   
Sbjct: 204 DGKVVTLLAGQSTAPQTIF----NSINVLIGIGLLALPLGLNYAGWVLGILLLFIFASAT 259

Query: 108 DWTIRLIVVNMKITGKT--TYQDSVEFAMGRKGKLLI--LLSNGLFAXXXXXXXXXXXXD 163
             T  L+   +  T  T  +Y D    A G KG+ LI  L +  L A             
Sbjct: 260 FCTAELLSRCLD-TDPTLMSYADLGYAAFGTKGRALISTLFTVDLLAIGVSLIILFGDS- 317

Query: 164 TIPHVLRAFFPGHENLFHRNIIIILVTCFISFPLSLNRNISKL 206
                L A FP +   F + +   +VT  +  PLS+  NIS L
Sbjct: 318 -----LHALFPDYSLNFFKILGFFVVTPPVFLPLSVLSNISLL 355

>TBLA0C05630 Chr3 (1364052..1366280) [2229 bp, 742 aa] {ON}
           Anc_2.177 YNL101W
          Length = 742

 Score = 34.7 bits (78), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 68/318 (21%), Positives = 125/318 (39%), Gaps = 34/318 (10%)

Query: 56  LRENRSKSNIFMAFMNMANSILGAGVIGQPFAIKNCGLVGGIFAVILLSVLVDWTIRLIV 115
           L   + K++   AF  +  S +G G++  P A    GL+     +I+      +   L++
Sbjct: 346 LNRAKGKTSTKKAFFLLLKSFIGTGILFLPNAFSKGGLIFSNVLIIIFGFYSYYCYMLLI 405

Query: 116 VNMKITGKTTYQDSVEFAMGRK--GKLL--ILLSNGLFAXXXXXXXXXXXXDTIPHVLRA 171
              + +  +++ +     MG K  G L+  I+L + + +             T  +    
Sbjct: 406 KCKRYSQVSSFGE-----MGNKLYGPLMQKIILFSIMISQIGFSCAYIIFTSTNLNYFFQ 460

Query: 172 FFPGHENLFHRNIIIILVTCFISFPLSLNRNISKLSKASMLAXXXXXXXXXXXX---XKG 228
            +P  E L     +I  +  FI  PLS  RNISKLS  S++A                K 
Sbjct: 461 QYPLTEKLDFNFFLIFQLILFI--PLSFVRNISKLSVPSLVANLMIIIGLMIVIYYCVKQ 518

Query: 229 PMIDDAYKGSFNTTELFFTPR---IFQGISVISFALVCHHNTSFIYFSLKTPSLKRFDRL 285
             +D  +  + N  E+FF  +   IF G ++ +F  +           L  P  +   + 
Sbjct: 519 FTVDMGFHMA-NGVEIFFNRQDWSIFVGTAIFAFEGI----------GLLIPIEESMAKP 567

Query: 286 THFSCFVA-MIFC-----FLMGYTGFLVFKDRTKGNILNNFPGSDNVVNVARFCFGFNML 339
             F   +  +I C      L+G  G++ + +     IL N P     V   +  +   ++
Sbjct: 568 EEFGKVLGGVIGCVTSLFILIGSMGYVTYGEDINTVILINLPNDKVTVQSIQLLYSIAIM 627

Query: 340 TTFPLEIFVLRDVIRDFM 357
            + PL+IF    +I +F+
Sbjct: 628 LSIPLQIFPAIKIIENFI 645

>NDAI0F02660 Chr6 complement(649723..651855) [2133 bp, 710 aa] {ON}
           Anc_2.177
          Length = 710

 Score = 34.7 bits (78), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 44/204 (21%), Positives = 80/204 (39%), Gaps = 15/204 (7%)

Query: 10  SIQEETFSDRDELLGSSFQLSSFDRNSQRNSERLIDGSEDESTTAFLRENRSKSNIFMAF 69
           S +++   D +E L S+ + +    +  R S+  I  +   ++TA              F
Sbjct: 252 SFEDDFLQDDNEYLLSTTERTPLLPSQSRLSKAAIHSARGTTSTA------------KTF 299

Query: 70  MNMANSILGAGVIGQPFAIKNCGLVGGIFAVILLSVLVDWTIRLIVVNMKITGKTTYQDS 129
           + +  S +G G++  P A  N GL+  I  +    +   W   ++      TG++++ D 
Sbjct: 300 LLLLKSFMGTGILFLPAAFHNGGLLFSIIMLFFFGIYSYWCYYILTKAKVATGQSSFGDI 359

Query: 130 VEFAMGRKGKLLILLSNGLFAXXXXXXXXXXXXDTIPHVLRAFFPGHENLFHRNIIIILV 189
                G   K +IL S  L                +    + FF   +  F   I ++  
Sbjct: 360 GLKLYGPSMKFIILFSLVLTQLGFSAAYMIFTAKNLNAFCQNFFLLEDINF---IYLMGF 416

Query: 190 TCFISFPLSLNRNISKLSKASMLA 213
             F S    L+R +SKLS  S++A
Sbjct: 417 QLFFSSHYHLSRKVSKLSLPSLIA 440

>ZYRO0B10032g Chr2 complement(783526..785355) [1830 bp, 609 aa] {ON}
           similar to uniprot|P47082 Saccharomyces cerevisiae
           YJR001W AVT1 Vacuolar transporter imports large neutral
           amino acids into the vacuole member of a family of seven
           S. cerevisiae genes (AVT1-7) related to vesicular GABA-
           glycine transporters
          Length = 609

 Score = 34.3 bits (77), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 43/174 (24%), Positives = 73/174 (41%), Gaps = 11/174 (6%)

Query: 42  RLIDGSEDESTTAFLRENRSKSNIFMAFMNMANSILGAGVIGQPFAIKNCGLVGGIFAVI 101
           R ++G + E  T    ++     IF    N  N ++G G++  P  +KN G + G+  + 
Sbjct: 198 RKVEGKDGEVVTVLAGKSTGPQTIF----NSVNILIGIGLLALPLGLKNAGWIPGLCLLC 253

Query: 102 LLSVLVDWTIRLIVVNMKITGKT--TYQDSVEFAMGRKGKLLILLSNGLFAXXXXXXXXX 159
           +L++    +  L+   +  T  T  +Y D    A G KG++LI     L           
Sbjct: 254 ILALATFCSAELLSRCLD-TDPTLMSYADLGYAAYGSKGRILISCLFTLDLLGSGVSLII 312

Query: 160 XXXDTIPHVLRAFFPGHENLFHRNIIIILVTCFISFPLSLNRNISKLSKASMLA 213
              D+    L A  P + + F + +    VT  +  PLS+  NIS L   S + 
Sbjct: 313 LFGDS----LNALIPKYSSNFFKVLGFFAVTPGVFIPLSILSNISLLGITSTIG 362

>TDEL0E04090 Chr5 complement(761896..763797) [1902 bp, 633 aa] {ON}
           Anc_5.220 YJR001W
          Length = 633

 Score = 34.3 bits (77), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 45/174 (25%), Positives = 72/174 (41%), Gaps = 11/174 (6%)

Query: 42  RLIDGSEDESTTAFLRENRSKSNIFMAFMNMANSILGAGVIGQPFAIKNCGLVGGIFAVI 101
           + I+G +    T    ++ +   IF    N  N ++G G+   P  +K  G V G+  ++
Sbjct: 190 KQIEGKDGAVVTVLAGQSTAPQTIF----NSINVLIGIGLFALPLGLKYAGWVFGLLLLL 245

Query: 102 LLSVLVDWTIRLIVVNMKITGKT--TYQDSVEFAMGRKGKLLILLSNGLFAXXXXXXXXX 159
           +L+     T  L+   +  T  T  +Y D    A GR+G+ LI     L           
Sbjct: 246 VLACGTFCTAELLSRCLD-TDPTMMSYADLGYAAYGRRGRALISCLFTLDLLGSGVSLII 304

Query: 160 XXXDTIPHVLRAFFPGHENLFHRNIIIILVTCFISFPLSLNRNISKLSKASMLA 213
              D+    L A FP H + F + +    VT  I  PL++  NIS L   S + 
Sbjct: 305 LFGDS----LNALFPSHSSNFFKVLSFFAVTPAIFIPLNILSNISFLGIMSTIG 354

>CAGL0B04455g Chr2 (435437..437254) [1818 bp, 605 aa] {ON} some
           similarities with uniprot|P50944 Saccharomyces
           cerevisiae YNL101w or uniprot|P36062 Saccharomyces
           cerevisiae YKL146w
          Length = 605

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 55/220 (25%), Positives = 88/220 (40%), Gaps = 18/220 (8%)

Query: 1   MSKEAANEASIQEETFSDRDELLGSSFQ-LSSFDRNSQRNSERLIDGSEDESTTAFLREN 59
           M K A N++  Q  +F+     L S F  +S+  R + R S   I   +D  T +   + 
Sbjct: 90  MEKMALNKS--QLLSFNQDYLHLYSHFAGISASPRTTSRCSS--IIKYDDNDTCSIGEDV 145

Query: 60  RSKSNI--FMAFMNMANSILGAGVIGQPFAIKNCGLVGGIFAVILLSVLVDWTIRLIVVN 117
             K  I  F A++ +  S +G GV+  P A KN G++  I   I + +   W   ++ V 
Sbjct: 146 IVKGGISNFKAYILLLKSFVGTGVLLLPNAFKNGGMLFSIILFIFIGIYSFWCYYILSVV 205

Query: 118 MKITGKTTYQDSVEFAMGRKGKLLILLSNGLFAXXXXXXXXXXXXDTIPHVLRAFFPGHE 177
              T  + + +  +   G   K++IL S                   I  V     P  E
Sbjct: 206 KVSTKLSCFGEIGKRIYGTPMKVVILFS-------LILTQLGFASTGIIFVANNMKPSLE 258

Query: 178 NLFHRNII----IILVTCFISFPLSLNRNISKLSKASMLA 213
            LFH   I    +I     +  PL L  +I K S  +M++
Sbjct: 259 ALFHWKDIKYFYLIFCQLILYIPLGLITDIKKFSITTMVS 298

>SAKL0G12452g Chr7 complement(1058250..1060058) [1809 bp, 602 aa]
           {ON} similar to uniprot|P47082 Saccharomyces cerevisiae
           YJR001W AVT1 Vacuolar transporter imports large neutral
           amino acids into the vacuole member of a family of seven
           S. cerevisiae genes (AVT1-7) related to vesicular GABA-
           glycine transporters
          Length = 602

 Score = 32.7 bits (73), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 50/213 (23%), Positives = 81/213 (38%), Gaps = 33/213 (15%)

Query: 16  FSDRDELLGSSFQLSSFDRNSQRNSERLI----DGSEDESTTAFLRENRSKSNIFMAFMN 71
            S +  LL  +     F+  +  ++  +I    +  + ++ T    ++ +   IF    N
Sbjct: 162 LSTQQSLLRPTVSFQDFNAATDLDTHSIIVKQVETKDGKTVTVLAGQSTAPQTIF----N 217

Query: 72  MANSILGAGVIGQPFAIKNCGLVGGI-------FAVI----LLSVLVDWTIRLIVVNMKI 120
             N ++G G++  P  +K  G V G+       FA      LLS  +D    LI      
Sbjct: 218 SINVLIGIGLLALPLGMKYAGWVLGVPMLLTFAFATFCSAELLSRCLDTDPTLI------ 271

Query: 121 TGKTTYQDSVEFAMGRKGKLLILLSNGLFAXXXXXXXXXXXXDTIPHVLRAFFPGHENLF 180
               +Y D    A G KG+  I     L              D+    L A FP +   F
Sbjct: 272 ----SYGDLGYAAFGPKGRAFISFLFALDLLGSGVALIILFGDS----LNALFPQYSVTF 323

Query: 181 HRNIIIILVTCFISFPLSLNRNISKLSKASMLA 213
            + I   +VT  I  PLS+  N+S L   S ++
Sbjct: 324 FKIIGFFVVTPQIFMPLSILSNVSLLGIISTIS 356

>ACR051C Chr3 complement(448844..450880) [2037 bp, 678 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YKL146W
          Length = 678

 Score = 32.7 bits (73), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 52/280 (18%), Positives = 108/280 (38%), Gaps = 12/280 (4%)

Query: 185 IIILVTCFISFPLSLNRNISKLSKASMLAXXXXXXXXXXXXXKGPMIDDAYKGSFNTTEL 244
           + +     +  PL+L R I+KLS  ++LA                       G+   + L
Sbjct: 403 VYVAAQAAVYLPLALTRRITKLSATALLADLFILLGLVYVYYFSAS-QVVQHGAATDSML 461

Query: 245 FFTPR---IFQGISVISFALVCHHNTSFIYFSLKTPSLKRFDRLTHFSCFVAMIFCFL-M 300
            F P    +F G ++ ++  V       I  S+++P  ++F R   +   VA+   F+  
Sbjct: 462 AFNPSSWTVFLGTAIFTYEGVGLLIP--IQESMRSP--EKFRRCLLW-VMVAVTAVFISF 516

Query: 301 GYTGFLVFKDRTKGNILNNFPGSDNVVNVARFCFGFNMLTTFPLEIFVLRDVIRDFMFFN 360
           G   +  F  + +  IL NFP    +    +  +   ++ + PL++F    ++ + +   
Sbjct: 517 GMLCYAAFGAKVETVILLNFPQDSALGTGVQLLYAAAIMLSTPLQLFPAIRILENVVVTT 576

Query: 361 SKDTNQSQELSLKLHXXXXXXXXXXXXXXXXXXCNLGALFELTGATTASLMAYILPPSVN 420
           S+    S ++    +                   +L     L G+     + Y+ PP ++
Sbjct: 577 SRSGKYSTKVKWIKNWFRALVVVLMLVLASLGSNDLDKFVSLIGSFACIPLIYVYPPLLH 636

Query: 421 LLLIGKRSTVREK--LPHYACIIFGFTIMVVSSSQTIIAY 458
            ++     TV +       A + FG  IM  ++ QT++ +
Sbjct: 637 YVVFRGTGTVSQVALALDLAVMAFGLGIMGYTTVQTVVQW 676

>NCAS0D02870 Chr4 complement(545123..546952) [1830 bp, 609 aa] {ON}
           Anc_5.220 YJR001W
          Length = 609

 Score = 32.7 bits (73), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 47/192 (24%), Positives = 75/192 (39%), Gaps = 19/192 (9%)

Query: 30  SSFDRNSQRNSERL----IDGSEDESTTAFLRENRSKSNIFMAFMNMANSILGAGVIGQP 85
           ++FD +S    E +    I+G +    T    ++     IF    N  N ++G G++  P
Sbjct: 182 ANFDISSITGVESITLKQIEGKDGNVVTLIAGQSTGPQTIF----NSINVLIGIGLLALP 237

Query: 86  FAIKNCGLVGGIFAVILLSVLVDWTIRLIVVNMKITGKT--TYQDSVEFAMGRKGKLLI- 142
             +K  G V G+  ++  +     T  L+   +  T  T  +Y D    A G KG+ LI 
Sbjct: 238 LGLKYAGWVIGLPLLMTFAFGTFCTAELLSRCLD-TDPTLMSYADLGYAAFGSKGRALIS 296

Query: 143 -LLSNGLFAXXXXXXXXXXXXDTIPHVLRAFFPGHENLFHRNIIIILVTCFISFPLSLNR 201
            L +  L                    L A FP +   F + +   +VT  +  PLS   
Sbjct: 297 CLFTTDLLGCGVSLIILFGDS------LNALFPAYSVTFFKIVAFFIVTPPVFMPLSFLS 350

Query: 202 NISKLSKASMLA 213
           NIS L   S + 
Sbjct: 351 NISLLGILSTIG 362

>CAGL0D03036g Chr4 complement(314724..316592) [1869 bp, 622 aa] {ON}
           similar to uniprot|P47082 Saccharomyces cerevisiae
           YJR001w
          Length = 622

 Score = 32.0 bits (71), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 50/206 (24%), Positives = 83/206 (40%), Gaps = 30/206 (14%)

Query: 11  IQEETFSDRDELLGSSFQLSSFDRNSQRNSE-RLIDGSEDESTTAFLRENRSKSNIFMAF 69
           I   T S  + L GS+     FD N   +   + ++G +    T    ++ +   IF   
Sbjct: 181 ILRPTLSMNEMLTGST----PFDTNDVDSMVIKQVEGKDGTVVTLLAGQSTAPQTIF--- 233

Query: 70  MNMANSILGAGVIGQPFAIKNCGLVGGIFAVILLSVLVDWTIRLIVVNMKITGKT--TYQ 127
            N  N ++G G++  P  +K  G + G+  + + +     T  L+   +  T  T  +Y 
Sbjct: 234 -NSINVLIGIGLLALPLGMKYAGWIPGLIMLSIFAFGTFCTAELLSRCLD-TDPTLISYA 291

Query: 128 DSVEFAMGRKGKLLI-------LLSNGLFAXXXXXXXXXXXXDTIPHVLRAFFPGHENLF 180
           D    A G +G+  I       LLS G+              D+    L A FP +   F
Sbjct: 292 DLGYAAFGSRGRAFISALFTVDLLSCGV-------SLVILFGDS----LNALFPQYSVTF 340

Query: 181 HRNIIIILVTCFISFPLSLNRNISKL 206
            + +   +VT  +  PLS+  NIS L
Sbjct: 341 FKIVCFFVVTPPVFIPLSILSNISLL 366

>Ecym_3335 Chr3 complement(639655..641079) [1425 bp, 474 aa] {ON}
           similar to Ashbya gossypii ADL205C
          Length = 474

 Score = 32.0 bits (71), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 51/288 (17%), Positives = 108/288 (37%), Gaps = 14/288 (4%)

Query: 63  SNIFMAFMNMANSILGAGVIGQPFAIKNCGLVGGIFAVILLSVLVDWTIRLIVVNMKITG 122
           + ++ + +N+  +I+GAG++  P+A +  G+   I  ++  ++   + + L+ ++ K   
Sbjct: 5   ATVYSSTVNLVKTIVGAGLLAIPYAFRADGVTVAIILLLFAAITSGFGLYLLSLSSKALL 64

Query: 123 KTTYQDSVEFAMGRKGKLLILLSNGLFAXXXXXXXXXXXXDTIPHVLRAFFPGHENLFHR 182
                           KL  L    +F               +  +  +   G  N +  
Sbjct: 65  NPRQSSFFTLCSVTYPKLSFLFDFAMFIQCYGVGLSYLVL--VGDLFSSLLGGRRNWWIL 122

Query: 183 NIIIILVTCFISFPLSLNRNISKLSKAS---MLAXXXXXXXXXXXXXKGPMIDDAY---K 236
              II+V      PL+  R +  L  +S   +L+             +G M  + Y   +
Sbjct: 123 GSTIIVV------PLAHLRQLDSLKYSSLVGLLSITYLVLLVTGTFLQGVMFGNKYVEHR 176

Query: 237 GSFNTTELFFTPRIFQGISVISFALVCHHNTSFIYFSLKTPSLKRFDRLTHFSCFVAMIF 296
           G  +   +     +    S+I  A     N   +   LK  S     R+ ++S  ++ + 
Sbjct: 177 GDVSWLHIHSVGELVSTFSIIILAYTGSMNMFSVINELKDNSTANAKRVVYYSVGISTLI 236

Query: 297 CFLMGYTGFLVFKDRTKGNILNNFPGSDNVVNVARFCFGFNMLTTFPL 344
              +G  G+L F +    N++ N+  S     +  F  G  ++ +FPL
Sbjct: 237 FLSVGLGGYLTFGNNVLTNVILNYDESAITTRIGTFSLGTMVILSFPL 284

>KLTH0G07502g Chr7 (608628..610433) [1806 bp, 601 aa] {ON} similar
           to uniprot|P36062 Saccharomyces cerevisiae YKL146W AVT3
           Vacuolar transporter exports large neutral amino acids
           from the vacuole member of a family of seven S.
           cerevisiae genes (AVT1-7) related to vesicular GABA-
           glycine transporters
          Length = 601

 Score = 32.0 bits (71), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 78/336 (23%), Positives = 127/336 (37%), Gaps = 48/336 (14%)

Query: 48  EDESTTAFLRENRS--------KSNIFMAFMNMANSILGAGVIGQPFAIKNCGLVGGIFA 99
           EDE T    R  R         KS+ F A + +  S +G GV+  P A  N G       
Sbjct: 186 EDEETALVGRRARHRISHRQPHKSSTFKAVLLLLKSFVGTGVLFLPRAFHNGGWAFSTTC 245

Query: 100 VILLSVLVDWTIRLIVVNMKITGKTT-YQDSVEFAMGRKGKLLILLSNGLFAXXXXXXXX 158
           ++   V + +   ++++N K+      Y D      GR  +L IL S  L          
Sbjct: 246 LLACGV-ISYYCFVLLINTKLKKNVNGYGDLGAAVYGRNMELAILGSIVLSQIGFVAAYA 304

Query: 159 XXXXDTIPHVLRAFFPGHENLFHRN---IIIILVTCFISFPLSLNRNISKLSKASMLA-- 213
                     L+ FF    ++FH     +  + V   +  PLSL RNI+KLS  ++LA  
Sbjct: 305 VFTATN----LQVFF---SSVFHWEASMVFWLAVQLLLYLPLSLTRNIAKLSGTALLADL 357

Query: 214 ------XXXXXXXXXXXXXKGPMIDDAYKGSFNTTELFFTPRIF--QGISVISFALVCHH 265
                               G   D     + N   LF    IF  +GI ++        
Sbjct: 358 FIMFGLLYVYYYCSRYVAHNGVASDSMLVFNKNDWTLFIGTAIFTYEGIGLL-------- 409

Query: 266 NTSFIYFSLKTPSLKRFDRL---THFSCFVAMIFCFLMGYTGFLVFKDRTKGNILNNFPG 322
               I  S+K P  ++F++       S  +A I C L+ Y+    F    +  IL NFP 
Sbjct: 410 --IPIQESMKHP--EKFNKCLLGVMVSVSIAFILCGLLCYSA---FGSSVETVILLNFPR 462

Query: 323 SDNVVNVARFCFGFNMLTTFPLEIFVLRDVIRDFMF 358
              +    +  +   ++ + PL++F +  ++   +F
Sbjct: 463 KSAMTASVQLLYALAIMLSTPLQLFPIIRILETSIF 498

>Suva_12.83 Chr12 (119404..121215) [1812 bp, 603 aa] {ON} YJR001W
           (REAL)
          Length = 603

 Score = 30.8 bits (68), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 53/227 (23%), Positives = 83/227 (36%), Gaps = 39/227 (17%)

Query: 1   MSKEAANEASIQEETFSDRDELLGSSFQLSSF-----DRNSQRNSE-----RLIDGSEDE 50
           M+    +  SIQ     D   +L  +  L+        RN   N       + ++G + +
Sbjct: 141 MAIHDDDYGSIQNSMIGDSASILRPTASLTEMMSGGAGRNYANNDMESIVVKRVEGIDGK 200

Query: 51  STTAFLRENRSKSNIFMAFMNMANSILGAGVIGQPFAIKNCGLVGG-----IFAV----- 100
             T    ++     IF    N  N ++G G++  P  ++  G V G     IFA+     
Sbjct: 201 VVTLLAGQSTGPQTIF----NSINVLIGIGLLALPLGLRYAGWVLGFTLLSIFALGTFCT 256

Query: 101 -ILLSVLVDWTIRLIVVNMKITGKTTYQDSVEFAMGRKGKLLILLSNGLFAXXXXXXXXX 159
             LLS  +D    LI          +Y D    A G KG+ LI     L           
Sbjct: 257 AELLSRCLDTDPTLI----------SYADLGYAAFGSKGRALISALFTLDLLGSGVSLVI 306

Query: 160 XXXDTIPHVLRAFFPGHENLFHRNIIIILVTCFISFPLSLNRNISKL 206
              D+    L A FP +   F + +    +T  +  PLS+  N+S L
Sbjct: 307 LFGDS----LNALFPQYSTTFFKIVSFFFITPPVFIPLSVLSNVSLL 349

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.327    0.140    0.411 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 40,803,363
Number of extensions: 1554632
Number of successful extensions: 5399
Number of sequences better than 10.0: 126
Number of HSP's gapped: 5418
Number of HSP's successfully gapped: 165
Length of query: 469
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 356
Effective length of database: 40,524,141
Effective search space: 14426594196
Effective search space used: 14426594196
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 68 (30.8 bits)