Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_33.132251.52ON96496441630.0
KLTH0F01672g1.52ON116496029000.0
KAFR0D041001.52ON111797616290.0
NCAS0B086001.52ON111797116170.0
Suva_2.6871.52ON112896415850.0
Skud_4.7831.52ON113596815560.0
TPHA0E036401.52ON113797814800.0
YDR507C (GIN4)1.52ON114275814281e-180
Smik_4.7891.52ON113679414051e-177
SAKL0C01716g1.52ON121539112731e-156
TDEL0C064901.52ON115337511631e-141
KLLA0C01650g1.52ON111237211531e-140
Kpol_2002.461.52ON112338211251e-136
ZYRO0F17402g1.52ON118937411131e-133
AFR696C1.52ON114236910931e-131
KNAG0F002901.52ON112537510551e-126
Ecym_10581.52ON116436910561e-125
NDAI0A006601.52ON102237610241e-122
CAGL0K05709g1.52ON110337110231e-121
TBLA0A071501.52ON13913239241e-105
Skud_3.391.52ON10173718246e-94
Suva_3.1901.52ON10243717842e-88
Smik_3.541.52ON10323727525e-84
YCL024W (KCC4)1.52ON10371676265e-67
TDEL0A025502.479ON13691794251e-41
Smik_11.1392.479ON15341764232e-41
YKL101W (HSL1)2.479ON15181764223e-41
Skud_11.1262.479ON15181764161e-40
Ecym_73922.479ON14341604133e-40
Suva_11.1232.479ON15261764125e-40
KNAG0A065402.479ON14321864053e-39
ZYRO0G03366g2.479ON16161764027e-39
NCAS0A057702.479ON14611823955e-38
TBLA0I011502.479ON17451793912e-37
KLLA0F13552g2.479ON12671863902e-37
SAKL0E02860g2.479ON13771593883e-37
NDAI0D027502.479ON15151693866e-37
ABL034W2.479ON14251613857e-37
KLTH0D05566g2.479ON11281743784e-36
KAFR0D032002.479ON14481713732e-35
Kpol_431.92.479ON15522423705e-35
Kwal_26.77882.479ON12671743695e-35
CAGL0K08514g2.479ON14891713581e-33
TPHA0G032002.479ON15341833293e-30
CAGL0M02299g8.668ON893921997e-15
TBLA0B038608.668ON988911962e-14
KNAG0J015908.654ON8051211917e-14
NDAI0E023908.668ON8831761891e-13
NDAI0B020708.279ON1258861891e-13
NDAI0E023208.654ON932921872e-13
TBLA0B004906.31ON7871251853e-13
CAGL0M02519g8.654ON756921853e-13
Kwal_56.237178.279ON858931844e-13
CAGL0M11396g8.279ON1192861844e-13
TPHA0G017108.654ON805891836e-13
ZYRO0F06842g8.654ON843921801e-12
NDAI0E012908.654ON729951801e-12
KLTH0G13288g8.279ON1142931792e-12
SAKL0H06754g8.668ON884881782e-12
TDEL0A061408.668ON861881772e-12
TBLA0B039708.654ON1208891783e-12
KAFR0H025408.654ON8171181773e-12
YPL150W8.668ON9011011773e-12
Kwal_56.224766.31ON697991763e-12
SAKL0H16632g8.279ON1062861764e-12
Smik_6.3478.668ON917891764e-12
NCAS0B050908.279ON1210911765e-12
CAGL0F00649g1.390ON514871735e-12
KNAG0G021108.279ON1192861747e-12
ACR133C8.668ON851891737e-12
Ecym_42918.279ON1145861748e-12
NCAS0D021006.31ON726771738e-12
Suva_16.1698.654ON858951738e-12
Smik_4.3678.279ON1066811731e-11
AGR058W8.279ON1071861731e-11
Kwal_26.87098.654ON829921721e-11
KAFR0B028008.279ON1095841721e-11
NCAS0C015908.654ON864921721e-11
KNAG0J016708.668ON1009871721e-11
TPHA0D011408.654ON622911711e-11
YPL141C (FRK1)8.654ON865951711e-11
TPHA0J004206.31ON7071211711e-11
CAGL0M08910g5.611ON612791701e-11
Suva_2.2838.279ON1089811711e-11
YDR122W (KIN1)8.279ON1064811711e-11
Smik_12.1558.279ON1162861712e-11
Skud_4.3838.279ON1065811712e-11
KLLA0F11319g8.668ON8431081702e-11
NCAS0C016708.668ON896881702e-11
ZYRO0F07194g8.668ON9381011702e-11
TPHA0J008208.279ON1218861702e-11
TDEL0A060008.654ON790921692e-11
Kpol_1072.298.654ON893901692e-11
TBLA0C046008.279ON1315811703e-11
KLLA0F19536g8.279ON1104861693e-11
Skud_16.1408.654ON865921683e-11
Skud_12.1648.279ON1160861693e-11
Skud_16.1328.668ON924891683e-11
KLTH0D10714g8.654ON872921684e-11
NDAI0J012508.279ON11761011675e-11
YLR096W (KIN2)8.279ON1147861675e-11
TDEL0F040608.279ON1126811666e-11
KAFR0A037308.654ON788951657e-11
Smik_6.3398.654ON865901657e-11
TPHA0C004705.611ON631841647e-11
Suva_2.6515.611ON633791647e-11
Smik_4.7545.611ON632791648e-11
Suva_16.1608.668ON9181031658e-11
Kpol_1012.68.654ON628921649e-11
YDR477W (SNF1)5.611ON633791649e-11
Skud_4.7515.611ON634791631e-10
TBLA0C017508.654ON981901641e-10
CAGL0J03872g8.654ON661921631e-10
Ecym_24058.668ON855911631e-10
Kpol_1018.655.611ON601791621e-10
Suva_10.1808.279ON1159861631e-10
Kpol_1066.468.279ON1225811641e-10
NCAS0B014708.654ON727891631e-10
KLTH0D11044g8.668ON849841631e-10
KAFR0C058605.611ON644791621e-10
Skud_7.1141.390ON5021131612e-10
SAKL0H07084g8.654ON919921622e-10
ZYRO0D06776g8.279ON1204811622e-10
Smik_7.1151.390ON5071211602e-10
KLTH0C10912g6.31ON697791612e-10
Kwal_26.87518.668ON848881612e-10
KNAG0H031408.279ON936911612e-10
YGL158W (RCK1)1.390ON5121131592e-10
Smik_15.4178.654ON806901603e-10
KNAG0B032305.611ON641841594e-10
Suva_13.1636.31ON7051211594e-10
NCAS0A080805.611ON623791576e-10
TPHA0D028405.611ON634781576e-10
Kpol_495.145.611ON624791567e-10
NCAS0B037408.279ON1049811577e-10
Kpol_1037.206.31ON7041111567e-10
KNAG0D010906.222ON3721101538e-10
TBLA0E033605.611ON654791568e-10
Ecym_83398.654ON920921569e-10
ACR119W8.654ON931921551e-09
Kpol_1072.198.668ON896881551e-09
Smik_13.1596.31ON7051211541e-09
Ecym_55885.611ON6131501541e-09
Skud_15.3998.654ON807911541e-09
CAGL0B01925g8.279ON944861542e-09
TPHA0G016308.668ON871881532e-09
SAKL0G06952g5.611ON599791522e-09
YMR001C (CDC5)6.31ON7051211522e-09
Suva_8.2848.654ON808911522e-09
TPHA0F024306.31ON798791523e-09
KLTH0G05698g5.611ON5971451513e-09
Kwal_47.182335.611ON598791513e-09
KAFR0G026906.31ON713931513e-09
TDEL0A047805.611ON621791503e-09
KNAG0A030408.654ON644881503e-09
NCAS0C037708.34ON1598941514e-09
KNAG0E008506.31ON7111131504e-09
CAGL0K10604g1.374ON446911476e-09
Kpol_487.141.390ON624921487e-09
AEL230W5.611ON6081511477e-09
KLLA0A03806g5.611ON602791478e-09
Skud_13.1546.31ON7051211488e-09
NCAS0A088801.374ON422841459e-09
NDAI0H034601.390ON625871461e-08
Ecym_30356.31ON7401201471e-08
YOR233W (KIN4)8.654ON800911471e-08
ACL006W6.31ON7081201461e-08
KNAG0I014801.374ON440841441e-08
CAGL0F04741g1.374ON4421101432e-08
SAKL0E01584g6.31ON6951211442e-08
ZYRO0C07480g6.31ON7741271442e-08
CAGL0J11638g6.31ON746791442e-08
TDEL0G043806.31ON722791442e-08
NDAI0H009405.611ON685981433e-08
KLTH0A06776g6.341ON1523791443e-08
KLLA0F12188g1.390ON546901414e-08
Kwal_56.240916.222ON381791395e-08
KLLA0C06138g6.31ON7081211415e-08
NDAI0C026806.31ON750701406e-08
TPHA0O006701.390ON585921406e-08
ZYRO0A05544g5.611ON631791407e-08
Kpol_1018.545.591ON834811398e-08
TDEL0B061601.390ON551941381e-07
KLTH0H03982g6.222ON398791361e-07
NDAI0G031108.34ON1707901391e-07
Kpol_1023.266.31ON739791362e-07
TPHA0N003707.41ON450871352e-07
NCAS0A087701.390ON569951352e-07
Ecym_13131.390ON299851332e-07
NDAI0G053001.374ON437841352e-07
KNAG0F029006.31ON649861352e-07
YFL033C (RIM15)8.34ON1770901362e-07
KLLA0D07348g8.654ON909911362e-07
Skud_12.3291.390ON610911352e-07
KLLA0F11143g8.676ON813801353e-07
AFL101C6.222ON367861333e-07
Kwal_26.87968.676ON796811343e-07
Smik_6.3508.676ON822841343e-07
Suva_16.976.222ON368771323e-07
Suva_16.1578.676ON832891343e-07
Suva_10.3451.390ON609911334e-07
AAL029W1.390ON534851334e-07
TBLA0D044201.390ON680981334e-07
Kwal_0.1551.390ON587911324e-07
Kpol_1069.131.374ON427861325e-07
KNAG0E032008.34ON15271241335e-07
CAGL0B03509g1.390ON597871325e-07
Kwal_14.11598.34ON1521891336e-07
KLTH0H11858g1.390ON565911316e-07
TBLA0A020506.222ON4341061306e-07
ACR142W8.676ON837861327e-07
CAGL0K12562g8.34ON1682921327e-07
Skud_15.1441.374ON449841308e-07
KAFR0B054108.279ON539811308e-07
KAFR0H024308.676ON784811318e-07
TDEL0A062208.676ON794811309e-07
Skud_16.1298.676ON827841301e-06
KLTH0H11396g1.374ON437861281e-06
KNAG0C018201.336ON5901031291e-06
NCAS0D047106.371ON804871301e-06
CAGL0M02233g8.676ON767921291e-06
Ecym_23978.676ON872801291e-06
SAKL0A04246g6.222ON400791281e-06
YPL209C (IPL1)6.222ON367771271e-06
Kwal_23.63256.341ON1542791301e-06
SAKL0D07656g1.374ON4321361271e-06
Smik_6.468.34ON17601071291e-06
TBLA0F008603.162ON980871291e-06
TPHA0O011201.374ON429841272e-06
NDAI0G061501.225ON795911282e-06
NCAS0B044906.222ON349771262e-06
TPHA0E028206.222ON384791262e-06
KLTH0D11242g8.676ON795811282e-06
KNAG0I013601.390ON614951272e-06
Skud_6.388.34ON17581071282e-06
KLTH0G18612g8.34ON1524891282e-06
YPL153C (RAD53)8.676ON821841272e-06
Suva_15.1551.374ON4521101262e-06
KAFR0C035208.34ON1450881282e-06
TDEL0B063201.374ON444941262e-06
SAKL0D08294g1.390ON503921262e-06
KLTH0D06006g2.496ON954851272e-06
ACR218W8.34ON1569891272e-06
Ecym_12751.374ON451801253e-06
Smik_6.4146.222ON367771243e-06
ZYRO0D04752g7.41ON489881253e-06
Skud_16.706.222ON367771243e-06
Skud_6.891.374ON446861253e-06
Smik_12.3211.390ON610911263e-06
Ecym_63011.330ON358901243e-06
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_33.13225
         (964 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_33.13225 s33 (127676..130570) [2895 bp, 964 aa] {ON} YFR016...  1608   0.0  
KLTH0F01672g Chr6 (127277..130771) [3495 bp, 1164 aa] {ON} simil...  1121   0.0  
KAFR0D04100 Chr4 complement(809681..813034) [3354 bp, 1117 aa] {...   632   0.0  
NCAS0B08600 Chr2 (1649375..1652728) [3354 bp, 1117 aa] {ON} Anc_...   627   0.0  
Suva_2.687 Chr2 complement(1215095..1218481) [3387 bp, 1128 aa] ...   615   0.0  
Skud_4.783 Chr4 complement(1382552..1385959) [3408 bp, 1135 aa] ...   603   0.0  
TPHA0E03640 Chr5 complement(769962..773375) [3414 bp, 1137 aa] {...   574   0.0  
YDR507C Chr4 complement(1462358..1465786) [3429 bp, 1142 aa] {ON...   554   e-180
Smik_4.789 Chr4 complement(1385209..1388619) [3411 bp, 1136 aa] ...   545   e-177
SAKL0C01716g Chr3 (143880..147527) [3648 bp, 1215 aa] {ON} simil...   494   e-156
TDEL0C06490 Chr3 complement(1191461..1194922) [3462 bp, 1153 aa]...   452   e-141
KLLA0C01650g Chr3 (128119..131457) [3339 bp, 1112 aa] {ON} simil...   448   e-140
Kpol_2002.46 s2002 (95107..98478) [3372 bp, 1123 aa] {ON} (95107...   437   e-136
ZYRO0F17402g Chr6 complement(1445685..1449254) [3570 bp, 1189 aa...   433   e-133
AFR696C Chr6 complement(1722130..1725558) [3429 bp, 1142 aa] {ON...   425   e-131
KNAG0F00290 Chr6 (31750..35127) [3378 bp, 1125 aa] {ON} Anc_1.52...   410   e-126
Ecym_1058 Chr1 (105835..109329) [3495 bp, 1164 aa] {ON} similar ...   411   e-125
NDAI0A00660 Chr1 (121773..124841) [3069 bp, 1022 aa] {ON} Anc_1.52    399   e-122
CAGL0K05709g Chr11 complement(556732..560043) [3312 bp, 1103 aa]...   398   e-121
TBLA0A07150 Chr1 (1776160..1780335) [4176 bp, 1391 aa] {ON} Anc_...   360   e-105
Skud_3.39 Chr3 (66201..69254) [3054 bp, 1017 aa] {ON} YCL024W (R...   322   6e-94
Suva_3.190 Chr3 (288639..288813,288870..291766) [3072 bp, 1024 a...   306   2e-88
Smik_3.54 Chr3 (80309..83407) [3099 bp, 1032 aa] {ON} YCL024W (R...   294   5e-84
YCL024W Chr3 (79162..82275) [3114 bp, 1037 aa] {ON}  KCC4Protein...   245   5e-67
TDEL0A02550 Chr1 (457841..461950) [4110 bp, 1369 aa] {ON} Anc_2....   168   1e-41
Smik_11.139 Chr11 (235511..240115) [4605 bp, 1534 aa] {ON} YKL10...   167   2e-41
YKL101W Chr11 (248920..253476) [4557 bp, 1518 aa] {ON}  HSL1Nim1...   167   3e-41
Skud_11.126 Chr11 (235011..239567) [4557 bp, 1518 aa] {ON} YKL10...   164   1e-40
Ecym_7392 Chr7 complement(803240..807544) [4305 bp, 1434 aa] {ON...   163   3e-40
Suva_11.123 Chr11 (235064..239644) [4581 bp, 1526 aa] {ON} YKL10...   163   5e-40
KNAG0A06540 Chr1 (1002435..1006733) [4299 bp, 1432 aa] {ON} Anc_...   160   3e-39
ZYRO0G03366g Chr7 (261014..265864) [4851 bp, 1616 aa] {ON} simil...   159   7e-39
NCAS0A05770 Chr1 (1132854..1137239) [4386 bp, 1461 aa] {ON} Anc_...   156   5e-38
TBLA0I01150 Chr9 complement(235187..240424) [5238 bp, 1745 aa] {...   155   2e-37
KLLA0F13552g Chr6 complement(1252906..1256709) [3804 bp, 1267 aa...   154   2e-37
SAKL0E02860g Chr5 complement(228726..232859) [4134 bp, 1377 aa] ...   154   3e-37
NDAI0D02750 Chr4 (639802..644349) [4548 bp, 1515 aa] {ON} Anc_2....   153   6e-37
ABL034W Chr2 (333432..337709) [4278 bp, 1425 aa] {ON} Syntenic h...   152   7e-37
KLTH0D05566g Chr4 (498055..501441) [3387 bp, 1128 aa] {ON} weakl...   150   4e-36
KAFR0D03200 Chr4 (628993..633339) [4347 bp, 1448 aa] {ON} Anc_2....   148   2e-35
Kpol_431.9 s431 complement(22310..26968) [4659 bp, 1552 aa] {ON}...   147   5e-35
Kwal_26.7788 s26 (511530..515333) [3804 bp, 1267 aa] {ON} YKL101...   146   5e-35
CAGL0K08514g Chr11 complement(854143..858612) [4470 bp, 1489 aa]...   142   1e-33
TPHA0G03200 Chr7 (683296..687900) [4605 bp, 1534 aa] {ON} Anc_2....   131   3e-30
CAGL0M02299g Chr13 (273725..276406) [2682 bp, 893 aa] {ON} simil...    81   7e-15
TBLA0B03860 Chr2 (887855..890821) [2967 bp, 988 aa] {ON} Anc_8.6...    80   2e-14
KNAG0J01590 Chr10 (292565..294982) [2418 bp, 805 aa] {ON} Anc_8....    78   7e-14
NDAI0E02390 Chr5 complement(496256..498907) [2652 bp, 883 aa] {O...    77   1e-13
NDAI0B02070 Chr2 (514024..517800) [3777 bp, 1258 aa] {ON}              77   1e-13
NDAI0E02320 Chr5 (480203..483001) [2799 bp, 932 aa] {ON}               77   2e-13
TBLA0B00490 Chr2 complement(94755..97118) [2364 bp, 787 aa] {ON}...    76   3e-13
CAGL0M02519g Chr13 complement(290723..292993) [2271 bp, 756 aa] ...    76   3e-13
Kwal_56.23717 s56 complement(674222..676798) [2577 bp, 858 aa] {...    75   4e-13
CAGL0M11396g Chr13 (1122109..1125687) [3579 bp, 1192 aa] {ON} si...    75   4e-13
TPHA0G01710 Chr7 complement(350452..352869) [2418 bp, 805 aa] {O...    75   6e-13
ZYRO0F06842g Chr6 (561269..563800) [2532 bp, 843 aa] {ON} simila...    74   1e-12
NDAI0E01290 Chr5 complement(255593..257782) [2190 bp, 729 aa] {O...    74   1e-12
KLTH0G13288g Chr7 complement(1139058..1142486) [3429 bp, 1142 aa...    74   2e-12
SAKL0H06754g Chr8 (594995..597649) [2655 bp, 884 aa] {ON} simila...    73   2e-12
TDEL0A06140 Chr1 complement(1074016..1076601) [2586 bp, 861 aa] ...    73   2e-12
TBLA0B03970 Chr2 complement(904167..907793) [3627 bp, 1208 aa] {...    73   3e-12
KAFR0H02540 Chr8 complement(483399..485852) [2454 bp, 817 aa] {O...    73   3e-12
YPL150W Chr16 (268188..270893) [2706 bp, 901 aa] {ON} Protein ki...    73   3e-12
Kwal_56.22476 s56 complement(145039..147132) [2094 bp, 697 aa] {...    72   3e-12
SAKL0H16632g Chr8 complement(1461613..1464801) [3189 bp, 1062 aa...    72   4e-12
Smik_6.347 Chr6 complement(553316..556069) [2754 bp, 917 aa] {ON...    72   4e-12
NCAS0B05090 Chr2 (946126..949758) [3633 bp, 1210 aa] {ON}              72   5e-12
CAGL0F00649g Chr6 (71961..73505) [1545 bp, 514 aa] {ON} similar ...    71   5e-12
KNAG0G02110 Chr7 (477260..480838) [3579 bp, 1192 aa] {ON} Anc_8....    72   7e-12
ACR133C Chr3 complement(581468..584023) [2556 bp, 851 aa] {ON} S...    71   7e-12
Ecym_4291 Chr4 complement(620549..623986) [3438 bp, 1145 aa] {ON...    72   8e-12
NCAS0D02100 Chr4 (385878..388058) [2181 bp, 726 aa] {ON} Anc_6.31      71   8e-12
Suva_16.169 Chr16 complement(292738..295314) [2577 bp, 858 aa] {...    71   8e-12
Smik_4.367 Chr4 (655941..659141) [3201 bp, 1066 aa] {ON} YDR122W...    71   1e-11
AGR058W Chr7 (823626..826841) [3216 bp, 1071 aa] {ON} Syntenic h...    71   1e-11
Kwal_26.8709 s26 (907885..910374) [2490 bp, 829 aa] {ON} YPL141C...    71   1e-11
KAFR0B02800 Chr2 (571295..574582) [3288 bp, 1095 aa] {ON} Anc_8....    71   1e-11
NCAS0C01590 Chr3 (293327..295921) [2595 bp, 864 aa] {ON} Anc_8.654     71   1e-11
KNAG0J01670 Chr10 complement(304021..307050) [3030 bp, 1009 aa] ...    71   1e-11
TPHA0D01140 Chr4 (238656..240524) [1869 bp, 622 aa] {ON} Anc_8.6...    70   1e-11
YPL141C Chr16 complement(283464..286061) [2598 bp, 865 aa] {ON} ...    70   1e-11
TPHA0J00420 Chr10 complement(96445..98568) [2124 bp, 707 aa] {ON...    70   1e-11
CAGL0M08910g Chr13 complement(887703..889541) [1839 bp, 612 aa] ...    70   1e-11
Suva_2.283 Chr2 (489490..492759) [3270 bp, 1089 aa] {ON} YDR122W...    70   1e-11
YDR122W Chr4 (694700..697894) [3195 bp, 1064 aa] {ON}  KIN1Serin...    70   1e-11
Smik_12.155 Chr12 (312480..315968) [3489 bp, 1162 aa] {ON} YLR09...    70   2e-11
Skud_4.383 Chr4 (666354..669551) [3198 bp, 1065 aa] {ON} YDR122W...    70   2e-11
KLLA0F11319g Chr6 (1042436..1044967) [2532 bp, 843 aa] {ON} simi...    70   2e-11
NCAS0C01670 Chr3 complement(306682..309372) [2691 bp, 896 aa] {O...    70   2e-11
ZYRO0F07194g Chr6 complement(581438..584254) [2817 bp, 938 aa] {...    70   2e-11
TPHA0J00820 Chr10 (193408..197064) [3657 bp, 1218 aa] {ON} Anc_8...    70   2e-11
TDEL0A06000 Chr1 (1053427..1055799) [2373 bp, 790 aa] {ON} Anc_8...    70   2e-11
Kpol_1072.29 s1072 complement(61987..64668) [2682 bp, 893 aa] {O...    70   2e-11
TBLA0C04600 Chr3 (1112043..1115990) [3948 bp, 1315 aa] {ON} Anc_...    70   3e-11
KLLA0F19536g Chr6 (1808263..1811577) [3315 bp, 1104 aa] {ON} sim...    70   3e-11
Skud_16.140 Chr16 complement(255090..257687) [2598 bp, 865 aa] {...    69   3e-11
Skud_12.164 Chr12 (315700..319182) [3483 bp, 1160 aa] {ON} YLR09...    70   3e-11
Skud_16.132 Chr16 (239797..242571) [2775 bp, 924 aa] {ON} YPL150...    69   3e-11
KLTH0D10714g Chr4 (880389..883007) [2619 bp, 872 aa] {ON} simila...    69   4e-11
NDAI0J01250 Chr10 complement(291314..294844) [3531 bp, 1176 aa] ...    69   5e-11
YLR096W Chr12 (332590..336033) [3444 bp, 1147 aa] {ON}  KIN2Seri...    69   5e-11
TDEL0F04060 Chr6 (749896..753276) [3381 bp, 1126 aa] {ON} Anc_8....    69   6e-11
KAFR0A03730 Chr1 (761946..764312) [2367 bp, 788 aa] {ON} Anc_8.6...    68   7e-11
Smik_6.339 Chr6 (538177..540774) [2598 bp, 865 aa] {ON} YPL141C ...    68   7e-11
TPHA0C00470 Chr3 (81482..83377) [1896 bp, 631 aa] {ON} Anc_5.611...    68   7e-11
Suva_2.651 Chr2 (1164264..1166165) [1902 bp, 633 aa] {ON} YDR477...    68   7e-11
Smik_4.754 Chr4 (1333667..1335565) [1899 bp, 632 aa] {ON} YDR477...    68   8e-11
Suva_16.160 Chr16 (277393..280149) [2757 bp, 918 aa] {ON} YPL150...    68   8e-11
Kpol_1012.6 s1012 (11581..13467) [1887 bp, 628 aa] {ON} (11581.....    68   9e-11
YDR477W Chr4 (1412373..1414274) [1902 bp, 633 aa] {ON}  SNF1AMP-...    68   9e-11
Skud_4.751 Chr4 (1332135..1334039) [1905 bp, 634 aa] {ON} YDR477...    67   1e-10
TBLA0C01750 Chr3 (412762..415707) [2946 bp, 981 aa] {ON} Anc_8.6...    68   1e-10
CAGL0J03872g Chr10 (368472..370457) [1986 bp, 661 aa] {ON} simil...    67   1e-10
Ecym_2405 Chr2 (788655..791222) [2568 bp, 855 aa] {ON} similar t...    67   1e-10
Kpol_1018.65 s1018 (189779..191584) [1806 bp, 601 aa] {ON} (1897...    67   1e-10
Suva_10.180 Chr10 (337364..340843) [3480 bp, 1159 aa] {ON} YLR09...    67   1e-10
Kpol_1066.46 s1066 (82874..86551) [3678 bp, 1225 aa] {ON} (82874...    68   1e-10
NCAS0B01470 Chr2 (241003..243186) [2184 bp, 727 aa] {ON} Anc_8.654     67   1e-10
KLTH0D11044g Chr4 complement(901388..903937) [2550 bp, 849 aa] {...    67   1e-10
KAFR0C05860 Chr3 (1160586..1162520) [1935 bp, 644 aa] {ON} Anc_5...    67   1e-10
Skud_7.114 Chr7 (211645..213153) [1509 bp, 502 aa] {ON} YGL158W ...    67   2e-10
SAKL0H07084g Chr8 complement(619288..622047) [2760 bp, 919 aa] {...    67   2e-10
ZYRO0D06776g Chr4 complement(583027..586641) [3615 bp, 1204 aa] ...    67   2e-10
Smik_7.115 Chr7 (201140..202663) [1524 bp, 507 aa] {ON} YGL158W ...    66   2e-10
KLTH0C10912g Chr3 (898372..900465) [2094 bp, 697 aa] {ON} highly...    67   2e-10
Kwal_26.8751 s26 complement(928853..931399) [2547 bp, 848 aa] {O...    67   2e-10
KNAG0H03140 Chr8 complement(589553..592363) [2811 bp, 936 aa] {O...    67   2e-10
YGL158W Chr7 (207033..208571) [1539 bp, 512 aa] {ON}  RCK1Protei...    66   2e-10
Smik_15.417 Chr15 (725513..727933) [2421 bp, 806 aa] {ON} YOR233...    66   3e-10
KNAG0B03230 Chr2 complement(625072..626997) [1926 bp, 641 aa] {O...    66   4e-10
Suva_13.163 Chr13 complement(259136..261253) [2118 bp, 705 aa] {...    66   4e-10
NCAS0A08080 Chr1 complement(1594221..1596092) [1872 bp, 623 aa] ...    65   6e-10
TPHA0D02840 Chr4 (591733..593637) [1905 bp, 634 aa] {ON}               65   6e-10
Kpol_495.14 s495 (33810..35684) [1875 bp, 624 aa] {ON} (33810..3...    65   7e-10
NCAS0B03740 Chr2 complement(668231..671380) [3150 bp, 1049 aa] {...    65   7e-10
Kpol_1037.20 s1037 (41658..43772) [2115 bp, 704 aa] {ON} (41658....    65   7e-10
KNAG0D01090 Chr4 complement(183319..184437) [1119 bp, 372 aa] {O...    64   8e-10
TBLA0E03360 Chr5 complement(838512..840476) [1965 bp, 654 aa] {O...    65   8e-10
Ecym_8339 Chr8 (684113..686875) [2763 bp, 920 aa] {ON} similar t...    65   9e-10
ACR119W Chr3 (560761..563556) [2796 bp, 931 aa] {ON} Syntenic ho...    64   1e-09
Kpol_1072.19 s1072 (44906..47596) [2691 bp, 896 aa] {ON} (44906....    64   1e-09
Smik_13.159 Chr13 complement(260249..262366) [2118 bp, 705 aa] {...    64   1e-09
Ecym_5588 Chr5 complement(1205102..1206943) [1842 bp, 613 aa] {O...    64   1e-09
Skud_15.399 Chr15 (714789..717212) [2424 bp, 807 aa] {ON} YOR233...    64   1e-09
CAGL0B01925g Chr2 (176316..179150) [2835 bp, 944 aa] {ON} simila...    64   2e-09
TPHA0G01630 Chr7 (336511..339126) [2616 bp, 871 aa] {ON} Anc_8.6...    64   2e-09
SAKL0G06952g Chr7 (570584..572383) [1800 bp, 599 aa] {ON} simila...    63   2e-09
YMR001C Chr13 complement(269019..271136) [2118 bp, 705 aa] {ON} ...    63   2e-09
Suva_8.284 Chr8 (514891..517317) [2427 bp, 808 aa] {ON} YOR233W ...    63   2e-09
TPHA0F02430 Chr6 complement(535865..538261) [2397 bp, 798 aa] {O...    63   3e-09
KLTH0G05698g Chr7 (453530..455323) [1794 bp, 597 aa] {ON} simila...    63   3e-09
Kwal_47.18233 s47 complement(743846..745642) [1797 bp, 598 aa] {...    63   3e-09
KAFR0G02690 Chr7 complement(555573..557714) [2142 bp, 713 aa] {O...    63   3e-09
TDEL0A04780 Chr1 (842715..844580) [1866 bp, 621 aa] {ON} Anc_5.6...    62   3e-09
KNAG0A03040 Chr1 complement(372150..374084) [1935 bp, 644 aa] {O...    62   3e-09
NCAS0C03770 Chr3 complement(761101..765897) [4797 bp, 1598 aa] {...    63   4e-09
KNAG0E00850 Chr5 complement(158992..161127) [2136 bp, 711 aa] {O...    62   4e-09
CAGL0K10604g Chr11 complement(1030055..1031395) [1341 bp, 446 aa...    61   6e-09
Kpol_487.14 s487 complement(56520..58394) [1875 bp, 624 aa] {ON}...    62   7e-09
AEL230W Chr5 (198401..200227) [1827 bp, 608 aa] {ON} Syntenic ho...    61   7e-09
KLLA0A03806g Chr1 complement(338807..340615) [1809 bp, 602 aa] {...    61   8e-09
Skud_13.154 Chr13 complement(255263..257380) [2118 bp, 705 aa] {...    62   8e-09
NCAS0A08880 Chr1 (1756271..1757539) [1269 bp, 422 aa] {ON} Anc_1...    60   9e-09
NDAI0H03460 Chr8 complement(836849..838726) [1878 bp, 625 aa] {O...    61   1e-08
Ecym_3035 Chr3 complement(70391..72613) [2223 bp, 740 aa] {ON} s...    61   1e-08
YOR233W Chr15 (775846..778248) [2403 bp, 800 aa] {ON}  KIN4Serin...    61   1e-08
ACL006W Chr3 (344395..346521) [2127 bp, 708 aa] {ON} Syntenic ho...    61   1e-08
KNAG0I01480 Chr9 (287733..289055) [1323 bp, 440 aa] {ON} Anc_1.3...    60   1e-08
CAGL0F04741g Chr6 (478256..479584) [1329 bp, 442 aa] {ON} simila...    60   2e-08
SAKL0E01584g Chr5 complement(121830..123917) [2088 bp, 695 aa] {...    60   2e-08
ZYRO0C07480g Chr3 (565426..567750) [2325 bp, 774 aa] {ON} highly...    60   2e-08
CAGL0J11638g Chr10 complement(1130744..1132984) [2241 bp, 746 aa...    60   2e-08
TDEL0G04380 Chr7 (792278..794446) [2169 bp, 722 aa] {ON} Anc_6.3...    60   2e-08
NDAI0H00940 Chr8 complement(209645..211702) [2058 bp, 685 aa] {O...    60   3e-08
KLTH0A06776g Chr1 complement(562932..567503) [4572 bp, 1523 aa] ...    60   3e-08
KLLA0F12188g Chr6 (1122745..1124385) [1641 bp, 546 aa] {ON} some...    59   4e-08
Kwal_56.24091 s56 (845680..846825) [1146 bp, 381 aa] {ON} YPL209...    58   5e-08
KLLA0C06138g Chr3 (540409..542535) [2127 bp, 708 aa] {ON} simila...    59   5e-08
NDAI0C02680 Chr3 complement(621951..624203) [2253 bp, 750 aa] {O...    59   6e-08
TPHA0O00670 Chr15 (125331..127088) [1758 bp, 585 aa] {ON} Anc_1....    59   6e-08
ZYRO0A05544g Chr1 (450809..452704) [1896 bp, 631 aa] {ON} highly...    59   7e-08
Kpol_1018.54 s1018 (163688..166192) [2505 bp, 834 aa] {ON} (1636...    58   8e-08
TDEL0B06160 Chr2 complement(1086672..1088327) [1656 bp, 551 aa] ...    58   1e-07
KLTH0H03982g Chr8 complement(363432..364628) [1197 bp, 398 aa] {...    57   1e-07
NDAI0G03110 Chr7 complement(725984..731107) [5124 bp, 1707 aa] {...    58   1e-07
Kpol_1023.26 s1023 (51805..54024) [2220 bp, 739 aa] {ON} (51805....    57   2e-07
TPHA0N00370 Chr14 (68298..69650) [1353 bp, 450 aa] {ON} Anc_7.41...    57   2e-07
NCAS0A08770 Chr1 complement(1733181..1734890) [1710 bp, 569 aa] ...    57   2e-07
Ecym_1313 Chr1 complement(633556..634455) [900 bp, 299 aa] {ON} ...    56   2e-07
NDAI0G05300 Chr7 (1289208..1290521) [1314 bp, 437 aa] {ON} Anc_1...    57   2e-07
KNAG0F02900 Chr6 (549477..551426) [1950 bp, 649 aa] {ON}               57   2e-07
YFL033C Chr6 complement(69115..74427) [5313 bp, 1770 aa] {ON}  R...    57   2e-07
KLLA0D07348g Chr4 (626999..629728) [2730 bp, 909 aa] {ON} simila...    57   2e-07
Skud_12.329 Chr12 (580813..582645) [1833 bp, 610 aa] {ON} YLR248...    57   2e-07
KLLA0F11143g Chr6 complement(1026129..1028570) [2442 bp, 813 aa]...    57   3e-07
AFL101C Chr6 complement(249144..250247) [1104 bp, 367 aa] {ON} S...    56   3e-07
Kwal_26.8796 s26 (946406..948796) [2391 bp, 796 aa] {ON} YPL153C...    56   3e-07
Smik_6.350 Chr6 (559997..562465) [2469 bp, 822 aa] {ON} YPL153C ...    56   3e-07
Suva_16.97 Chr16 complement(165977..167083) [1107 bp, 368 aa] {O...    55   3e-07
Suva_16.157 Chr16 complement(270891..273389) [2499 bp, 832 aa] {...    56   3e-07
Suva_10.345 Chr10 (601536..603365) [1830 bp, 609 aa] {ON} YLR248...    56   4e-07
AAL029W Chr1 (289989..291593) [1605 bp, 534 aa] {ON} Syntenic ho...    56   4e-07
TBLA0D04420 Chr4 complement(1097314..1099356) [2043 bp, 680 aa] ...    56   4e-07
Kwal_0.155 s0 (84856..86619) [1764 bp, 587 aa] {ON} YLR248W (RCK...    55   4e-07
Kpol_1069.13 s1069 complement(27223..28506) [1284 bp, 427 aa] {O...    55   5e-07
KNAG0E03200 Chr5 complement(641437..646020) [4584 bp, 1527 aa] {...    56   5e-07
CAGL0B03509g Chr2 complement(349638..351431) [1794 bp, 597 aa] {...    55   5e-07
Kwal_14.1159 s14 complement(219896..224461) [4566 bp, 1521 aa] {...    56   6e-07
KLTH0H11858g Chr8 (1013677..1015374) [1698 bp, 565 aa] {ON} some...    55   6e-07
TBLA0A02050 Chr1 (495735..497039) [1305 bp, 434 aa] {ON}               55   6e-07
ACR142W Chr3 (597519..600032) [2514 bp, 837 aa] {ON} Syntenic ho...    55   7e-07
CAGL0K12562g Chr11 (1235695..1240743) [5049 bp, 1682 aa] {ON} si...    55   7e-07
Skud_15.144 Chr15 complement(254620..255969) [1350 bp, 449 aa] {...    55   8e-07
KAFR0B05410 Chr2 complement(1111152..1112771) [1620 bp, 539 aa] ...    55   8e-07
KAFR0H02430 Chr8 complement(464446..466800) [2355 bp, 784 aa] {O...    55   8e-07
TDEL0A06220 Chr1 (1088622..1091006) [2385 bp, 794 aa] {ON} Anc_8...    55   9e-07
Skud_16.129 Chr16 complement(233341..235824) [2484 bp, 827 aa] {...    55   1e-06
KLTH0H11396g Chr8 complement(973355..974668) [1314 bp, 437 aa] {...    54   1e-06
KNAG0C01820 Chr3 (355604..357376) [1773 bp, 590 aa] {ON}               54   1e-06
NCAS0D04710 Chr4 complement(901442..903856) [2415 bp, 804 aa] {O...    55   1e-06
CAGL0M02233g Chr13 complement(267332..269635) [2304 bp, 767 aa] ...    54   1e-06
Ecym_2397 Chr2 complement(771343..773961) [2619 bp, 872 aa] {ON}...    54   1e-06
SAKL0A04246g Chr1 complement(396019..397221) [1203 bp, 400 aa] {...    54   1e-06
YPL209C Chr16 complement(156490..157593) [1104 bp, 367 aa] {ON} ...    54   1e-06
Kwal_23.6325 s23 complement(1533223..1537851) [4629 bp, 1542 aa]...    55   1e-06
SAKL0D07656g Chr4 complement(627469..628767) [1299 bp, 432 aa] {...    54   1e-06
Smik_6.46 Chr6 complement(84451..89733) [5283 bp, 1760 aa] {ON} ...    54   1e-06
TBLA0F00860 Chr6 (219628..222570) [2943 bp, 980 aa] {ON} Anc_3.1...    54   1e-06
TPHA0O01120 Chr15 complement(217462..218751) [1290 bp, 429 aa] {...    54   2e-06
NDAI0G06150 Chr7 (1519393..1521780) [2388 bp, 795 aa] {ON} Anc_1...    54   2e-06
NCAS0B04490 Chr2 (814474..815523) [1050 bp, 349 aa] {ON} Anc_8.141     53   2e-06
TPHA0E02820 Chr5 complement(589816..590970) [1155 bp, 384 aa] {O...    53   2e-06
KLTH0D11242g Chr4 (918232..920619) [2388 bp, 795 aa] {ON} simila...    54   2e-06
KNAG0I01360 Chr9 complement(262712..264556) [1845 bp, 614 aa] {O...    54   2e-06
Skud_6.38 Chr6 complement(72416..77692) [5277 bp, 1758 aa] {ON} ...    54   2e-06
KLTH0G18612g Chr7 (1604066..1608640) [4575 bp, 1524 aa] {ON} sim...    54   2e-06
YPL153C Chr16 complement(261727..264192) [2466 bp, 821 aa] {ON} ...    54   2e-06
Suva_15.155 Chr15 complement(267680..269038) [1359 bp, 452 aa] {...    53   2e-06
KAFR0C03520 Chr3 (715667..720019) [4353 bp, 1450 aa] {ON} Anc_8....    54   2e-06
TDEL0B06320 Chr2 (1118534..1119868) [1335 bp, 444 aa] {ON} Anc_1...    53   2e-06
SAKL0D08294g Chr4 (692455..693966) [1512 bp, 503 aa] {ON} some s...    53   2e-06
KLTH0D06006g Chr4 complement(532589..535453) [2865 bp, 954 aa] {...    54   2e-06
ACR218W Chr3 (731433..736142) [4710 bp, 1569 aa] {ON} Syntenic h...    54   2e-06
Ecym_1275 Chr1 complement(560481..561836) [1356 bp, 451 aa] {ON}...    53   3e-06
Smik_6.414 Chr6 (666806..667909) [1104 bp, 367 aa] {ON} YPL209C ...    52   3e-06
ZYRO0D04752g Chr4 complement(397364..398215,398290..398907) [147...    53   3e-06
Skud_16.70 Chr16 complement(129918..131021) [1104 bp, 367 aa] {O...    52   3e-06
Skud_6.89 Chr6 (166257..167594) [1338 bp, 446 aa] {ON} YFR014C (...    53   3e-06
Smik_12.321 Chr12 (579087..580919) [1833 bp, 610 aa] {ON} YLR248...    53   3e-06
Ecym_6301 Chr6 complement(566248..567324) [1077 bp, 358 aa] {ON}...    52   3e-06
NDAI0G05190 Chr7 complement(1258638..1260452) [1815 bp, 604 aa] ...    53   3e-06
KAFR0I02100 Chr9 (431876..433258) [1383 bp, 460 aa] {ON} Anc_1.3...    53   3e-06
YLR248W Chr12 (634252..636084) [1833 bp, 610 aa] {ON}  RCK2Prote...    53   4e-06
NDAI0F01600 Chr6 complement(392424..393662) [1239 bp, 412 aa] {O...    52   4e-06
NDAI0H03520 Chr8 (860096..861472) [1377 bp, 458 aa] {ON}               52   4e-06
SAKL0D06534g Chr4 complement(538606..540091,540155..540237) [156...    52   4e-06
NCAS0E02230 Chr5 (429499..430176,430250..431104) [1533 bp, 510 a...    52   4e-06
YFR014C Chr6 complement(172537..173877) [1341 bp, 446 aa] {ON}  ...    52   4e-06
ZYRO0E07018g Chr5 (531316..532419) [1104 bp, 367 aa] {ON} simila...    52   5e-06
Ecym_2194 Chr2 complement(381633..382733) [1101 bp, 366 aa] {ON}...    52   5e-06
TBLA0G03450 Chr7 (913497..919415) [5919 bp, 1972 aa] {ON} Anc_8....    53   5e-06
TDEL0E05310 Chr5 (972769..973893) [1125 bp, 374 aa] {ON} Anc_6.2...    52   5e-06
Smik_7.319 Chr7 complement(534132..535472) [1341 bp, 446 aa] {ON...    52   5e-06
Smik_7.93 Chr7 complement(158441..160132) [1692 bp, 563 aa] {ON}...    52   5e-06
Suva_6.26 Chr6 complement(42811..48072) [5262 bp, 1753 aa] {ON} ...    52   6e-06
KNAG0J01700 Chr10 (309962..312424) [2463 bp, 820 aa] {ON}              52   6e-06
TPHA0G01600 Chr7 complement(329313..331850) [2538 bp, 845 aa] {O...    52   7e-06
CAGL0I09504g Chr9 (909589..911175) [1587 bp, 528 aa] {ON} simila...    52   7e-06
AAR009W Chr1 (358947..360308) [1362 bp, 453 aa] {ON} Syntenic ho...    52   7e-06
Kpol_1028.16 s1028 complement(45186..47825) [2640 bp, 879 aa] {O...    52   8e-06
NDAI0I00340 Chr9 (65047..70557) [5511 bp, 1836 aa] {ON} Anc_6.341      52   8e-06
TPHA0D00360 Chr4 complement(55596..60206) [4611 bp, 1536 aa] {ON...    52   8e-06
TDEL0A07860 Chr1 (1365985..1368498) [2514 bp, 837 aa] {ON} Anc_6...    52   8e-06
ZYRO0E05170g Chr5 complement(390866..392593) [1728 bp, 575 aa] {...    52   9e-06
Kwal_0.96 s0 complement(46082..47365) [1284 bp, 427 aa] {ON} YOL...    51   9e-06
KAFR0F01150 Chr6 complement(218711..219811) [1101 bp, 366 aa] {O...    51   9e-06
CAGL0C03509g Chr3 complement(350846..353533) [2688 bp, 895 aa] {...    52   9e-06
NDAI0E02110 Chr5 complement(430989..433700) [2712 bp, 903 aa] {O...    52   9e-06
NCAS0A12350 Chr1 complement(2446237..2447236,2447319..2448559) [...    51   1e-05
SAKL0B01210g Chr2 complement(109892..114658) [4767 bp, 1588 aa] ...    52   1e-05
Kpol_1072.16 s1072 complement(37585..39972) [2388 bp, 795 aa] {O...    51   1e-05
ZYRO0F03014g Chr6 complement(255189..260003) [4815 bp, 1604 aa] ...    52   1e-05
SAKL0H06534g Chr8 complement(575439..577853) [2415 bp, 804 aa] {...    51   1e-05
KNAG0D00210 Chr4 complement(22721..25222) [2502 bp, 833 aa] {ON}...    51   1e-05
AFL188C Chr6 complement(88793..90211) [1419 bp, 472 aa] {ON} Syn...    51   1e-05
ZYRO0B01166g Chr2 complement(97168..100059) [2892 bp, 963 aa] {O...    51   1e-05
Smik_15.535 Chr15 complement(940569..942050) [1482 bp, 493 aa] {...    51   1e-05
YOL016C Chr15 complement(294777..296120) [1344 bp, 447 aa] {ON} ...    50   1e-05
Skud_7.92 Chr7 complement(169006..170697) [1692 bp, 563 aa] {ON}...    51   1e-05
TBLA0B07330 Chr2 complement(1745229..1746821,1746990..1747013) [...    51   1e-05
ZYRO0B09196g Chr2 complement(721019..722569) [1551 bp, 516 aa] {...    50   2e-05
TPHA0O01400 Chr15 complement(277678..279258) [1581 bp, 526 aa] {...    50   2e-05
Kpol_1065.3 s1065 complement(4445..5575) [1131 bp, 376 aa] {ON} ...    50   2e-05
NCAS0D00630 Chr4 complement(107310..108593) [1284 bp, 427 aa] {O...    50   2e-05
Smik_2.101 Chr2 (186008..187069) [1062 bp, 353 aa] {ON} YBL016W ...    50   2e-05
YNR047W Chr14 (708523..711204) [2682 bp, 893 aa] {ON}  FPK1Ser/T...    51   2e-05
Suva_6.78 Chr6 (135988..137325) [1338 bp, 445 aa] {ON} YFR014C (...    50   2e-05
Klac_YGOB_Anc_8.34 Chr6 (836287..839007,839010..841004) [4716 bp...    51   2e-05
TBLA0I01310 Chr9 (279407..281245) [1839 bp, 612 aa] {ON} Anc_2.4...    50   2e-05
NCAS0A05370 Chr1 complement(1061671..1066197) [4527 bp, 1508 aa]...    51   2e-05
TBLA0D05010 Chr4 complement(1234934..1236238) [1305 bp, 434 aa] ...    50   2e-05
TPHA0M02080 Chr13 (426966..429635) [2670 bp, 889 aa] {ON} Anc_6....    50   2e-05
Smik_14.377 Chr14 (666338..669025) [2688 bp, 895 aa] {ON} YNR047...    50   2e-05
Skud_14.379 Chr14 (677081..679774) [2694 bp, 897 aa] {ON} YNR047...    50   2e-05
Ecym_5624 Chr5 (1256658..1258022) [1365 bp, 454 aa] {ON} similar...    50   2e-05
Kwal_26.7861 s26 complement(544126..546993) [2868 bp, 955 aa] {O...    50   2e-05
TDEL0H04100 Chr8 complement(706443..707306,707369..707974) [1470...    50   2e-05
KLTH0H10318g Chr8 complement(888661..890128,890228..890316) [155...    50   2e-05
TPHA0D02740 Chr4 (566279..568819) [2541 bp, 846 aa] {ON} Anc_5.5...    50   3e-05
SAKL0H24750g Chr8 complement(2152673..2155420) [2748 bp, 915 aa]...    50   3e-05
Ecym_6145 Chr6 complement(266766..267863) [1098 bp, 365 aa] {ON}...    49   3e-05
Suva_14.402 Chr14 (690198..692915) [2718 bp, 905 aa] {ON} YNR047...    50   3e-05
SAKL0E05984g Chr5 complement(485895..487391,487462..487482) [151...    50   3e-05
NCAS0F01460 Chr6 complement(290441..292465) [2025 bp, 674 aa] {O...    50   3e-05
KLLA0F01276g Chr6 complement(120001..121560) [1560 bp, 519 aa] {...    50   3e-05
NCAS0D04600 Chr4 (875553..880604) [5052 bp, 1683 aa] {ON} Anc_6....    50   3e-05
ZYRO0F07370g Chr6 (595931..598219) [2289 bp, 762 aa] {ON} simila...    50   3e-05
TDEL0C00590 Chr3 complement(94223..99031) [4809 bp, 1602 aa] {ON...    50   3e-05
Suva_13.281 Chr13 complement(455094..457136) [2043 bp, 680 aa] {...    50   3e-05
NCAS0C01370 Chr3 complement(250693..253092) [2400 bp, 799 aa] {O...    50   3e-05
CAGL0M10153g Chr13 complement(1010688..1013291) [2604 bp, 867 aa...    50   4e-05
TPHA0H00410 Chr8 (79426..82197) [2772 bp, 923 aa] {ON} Anc_8.141...    50   4e-05
KAFR0H02510 Chr8 complement(476574..479213) [2640 bp, 879 aa] {O...    50   4e-05
Smik_15.153 Chr15 complement(261920..263248) [1329 bp, 442 aa] {...    49   4e-05
NDAI0H02340 Chr8 complement(568767..570887) [2121 bp, 706 aa] {O...    50   4e-05
Suva_3.110 Chr3 complement(160016..164146) [4131 bp, 1376 aa] {O...    50   4e-05
Skud_15.519 Chr15 complement(932720..934216) [1497 bp, 498 aa] {...    49   4e-05
TBLA0D05640 Chr4 (1380616..1383066) [2451 bp, 816 aa] {ON} Anc_1...    50   4e-05
YCR091W Chr3 (274404..276566) [2163 bp, 720 aa] {ON}  KIN82Putat...    49   4e-05
TBLA0B03840 Chr2 complement(881914..884490) [2577 bp, 858 aa] {O...    49   4e-05
CAGL0L07326g Chr12 (810529..812049) [1521 bp, 506 aa] {ON} simil...    49   4e-05
NCAS0A09750 Chr1 (1940202..1942370) [2169 bp, 722 aa] {ON}             49   4e-05
YBL016W Chr2 (192451..193512) [1062 bp, 353 aa] {ON}  FUS3Mitoge...    49   4e-05
NCAS0B05910 Chr2 (1120092..1121645) [1554 bp, 517 aa] {ON} Anc_2...    49   5e-05
Kpol_265.1 s265 (4826..7099) [2274 bp, 757 aa] {ON} (4826..7099)...    49   5e-05
KAFR0D03020 Chr4 (596365..598398) [2034 bp, 677 aa] {ON} Anc_2.4...    49   5e-05
KLTH0H08316g Chr8 (730027..731094) [1068 bp, 355 aa] {ON} simila...    49   5e-05
Kwal_14.2497 s14 complement(784224..785480) [1257 bp, 418 aa] {O...    49   5e-05
CAGL0L05632g Chr12 (612478..614511) [2034 bp, 677 aa] {ON} simil...    49   5e-05
TPHA0C00160 Chr3 complement(17339..19603) [2265 bp, 754 aa] {ON}...    49   5e-05
Skud_3.146 Chr3 complement(227229..231233) [4005 bp, 1334 aa] {O...    49   5e-05
KNAG0I02670 Chr9 complement(524008..526734) [2727 bp, 908 aa] {O...    49   5e-05
SAKL0B04488g Chr2 (395136..396242) [1107 bp, 368 aa] {ON} highly...    49   5e-05
YDL101C Chr4 complement(280307..281848) [1542 bp, 513 aa] {ON}  ...    49   5e-05
Suva_2.105 Chr2 (186428..187489) [1062 bp, 353 aa] {ON} YBL016W ...    49   6e-05
CAGL0M13167g Chr13 complement(1293074..1294906) [1833 bp, 610 aa...    49   6e-05
Skud_14.362 Chr14 complement(648801..653540) [4740 bp, 1579 aa] ...    49   6e-05
NCAS0A06440 Chr1 (1270771..1273020) [2250 bp, 749 aa] {ON} Anc_4...    49   6e-05
KAFR0C03010 Chr3 (598970..601342) [2373 bp, 790 aa] {ON} Anc_8.1...    49   6e-05
NDAI0D03420 Chr4 (806856..809261) [2406 bp, 801 aa] {ON} Anc_4.384     49   6e-05
YOR351C Chr15 complement(995018..996511) [1494 bp, 497 aa] {ON} ...    49   6e-05
TPHA0C04570 Chr3 (985491..987071) [1581 bp, 526 aa] {ON} Anc_2.3...    49   6e-05
YMR104C Chr13 complement(473420..475453) [2034 bp, 677 aa] {ON} ...    49   6e-05
KAFR0B06980 Chr2 (1452754..1455081) [2328 bp, 775 aa] {ON} Anc_4...    49   7e-05
KAFR0I02010 Chr9 complement(411589..412887) [1299 bp, 432 aa] {O...    49   7e-05
KNAG0I00590 Chr9 (100275..102068) [1794 bp, 597 aa] {ON}               49   7e-05
KAFR0J02620 Chr10 complement(502187..504265) [2079 bp, 692 aa] {...    49   7e-05
Kpol_448.13 s448 (25051..27063) [2013 bp, 670 aa] {ON} (25051..2...    49   7e-05
KAFR0K00280 Chr11 complement(64906..65988) [1083 bp, 360 aa] {ON...    48   8e-05
AGR334W Chr7 (1355098..1356693) [1596 bp, 531 aa] {ON} Syntenic ...    48   8e-05
ZYRO0D03344g Chr4 complement(278347..280326) [1980 bp, 659 aa] {...    49   8e-05
TDEL0D00330 Chr4 complement(55638..57872) [2235 bp, 744 aa] {ON}...    49   8e-05
Smik_2.417 Chr2 (735214..736797) [1584 bp, 527 aa] {ON} YBR274W ...    48   8e-05
ADL389W Chr4 (27641..29776) [2136 bp, 711 aa] {ON} Syntenic homo...    49   8e-05
KLTH0F09988g Chr6 complement(868693..869931) [1239 bp, 412 aa] {...    48   8e-05
KNAG0D00390 Chr4 (53459..58429) [4971 bp, 1656 aa] {ON} Anc_6.34...    49   8e-05
CAGL0F09075g Chr6 (894761..897001) [2241 bp, 746 aa] {ON} simila...    49   8e-05
ZYRO0D17468g Chr4 (1439376..1441958) [2583 bp, 860 aa] {ON} weak...    49   8e-05
KLLA0E01585g Chr5 (149305..149370,149488..150960) [1539 bp, 512 ...    48   8e-05
ZYRO0G00506g Chr7 complement(38488..40854) [2367 bp, 788 aa] {ON...    49   9e-05
NDAI0G03470 Chr7 complement(829975..832455) [2481 bp, 826 aa] {O...    48   9e-05
Skud_3.165 Chr3 (258916..261066) [2151 bp, 716 aa] {ON} YCR091W ...    48   1e-04
Kwal_47.16761 s47 (100315..102549) [2235 bp, 744 aa] {ON} YHR205...    48   1e-04
Ecym_6040 Chr6 complement(77854..80544) [2691 bp, 896 aa] {ON} s...    48   1e-04
NDAI0I00250 Chr9 (42174..44867) [2694 bp, 897 aa] {ON} Anc_3.177...    48   1e-04
Suva_11.99 Chr11 (192143..194197) [2055 bp, 684 aa] {ON} YMR104C...    48   1e-04
AEL185C Chr5 complement(291129..292676) [1548 bp, 515 aa] {ON} S...    48   1e-04
TPHA0G03290 Chr7 (702953..705874) [2922 bp, 973 aa] {ON} Anc_2.4...    48   1e-04
SAKL0B12364g Chr2 (1060853..1063021) [2169 bp, 722 aa] {ON} high...    48   1e-04
KAFR0G01810 Chr7 (386620..389130) [2511 bp, 836 aa] {ON} Anc_1.2...    48   1e-04
Kpol_1033.55 s1033 (138831..140555,140557..140895) [2064 bp, 687...    48   1e-04
KAFR0C04780 Chr3 (948771..951131) [2361 bp, 786 aa] {ON} Anc_6.3...    48   1e-04
Ecym_2499 Chr2 complement(976395..981020) [4626 bp, 1541 aa] {ON...    48   1e-04
Smik_3.173 Chr3 complement(242285..246307) [4023 bp, 1340 aa] {O...    48   1e-04
KLTH0D17204g Chr4 complement(1426818..1429085) [2268 bp, 755 aa]...    48   1e-04
Skud_11.67 Chr11 complement(135815..137341) [1527 bp, 508 aa] {O...    48   1e-04
YKL126W Chr11 (205707..207749) [2043 bp, 680 aa] {ON}  YPK1Serin...    48   1e-04
Kwal_47.17263 s47 complement(321115..324498) [3384 bp, 1127 aa] ...    48   1e-04
KLLA0D07810g Chr4 complement(669095..671251) [2157 bp, 718 aa] {...    48   1e-04
KLLA0B02332g Chr2 complement(206863..207948) [1086 bp, 361 aa] {...    47   1e-04
Skud_11.103 Chr11 (192587..194629) [2043 bp, 680 aa] {ON} YMR104...    48   1e-04
KNAG0E00360 Chr5 (54187..55563) [1377 bp, 458 aa] {ON}                 47   1e-04
NDAI0B04700 Chr2 complement(1164332..1165918) [1587 bp, 528 aa] ...    47   1e-04
CAGL0K07458g Chr11 complement(737165..739279) [2115 bp, 704 aa] ...    48   1e-04
NDAI0K01370 Chr11 (313672..315714) [2043 bp, 680 aa] {ON}              48   1e-04
TBLA0F01550 Chr6 complement(385184..386716) [1533 bp, 510 aa] {O...    47   1e-04
YGL180W Chr7 (160065..162758) [2694 bp, 897 aa] {ON}  ATG1Protei...    48   1e-04
ZYRO0G19074g Chr7 complement(1580648..1583413) [2766 bp, 921 aa]...    48   2e-04
Smik_10.106 Chr10 complement(175752..177776) [2025 bp, 674 aa] {...    47   2e-04
Kpol_1035.40 s1035 (101912..102910,102960..102968,103011..106556...    48   2e-04
Kpol_1004.19 s1004 (36090..36101,36217..37689) [1485 bp, 494 aa]...    47   2e-04
ACL191C Chr3 complement(26475..27572) [1098 bp, 365 aa] {ON} Syn...    47   2e-04
Suva_7.82 Chr7 (156049..158751) [2703 bp, 900 aa] {ON} YGL180W (...    48   2e-04
Kpol_1018.162 s1018 (414868..416904) [2037 bp, 678 aa] {ON} (414...    47   2e-04
KAFR0C05130 Chr3 (1018035..1019402) [1368 bp, 455 aa] {ON} Anc_7...    47   2e-04
ADR317C Chr4 complement(1263080..1265539) [2460 bp, 819 aa] {ON}...    47   2e-04
KAFR0K02450 Chr11 (504087..504131,504190..505680) [1536 bp, 511 ...    47   2e-04
Skud_14.172 Chr14 (323327..325564) [2238 bp, 745 aa] {ON} YNL161...    47   2e-04
CAGL0K01617g Chr11 complement(143308..145632) [2325 bp, 774 aa] ...    47   2e-04
KLTH0G17512g Chr7 complement(1518329..1519426) [1098 bp, 365 aa]...    47   2e-04
Suva_4.145 Chr4 complement(268826..270370) [1545 bp, 514 aa] {ON...    47   2e-04
KLLA0B12716g Chr2 (1109939..1112089) [2151 bp, 716 aa] {ON} simi...    47   2e-04
Kpol_1031.32 s1031 (76827..78821) [1995 bp, 664 aa] {ON} (76827....    47   2e-04
Ecym_1508 Chr1 (1045857..1050941) [5085 bp, 1694 aa] {ON} simila...    47   2e-04
Skud_2.406 Chr2 (718522..720105) [1584 bp, 527 aa] {ON} YBR274W ...    47   2e-04
Smik_11.113 Chr11 (191688..193730) [2043 bp, 680 aa] {ON} YMR104...    47   2e-04
Kwal_14.1416 s14 (315842..316939) [1098 bp, 365 aa] {ON} YGR040W...    47   2e-04
NCAS0A05570 Chr1 (1093653..1096409) [2757 bp, 918 aa] {ON} Anc_6...    47   2e-04
TBLA0F00240 Chr6 complement(45510..49256) [3747 bp, 1248 aa] {ON...    47   2e-04
Smik_13.290 Chr13 complement(457921..459951) [2031 bp, 676 aa] {...    47   2e-04
ZYRO0G02530g Chr7 (194463..196577) [2115 bp, 704 aa] {ON} highly...    47   2e-04
TPHA0G02910 Chr7 (624676..626727) [2052 bp, 683 aa] {ON} Anc_2.4...    47   2e-04
AER264C Chr5 complement(1120017..1124468) [4452 bp, 1483 aa] {ON...    47   2e-04
Ecym_7473 Chr7 (963826..966045) [2220 bp, 739 aa] {ON} similar t...    47   2e-04
NDAI0E03760 Chr5 (817014..818765) [1752 bp, 583 aa] {ON} Anc_7.41      47   2e-04
KAFR0C04280 Chr3 (848308..849912) [1605 bp, 534 aa] {ON} Anc_1.3...    47   2e-04
KLLA0D09328g Chr4 complement(788565..791705) [3141 bp, 1046 aa] ...    47   2e-04
YBR274W Chr2 (749594..751177) [1584 bp, 527 aa] {ON}  CHK1Serine...    47   2e-04
ZYRO0E07876g Chr5 (616134..617243) [1110 bp, 369 aa] {ON} simila...    47   2e-04
Skud_4.154 Chr4 complement(275783..277324) [1542 bp, 513 aa] {ON...    47   2e-04
Kwal_23.3590 s23 complement(353755..355254) [1500 bp, 499 aa] {O...    47   2e-04
Smik_4.135 Chr4 complement(256861..258402) [1542 bp, 513 aa] {ON...    47   2e-04
Suva_14.385 Chr14 complement(661987..666732) [4746 bp, 1581 aa] ...    47   2e-04
Kpol_541.48 s541 (152877..153692,153695..156046) [3168 bp, 1055 ...    47   2e-04
TPHA0J00630 Chr10 (139476..140600) [1125 bp, 374 aa] {ON} Anc_4....    47   2e-04
Ecym_5252 Chr5 (525687..526976) [1290 bp, 429 aa] {ON} similar t...    47   2e-04
NDAI0A03870 Chr1 (867910..870597) [2688 bp, 895 aa] {ON} Anc_2.496     47   2e-04
KAFR0B02140 Chr2 (417972..420662) [2691 bp, 896 aa] {ON} Anc_8.1...    47   2e-04
TBLA0D00220 Chr4 (52218..54500) [2283 bp, 760 aa] {ON} Anc_2.96 ...    47   3e-04
KAFR0C04480 Chr3 (894906..896213) [1308 bp, 435 aa] {ON} Anc_1.3...    47   3e-04
YNL020C Chr14 complement(595623..597539) [1917 bp, 638 aa] {ON} ...    47   3e-04
SAKL0A01254g Chr1 (119884..124560) [4677 bp, 1558 aa] {ON} simil...    47   3e-04
Skud_14.309 Chr14 complement(566344..568263) [1920 bp, 639 aa] {...    47   3e-04
Suva_8.405 Chr8 complement(730738..732348) [1611 bp, 536 aa] {ON...    47   3e-04
TDEL0A02720 Chr1 complement(491618..494365) [2748 bp, 915 aa] {O...    47   3e-04
CAGL0L06006g Chr12 complement(672704..675532) [2829 bp, 942 aa] ...    47   3e-04
TPHA0F02150 Chr6 complement(475516..477768) [2253 bp, 750 aa] {O...    47   3e-04
KLTH0E06754g Chr5 (619163..621784) [2622 bp, 873 aa] {ON} simila...    47   3e-04
CAGL0E05720g Chr5 (569265..570341) [1077 bp, 358 aa] {ON} simila...    46   3e-04
Smik_7.92 Chr7 (155049..157742) [2694 bp, 897 aa] {ON} YGL180W (...    47   3e-04
Smik_14.167 Chr14 (311655..312284,312591..314228) [2268 bp, 755 ...    47   3e-04
Kwal_47.17252 s47 (318148..320766) [2619 bp, 872 aa] {ON} YGL180...    47   3e-04
NDAI0K02390 Chr11 (537260..539920) [2661 bp, 886 aa] {ON} Anc_6....    47   3e-04
NDAI0B02500 Chr2 (625206..629036) [3831 bp, 1276 aa] {ON} Anc_8....    47   3e-04
YNL161W Chr14 (332597..334867) [2271 bp, 756 aa] {ON}  CBK1Serin...    47   3e-04
TDEL0A07560 Chr1 complement(1316498..1321225) [4728 bp, 1575 aa]...    47   3e-04
TBLA0A10690 Chr1 (2642723..2645632) [2910 bp, 969 aa] {ON} Anc_4...    47   3e-04
Suva_14.178 Chr14 (328862..331195) [2334 bp, 777 aa] {ON} YNL161...    47   3e-04
KLTH0B06424g Chr2 complement(518184..520328) [2145 bp, 714 aa] {...    47   3e-04
KLTH0A07458g Chr1 (620459..623080) [2622 bp, 873 aa] {ON} simila...    47   3e-04
Kpol_1051.42 s1051 (98030..99379,99382..100212) [2181 bp, 726 aa...    47   3e-04
KAFR0F04340 Chr6 (848844..853628) [4785 bp, 1594 aa] {ON} Anc_6....    47   4e-04
Ecym_5209 Chr5 complement(445530..448133) [2604 bp, 867 aa] {ON}...    46   4e-04
KLLA0A02497g Chr1 (218592..219680) [1089 bp, 362 aa] {ON} highly...    46   4e-04
TDEL0A02220 Chr1 (402496..404565) [2070 bp, 689 aa] {ON} Anc_2.4...    46   4e-04
TBLA0I01370 Chr9 complement(294202..296526) [2325 bp, 774 aa] {O...    46   4e-04
Kwal_23.6458 s23 (1592349..1594955) [2607 bp, 868 aa] {ON} YNR04...    46   4e-04
TPHA0B01150 Chr2 complement(259998..262070) [2073 bp, 690 aa] {O...    46   4e-04
SAKL0C05368g Chr3 complement(510576..511832) [1257 bp, 418 aa] {...    46   4e-04
NDAI0F03200 Chr6 complement(770618..772924) [2307 bp, 768 aa] {O...    46   4e-04
Kwal_33.14554 s33 (717776..719920) [2145 bp, 714 aa] {ON} YNL161...    46   4e-04
KLLA0B03586g Chr2 complement(326871..329075) [2205 bp, 734 aa] {...    46   4e-04
NCAS0G02070 Chr7 (372747..374960) [2214 bp, 737 aa] {ON} Anc_2.96      46   4e-04
TDEL0F00840 Chr6 (144884..146875) [1992 bp, 663 aa] {ON} Anc_2.9...    46   4e-04
KNAG0F01440 Chr6 (261403..263685) [2283 bp, 760 aa] {ON}               46   4e-04
ABL028W Chr2 (345953..348121) [2169 bp, 722 aa] {ON} Syntenic ho...    46   4e-04
SAKL0E03608g Chr5 complement(291806..294007) [2202 bp, 733 aa] {...    46   4e-04
ZYRO0A07546g Chr1 complement(619278..620747,620833..620847) [148...    46   4e-04
Suva_11.65 Chr11 complement(134606..136120) [1515 bp, 504 aa] {O...    46   4e-04
TBLA0A02240 Chr1 (539297..540538) [1242 bp, 413 aa] {ON} Anc_6.2...    46   4e-04
KLLA0F23155g Chr6 (2157146..2158429) [1284 bp, 427 aa] {ON} simi...    46   4e-04
KLTH0F05918g Chr6 complement(525566..527254) [1689 bp, 562 aa] {...    46   4e-04
YJL128C Chr10 complement(178097..180103) [2007 bp, 668 aa] {ON} ...    46   5e-04
KLTH0B09042g Chr2 (736520..738112) [1593 bp, 530 aa] {ON} simila...    46   5e-04
CAGL0H00979g Chr8 complement(94328..95527) [1200 bp, 399 aa] {ON...    45   5e-04
KAFR0B01510 Chr2 complement(284425..286092) [1668 bp, 555 aa] {O...    46   5e-04
KNAG0M00190 Chr13 complement(25224..27602) [2379 bp, 792 aa] {ON...    46   5e-04
KNAG0J02660 Chr10 (495011..497425) [2415 bp, 804 aa] {ON} Anc_1....    46   5e-04
Skud_2.90 Chr2 (176138..177199) [1062 bp, 353 aa] {ON} YBL016W (...    45   6e-04
TDEL0D04600 Chr4 (843530..845917) [2388 bp, 795 aa] {ON} Anc_3.1...    46   6e-04
SAKL0C07348g Chr3 (677348..679933) [2586 bp, 861 aa] {ON} some s...    46   6e-04
NCAS0B07380 Chr2 complement(1396315..1397898) [1584 bp, 527 aa] ...    45   6e-04
SAKL0G06402g Chr7 (535632..537986) [2355 bp, 784 aa] {ON} simila...    46   6e-04
ZYRO0E05588g Chr5 (430271..431686) [1416 bp, 471 aa] {ON} simila...    45   6e-04
ZYRO0B04906g Chr2 (395546..398089) [2544 bp, 847 aa] {ON} simila...    46   6e-04
TBLA0I00280 Chr9 (42870..46820) [3951 bp, 1316 aa] {ON} Anc_2.49...    46   6e-04
CAGL0F00913g Chr6 (97023..100643) [3621 bp, 1206 aa] {ON} simila...    46   6e-04
Skud_7.91 Chr7 (165681..168374) [2694 bp, 897 aa] {ON} YGL180W (...    45   7e-04
KLTH0D04818g Chr4 (439491..441566) [2076 bp, 691 aa] {ON} simila...    45   7e-04
Skud_10.87 Chr10 complement(153140..155164) [2025 bp, 674 aa] {O...    45   7e-04
KLTH0D05082g Chr4 complement(457124..458680) [1557 bp, 518 aa] {...    45   7e-04
KLTH0F06468g Chr6 (559256..561769) [2514 bp, 837 aa] {ON} simila...    45   7e-04
Suva_7.83 Chr7 complement(159329..161038) [1710 bp, 569 aa] {ON}...    45   7e-04
NCAS0A04360 Chr1 (880768..882822) [2055 bp, 684 aa] {ON} Anc_2.446     45   7e-04
TDEL0G02820 Chr7 complement(543911..545377,545450..545476) [1494...    45   7e-04
Smik_3.189 Chr3 (273885..276044) [2160 bp, 719 aa] {ON} YCR091W ...    45   7e-04
KAFR0A01760 Chr1 complement(363462..366119) [2658 bp, 885 aa] {O...    45   8e-04
AFL143C Chr6 complement(164241..165326) [1086 bp, 361 aa] {ON} S...    45   8e-04
Sklu_YGOB_Anc_2.496 Chr5 (185447..187306) [1860 bp, 619 aa] {ON}...    45   8e-04
YCR073C Chr3 complement(242588..246583) [3996 bp, 1331 aa] {ON} ...    45   8e-04
NCAS0I02080 Chr9 (390551..392875) [2325 bp, 774 aa] {ON} Anc_3.162     45   8e-04
CAGL0K03399g Chr11 complement(311316..313427) [2112 bp, 703 aa] ...    45   8e-04
YNR031C Chr14 complement(680694..685433) [4740 bp, 1579 aa] {ON}...    45   9e-04
NDAI0B03190 Chr2 complement(815759..817309) [1551 bp, 516 aa] {O...    45   0.001
NCAS0C04120 Chr3 complement(840008..842755) [2748 bp, 915 aa] {O...    45   0.001
AER232C Chr5 complement(1066272..1067981) [1710 bp, 569 aa] {ON}...    45   0.001
Kwal_26.7635 s26 (451306..453381) [2076 bp, 691 aa] {ON} YKL126W...    45   0.001
TBLA0D02230 Chr4 (557816..561280) [3465 bp, 1154 aa] {ON} Anc_8....    45   0.001
NDAI0A06620 Chr1 complement(1510218..1512461) [2244 bp, 747 aa] ...    45   0.001
KAFR0A07370 Chr1 complement(1487868..1490012) [2145 bp, 714 aa] ...    45   0.001
Kwal_17.2687 s17 complement(6084..7172) [1089 bp, 362 aa] {ON} Y...    44   0.001
Smik_14.360 Chr14 complement(638655..643406) [4752 bp, 1583 aa] ...    45   0.001
KLLA0C08525g Chr3 (744554..749209) [4656 bp, 1551 aa] {ON} simil...    45   0.001
AFR035W Chr6 (498529..500688) [2160 bp, 719 aa] {ON} Syntenic ho...    45   0.001
SAKL0E03344g Chr5 (272024..273754) [1731 bp, 576 aa] {ON} simila...    45   0.001
Ecym_8400 Chr8 complement(825315..828515) [3201 bp, 1066 aa] {ON...    45   0.001
ACL053C Chr3 complement(273163..276708) [3546 bp, 1181 aa] {ON} ...    45   0.001
TPHA0H01880 Chr8 (441140..442402) [1263 bp, 420 aa] {ON} Anc_6.2...    44   0.001
ADR379C Chr4 complement(1386598..1388076) [1479 bp, 492 aa] {ON}...    44   0.001
Suva_15.411 Chr15 (716095..718542) [2448 bp, 815 aa] {ON} YHR205...    44   0.001
Ecym_8399 Chr8 (821221..824766) [3546 bp, 1181 aa] {ON} similar ...    44   0.002
Suva_6.208 Chr6 (369853..371880) [2028 bp, 675 aa] {ON} YJL128C ...    44   0.002
Ecym_1030 Chr1 (56043..57365) [1323 bp, 440 aa] {ON} similar to ...    44   0.002
Smik_8.295 Chr8 (484074..486548) [2475 bp, 824 aa] {ON} YHR205W ...    44   0.002
Ecym_5236 Chr5 (486270..488864) [2595 bp, 864 aa] {ON} similar t...    44   0.002
ADR167W Chr4 (994581..997202) [2622 bp, 873 aa] {ON} Syntenic ho...    44   0.002
TBLA0I02400 Chr9 complement(548975..554167) [5193 bp, 1730 aa] {...    44   0.002
YMR291W Chr13 (852630..854390) [1761 bp, 586 aa] {ON}  TDA1Prote...    44   0.002
YHR205W Chr8 (509363..511837) [2475 bp, 824 aa] {ON}  SCH9AGC fa...    44   0.002
KAFR0C02840 Chr3 (559821..560873) [1053 bp, 350 aa] {ON} Anc_8.1...    44   0.002
KLLA0C18568g Chr3 (1639958..1642282) [2325 bp, 774 aa] {ON} simi...    44   0.002
AFR724C Chr6 complement(1770338..1771660) [1323 bp, 440 aa] {ON}...    44   0.002
Kpol_541.49 s541 complement(156530..159514) [2985 bp, 994 aa] {O...    44   0.002
NDAI0G03450 Chr7 (822716..825562) [2847 bp, 948 aa] {ON} Anc_8.141     44   0.002
KAFR0A05090 Chr1 (1011918..1013924) [2007 bp, 668 aa] {ON}             44   0.002
AFR377C Chr6 complement(1116589..1118769) [2181 bp, 726 aa] {ON}...    44   0.002
TDEL0F00930 Chr6 complement(160181..163573) [3393 bp, 1130 aa] {...    44   0.002
KLLA0C17160g Chr3 (1498959..1501454) [2496 bp, 831 aa] {ON} simi...    44   0.002
Kwal_56.22693 s56 complement(239982..242936) [2955 bp, 984 aa] {...    44   0.002
Skud_8.272 Chr8 (478199..480706) [2508 bp, 835 aa] {ON} YHR205W ...    44   0.002
NCAS0G01210 Chr7 complement(215860..216963) [1104 bp, 367 aa] {O...    43   0.002
KAFR0D03100 Chr4 complement(610106..611635) [1530 bp, 509 aa] {O...    44   0.002
Kpol_1033.63 s1033 complement(158652..160205) [1554 bp, 517 aa] ...    44   0.002
KNAG0G02300 Chr7 (528489..529748) [1260 bp, 419 aa] {ON} Anc_8.3...    43   0.002
KNAG0A05670 Chr1 complement(847460..849016) [1557 bp, 518 aa] {O...    44   0.002
KLLA0C03828g Chr3 (349187..351568) [2382 bp, 793 aa] {ON} simila...    44   0.002
KAFR0A08360 Chr1 complement(1677561..1680050) [2490 bp, 829 aa] ...    44   0.003
CAGL0L11550g Chr12 (1232015..1235233) [3219 bp, 1072 aa] {ON} si...    44   0.003
NDAI0K02100 Chr11 complement(469575..472304) [2730 bp, 909 aa] {...    44   0.003
TBLA0A08430 Chr1 complement(2075682..2076773) [1092 bp, 363 aa] ...    43   0.003
Skud_4.97 Chr4 (168099..169670) [1572 bp, 523 aa] {ON} YDL159W (...    43   0.003
CAGL0K02673g Chr11 complement(241338..244085) [2748 bp, 915 aa] ...    44   0.003
TPHA0P01270 Chr16 complement(254480..257137) [2658 bp, 885 aa] {...    44   0.003
KNAG0A06290 Chr1 (958438..960516) [2079 bp, 692 aa] {ON} Anc_2.4...    44   0.003
Smik_4.207 Chr4 complement(381159..383456) [2298 bp, 765 aa] {ON...    44   0.003
CAGL0J06072g Chr10 complement(574501..576822) [2322 bp, 773 aa] ...    44   0.003
KNAG0M01450 Chr13 (254622..256061) [1440 bp, 479 aa] {ON}              43   0.003
KAFR0F02220 Chr6 (432967..435210) [2244 bp, 747 aa] {ON} Anc_3.1...    43   0.003
Kwal_55.20326 s55 complement(351010..353262) [2253 bp, 750 aa] {...    43   0.003
Suva_15.297 Chr15 (518854..520850,520945..522172) [3225 bp, 1074...    44   0.003
CAGL0M08404g Chr13 complement(836791..838179) [1389 bp, 462 aa] ...    43   0.003
Kwal_23.5576 s23 complement(1223517..1225031) [1515 bp, 504 aa] ...    43   0.003
YDL028C Chr4 complement(400997..403291) [2295 bp, 764 aa] {ON}  ...    43   0.003
Kwal_26.6921 s26 (123345..123875) [531 bp, 176 aa] {OFF} YOR351C...    41   0.003
Smik_14.311 Chr14 complement(558013..559926) [1914 bp, 637 aa] {...    43   0.003
KLTH0D01386g Chr4 (129448..130053,130132..130974) [1449 bp, 482 ...    43   0.003
Kpol_499.3 s499 complement(6075..7199) [1125 bp, 374 aa] {ON} co...    43   0.003
TDEL0E03520 Chr5 (657779..659251) [1473 bp, 490 aa] {ON} Anc_5.2...    43   0.003
ABL055C Chr2 complement(295495..297105) [1611 bp, 536 aa] {ON} S...    43   0.004
TPHA0B02440 Chr2 (560189..561592) [1404 bp, 467 aa] {ON} Anc_5.2...    43   0.004
KAFR0A03710 Chr1 (758918..760399) [1482 bp, 493 aa] {ON} Anc_8.6...    43   0.004
ZYRO0D08184g Chr4 (706856..711601) [4746 bp, 1581 aa] {ON} simil...    43   0.004
NCAS0A14050 Chr1 complement(2763082..2764551) [1470 bp, 489 aa] ...    43   0.004
TPHA0C02880 Chr3 (623723..624778) [1056 bp, 351 aa] {ON} Anc_8.1...    42   0.004
Skud_4.223 Chr4 complement(395836..398145) [2310 bp, 769 aa] {ON...    43   0.004
AFL217C Chr6 complement(30765..32840) [2076 bp, 691 aa] {ON} Syn...    43   0.004
Suva_14.327 Chr14 complement(578572..580470) [1899 bp, 632 aa] {...    43   0.004
Suva_4.221 Chr4 complement(391492..393789) [2298 bp, 765 aa] {ON...    43   0.004
KLLA0F14190g Chr6 (1311121..1315137) [4017 bp, 1338 aa] {ON} uni...    43   0.004
NCAS0C04100 Chr3 (834997..837714) [2718 bp, 905 aa] {ON} Anc_8.141     43   0.004
SAKL0H01364g Chr8 complement(143450..145141) [1692 bp, 563 aa] {...    43   0.004
NDAI0K01480 Chr11 complement(337108..338706) [1599 bp, 532 aa] {...    43   0.005
Kwal_56.23841 s56 (732202..733500) [1299 bp, 432 aa] {ON} YLR113...    42   0.005
KLTH0G12738g Chr7 complement(1085500..1086804) [1305 bp, 434 aa]...    42   0.005
KLTH0E06776g Chr5 complement(622147..625575) [3429 bp, 1142 aa] ...    43   0.005
CAGL0K11550g Chr11 (1118971..1120587) [1617 bp, 538 aa] {ON} sim...    42   0.005
SAKL0A00484g Chr1 complement(57938..60544) [2607 bp, 868 aa] {ON...    43   0.005
TDEL0D02040 Chr4 (395555..397138) [1584 bp, 527 aa] {ON} Anc_1.3...    42   0.005
Suva_4.535 Chr4 (921278..922861) [1584 bp, 527 aa] {ON} YBR274W ...    42   0.005
SAKL0E12342g Chr5 complement(1021369..1023795) [2427 bp, 808 aa]...    43   0.005
Ecym_4647 Chr4 (1261859..1263511) [1653 bp, 550 aa] {ON} similar...    42   0.005
Ecym_7414 Chr7 (848665..850440) [1776 bp, 591 aa] {ON} similar t...    42   0.005
Skud_13.262 Chr13 complement(448758..450791) [2034 bp, 677 aa] {...    42   0.005
Smik_4.79 Chr4 (149246..150796) [1551 bp, 516 aa] {ON} YDL159W (...    42   0.005
Skud_13.465 Chr13 (826172..827929) [1758 bp, 585 aa] {ON} YMR291...    42   0.005
YNL298W Chr14 (68915..71443) [2529 bp, 842 aa] {ON}  CLA4Cdc42p-...    43   0.005
TDEL0A02330 Chr1 complement(420205..421662) [1458 bp, 485 aa] {O...    42   0.005
Smik_15.39 Chr15 (72332..74314) [1983 bp, 660 aa] {ON} YOL113W (...    42   0.005
Kpol_543.55 s543 (126256..127533) [1278 bp, 425 aa] {ON} (126256...    42   0.006
TDEL0B04700 Chr2 (834336..836996) [2661 bp, 886 aa] {ON} Anc_8.1...    42   0.006
Kpol_209.1 s209 (1823..5734) [3912 bp, 1303 aa] {ON} (1823..5734...    43   0.006
TBLA0F00820 Chr6 (209607..211844) [2238 bp, 745 aa] {ON} Anc_3.1...    42   0.006
TBLA0B08520 Chr2 complement(2038517..2041321) [2805 bp, 934 aa] ...    42   0.006
Kwal_26.7682 s26 complement(470565..472121) [1557 bp, 518 aa] {O...    42   0.006
Skud_16.42 Chr16 complement(75193..76287) [1095 bp, 364 aa] {ON}...    42   0.006
TDEL0B04490 Chr2 (792559..793629) [1071 bp, 356 aa] {ON} Anc_8.1...    42   0.006
NCAS0F01580 Chr6 complement(313801..317949) [4149 bp, 1382 aa] {...    42   0.006
ZYRO0G02816g Chr7 complement(213421..214980) [1560 bp, 519 aa] {...    42   0.006
TPHA0I00920 Chr9 (204753..209057) [4305 bp, 1434 aa] {ON} Anc_1....    42   0.006
ACL054W Chr3 (269703..272621) [2919 bp, 972 aa] {ON} Syntenic ho...    42   0.006
YDL159W Chr4 (172481..174028) [1548 bp, 515 aa] {ON}  STE7Signal...    42   0.007
KNAG0I02830 Chr9 (549811..554358) [4548 bp, 1515 aa] {ON} Anc_1....    42   0.007
Smik_11.58 Chr11 (112932..115715) [2784 bp, 927 aa] {ON} YKL171W...    42   0.007
KLTH0G06974g Chr7 (556626..558125) [1500 bp, 499 aa] {ON} highly...    42   0.007
YKL171W Chr11 (127475..130261) [2787 bp, 928 aa] {ON}  NNK1Prote...    42   0.007
TPHA0M00300 Chr13 (59377..61701) [2325 bp, 774 aa] {ON} Anc_3.16...    42   0.007
TBLA0A03220 Chr1 complement(765108..768590) [3483 bp, 1160 aa] {...    42   0.007
Suva_7.325 Chr7 (550760..551866) [1107 bp, 368 aa] {ON} YGR040W ...    42   0.007
KLLA0C14278g Chr3 (1240990..1242615) [1626 bp, 541 aa] {ON} simi...    42   0.008
Kpol_185.2 s185 complement(1614..3704) [2091 bp, 696 aa] {ON} co...    42   0.008
TDEL0A06750 Chr1 (1179818..1180936) [1119 bp, 372 aa] {ON} Anc_6...    42   0.008
Skud_11.113 Chr11 complement(207796..209355) [1560 bp, 519 aa] {...    42   0.008
Ecym_8164 Chr8 (342672..346076) [3405 bp, 1134 aa] {ON} similar ...    42   0.008
Suva_2.642 Chr2 (1147428..1148865,1149541..1150805) [2703 bp, 90...    42   0.008
SAKL0C12386g Chr3 complement(1108341..1110923) [2583 bp, 860 aa]...    42   0.008
Kwal_33.13112 s33 (76807..78324) [1518 bp, 505 aa] {ON} YDR523C ...    42   0.008
ZYRO0A12826g Chr1 (1014651..1015751) [1101 bp, 366 aa] {ON} high...    42   0.008
Suva_11.108 Chr11 complement(207520..209070) [1551 bp, 516 aa] {...    42   0.008
ZYRO0C02288g Chr3 complement(181604..184327) [2724 bp, 907 aa] {...    42   0.009
Ecym_6400 Chr6 complement(779716..781983) [2268 bp, 755 aa] {ON}...    42   0.009
Ecym_7361 Chr7 complement(753862..755313) [1452 bp, 483 aa] {ON}...    42   0.009
CAGL0M03729g Chr13 complement(420316..422901) [2586 bp, 861 aa] ...    42   0.009
Smik_14.34 Chr14 (53272..55788) [2517 bp, 838 aa] {ON} YNL298W (...    42   0.009
TPHA0M01840 Chr13 complement(380953..385818) [4866 bp, 1621 aa] ...    42   0.009
TDEL0D02650 Chr4 complement(505536..506636) [1101 bp, 366 aa] {O...    41   0.009
CAGL0D02244g Chr4 complement(229504..230967) [1464 bp, 487 aa] {...    42   0.009
KNAG0D01140 Chr4 (192308..193495) [1188 bp, 395 aa] {ON}               42   0.009
YKL116C Chr11 complement(221344..222900) [1557 bp, 518 aa] {ON} ...    42   0.010
YDR466W Chr4 (1395121..1397817) [2697 bp, 898 aa] {ON}  PKH3Prot...    42   0.010
NDAI0B02900 Chr2 complement(737651..738709) [1059 bp, 352 aa] {O...    41   0.010
ZYRO0D07502g Chr4 complement(652782..654320) [1539 bp, 512 aa] {...    42   0.010
Suva_11.52 Chr11 (112355..115156) [2802 bp, 933 aa] {ON} YKL171W...    42   0.010
KLTH0C09548g Chr3 (792218..795199) [2982 bp, 993 aa] {ON} simila...    42   0.010
Kwal_26.8347 s26 complement(748254..750032) [1779 bp, 592 aa] {O...    42   0.010
Kpol_1055.24 s1055 complement(57430..60243) [2814 bp, 937 aa] {O...    42   0.011
NDAI0H01020 Chr8 complement(225366..228566) [3201 bp, 1066 aa] {...    42   0.011
KLLA0B13607g Chr2 (1191592..1194561) [2970 bp, 989 aa] {ON} simi...    42   0.011
NCAS0A05050 Chr1 complement(1002107..1004788) [2682 bp, 893 aa] ...    42   0.011
NCAS0H03070 Chr8 complement(590494..592440) [1947 bp, 648 aa] {O...    42   0.011
TBLA0B06940 Chr2 (1639189..1643520) [4332 bp, 1443 aa] {ON} Anc_...    42   0.011
Ecym_5505 Chr5 (1027605..1030616) [3012 bp, 1003 aa] {ON} simila...    42   0.011
TPHA0H02630 Chr8 complement(614048..618151) [4104 bp, 1367 aa] {...    42   0.011
SAKL0H19668g Chr8 (1736301..1737674) [1374 bp, 457 aa] {ON} high...    41   0.012
KLLA0C12485g Chr3 (1060167..1062944) [2778 bp, 925 aa] {ON} simi...    42   0.012
CAGL0M13541g Chr13 (1333846..1335714) [1869 bp, 622 aa] {ON} sim...    41   0.012
Kpol_1066.45 s1066 complement(76786..79428) [2643 bp, 880 aa] {O...    42   0.012
Suva_4.87 Chr4 (160236..161810) [1575 bp, 524 aa] {ON} YDL159W (...    41   0.012
TDEL0E00690 Chr5 (144269..146770) [2502 bp, 833 aa] {ON} Anc_3.6...    41   0.012
KNAG0B05350 Chr2 complement(1034166..1036676) [2511 bp, 836 aa] ...    41   0.012
ZYRO0G05214g Chr7 (420482..422980) [2499 bp, 832 aa] {ON} some s...    41   0.013
SAKL0G08448g Chr7 (718250..721717) [3468 bp, 1155 aa] {ON} simil...    42   0.013
NDAI0C03900 Chr3 complement(883841..885310) [1470 bp, 489 aa] {O...    41   0.013
Smik_12.173 Chr12 (351727..353034) [1308 bp, 435 aa] {ON} YLR113...    41   0.013
TDEL0H01070 Chr8 complement(192834..194624) [1791 bp, 596 aa] {O...    41   0.013
SAKL0C05236g Chr3 (498347..501385) [3039 bp, 1012 aa] {ON} simil...    41   0.013
Kwal_23.4276 s23 complement(648061..649626) [1566 bp, 521 aa] {O...    41   0.013
KLLA0C00979g Chr3 (73295..74746) [1452 bp, 483 aa] {ON} similar ...    41   0.013
Skud_5.249 Chr5 complement(400867..404310) [3444 bp, 1147 aa] {O...    41   0.013
TDEL0E02180 Chr5 complement(408232..411195) [2964 bp, 987 aa] {O...    41   0.013
KNAG0A06750 Chr1 (1053919..1056294) [2376 bp, 791 aa] {ON} Anc_2...    41   0.014
TPHA0G02480 Chr7 (509815..511860) [2046 bp, 681 aa] {ON} Anc_2.4...    41   0.014
Skud_14.40 Chr14 (62496..65006) [2511 bp, 836 aa] {ON} YNL298W (...    41   0.014
Skud_11.54 Chr11 (113775..116570) [2796 bp, 931 aa] {ON} YKL171W...    41   0.014
SAKL0A03344g Chr1 complement(305149..306243) [1095 bp, 364 aa] {...    41   0.014
Ecym_6307 Chr6 (578677..580227) [1551 bp, 516 aa] {ON} similar t...    41   0.015
Suva_13.481 Chr13 (834531..836279) [1749 bp, 582 aa] {ON} YMR291...    41   0.015
Smik_6.125 Chr6 (201071..202177) [1107 bp, 368 aa] {ON} YGR040W ...    41   0.015
Kwal_33.14167 s33 (554863..557379) [2517 bp, 838 aa] {ON} YDL028...    41   0.015
Ecym_2302 Chr2 (587299..588951) [1653 bp, 550 aa] {ON} similar t...    41   0.015
SAKL0C00946g Chr3 (84995..86689) [1695 bp, 564 aa] {ON} similar ...    41   0.015
SAKL0G01848g Chr7 (154547..157204) [2658 bp, 885 aa] {ON} weakly...    41   0.015
Suva_14.42 Chr14 (65645..68239) [2595 bp, 864 aa] {ON} YNL298W (...    41   0.015
SAKL0G10978g Chr7 (929164..930729) [1566 bp, 521 aa] {ON} highly...    41   0.015
Skud_7.337 Chr7 (562750..563856) [1107 bp, 368 aa] {ON} YGR040W ...    40   0.016
SAKL0H24706g Chr8 (2145552..2149100) [3549 bp, 1182 aa] {ON} sim...    41   0.016
KLLA0C04213g Chr3 (386815..387999) [1185 bp, 394 aa] {ON} simila...    40   0.016
NCAS0A04440 Chr1 complement(895181..896935) [1755 bp, 584 aa] {O...    41   0.017
NCAS0A02120 Chr1 (401097..402230) [1134 bp, 377 aa] {ON} Anc_4.184     40   0.017
KLLA0F07623g Chr6 (720246..723935) [3690 bp, 1229 aa] {ON} simil...    41   0.017
Smik_8.180 Chr8 (292993..296214) [3222 bp, 1073 aa] {ON} YHR102W...    41   0.017
NCAS0H01740 Chr8 complement(331436..335284) [3849 bp, 1282 aa] {...    41   0.018
Kpol_1002.111 s1002 (277615..278664) [1050 bp, 349 aa] {ON} (277...    40   0.018
NDAI0A00920 Chr1 (189693..192521) [2829 bp, 942 aa] {ON} Anc_1.1...    41   0.018
AEL179W Chr5 (302948..303817) [870 bp, 289 aa] {ON} NOHBY510; No...    40   0.018
KNAG0A03060 Chr1 complement(375640..377142) [1503 bp, 500 aa] {O...    40   0.018
Kwal_47.18307 s47 complement(776521..778386) [1866 bp, 621 aa] {...    41   0.018
SAKL0H16038g Chr8 complement(1401627..1402931) [1305 bp, 434 aa]...    40   0.019
Skud_8.39 Chr8 complement(76730..79501) [2772 bp, 923 aa] {ON} Y...    41   0.019
Suva_10.202 Chr10 (380079..381386) [1308 bp, 435 aa] {ON} YLR113...    40   0.019
TPHA0H01470 Chr8 complement(329451..333578) [4128 bp, 1375 aa] {...    41   0.019
KLLA0E15313g Chr5 (1362851..1365025) [2175 bp, 724 aa] {ON} simi...    41   0.019
Smik_8.42 Chr8 complement(74075..76894) [2820 bp, 939 aa] {ON} Y...    41   0.020
NCAS0C03380 Chr3 complement(664012..665310) [1299 bp, 432 aa] {O...    40   0.020
YGR040W Chr7 (575398..576504) [1107 bp, 368 aa] {ON}  KSS1Mitoge...    40   0.021
Smik_13.507 Chr13 (835298..837058) [1761 bp, 586 aa] {ON} YMR291...    40   0.021
Skud_12.181 Chr12 (354407..355702) [1296 bp, 431 aa] {ON} YLR113...    40   0.022
Suva_11.56 Chr11 complement(119479..120675) [1197 bp, 398 aa] {O...    40   0.022
KLTH0H03080g Chr8 complement(274038..275078) [1041 bp, 346 aa] {...    40   0.022
KLTH0F04840g Chr6 complement(427194..428339) [1146 bp, 381 aa] {...    40   0.022
YPL203W Chr16 (166256..167398) [1143 bp, 380 aa] {ON}  TPK2cAMP-...    40   0.023
Kwal_23.5290 s23 complement(1095011..1097470) [2460 bp, 819 aa] ...    40   0.024
Kpol_1035.17 s1035 complement(39908..41503) [1596 bp, 531 aa] {O...    40   0.024
Skud_16.76 Chr16 (139571..140719) [1149 bp, 382 aa] {ON} YPL203W...    40   0.025
CAGL0J04290g Chr10 complement(403542..404615) [1074 bp, 357 aa] ...    40   0.025
ZYRO0A06446g Chr1 complement(513126..515957) [2832 bp, 943 aa] {...    40   0.025
Smik_11.125 Chr11 complement(208208..209764) [1557 bp, 518 aa] {...    40   0.026
CAGL0K02167g Chr11 complement(192297..195785) [3489 bp, 1162 aa]...    40   0.026
TBLA0H01660 Chr8 complement(377521..380511) [2991 bp, 996 aa] {O...    40   0.027
KAFR0D01220 Chr4 (246927..250094) [3168 bp, 1055 aa] {ON} Anc_7....    40   0.027
Suva_16.104 Chr16 (176201..177352) [1152 bp, 383 aa] {ON} YPL203...    40   0.027
KLTH0A01320g Chr1 (118671..121115) [2445 bp, 814 aa] {ON} simila...    40   0.027
Kpol_1039.33 s1039 complement(102096..104201) [2106 bp, 701 aa] ...    40   0.027
YPL236C Chr16 complement(101608..102702) [1095 bp, 364 aa] {ON} ...    40   0.027
KAFR0D04760 Chr4 complement(932849..936205) [3357 bp, 1118 aa] {...    40   0.028
KLTH0D08712g Chr4 complement(728072..729886) [1815 bp, 604 aa] {...    40   0.028
Smik_11.62 Chr11 complement(120153..121346) [1194 bp, 397 aa] {O...    40   0.028
ZYRO0G18590g Chr7 complement(1533974..1536202) [2229 bp, 742 aa]...    40   0.028
NDAI0F01650 Chr6 (403635..404738) [1104 bp, 367 aa] {ON} Anc_6.214     40   0.028
Suva_4.223 Chr4 complement(395869..397719) [1851 bp, 616 aa] {ON...    40   0.029
NCAS0A01100 Chr1 (218400..219464) [1065 bp, 354 aa] {ON}               40   0.030
TBLA0A08810 Chr1 (2161249..2162304) [1056 bp, 351 aa] {ON} Anc_8...    40   0.030
NDAI0A06130 Chr1 complement(1391744..1394203) [2460 bp, 819 aa] ...    40   0.030
Smik_6.408 Chr6 complement(657018..658163) [1146 bp, 381 aa] {ON...    40   0.030
NCAS0B05560 Chr2 complement(1050313..1051371) [1059 bp, 352 aa] ...    40   0.031
Kpol_1028.40 s1028 (95617..100392) [4776 bp, 1591 aa] {ON} (9561...    40   0.031
NCAS0A07990 Chr1 complement(1578473..1581346) [2874 bp, 957 aa] ...    40   0.031
Ecym_3323 Chr3 (618386..620632) [2247 bp, 748 aa] {ON} similar t...    40   0.032
Kwal_56.24274 s56 (932404..933444) [1041 bp, 346 aa] {ON} YPL236...    40   0.032
YHL007C Chr8 complement(95118..97937) [2820 bp, 939 aa] {ON}  ST...    40   0.032
Ecym_8095 Chr8 (205952..207106) [1155 bp, 384 aa] {ON} similar t...    40   0.032
ZYRO0G16082g Chr7 complement(1320266..1321714) [1449 bp, 482 aa]...    40   0.033
YKL166C Chr11 complement(134509..135705) [1197 bp, 398 aa] {ON} ...    40   0.033
Suva_16.70 Chr16 complement(110631..111725) [1095 bp, 364 aa] {O...    40   0.033
Smik_6.441 Chr6 (721619..722713) [1095 bp, 364 aa] {ON} YPL236C ...    40   0.033
KNAG0B04320 Chr2 complement(821265..824348) [3084 bp, 1027 aa] {...    40   0.034
Kpol_1002.21 s1002 complement(62702..63895) [1194 bp, 397 aa] {O...    40   0.035
Suva_2.449 Chr2 complement(789612..794603) [4992 bp, 1663 aa] {O...    40   0.036
KLTH0F00946g Chr6 (73412..74950) [1539 bp, 512 aa] {ON} similar ...    40   0.036
NCAS0B08280 Chr2 (1579804..1581033) [1230 bp, 409 aa] {ON} Anc_1...    40   0.036
NCAS0H01940 Chr8 (374913..377960) [3048 bp, 1015 aa] {ON} Anc_5....    40   0.036
YGL179C Chr7 complement(163409..165091) [1683 bp, 560 aa] {ON}  ...    40   0.037
NDAI0C01700 Chr3 complement(367077..370139) [3063 bp, 1020 aa] {...    40   0.037
NCAS0J00960 Chr10 (157010..159121) [2112 bp, 703 aa] {ON}              40   0.037
TPHA0P01050 Chr16 complement(212259..215624) [3366 bp, 1121 aa] ...    40   0.038
KAFR0D04950 Chr4 (971956..974982) [3027 bp, 1008 aa] {ON} Anc_5....    40   0.038
NCAS0A09960 Chr1 complement(1993554..1995926) [2373 bp, 790 aa] ...    40   0.038
Skud_11.58 Chr11 complement(120855..122042) [1188 bp, 395 aa] {O...    39   0.038
TBLA0F02350 Chr6 complement(578797..580467) [1671 bp, 556 aa] {O...    40   0.039
TPHA0G02990 Chr7 complement(640488..642098) [1611 bp, 536 aa] {O...    40   0.039
Kpol_183.1 s183 (158..2257) [2100 bp, 699 aa] {ON} (158..2257) [...    40   0.039
TBLA0B00770 Chr2 complement(168444..170519) [2076 bp, 691 aa] {O...    40   0.040
Ecym_3525 Chr3 (993328..995784) [2457 bp, 818 aa] {ON} similar t...    40   0.041
KAFR0B02980 Chr2 (623470..624804) [1335 bp, 444 aa] {ON} Anc_8.3...    39   0.041
KNAG0D04810 Chr4 (867817..872139) [4323 bp, 1440 aa] {ON} Anc_7....    40   0.041
CAGL0H06259g Chr8 (615045..619055) [4011 bp, 1336 aa] {ON} simil...    40   0.042
Kwal_26.7355 s26 (326867..331207) [4341 bp, 1446 aa] {ON} YJL095...    40   0.042
TPHA0C03380 Chr3 (740939..743032) [2094 bp, 697 aa] {ON} Anc_2.2...    40   0.043
Skud_4.225 Chr4 complement(400160..401992) [1833 bp, 610 aa] {ON...    40   0.044
ZYRO0B07854g Chr2 complement(613992..616007) [2016 bp, 671 aa] {...    40   0.045
CAGL0L03520g Chr12 complement(403100..407443) [4344 bp, 1447 aa]...    40   0.047
TBLA0A04720 Chr1 (1168895..1172683) [3789 bp, 1262 aa] {ON} Anc_...    40   0.048
KLTH0D10670g Chr4 (877472..878806) [1335 bp, 444 aa] {ON} some s...    39   0.048
TBLA0A02030 Chr1 complement(491365..492576) [1212 bp, 403 aa] {O...    39   0.049
Kwal_23.3992 s23 complement(515493..517208) [1716 bp, 571 aa] {O...    39   0.050
NCAS0C03690 Chr3 (741930..744881) [2952 bp, 983 aa] {ON}               39   0.050
TBLA0A10420 Chr1 (2562614..2564092) [1479 bp, 492 aa] {ON} Anc_5...    39   0.050
SAKL0D12628g Chr4 (1048973..1051429) [2457 bp, 818 aa] {ON} weak...    39   0.050
KAFR0F01800 Chr6 complement(350480..351754) [1275 bp, 424 aa] {O...    39   0.051
Ecym_2434 Chr2 complement(843308..846676) [3369 bp, 1122 aa] {ON...    39   0.051
Suva_15.46 Chr15 (81948..83909) [1962 bp, 653 aa] {ON} YOL113W (...    39   0.051
Kwal_33.14081 s33 complement(519343..521085) [1743 bp, 580 aa] {...    39   0.052
Kpol_1044.3 s1044 (4910..5845,5849..7711) [2799 bp, 932 aa] {ON}...    39   0.054
AEL205W Chr5 (246871..249252) [2382 bp, 793 aa] {ON} Syntenic ho...    39   0.054
ZYRO0G08844g Chr7 complement(711678..712766) [1089 bp, 362 aa] {...    39   0.055
Ecym_4523 Chr4 (1039929..1042070) [2142 bp, 713 aa] {ON} similar...    39   0.056
TDEL0D05320 Chr4 complement(965082..968255) [3174 bp, 1057 aa] {...    39   0.057
NDAI0A04760 Chr1 complement(1088637..1090103) [1467 bp, 488 aa] ...    39   0.058
NDAI0F01340 Chr6 complement(327928..329148) [1221 bp, 406 aa] {O...    39   0.058
TPHA0H01630 Chr8 (371333..374443) [3111 bp, 1036 aa] {ON} Anc_5....    39   0.059
Skud_4.742 Chr4 (1315170..1317881) [2712 bp, 903 aa] {ON} YDR466...    39   0.059
KNAG0G01430 Chr7 complement(322758..323822) [1065 bp, 354 aa] {O...    39   0.061
ZYRO0F11418g Chr6 complement(936573..938117) [1545 bp, 514 aa] {...    39   0.061
KAFR0F03900 Chr6 (763094..764203) [1110 bp, 369 aa] {ON} Anc_4.1...    39   0.061
ACR196C Chr3 complement(692321..693913) [1593 bp, 530 aa] {ON} S...    39   0.061
Smik_12.450 Chr12 (788896..791106) [2211 bp, 736 aa] {ON} YLR362...    39   0.062
TDEL0H03640 Chr8 complement(600211..603924) [3714 bp, 1237 aa] {...    39   0.064
KAFR0E01810 Chr5 complement(372094..373524) [1431 bp, 476 aa] {O...    39   0.065
Kwal_26.7154 s26 (237387..241028) [3642 bp, 1213 aa] {ON} YOL045...    39   0.066
TPHA0D01540 Chr4 complement(316471..318594) [2124 bp, 707 aa] {O...    39   0.066
KLLA0E03587g Chr5 complement(323764..325707) [1944 bp, 647 aa] {...    39   0.068
Smik_8.156 Chr8 complement(234928..238269) [3342 bp, 1113 aa] {O...    39   0.069
TBLA0D01110 Chr4 (283160..285640) [2481 bp, 826 aa] {ON} Anc_8.7...    39   0.069
Kwal_26.8703 s26 (905007..906341) [1335 bp, 444 aa] {ON} YOR231W...    39   0.072
AFL090W Chr6 (274336..275376) [1041 bp, 346 aa] {ON} Syntenic ho...    39   0.074
NCAS0C02510 Chr3 complement(468113..469390) [1278 bp, 425 aa] {O...    39   0.074
KNAG0C01020 Chr3 (200271..202595) [2325 bp, 774 aa] {ON} Anc_1.1...    39   0.074
Kpol_1040.20 s1040 (57057..60950) [3894 bp, 1297 aa] {ON} (57057...    39   0.075
Skud_10.49 Chr10 complement(81651..84206) [2556 bp, 851 aa] {ON}...    39   0.079
Kpol_1031.10 s1031 (25064..28447) [3384 bp, 1127 aa] {ON} (25064...    39   0.079
YHR102W Chr8 (316572..319814) [3243 bp, 1080 aa] {ON}  KIC1Prote...    39   0.079
Kpol_1072.31 s1072 complement(67104..68684) [1581 bp, 526 aa] {O...    39   0.079
ZYRO0G18502g Chr7 (1528075..1529265) [1191 bp, 396 aa] {ON} simi...    39   0.080
Suva_15.65 Chr15 (102271..105513) [3243 bp, 1080 aa] {ON} YOL100...    39   0.080
NDAI0E01310 Chr5 complement(260484..262094) [1611 bp, 536 aa] {O...    39   0.080
Suva_15.271 Chr15 complement(460466..463813) [3348 bp, 1115 aa] ...    39   0.081
Smik_4.767 Chr4 complement(1353354..1355630) [2277 bp, 758 aa] {...    39   0.081
TPHA0L01240 Chr12 (263357..264814) [1458 bp, 485 aa] {ON} Anc_8....    39   0.082
Ecym_8100 Chr8 complement(214001..216547) [2547 bp, 848 aa] {ON}...    39   0.083
KLLA0F23507g Chr6 complement(2198603..2200066) [1464 bp, 487 aa]...    39   0.083
TPHA0H02390 Chr8 (561244..563436) [2193 bp, 730 aa] {ON} Anc_6.3...    39   0.083
KLTH0D03454g Chr4 (327039..331340) [4302 bp, 1433 aa] {ON} simil...    39   0.084
CAGL0M11748g Chr13 (1168856..1170199) [1344 bp, 447 aa] {ON} hig...    39   0.085
YHR079C Chr8 complement(258244..261591) [3348 bp, 1115 aa] {ON} ...    39   0.085
Kpol_1042.20 s1042 (45090..47261) [2172 bp, 723 aa] {ON} (45090....    39   0.085
Kpol_513.17 s513 (49097..50824) [1728 bp, 575 aa] {ON} (49097..5...    39   0.086
ZYRO0C13156g Chr3 complement(1041022..1042068) [1047 bp, 348 aa]...    38   0.086
SAKL0C06666g Chr3 complement(628448..630367) [1920 bp, 639 aa] {...    39   0.087
YDR490C Chr4 complement(1431968..1434268) [2301 bp, 766 aa] {ON}...    39   0.089
NCAS0A06680 Chr1 (1320265..1321704) [1440 bp, 479 aa] {ON} Anc_5...    39   0.090
TDEL0F04290 Chr6 (801456..802739) [1284 bp, 427 aa] {ON} Anc_8.3...    38   0.091
TBLA0B03990 Chr2 complement(910314..912455) [2142 bp, 713 aa] {O...    39   0.092
KNAG0K02370 Chr11 complement(475088..477739) [2652 bp, 883 aa] {...    39   0.092
TBLA0D02240 Chr4 complement(561856..566547) [4692 bp, 1563 aa] {...    39   0.092
KLLA0A06776g Chr1 (612115..614517) [2403 bp, 800 aa] {ON} simila...    39   0.095
KNAG0K01710 Chr11 (360438..361931) [1494 bp, 497 aa] {ON} Anc_3....    38   0.097
KLLA0D14905g Chr4 (1256065..1257768) [1704 bp, 567 aa] {ON} simi...    39   0.097
TPHA0H00420 Chr8 complement(82575..85691) [3117 bp, 1038 aa] {ON...    39   0.099
TDEL0D01400 Chr4 (269367..273656) [4290 bp, 1429 aa] {ON} Anc_1....    39   0.10 
Suva_8.47 Chr8 complement(91615..94557) [2943 bp, 980 aa] {ON} Y...    39   0.10 
ZYRO0C06776g Chr3 complement(508813..511485) [2673 bp, 890 aa] {...    39   0.10 
TBLA0E02290 Chr5 complement(563483..567385) [3903 bp, 1300 aa] {...    39   0.10 
Kpol_1032.10 s1032 (24479..26854) [2376 bp, 791 aa] {ON} (24479....    39   0.11 
NCAS0G03810 Chr7 complement(703842..705827) [1986 bp, 661 aa] {O...    38   0.11 
TDEL0D04460 Chr4 complement(813075..815816) [2742 bp, 913 aa] {O...    39   0.11 
KLTH0H04180g Chr8 (381111..382172) [1062 bp, 353 aa] {ON} highly...    38   0.11 
TPHA0B03130 Chr2 complement(719624..721372) [1749 bp, 582 aa] {O...    38   0.11 
YJL165C Chr10 complement(106894..109461) [2568 bp, 855 aa] {ON} ...    38   0.11 
SAKL0C09174g Chr3 complement(833618..836833) [3216 bp, 1071 aa] ...    39   0.11 
Smik_10.65 Chr10 complement(104987..107545) [2559 bp, 852 aa] {O...    38   0.12 
Kpol_1066.19 s1066 (31013..32806) [1794 bp, 597 aa] {OFF} (31013...    38   0.12 
Kpol_YGOB_1066.19 s1066 (30983..32806) [1824 bp, 607 aa] {ON} AN...    38   0.12 
AEL115C Chr5 complement(405062..406222) [1161 bp, 386 aa] {ON} S...    38   0.12 
ZYRO0D06182g Chr4 complement(529121..530416) [1296 bp, 431 aa] {...    38   0.12 
SAKL0B11308g Chr2 complement(984543..986369) [1827 bp, 608 aa] {...    38   0.12 
KNAG0B04500 Chr2 (865766..869089) [3324 bp, 1107 aa] {ON} Anc_5....    38   0.12 
YOL113W Chr15 (104326..106293) [1968 bp, 655 aa] {ON}  SKM1Membe...    38   0.13 
KNAG0A06390 Chr1 complement(974644..976254) [1611 bp, 536 aa] {O...    38   0.13 
CAGL0G04609g Chr7 complement(437162..440059) [2898 bp, 965 aa] {...    38   0.13 
KLLA0E08405g Chr5 complement(756205..758538) [2334 bp, 777 aa] {...    38   0.13 
TBLA0B08250 Chr2 complement(1968879..1972922) [4044 bp, 1347 aa]...    38   0.13 
NCAS0B08320 Chr2 complement(1585766..1588471) [2706 bp, 901 aa] ...    38   0.13 
KAFR0C04590 Chr3 complement(917915..922321) [4407 bp, 1468 aa] {...    38   0.14 
Ecym_4773 Chr4 complement(1504949..1506541) [1593 bp, 530 aa] {O...    38   0.14 
Kwal_33.13846 s33 complement(419630..420757) [1128 bp, 375 aa] {...    38   0.14 
KNAG0C02080 Chr3 complement(404332..405588) [1257 bp, 418 aa] {O...    38   0.14 
TPHA0A05460 Chr1 (1233608..1235170) [1563 bp, 520 aa] {ON} Anc_5...    38   0.14 
KAFR0K00330 Chr11 (74162..75283) [1122 bp, 373 aa] {ON} Anc_6.21...    37   0.15 
KAFR0K02490 Chr11 (515669..518356) [2688 bp, 895 aa] {ON} Anc_5....    38   0.15 
KNAG0K01740 Chr11 (364195..366492) [2298 bp, 765 aa] {ON} Anc_3....    38   0.15 
Kpol_1054.2 s1054 complement(4365..7655) [3291 bp, 1096 aa] {ON}...    38   0.15 
Smik_4.745 Chr4 (1316457..1319201) [2745 bp, 914 aa] {ON} YDR466...    38   0.15 
KLTH0F12012g Chr6 complement(1013169..1014881) [1713 bp, 570 aa]...    38   0.15 
KLLA0D03190g Chr4 (267933..269051) [1119 bp, 372 aa] {ON} highly...    37   0.16 
Ecym_2744 Chr2 complement(1442759..1444465) [1707 bp, 568 aa] {O...    38   0.16 
TBLA0C02310 Chr3 complement(546887..548596) [1710 bp, 569 aa] {O...    38   0.16 
KLLA0B07205g Chr2 complement(624606..625973) [1368 bp, 455 aa] {...    37   0.16 
CAGL0I05390g Chr9 complement(508677..510041) [1365 bp, 454 aa] {...    37   0.16 
TPHA0L02180 Chr12 (453556..455538) [1983 bp, 660 aa] {ON} Anc_5....    38   0.16 
Kpol_530.41 s530 (94710..96326) [1617 bp, 538 aa] {ON} (94710..9...    38   0.16 
ZYRO0G15290g Chr7 complement(1237119..1241582) [4464 bp, 1487 aa...    38   0.16 
Kwal_56.24059 s56 complement(829673..830734) [1062 bp, 353 aa] {...    37   0.16 
KLLA0A07403g Chr1 (661261..663900) [2640 bp, 879 aa] {ON} simila...    38   0.17 
Skud_10.50 Chr10 complement(84697..85890) [1194 bp, 397 aa] {ON}...    37   0.17 
KLLA0E21693g Chr5 complement(1936438..1939488) [3051 bp, 1016 aa...    38   0.17 
KNAG0C06060 Chr3 (1183766..1186654) [2889 bp, 962 aa] {ON} Anc_5...    38   0.17 
NCAS0B01450 Chr2 (237824..239341) [1518 bp, 505 aa] {ON} Anc_8.652     37   0.17 
KNAG0D02140 Chr4 complement(362745..365357) [2613 bp, 870 aa] {O...    38   0.18 
NCAS0B08300 Chr2 (1582859..1584796) [1938 bp, 645 aa] {ON} Anc_1...    37   0.18 
Suva_6.246 Chr6 (439815..442373) [2559 bp, 852 aa] {ON} YJL165C ...    38   0.18 
KLTH0E04334g Chr5 complement(391495..393723) [2229 bp, 742 aa] {...    38   0.18 
TDEL0C03710 Chr3 (653934..655169) [1236 bp, 411 aa] {ON} Anc_1.1...    37   0.18 
TDEL0B06900 Chr2 complement(1220590..1222257) [1668 bp, 555 aa] ...    37   0.18 
SAKL0B05082g Chr2 (436707..438896) [2190 bp, 729 aa] {ON} simila...    38   0.18 
KLLA0F20053g Chr6 (1867209..1868543) [1335 bp, 444 aa] {ON} high...    37   0.18 
Ecym_3586 Chr3 complement(1112070..1115303) [3234 bp, 1077 aa] {...    38   0.18 
YJL164C Chr10 complement(109966..111159) [1194 bp, 397 aa] {ON} ...    37   0.18 
Ecym_4266 Chr4 complement(564935..566329) [1395 bp, 464 aa] {ON}...    37   0.19 
Smik_10.66 Chr10 complement(108043..109236) [1194 bp, 397 aa] {O...    37   0.19 
NDAI0H02470 Chr8 complement(597707..601942) [4236 bp, 1411 aa] {...    38   0.19 
KAFR0D03390 Chr4 (667896..670292) [2397 bp, 798 aa] {ON} Anc_2.4...    37   0.19 
Skud_8.163 Chr8 (290415..293645) [3231 bp, 1076 aa] {ON} YHR102W...    38   0.19 
SAKL0H07128g Chr8 complement(623681..625141) [1461 bp, 486 aa] {...    37   0.20 
NCAS0C01580 Chr3 (291554..292873) [1320 bp, 439 aa] {ON} Anc_8.652     37   0.20 
TBLA0J01000 Chr10 complement(227869..231072) [3204 bp, 1067 aa] ...    37   0.20 
Kpol_1033.50 s1033 complement(126043..127197) [1155 bp, 384 aa] ...    37   0.21 
TBLA0C03140 Chr3 (759258..760763) [1506 bp, 501 aa] {ON} Anc_5.2...    37   0.21 
NCAS0C04940 Chr3 (1006185..1009535) [3351 bp, 1116 aa] {ON} Anc_...    37   0.21 
ZYRO0G19052g Chr7 (1576638..1580033) [3396 bp, 1131 aa] {ON} sim...    37   0.21 
KLLA0D13266g Chr4 complement(1137750..1141208) [3459 bp, 1152 aa...    37   0.21 
TDEL0C03760 Chr3 complement(661391..663895) [2505 bp, 834 aa] {O...    37   0.21 
KLTH0F18942g Chr6 (1535941..1537032) [1092 bp, 363 aa] {ON} high...    37   0.22 
Kpol_2002.75 s2002 complement(168123..169394) [1272 bp, 423 aa] ...    37   0.22 
Kwal_55.22001 s55 (1069907..1070998) [1092 bp, 363 aa] {ON} YNL3...    37   0.22 
Skud_1.44 Chr1 (95573..99643) [4071 bp, 1356 aa] {ON} YAL017W (R...    37   0.22 
KAFR0K00700 Chr11 complement(153981..158126) [4146 bp, 1381 aa] ...    37   0.23 
Ecym_2203 Chr2 (401590..402648) [1059 bp, 352 aa] {ON} similar t...    37   0.23 
ZYRO0F01034g Chr6 (80328..82826) [2499 bp, 832 aa] {ON} similar ...    37   0.23 
NDAI0D04050 Chr4 (952438..953538) [1101 bp, 366 aa] {ON} Anc_4.184     37   0.23 
SAKL0F11110g Chr6 (868447..869832) [1386 bp, 461 aa] {ON} simila...    37   0.23 
KAFR0J01370 Chr10 complement(250424..252766) [2343 bp, 780 aa] {...    37   0.23 
YAL017W Chr1 (120225..124295) [4071 bp, 1356 aa] {ON}  PSK1One o...    37   0.24 
Suva_6.245 Chr6 (438131..439315) [1185 bp, 394 aa] {ON} YJL164C ...    37   0.24 
AEL173W Chr5 (313261..314856) [1596 bp, 531 aa] {ON} Syntenic ho...    37   0.24 
TBLA0E02790 Chr5 complement(693136..695562) [2427 bp, 808 aa] {O...    37   0.24 
TPHA0D03940 Chr4 (825250..826989) [1740 bp, 579 aa] {ON} Anc_3.4...    37   0.25 
NCAS0F02190 Chr6 complement(435844..437706) [1863 bp, 620 aa] {O...    37   0.25 
CAGL0I03498g Chr9 (297344..298699) [1356 bp, 451 aa] {ON} simila...    37   0.25 
NCAS0B04580 Chr2 (831695..835255) [3561 bp, 1186 aa] {ON} Anc_8....    37   0.25 
ABR014W Chr2 (417708..420623) [2916 bp, 971 aa] {ON} Syntenic ho...    37   0.25 
AGR048C Chr7 complement(807464..808825) [1362 bp, 453 aa] {ON} S...    37   0.26 
Smik_3.94 Chr3 (128344..130155) [1812 bp, 603 aa] {ON} YCR008W (...    37   0.26 
SAKL0D06820g Chr4 (566145..567938) [1794 bp, 597 aa] {ON} simila...    37   0.26 
ADR293C Chr4 complement(1207021..1210425) [3405 bp, 1134 aa] {ON...    37   0.26 
Suva_1.50 Chr1 (96474..100556) [4083 bp, 1360 aa] {ON} YAL017W (...    37   0.26 
TPHA0A02760 Chr1 (594482..597502) [3021 bp, 1006 aa] {ON} Anc_1....    37   0.27 
NCAS0F02410 Chr6 complement(476683..478071) [1389 bp, 462 aa] {O...    37   0.27 
NDAI0J01990 Chr10 (491491..493758) [2268 bp, 755 aa] {ON} Anc_4....    37   0.27 
Skud_16.141 Chr16 complement(259166..260707) [1542 bp, 513 aa] {...    37   0.27 
TPHA0B01010 Chr2 complement(229538..231634) [2097 bp, 698 aa] {O...    37   0.27 
Suva_8.282 Chr8 (511665..513185) [1521 bp, 506 aa] {ON} YOR231W ...    37   0.28 
YPL140C Chr16 complement(287514..289034) [1521 bp, 506 aa] {ON} ...    37   0.28 
Suva_2.666 Chr2 complement(1183839..1186133) [2295 bp, 764 aa] {...    37   0.28 
KAFR0G00440 Chr7 (124896..127328) [2433 bp, 810 aa] {ON} Anc_1.1...    37   0.29 
KAFR0A01420 Chr1 (276454..280650) [4197 bp, 1398 aa] {ON} Anc_1....    37   0.29 
TPHA0B00240 Chr2 complement(44468..46525) [2058 bp, 685 aa] {ON}...    37   0.29 
YKL161C Chr11 complement(149386..150687) [1302 bp, 433 aa] {ON} ...    37   0.29 
KNAG0F00170 Chr6 (13778..15409) [1632 bp, 543 aa] {ON} Anc_1.24 ...    37   0.29 
KNAG0H02020 Chr8 complement(357248..359026) [1779 bp, 592 aa] {O...    37   0.30 
ZYRO0B06512g Chr2 complement(521075..524410) [3336 bp, 1111 aa] ...    37   0.30 
NDAI0G02700 Chr7 complement(618268..619611) [1344 bp, 447 aa] {O...    37   0.31 
ACL104C Chr3 complement(157357..160200) [2844 bp, 947 aa] {ON} S...    37   0.31 
Smik_4.209 Chr4 complement(385530..386995,387230..387623) [1860 ...    37   0.32 
NDAI0G00640 Chr7 (139655..141520) [1866 bp, 621 aa] {ON} Anc_2.284     37   0.33 
Smik_4.494 Chr4 (900954..902321) [1368 bp, 455 aa] {ON} YDR247W ...    37   0.33 
YLR113W Chr12 (371620..372927) [1308 bp, 435 aa] {ON}  HOG1Mitog...    37   0.33 
TPHA0B03850 Chr2 (909219..910841) [1623 bp, 540 aa] {ON} Anc_1.4...    37   0.34 
NCAS0I02060 Chr9 (386630..388573) [1944 bp, 647 aa] {ON} Anc_3.1...    37   0.35 
Suva_16.439 Chr16 (755102..756796) [1695 bp, 564 aa] {ON} YPR111...    37   0.35 
AEL120W Chr5 (396394..398715) [2322 bp, 773 aa] {ON} Syntenic ho...    37   0.36 
SAKL0E07722g Chr5 complement(625066..627441) [2376 bp, 791 aa] {...    37   0.36 
TDEL0E05220 Chr5 complement(957515..958597) [1083 bp, 360 aa] {O...    36   0.37 
KNAG0K01250 Chr11 (246241..247467) [1227 bp, 408 aa] {ON} Anc_3....    36   0.37 
KNAG0D00830 Chr4 complement(130823..131986) [1164 bp, 387 aa] {O...    36   0.37 
ABR088C Chr2 complement(546325..547920) [1596 bp, 531 aa] {ON} S...    37   0.37 
SAKL0F06094g Chr6 (457709..459442) [1734 bp, 577 aa] {ON} unipro...    37   0.37 
Skud_3.73 Chr3 (110742..112556) [1815 bp, 604 aa] {ON} YCR008W (...    37   0.38 
Smik_15.415 Chr15 (722292..723815) [1524 bp, 507 aa] {ON} YOR231...    36   0.38 
TBLA0D05210 Chr4 (1279846..1282323) [2478 bp, 825 aa] {ON} Anc_1...    37   0.39 
Suva_11.178 Chr11 complement(330253..332184) [1932 bp, 643 aa] {...    36   0.41 
KNAG0D02790 Chr4 (507235..508848) [1614 bp, 537 aa] {ON} Anc_5.3...    36   0.41 
CAGL0G09020g Chr7 (860266..861351) [1086 bp, 361 aa] {ON} highly...    36   0.43 
TDEL0A05980 Chr1 (1049221..1050771) [1551 bp, 516 aa] {ON} Anc_8...    36   0.45 
NCAS0C03560 Chr3 complement(710551..712476) [1926 bp, 641 aa] {O...    36   0.45 
SAKL0A04466g Chr1 (413816..414937) [1122 bp, 373 aa] {ON} highly...    36   0.47 
SAKL0B09856g Chr2 complement(830531..834355) [3825 bp, 1274 aa] ...    36   0.48 
Smik_6.338 Chr6 (535192..536727) [1536 bp, 511 aa] {ON} YPL140C ...    36   0.49 
KLTH0F16676g Chr6 complement(1351362..1353998) [2637 bp, 878 aa]...    36   0.49 
Kwal_27.10004 s27 complement(156153..158360) [2208 bp, 735 aa] {...    36   0.49 
KAFR0G00460 Chr7 complement(128077..130023) [1947 bp, 648 aa] {O...    36   0.50 
KNAG0L00520 Chr12 (79786..80892) [1107 bp, 368 aa] {ON} Anc_7.86...    36   0.51 
YOR231W Chr15 (772601..774127) [1527 bp, 508 aa] {ON}  MKK1Mitog...    36   0.51 
AFR372W Chr6 (1109169..1111493) [2325 bp, 774 aa] {ON} Syntenic ...    36   0.52 
Kpol_463.8 s463 complement(18696..23039) [4344 bp, 1447 aa] {ON}...    36   0.53 
KAFR0H03330 Chr8 complement(635910..637019) [1110 bp, 369 aa] {O...    36   0.53 
KAFR0C01440 Chr3 complement(295468..298755) [3288 bp, 1095 aa] {...    36   0.53 
YPR111W Chr16 (747306..749000) [1695 bp, 564 aa] {ON}  DBF20Ser/...    36   0.54 
TBLA0C02940 Chr3 complement(706091..711022) [4932 bp, 1643 aa] {...    36   0.58 
ADR033W Chr4 (764716..766449) [1734 bp, 577 aa] {ON} Syntenic ho...    36   0.58 
KLLA0C04191g Chr3 (384198..386591) [2394 bp, 797 aa] {ON} weakly...    36   0.58 
KNAG0C03830 Chr3 (751393..752877) [1485 bp, 494 aa] {ON} Anc_7.3...    36   0.59 
Skud_15.397 Chr15 (711559..713082) [1524 bp, 507 aa] {ON} YOR231...    36   0.60 
Ecym_4448 Chr4 complement(917136..918872) [1737 bp, 578 aa] {ON}...    36   0.62 
CAGL0K11275g Chr11 (1094626..1096203) [1578 bp, 525 aa] {ON} sim...    36   0.63 
TDEL0E01710 Chr5 complement(330667..332706) [2040 bp, 679 aa] {O...    36   0.63 
Skud_16.398 Chr16 (712145..713827) [1683 bp, 560 aa] {ON} YPR111...    36   0.64 
TDEL0C02110 Chr3 (364853..366340) [1488 bp, 495 aa] {ON} Anc_7.3...    36   0.64 
KAFR0I02440 Chr9 complement(493668..495128) [1461 bp, 486 aa] {O...    35   0.64 
NDAI0B00210 Chr2 (27983..29185) [1203 bp, 400 aa] {ON} Anc_1.182       35   0.64 
YOL045W Chr15 (243497..246802) [3306 bp, 1101 aa] {ON}  PSK2One ...    36   0.65 
Ecym_2457 Chr2 (888054..890165) [2112 bp, 703 aa] {ON} similar t...    36   0.65 
Skud_4.764 Chr4 complement(1351725..1353995) [2271 bp, 756 aa] {...    36   0.65 
KNAG0B01780 Chr2 (326438..331180) [4743 bp, 1580 aa] {ON} Anc_1....    36   0.67 
Smik_15.122 Chr15 (209665..212970) [3306 bp, 1101 aa] {ON} YOL04...    36   0.68 
TPHA0H00760 Chr8 complement(152442..155384) [2943 bp, 980 aa] {O...    36   0.68 
Suva_10.464 Chr10 (809505..811721) [2217 bp, 738 aa] {ON} YLR362...    36   0.68 
YLR362W Chr12 (849866..852019) [2154 bp, 717 aa] {ON}  STE11Sign...    36   0.69 
Smik_16.354 Chr16 (625456..627150) [1695 bp, 564 aa] {ON} YPR111...    35   0.70 
KNAG0A01330 Chr1 complement(34784..35977) [1194 bp, 397 aa] {ON}...    35   0.70 
Kpol_2001.31 s2001 complement(90402..93110) [2709 bp, 902 aa] {O...    36   0.73 
Kwal_55.21545 s55 complement(882294..884891) [2598 bp, 865 aa] {...    35   0.74 
TPHA0L00500 Chr12 (83710..86589) [2880 bp, 959 aa] {ON} Anc_7.86...    36   0.74 
YOL100W Chr15 (129237..132482) [3246 bp, 1081 aa] {ON}  PKH2Seri...    35   0.76 
KLTH0G05214g Chr7 (423793..425754) [1962 bp, 653 aa] {ON} weakly...    35   0.76 
TBLA0A01660 Chr1 complement(391368..392828) [1461 bp, 486 aa] {O...    35   0.77 
Smik_11.200 Chr11 complement(333676..335592) [1917 bp, 638 aa] {...    35   0.77 
Skud_11.181 Chr11 complement(326935..328845) [1911 bp, 636 aa] {...    35   0.77 
TBLA0C00720 Chr3 (149299..151149) [1851 bp, 616 aa] {ON} Anc_1.4...    35   0.77 
YKL048C Chr11 complement(347214..349136) [1923 bp, 640 aa] {ON} ...    35   0.77 
TDEL0A04580 Chr1 (816247..818331) [2085 bp, 694 aa] {ON} Anc_5.5...    35   0.77 
ZYRO0F06798g Chr6 (558198..559676) [1479 bp, 492 aa] {ON} simila...    35   0.80 
Ecym_2153 Chr2 complement(287697..288788) [1092 bp, 363 aa] {ON}...    35   0.81 
KLTH0E16104g Chr5 complement(1425822..1427042) [1221 bp, 406 aa]...    35   0.83 
Skud_8.139 Chr8 complement(232178..235534) [3357 bp, 1118 aa] {O...    35   0.84 
CAGL0B02739g Chr2 complement(262590..264620) [2031 bp, 676 aa] {...    35   0.85 
ZYRO0C02772g Chr3 (216325..217464) [1140 bp, 379 aa] {ON} highly...    35   0.85 
KLTH0H12650g Chr8 (1072961..1074592) [1632 bp, 543 aa] {ON} simi...    35   0.85 
ZYRO0A02772g Chr1 complement(223226..224473) [1248 bp, 415 aa] {...    35   0.88 
Kwal_55.21709 s55 (948619..949641) [1023 bp, 340 aa] {ON} YOR061...    35   0.90 
KAFR0C03020 Chr3 complement(601565..603121) [1557 bp, 518 aa] {O...    35   0.98 
Suva_16.170 Chr16 complement(296877..298406) [1530 bp, 509 aa] {...    35   1.0  
CAGL0B04147g Chr2 (402798..404498) [1701 bp, 566 aa] {ON} highly...    35   1.0  
CAGL0J00539g Chr10 (47095..48561) [1467 bp, 488 aa] {ON} highly ...    35   1.0  
CAGL0L12474g Chr12 complement(1347340..1348248) [909 bp, 302 aa]...    35   1.0  
NCAS0A11530 Chr1 (2281835..2283223) [1389 bp, 462 aa] {ON} Anc_3...    35   1.1  
NDAI0A00960 Chr1 complement(197205..198431) [1227 bp, 408 aa] {O...    35   1.1  
Skud_15.54 Chr15 (88576..91824) [3249 bp, 1082 aa] {ON} YOL100W ...    35   1.1  
KAFR0E02850 Chr5 (575512..576786) [1275 bp, 424 aa] {ON} Anc_8.4...    35   1.1  
NCAS0I02840 Chr9 (528136..529344) [1209 bp, 402 aa] {ON} Anc_1.2...    35   1.1  
AFR019W Chr6 (471481..472560) [1080 bp, 359 aa] {ON} Syntenic ho...    35   1.1  
ZYRO0A06182g Chr1 (493846..496062) [2217 bp, 738 aa] {ON} simila...    35   1.1  
Smik_4.532 Chr4 complement(956572..961554) [4983 bp, 1660 aa] {O...    35   1.1  
SAKL0C12870g Chr3 (1145051..1146142) [1092 bp, 363 aa] {ON} high...    35   1.1  
KLLA0A09713g Chr1 (851952..853625) [1674 bp, 557 aa] {ON} simila...    35   1.2  
NDAI0B03560 Chr2 complement(892839..895109) [2271 bp, 756 aa] {O...    35   1.2  
TBLA0G01910 Chr7 complement(500551..502596) [2046 bp, 681 aa] {O...    35   1.2  
SAKL0D06666g Chr4 (551260..552522) [1263 bp, 420 aa] {ON} some s...    35   1.3  
KNAG0B01130 Chr2 complement(208528..210279) [1752 bp, 583 aa] {O...    35   1.3  
Skud_15.39 Chr15 (69445..71412) [1968 bp, 655 aa] {ON} YOL113W (...    35   1.3  
KLLA0F01507g Chr6 (144356..145774) [1419 bp, 472 aa] {ON} some s...    35   1.3  
Kwal_55.20221 s55 (304482..308006) [3525 bp, 1174 aa] {ON} YHR07...    35   1.3  
TBLA0D02730 Chr4 complement(674994..676427) [1434 bp, 477 aa] {O...    35   1.3  
YDR247W Chr4 (956013..957398) [1386 bp, 461 aa] {ON}  VHS1Cytopl...    35   1.4  
KAFR0K01540 Chr11 (320997..322706) [1710 bp, 569 aa] {ON} Anc_3....    35   1.4  
NDAI0C05340 Chr3 (1236394..1237296) [903 bp, 300 aa] {ON}              34   1.4  
Smik_1.50 Chr1 (103132..107205) [4074 bp, 1357 aa] {ON} YAL017W ...    35   1.4  
TBLA0A03570 Chr1 (892930..895857) [2928 bp, 975 aa] {ON} Anc_5.4...    35   1.5  
TDEL0A00600 Chr1 complement(101753..102877) [1125 bp, 374 aa] {O...    34   1.5  
YDR283C Chr4 complement(1025070..1030049) [4980 bp, 1659 aa] {ON...    35   1.5  
KLTH0H01584g Chr8 (143065..144453) [1389 bp, 462 aa] {ON} simila...    34   1.5  
SAKL0B11044g Chr2 complement(962142..962940,963019..963086,96315...    34   1.6  
ACR281C Chr3 complement(864528..868307) [3780 bp, 1259 aa] {ON} ...    35   1.6  
ZYRO0C12408g Chr3 (979857..981593) [1737 bp, 578 aa] {ON} highly...    34   1.7  
KLTH0E03828g Chr5 (345775..349131) [3357 bp, 1118 aa] {ON} simil...    34   1.7  
KNAG0H00560 Chr8 (89502..91268) [1767 bp, 588 aa] {ON} Anc_2.597...    34   1.7  
NCAS0E01150 Chr5 complement(217594..219315) [1722 bp, 573 aa] {O...    34   1.8  
Kpol_1031.67 s1031 (174170..175663) [1494 bp, 497 aa] {ON} (1741...    34   1.8  
KAFR0G00480 Chr7 complement(131066..132268) [1203 bp, 400 aa] {O...    34   1.8  
ADL217W Chr4 (321491..323743) [2253 bp, 750 aa] {ON} Syntenic ho...    34   1.8  
Ecym_5241 Chr5 complement(495748..497586) [1839 bp, 612 aa] {ON}...    34   1.8  
Kwal_56.24584 s56 complement(1063271..1064578) [1308 bp, 435 aa]...    34   1.8  
YER129W Chr5 (417281..420709) [3429 bp, 1142 aa] {ON}  SAK1Upstr...    34   1.9  
Smik_5.275 Chr5 (426176..429601) [3426 bp, 1141 aa] {ON} YER129W...    34   1.9  
KAFR0I01570 Chr9 (330982..332574) [1593 bp, 530 aa] {ON} Anc_2.5...    34   2.0  
NDAI0G03030 Chr7 (704910..708269) [3360 bp, 1119 aa] {ON}              34   2.1  
Smik_6.178 Chr6 (291601..293322) [1722 bp, 573 aa] {ON} YGR092W ...    34   2.1  
KAFR0C00930 Chr3 complement(186877..189687) [2811 bp, 936 aa] {O...    34   2.2  
YDL025C Chr4 complement(405344..407206) [1863 bp, 620 aa] {ON}  ...    34   2.2  
ZYRO0B04796g Chr2 (385611..387683) [2073 bp, 690 aa] {ON} simila...    34   2.2  
KAFR0D04500 Chr4 (887515..889989) [2475 bp, 824 aa] {ON} Anc_1.5...    34   2.3  
NCAS0I00470 Chr9 (74336..77584) [3249 bp, 1082 aa] {ON} Anc_7.86       34   2.3  
TDEL0F03120 Chr6 (570471..572192) [1722 bp, 573 aa] {ON} Anc_3.4...    34   2.3  
KAFR0H01040 Chr8 complement(189604..190860) [1257 bp, 418 aa] {O...    34   2.3  
KAFR0F02190 Chr6 (428623..430095) [1473 bp, 490 aa] {ON} Anc_3.1...    34   2.4  
ZYRO0A05214g Chr1 complement(418443..421268) [2826 bp, 941 aa] {...    34   2.4  
NCAS0D01230 Chr4 complement(225213..226661) [1449 bp, 482 aa] {O...    33   2.5  
Suva_14.32 Chr14 complement(52757..53884) [1128 bp, 375 aa] {ON}...    33   2.5  
Suva_7.375 Chr7 (643870..645591) [1722 bp, 573 aa] {ON} YGR092W ...    34   2.6  
Suva_15.124 Chr15 (215781..219101) [3321 bp, 1106 aa] {ON} YOL04...    34   2.6  
TDEL0G00630 Chr7 complement(128151..129764) [1614 bp, 537 aa] {O...    33   2.7  
TPHA0F02870 Chr6 complement(636574..638259) [1686 bp, 561 aa] {O...    33   2.7  
TPHA0E02840 Chr5 (594381..595589) [1209 bp, 402 aa] {ON} Anc_6.2...    33   2.7  
KLTH0E11924g Chr5 (1059134..1060030) [897 bp, 298 aa] {ON} highl...    33   2.9  
Ecym_2640 Chr2 complement(1232617..1236594) [3978 bp, 1325 aa] {...    34   2.9  
YGR092W Chr7 (668189..669907) [1719 bp, 572 aa] {ON}  DBF2Ser/Th...    33   3.0  
KLTH0H10582g Chr8 (914695..916440) [1746 bp, 581 aa] {ON} weakly...    33   3.0  
Suva_5.250 Chr5 (392904..396323) [3420 bp, 1139 aa] {ON} YER129W...    33   3.1  
Kpol_1055.25 s1055 complement(62930..67933) [5004 bp, 1667 aa] {...    33   3.1  
YPL026C Chr16 complement(500675..502183) [1509 bp, 502 aa] {ON} ...    33   3.2  
Skud_7.391 Chr7 (652479..654200) [1722 bp, 573 aa] {ON} YGR092W ...    33   3.2  
ZYRO0D10472g Chr4 (876899..880357) [3459 bp, 1152 aa] {ON} simil...    33   3.3  
NCAS0B02350 Chr2 complement(394128..395018) [891 bp, 296 aa] {ON...    33   3.3  
Skud_4.509 Chr4 (910551..911945) [1395 bp, 464 aa] {ON} YDR247W ...    33   3.4  
KLTH0D02486g Chr4 (247566..251237) [3672 bp, 1223 aa] {ON} simil...    33   3.8  
Skud_1.72 Chr1 (141337..144261) [2925 bp, 974 aa] {ON} YAR019C (...    33   4.2  
AER222C Chr5 complement(1043479..1044750) [1272 bp, 423 aa] {ON}...    33   5.3  
TPHA0N01450 Chr14 complement(318088..320340) [2253 bp, 750 aa] {...    33   5.3  
Suva_2.413 Chr2 (735541..736923) [1383 bp, 460 aa] {ON} YDR247W ...    32   5.8  
NDAI0G05790 Chr7 complement(1433294..1435252) [1959 bp, 652 aa] ...    33   6.0  
Kpol_1065.6 s1065 (12266..12916,12918..13280,13332..13340,13394....    32   6.6  
Suva_3.129 Chr3 (193311..194282) [972 bp, 323 aa] {ON} YCR091W (...    32   7.2  
Skud_15.112 Chr15 (202308..205613) [3306 bp, 1101 aa] {ON} YOL04...    32   8.5  

>Kwal_33.13225 s33 (127676..130570) [2895 bp, 964 aa] {ON} YFR016C -
           Hypothetical ORF [contig 120] FULL
          Length = 964

 Score = 1608 bits (4163), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 807/964 (83%), Positives = 807/964 (83%)

Query: 1   MRRLRSCPVLPYHGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDS 60
           MRRLRSCPVLPYHGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDS
Sbjct: 1   MRRLRSCPVLPYHGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDS 60

Query: 61  DEISPEAQDLIAKILTVDPAARIKSREILKHPLLQKYPSIKDSKSIRNLPREDTYLNPLD 120
           DEISPEAQDLIAKILTVDPAARIKSREILKHPLLQKYPSIKDSKSIRNLPREDTYLNPLD
Sbjct: 61  DEISPEAQDLIAKILTVDPAARIKSREILKHPLLQKYPSIKDSKSIRNLPREDTYLNPLD 120

Query: 121 SVNGSIDESIINNLVVLWHGRDRNEITAQLKEPGANLEKTFYALLFRFKHDSHQEQLKQQ 180
           SVNGSIDESIINNLVVLWHGRDRNEITAQLKEPGANLEKTFYALLFRFKHDSHQEQLKQQ
Sbjct: 121 SVNGSIDESIINNLVVLWHGRDRNEITAQLKEPGANLEKTFYALLFRFKHDSHQEQLKQQ 180

Query: 181 RRSQASHISPKXXXXXXXXXXXXITNVTPKKKNKAPVISASSSHKRPVSFNRLSFNNGSN 240
           RRSQASHISPK            ITNVTPKKKNKAPVISASSSHKRPVSFNRLSFNNGSN
Sbjct: 181 RRSQASHISPKRSNMRNSVSRRSITNVTPKKKNKAPVISASSSHKRPVSFNRLSFNNGSN 240

Query: 241 TAHTPPTSASKRASVNLSSNKRISALINPNNSPTPVHKRSSMRDLDASAPPIPMDMLKDY 300
           TAHTPPTSASKRASVNLSSNKRISALINPNNSPTPVHKRSSMRDLDASAPPIPMDMLKDY
Sbjct: 241 TAHTPPTSASKRASVNLSSNKRISALINPNNSPTPVHKRSSMRDLDASAPPIPMDMLKDY 300

Query: 301 NKSAPKVXXXXXXXXXXXXXXPGNKRGSITTKLIATYAKISKDNDWEYIEKETRRTSADF 360
           NKSAPKV              PGNKRGSITTKLIATYAKISKDNDWEYIEKETRRTSADF
Sbjct: 301 NKSAPKVSRRSTRLSKRLSFLPGNKRGSITTKLIATYAKISKDNDWEYIEKETRRTSADF 360

Query: 361 ATLCDEIFEHEKYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHQMXXX 420
           ATLCDEIFEHEKY                                         HQM   
Sbjct: 361 ATLCDEIFEHEKYEQIRKEKEELERRVREAKEQEELERRQREEEERLQREMELQHQMRLE 420

Query: 421 XXXXXXXXXXXXXIEQEIALLKQSVNPQGPSDSNHVRSVSAPAESVLKVDKRGSTGNLDN 480
                        IEQEIALLKQSVNPQGPSDSNHVRSVSAPAESVLKVDKRGSTGNLDN
Sbjct: 421 EESRRRQRETQELIEQEIALLKQSVNPQGPSDSNHVRSVSAPAESVLKVDKRGSTGNLDN 480

Query: 481 DIMALLNRRTFSLETRPKSRLDPGIYTSEEEDFGSKNHGADLSTEKTILETIRRSKFLGS 540
           DIMALLNRRTFSLETRPKSRLDPGIYTSEEEDFGSKNHGADLSTEKTILETIRRSKFLGS
Sbjct: 481 DIMALLNRRTFSLETRPKSRLDPGIYTSEEEDFGSKNHGADLSTEKTILETIRRSKFLGS 540

Query: 541 SFDINXXXXXXXXXXXXXXXXXXXXXXXXVASNATTANVVGNGYESQTLPKRKMGSAMEA 600
           SFDIN                        VASNATTANVVGNGYESQTLPKRKMGSAMEA
Sbjct: 541 SFDINKELARERRLKEERAALAKRKDEERVASNATTANVVGNGYESQTLPKRKMGSAMEA 600

Query: 601 SSEPRKISEVEVPQFTRRSRHFTASNKRLSVLSMYSTKTSFTNLADHLKGKADVQLIQTS 660
           SSEPRKISEVEVPQFTRRSRHFTASNKRLSVLSMYSTKTSFTNLADHLKGKADVQLIQTS
Sbjct: 601 SSEPRKISEVEVPQFTRRSRHFTASNKRLSVLSMYSTKTSFTNLADHLKGKADVQLIQTS 660

Query: 661 PPSASKMDQEAEFMFESVDKEGKETADTSADSRLYEVAETKDAKNAKPAVKLNFADRFNR 720
           PPSASKMDQEAEFMFESVDKEGKETADTSADSRLYEVAETKDAKNAKPAVKLNFADRFNR
Sbjct: 661 PPSASKMDQEAEFMFESVDKEGKETADTSADSRLYEVAETKDAKNAKPAVKLNFADRFNR 720

Query: 721 XXXXXXXXXXXXAAIKLPALPPLDKNKPNMVSGLGLYQATAEPSHEDAQPVAKSMVIDDV 780
                       AAIKLPALPPLDKNKPNMVSGLGLYQATAEPSHEDAQPVAKSMVIDDV
Sbjct: 721 PTSPPSQDTDSSAAIKLPALPPLDKNKPNMVSGLGLYQATAEPSHEDAQPVAKSMVIDDV 780

Query: 781 ESEITTEPRNTVTETEEAAKNSTVVPTAPVAPLNNVMKKNTDADRKPLSDITPAVEXXXX 840
           ESEITTEPRNTVTETEEAAKNSTVVPTAPVAPLNNVMKKNTDADRKPLSDITPAVE    
Sbjct: 781 ESEITTEPRNTVTETEEAAKNSTVVPTAPVAPLNNVMKKNTDADRKPLSDITPAVEKKAN 840

Query: 841 XXXXXXXXXXXXXXXXXXXYDFRFKTVIEETQMFNALSKLLAAWKDYGLKDVIASPSLKQ 900
                              YDFRFKTVIEETQMFNALSKLLAAWKDYGLKDVIASPSLKQ
Sbjct: 841 KSFFRKFSSKGSDEKKSGDYDFRFKTVIEETQMFNALSKLLAAWKDYGLKDVIASPSLKQ 900

Query: 901 IRGKLSSDNILSLRSTLFIITVVGRGEGSYVEFTKKSGSNKTFXXXXXXXXXXXXXXXAL 960
           IRGKLSSDNILSLRSTLFIITVVGRGEGSYVEFTKKSGSNKTF               AL
Sbjct: 901 IRGKLSSDNILSLRSTLFIITVVGRGEGSYVEFTKKSGSNKTFKKLVKEIEKILESKKAL 960

Query: 961 VFSN 964
           VFSN
Sbjct: 961 VFSN 964

>KLTH0F01672g Chr6 (127277..130771) [3495 bp, 1164 aa] {ON} similar to
            uniprot|Q12263 Saccharomyces cerevisiae YDR507C
          Length = 1164

 Score = 1121 bits (2900), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 601/960 (62%), Positives = 668/960 (69%), Gaps = 11/960 (1%)

Query: 10   LPYHGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDEISPEAQD 69
            LPYHGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSG+FEMPD++EIS EAQD
Sbjct: 211  LPYHGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGKFEMPDTNEISGEAQD 270

Query: 70   LIAKILTVDPAARIKSREILKHPLLQKYPSIKDSKSIRNLPREDTYLNPLDSVNGSIDES 129
            LIAKILTVDPAARIKSR ILKHPLLQKYPSIKDSKSIRNLPREDTYLNPLDSV+G+ID++
Sbjct: 271  LIAKILTVDPAARIKSRGILKHPLLQKYPSIKDSKSIRNLPREDTYLNPLDSVDGTIDDT 330

Query: 130  IINNLVVLWHGRDRNEITAQLKEPGANLEKTFYALLFRFKHDSHQEQLKQQRRSQASHIS 189
            II NLVVLWHGRDRNEIT +LKEPGANLEKTFYALLFRFKHDS QEQLKQQRRSQA  +S
Sbjct: 331  IIGNLVVLWHGRDRNEITNKLKEPGANLEKTFYALLFRFKHDSQQEQLKQQRRSQAMQVS 390

Query: 190  PKXXXXXXXXXXXXITNVTPKKKNKAPVISASSSHKRPVSFNRLSFNNGSNTAHTPPTSA 249
            PK            I + TPKKK +APVISASSSHKRPVSF+RLS++NGSNT H  P S+
Sbjct: 391  PKKTGLRKSNSRRSINSTTPKKKTRAPVISASSSHKRPVSFSRLSYSNGSNTDHNTPNSS 450

Query: 250  SKRASVNLSSNKRISALINPNNSPTPVHKRSSMRDLDASAPPIPMDMLKDYNKSAPKVXX 309
             KR+SVNLSSNKRISALINPN+SPTP  KR+S+R+LD SAPPIP+DMLKDYNK+APK   
Sbjct: 451  GKRSSVNLSSNKRISALINPNSSPTPASKRASLRELDPSAPPIPVDMLKDYNKAAPKANR 510

Query: 310  XXXXXXXXXXXXPGNKRGSITTKLIATYAKISKDNDWEYIEKETRRTSADFATLCDEIFE 369
                        PGNKRGSITTKLIATYAKIS+DNDWEYIEKET+RTSADFATLCDEIFE
Sbjct: 511  KSSRISKRLSFLPGNKRGSITTKLIATYAKISEDNDWEYIEKETKRTSADFATLCDEIFE 570

Query: 370  HEKYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHQMXXXXXXXXXXXX 429
            HEKY                                          Q             
Sbjct: 571  HEKYEQIRREKEELERRVREAKEQEERERRQREEEERRQREEELARQREFEEERYHRQRE 630

Query: 430  XXXXIEQEIALLKQSVNPQGPSDSNHVRSVSAPAESVLKVDKRGSTGNLDNDIMALLNRR 489
                I++E+ALLK+        D N  RSVSAP ESVLKVDKR S   LD DIM LLNRR
Sbjct: 631  VQENIDREMALLKEGYETSSGVDPNKNRSVSAPVESVLKVDKRSSMDALDGDIMDLLNRR 690

Query: 490  TFSLETRPKSRLDPGIYTSEE-EDFGSKNHGADLSTEKTILETIRRSKFLGSSFDINXX- 547
            TFSLETRPKSRLDPGIYT EE  +   K+ G DL TEKTILETIRRSKFLGSSFDIN   
Sbjct: 691  TFSLETRPKSRLDPGIYTLEEVPNSDIKDGGRDLKTEKTILETIRRSKFLGSSFDINKEL 750

Query: 548  XXXXXXXXXXXXXXXXXXXXXXVASNATTANVVGNGYESQTLPKRKMGSAM--EASSEPR 605
                                  V SNA T N   NGYE QTLPK    + +  +A S+PR
Sbjct: 751  ARERRLKEERAAALKQRKKEDRVVSNA-TGNYSENGYEPQTLPKNAAATKISNDAGSDPR 809

Query: 606  KISEVEVPQFTRRSRHFTASNKRLSVLSMYSTKTSFTNLADHLKGKADVQLIQTSPPSAS 665
            KISEV+VPQFTRRSRHFTASNKRLSVLSMYSTK SFTNLADHL+GK D+Q I  SPPS S
Sbjct: 810  KISEVQVPQFTRRSRHFTASNKRLSVLSMYSTKASFTNLADHLRGKTDLQSINGSPPSTS 869

Query: 666  KMDQEAEFMFESVDKEGKETADTSADSRLYEVAETKDAKN-AKPAVKLNFADRFNRXXXX 724
            +M+ E EFMFESVD EGKETADTSADSRLYEVAE  D K  A+ AV+LNFADRFN+    
Sbjct: 870  RMEPETEFMFESVDGEGKETADTSADSRLYEVAEGNDPKGAARSAVRLNFADRFNKPTSP 929

Query: 725  XXXXXXXXAAIKLPALPPLDKNKPNMVSGLGLYQATAEPSHEDAQPVAKSMVIDDVESEI 784
                      IKLP+LPPLDK K + V+GLGLYQ  ++ S  +     KSM+  D E + 
Sbjct: 930  PPQSVEDPNGIKLPSLPPLDKAKSDGVNGLGLYQPASDSSETEIHHQPKSMIPVDAEQKE 989

Query: 785  TTEPRNTVTETEEAAKNSTVVPTAPVAPLNNVMKKNTDADRKPLSDITPAVEXXXXXXXX 844
              E +      E+       V +AP APLN VMKKNT+A++   +   P           
Sbjct: 990  AAEAK----PEEQKQVPPKDVESAP-APLNKVMKKNTEAEKNQPNQPAPNAVKKNNKSFF 1044

Query: 845  XXXXXXXXXXXXXXXYDFRFKTVIEETQMFNALSKLLAAWKDYGLKDVIASPSLKQIRGK 904
                           YDF+F TVIE TQMFNALSKLLAAWKDYGLKDV+ASPS K+I+GK
Sbjct: 1045 RRFSGKSDDEKRPGEYDFKFDTVIEGTQMFNALSKLLAAWKDYGLKDVVASPSQKKIKGK 1104

Query: 905  LSSDNILSLRSTLFIITVVGRGEGSYVEFTKKSGSNKTFXXXXXXXXXXXXXXXALVFSN 964
            +SSDN+LSLRSTLF I++V +GEGS V FTKKSGS KTF               ALVF+N
Sbjct: 1105 MSSDNMLSLRSTLFEISIVSKGEGSIVGFTKKSGSTKTFKKLVKEIEKILESKKALVFNN 1164

>KAFR0D04100 Chr4 complement(809681..813034) [3354 bp, 1117 aa] {ON}
            Anc_1.52 YDR507C
          Length = 1117

 Score =  632 bits (1629), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 424/976 (43%), Positives = 535/976 (54%), Gaps = 124/976 (12%)

Query: 10   LPYHGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDEISPEAQD 69
            +PYHGF SDVWSCG+ILFALLTGRLPFDEEDGNIRNLLLKVQSG+FEMP  DEIS EAQD
Sbjct: 201  IPYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGEFEMPSDDEISHEAQD 260

Query: 70   LIAKILTVDPAARIKSREILKHPLLQKYPSIKDSKSIRNLPREDTYLNPLDSVNGSIDES 129
            L+AKILTVDP  RI++R+ILKHPLLQKYPSIKDSKSIRNLPREDTYLNPL   N +ID++
Sbjct: 261  LLAKILTVDPEKRIRARDILKHPLLQKYPSIKDSKSIRNLPREDTYLNPLSDNNSTIDKT 320

Query: 130  IINNLVVLWHGRDRNEITAQLKEPGANLEKTFYALLFRFKHDSHQEQLKQQRRSQASHIS 189
            I+ NLVVLWHGRD NEI ++LKEPGAN EKT YALL RFK DS +E  K ++  +   I+
Sbjct: 321  ILQNLVVLWHGRDVNEIISKLKEPGANAEKTLYALLDRFKIDSEKENFKNEQIRKRQSIT 380

Query: 190  PKXXXXXXXXXXXXITNVTP-KKKNKAPVISASSSHKRPVSFNRLS---FNNGSNTAHTP 245
                              TP ++KN+  +IS SSSHK+P SFNRLS    NN S ++ T 
Sbjct: 381  SSVSRSPAKKAS------TPQRRKNRISMISVSSSHKKPASFNRLSSVVHNNLSASSSTT 434

Query: 246  PTSASKRASVNLSSNKRISALINP----NNSPTPVH--KRSSMRDLDASAPPIPMDMLKD 299
             T ASK+ S+    NK++S + +     N+SPTP H  KR+SM + D  +       +  
Sbjct: 435  TTPASKKFSM----NKKLSMIADKSNSNNSSPTPAHRNKRTSMINTDRQS-------ILS 483

Query: 300  YNKSAPKVXXXXXXXXXXXXXXPGNKRGSITTKLIATYAKISKDNDWEYIEKETRRTSAD 359
             NK A +                  KRGSITTKLIATYAK+S+D+DWEYIEKET+RTS+D
Sbjct: 484  KNKRASR-------SSKRLSVMANMKRGSITTKLIATYAKLSEDDDWEYIEKETKRTSSD 536

Query: 360  FATLCDEIFEHEKYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHQMXX 419
            FATL DEIFEHEKY                                         H++  
Sbjct: 537  FATLIDEIFEHEKY--------EQIRKEKEELARKVRLAKEREEEERRRREEEELHKLNE 588

Query: 420  XXXXXXXXXXXXXXIEQEI----ALLKQSVNPQGPSDSNHVRSVSAPAESVLKVDKRGST 475
                          +++EI    A LK  V P    + ++ RSVS P      + K    
Sbjct: 589  EKKFEAQQLQLQRQMDEEIENLRADLKGDVEPNQEKNEDNYRSVSVP------LSKETVN 642

Query: 476  GNLDNDIMALLNRRTFSLETRPKSRLDPGIYTSEEEDFGSKNHGAD-------LSTEKTI 528
             N       LL +R FSL+TRP SRLDPG++ SE+     K    D       L TEK I
Sbjct: 643  DN-------LLRQRNFSLQTRPISRLDPGLFFSEQSPTEEKPISPDEPVPNKKLDTEKMI 695

Query: 529  LETIRRSKFLGSSFDINXXXXXXXXXXXXXXXXXXXXXXXXVASNATTANVVGNGYESQT 588
            LETIRRSKFLGSSFDIN                        V    T   +      S  
Sbjct: 696  LETIRRSKFLGSSFDIN---------------RELKAAEKRVMQPPTVQKLTTENKSSDE 740

Query: 589  LPKRKMGSAMEASS--EPRKISEVEVPQFTRRSRHFTASNKRLSVLSMYSTKTSFTNLAD 646
            LPK  +G+A   SS  E  KIS++ VPQFTR+SRHFT SN+RLSVLSMYST+ SF+NL D
Sbjct: 741  LPKHAVGTAALNSSTAEVSKISDIRVPQFTRKSRHFTTSNRRLSVLSMYSTRQSFSNLVD 800

Query: 647  HLKG-KADVQLIQTSPPSASKMDQEAEFMFESVDKEGKETADTSADSRLYEVAETKDAKN 705
             LK  +A  +L Q +P   S  D  +EF+FE+V++E + T ++S D +LYEVA+  DA  
Sbjct: 801  ILKNTEAGTELGQRTPTPHSAGD--SEFIFETVNEEAEYTGNSSNDDKLYEVADL-DAAE 857

Query: 706  AKPAVKLNFADRFNRXXXXXXXXXXXXAAIKLPALPPLDKNKPNMVSGLGLYQATA--EP 763
                +KLNFADRFN+               KLP LPPLD       +GLG+YQ ++  EP
Sbjct: 858  KPSGMKLNFADRFNKKEEDSTEPSRDIQN-KLPVLPPLDGK-----AGLGIYQTSSPIEP 911

Query: 764  SHEDAQPVAKSMVIDDVESEITTEPRNTVTETEEAAKNSTVVPTAPVAPLNNV------- 816
               + +PV     ++ + S+   +P   +          +++P A +    NV       
Sbjct: 912  QLLE-RPVKGDKFMETISSD-NEKPEKEI---------KSMIPEAVIEEPKNVSPIEVQK 960

Query: 817  MKKNTDADRKPLSDITPAV-----------EXXXXXXXXXXXXXXXXXXXXXXXYDFRFK 865
             +K+ + D++P+ +  P V           +                        +    
Sbjct: 961  TRKDQEHDKRPVMEKKPEVVAPKQRESDQEKKRSVSFFRKFSGSSISSNKSKAETEKVLV 1020

Query: 866  TVIEETQMFNALSKLLAAWKDYGLKDVIASPSLKQIRGKLSSDNILSLRSTLFIITVVGR 925
            T I   Q+F+ L +LL  W  YGLK+V +  S   I GKLSSDNILSLRST F I V   
Sbjct: 1021 TNIAARQVFDGLRRLLNGWSKYGLKNVRSVSSTMTISGKLSSDNILSLRSTNFEIKVTSN 1080

Query: 926  GEGSYVEFTKKSGSNK 941
            GE S V   KKSGS+K
Sbjct: 1081 GESSSVLIRKKSGSSK 1096

>NCAS0B08600 Chr2 (1649375..1652728) [3354 bp, 1117 aa] {ON} Anc_5.591
            YDR466W
          Length = 1117

 Score =  627 bits (1617), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 411/971 (42%), Positives = 537/971 (55%), Gaps = 119/971 (12%)

Query: 10   LPYHGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDEISPEAQD 69
            +PYHGFESDVWSCG+ILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPD DE+S +AQD
Sbjct: 208  IPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDDDEMSRDAQD 267

Query: 70   LIAKILTVDPAARIKSREILKHPLLQKYPSIKDSKSIRNLPREDTYLNPLDSVNGSIDES 129
            LI++ILTVDP  RIK+REILKHPLLQKYPSIKDSKSI+NLPREDTYL PL   N  ID S
Sbjct: 268  LISRILTVDPTKRIKTREILKHPLLQKYPSIKDSKSIKNLPREDTYLFPLSDNNSVIDPS 327

Query: 130  IINNLVVLWHGRDRNEITAQLKEPGANLEKTFYALLFRFKHDSHQEQLKQQRRSQASHIS 189
            I+ NLVVLWHGRD+ +I A+LKE GAN EKT YALL+RFK ++     KQ++  +   I 
Sbjct: 328  ILQNLVVLWHGRDKEQIAAKLKESGANAEKTIYALLYRFKIEAENLSAKQEQVKRKQSII 387

Query: 190  PKXXXXXXXXXXXXITNVTPKKKNKAPVISASSSHKRPVSFNRL-SFNNG---------- 238
             K              +  P+KKN+   +S SSS KRPVSFNRL + +NG          
Sbjct: 388  KKSTAN---------VSTPPRKKNRISTMSVSSSRKRPVSFNRLPTISNGKTNNIIPNGR 438

Query: 239  -SNTAHTPPTSASKRASVNLSSNKRISALI-----NPN-NSPTPVH-KRSSMRDLD-ASA 289
              ++ +T P S +KR S+NLSSNKR+S L+     N N NSPTP   KR S+ +LD ++A
Sbjct: 439  NGDSNNTTPKS-NKRLSINLSSNKRLSNLLVQGHSNGNSNSPTPSRSKRISLINLDNSTA 497

Query: 290  PPIPMDMLKDYNKSAPKVXXXXXXXXXXXXXXPGN-KRGSITTKLIATYAKISKDNDWEY 348
            PPIP+++LKDY   +                  GN KRGSITTKL++TYAK+S+D++WEY
Sbjct: 498  PPIPVNVLKDYKNKSSSSKNKRASKRLTFL---GNGKRGSITTKLLSTYAKLSEDDNWEY 554

Query: 349  IEKETRRTSADFATLCDEIFEHEKYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 408
            IEKET+RTS+DFATL DEIFEHEKY                                   
Sbjct: 555  IEKETKRTSSDFATLIDEIFEHEKY--------EQIRKEKEELARKVREAKEGEARERRE 606

Query: 409  XXXXXXHQMXXXXXXXXXXXXXXXXIEQEIALLKQSV--NPQGPSDSNHVRSVSAPAESV 466
                   +                 I+QEI+ LK  +    +G     + RSVSAP E  
Sbjct: 607  QESEKQRKQREREELERQQLELQNHIDQEISNLKADLANETKGAEPYENPRSVSAPLE-- 664

Query: 467  LKVDKRGSTGNLDNDIMALLNRRTFSLETRPKSRLDPGI-YTSEEEDFGS---KNHGADL 522
                 R +   ++ DI  L  RR  SL+TRPKSRLDPGI Y++  E   +    +   ++
Sbjct: 665  -----RENPEAIERDINDLFARRNVSLQTRPKSRLDPGILYSAPAETVSNPLLSDIDQEI 719

Query: 523  STEKTILETIRRSKFLGSSFDINXXXXXXXXXXXXXXXXXXXXXXXXVASNATTANVVGN 582
              EK ILETIRRS+FLGSS++IN                          S  T+ N+V +
Sbjct: 720  DREKKILETIRRSRFLGSSYNINKELEFAKKTALAETSKKEKR------SKVTSQNIVAD 773

Query: 583  GYESQTLPKRKMGSAMEASSEPRKISEVEVPQFTRRSRHFTASNKRLSVLSMYSTKTSFT 642
                  +P     + +      RKISE++VPQFTR+SRHF+ SN+RLSVLSMYSTK S+T
Sbjct: 774  KAAIGVIPLNDTEAGL------RKISEIKVPQFTRKSRHFSNSNRRLSVLSMYSTKQSYT 827

Query: 643  NLADHLKGKADVQLIQTSPPSASKMDQEAEFMFESVDKEGKETADTSADSRLYEVAETKD 702
            NL D LK        + +  + SK   E EF FESV+ EG  TA+     +LYE+ E  +
Sbjct: 828  NLGDILKEGGVNLASEANNTTTSKASTEPEFQFESVN-EG--TAN-----KLYELQEEPE 879

Query: 703  AKNAKPAVKLNFADRFNRXXXXXXXXXXXXAAIKLPALPPLDKNKPNMVSGLGLYQATAE 762
              +      +N  D                  +KLP LPPL + K N  +GL +YQ++++
Sbjct: 880  YTD------VNKED------------GKPKKNVKLPTLPPLHE-KTNQANGLAIYQSSSD 920

Query: 763  PSHEDAQPVAKSMVIDDVESEITTEPRNTVTETEEAAKNSTVVPTAPVA-PLNNVMKK-- 819
               +  +P  KS              ++ + E +++  NS  V   PV  P +   KK  
Sbjct: 921  DDKKPTEPQPKS--------------QSMIPERQDSINNSASVKKTPVVEPESQATKKIN 966

Query: 820  -------NTDADRKPLSDITPAVEXXXXXX-XXXXXXXXXXXXXXXXXYDFRFKTVIEET 871
                     + +RKPL+++ P VE                        +D+     +   
Sbjct: 967  KPKQRQPKKEEERKPLNEMPPNVEKKRNVSFFRKFSKSSAVSTLTKNGFDYEVYVNVSAP 1026

Query: 872  QMFNALSKLLAAWKDYGLKDVIASPSLKQIRGKLSSDNILSLRSTLFIITVVGRGEGSYV 931
            Q++  L +LL  W  YGLKDV +  +  ++ GKLS+DNILSLRST+F + V  +G+ S V
Sbjct: 1027 QLYKGLLRLLQGWSKYGLKDVKSQSNYMKLTGKLSNDNILSLRSTVFEMIVESKGKQSVV 1086

Query: 932  EFTKKSGSNKT 942
             F K SGS+KT
Sbjct: 1087 GFNKISGSSKT 1097

>Suva_2.687 Chr2 complement(1215095..1218481) [3387 bp, 1128 aa] {ON}
            YCL024W (REAL)
          Length = 1128

 Score =  615 bits (1585), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 406/964 (42%), Positives = 534/964 (55%), Gaps = 91/964 (9%)

Query: 10   LPYHGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDEISPEAQD 69
            +PY GF SDVWSCG+ILFALLTGRLPFDEEDGNIR LLLKVQ G+FE+P  DEIS EAQD
Sbjct: 205  IPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRALLLKVQKGEFELPSDDEISREAQD 264

Query: 70   LIAKILTVDPAARIKSREILKHPLLQKYPSIKDSKSIRNLPREDTYLNPLDSVNGSIDES 129
            LI+KILTVDP  RIK+R+ILKHPLLQKYPSI+DSKSIR+LPREDTYL PL   N SID +
Sbjct: 265  LISKILTVDPERRIKARDILKHPLLQKYPSIRDSKSIRDLPREDTYLTPLSESNSSIDAT 324

Query: 130  IINNLVVLWHGRDRNEITAQLKEPGANLEKTFYALLFRFKHDSHQEQLKQQ----RRSQA 185
            I+ NLV+LWHGRD + I A+L+EPGAN EKT YALL+RFK D+ +E +KQQ    R+S  
Sbjct: 325  ILQNLVILWHGRDPDGIRAKLQEPGANAEKTLYALLYRFKCDTQKELIKQQQIRKRQSIG 384

Query: 186  S-HISPKXXXXXXXXXXXXITNVTP-KKKNKAPVISASSSHKRPVSFNRLSFNNGSNTAH 243
            S  ISP              T+ TP +++N+  +IS SSS K+P+SFN+ + ++ S++  
Sbjct: 385  SVSISPPKR-----------TSTTPQRRRNRESIISVSSSRKKPISFNKFTASSASSSNL 433

Query: 244  TPPTSASKRASVNLSSNKRISALINPNNSPTPV--HKRSSMRDLDASAPPIPMDMLKDYN 301
            T P S SKR S N SS K++S ++N  +SPTP   +KR+S+ ++D +     +      N
Sbjct: 434  TTPGS-SKRLSKNFSSKKKLSTIVN-QSSPTPSSRNKRTSIANVDKNQKRASIFSTTKKN 491

Query: 302  KSAPKVXXXXXXXXXXXXXXPGNKRGSITTKLIATYAKISKDNDWEYIEKETRRTSADFA 361
            K A K               P  KR S+TTKL++TYAK+++D+DWEYIEKET+RTS++FA
Sbjct: 492  KRASK-------STRRMSLIPSMKRESVTTKLMSTYAKLAEDDDWEYIEKETKRTSSNFA 544

Query: 362  TLCDEIFEHEKYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHQMXXXX 421
            TL DEIFE+EKY                                          ++    
Sbjct: 545  TLIDEIFEYEKY-----DQIRKEKEELERKVKEAKALEELERRKRKQEEKERARKLLEKE 599

Query: 422  XXXXXXXXXXXXIEQEIALLKQS-VNPQGPSDSNHVRSVSAPAESVLKVDKRGSTGNLDN 480
                        I+ +I+ L+   +N +      ++RS+SAP E     ++  +  +L+ 
Sbjct: 600  ELKRKQEELKKQIDIDISDLEHELINHREEKFEGNIRSISAPME-----NEENNINHLEA 654

Query: 481  DIMALLNRRTFSLETRPKSRLDPGIYTS---EEED--FGSKNHGADLSTEKTILETIRRS 535
            DI  +L RR FSL+TRP SRLDPGI  S   E ED     K     L+TEK ILETIRRS
Sbjct: 655  DIDNILRRRNFSLQTRPVSRLDPGIIFSSPIETEDPVEPKKAENERLTTEKKILETIRRS 714

Query: 536  KFLGSSFDINXXXXXXXXXXXXXXXXXXXXXXXXVASNATTANVVGNG-YESQTLPKRKM 594
            KFLGSSF+I+                        V+ +        NG YES  LPK   
Sbjct: 715  KFLGSSFNIDKELKLSQMEYPGMAAPQRLSEERIVSDS--------NGKYESLVLPKDAK 766

Query: 595  GSA------------MEASSEPRKISEVEVPQFTRRSRHFTASNKRLSVLSMYSTKTSFT 642
            G A            + ++ E RKIS++ VPQFTR+SRHF+ SNKRLSVLSMYSTK SFT
Sbjct: 767  GVAHLKDNTAPTTTELLSNGELRKISDIRVPQFTRKSRHFSESNKRLSVLSMYSTKESFT 826

Query: 643  NLADHLK-GKADVQLIQTSPPSASKMDQEAEFMFESVDKEGKETADTSADSRLYEVAET- 700
            NL D LK G  D+   Q       +   ++EF+FE+V++E + T ++S D RLY+V ++ 
Sbjct: 827  NLVDILKNGNLDINPQQNQRVPTPRSADDSEFLFETVNEEAEYTGNSSNDERLYDVGDSC 886

Query: 701  -KDAKNAKPAVKLNFADRFNRXXXXXXXXXXXXAAIKLPALPPLDKNKPNMVSGLGLYQA 759
             KD    K  +KLNFADRFN               + LP LPPL+       +G    + 
Sbjct: 887  IKD----KNTLKLNFADRFN-----GSTNEKETKNLHLPTLPPLNGKDE---AGKQGEEQ 934

Query: 760  TAEPSHEDAQPVAKSMVIDDVESEITTEPRNTVTETEEAAKNSTVVPTAPVAPLNNVMKK 819
              E  HE  QP  KSM+    ES+  +       E E+  +    +       +    +K
Sbjct: 935  EKEDLHE--QPKVKSMI---PESDSLSHAEKEQKEREDQQRGGKDLEPPLNKSVQKTREK 989

Query: 820  NTDADRKPLS-DITPAVEXXXXXXXXXXXXXXXXXXXXXXXYDFRFKTVIEETQMFNALS 878
            N D   K  S D  P                          Y       +   Q+FN L 
Sbjct: 990  NNDTQAKNQSTDPKPNKNVSGNGSFFRKFSKSSTSEKSTELY-----AKVSAKQLFNGLE 1044

Query: 879  KLLAAWKDYGLKDVIASPSLKQIRGKLSSDNILSLRSTLFIITVVGRGEGSYVEFTKKSG 938
            KLL  W  YGLK+V ++P+   + GKLSS+N+ SLRSTLF +++  +G+ S VEF K SG
Sbjct: 1045 KLLRGWNQYGLKNVKSNPNNLTLTGKLSSENMFSLRSTLFEVSIYQKGKVSVVEFKKISG 1104

Query: 939  SNKT 942
            S KT
Sbjct: 1105 SFKT 1108

>Skud_4.783 Chr4 complement(1382552..1385959) [3408 bp, 1135 aa] {ON}
            YDR507C (REAL)
          Length = 1135

 Score =  603 bits (1556), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 401/968 (41%), Positives = 519/968 (53%), Gaps = 94/968 (9%)

Query: 10   LPYHGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDEISPEAQD 69
            +PY GF SDVWSCG+ILFALLTGRLPFDEEDGNIR LLLKVQ GQFE+P  DE+S EAQD
Sbjct: 205  IPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGQFELPSDDEVSREAQD 264

Query: 70   LIAKILTVDPAARIKSREILKHPLLQKYPSIKDSKSIRNLPREDTYLNPLDSVNGSIDES 129
            LI KILTVDP  RIK+R+ILKHPLLQKYPSI+DSKSIR LPREDTYL PL   N SID +
Sbjct: 265  LICKILTVDPKRRIKARDILKHPLLQKYPSIRDSKSIRGLPREDTYLTPLSESNSSIDAT 324

Query: 130  IINNLVVLWHGRDRNEITAQLKEPGANLEKTFYALLFRFKHDSHQEQLKQQRRSQASHIS 189
            I+ NLV+LWHGRD + I  +LKEPGAN EKT YALL+RFK D+ +E ++QQ       I 
Sbjct: 325  ILQNLVILWHGRDPDGIKEKLKEPGANAEKTLYALLYRFKCDTQKELIRQQ------QIK 378

Query: 190  PKXXXXXXXXXXXXITNVTP-KKKNKAPVISASSSHKRPVSFNRLSFNNGSNTAHTPPTS 248
             +              + TP ++KN+  +IS +SS K+P+SFN+ + ++ S++  T P S
Sbjct: 379  KRQSISSVSTSSPNKISTTPQRRKNRESIISVTSSRKKPISFNKFTASSASSSNLTTPGS 438

Query: 249  ASKRASVNLSSNKRISALINPNNSPTPV--HKRSSMRDLDASAPPIPMDMLKDYNKSAPK 306
             SKR S N SS KR+S ++N   SPTP   +KR+S+ ++D +     +      NK   +
Sbjct: 439  -SKRLSKNFSSKKRLSTIVN-QASPTPASRNKRTSIINVDKNQRRASVFSTAKRNKKTSR 496

Query: 307  VXXXXXXXXXXXXXXPGNKRGSITTKLIATYAKISKDNDWEYIEKETRRTSADFATLCDE 366
                           P  KR S+TTKL++TYAK++ D+DWEYIEKET+RTS++FATL DE
Sbjct: 497  -------STKKLSLIPSMKRESVTTKLMSTYAKLAADDDWEYIEKETKRTSSNFATLIDE 549

Query: 367  IFEHEKYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHQMXXXXXXXXX 426
            IFE+EKY                                          ++         
Sbjct: 550  IFEYEKY-----EKIRKEKKELELKVREAKAREELERRKRKQEEKEHSRKVLEKEELKRK 604

Query: 427  XXXXXXXIEQEIALLKQ--SVNPQGPSDSNHVRSVSAPAESVLKVDKRGSTGNLDNDIMA 484
                   IE +I+ L+   S + +   D N +RS+SAP ES  K     +  +L+ DI  
Sbjct: 605  QQELKKQIEIDISDLEHELSKHKEEKPDGN-IRSISAPMESEEK-----NINHLEVDIDN 658

Query: 485  LLNRRTFSLETRPKSRLDPGIYTSEEEDFGS-----KNHGADLSTEKTILETIRRSKFLG 539
            +L RR FSL+TRP SRLDPGI  S   +  S     +     L+TEK ILETIRRSKFLG
Sbjct: 659  ILRRRNFSLQTRPVSRLDPGIMFSSPVEKESAVEPKRTENERLTTEKKILETIRRSKFLG 718

Query: 540  SSFDINXXXXXXXXXXXXXXXXXXXXXXXXVASNATTANVVGNGYESQTLPKRKMG-SAM 598
            SSF+I                         V+  +       + Y S  LPK   G S +
Sbjct: 719  SSFNIEKELKLSKMEYPSMVPPQRLSEERIVSDPS-------DDYGSLVLPKDARGYSQL 771

Query: 599  E-----------ASSEPRKISEVEVPQFTRRSRHFTASNKRLSVLSMYSTKTSFTNLADH 647
            E           ++ E RKISEV VPQFTR+SRHF+ SNKRLSVLSMYS+K SFTNL D 
Sbjct: 772  EDHIAPTTGDLLSNGELRKISEVRVPQFTRKSRHFSESNKRLSVLSMYSSKESFTNLVDI 831

Query: 648  LK-GKADVQLIQTSPPSASKMDQEAEFMFESVDKEGKETADTSADSRLYEVAET--KDAK 704
            LK G  DV   Q+      K   ++EF+FE+V++E + T ++S D RLY+V ++  KD  
Sbjct: 832  LKNGNIDVHKQQSQRIPTPKSADDSEFLFETVNEEAEYTGNSSNDERLYDVGDSTIKD-- 889

Query: 705  NAKPAVKLNFADRFNRXXXXXXXXXXXXAAIKLPALPPLDK----NKPNMVSGLGLYQAT 760
              K A+KLNFADRFN               + LP LPPL+     NK      LG+    
Sbjct: 890  --KSALKLNFADRFN-----ASTNEKETENLHLPTLPPLNGGDEVNKQKDEDVLGI---- 938

Query: 761  AEPSHEDAQPVAKSMVIDDVESEITTEPRNTVT-------ETEEAAKNSTVVPTAPVAPL 813
                    QP  KSM+     S  T +             + E+ AK +  +      PL
Sbjct: 939  --------QPKVKSMIPQSDSSSHTGKEEEKEEKGEEGREDQEKDAKGAKDIE----PPL 986

Query: 814  NNVMKKNTDADRKPLSDITPAVEXXXXXXXXXXXXXXXXXXXXXXXYDFRFKTVIEETQM 873
            N  ++K    D  P     P                                  +   Q+
Sbjct: 987  NKSVQKTRANDSGPQVKSHPREPKKDRNISGNGSFFRKFSKSSTSDKSVELYAKVSAKQL 1046

Query: 874  FNALSKLLAAWKDYGLKDVIASPSLKQIRGKLSSDNILSLRSTLFIITVVGRGEGSYVEF 933
            FN L KLL  W  YGLK++ + P+   + GKLSS+NI SLRSTLF I++  RG+ S V+F
Sbjct: 1047 FNGLEKLLRGWTQYGLKNIKSHPNNLTLTGKLSSENIFSLRSTLFEISIYPRGKMSVVQF 1106

Query: 934  TKKSGSNK 941
             K SG+ K
Sbjct: 1107 KKVSGAFK 1114

>TPHA0E03640 Chr5 complement(769962..773375) [3414 bp, 1137 aa] {ON}
            Anc_1.52 YDR507C
          Length = 1137

 Score =  574 bits (1480), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 392/978 (40%), Positives = 521/978 (53%), Gaps = 120/978 (12%)

Query: 10   LPYHGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDEISPEAQD 69
            LPY+G E+D+WSCG+ILFALLTGRLPFDEEDGNIRNLLLKVQ G+FEMP SDE+S EAQD
Sbjct: 217  LPYNGLETDIWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPGSDELSLEAQD 276

Query: 70   LIAKILTVDPAARIKSREILKHPLLQKYPSIKDSKSIRNLPREDTYLNPLDSVNG---SI 126
            LI KILTV+P  RIK+REILKHPLLQKYP+IKDSK+IR+LPREDTYLNPL   NG    I
Sbjct: 277  LIGKILTVNPKQRIKTREILKHPLLQKYPNIKDSKTIRDLPREDTYLNPLADNNGVDTEI 336

Query: 127  DESIINNLVVLWHGRDRNEITAQLKEPGANLEKTFYALLFRFKHDSHQEQLKQ-QRRSQA 185
            DESI+ NL VLWHG+D+NEI  +LKEPGAN EKT Y LL RFK D+ +E  K  Q R + 
Sbjct: 337  DESILQNLTVLWHGKDKNEIIKKLKEPGANAEKTLYVLLHRFKEDTERENHKNSQLRKRQ 396

Query: 186  SHISPKXXXXXXXXXXXXITNVTPKKKNKAPVISASSSHKRPVSFNRLSFNNGS------ 239
            S +                 NV  ++KN+  +IS +SSHK+PVS+N+++   GS      
Sbjct: 397  SLMKASSSSSSNQ------GNVPRRRKNRNSMISVTSSHKKPVSYNKIAMVGGSSKDVIS 450

Query: 240  --NTAHTPPTSASKRASVNL-SSNKRISALINPNNS----PTPVHKRSSMRDL---DASA 289
              ++++T P S SKR S++L SSNKR S L   +NS    P P  +RSS ++L   ++ A
Sbjct: 451  LPSSSNTTPAS-SKRISLSLSSSNKRNSRLYTQSNSSSPTPAPRSRRSSNQNLINKESEA 509

Query: 290  PPIPMDMLKDYNKSAPKVXXXXXXXXXXXXXXPGNKRGSITTKLIATYAKISKDNDWEYI 349
            PPIP+D+LKDYNK + +                 NKRGS+TTK+++TYAK+++D+DWE+I
Sbjct: 510  PPIPVDVLKDYNKISNQ-NKRGSRLSKRYSFLLNNKRGSVTTKIMSTYAKLAEDDDWEFI 568

Query: 350  EKETRRTSADFATLCDEIFEHEKYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 409
            EKET+R S+DFATL DEIFEHEK+                                    
Sbjct: 569  EKETKRVSSDFATLIDEIFEHEKFEKIRKEKEELERKVIEAKQKEERERKEAEAAAKEEA 628

Query: 410  XXXXXHQMXXXXXXXXXXXXXXXXIEQEIALLKQS---VNPQGPSDSNHVRSVSAPAESV 466
                  ++                I++E  LLK     VN +   +  + RSVS P ++ 
Sbjct: 629  RVRREKEL---ARMNKEEEQLQNDIDEEARLLKDEFNFVNDETQENPINSRSVSEPVKNG 685

Query: 467  LKVDKRGSTGNLDNDIMALLNRRTFSLETRPKSRLDPGIYTSEEEDF---GSKNHGADLS 523
               D++G              +R FSL+TRP SRLDPG+  S+  D     S +    ++
Sbjct: 686  -GTDEKG--------------QRNFSLQTRPISRLDPGLMFSKLGDVDNNSSVDENLTMN 730

Query: 524  TEKTILETIRRSKFLGSSFDINXXXXXXXXX-----XXXXXXXXXXXXXXXVASNATTAN 578
             +KTILETIRRSKFLGSSFDIN                             +AS +  +N
Sbjct: 731  NQKTILETIRRSKFLGSSFDINKELNNANEERKRLRQLQLQKQKELEEKERIASTSYVSN 790

Query: 579  VVGNGYESQTLPKRKMGSA----MEASSEPRKISEVEVPQFTRRSRHFTASNKRLSVLSM 634
                  E+Q L K  +G        +  EPRKISEV+VPQFTR+S++F+ SNKRLSVLS 
Sbjct: 791  ------ENQVLSKNAIGVVDLKDFSSDVEPRKISEVQVPQFTRKSKYFSESNKRLSVLSF 844

Query: 635  YSTKTSFTNLADHLKGKADVQLIQTSPPSASKMDQEAEFMFESVDK--EGKETADTSADS 692
            YS+K S+TNL D +K         T  P  +  D + +++ E  +   E  +      D 
Sbjct: 845  YSSKQSYTNLVDMIKENPVEDEDVTEDPGFNFEDSQYDYLEEKNEAPLEVSDEVPKEVDD 904

Query: 693  RLYEVAETKDAKNAKPAVKLNFADRFNRXXXXXXXXXXXXAAIKLPALPPLDKNKPNMVS 752
            ++ E     + KN+  ++KLNFADRF+                        +   PN++S
Sbjct: 905  KVQE-----EEKNS-VSMKLNFADRFSNVNSNTKQESS------------FEDKFPNILS 946

Query: 753  -----GLGLYQATAEPSHEDAQPVAKSMVIDDVESEITTEPRNTVTETEEAAKNSTVVPT 807
                 GLGLY       +E  +P                +P  ++   E+   +S VV  
Sbjct: 947  KSGTEGLGLYSK-----NEKTEP----------------KPVKSMIPEEDKVNSSPVVE- 984

Query: 808  APVAPLNNVMKKNTDADRKPLSDITPAVEXXXXXXX--XXXXXXXXXXXXXXXXYDFRFK 865
               APLN V+ K T A+ K  S      +                         ++    
Sbjct: 985  ---APLNKVVNK-TRAENKSTSKGPSGSQKVSNTSSFLRKISGKSSNSTVAKGAFEVNLY 1040

Query: 866  TVIEETQMFNALSKLLAAWKDYGLKDVIASPSLKQIRGKLSSDNILSLRSTLFIITVVGR 925
            + + ETQ+FN L  LL  W +YGLKDV      K I GKLS+DNILSLRST+  + V   
Sbjct: 1041 SSVTETQLFNGLQNLLKGWTNYGLKDVKVDKQKKMIVGKLSNDNILSLRSTIVELCVFTE 1100

Query: 926  GEGSYVEFTKKSGSNKTF 943
             + S +   KKSGS+KT 
Sbjct: 1101 SKFSVIGIRKKSGSSKTM 1118

>YDR507C Chr4 complement(1462358..1465786) [3429 bp, 1142 aa] {ON}
           GIN4Protein kinase involved in bud growth and assembly
           of the septin ring, proposed to have kinase-dependent
           and kinase-independent activities; undergoes
           autophosphorylation; similar to Kcc4p and Hsl1p
          Length = 1142

 Score =  554 bits (1428), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 338/758 (44%), Positives = 445/758 (58%), Gaps = 65/758 (8%)

Query: 10  LPYHGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDEISPEAQD 69
           +PY GF SDVWSCG+ILFALLTGRLPFDEEDGNIR LLLKVQ G+FEMP  DEIS EAQD
Sbjct: 205 IPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGEFEMPSDDEISREAQD 264

Query: 70  LIAKILTVDPAARIKSREILKHPLLQKYPSIKDSKSIRNLPREDTYLNPLDSVNGSIDES 129
           LI KILTVDP  RIK+R+ILKHPLLQKYPSI+DSKSIR LPREDTYL PL   N SID +
Sbjct: 265 LIRKILTVDPERRIKTRDILKHPLLQKYPSIRDSKSIRGLPREDTYLTPLSESNSSIDAT 324

Query: 130 IINNLVVLWHGRDRNEITAQLKEPGANLEKTFYALLFRFKHDSHQEQLKQQRRSQASHIS 189
           I+ NLV+LWHGRD   I  +L+EPGAN EKT YALL+RFK D+ +E +KQQ       + 
Sbjct: 325 ILQNLVILWHGRDPEGIKEKLREPGANAEKTLYALLYRFKCDTQKELIKQQ------QVK 378

Query: 190 PKXXXXXXXXXXXXITNVTP-KKKNKAPVISASSSHKRPVSFNRLSFNNGSNTAHTPPTS 248
            +              + TP +++N+  +IS +SS K+P+SFN+ + ++ S++  T P S
Sbjct: 379 KRQSISSVSVSPSKKVSTTPQRRRNRESLISVTSSRKKPISFNKFTASSASSSNLTTPGS 438

Query: 249 ASKRASVNLSSNKRISALINPNNSPTPV--HKRSSMRDLDASAPPIPMDMLKDYNKSAPK 306
            SKR S N SS K++S ++N  +SPTP   +KR+S+ +++ +     +      NK + +
Sbjct: 439 -SKRLSKNFSSKKKLSTIVN-QSSPTPASRNKRASVINVEKNQKRASIFSTTKKNKRSSR 496

Query: 307 VXXXXXXXXXXXXXXPGNKRGSITTKLIATYAKISKDNDWEYIEKETRRTSADFATLCDE 366
                          P  KR S+TTKL++TYAK+++D+DWEYIEKET+RTS++FATL DE
Sbjct: 497 -------SIKRMSLIPSMKRESVTTKLMSTYAKLAEDDDWEYIEKETKRTSSNFATLIDE 549

Query: 367 IFEHEKYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHQMXXXXXXXXX 426
           IFE+EKY                                          ++         
Sbjct: 550 IFEYEKY-----EQIRKEKEELERKVREAKAREELERRRRKQEEKERARKLLEKEDLKRK 604

Query: 427 XXXXXXXIEQEIALLKQSVNPQGPS--DSNHVRSVSAPAESVLKVDKRGSTGNLDNDIMA 484
                  IE +I+ L+Q ++       D N +RS+SAP E     ++  +  +L+ DI  
Sbjct: 605 QEELKKQIEIDISDLEQELSKHKEEKLDGN-IRSISAPME-----NEEKNINHLEVDIDN 658

Query: 485 LLNRRTFSLETRPKSRLDPGI-YTSEEEDFG----SKNHGADLSTEKTILETIRRSKFLG 539
           +L RR FSL+TRP SRLDPGI ++S  E+       +     L+TEK ILETIRRSKFLG
Sbjct: 659 ILRRRNFSLQTRPVSRLDPGIMFSSPTEEVSPVEPKRTENERLTTEKKILETIRRSKFLG 718

Query: 540 SSFDINXXXXXXXXXXXXXXXXXXXXXXXXVASNATTANVVGNGYESQTLPKRKMGSAM- 598
           SSF+I+                        V+ +        +GYES  LPK   G +  
Sbjct: 719 SSFNIDKELKLSKMEYPSIIAPQRLSEERVVSDS-------NDGYESLILPKDGNGVSQL 771

Query: 599 ---EASSEP------RKISEVEVPQFTRRSRHFTASNKRLSVLSMYSTKTSFTNLADHLK 649
               A++ P      RKISE+ VPQFTR+SRHF+ SNKRLSVLSMYSTK SFTNL D LK
Sbjct: 772 KDSTATTAPVSDGRLRKISEIRVPQFTRKSRHFSESNKRLSVLSMYSTKESFTNLVDILK 831

Query: 650 -GKADVQLIQTSPPSASKMDQEAEFMFESVDKEGKETADTSADSRLYEVAET--KDAKNA 706
            G  DV   Q+      +   ++EF+FE+V++E + T ++S D RLY+V ++  KD    
Sbjct: 832 NGNLDVNNQQSQRIPTPRSADDSEFLFETVNEEAEYTGNSSNDERLYDVGDSTIKD---- 887

Query: 707 KPAVKLNFADRFNRXXXXXXXXXXXXAAIKLPALPPLD 744
           K A+KLNFADRFN               + LP LPPL+
Sbjct: 888 KSALKLNFADRFN-----GSNEAKQTDNLHLPILPPLN 920

 Score = 78.6 bits (192), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 39/74 (52%), Positives = 49/74 (66%)

Query: 868  IEETQMFNALSKLLAAWKDYGLKDVIASPSLKQIRGKLSSDNILSLRSTLFIITVVGRGE 927
            I   Q+FN L KLL  W  YGLK++ + P+   + GKLSSDNI SLRSTLF + +  RG+
Sbjct: 1048 ISAKQLFNGLEKLLRGWTQYGLKNIKSHPNNLTLTGKLSSDNIFSLRSTLFEVNIYPRGK 1107

Query: 928  GSYVEFTKKSGSNK 941
             S V+F K SGS K
Sbjct: 1108 MSVVQFKKVSGSFK 1121

>Smik_4.789 Chr4 complement(1385209..1388619) [3411 bp, 1136 aa]
           {ON} YDR507C (REAL)
          Length = 1136

 Score =  545 bits (1405), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 346/794 (43%), Positives = 451/794 (56%), Gaps = 79/794 (9%)

Query: 10  LPYHGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDEISPEAQD 69
           +PY GF SDVWSCG+ILFALLTGRLPFDEEDGNIR LLLKVQ G+FE+P  DEIS EAQD
Sbjct: 205 IPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGEFELPSDDEISREAQD 264

Query: 70  LIAKILTVDPAARIKSREILKHPLLQKYPSIKDSKSIRNLPREDTYLNPLDSVNGSIDES 129
           LI++ILTVDP  RIK+R+ILKHPLLQKYPSIKDSKSIR LPREDTYL PL   N SID +
Sbjct: 265 LISRILTVDPERRIKTRDILKHPLLQKYPSIKDSKSIRGLPREDTYLTPLSESNSSIDAT 324

Query: 130 IINNLVVLWHGRDRNEITAQLKEPGANLEKTFYALLFRFKHDSHQEQLKQQRRSQASHIS 189
           I+ NLV+LWHGRD + I  +L+E GAN EKT YALL+RFK D+ +E +KQQ       I 
Sbjct: 325 ILQNLVILWHGRDPDGIKEKLRETGANAEKTLYALLYRFKCDTQKELVKQQ------QIK 378

Query: 190 PKXXXXXXXXXXXXITNVTP-KKKNKAPVISASSSHKRPVSFNRLSFNNGSNTAHTPPTS 248
            +              + TP ++KN+  +IS SSS K+P+SFN+ + ++ S++  T P S
Sbjct: 379 KRQSISSLSISPSKKLSTTPQRRKNRESMISVSSSRKKPISFNKFTASSASSSNLTTPGS 438

Query: 249 ASKRASVNLSSNKRISALINPNNSPTPV--HKRSSMRDLDASAPPIPMDMLKDYNKSAPK 306
            SKR S N SS K++S ++N  +SPTP   +KR+S+ +++ +     +      NK   K
Sbjct: 439 -SKRLSKNFSSKKKLSTIVN-QSSPTPASRNKRASVINIEKNQKRASVFSTAKKNKRTSK 496

Query: 307 VXXXXXXXXXXXXXXPGNKRGSITTKLIATYAKISKDNDWEYIEKETRRTSADFATLCDE 366
                          P  KR S+TTKL++TYAK+++D+DWEYIEKET+RTS++FATL DE
Sbjct: 497 -------SIKRMSLIPSMKRESVTTKLMSTYAKLAEDDDWEYIEKETKRTSSNFATLIDE 549

Query: 367 IFEHEKYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHQMXXXXXXXXX 426
           IFE+EKY                                          ++         
Sbjct: 550 IFEYEKY-----EQIRKEKEELERKVREAKAREELERRRRRQEEKERTRKLLEKEELKMK 604

Query: 427 XXXXXXXIEQEIALLKQ--SVNPQGPSDSNHVRSVSAPAESVLKVDKRGSTGNLDNDIMA 484
                  IE +I+ L+Q  S + +   D N +RS+SAP E     ++  +  +L  DI  
Sbjct: 605 QEELKKQIEMDISDLEQELSRHKEEKPDGN-IRSISAPME-----NEEKNIDHLGTDIDN 658

Query: 485 LLNRRTFSLETRPKSRLDPGIYTSE--EEDF---GSKNHGADLSTEKTILETIRRSKFLG 539
           +L RR FSL+TRP SRLDPGI  S   E  +     ++    L+TEK ILETIRRSKFLG
Sbjct: 659 ILRRRNFSLQTRPVSRLDPGIVFSNPIETVYPVEPKRSENERLTTEKKILETIRRSKFLG 718

Query: 540 SSFDINXXXXXXXXXXXXXXXXXXXXXXXXVASNATTANVVGNGYESQTLPKRKMGSAM- 598
           SSF+I                         V+        +   YES  LPK   G +  
Sbjct: 719 SSFNIEKELKLSKMEYPSVLAPEKLSGERVVSD-------LNGKYESLILPKDAKGVSQL 771

Query: 599 -----------EASSEPRKISEVEVPQFTRRSRHFTASNKRLSVLSMYSTKTSFTNLADH 647
                       +  + RKISEV VPQFTR+SRHF+ SNKRLS+LSMYSTK SFTNL D 
Sbjct: 772 KDDITSTTTEHLSDGKLRKISEVRVPQFTRKSRHFSESNKRLSLLSMYSTKESFTNLVDI 831

Query: 648 LK-GKADVQLIQTSPPSASKMDQEAEFMFESVDKEGKETADTSADSRLYEVAET--KDAK 704
           LK    DV   Q+      +   ++EF+FE+V++E + T ++S D RLY+V ++  KD  
Sbjct: 832 LKNSNLDVNNQQSQRIPTPRSADDSEFLFETVNEEAEYTGNSSNDERLYDVGDSTIKD-- 889

Query: 705 NAKPAVKLNFADRFNRXXXXXXXXXXXXAAIKLPALPPLDKNKPNMVSGLGLYQATAEPS 764
             K A+KLNFADRFN               + LP+LPPL           G  +   + S
Sbjct: 890 --KTALKLNFADRFNESTEYKETDN-----LHLPSLPPLS----------GDDEMRKQNS 932

Query: 765 HEDA--QPVAKSMV 776
            ED+  QP  KSM+
Sbjct: 933 EEDSLVQPKVKSMI 946

 Score = 73.6 bits (179), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 47/70 (67%)

Query: 872  QMFNALSKLLAAWKDYGLKDVIASPSLKQIRGKLSSDNILSLRSTLFIITVVGRGEGSYV 931
            Q+FN L KLL  W  +GLK++ + P+   + GKLSS+NI SLRSTLF I +  +G  S V
Sbjct: 1046 QLFNGLEKLLRGWTQFGLKNIKSHPNNLTLTGKLSSENIFSLRSTLFEINIYPKGRMSVV 1105

Query: 932  EFTKKSGSNK 941
            +F K SGS K
Sbjct: 1106 QFKKISGSFK 1115

>SAKL0C01716g Chr3 (143880..147527) [3648 bp, 1215 aa] {ON} similar
           to uniprot|Q12263 Saccharomyces cerevisiae YDR507C
          Length = 1215

 Score =  494 bits (1273), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 250/391 (63%), Positives = 295/391 (75%), Gaps = 28/391 (7%)

Query: 10  LPYHGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDEISPEAQD 69
           LPYHGFESDVWSCG+IL+ALLTGRLPFDE++GNIR+LLLKVQSG++EMP +DEIS EAQD
Sbjct: 213 LPYHGFESDVWSCGVILYALLTGRLPFDEDNGNIRSLLLKVQSGEYEMPGNDEISSEAQD 272

Query: 70  LIAKILTVDPAARIKSREILKHPLLQKYPSIKDSKSIRNLPREDTYLNPLDSVNGSIDES 129
           LIAKILTVDP  RIK+REILKHPLLQKYPSIKDSKSIRNLPREDTYLNPLD  +GSID+ 
Sbjct: 273 LIAKILTVDPDRRIKTREILKHPLLQKYPSIKDSKSIRNLPREDTYLNPLDHGDGSIDDG 332

Query: 130 IINNLVVLWHGRDRNEITAQLKEPGANLEKTFYALLFRFKHDSHQEQLKQQRRS------ 183
           I+ NLVVLWHGRDRNEI A+L EPGANLEKTFY LLFRFKHD HQ+Q +QQ++       
Sbjct: 333 ILQNLVVLWHGRDRNEIVAKLNEPGANLEKTFYVLLFRFKHDVHQQQQQQQQQQQQQQQQ 392

Query: 184 -------------QASHISPKXXXXXXXXXXX------XITNVTPKKKNKAPVISASSSH 224
                        Q+ ++SPK                      TPKKKN+  +IS SSSH
Sbjct: 393 QQQQQQQQQQQSRQSGYVSPKKLAMKKSASRKSITSTSLSGTTTPKKKNRVSMISVSSSH 452

Query: 225 KRPVSFNRLSFNNGSNTAHTPPTSASKRASVNLSSNKRISALINPNNSPTPVHKRSSMRD 284
           KRPVSFN+LS    S++A   P S++KR S++LSS+KR+SA+  PN SPTP +KR S+RD
Sbjct: 453 KRPVSFNKLSTAGKSDSACGTPGSSTKRMSISLSSSKRLSAM-GPNTSPTPANKRMSVRD 511

Query: 285 LDASAPPIPMDMLKDYNKSAP--KVXXXXXXXXXXXXXXPGNKRGSITTKLIATYAKISK 342
           +D+SAPP+PMD+L DY  + P  K               P  KRGSITTKLIATYAK+S+
Sbjct: 512 MDSSAPPVPMDVLNDYTSALPNRKATKRASRASKRLSFLPNIKRGSITTKLIATYAKLSE 571

Query: 343 DNDWEYIEKETRRTSADFATLCDEIFEHEKY 373
           ++DWEYIEKET+RTSADFATLCD+IFEHEKY
Sbjct: 572 EDDWEYIEKETKRTSADFATLCDQIFEHEKY 602

 Score =  375 bits (964), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 254/545 (46%), Positives = 310/545 (56%), Gaps = 49/545 (8%)

Query: 434  IEQEIALLKQSVN-PQGPSDSNHV---RSVSAP-AESVLKVD-KRGSTGNLDNDIMALLN 487
            + +E+A+L+     PQ   +       R VSAP A S  K D KR S   L  DI  LL 
Sbjct: 664  MAKEVAMLRADYGEPQTEPEEQGASKNRCVSAPIASSSAKDDGKRDSIARLSGDIDDLLK 723

Query: 488  RRTFSLETRPKSRLDPGIYTSEEEDFGS----KNHGAD---LSTEKTILETIRRSKFLGS 540
            RRT SL+TRP SRLDPGI  +E  + GS    +  G D   L TEKTILETIRRS+FLGS
Sbjct: 724  RRTVSLQTRPVSRLDPGIVAAE--NLGSVIYEEADGVDETTLRTEKTILETIRRSRFLGS 781

Query: 541  SFDINXXXXXXXXXXXXXXXXXXXXXXXXVASNATTANVVGNGYESQTLPKRKMGSAM-- 598
            SFDI                         + S+AT A+   + YES+ LPK         
Sbjct: 782  SFDIKKELERAQRKKEEALARQHQQR---ILSSATAASATNDAYESRALPKNAAAVDTLN 838

Query: 599  -EASSEPRKISEVEVPQFTRRSRHFTASNKRLSVLSMYSTKTSFTNLADHLKGKADVQLI 657
             E + EPRKISE++VPQFTRRSRHFTASNKRLSVLSMYSTK+SFTNLADHLKG AD+Q +
Sbjct: 839  DERNPEPRKISEIKVPQFTRRSRHFTASNKRLSVLSMYSTKSSFTNLADHLKGGADLQEV 898

Query: 658  QTSPPSASKMDQEAEFMFESVDKE-GKETADTSADSRLYEVAETKDAK--NAKPAVKLNF 714
              S PS +K+ QE EF+FESV +E  +ET DT+ADSRLYEV +  ++   + K A++LNF
Sbjct: 899  SGSAPSTTKITQEPEFLFESVHEEDSEETPDTTADSRLYEVPDGSESSKTSTKAAMRLNF 958

Query: 715  ADRFNRXXXXXXXXXXXXAAIKLPALPPLDKNKPNMVSGLGLYQ------ATAEPSHEDA 768
            ADRFN             A +KLP LPPL+KN     +GLG+YQ      A   P+    
Sbjct: 959  ADRFN------TRAGDNPADVKLPPLPPLEKNGSKKPNGLGIYQSPERPRADPNPTSMVH 1012

Query: 769  QPVAKSMVIDDVE--------SEITTEPRNTVTETE-EAAKNSTVVPTAPVAPLNNVMKK 819
            +P   SM+ DD+         +E    P +   ++E + A +S   P A   PLN +M+K
Sbjct: 1013 EPKVFSMIPDDIAGPAKSTKPAESENVPTSATKKSEPKNALHSADAPEASQPPLNGMMRK 1072

Query: 820  NTDADRKPLSDITPAVEXXXXXXXXXXXXXXXXXXXXXXXYDFRFKTVIEETQMFNALSK 879
            N   DRKPL DITPA E                       +D +  T +E  QMFNAL K
Sbjct: 1073 NN--DRKPLEDITPAAE-KKRNRSFFRKFSRSSEEKKSDNFDAKLNTSVEAVQMFNALGK 1129

Query: 880  LLAAWKDYGLKDVIASPSLKQIRGKLSSDNILSLRSTLFIITVV-GRGEGSYVEFTKKSG 938
            LL  WKDYGLK+V      K I GKLSSDNILSLRST+F I V     +GS V F KKSG
Sbjct: 1130 LLGGWKDYGLKEVRVQGPTKTITGKLSSDNILSLRSTMFEILVRDDSSKGSVVWFVKKSG 1189

Query: 939  SNKTF 943
            S KTF
Sbjct: 1190 STKTF 1194

>TDEL0C06490 Chr3 complement(1191461..1194922) [3462 bp, 1153 aa]
           {ON} Anc_1.52 YDR507C
          Length = 1153

 Score =  452 bits (1163), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 228/375 (60%), Positives = 282/375 (75%), Gaps = 15/375 (4%)

Query: 10  LPYHGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDEISPEAQD 69
           +PYHGF SDVWSCG+ILFALLTGRLPFD+EDGNIRNLLL+VQSG++EMP  DEISP+AQD
Sbjct: 206 IPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRNLLLQVQSGRYEMPGDDEISPDAQD 265

Query: 70  LIAKILTVDPAARIKSREILKHPLLQKYPSIKDSKSIRNLPREDTYLNPL-DSVNGSIDE 128
           LIA+ILTVDP  RIK+R+ILKHPLLQKYPSI DSKSIRNLPREDTYL+PL +  +  IDE
Sbjct: 266 LIARILTVDPEQRIKARDILKHPLLQKYPSINDSKSIRNLPREDTYLHPLSEGESAEIDE 325

Query: 129 SIINNLVVLWHGRDRNEITAQLKEPGANLEKTFYALLFRFKHDSHQEQLKQ-QRRSQASH 187
           +I+ NLVVLWHGR++ EI  +L+EPGAN EKT YALL RFK D+  + +K  Q + + S 
Sbjct: 326 NILQNLVVLWHGREQLEIINKLREPGANAEKTLYALLDRFKSDTENDSVKHPQSKKRVSQ 385

Query: 188 ISPKXXXXXXXXXXXXITNVTPKKKNKAPVISASSSHKRPVSFNRLSFNNGSNTAHTPPT 247
           I+P              TN +PK++N+  +IS SSSHKRPVSFN+LS  N  +    P +
Sbjct: 386 INPVRQPTTKKAPSKPQTNASPKRRNRTSMISVSSSHKRPVSFNKLS--NVVSPGSVPSS 443

Query: 248 SA---SKRASVNLSSNKRISALINPNNSPTPV--HKRSSMRDLDAS----APPIPMDMLK 298
           ++   SKR SVNLSSNKR+SA+   + SPTP   HKR S+ DL+       PP+P++MLK
Sbjct: 444 NSNTPSKRVSVNLSSNKRLSAVYTNSGSPTPASRHKRVSIVDLERERENDTPPVPIEMLK 503

Query: 299 DYNKSAPKVXXXXXXXXXXXXXXPGNKRGSITTKLIATYAKISKDNDWEYIEKETRRTSA 358
           DY+ +A +               P NKRGSITTKLI+TYAK+S+D+DWEYIEKET+RTS+
Sbjct: 504 DYSSTAKQ--KRLSRNNMRLSFKPSNKRGSITTKLISTYAKLSEDDDWEYIEKETKRTSS 561

Query: 359 DFATLCDEIFEHEKY 373
           DFATLCD+IFEHEK+
Sbjct: 562 DFATLCDQIFEHEKF 576

 Score =  286 bits (733), Expect = 7e-81,   Method: Compositional matrix adjust.
 Identities = 204/504 (40%), Positives = 267/504 (52%), Gaps = 51/504 (10%)

Query: 457  RSVSAPAESVLKVDKRGSTGNLDNDIMALLNRRTFSLETRPKSRLDPGIYTS---EEEDF 513
            RSVS P    L+        +L  +I  LL +RTFSL+TRP SRLDPG+++S   E++ +
Sbjct: 662  RSVSEP----LQKKSADPMADLQANIDDLLRQRTFSLQTRPVSRLDPGVFSSDSSEKDQY 717

Query: 514  GSKNHGADLSTEKTILETIRRSKFLGSSFDINXXXXXXXXXXXXXXXXXXXXXXXXVASN 573
                  A L+ +K ILETIRRSKFLGSSFDIN                          S 
Sbjct: 718  TGSEDRAKLNNDKIILETIRRSKFLGSSFDINKELKRAADNEAKKQRQ----------SK 767

Query: 574  ATTANVVG---NGYESQTLPKRKMGSA----MEASSEPRKISEVEVPQFTRRSRHFTASN 626
            AT+  ++    + YE+Q LPK    SA        +EPRKIS+++VPQFTR+SR F  SN
Sbjct: 768  ATSDRIISTTNDEYETQILPKNATASAPLKDHNHQAEPRKISDIKVPQFTRKSRQFGDSN 827

Query: 627  KRLSVLSMYSTKTSFTNLADHLKGKA-DVQLIQTSPPSASKMDQEAEFMFESVDKEGKET 685
            KRLSVLSMYS+K S+TNLAD L  +A + +  + SP   S    E EF+FE+V ++G+ T
Sbjct: 828  KRLSVLSMYSSKQSYTNLADLLNEEASNAKGNRDSPNDQS--GHEPEFLFENVQEDGEVT 885

Query: 686  ADTSADSRLYEVAETKDAKNAKPAVKLNFADRFNRXXXXXXXXXXXXAAIKLPALPPLDK 745
             D+S D RLYEV E  D+   K  +KLNFADRF                ++LP LPPLD 
Sbjct: 886  GDSSHDGRLYEVPE--DSNMTKEKLKLNFADRF--KTSNGEDRTAEDKNVRLPTLPPLDG 941

Query: 746  NKPNMVSGLGLYQATAEPSHEDAQPVAKSMVIDDVESEITTEPRNTVTETEEA---AKNS 802
             +     GLG+YQ+++E   E AQ   KSM+ +D          N  +ET E     +++
Sbjct: 942  KE---AKGLGIYQSSSESLPEPAQHNVKSMIQND---------ENQPSETAEVLSIKEDN 989

Query: 803  TVVPTAPVAPLN-NVMKKNTDADRKPLSDITPAVEXXXXXXXXX--XXXXXXXXXXXXXX 859
              V     APLN ++ K  TD  +K  S+  P+ E                         
Sbjct: 990  AQVERQQEAPLNASIPKHRTDGAQK--SERMPSKEGSEKKRNTSFFRKFSKSSNEKTNGE 1047

Query: 860  YDFRFKTVIEETQMFNALSKLLAAWKDYGLKDVIASPSLKQIRGKLSSDNILSLRSTLFI 919
            +D      +   Q+FN L  LL  WK YGLK V + P    + GKLSS+NILSLRSTLF 
Sbjct: 1048 FDAELYASVAAKQLFNGLQNLLQGWKKYGLKGVKSMPDKLTLTGKLSSENILSLRSTLFE 1107

Query: 920  ITVVGRGEGSYVEFTKKSGSNKTF 943
            + V  RG+GS V F KKSGS KT 
Sbjct: 1108 MVVWSRGKGSIVGFRKKSGSTKTL 1131

>KLLA0C01650g Chr3 (128119..131457) [3339 bp, 1112 aa] {ON} similar
           to uniprot|Q12263 Saccharomyces cerevisiae YDR507C
          Length = 1112

 Score =  448 bits (1153), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 230/372 (61%), Positives = 274/372 (73%), Gaps = 22/372 (5%)

Query: 10  LPYHGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDEISPEAQD 69
           LPYHGFESDVWSCG+IL+ALLTGRLPFDEEDGNIRNLLLKVQSG+FEMP  DEIS EAQD
Sbjct: 200 LPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQSGKFEMPGDDEISSEAQD 259

Query: 70  LIAKILTVDPAARIKSREILKHPLLQKYPSIKDSKSIRNLPREDTYLNP--LDSVNGSID 127
           LIA+ILTVDP  RIK+REILKHPLL+KYPSIKDSKSIRNLPREDTYLNP  L+  N  +D
Sbjct: 260 LIARILTVDPEQRIKTREILKHPLLRKYPSIKDSKSIRNLPREDTYLNPLSLEGGNQCVD 319

Query: 128 ESIINNLVVLWHGRDRNEITAQLKEPGANLEKTFYALLFRFKHDSHQEQLKQQRRSQASH 187
           E+I+ NLVVLWHGR++ +I  +L EPGANLEKTFYALL RFKHD++Q+QLKQQ   +   
Sbjct: 320 ETILQNLVVLWHGRNKEDIITKLMEPGANLEKTFYALLHRFKHDNYQDQLKQQELQKKQS 379

Query: 188 ISPKXXXXXXXXXXXXITN--VTPKKKNKAPVISASSSHKRPVSFNRLSFNNGSNTAHTP 245
           +S               ++  VT  KK +  +I ASSSHKRPVS  +LS      + H+ 
Sbjct: 380 VSSNSLMYVGSLPSPNKSDSPVTTPKKKRTSIIVASSSHKRPVSMQKLS------SQHSS 433

Query: 246 PT---SASKRASVNLSSNKRISALINPNNSPTP-VHKRSSMRDLDASAPPIPMDMLKDYN 301
           P    S  KR S    SNKRIS L++ ++SPTP  HKR S R  D++APP+P +ML+DY 
Sbjct: 434 PVKNGSIGKRLSKTFPSNKRISQLVSNSSSPTPAAHKRVS-RINDSAAPPVPKEMLRDYK 492

Query: 302 KSAPKVXXXXXXXXXXXXXXPGNKRGSITTKLIATYAKISKDNDWEYIEKETRRTSADFA 361
           + + +               P  KRGSITTKLIATYAK+S+D++WEYIEKET+RTS DFA
Sbjct: 493 RQSKR-------QSKRFSLLPNMKRGSITTKLIATYAKLSEDSEWEYIEKETKRTSQDFA 545

Query: 362 TLCDEIFEHEKY 373
           TL D+IFEHEKY
Sbjct: 546 TLMDQIFEHEKY 557

 Score =  304 bits (779), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 219/543 (40%), Positives = 288/543 (53%), Gaps = 58/543 (10%)

Query: 434  IEQEIALLKQSVNP-QGPSDSNHV---RSVSAPAESVLKVDKRGSTGNLDNDIMALLNRR 489
            +E EIA LK      QG SD  +    RSVSAP E+    +KR ST  + NDI  L+N R
Sbjct: 614  MEDEIAKLKAEYEAVQGSSDERNTANGRSVSAPIETDRTANKRDSTFGIKNDINELINTR 673

Query: 490  TFSLETRPKSRLDPGIYTSEEEDFGSKNHGADLSTEKTILETIRRSKFLGSSFDINXXXX 549
             FSL+TRP SRLDPGI  +E     +       S EKTILETIRRSKFLGS F++N    
Sbjct: 674  NFSLQTRPVSRLDPGIIAAESR-LSANLEDDQASKEKTILETIRRSKFLGSQFNLNVELE 732

Query: 550  XXXXXXXXXXXXXXXXXXXXVASNATTANVVGNGYESQTLPK--RKMGSAMEASSEPRKI 607
                                  +           YE Q LPK  + + +  +   EPRK+
Sbjct: 733  KAQKDLVSKERQEQLRKYSEQTAK----------YEVQKLPKNAKAVATLRDDEVEPRKL 782

Query: 608  SEVEVPQFTRRSRHFTASNKRLSVLSMYSTKTSFTNLADHLKGKADVQLIQTSPP-SASK 666
            SEV+VPQFTRRS+HF++SNKR SVLS+YSTKTSFTNL DHLK    ++ +   P  S+SK
Sbjct: 783  SEVKVPQFTRRSKHFSSSNKRFSVLSLYSTKTSFTNLVDHLKNDNYLEPLPGQPEYSSSK 842

Query: 667  MDQEAEFMFESVDKEGKETADTSADSRLYEVAETKDAKNAKPAVKLNFADRFNRXXXXXX 726
            + QE EFMFE+V+       +   +S+L+EV ET++ K A  A K +   R         
Sbjct: 843  VAQEPEFMFETVE-------ELDENSKLFEVPETEEGKLASAARKESTDAR--------- 886

Query: 727  XXXXXXAAIKLPALPPL----DKNKPNMVSGLGLYQATAEPSHEDAQPVAKSMVIDD-VE 781
                    I LP+LPPL    D    N   GLG+YQ    P+ +  +P  K+M+ID+ ++
Sbjct: 887  KQSTNDKDINLPSLPPLQVSHDVADENGALGLGIYQ----PNDQTQKP-HKTMLIDESID 941

Query: 782  SEITTEPRNTVTETEEAAKNSTVVPTAPVAPLNNVMKKNTDADRKPLSDITPAVEXXXXX 841
              I++   + V+ TE   K           PLN+V++KN + +RKPL +ITP VE     
Sbjct: 942  ENISS--TSDVSRTEVVKK----------PPLNDVVRKNNN-ERKPLEEITPKVENKRKI 988

Query: 842  XXXXXXXXXXXXXXXXXXYDFRFKTVIEETQMFNALSKLLAAWKDYGLKDVIASPSLKQI 901
                              +D + K  +   +M+ AL +LL  W +YGLK V +SP+   I
Sbjct: 989  SFFRKFSQGSEKKLGPESFDSQLKAGVSAPKMYKALDRLLNEWTNYGLKHVESSPNDFVI 1048

Query: 902  RGKLSSDNILSLRSTLFIITVV-GRGEGSYVEFTKKSGSNKTFXXXXXXXXXXXXXXXAL 960
             GKL+SDNILSLRST F ITV+ G G GS ++FTKKSGS KTF                L
Sbjct: 1049 SGKLTSDNILSLRSTGFKITVLPGEGNGSIIQFTKKSGSTKTFNRLVKEIEKILEKEKVL 1108

Query: 961  VFS 963
            VFS
Sbjct: 1109 VFS 1111

>Kpol_2002.46 s2002 (95107..98478) [3372 bp, 1123 aa] {ON}
           (95107..98478) [3372 nt, 1124 aa]
          Length = 1123

 Score =  437 bits (1125), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 232/382 (60%), Positives = 273/382 (71%), Gaps = 24/382 (6%)

Query: 10  LPYHGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDEISPEAQD 69
           LPYHG E+DVWSCG+ILFALLTGRLPFDEEDGNIRNLLLKVQ G+FEMP  DEIS EAQD
Sbjct: 203 LPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPGDDEISKEAQD 262

Query: 70  LIAKILTVDPAARIKSREILKHPLLQKYPSIKDSKSIRNLPREDTYLNPL---DSVNGSI 126
           L+ KIL VDP  RIKSREILKHPLLQKYPSIKDSK+IRNLPREDTYLNPL   D  + +I
Sbjct: 263 LLYKILVVDPEKRIKSREILKHPLLQKYPSIKDSKTIRNLPREDTYLNPLIGNDGGDATI 322

Query: 127 DESIINNLVVLWHGRDRNEITAQLKEPGANLEKTFYALLFRFKHDSHQEQLKQ-QRRSQA 185
           D++I+ NLVVLWHGR+ ++I  +L+EPGAN EKT YALL+RFK DS QE LK  Q + + 
Sbjct: 323 DKTILQNLVVLWHGRNEDDIAKKLREPGANAEKTLYALLYRFKVDSEQEALKNSQIKKRQ 382

Query: 186 SHISPKXXXXXXXXXXXXITNVTP-KKKNKAPVISASSSHKRPVSFNRLS-FNNGSNTAH 243
           S IS              I   TP KKKN+  VIS SSSHKRPVS NRLS   NG +   
Sbjct: 383 SIIS------NNNLKSGNINTTTPQKKKNRNSVISVSSSHKRPVSLNRLSTIQNGKDVIS 436

Query: 244 TPPTS-----ASKRASVNLSSNKRISALINPNN---SPTPVHKRSSMRDLDASA--PPIP 293
            P +S     +SKR S++LSSNK    L   N+   +P P +KR S+++L+ S+  PPIP
Sbjct: 437 VPSSSNTTPGSSKRISMSLSSNKGSKILPQSNSGSPTPAPRNKRMSVQNLETSSNPPPIP 496

Query: 294 MDMLKDYNKSAPKVXXXXXXX--XXXXXXXPGNKRGSITTKLIATYAKISKDNDWEYIEK 351
           +DMLKDY  S                    P  KRGSITTK+I+TYAK+S+D+DWE+IEK
Sbjct: 497 VDMLKDYGNSTSSHANAKRASRISKRLSVLPNAKRGSITTKIISTYAKLSEDDDWEFIEK 556

Query: 352 ETRRTSADFATLCDEIFEHEKY 373
           ET+R S+DFATL DEIFEHEKY
Sbjct: 557 ETKRVSSDFATLIDEIFEHEKY 578

 Score =  213 bits (542), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 166/502 (33%), Positives = 245/502 (48%), Gaps = 61/502 (12%)

Query: 455  HVRSVSAPAESVLKVDKRGSTGNLDNDIMALLNRRTFSLETRPKSRLDPGIYTS-----E 509
            +VRS+S+P E+       G+    + D      +R+FSL+TRP S+LDPGI        +
Sbjct: 651  NVRSISSPVEN-------GNEAKSEEDASG---QRSFSLQTRPVSKLDPGIKCGSNKPVQ 700

Query: 510  EEDFGSKNHGADLSTEKTILETIRRSKFLGSSFDINXXXXXXXXXXXXXXXXXXXXXXXX 569
             E+         + ++K ILETIRRSKFLGSSF+I+                        
Sbjct: 701  MEEIVEDELDKTIDSQKVILETIRRSKFLGSSFNIDKELKQVKKDAEVKRMRKSQKEDRD 760

Query: 570  VASNATTANVVGNGYESQTLPKRK--MGSAMEASSE--PRKISEVEVPQFTRRSRHFTAS 625
            V+    +       YE+Q LPK     G+  + S E  PRKIS+++VPQFTR+S+ FT S
Sbjct: 761  VSGRIVSE--TNEQYETQVLPKNATAFGALKDDSEEVEPRKISDIQVPQFTRKSKLFTDS 818

Query: 626  NKRLSVLSMYSTKTSFTNLADHLK-GKADVQLIQTSPPSASKMDQEAEFMFESVDKEGKE 684
            NKRLSVLS+YS+  S+TNLA+ LK G  D+ + + S  +  ++ +E EF FE+V   G E
Sbjct: 819  NKRLSVLSIYSSTQSYTNLANVLKEGGVDIGVNEGS--NNVEVSEEPEFQFETV---GTE 873

Query: 685  TADTSADSRLYEVAETKDAKNAKPAVKLNFADRFNRXXXXXXXXXXXXAAIKLPALPPLD 744
              +   +       E   ++ A   +KLN+ADRF+               +KLP LPPL 
Sbjct: 874  IENNKYEEEKEIENENNLSQGAN--IKLNYADRFD--------TAGNVNEVKLPTLPPLG 923

Query: 745  KNKPNMVSGLGLYQATAEPSHEDAQPVAKSMVIDDVESEITTEPRNTVTETEEAAKNSTV 804
             +K  +  GLG+Y + +     +++PV                P     ++EE  K   V
Sbjct: 924  DDK--VSDGLGIYSSKSGSEGNESKPV----------------PSIKENKSEETLKEKNV 965

Query: 805  VPTAPVAPLNNVMKKNTDADRKPL---SDITPAVEXXXXXXXXXXXXXXXXXXXXXXXYD 861
                P  PLN+V+ K  D  +  +   ++   + +                       YD
Sbjct: 966  ---EPKPPLNDVVPKTRDTKKTNVVQNNNAKHSSDKPRSTSFFRKISKGLTVQNDTTGYD 1022

Query: 862  FRFKTVIEETQMFNALSKLLAAWKDYGLKDVIASPSLKQIRGKLSSDNILSLRSTLFIIT 921
             +  + +  TQ++N L  LL  WKDYGLK++ ++     I  +LSSDNILSLRST   + 
Sbjct: 1023 VKLFSNVSVTQLYNGLFNLLKGWKDYGLKEIKSNKEAFSISVRLSSDNILSLRSTFVDMV 1082

Query: 922  VVGRGEGSYVEFTKKSGSNKTF 943
            V   G+ S + F KKSGS+KT 
Sbjct: 1083 VFSEGKHSVIGFRKKSGSSKTL 1104

>ZYRO0F17402g Chr6 complement(1445685..1449254) [3570 bp, 1189 aa]
           {ON} similar to uniprot|Q12263 Saccharomyces cerevisiae
           YDR507C
          Length = 1189

 Score =  433 bits (1113), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 225/374 (60%), Positives = 277/374 (74%), Gaps = 19/374 (5%)

Query: 10  LPYHGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDEISPEAQD 69
           +PYHGF SD+WSCG+I FALLTGRLPFDEEDGNIRNLLLKVQSG+FEMPD DEISPEAQD
Sbjct: 206 IPYHGFASDIWSCGVIFFALLTGRLPFDEEDGNIRNLLLKVQSGKFEMPDDDEISPEAQD 265

Query: 70  LIAKILTVDPAARIKSREILKHPLLQKYPSIKDSKSIRNLPREDTYLNPL-DSVNGSIDE 128
           L+AKILTVDP  RIK REILKHPLLQKYP++ D+KSIRNLPREDTYL+PL DS +  +D+
Sbjct: 266 LLAKILTVDPECRIKPREILKHPLLQKYPNVSDNKSIRNLPREDTYLHPLSDSGSSEVDQ 325

Query: 129 SIINNLVVLWHGRDRNEITAQLKEPGANLEKTFYALLFRFKHDSHQEQLKQQRRSQASHI 188
           +I+ NLVVLWHGR   EI A+LK+PGAN EKT YALL RFK+D+ +E  +Q++  + S +
Sbjct: 326 NILQNLVVLWHGRPAGEIAAKLKDPGANAEKTLYALLARFKNDTEREAARQKQIKKRSSL 385

Query: 189 SPKXXXXXXXXXXXXITNVTPKKKNKAPVISASSSHKRPVSFNRLS---FNNGSNTAHTP 245
           +                +V+PKK+N+A  I+ASSSHKRPVS  +LS    +N ++   + 
Sbjct: 386 NGTGAGVNN-------NHVSPKKRNRASTINASSSHKRPVSLIKLSGSSNSNSNSNPSST 438

Query: 246 PTSASKRASVNLSSNKRISALINPNN--SPTPV--HKRSSM--RDLDASAPPIPMDMLKD 299
            T+  KR SVNLSSNKR+S +    N  SPTP    KR S+   D +  APP+P+DMLKD
Sbjct: 439 STTPPKRMSVNLSSNKRLSTVKTQGNGGSPTPASRSKRVSIIESDKNGGAPPVPIDMLKD 498

Query: 300 YNKSAPKVXXXXXXXXXXXXXXPGNKRGSITTKLIATYAKISKDNDWEYIEKETRRTSAD 359
           YNK+                  P NKRGS+TTKLI+TYAK+S+++DWEYIEKET+RTS+D
Sbjct: 499 YNKTPN--SKRLSRASVRLSFKPTNKRGSVTTKLISTYAKLSEEDDWEYIEKETKRTSSD 556

Query: 360 FATLCDEIFEHEKY 373
           FATL DEIFEHEK+
Sbjct: 557 FATLIDEIFEHEKF 570

 Score =  253 bits (645), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 200/556 (35%), Positives = 265/556 (47%), Gaps = 80/556 (14%)

Query: 446  NPQGPSDSNHVRSVSAPAESVLKVDKRGSTGNLDNDIMALLNRRTFSLETRPKSRLDPGI 505
            N Q P   N VRSVSAP    L+  KR S  N+ +DI  +  +RT SL+TRP SRLDPG+
Sbjct: 637  NNQAP---NGVRSVSAP----LERKKRDSMVNVQSDIEEIFGQRTMSLQTRPVSRLDPGL 689

Query: 506  YTSEEE---DFGSKNHGADLSTEKTILETIRRSKFLGSSFDINXXXXXXXXXXXXXXXXX 562
            + +EE    + G       L T+K ILETIRRSKFLGSSFDI                  
Sbjct: 690  FYAEESNEPEAGDTEEEKKLRTQKNILETIRRSKFLGSSFDIGKELQNEELKKKASQPHR 749

Query: 563  XXXXXXXVASNATTANVVGNGYESQTLPKRKMGSAMEASSEPRKISEVEVPQFTRRSRHF 622
                         T +     Y+++ LP + + +A     EPRKISE+ VPQFTR+SR F
Sbjct: 750  DR-----------TVSQTNEPYDTRVLPTQAVATAPLRDQEPRKISEISVPQFTRKSRFF 798

Query: 623  TASNKRLSVLSMYSTKTSFTNLADHLKGK--ADVQLIQTSPPSASKMDQEAEFMFESVDK 680
            + SNKRLSVLSMYSTK S+ NL++ L     +D +L   +  S  K  +E EF FE+V +
Sbjct: 799  SDSNKRLSVLSMYSTKHSYNNLSNLLNDSDASDGRLNSAAEYSDVKGKKEPEFQFEAVRE 858

Query: 681  EGKETADTSA----DSRLYEVAETK-------DAKNAKPAVKLNFADRF--NRXXXXXXX 727
               E    S     D RL  V+ T        D  ++K  +KLNFADRF  +        
Sbjct: 859  ASDEDNGISRLSNNDERLRNVSGTSGGSGVPHDNLSSKHNMKLNFADRFSADEPTAGSSN 918

Query: 728  XXXXXAAIKLPALPPLDKNKPNMVSGLGLYQATAEPSHEDAQPVAKSMVID-------DV 780
                   +KLP LPPLD    +  +GLG+YQ+++E   +  +P  KS + D       +V
Sbjct: 919  SSSASKNVKLPTLPPLDGT--SEANGLGIYQSSSESFRDIVEPTPKSKLQDNSSNPEQEV 976

Query: 781  ESEI--------------TTEPRNTVTETEEAAKNSTVVPTAPVA------PLNNVMKKN 820
            E E+               ++ R+  T+  +A K S+       A      PLN+ M K 
Sbjct: 977  EEEVAGREGSVKHSAIDTASKERSKRTDRIDAKKPSSFQENLASAGASKGPPLNDSMPKR 1036

Query: 821  TDAD-------------RKPLSDITPAVEXXXXXXXXXXXXXXXXXXXXXXXYDFRFKTV 867
             + D             R PL DIT                           +D    T 
Sbjct: 1037 RNEDPRNGSTAAKGENGRAPLKDIT--TNSDKKRNVSFFRKFSKSNEKDTTGFDGEINTT 1094

Query: 868  IEETQMFNALSKLLAAWKDYGLKDVIASPSLKQIRGKLSSDNILSLRSTLFIITVVGRGE 927
            +   Q+F  L  LL  W  YGLKDV + P    + GKL+S+NILSLRSTLF + V  RG+
Sbjct: 1095 VSAKQLFLGLQNLLHGWTQYGLKDVRSHPEKMTLTGKLTSENILSLRSTLFEMVVWSRGK 1154

Query: 928  GSYVEFTKKSGSNKTF 943
             S V F KKSGS+K  
Sbjct: 1155 VSVVGFRKKSGSSKAM 1170

>AFR696C Chr6 complement(1722130..1725558) [3429 bp, 1142 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR507C
           (GIN4) and YCL024W (KCC4)
          Length = 1142

 Score =  425 bits (1093), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 227/369 (61%), Positives = 279/369 (75%), Gaps = 26/369 (7%)

Query: 10  LPYHGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDEISPEAQD 69
           LPYHGFESDVWSCG+IL+ALLTGRLPFDEEDGNIRNLLLKVQSG++E+P  DEISPEA+D
Sbjct: 202 LPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQSGKYEIPGEDEISPEARD 261

Query: 70  LIAKILTVDPAARIKSREILKHPLLQKYPSIKDSKSIRNLPREDTYLNPLDSVNGSIDES 129
           LI +ILTV+P  RIK+REILKHPLLQKYPSIKDSKSIRNLPREDTYLNPLD  +G+ID++
Sbjct: 262 LIVQILTVEPEQRIKTREILKHPLLQKYPSIKDSKSIRNLPREDTYLNPLDHNDGTIDQA 321

Query: 130 IINNLVVLWHGRDRNEITAQLKEPGANLEKTFYALLFRFKHDSHQEQLKQQ---RRSQAS 186
           I+ NLVVLWHGRD+NEIT +LKEPGANLEKTFYALL RFK ++ Q+QLKQQ   +R  ++
Sbjct: 322 ILQNLVVLWHGRDKNEITMKLKEPGANLEKTFYALLHRFKFENEQQQLKQQQIAKRISST 381

Query: 187 HISPKXXXXXXXXXXXXITNV--TPKKKNKAPVISASSSHKRPVSFNRLSFNNGSNTAHT 244
             SP+            I N+  TPKKK ++  I+ SS+HKRPVS  +L   N   T + 
Sbjct: 382 SSSPQ-QNIVKSSSRRSINNILSTPKKK-RSSAINVSSAHKRPVSIQKL---NDCGTLN- 435

Query: 245 PPTSASKRASVNLSSNKRISALINPNNSPTPVHKRSSMRDLDASAPPIPMDMLKDYNKSA 304
            PTS SK+ S+   SN+++SA++  +NS +P  KR S+      APP+P  +L+DYNK A
Sbjct: 436 -PTSPSKKRSL---SNRKLSAVLAGSNSSSPSRKRMSV---GQDAPPVPTAVLRDYNKRA 488

Query: 305 PKVXXXXXXXXXXXXXXPGNKRGSITTKLIATYAKISKDNDWEYIEKETRRTSADFATLC 364
            +                 +KRGSITTK+IATYAK+S+DNDWEYI++E +RTS+DFATL 
Sbjct: 489 SRASKRLSFLP--------SKRGSITTKIIATYAKLSEDNDWEYIDREAKRTSSDFATLI 540

Query: 365 DEIFEHEKY 373
           D IFEHEKY
Sbjct: 541 DNIFEHEKY 549

 Score =  290 bits (743), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 210/540 (38%), Positives = 271/540 (50%), Gaps = 57/540 (10%)

Query: 434  IEQEIALLKQSVNPQGP------SDSNHVRSVSAPAE-SVLKVDKRGSTGNLDNDIMALL 486
            +E+++A LK  V           +   HVRS+S P E    +  KR S   L N+I +LL
Sbjct: 609  LEEQVARLKAEVAATKQEKRISLAQEQHVRSISEPMERKGTRPSKRDSFLALQNNINSLL 668

Query: 487  NRRTFSLETRPKSRLDPGIYTSEEEDFGSKNHGAD---LSTEKTILETIRRSKFLGSSFD 543
             RRT SLETRP SRLDPGI  SEE      +   +   L  EK ILETIRRSKFLGS +D
Sbjct: 669  KRRTLSLETRPISRLDPGIRLSEENTILEDDLECNEDRLRVEKNILETIRRSKFLGSQYD 728

Query: 544  INXXXXXXXXXXXXXXXXXXXX-----------XXXXVASNATTANVVGNGYESQTLPKR 592
            I+                                     S+ TT        ES  LPK 
Sbjct: 729  IDKELQRVRREKLEKVNMRKSQDRKLEPGLHSRQEQRFVSDGTTVTSSHEDSESIILPKN 788

Query: 593  --KMGSAMEASSEPRKISEVEVPQFTRRSRHFTASNKRLSVLSMYSTKTSFTNLADHLKG 650
               +G   +  SEPRK+SEV++PQFTRRS+HF+AS+KRLSVLSMYSTK S+TNLAD+L  
Sbjct: 789  VTAIGVLKDEESEPRKLSEVKIPQFTRRSKHFSASSKRLSVLSMYSTKVSYTNLADYLNN 848

Query: 651  KADVQLIQTSPPSASKMDQEAEFMFESVDKEGKETADTSADSRLY--EVAETKDAKNAKP 708
               ++ +Q S P++ K+ QE EFMFES  +E +  A    D+ L   +V    D +  +P
Sbjct: 849  DVQLKSLQPSAPTSIKIPQEPEFMFESAGQENRYQAAAPTDTYLERPKVGVEGDHEPGEP 908

Query: 709  AVKLNFADRFNRXXXXXXXXXXXXAAIKLPALPPLDK-NKPNMVSGLGLYQATAEPSHED 767
               +   D  +R            A +KLP LPPLD  NKPN   GLG+YQA A P    
Sbjct: 909  VELIELDDSEDR---SKQYSEEDIAKVKLPILPPLDHLNKPN---GLGIYQAPAPPKEPL 962

Query: 768  AQPVAKSMVIDDVESEIT---TEPRNTVTETEEAAKNSTVVPTAPVAPLNNVMKKNTDAD 824
             QPV KSM+ DD++ +       PR   TE     K +  VP   +A           A+
Sbjct: 963  GQPVMKSMIPDDIKIKCVPNQLSPRRRATERAPEKKLTKTVPERVIA-----------AE 1011

Query: 825  RKPLSDITPAVEXXXXXXXXXXXXXXXXXXXXXXXYDFRFKTVIEETQMFNALSKLLAAW 884
              P  +                              D +  T + +++MF AL+KLL  W
Sbjct: 1012 TFPPPNTK----------KKPSFFKKFSREKMHSDCDVQLDTTVGDSKMFRALNKLLNGW 1061

Query: 885  KDYGLKDVIASPSLKQIRGKLSSDNILSLRSTLFIITVVGRGE-GSYVEFTKKSGSNKTF 943
              YGLK+V + P+   I GKLSSDNILSLRST F I ++   + GS V+FTKKSGS KTF
Sbjct: 1062 TSYGLKEVRSMPASYTITGKLSSDNILSLRSTAFEIVILSVADTGSSVKFTKKSGSKKTF 1121

>KNAG0F00290 Chr6 (31750..35127) [3378 bp, 1125 aa] {ON} Anc_1.52
           YDR507C
          Length = 1125

 Score =  410 bits (1055), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 210/375 (56%), Positives = 268/375 (71%), Gaps = 25/375 (6%)

Query: 10  LPYHGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDEISPEAQD 69
           +PYHGF SDVWSCG+IL+ALLTGRLPFDEEDGNIRNLLLKVQ+GQFEMP+ DEIS EAQ+
Sbjct: 202 IPYHGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQAGQFEMPEDDEISKEAQN 261

Query: 70  LIAKILTVDPAARIKSREILKHPLLQKYPSIKDSKSIRNLPREDTYLNPLDSVNGSIDES 129
           LI+KIL V+PA RI +R+ILKHPLLQKYPSIKDSKSIRNLPREDTYL+PL   N +IDE+
Sbjct: 262 LISKILVVNPAERITARDILKHPLLQKYPSIKDSKSIRNLPREDTYLHPLAETNSAIDEN 321

Query: 130 IINNLVVLWHGRDRNEITAQLKEPGANLEKTFYALLFRFKHDSHQEQLK------QQRRS 183
           I+ NLVVLWHGRD  EI  +LKE GAN EKT YA+L RFK D  QE LK      +Q   
Sbjct: 322 ILQNLVVLWHGRDPAEIRVKLKEHGANAEKTLYAMLNRFKLDVEQENLKNEHLKNRQSGG 381

Query: 184 QASHISPKXXXXXXXXXXXXITNVTPKKKNKAPVISASSSHKRPVSFNRL-SFNNGSNTA 242
           Q++ ++P               N TP+KKN+A VIS +SSHKRP+SF +L + N+ S+ A
Sbjct: 382 QSTSMAPATNQSTAVNRSSGNKNTTPRKKNRASVISVTSSHKRPISFQKLPTLNSTSSLA 441

Query: 243 HTPPTSASKRASVNLSSNKRISALINPNNSPTPV--HKRSSMRDLDA--SAPPIPMDMLK 298
              P+++++R  ++  S   +S   N N SPTP    KR+SM ++ A  S+     +  K
Sbjct: 442 AITPSTSARRKRLSKISGYPVS---NVNGSPTPASRKKRNSMANIQAARSSTIKKTNTFK 498

Query: 299 DYNKSAPKVXXXXXXXXXXXXXXPGNKRGSITTKLIATYAKISKDNDWEYIEKETRRTSA 358
             N+++ +V              P NK G+I +KLI+TYAK+S+D++WEY+E+ET+RTS+
Sbjct: 499 KNNRASKRV-----------SILPNNKNGTIASKLISTYAKLSEDDEWEYLEQETKRTSS 547

Query: 359 DFATLCDEIFEHEKY 373
           +FATL DEIFEHEKY
Sbjct: 548 NFATLIDEIFEHEKY 562

 Score =  218 bits (556), Expect = 7e-58,   Method: Compositional matrix adjust.
 Identities = 180/534 (33%), Positives = 265/534 (49%), Gaps = 72/534 (13%)

Query: 434  IEQEIALLKQSVNPQGPSDSNHVRSVSAPAESVLKVDKRGSTGNLDNDIMALLNRRTFSL 493
            +E+EI  LK+ ++          RSVS P      ++K+   G ++ ++  LL +R  +L
Sbjct: 615  MEEEIENLKKELDMMSHEGKTESRSVSEP------LNKK--QGGVEIEVKELLRQRNAAL 666

Query: 494  ETRPKSRLDPGIY-TSEEEDFGSKNHGAD---------LSTEKTILETIRRSKFLGSSFD 543
            +TRPKSRLDPG++  S E D  ++N             L TEK ILETIRRSKFLGSSFD
Sbjct: 667  QTRPKSRLDPGLFFDSAESD--TRNPSLQVFEGEVDNKLKTEKAILETIRRSKFLGSSFD 724

Query: 544  INXXXXXXXXXXXXXXXXXXXXXXXXVASNATTANVVGNGYESQTLPKRKMGSA----ME 599
            I+                          +         N   S  LPK  + +A      
Sbjct: 725  ISKELKSASARSDYSR------------APGRVITAPSNLERSDVLPKNAIATAPLRIHS 772

Query: 600  ASSEPRKISEVEVPQFTRRSRHFTASNKRLSVLSMYSTKTSFTNLADHLKGK------AD 653
               E RKIS+++VPQFTR+SR+F+ S+KRLSVLSMYST+ SF NL+D +  +      A+
Sbjct: 773  DQPEVRKISDIKVPQFTRKSRNFSESSKRLSVLSMYSTRQSFKNLSDMMNFESENTDAAE 832

Query: 654  VQLIQTSPPSASKMDQEAEFMFESVDKEGKETADTSADSRLYEVAETKDAKNAKPAVKLN 713
             +    +P SA     ++EF+FESV++E + T +TS D +LYEV+E+ ++  +K  +++N
Sbjct: 833  NRGQIATPNSAG----QSEFLFESVNEEAENTNNTSTDGKLYEVSESPESS-SKKGLRVN 887

Query: 714  FADRFNRXXXXXXXXXXXXAAIKLPALPPLDKNKPNMVSGLGLYQATAEPSHEDAQPVAK 773
             +DR+N+               KLP LPPLD      ++GLG+YQ   +P   +A+P  K
Sbjct: 888  LSDRYNKANSEADMEN------KLPILPPLDPE----IAGLGIYQD--QPEEVNAKPQEK 935

Query: 774  SMVIDDVESEITTEPRNTVTETEEAAKNSTVVPTAPVAPLNNVMKKNTDADRKPLSDITP 833
                   E+   +E    V++ +  A+N    P  P+       KK  DA ++   + T 
Sbjct: 936  KSKSKSAETGDISEGEPEVSDLK--AENIRKAPQPPITE-----KKKLDAKKQRNDERTK 988

Query: 834  AVEXXXXXXXXXXXXXXXXXXXXXXXYDFRF------KTVIEETQMFNALSKLLAAWKDY 887
            A +                          +        T +  TQM+  L  LL  W  Y
Sbjct: 989  ASKENTFSNNFLRKLSGQSNTTTQSVKKTKLGAEDGIHTTVSATQMYQGLYNLLRGWGSY 1048

Query: 888  GLKDVIASPSLKQIRGKLSSDNILSLRSTLFIITVVGRGEGSYVEFTKKSGSNK 941
            GLK +  +     I GKL+S+NILSLRST+F I ++  G+GS V+  KKSGS K
Sbjct: 1049 GLKSIKGNSENMTITGKLASENILSLRSTIFEIIIIREGKGSKVDIKKKSGSTK 1102

>Ecym_1058 Chr1 (105835..109329) [3495 bp, 1164 aa] {ON} similar to
           Ashbya gossypii AFR696C
          Length = 1164

 Score =  411 bits (1056), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 222/369 (60%), Positives = 268/369 (72%), Gaps = 24/369 (6%)

Query: 10  LPYHGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDEISPEAQD 69
           LPYHGFESDVWSCG+IL+ALLTGRLPFDE+DGNIR LLLKVQSG+FEMPD DEIS EAQD
Sbjct: 203 LPYHGFESDVWSCGVILYALLTGRLPFDEDDGNIRKLLLKVQSGEFEMPDKDEISIEAQD 262

Query: 70  LIAKILTVDPAARIKSREILKHPLLQKYPSIKDSKSIRNLPREDTYLNPLDSVNGSIDES 129
           LIAKILTVDP+ RIK+REILKHPLL+KYPSIKDSKSIRNLPREDTYLNPLD  +G++D +
Sbjct: 263 LIAKILTVDPSGRIKTREILKHPLLKKYPSIKDSKSIRNLPREDTYLNPLDHNDGTVDRT 322

Query: 130 IINNLVVLWHGRDRNEITAQLKEPGANLEKTFYALLFRFKHDSHQEQLKQ----QRRSQA 185
           I+ NLVVLWHGRD NEI  +L E G NLEKTFYALL RFK+++ Q+QLKQ    +R S A
Sbjct: 323 ILKNLVVLWHGRDENEIVMKLNEQGPNLEKTFYALLHRFKYENEQQQLKQQQIAKRISSA 382

Query: 186 SHISPKXXXXXXXXXXXXITNVTPKKKNKAPVISASSSHKRPVSFNRLSFNNGSNTAHTP 245
           S    +               VTPKKK ++  I+ SS+HKRPVS  +     G N     
Sbjct: 383 SSSPQRNIVKSSSRRSINQILVTPKKK-RSSGINVSSAHKRPVSIQKWGEIGGGNNGLIS 441

Query: 246 PTSASKRASVNLSSNKRISALIN-PNNSPTPVHKRSSMRDLDASAPPIPMDMLKDYNKSA 304
           P   SK+ S+   SN+++SA++N P++SP+   KR S   +   APP+P  +L+DYNK A
Sbjct: 442 P---SKKRSL---SNRKLSAILNTPSSSPS--RKRMS---IAQDAPPMPTSVLRDYNKRA 490

Query: 305 PKVXXXXXXXXXXXXXXPGNKRGSITTKLIATYAKISKDNDWEYIEKETRRTSADFATLC 364
            +               P  KR SIT+K+IATYAK+S+DNDWEYI+KE +RTS+DFATL 
Sbjct: 491 SR-------NSKRFSFLPSIKRQSITSKIIATYAKLSEDNDWEYIDKEAKRTSSDFATLI 543

Query: 365 DEIFEHEKY 373
           D IFEHEKY
Sbjct: 544 DNIFEHEKY 552

 Score =  256 bits (655), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 198/516 (38%), Positives = 256/516 (49%), Gaps = 67/516 (12%)

Query: 457  RSVSAPAESVLKVDKRGSTGNLDNDIMALLNRRTFSLETRPKSRLDPGIYTSE---EEDF 513
            RSVS P +      KR S   L   I  +LN+R  S++TRP SRLDPGI   E   E D+
Sbjct: 666  RSVSEPHKRHSSTSKRDSLLALQYSINTVLNKRAVSVQTRPISRLDPGIMAQEVAHELDY 725

Query: 514  GSKNHGAD--LSTEKTILETIRRSKFLGSSFDINXXXXXXXXXXXXXXXXXXXXXX---- 567
              +   ++  L  EKTILETIRRS FLGS FDI+                          
Sbjct: 726  DDEEILSERTLRREKTILETIRRSNFLGSQFDIHKELKNAKKEKIEKAKKRKQLNRKLPD 785

Query: 568  ------XXVASNATTANVVGNGYESQTLPKRK-MGSAMEASSEPRKISEVEVPQFTRRSR 620
                      S+ TT     +GY++ +L +   +G   +  SEP+K+SEV +P+ TRRSR
Sbjct: 786  RISYHDQRFVSDGTTITSAHDGYDTTSLTRHTTVGVLRDDESEPKKLSEVRIPEVTRRSR 845

Query: 621  HFTASNKRLSVLSMYSTKTSFTNLADHLKGKADVQLIQTSPPSASKMDQEAEFMFESV-- 678
            H +AS+KR SVLSMYST TS+TNLAD +K  +DVQL   +  ++SK+ Q+ EFMFES   
Sbjct: 846  HLSASSKRFSVLSMYSTMTSYTNLADFMK--SDVQLKPLNDTASSKVTQQPEFMFESTID 903

Query: 679  DKEGKETADTSADSRLYEVAETKDAKNAKPAVKLNFADRFNR---------XXXXXXXXX 729
            + E   + D S  S +       +A N    +KLN+ADRF +                  
Sbjct: 904  NVERISSNDNSHISSM-------EAPN-NTVIKLNYADRFYKPVEVIELDDTDNTQPDTE 955

Query: 730  XXXAAIKLPALPPLDK-NK-PNMVSGLGLYQATAEPSHEDAQPVAKSMVIDDVESEITTE 787
                 +KLPALPPL+K NK PN   GLG+YQ ++    ED +   +S             
Sbjct: 956  EDITKVKLPALPPLEKLNKSPN---GLGIYQHSS--PREDFKHAVRS------------- 997

Query: 788  PRNTVTETEEAAKNSTVVPTAPVAPLNNVMKKNTDADRKPLSDITPAVEXXXXXXXXXXX 847
                VT  E          T   APL +V K+     R+PL+D+                
Sbjct: 998  ----VTPNENKENEDPAGTTQQKAPLTSVGKEL--GIREPLTDLA----QQGVPKKRPSF 1047

Query: 848  XXXXXXXXXXXXYDFRFKTVIEETQMFNALSKLLAAWKDYGLKDVIASPSLKQIRGKLSS 907
                        YD++  T +  T+MF AL KLL  W  YGLK V +SPS+  I GKLSS
Sbjct: 1048 FRKFSKEKIKPEYDYQLDTTVNNTKMFRALDKLLNGWTSYGLKQVRSSPSVSMITGKLSS 1107

Query: 908  DNILSLRSTLFIITVVGRGEGSYVEFTKKSGSNKTF 943
            DNILSLRST F + V G   GS V FTKKSGS KTF
Sbjct: 1108 DNILSLRSTAFQVVVAGSNHGSSVRFTKKSGSKKTF 1143

>NDAI0A00660 Chr1 (121773..124841) [3069 bp, 1022 aa] {ON} Anc_1.52
          Length = 1022

 Score =  399 bits (1024), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 207/376 (55%), Positives = 266/376 (70%), Gaps = 46/376 (12%)

Query: 10  LPYHGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDEISPEAQD 69
           +PYHGF+SDVWSCG+ILFALLTGRLPFDEEDGNIRNLLLKVQSG++EMPD DEIS EAQD
Sbjct: 204 VPYHGFQSDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGEYEMPDDDEISKEAQD 263

Query: 70  LIAKILTVDPAARIKSREILKHPLLQKYPSIKDSKSIRNLPREDTYLNPLDSVNGSIDES 129
           LI +ILTVDP  RIK+R+ILKHPLLQKYPSIKDS+SI+NLPREDTYL PL   N  ID+S
Sbjct: 264 LIGRILTVDPEQRIKTRDILKHPLLQKYPSIKDSRSIKNLPREDTYLYPLSENNSIIDDS 323

Query: 130 IINNLVVLWHGRDRNEITAQLKEPGANLEKTFYALLFRFKHDSHQEQLKQQRRSQASHIS 189
           I+ NLV LWHGRD+++I  +L+E GA+ EKT YALL+RFK ++ +               
Sbjct: 324 ILQNLVALWHGRDKDDIAGKLRESGADAEKTVYALLYRFKVEAEKMN------------- 370

Query: 190 PKXXXXXXXXXXXXITNVTPKKKNKAPVISASSSHKRPVSFNRLSFNNGSNTAHTPPTSA 249
                          T  +P++KN+  +IS SSSHKRPVS  ++S    +   +TPP  +
Sbjct: 371 ---------------TCSSPRRKNRISMISVSSSHKRPVSMKKIS----TVQNNTPP--S 409

Query: 250 SKRASVNLSSN--KRISALI-NPNNSPTPVH-KRSSMRDLDASA----PPIPMDMLKDYN 301
           ++R S++LSS   KR+S ++ + N+SPTP   KR S+ ++D S     PP+PM+ML+DY 
Sbjct: 410 NRRLSISLSSTQRKRMSGILQHTNSSPTPSRTKRISVINIDDSENKAPPPVPMEMLEDYK 469

Query: 302 KSAPKVXXXXXXXXXX----XXXXPGNKRGSITTKLIATYAKISKDNDWEYIEKETRRTS 357
            ++  V                    NKR SITTKL++TYAK+S+D++WEYIE+ET+RTS
Sbjct: 470 NNSKNVRRTIKKKKKKKNNYRLTLVNNKRVSITTKLLSTYAKLSEDDNWEYIERETKRTS 529

Query: 358 ADFATLCDEIFEHEKY 373
           +DFATL DE+FEHEKY
Sbjct: 530 SDFATLIDELFEHEKY 545

 Score =  162 bits (410), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 162/527 (30%), Positives = 232/527 (44%), Gaps = 128/527 (24%)

Query: 434  IEQEIALLKQSVNPQGPSDSNHVRSVSAPAESVLKVDKRGSTGNLDNDIMALLNRRTFSL 493
            I++EI+ LK+        + ++ RSVSAP +     D+  +          L NRR FSL
Sbjct: 588  IDEEISKLKEDA-----LEKDNFRSVSAPIKENEDEDENEN---------ELRNRRQFSL 633

Query: 494  ETRPKSRLDPGIYTSEEEDFGSK-----NHGADLST---EKTILETIRRSKFLGSSFDIN 545
            +TRP SRLDPGI  S   +  S      N   + S+   ++ ILETIRRSKFLGSSF+I 
Sbjct: 634  QTRPVSRLDPGILYSAPAEIPSYERVVVNESGNKSSAQQQRKILETIRRSKFLGSSFNIQ 693

Query: 546  XXXXXXXXXXXXXXXXXXXXXXXXVASNATTANVVGNGYESQTLPKRKMGSAMEASSEPR 605
                                         T   VV        + + K+   +      R
Sbjct: 694  QELEFSQRNVLV----------------PTKEQVVD-------VDEVKLEGGL------R 724

Query: 606  KISEVEVPQFTRRSRHFTASNKRLSVLSMYSTKTSFTNLADHLK-GKADVQLIQTSPPSA 664
            KISEV++PQFTR+SRHF+ SNKRLSVLSMYSTK S+TNL   LK G  + +  + +P   
Sbjct: 725  KISEVKIPQFTRKSRHFSDSNKRLSVLSMYSTKQSYTNLGHILKDGTEESEPAKKTP--- 781

Query: 665  SKMDQEAEFMFESVDKEGKETADTSADSRLYEVAETKDAKNAKPAVKLNFADRFNRXXXX 724
                   E +FES             D RLYEV+E  + +  K  ++             
Sbjct: 782  -------ELLFES-----------GRDDRLYEVSEEPEIQEEKEDIE------------- 810

Query: 725  XXXXXXXXAAIKLPALPPLDKN-------KPNMVSGLGLYQATAEPSHEDAQPVAKSMVI 777
                      + LP LPPL ++           ++GL +++                   
Sbjct: 811  ---------TVTLPQLPPLKQSANTNANANETEINGLAIFRPK----------------- 844

Query: 778  DDVESEITTEPRNTVTETEEAAKNSTVVPTAPVAPLNNVMKKNTDADRKPLSDITP-AVE 836
            +++E E  T+    V  +++  K+       P+A +NN  ++      + L +I P  V 
Sbjct: 845  ENIELEDITKEVKEVIPSQDHGKDK------PIA-INNPKQRLEVKPERQLDEIAPNKVG 897

Query: 837  XXXXXXXXXXXXXXXXXXXXXXXYDFRFKTVIEETQMFNALSKLLAAWKDYGLKDVIASP 896
                                   YD      I   Q++  L KLL  W  YGLKDV +  
Sbjct: 898  TTEKKRNVSFFRKFSNNSATIKGYDHEIYVNIGSRQLYTGLRKLLEGWTQYGLKDVRSDN 957

Query: 897  SLKQIRGKLSSDNILSLRSTLFIITVVGRG-EGSYVEFTKKSGSNKT 942
            +  +I GKL++DNILSLRSTLF + V  +G + S + FTK  GS+K 
Sbjct: 958  TAMKITGKLANDNILSLRSTLFELLVEPKGSKYSLIGFTKVQGSSKV 1004

>CAGL0K05709g Chr11 complement(556732..560043) [3312 bp, 1103 aa]
           {ON} similar to uniprot|Q12263 Saccharomyces cerevisiae
           YDR507c GIN4
          Length = 1103

 Score =  398 bits (1023), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 210/371 (56%), Positives = 262/371 (70%), Gaps = 20/371 (5%)

Query: 10  LPYHGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDEISPEAQD 69
           LPY GF SDVWSCG+ILFALLTGRLPFDEEDGNIRNLLLKVQ G+FEMPD DEI+ EAQD
Sbjct: 203 LPYEGFSSDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPDDDEITKEAQD 262

Query: 70  LIAKILTVDPAARIKSREILKHPLLQKYPSIKDSKSIRNLPREDTYLNPLDSVNGSIDES 129
           L+A++LTVDP+ RI  REILKHPLLQKYPSIKDS+SIRNLPREDTYL+PL   N  ID++
Sbjct: 263 LLARLLTVDPSKRITIREILKHPLLQKYPSIKDSRSIRNLPREDTYLSPLADTNSKIDDA 322

Query: 130 IINNLVVLWHGRDRNEITAQLKEPGANLEKTFYALLFRFKHDSHQEQLKQQRRSQASHIS 189
           I+ NLV+LWHG+D  EI A+L+EPGAN EKT YALL+RFK D+ +E  + +R+S+    +
Sbjct: 323 ILQNLVILWHGKDAREIAAKLREPGANTEKTLYALLYRFKCDTQREANRARRQSKIVQRN 382

Query: 190 PKXXXXXXXXXXXXITNVTPKKKNKAPVISASSSHKRPVSFNRLSFNNGSNTAHTPPTSA 249
                          T  TP+KKNK   I ASSS KRPVS  + + N   N++ T    +
Sbjct: 383 STIRSTAPESPSKKKT-YTPQKKNKRASIIASSS-KRPVSVTKTATNITVNSSITGTPKS 440

Query: 250 SKRASVNLSSNKRISALINPNNSPTPV--HKRSSM--RDLDASAP---PIPMDMLKDYNK 302
           +KR S+N S+ KR+SAL    +SPT     +RSS+  +D   + P    I M   K  +K
Sbjct: 441 AKRMSMNNSARKRMSALYGTRDSPTKTSRSRRSSIITKDFLGNRPRDSVISMSHNKRASK 500

Query: 303 SAPKVXXXXXXXXXXXXXXPGNKRGSITTKLIATYAKISKDNDWEYIEKETRRTSADFAT 362
           S+ ++              P  KR S+TTKL+ATYAK+S+D+DWEYIE+ET+RTS+DFAT
Sbjct: 501 SSKRI-----------SLVPNLKRQSVTTKLMATYAKLSEDDDWEYIERETKRTSSDFAT 549

Query: 363 LCDEIFEHEKY 373
           L DEIFE+EKY
Sbjct: 550 LIDEIFEYEKY 560

 Score =  205 bits (521), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 178/528 (33%), Positives = 251/528 (47%), Gaps = 78/528 (14%)

Query: 434  IEQEIALLKQSVNPQGPSDS-NHVRSVSAPAESVLKVDKRGSTGNLDNDIMALLNRRTFS 492
            +++EI+ LK+ +   G  D+ +  RSVS P ES     K     +++ DI  +L  R +S
Sbjct: 613  MDEEISNLKKEL--VGDQDNEDKFRSVSEPLES-----KSKKIEDIEEDIDGILRNRKYS 665

Query: 493  LETRPKSRLDPGI------YTSEEEDFGSKNHGADLS-TEKTILETIRRSKFLGSSFDIN 545
            L+TRP SRLDPGI        SE+    + N   +L  TE+ ILETIRRSKFLGSSFDI 
Sbjct: 666  LQTRPVSRLDPGIGFIDKPRQSEQHVPETVNLEPELEETEQKILETIRRSKFLGSSFDIK 725

Query: 546  XXXXXXXXXXXXXXXXXXXXXXXXVASNATTANVVGNGYESQTLPK--RKMGSAMEASSE 603
                                    +                +TLPK   K   +M+ S  
Sbjct: 726  KELENVKRHRQTSQPIEKEMAPPALP---------------ETLPKAVEKKNVSMDPSL- 769

Query: 604  PRKISEVEVPQFTRRSRHFTASNKRLSVLSMYSTKTSFTNLADHLK-GKADVQLIQTSPP 662
             RKIS+++VPQFTR+SRHF+ SN+RLSVLSMYSTK S++NLAD LK G  + ++IQT+P 
Sbjct: 770  -RKISDIKVPQFTRKSRHFSTSNRRLSVLSMYSTKESYSNLADILKNGPGEKEMIQTAPT 828

Query: 663  SASKMDQEAEFMFESVDKEGKETADTSADSRLYEVAETKDAKNAKPAVKLNFADRFNRXX 722
              S  D +   +F+++D E    A  S + RLYEVAE  +++N     K++ AD  N   
Sbjct: 829  PKSADDSDQ--LFDTID-EADTPASVSREERLYEVAE--ESENELANKKIDIADLLNSEG 883

Query: 723  XXXXXXXXXXAAIKLPALPPLDKNKPNMVSGLGLYQATAEPSHEDAQPVAKSMVIDDVES 782
                       ++KLP LPPL ++        G  + T E S        KSM+ ++++S
Sbjct: 884  SNLKSVEEQEDSMKLPKLPPLFED--------GSTKETKEQS--------KSMIPENMQS 927

Query: 783  EITTEPRNTVTETEEAAKNSTVVPTAPVAPLNNVMKKNTDADRKPLSDITPAVEXXXXXX 842
               +E +  + +       S          LN  M K+ D   K ++   P V       
Sbjct: 928  ---SESQKQIEKNNSDEGGS----------LNPFMTKHRDVSDKGVTKEKPTVTMKTTSE 974

Query: 843  XXXXXXXXXXX---------XXXXXXYDFRFKTVIEETQMFNALSKLLAAWKDYGLKDVI 893
                                       D    T +   Q+F+ L  LL  W  YGLK + 
Sbjct: 975  QVSADKKRNMSFLRKLSKGSSSSKDNVDVTLSTSVSSKQLFSGLVNLLKGWTKYGLKGIA 1034

Query: 894  ASPSLKQIRGKLSSDNILSLRSTLFIITVVGRGEGSYVEFTKKSGSNK 941
               + + I GKL++DNILS RST F I +  + +GS V F K SGS K
Sbjct: 1035 IDSTSQTITGKLANDNILSFRSTAFSILIFSQEKGSAVTFRKVSGSGK 1082

>TBLA0A07150 Chr1 (1776160..1780335) [4176 bp, 1391 aa] {ON}
           Anc_1.52 YDR507C
          Length = 1391

 Score =  360 bits (924), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 194/323 (60%), Positives = 227/323 (70%), Gaps = 32/323 (9%)

Query: 10  LPYHGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDEISPEAQD 69
           LPYHG E+DVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMP +DEIS EAQD
Sbjct: 205 LPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPGNDEISREAQD 264

Query: 70  LIAKILTVDPAARIKSREILKHPLLQKYPSIKDSKSIRNLPREDTYLNPLDSVNG---SI 126
           LI+KILTVDP  RIK+REILKHPL+QKYPSIKDSK+IRNLPREDTYLNPL   NG    I
Sbjct: 265 LISKILTVDPKKRIKTREILKHPLVQKYPSIKDSKTIRNLPREDTYLNPLSDDNGDVCEI 324

Query: 127 DESIINNLVVLWHGRDRNEITAQLKEPGANLEKTFYALLFRFKHDSHQE-----QLKQ-Q 180
           D  I+ NLVVLWHGRD  EIT +LKEPGAN EKT YALL RFK+D+ +E     QLK+ Q
Sbjct: 325 DPKILQNLVVLWHGRDSKEITKKLKEPGANAEKTLYALLDRFKNDTEKEIKRQSQLKKRQ 384

Query: 181 RRSQASHI-SPKXXXXXXXXXXXXITNVTPKKKNKAPVISASSSHKRPVSFNRLS----- 234
            + Q +H  S              + N   K+KN+A ++S SS+HKRPVSFNRLS     
Sbjct: 385 SQVQQTHSHSNSNTSAYSHVSRGALVNTPTKRKNRASMVSVSSAHKRPVSFNRLSRADLS 444

Query: 235 ---FNNGSN-----------TAHTPPTSASKRASVNLSSNKRISALI--NPNNSPTPVHK 278
               N G N           +      S+SKR S+NLSSNKRIS L+  + N SPTP + 
Sbjct: 445 NHVINTGINGTPQRHSQIESSGTLQRNSSSKRMSINLSSNKRISQLLANDLNTSPTPSNC 504

Query: 279 RSSMRDLDASAPPIPMDMLKDYN 301
              M  ++ + PP+PMD++K+YN
Sbjct: 505 TKRMSIINGT-PPVPMDIMKNYN 526

 Score =  145 bits (367), Expect = 9e-35,   Method: Compositional matrix adjust.
 Identities = 133/424 (31%), Positives = 185/424 (43%), Gaps = 98/424 (23%)

Query: 457  RSVSAPAESVLKVDKRGSTGNLDNDIMALLNRRTFSLETRPKSRLDPGI-YTS------- 508
            RSVSAP E   K   R S  +          +R FSL TRP SRLDPG+ Y+S       
Sbjct: 762  RSVSAPLEKTEK--SRDSPFDYSK-------QRNFSLRTRPVSRLDPGLMYSSGTGSSAY 812

Query: 509  ----EEEDFGSKNHGADLSTEKTILETIRRSKFLGSSFD---------------INXXXX 549
                  ED  S +    + T+K ILETIRRSKFLGSSFD               I     
Sbjct: 813  NPSHSTEDLHSTSSLNRIDTQKVILETIRRSKFLGSSFDLKKELEMVEELESNRIKQQAF 872

Query: 550  XXXXXXXXXXXXXXXXXXXXVASNATTANVVGNGYESQTLPKRKMGSAM-----EASSEP 604
                                  SN    +   + YE++ LPK   G        ++S +P
Sbjct: 873  QDSHLEEMNDVTEDLSQHNVDTSNDRIVSTTNDRYETEILPKSHAGKTQTIGLNDSSVQP 932

Query: 605  RKISEVEVPQFTRRSRHFTASNKRLSVLSMYSTKTSFTNLADHLKGKA-DVQLIQTSPPS 663
            R +SE++VPQFTR+S+ F+ SNKRLSVLS+YS++ SFTNL D LK    +V+  + SP +
Sbjct: 933  RTLSEIKVPQFTRKSKFFSESNKRLSVLSLYSSRESFTNLVDMLKEDGINVEPTERSPTT 992

Query: 664  ASKMDQEAEFMFESVDKEGKETADTSADSRLYEVAETKDAKNAKPA----VKLNFADRFN 719
             S   QE EF+FES       + DT +     E     + +N++P     ++L+F DRFN
Sbjct: 993  KS---QEPEFLFES------PSVDTYSRDSSTEDKPINEKENSEPIQSNNLRLSFHDRFN 1043

Query: 720  RXXXXXXXXXXXXA-----------------------------AIKLPALPPLDKNKPNM 750
            R            +                              +KLPALPPL   K   
Sbjct: 1044 RQLSTEDTEKTKNSPSGHIKDEPKKDDDNGVDLSTPKAKDESNLVKLPALPPLTTKK--- 1100

Query: 751  VSGLGLYQATAE-----------PSHEDAQPVAKSMVIDDVESEITTEPRNTVTETEEAA 799
              GLG+YQ + +           PS  +AQ  + ++ +    + +  E    + E+ E  
Sbjct: 1101 TDGLGIYQKSKQRTSSNASNPITPSSTNAQLTSAAVNVTPPTTTMINESIQKLQESREKV 1160

Query: 800  KNST 803
             NS+
Sbjct: 1161 NNSS 1164

 Score = 86.7 bits (213), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 36/52 (69%), Positives = 47/52 (90%)

Query: 322 PGNKRGSITTKLIATYAKISKDNDWEYIEKETRRTSADFATLCDEIFEHEKY 373
           P  +RGSITTKLI+TYA++++D+DWE+IEKET+R S++FATL D IFEHEKY
Sbjct: 618 PNMQRGSITTKLISTYAQLAEDDDWEFIEKETKRVSSNFATLIDNIFEHEKY 669

 Score = 69.3 bits (168), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 50/84 (59%), Gaps = 1/84 (1%)

Query: 860  YDFRFKTVIEETQMFNALSKLLAAWKDYGLKDVIASPSLKQIRGKLSSDNILSLRSTLFI 919
            YDF+ K  +   QMF  L  L   W  YGLK++ +SP   +  GK+SS+NILS +ST+F 
Sbjct: 1288 YDFQLKANVAAPQMFKGLDTLFRGWSKYGLKNIKSSPESLRFTGKVSSENILSFKSTVFE 1347

Query: 920  ITVVGRG-EGSYVEFTKKSGSNKT 942
            + ++    +   + F K SGS+K+
Sbjct: 1348 LEIISNSVKTCLLRFKKTSGSSKS 1371

>Skud_3.39 Chr3 (66201..69254) [3054 bp, 1017 aa] {ON} YCL024W
           (REAL)
          Length = 1017

 Score =  322 bits (824), Expect = 6e-94,   Method: Compositional matrix adjust.
 Identities = 180/371 (48%), Positives = 230/371 (61%), Gaps = 51/371 (13%)

Query: 10  LPYHGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDEISPEAQD 69
           LPY GF SDVWSCG+ILFALLTGRLPFDEE+GNIR LLLKVQ GQFEMPD  EIS +AQD
Sbjct: 201 LPYEGFSSDVWSCGVILFALLTGRLPFDEENGNIRTLLLKVQRGQFEMPDDTEISKDAQD 260

Query: 70  LIAKILTVDPAARIKSREILKHPLLQKYPSIKDSKSIRNLPREDTYLNPLDSVNGSIDES 129
           LI+KIL VDPA RIK R+IL HPLL++Y +IKDSKSI++LPREDTYL PL     +ID+S
Sbjct: 261 LISKILVVDPAQRIKIRDILSHPLLKRYQTIKDSKSIKDLPREDTYLYPLADAGAAIDDS 320

Query: 130 IINNLVVLWHGRDRNEITAQLKEPGANLEKTFYALLFRFKHDSHQEQLKQQRRSQASHIS 189
           I+ NLVVLWHGR  +EI A+LK  G N EKT YALL+RFK +S +E  K++R        
Sbjct: 321 ILQNLVVLWHGRHADEIKAKLKASGTNTEKTLYALLYRFKLESMRESNKRRRHK------ 374

Query: 190 PKXXXXXXXXXXXXITNVTPKKKNKAPVISASSSHKRPVSFNRLSFNNGSNTAHTPPTSA 249
                             T K KN+    S SS           S   G N   TP    
Sbjct: 375 ------------------TKKTKNRK--FSTSS-----------SLVKGRNLESTPRKRT 403

Query: 250 SKRASVNLSSNKRISALI----NPNNSPTPVH--KRSSMRDLDASAPP-IPMDMLKDYNK 302
           SK  S N SS K+ S+ I    + N+SP P+   K  S+R+  +   P +P+ +L  + +
Sbjct: 404 SKTHSNNFSSGKKRSSFILSPNSINSSPIPLRNSKGISLRNATSGGSPVVPVILLNSFKR 463

Query: 303 SAPKVXXXXXXXXXXXXXXPGNKRGSITTKLIATYAKISKDNDWEYIEKETRRTSADFAT 362
           ++                 P  K GS+T++L++ Y K+  ++DWE IEK+T+RTS++FAT
Sbjct: 464 NS-------KLSSKRSSYMPNLKSGSVTSRLLSNYNKLIDEDDWECIEKDTKRTSSNFAT 516

Query: 363 LCDEIFEHEKY 373
           L DEIFE E++
Sbjct: 517 LIDEIFEPEEF 527

 Score =  119 bits (298), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 145/486 (29%), Positives = 210/486 (43%), Gaps = 91/486 (18%)

Query: 478 LDNDIMALL-NRRTFSLETRPKSRLDPGIYTSEEEDFGSKNHGAD------LSTEKTILE 530
           L  DI  LL NR   S  TRP S+LDPG+  +     G+  H           TE  I+E
Sbjct: 584 LLQDIDTLLTNRYQLSAYTRPISKLDPGLMPAA----GTTPHDIKEQTALIRDTEVKIIE 639

Query: 531 TIRRSKFLGSSFDINXXXXXXXXXXXXXXXXXXXXXXXXVASNATTANVVGNGYESQTLP 590
           TI RSKFLGS  ++                          +S  +T  ++   Y+ +T  
Sbjct: 640 TIHRSKFLGSLLNVREGMSKDDDELAPIEE----------SSIISTTPLI---YDDRT-- 684

Query: 591 KRKMGSAMEASSEPRKISEVEVPQFTRRSRHFTASNKRLSVLSMYSTKTSFTNLADHLKG 650
                       E RKIS+VEVP FTR+SRHFTA++ R SVLS+YS++ SF +L+   K 
Sbjct: 685 ------------EVRKISDVEVPHFTRKSRHFTAASNRRSVLSLYSSRDSFKDLSQISKN 732

Query: 651 KADVQLIQTS--PPSASKMDQEAEFM---FESVDKEG--KETADTSADSRLYEVAETKD- 702
           +      Q S    S+SK     E +    E +D +      +  ++D+ LY+V E  D 
Sbjct: 733 EYSDSPSQRSVDDTSSSKKVGHTESLASVAEHIDDDSYNDHNSGMNSDNVLYDVPEGVDL 792

Query: 703 ---AKNAKPAVKLNFADRFNRXXXXXXXXXXXXAAIKLPALPPLD-KNKPNMVSGLGLYQ 758
               KN+                            ++LP+L     KN     SGLG+YQ
Sbjct: 793 PQEVKNSDE----------QSSCSLVSSSLEPTPVVELPSLSSFQGKN----ASGLGIYQ 838

Query: 759 ATAEPSHEDAQPVAKSMVIDDVESEITTEPRNTVTETEEAAKNSTVVPTAPVAPLNNVMK 818
              EPS + + P A     D VE        N  TE ++  K+ ++    P    ++ +K
Sbjct: 839 --REPS-KVSLPTATIDTSDAVE--------NRETEVKKELKHDSIATNLP----DDNVK 883

Query: 819 KNTDADRKPLSDITPAVEXXXXXXXXXXXXXXXXXXXXXXXYDFRFKTVIEETQMFNALS 878
           +N +A  +  S I  +                          +      I   ++F  L 
Sbjct: 884 ENNNATAEAPSRIKKS-----------SNVSILKNISKGKILELEIHAKIPNKRLFEGLH 932

Query: 879 KLLAAWKDYGLKDVIASPSLKQIRGKLSSDNILSLRSTLFIITVVGRGEG-SYVEFTKKS 937
           KLL  WK YGLK +    +   I+GKL +D+ILSLRSTLF I V+  G+  S ++F KK+
Sbjct: 933 KLLEGWKQYGLKKLGFDAAKMIIKGKLVNDSILSLRSTLFEIIVLPNGDDRSLIKFNKKT 992

Query: 938 GSNKTF 943
           GS+K  
Sbjct: 993 GSSKVL 998

>Suva_3.190 Chr3 (288639..288813,288870..291766) [3072 bp, 1024 aa]
           {ON} YDR507C (REAL)
          Length = 1024

 Score =  306 bits (784), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 177/371 (47%), Positives = 226/371 (60%), Gaps = 45/371 (12%)

Query: 10  LPYHGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDEISPEAQD 69
           LPY GF SDVWSCG+ILFALLTGRLPFDE++GN+R+LLLKVQ GQFEMPD+ EIS +AQ+
Sbjct: 193 LPYRGFASDVWSCGVILFALLTGRLPFDEDNGNVRDLLLKVQRGQFEMPDATEISKDAQN 252

Query: 70  LIAKILTVDPAARIKSREILKHPLLQKYPSIKDSKSIRNLPREDTYLNPL----DSVNGS 125
           LI++IL VDP  R+K+R+IL HPLL+KY +I+DSKSIRNLPRE+TYL PL    +  N +
Sbjct: 253 LISRILVVDPTQRMKTRDILTHPLLKKYQTIRDSKSIRNLPRENTYLYPLADAGNHTNAT 312

Query: 126 IDESIINNLVVLWHGRDRNEITAQLKEPGANLEKTFYALLFRFKHDSHQEQLKQQRRSQA 185
           ID SI+ NLVVLWHGR  +EI A LK+ G N EKT YALL+RFK    QE  K+ R    
Sbjct: 313 IDGSILQNLVVLWHGRPADEIVANLKDNGTNTEKTLYALLYRFK----QEANKRSRHK-- 366

Query: 186 SHISPKXXXXXXXXXXXXITNVTPKKKNKAPVISASSSHKRPVSFNRLSFNNGSNTAHTP 245
                                   K   K P   + S      S NRLS   GS      
Sbjct: 367 ----------------------IKKTTKKNPPYPSMSILSSSSSHNRLS---GSTPRRRT 401

Query: 246 PTSASKRASVNLSSNKRISALINPNNSPTPVH--KRSSMRDL-DASAPPIPMDMLKDYNK 302
           P   S   S +   +  I A  + N SP P    KRSS  +   A+ PP+P+ +L  Y +
Sbjct: 402 PKRRSMNFSSSKKRSSFILASNSSNGSPMPSRNSKRSSFFNTASANVPPVPVKLLNSYKR 461

Query: 303 SAPKVXXXXXXXXXXXXXXPGNKRGSITTKLIATYAKISKDNDWEYIEKETRRTSADFAT 362
           ++ +               P  KRGS+T+K ++ Y  +  ++DWEYIEK+T+RTS++FAT
Sbjct: 462 NSKR-------SSKRLSYVPNVKRGSLTSKSLSKYTNLIDEDDWEYIEKDTKRTSSNFAT 514

Query: 363 LCDEIFEHEKY 373
           L DEIFE EK+
Sbjct: 515 LIDEIFEPEKF 525

 Score =  115 bits (289), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 148/525 (28%), Positives = 223/525 (42%), Gaps = 92/525 (17%)

Query: 440  LLKQSVNPQGPSDS-NHVRSVSAPAESVLKVDKRGSTGNLDNDIMALL-NRRTFSLETRP 497
            L +++ N  G SD+   ++ ++    S L ++   S   L  DI  LL NR   S  TRP
Sbjct: 552  LNQENGNETGKSDAMEELKKINNKVSSPL-INYEYSQQELLQDINTLLTNRCQLSAYTRP 610

Query: 498  KSRLDPGIYTSEEEDFGSKNHGADL--STEKTILETIRRSKFLGSSFDINXXXXXXXXXX 555
             S+LDPG+  + E          DL   TE  ILETIR+SK L SS ++           
Sbjct: 611  ISKLDPGLMPTPETIPYDIKEKTDLLLDTEMKILETIRKSKILDSSLNLRKEVSRDADRL 670

Query: 556  XXXXXXXXXXXXXXVASNATTANVVGNGYESQTLPKRKMGSAMEASSEPRKISEVEVPQF 615
                          +AS  TT  V  N                  S E  KIS+++VP F
Sbjct: 671  PSVEESP-------IAS--TTPLVYNND-----------------SKEVCKISDIQVPHF 704

Query: 616  TRRSRHFTASNKRLSVLSMYSTKTSFTNLADHLKGKADVQLIQTSPPSASK-------MD 668
            TR+S+ FT +N R SVLS+YS++ SF  L+         +++ +  PSA+        + 
Sbjct: 705  TRKSKCFTPTNNRRSVLSLYSSRHSFKGLS---------RILNSKDPSANPYSHINGPLS 755

Query: 669  QEAEFMFESVDKEGKETADTSADSRLYEVAET----KDAKNAKPAVKLNFADRFNRXXXX 724
            +E +   +  + +  E  + +  +RLY+V+E+    +   +          D        
Sbjct: 756  EEIDLTEDIANMKNIENNNNNN-NRLYDVSESAILLQGNDDDDDDDDNENDDGSQSIQSS 814

Query: 725  XXXXXXXXAAIKLPALPPL-DKNKPNMVSGLGLYQATAEPSHEDAQPVAKSMVIDDVESE 783
                      +KLP+L    +KN     SGLG+YQ   EPS E +           +ES 
Sbjct: 815  VSNNTEPTTFVKLPSLSSFQEKN----ASGLGIYQR--EPSIEPS-----------IESS 857

Query: 784  ITTEPRNTVT--ETEEAAKNSTVVPTAPVAPLNNVMKKNTDADR--KPLSDITPAVEXXX 839
            I   P  T+   + +E  +N         +  N+ +KKN D     +  S+++       
Sbjct: 858  IEPLPNVTIAIEDVDEDGENEIQHENITTSLSNDNIKKNDDTKDTIREYSNVS------- 910

Query: 840  XXXXXXXXXXXXXXXXXXXXYDFRFKTVIEETQMFNALSKLLAAWKDYGLKDVIASPSLK 899
                                 +      I   ++F  L KLL  WK YGLK++    +  
Sbjct: 911  ----------FLKKFSKGKILELEIHAKIPAERLFEGLHKLLEGWKQYGLKNLGFDTANM 960

Query: 900  QIRGKLSSDNILSLRSTLF-IITVVGRGEGSYVEFTKKSGSNKTF 943
             I GKL +DNILSLRSTLF II +  R + S ++F KK+GS KT 
Sbjct: 961  IITGKLVNDNILSLRSTLFEIIVLPNRDDRSLIKFNKKTGSTKTL 1005

>Smik_3.54 Chr3 (80309..83407) [3099 bp, 1032 aa] {ON} YCL024W
           (REAL)
          Length = 1032

 Score =  294 bits (752), Expect = 5e-84,   Method: Compositional matrix adjust.
 Identities = 172/372 (46%), Positives = 228/372 (61%), Gaps = 45/372 (12%)

Query: 10  LPYHGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDEISPEAQD 69
           LPY GF SDVWSCG+ILFALLTGRLPFDEE+GN+R+LLLKVQ GQFEMP++ EIS +AQD
Sbjct: 201 LPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNNAEISGDAQD 260

Query: 70  LIAKILTVDPAARIKSREILKHPLLQKYPSIKDSKSIRNLPREDTYLNPLDSVNG----S 125
           LI +IL VDP  RIK R+IL HPLL+KY +IKDSKSI++LPRE+TYL PL   +     +
Sbjct: 261 LIRRILVVDPTQRIKIRDILSHPLLKKYQTIKDSKSIKDLPRENTYLYPLADADNHTSVT 320

Query: 126 IDESIINNLVVLWHGRDRNEITAQLKEPGANLEKTFYALLFRFKHDSHQEQLKQQRRSQA 185
           ID+SI+ NLV+LWHGR   EI  +L++ G N EKT YALL+RFK +S +E  K+ R    
Sbjct: 321 IDDSILQNLVILWHGRPAEEIMKKLQDNGTNTEKTLYALLYRFKLESMKETNKRSRSK-- 378

Query: 186 SHISPKXXXXXXXXXXXXITNVTPKKKNKAPVISASSSHKRPVSFNRLSFNNGSNTAHTP 245
                               N T K K  + + S+SSS     +FN  S ++       P
Sbjct: 379 -------------------INKTKKSKRVSTLSSSSSS-----AFNHQSLDSA------P 408

Query: 246 PTSASKRASVNLSSNKRISALINPNN----SPTPVHKRSSMRDLDASAPPIPMDMLKDYN 301
              AS+  S N  S+++ S+ I  +N    SP P+     +    A    +P + L+   
Sbjct: 409 RKHASRGHSKNFPSSRKRSSFILSSNSTDCSPIPLRSSKRISISSA----VPGNTLQ-VP 463

Query: 302 KSAPKVXXXXXXXXXXXXXXPGNKRGSITTKLIATYAKISKDNDWEYIEKETRRTSADFA 361
            S+ K+              P   RGS+TT L++ Y  +  D+DWEYI+K+T+RTS++FA
Sbjct: 464 DSSLKLKRNSKRSSKRLSYMPNLGRGSLTTNLLSNYTNLIDDDDWEYIDKDTKRTSSNFA 523

Query: 362 TLCDEIFEHEKY 373
           TL DEIFE EK+
Sbjct: 524 TLIDEIFEPEKF 535

 Score =  123 bits (309), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 147/486 (30%), Positives = 207/486 (42%), Gaps = 84/486 (17%)

Query: 474  STGNLDNDIMALL-NRRTFSLETRPKSRLDPGIY-TSEEEDFGSKNHGADLS-TEKTILE 530
            S   L  DI  LL NR   S  TRP SRLDPG+   +       K   A L  TE  I+E
Sbjct: 596  SQKELLQDIDTLLTNRYQLSSYTRPISRLDPGLTPVTGAIPHSIKEKTALLQDTEMKIIE 655

Query: 531  TIRRSKFLGSSFDINXXXXXXXXXXXXXXXXXXXXXXXXVASNATTANVVGNGYESQTLP 590
            TIR+S+FLGS  ++                         V+   +T  ++   Y  Q   
Sbjct: 656  TIRKSEFLGSLLNVREGISQDNNQLASIE----------VSPKISTTPLM---YNDQV-- 700

Query: 591  KRKMGSAMEASSEPRKISEVEVPQFTRRSRHFTASNKRLSVLSMYSTKTSFTNLADHLKG 650
                        E RKIS+VEVP FTR+S+HFT +N R SVLS+YS K S  +L    K 
Sbjct: 701  ------------EIRKISDVEVPHFTRKSKHFTTANNRRSVLSLYSLKESLEDLNQISKN 748

Query: 651  KADVQLIQTSPPSASKMDQEAEFMFESVDK--EGKETADTSADSR----------LYEVA 698
            +        SPP  S  +     + + +++  E K +     DS           LY+V 
Sbjct: 749  EE-----PDSPPQGSTDNASKSELVDVIEEVTEQKNSQHDQDDSNDSNGMNNNNILYDVP 803

Query: 699  ETKDAKNAKPAVKLNFADRFNRXXXXXXXXXXXXAAIKLPALPPLDKNKPNMVSGLGLYQ 758
            E  D+        +N A   +               +KLP+L    +      SGLG+YQ
Sbjct: 804  ECVDSPQ---GYDINDA---HSTQSPASKSTEPKPVVKLPSLSSFQRKN---ASGLGIYQ 854

Query: 759  ATAEPSHEDAQPVAKSMVIDDVESEITTEPRNTVTETEEAAKNSTVVPTAPVAPLNNVMK 818
                   E ++    S+ I+  ES+ TTE  N   +  +  K+ T+        L+N   
Sbjct: 855  ------RESSRESLPSVTINISESDKTTE--NEAQKEIKHDKSDTI--------LSNHDG 898

Query: 819  KNTDADRKPLSDITPAVEXXXXXXXXXXXXXXXXXXXXXXXYDFRFKTVIEETQMFNALS 878
            K  D+ +  +S+I                             D R K  I E +++  L 
Sbjct: 899  K-ADSYKGDISNIV--------RESSHGSFLKKLSKGKILELDVRAK--ISEKRLYEGLH 947

Query: 879  KLLAAWKDYGLKDVIASPSLKQIRGKLSSDNILSLRSTLFIITVVGRGEG-SYVEFTKKS 937
            KLL  WK YGLK++  + +   I GKL +D ILSLRSTLF I ++  G G S ++F KK+
Sbjct: 948  KLLEGWKQYGLKNLGINTADMIISGKLVNDGILSLRSTLFEIVILPNGSGRSLIKFNKKT 1007

Query: 938  GSNKTF 943
            GS KT 
Sbjct: 1008 GSTKTL 1013

>YCL024W Chr3 (79162..82275) [3114 bp, 1037 aa] {ON}  KCC4Protein
           kinase of the bud neck involved in the septin
           checkpoint, associates with septin proteins, negatively
           regulates Swe1p by phosphorylation, shows structural
           homology to bud neck kinases Gin4p and Hsl1p
          Length = 1037

 Score =  245 bits (626), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 118/167 (70%), Positives = 137/167 (82%), Gaps = 4/167 (2%)

Query: 10  LPYHGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDEISPEAQD 69
           LPY GF SDVWSCG+ILFALLTGRLPFDEE+GN+R+LLLKVQ GQFEMP+  EIS +AQD
Sbjct: 201 LPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNDTEISRDAQD 260

Query: 70  LIAKILTVDPAARIKSREILKHPLLQKYPSIKDSKSIRNLPREDTYLNPL-DSVN---GS 125
           LI KIL VDP  RIK R+IL HPLL+KY +IKDSKSI++LPRE+TYL PL DS N    S
Sbjct: 261 LIGKILVVDPRQRIKIRDILSHPLLKKYQTIKDSKSIKDLPRENTYLYPLADSNNHTSAS 320

Query: 126 IDESIINNLVVLWHGRDRNEITAQLKEPGANLEKTFYALLFRFKHDS 172
           ID+SI+ NLVVLWHGR  ++I ++LKE G N EK  YALL+RFK DS
Sbjct: 321 IDDSILQNLVVLWHGRHADDIVSKLKENGTNKEKILYALLYRFKLDS 367

 Score =  126 bits (316), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 161/543 (29%), Positives = 226/543 (41%), Gaps = 121/543 (22%)

Query: 442  KQSVNPQGPSDSNHVRSVSAPAESVLKVDKRGST---------GNLDNDIMALL-NRRTF 491
            +QSVN Q  ++      VS   + + K++ + S+           L  DI  LL NR   
Sbjct: 556  RQSVNAQKINEDEFGSEVSDGMKELKKINDKVSSPLINYEFSQQELLQDIDTLLTNRYQL 615

Query: 492  SLETRPKSRLDPGIY-TSEEEDFGSKNHGADLS-TEKTILETIRRSKFLGSSFDINXXXX 549
            S  TRP SRLDPG+   +E      K   A L  TEK I+ETIRRSKFLGS  ++     
Sbjct: 616  SSYTRPISRLDPGLTPVTETLPNNLKEKTALLQDTEKKIIETIRRSKFLGSLLNVRGGLS 675

Query: 550  XXXXXXXXXXXXXXXXXXXXVASNATTANVVGNGYESQTLPKRKMGSAMEASSEPRKISE 609
                                    +TT  +  +  E                  PR+IS+
Sbjct: 676  PGKSELAPIEESPIV---------STTPLIYNDRME------------------PRRISD 708

Query: 610  VEVPQFTRRSRHFTASNKRLSVLSMYSTKTSFTNLADHLKGKADVQLIQTSPPSASKMDQ 669
            VEVP FTR+S+HFT +N R SVLS+Y+ K S  +L + L  K D  L    PP  S  D 
Sbjct: 709  VEVPHFTRKSKHFTTANNRRSVLSLYA-KDSIKDLNEFLI-KEDPDL----PPQGS-TDN 761

Query: 670  EAEFMFESVDKEGKETADTSADSR--LYEVAETKDAKNAKP-------------AVKLNF 714
            E+         E  E A++  DSR   Y+  ++KD  N                + + + 
Sbjct: 762  ESR-------SEDPEIAESITDSRNIQYDEDDSKDGDNVNNDNILSDFPQGVGISQEYDM 814

Query: 715  ADRFNRXXXXXXXXXXXXAAIKLPALPPLDKNKPNMVSGLGLYQATAEPSHEDAQPVA-- 772
             D+ N               +KLP+L           SGLGLYQ   EPS      +   
Sbjct: 815  KDK-NPNQSPISKSAEPTLVVKLPSLSSFQGKN---ASGLGLYQ--REPSKVTLPSLTSN 868

Query: 773  KSMVIDDVE--SEITTEPR--------NTVTETEEAAKNSTV-VPTAPVAPLNNVMKKNT 821
             S V +++E  +E  TE          + + E  +   N TV  PT    P N+V+ K  
Sbjct: 869  NSSVGENIEDGAEKGTESEKIAASLSDDDLKEDNDKKDNDTVNAPTTVKKPPNSVLLKKF 928

Query: 822  DADRKPLSDITPAVEXXXXXXXXXXXXXXXXXXXXXXXYDFRFKTVIEETQMFNALSKLL 881
               +                                   +      I E +++  L KLL
Sbjct: 929  SKGK---------------------------------ILELEIHAKIPEKRLYEGLHKLL 955

Query: 882  AAWKDYGLKDVIASPSLKQIRGKLSSDNILSLRSTLFIITVVGRGEG-SYVEFTKKSGSN 940
              WK YGLK+++ + +   I GKL +D+IL LRSTLF I V+  G+G S ++F KK+GS 
Sbjct: 956  EGWKQYGLKNLVFNITNMIITGKLVNDSILFLRSTLFEIMVLPNGDGRSLIKFNKKTGST 1015

Query: 941  KTF 943
            KT 
Sbjct: 1016 KTL 1018

>TDEL0A02550 Chr1 (457841..461950) [4110 bp, 1369 aa] {ON} Anc_2.479
           YKL101W
          Length = 1369

 Score =  168 bits (425), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 88/179 (49%), Positives = 120/179 (67%), Gaps = 21/179 (11%)

Query: 12  YHGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDEISPEAQDLI 71
           YHG  SDVWSCGIILFALLTG LPF+  D +I+ LLLKVQSG+++MP +  +S EAQDLI
Sbjct: 293 YHGGPSDVWSCGIILFALLTGHLPFN--DDSIKKLLLKVQSGKYQMPQN--LSKEAQDLI 348

Query: 72  AKILTVDPAARIKSREILKHPLLQKYPSIKDSKSIRNL------PREDTYLNPLDSVNGS 125
           AKILTV+PA R+ + EIL+HPL+ KY S+  +K  + L       + +  L+ L++   +
Sbjct: 349 AKILTVNPAKRLTTEEILRHPLIVKYDSMMKTKKYKALYKNMGQGKSNADLHLLNNYEAT 408

Query: 126 ---------IDESIINNLVVLWHGRDRNEITAQLKEPGANLEKTFYALLFRFK--HDSH 173
                    ID++I+NNL +LWHG  R  I A+L +P  + EK FY+LL ++K  H SH
Sbjct: 409 TINLNSRKDIDDTILNNLQILWHGASRELIVAKLLQPRMSEEKVFYSLLLKYKENHSSH 467

>Smik_11.139 Chr11 (235511..240115) [4605 bp, 1534 aa] {ON} YKL101W
           (REAL)
          Length = 1534

 Score =  167 bits (423), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 87/176 (49%), Positives = 122/176 (69%), Gaps = 20/176 (11%)

Query: 11  PYHGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDEISPEAQDL 70
           PYHG  SDVWSCGI+LFALLTG LPF+  D NI+ LLLKVQSG+++MP +  +S EA+DL
Sbjct: 290 PYHGGPSDVWSCGIVLFALLTGHLPFN--DDNIKKLLLKVQSGKYQMPMN--LSAEARDL 345

Query: 71  IAKILTVDPAARIKSREILKHPLLQKYPSIKDSKSIRNLPRE-------DTYLNPLDSVN 123
           I+KIL +DPA RI ++EILKHPL++KY  +  +K +R + R+       ++ L+ L++V+
Sbjct: 346 ISKILVIDPAKRITTQEILKHPLIKKYDDLPVNKILRKMKRDNMARGKSNSDLHLLNNVS 405

Query: 124 GS---------IDESIINNLVVLWHGRDRNEITAQLKEPGANLEKTFYALLFRFKH 170
            S         IDESI+ +L +LWHG  R  ITA+L +   + EK FY+LL ++K 
Sbjct: 406 PSIVTLYSRSDIDESILRSLQILWHGVSRELITAKLLQKPMSEEKLFYSLLLQYKQ 461

>YKL101W Chr11 (248920..253476) [4557 bp, 1518 aa] {ON}
           HSL1Nim1p-related protein kinase that regulates the
           morphogenesis and septin checkpoints; associates with
           the assembled septin filament; required along with Hsl7p
           for bud neck recruitment, phosphorylation, and
           degradation of Swe1p
          Length = 1518

 Score =  167 bits (422), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 85/176 (48%), Positives = 121/176 (68%), Gaps = 20/176 (11%)

Query: 11  PYHGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDEISPEAQDL 70
           PYHG  SDVWSCGI+LFALLTG LPF+  D NI+ LLLKVQSG+++MP +  +S EA+DL
Sbjct: 290 PYHGGPSDVWSCGIVLFALLTGHLPFN--DDNIKKLLLKVQSGKYQMPSN--LSSEARDL 345

Query: 71  IAKILTVDPAARIKSREILKHPLLQKYPSIKDSKSIRNLPRE-------DTYLNPLDSVN 123
           I+KIL +DP  RI ++EILKHPL++KY  +  +K +R + ++       ++ L+ L++V+
Sbjct: 346 ISKILVIDPEKRITTQEILKHPLIKKYDDLPVNKVLRKMRKDNMARGKSNSDLHLLNNVS 405

Query: 124 ---------GSIDESIINNLVVLWHGRDRNEITAQLKEPGANLEKTFYALLFRFKH 170
                    G IDESI+ +L +LWHG  R  ITA+L +   + EK FY+LL ++K 
Sbjct: 406 PSIVTLHSKGEIDESILRSLQILWHGVSRELITAKLLQKPMSEEKLFYSLLLQYKQ 461

>Skud_11.126 Chr11 (235011..239567) [4557 bp, 1518 aa] {ON} YKL101W
           (REAL)
          Length = 1518

 Score =  164 bits (416), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 85/176 (48%), Positives = 121/176 (68%), Gaps = 20/176 (11%)

Query: 11  PYHGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDEISPEAQDL 70
           PYHG  SDVWSCGI+LFALLTG LPF+  D NI+ LLLKVQSG+++MP +  +S EA+DL
Sbjct: 290 PYHGGPSDVWSCGIVLFALLTGHLPFN--DDNIKKLLLKVQSGKYQMPMN--LSAEARDL 345

Query: 71  IAKILTVDPAARIKSREILKHPLLQKYPSIKDSKSIRNLPRE-------DTYLNPLDSVN 123
           I+KIL ++P  RI ++EIL HPL++KY ++  +K IR + R+       ++ L+ L++V+
Sbjct: 346 ISKILVINPEKRITTQEILNHPLIKKYDNLPINKMIRKMKRDNMARGKSNSDLHLLNNVS 405

Query: 124 ---------GSIDESIINNLVVLWHGRDRNEITAQLKEPGANLEKTFYALLFRFKH 170
                    G IDESI+ +L +LWHG  R  ITA+L +   + EK FY+LL ++K 
Sbjct: 406 PSVVTLHSRGEIDESILRSLQILWHGVSRELITAKLLQKPMSEEKLFYSLLLQYKQ 461

>Ecym_7392 Chr7 complement(803240..807544) [4305 bp, 1434 aa] {ON}
           similar to Ashbya gossypii ABL034W
          Length = 1434

 Score =  163 bits (413), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 89/160 (55%), Positives = 113/160 (70%), Gaps = 8/160 (5%)

Query: 12  YHGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDEISPEAQDLI 71
           YHG  SDVWSCGIILFALLTG LPF+  D N++ LLLKVQSG+++MP +  IS EA+DLI
Sbjct: 244 YHGSPSDVWSCGIILFALLTGHLPFN--DDNVKKLLLKVQSGKYQMPQN--ISNEAKDLI 299

Query: 72  AKILTVDPAARIKSREILKHPLLQKYPSIKDSKSIRNLPREDTYLN--PLDSVNGSIDES 129
           AKIL VDPA RI   E+L+HPLL KY   + SKS  NL   D+  N   L+S +  IDES
Sbjct: 300 AKILIVDPAMRITIDEVLEHPLLLKYQKTR-SKSSSNLHALDSTPNIVVLESED-KIDES 357

Query: 130 IINNLVVLWHGRDRNEITAQLKEPGANLEKTFYALLFRFK 169
           I++NL +LWHG  +  +T +L + G   EK FY+LL R++
Sbjct: 358 ILSNLQILWHGAPKEYLTGKLLQQGFTEEKLFYSLLLRYQ 397

>Suva_11.123 Chr11 (235064..239644) [4581 bp, 1526 aa] {ON} YKL101W
           (REAL)
          Length = 1526

 Score =  163 bits (412), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 85/176 (48%), Positives = 121/176 (68%), Gaps = 20/176 (11%)

Query: 11  PYHGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDEISPEAQDL 70
           PYHG  SDVWSCGI+LFALLTG LPF+  D NI+ LLLKVQSG+++MP +  +S EA++L
Sbjct: 290 PYHGGPSDVWSCGIVLFALLTGHLPFN--DDNIKKLLLKVQSGKYQMPMN--LSLEARNL 345

Query: 71  IAKILTVDPAARIKSREILKHPLLQKYPSIKDSKSIRNLP-------REDTYLNPLDSVN 123
           I+KIL +DP  RI ++EIL+HPL++KY ++  +K +R +        + ++ L+ LD+V+
Sbjct: 346 ISKILVIDPEKRITTQEILEHPLIKKYDNLPVNKMLRKMKGDSMTRGKSNSDLHLLDNVS 405

Query: 124 GS---------IDESIINNLVVLWHGRDRNEITAQLKEPGANLEKTFYALLFRFKH 170
            S         IDESI+ +L +LWHG  R  ITA+L +   + EK FY+LL R+K 
Sbjct: 406 PSIVTLNTKNEIDESILRSLQILWHGVSRELITAKLLQKPMSEEKLFYSLLLRYKQ 461

>KNAG0A06540 Chr1 (1002435..1006733) [4299 bp, 1432 aa] {ON}
           Anc_2.479 YKL101W
          Length = 1432

 Score =  160 bits (405), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 94/186 (50%), Positives = 115/186 (61%), Gaps = 16/186 (8%)

Query: 11  PYHGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDEISPEAQDL 70
           PYHG  SDVWSCGIILFALLTG LPF+  D NIR LLLKVQSG+F +P +  IS EAQDL
Sbjct: 291 PYHGGPSDVWSCGIILFALLTGHLPFN--DDNIRKLLLKVQSGRFRLPRN--ISLEAQDL 346

Query: 71  IAKILTVDPAARIKSREILKHPLLQKYPSIKDSK-------SIRNLPREDTYLNPLD--- 120
           IAKIL V+P  RIK  +ILKHPL+ KY      K       S  NL  E   L P +   
Sbjct: 347 IAKILVVNPRQRIKISDILKHPLITKYRQFFKVKFNQVPNPSATNLNSEH-MLTPNNLKL 405

Query: 121 SVNGSIDESIINNLVVLWHGRDRNEITAQLKEPGANLEKTFYALLFRFKHDSHQEQLKQQ 180
           +    IDESI+ NL +LWHG  R  I A+L +   + EK FY+LL+++K   H   + + 
Sbjct: 406 ASRADIDESILRNLQILWHGTSREIIIAKLLQYPMSAEKIFYSLLWQYKQ-KHSSSIARN 464

Query: 181 RRSQAS 186
             S+ S
Sbjct: 465 NNSETS 470

>ZYRO0G03366g Chr7 (261014..265864) [4851 bp, 1616 aa] {ON} similar
           to uniprot|P34244 Saccharomyces cerevisiae YKL101W HSL1
           Nim1p-related protein kinase that regulates the
           morphogenesis and septin checkpoints associates with the
           assembled septin filament required along with Hsl7p for
           bud neck recruitment phosphorylation and degradation of
           Swe1p
          Length = 1616

 Score =  159 bits (402), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 86/176 (48%), Positives = 114/176 (64%), Gaps = 21/176 (11%)

Query: 11  PYHGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDEISPEAQDL 70
           PYHG  SDVWSCGIILFALLTG LPF+  D NI+ LLLKVQSG+F MP +  +S EA+DL
Sbjct: 318 PYHGGPSDVWSCGIILFALLTGHLPFN--DDNIKKLLLKVQSGKFHMPQN--LSAEAKDL 373

Query: 71  IAKILTVDPAARIKSREILKHPLLQKYPS----IKDSKSIRNLP----REDTYLNPLDSV 122
           ++KIL V+P  RI + EIL HPLL KY      +K   S+  +     + ++ L+ LD+ 
Sbjct: 374 MSKILVVNPFKRIATEEILNHPLLTKYDKLVKPVKYRSSVNPVALSQGKSNSDLHVLDAS 433

Query: 123 NGS---------IDESIINNLVVLWHGRDRNEITAQLKEPGANLEKTFYALLFRFK 169
           N +         ID+SI++NL +LWHG  R  I A+L +P  + EK FY+LL  +K
Sbjct: 434 NSNIVDLRSREDIDDSIVSNLQILWHGASRELIVAKLLQPRMSEEKLFYSLLLSYK 489

>NCAS0A05770 Chr1 (1132854..1137239) [4386 bp, 1461 aa] {ON}
           Anc_2.479
          Length = 1461

 Score =  156 bits (395), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 84/182 (46%), Positives = 119/182 (65%), Gaps = 18/182 (9%)

Query: 12  YHGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDEISPEAQDLI 71
           YHG  SDVWSCGIILFALLTG LPF+  D NI+ LLLKVQ+G+F MP +  +SPEAQDLI
Sbjct: 313 YHGGPSDVWSCGIILFALLTGHLPFN--DDNIKKLLLKVQAGKFRMPST--LSPEAQDLI 368

Query: 72  AKILTVDPAARIKSREILKHPLLQKY-PSIKDSKSIRNLPREDTYLNPLDSVN------- 123
           ++IL +DP+ RI +  IL HPL+ KY P+ K+  S     + ++ L+ L+ ++       
Sbjct: 369 SRILVIDPSKRITTDRILNHPLILKYEPAGKNMVS----GKSNSDLHVLEHISPQPISLT 424

Query: 124 --GSIDESIINNLVVLWHGRDRNEITAQLKEPGANLEKTFYALLFRFKHDSHQEQLKQQR 181
               ID SI+ NL +LWHG  R  I A+L +   + EK FY+LL+++K     + +KQ+ 
Sbjct: 425 SRNDIDASILKNLQILWHGTSRELIIAKLLQTPMSEEKLFYSLLWQYKQRHTIQPIKQKE 484

Query: 182 RS 183
           ++
Sbjct: 485 QT 486

>TBLA0I01150 Chr9 complement(235187..240424) [5238 bp, 1745 aa] {ON}
           Anc_2.479 YKL101W
          Length = 1745

 Score =  155 bits (391), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 85/179 (47%), Positives = 109/179 (60%), Gaps = 29/179 (16%)

Query: 12  YHGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDEISPEAQDLI 71
           YHG  +DVWSCGIILFALLTG LPF+ +  NI+ LLLKVQSG + MP   ++SP+A+DLI
Sbjct: 276 YHGSPTDVWSCGIILFALLTGHLPFNHD--NIKKLLLKVQSGVYHMP--SDLSPDAKDLI 331

Query: 72  AKILTVDPAARIKSREILKHPLLQKYP-------------SIKDSKS------IRNLPRE 112
           +KIL VDP  R+ + EIL H L+ KY              S+   KS      I NL   
Sbjct: 332 SKILVVDPDKRLTTTEILNHSLITKYDRMGLTNRNYNNNLSMARDKSNSNLNFINNLSNV 391

Query: 113 DTYL-NPLDSVNGSIDESIINNLVVLWHGRDRNEITAQLKEPGANLEKTFYALLFRFKH 170
           D  L NP D     ID SI++NL +LWHG  ++ I  +L +P  N EK FY+LL ++K 
Sbjct: 392 DILLQNPCD-----IDTSILSNLQILWHGESKHAIIDKLLQPNMNEEKLFYSLLLKYKQ 445

>KLLA0F13552g Chr6 complement(1252906..1256709) [3804 bp, 1267 aa]
           {ON} weakly similar to uniprot|P34244 Saccharomyces
           cerevisiae YKL101W HSL1 Nim1p-related protein kinase
           that regulates the morphogenesis and septin checkpoints
           associates with the assembled septin filament required
           along with Hsl7p for bud neck recruitment
           phosphorylation and degradation of Swe1p
          Length = 1267

 Score =  154 bits (390), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 86/186 (46%), Positives = 115/186 (61%), Gaps = 11/186 (5%)

Query: 12  YHGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDEISPEAQDLI 71
           YHG  SDVWSCGIILFALLTG LPF+  D N++ LLLKVQSG+++MP    +S EA+DLI
Sbjct: 251 YHGSPSDVWSCGIILFALLTGHLPFN--DDNVKKLLLKVQSGKYQMP--QWLSVEAKDLI 306

Query: 72  AKILTVDPAARIKSREILKHPLLQKYPSIKDSKSIRNLPREDTYLNPLD-SVNGSIDESI 130
           ++IL VDP  RI   +IL+H LL KY     SKS  +L   +   N +  S    IDE+I
Sbjct: 307 SRILVVDPNRRITIDQILQHELLTKYDQKSRSKSNSDLNLLNRTPNIVSFSSERDIDETI 366

Query: 131 INNLVVLWHGRDRNEITAQLKEPGANLEKTFYALLFRFKHDSHQEQLKQ------QRRSQ 184
           ++NL +LWHG  R  +  +L +PG   EK FY+LL+ ++    +   K        + S 
Sbjct: 367 LSNLQILWHGAARKHLVTRLMKPGFTEEKMFYSLLWNYQEKQQKSMQKDLIPVPTLKTSS 426

Query: 185 ASHISP 190
           AS +SP
Sbjct: 427 ASSVSP 432

>SAKL0E02860g Chr5 complement(228726..232859) [4134 bp, 1377 aa]
           {ON} similar to uniprot|Q75DQ1 Ashbya gossypii ABL034W
           ABL034Wp and weakly similar to YKL101W uniprot|P34244
           Saccharomyces cerevisiae YKL101W HSL1 Nim1p-related
           protein kinase that regulates the morphogenesis and
           septin checkpoints associates with the assembled septin
           filament required along with Hsl7p for bud neck
           recruitment phosphorylation and degradation of Swe1p
          Length = 1377

 Score =  154 bits (388), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 84/159 (52%), Positives = 104/159 (65%), Gaps = 6/159 (3%)

Query: 12  YHGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDEISPEAQDLI 71
           YHG  SDVWSCGIILFALLTG LPF+  D NI+ LLLKVQSG++ MP +  IS EAQDLI
Sbjct: 247 YHGSPSDVWSCGIILFALLTGHLPFN--DDNIKKLLLKVQSGKYHMPQN--ISSEAQDLI 302

Query: 72  AKILTVDPAARIKSREILKHPLLQKYPSIKD-SKSIRNLPREDTYLNPLDSVNGSIDESI 130
           +KIL VDP  RI   E+L+HPL+ KY   +  S S  +L      L  L S    ID SI
Sbjct: 303 SKILIVDPRGRITINEVLQHPLITKYDKARSKSNSDLHLLSRTPQLVTLQS-KEDIDGSI 361

Query: 131 INNLVVLWHGRDRNEITAQLKEPGANLEKTFYALLFRFK 169
           + NL +LWHG     I A+L + G   EK FY+LL++++
Sbjct: 362 LGNLQILWHGAPSEYIVARLLQHGFTEEKLFYSLLWQYQ 400

>NDAI0D02750 Chr4 (639802..644349) [4548 bp, 1515 aa] {ON} Anc_2.479
           YKL101W
          Length = 1515

 Score =  153 bits (386), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 82/169 (48%), Positives = 111/169 (65%), Gaps = 16/169 (9%)

Query: 12  YHGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDEISPEAQDLI 71
           YHG  SDVWSCGIILFALLTG LPF+  D NI+ LLLKVQ+G+++MP +  +S EA+DLI
Sbjct: 329 YHGGPSDVWSCGIILFALLTGHLPFN--DDNIKKLLLKVQAGKYQMPKN--LSDEAKDLI 384

Query: 72  AKILTVDPAARIKSREILKHPLLQKY-PSIKDSKSIRNLPREDTYLNPLDSVN------- 123
           ++IL V P+ R+ + EIL HPL+ KY  S K    ++     D +L  LDS++       
Sbjct: 385 SRILVVSPSKRLTTVEILNHPLILKYEKSSKKKHMVKGKSNSDLHL--LDSISPENITLN 442

Query: 124 --GSIDESIINNLVVLWHGRDRNEITAQLKEPGANLEKTFYALLFRFKH 170
               IDESI+ NL +LWHG  R+ I A+L +   + EK FY+LL ++K 
Sbjct: 443 SRMDIDESILKNLQILWHGTSRDIIIAKLLQKPISEEKLFYSLLLQYKQ 491

>ABL034W Chr2 (333432..337709) [4278 bp, 1425 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YKL101W (HSL1)
          Length = 1425

 Score =  152 bits (385), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 80/161 (49%), Positives = 105/161 (65%), Gaps = 7/161 (4%)

Query: 12  YHGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDEISPEAQDLI 71
           YHG  SDVWSCGIILFALLTG LPF+  D N+R LLLKVQ G+++MP +  +S EA+DLI
Sbjct: 241 YHGSPSDVWSCGIILFALLTGHLPFN--DDNVRKLLLKVQHGRYQMPSN--VSKEAKDLI 296

Query: 72  AKILTVDPAARIKSREILKHPLLQKY--PSIKDSKSIRNLPREDTYLNPLDSVNGSIDES 129
           +KIL VDP  RI   +IL+HPLL KY  P           P E   +  + S++  IDE+
Sbjct: 297 SKILVVDPEKRITVDKILEHPLLVKYDNPGKGGLACPLEKPEERPKVLDIHSID-DIDET 355

Query: 130 IINNLVVLWHGRDRNEITAQLKEPGANLEKTFYALLFRFKH 170
           I++NL +LWHG  +  +  +L + G   EK FYALL R++ 
Sbjct: 356 ILSNLQILWHGAPKEYLVDKLLQSGFTEEKLFYALLLRYQQ 396

>KLTH0D05566g Chr4 (498055..501441) [3387 bp, 1128 aa] {ON} weakly
           similar to uniprot|P34244 Saccharomyces cerevisiae
           YKL101W HSL1 Nim1p-related protein kinase that regulates
           the morphogenesis and septin checkpoints associates with
           the assembled septin filament required along with Hsl7p
           for bud neck recruitment phosphorylation and degradation
           of Swe1p
          Length = 1128

 Score =  150 bits (378), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 86/174 (49%), Positives = 111/174 (63%), Gaps = 21/174 (12%)

Query: 12  YHGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDEISPEAQDLI 71
           Y+G  SDVWSCGIILFALLTG LPF+  D NI+ LLLKVQ+G+++MP +  IS EAQDLI
Sbjct: 234 YNGGPSDVWSCGIILFALLTGHLPFN--DDNIKRLLLKVQAGKYQMPQA--ISLEAQDLI 289

Query: 72  AKILTVDPAARIKSREILKHPLLQKYPSIKDSKSIRNL-------PREDTYLNPLDSVNG 124
           ++IL VDP  RI   +IL HPL+ KY   K SKS  +L       P+  T  +  D    
Sbjct: 290 SRILVVDPNKRITINDILSHPLITKY-DYKRSKSNSDLHILSHTSPQICTIRSERD---- 344

Query: 125 SIDESIINNLVVLWHGRDRNEITAQLKEPGANLEKTFYALLFRFKHDSHQEQLK 178
            +D +I+ NL +LWHG  ++ I  +L EP    EKTFY+LL  ++    Q QLK
Sbjct: 345 -VDPTILQNLQILWHGAPKDYIMKRLLEPELTEEKTFYSLLLAYQ----QRQLK 393

>KAFR0D03200 Chr4 (628993..633339) [4347 bp, 1448 aa] {ON} Anc_2.479
           YKL101W
          Length = 1448

 Score =  148 bits (373), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 82/171 (47%), Positives = 110/171 (64%), Gaps = 17/171 (9%)

Query: 12  YHGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDEISPEAQDLI 71
           YHG  SDVWSCGIILFALLTG LPF+  D +I+ LLLKVQSG+F+MP +  IS EA+DLI
Sbjct: 296 YHGSPSDVWSCGIILFALLTGHLPFN--DDSIKKLLLKVQSGKFQMPQN--ISLEAEDLI 351

Query: 72  AKILTVDPAARIKSREILKHPLLQKYPSIK-DSKSIRNLPREDTYLNPLDSVN------- 123
           ++IL VDP  RI+  +IL HPL++KY   K DS ++ +  +     + L  +N       
Sbjct: 352 SRILVVDPEKRIQINDILIHPLIRKYEDNKTDSNNVSSYKKSSKSNSNLHILNDMGPSIV 411

Query: 124 -----GSIDESIINNLVVLWHGRDRNEITAQLKEPGANLEKTFYALLFRFK 169
                  IDESI+ NL +LWHG  R  I ++L +   + EK FY+LL ++K
Sbjct: 412 TLKARNEIDESILKNLQILWHGTSRELIISKLLQTPMSEEKLFYSLLLQYK 462

>Kpol_431.9 s431 complement(22310..26968) [4659 bp, 1552 aa] {ON}
           complement(22310..26968) [4659 nt, 1553 aa]
          Length = 1552

 Score =  147 bits (370), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 92/242 (38%), Positives = 133/242 (54%), Gaps = 30/242 (12%)

Query: 12  YHGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDEISPEAQDLI 71
           Y+G  SD+WSCGIILFALLTG LPF+  D NI+ LL+KVQ+G+++MP    IS EA++LI
Sbjct: 312 YNGAPSDIWSCGIILFALLTGHLPFN--DDNIKKLLIKVQNGRYQMPSY--ISQEAKNLI 367

Query: 72  AKILTVDPAARIKSREILKHPLLQKYP---SIKDSKSIRN-----LPREDTYLNPLDSV- 122
           ++IL VDP+ RI + +IL HPLL KY      KD K  +N       + ++ LN L ++ 
Sbjct: 368 SRILVVDPSKRISTEQILSHPLLTKYDKRLGKKDRKVTKNNKIMHRGKSNSDLNMLSNIP 427

Query: 123 ----------NGSIDESIINNLVVLWHGRDRNEITAQLKEPGANLEKTFYALLFRFKHDS 172
                        IDESI+ NL +LWHG  R+ I A+L +   + EK  Y+LL+++K  +
Sbjct: 428 QNTEIVKLRARSDIDESILKNLQILWHGISRDIIIAKLLQTPMSEEKLIYSLLWKYKQIN 487

Query: 173 HQEQLKQQRRSQASHISPKXXXXXXXXXXXXITNVTPKKKNKAPVISASSSHKRPVSFNR 232
                   + S+A  IS               +  T    N A  IS    +  P+ FN+
Sbjct: 488 F-------KSSKAPSISSASVNISVSAQDTETSTNTRTNSNSATDISIPFVNTEPLQFNK 540

Query: 233 LS 234
           ++
Sbjct: 541 IN 542

>Kwal_26.7788 s26 (511530..515333) [3804 bp, 1267 aa] {ON} YKL101W
           (HSL1) - Putative protein kinase homologous to S. pombe
           cdr1/nim1 [contig 55] FULL
          Length = 1267

 Score =  146 bits (369), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 84/174 (48%), Positives = 110/174 (63%), Gaps = 13/174 (7%)

Query: 12  YHGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDEISPEAQDLI 71
           Y+G  SDVWSCGIILFALLTG LPF+  D NI+ LLLKVQ+G+++MP S  +S  AQDLI
Sbjct: 234 YNGGPSDVWSCGIILFALLTGHLPFN--DDNIKRLLLKVQAGKYQMPQS--VSSGAQDLI 289

Query: 72  AKILTVDPAARIKSREILKHPLLQKYPSIKDSKS---IRNLPREDTYLNPLDSVNGSIDE 128
           ++IL VDP  RI   EIL HPLL KY + K SKS   +  L      ++ + S    +D 
Sbjct: 290 SRILVVDPDKRISINEILAHPLLAKYGN-KRSKSNSDLHILSHSKPQISTIKS-ESDVDP 347

Query: 129 SIINNLVVLWHGRDRNEITAQLKEPGANLEKTFYALLFRFKHDSHQEQLKQQRR 182
           +I+ NL +LWHG  +  I   L +P    EKTFY+LL  ++    Q Q KQ+ +
Sbjct: 348 TILQNLQILWHGAPKESILKGLLKPELTEEKTFYSLLLAYQ----QRQSKQKEK 397

>CAGL0K08514g Chr11 complement(854143..858612) [4470 bp, 1489 aa]
           {ON} similar to uniprot|P34244 Saccharomyces cerevisiae
           YKL101w serine/threonine-protein kinase
          Length = 1489

 Score =  142 bits (358), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 76/171 (44%), Positives = 109/171 (63%), Gaps = 16/171 (9%)

Query: 11  PYHGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDEISPEAQDL 70
           PYHG  SDVWSCGIILFALLTG LPF+  D NI+ LLLKVQ+G+F++P    ++ +A+DL
Sbjct: 302 PYHGGPSDVWSCGIILFALLTGHLPFN--DDNIKKLLLKVQAGRFQLPPY--LTNDAKDL 357

Query: 71  IAKILTVDPAARIKSREILKHPLLQKY---PSIKDSKSIRNLPREDTYLNPLD------- 120
           I +IL  +P  R+   EIL HPL++KY   P+     ++    + ++ L+ L+       
Sbjct: 358 ITRILVTNPEKRLTINEILNHPLIKKYRNPPAHIRKLNLLGRGKSNSDLHVLEYNTPATV 417

Query: 121 SVNGS--IDESIINNLVVLWHGRDRNEITAQLKEPGANLEKTFYALLFRFK 169
            +N    ID+SI+ +L +LWHG  R  +  +L   GA  EK FY+LLF++K
Sbjct: 418 CLNSEEDIDQSILKSLQILWHGTPRQRLVERLLVEGATEEKLFYSLLFQYK 468

>TPHA0G03200 Chr7 (683296..687900) [4605 bp, 1534 aa] {ON} Anc_2.479
           YKL101W
          Length = 1534

 Score =  131 bits (329), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 75/183 (40%), Positives = 114/183 (62%), Gaps = 28/183 (15%)

Query: 12  YHGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDEISPEAQDLI 71
           Y+G  SDVWSCGIILFALLTG LPF+  D +I+ LL+KVQ+G+++MP+   +S +A+DLI
Sbjct: 337 YNGGPSDVWSCGIILFALLTGHLPFN--DDSIKKLLIKVQNGRYQMPNY--LSKDAKDLI 392

Query: 72  AKILTVDPAARIKSREILKHPLLQKYP---SIKDS--------KSIRNLPR--EDTYLNP 118
           ++IL V+P AR+ + +IL+HPL+ KY    S+K          K+  NL R   +T L  
Sbjct: 393 SRILLVNPKARLTTEQILEHPLITKYDNQYSLKKENKLTKQAIKNYNNLMRGKSNTDLAI 452

Query: 119 LDSV-----------NGSIDESIINNLVVLWHGRDRNEITAQLKEPGANLEKTFYALLFR 167
           L ++              ID+SI+ NL +LW+G  R  + ++L +   + EK  Y+LL++
Sbjct: 453 LQNIPDKTDIIQLRSRNDIDDSILRNLQILWNGVPRETLISKLIQDPVSEEKLIYSLLWQ 512

Query: 168 FKH 170
           +K 
Sbjct: 513 YKQ 515

>CAGL0M02299g Chr13 (273725..276406) [2682 bp, 893 aa] {ON} similar
           to uniprot|Q12152 Saccharomyces cerevisiae YPL150w
          Length = 893

 Score = 81.3 bits (199), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 42/92 (45%), Positives = 55/92 (59%), Gaps = 7/92 (7%)

Query: 11  PYHGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDE--ISPEAQ 68
           PY GF+ D+WS G+IL+ LL G LPFDE+D      LL  Q    + P  DE    PEAQ
Sbjct: 208 PYDGFKVDIWSLGVILYTLLCGCLPFDEDDD-----LLTKQKIINDTPVIDERITIPEAQ 262

Query: 69  DLIAKILTVDPAARIKSREILKHPLLQKYPSI 100
           +LI ++L+ DP  R  +  IL HP LQ Y ++
Sbjct: 263 NLIEQLLSKDPTERPNTSAILLHPFLQPYGTL 294

>TBLA0B03860 Chr2 (887855..890821) [2967 bp, 988 aa] {ON} Anc_8.668
           YPL150W
          Length = 988

 Score = 80.1 bits (196), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 41/91 (45%), Positives = 58/91 (63%), Gaps = 7/91 (7%)

Query: 12  YHGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMP--DSDEISPEAQD 69
           Y GF+ DVWS G+IL+ LL G +PFDEE    +N   K+ +   EMP  DS  + P+A D
Sbjct: 204 YDGFKIDVWSLGVILYTLLNGFMPFDEEQQ--KNTEWKIVN---EMPSFDSTLLGPDAVD 258

Query: 70  LIAKILTVDPAARIKSREILKHPLLQKYPSI 100
           L++K+L  DP  R   +E+L+HP LQ Y ++
Sbjct: 259 LLSKLLAKDPIDRPSMKEVLEHPYLQPYGNV 289

>KNAG0J01590 Chr10 (292565..294982) [2418 bp, 805 aa] {ON} Anc_8.654
           YPL141C
          Length = 805

 Score = 78.2 bits (191), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 43/121 (35%), Positives = 63/121 (52%), Gaps = 18/121 (14%)

Query: 11  PYHGFESDVWSCGIILFALLTGRLPFDEEDGN-----IRNLLLKVQSGQFEMPDSDEISP 65
           PY G  +D+WSCGIILFA+L G LP+D++  N     I  L   +     + P  + I+P
Sbjct: 226 PYQGRRADLWSCGIILFAMLAGYLPWDDDKDNPDGEDIAKLYYYITHTALKFP--EYITP 283

Query: 66  EAQDLIAKILTVDPAARIKSREILKHPLLQKYPS-----------IKDSKSIRNLPREDT 114
             +DL+ +IL  DP  R+  REI  H  L+K+             I  SK+I  LP+ + 
Sbjct: 284 IPRDLLRRILVADPRRRVTLREIQGHQWLKKHAQFLSIQPEEWDRISQSKNITRLPKHNK 343

Query: 115 Y 115
           +
Sbjct: 344 H 344

>NDAI0E02390 Chr5 complement(496256..498907) [2652 bp, 883 aa] {ON}
           Anc_8.668
          Length = 883

 Score = 77.4 bits (189), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 53/176 (30%), Positives = 94/176 (53%), Gaps = 14/176 (7%)

Query: 12  YHGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDE--ISPEAQD 69
           Y GF+ D+WS G+IL+ +L G +PFDE+D        K+ +   EMP  ++  +S +A+D
Sbjct: 205 YDGFKIDIWSLGVILYTMLNGSMPFDEDDET--KTEWKIMN---EMPVFNDTILSEDAKD 259

Query: 70  LIAKILTVDPAARIKSREILKHPLLQKYPSIKDSKSIRNLPREDTYLNPLDSVNGSIDES 129
           L+ K+L+ DP  R   +EIL HP LQ Y S+   K+ R L ++    N     +  ++  
Sbjct: 260 LLIKLLSKDPNERPSMQEILHHPFLQPYGSLLLEKTDRLLRKQR---NGTIHFHSKLERK 316

Query: 130 IINNLVVLWHGRDRNEITAQLKEPGANLEKTFYALLFRFKHDSHQEQLKQQRRSQA 185
           ++ NL     G D   +   +++  ++L    + LL   + +   E++ Q +RS++
Sbjct: 317 LLKNLKRT--GFDTQAMKVSVQKRKSDLLSATWTLL--LQREKRHEKVNQPKRSRS 368

>NDAI0B02070 Chr2 (514024..517800) [3777 bp, 1258 aa] {ON} 
          Length = 1258

 Score = 77.4 bits (189), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 34/86 (39%), Positives = 58/86 (67%), Gaps = 4/86 (4%)

Query: 11  PYHGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDEISPEAQDL 70
           PY G E DVWS GI+L+ L+ G++PFD+E+ ++  L  K++ G+ E P  + +S E   L
Sbjct: 363 PYTGPEVDVWSFGIVLYVLVCGKVPFDDENSSV--LHEKIRQGKVEYP--NHLSIEVISL 418

Query: 71  IAKILTVDPAARIKSREILKHPLLQK 96
           ++K++ VDPA R   R++++HP + +
Sbjct: 419 LSKMIVVDPAKRASLRQVVEHPWMTR 444

>NDAI0E02320 Chr5 (480203..483001) [2799 bp, 932 aa] {ON} 
          Length = 932

 Score = 76.6 bits (187), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 37/92 (40%), Positives = 54/92 (58%), Gaps = 7/92 (7%)

Query: 11  PYHGFESDVWSCGIILFALLTGRLPFDEEDGN-----IRNLLLKVQSGQFEMPDSDEISP 65
           PY   ++D+WSCGIIL+A+L G LP+D++ GN     I  L   +     + P  D I+P
Sbjct: 255 PYEARKADIWSCGIILYAMLAGYLPWDDDSGNPDGDDISRLYYYITKTPLKFP--DYINP 312

Query: 66  EAQDLIAKILTVDPAARIKSREILKHPLLQKY 97
             +DL+ KIL  DP  RI  ++I KH  L+ +
Sbjct: 313 IPRDLLRKILVSDPRRRITMKQIEKHEWLKPH 344

>TBLA0B00490 Chr2 complement(94755..97118) [2364 bp, 787 aa] {ON}
           Anc_6.31 YMR001C
          Length = 787

 Score = 75.9 bits (185), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 40/125 (32%), Positives = 71/125 (56%), Gaps = 3/125 (2%)

Query: 13  HGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDEISPEAQDLIA 72
           H +E D+WS G+++FALL G+ PF  +D N   +  ++++ ++  P +  IS EA+ LI 
Sbjct: 318 HSYEVDIWSIGVMIFALLIGKPPFQAKDVN--TIYSRIKNSEYTFPINKSISQEAKTLIQ 375

Query: 73  KILTVDPAARIKSREILKHPLLQ-KYPSIKDSKSIRNLPREDTYLNPLDSVNGSIDESII 131
            IL  DP AR    EI+++   +  +PS+  +     +P  D +L P +S+N   +  I 
Sbjct: 376 DILINDPIARPSINEIMEYVWFRGTFPSMTSNTVFTEIPEYDQFLTPNESLNNFRNCMIQ 435

Query: 132 NNLVV 136
           + L++
Sbjct: 436 SGLIL 440

>CAGL0M02519g Chr13 complement(290723..292993) [2271 bp, 756 aa]
           {ON} highly similar to uniprot|Q03002 Saccharomyces
           cerevisiae YPL141c or uniprot|Q01919 Saccharomyces
           cerevisiae YOR233w KIN4
          Length = 756

 Score = 75.9 bits (185), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 39/92 (42%), Positives = 56/92 (60%), Gaps = 7/92 (7%)

Query: 11  PYHGFESDVWSCGIILFALLTGRLPFDEE----DG-NIRNLLLKVQSGQFEMPDSDEISP 65
           PY   ++D WSCGIILFA+L G LP+D++    DG +I  L   + +   + P+   I+P
Sbjct: 244 PYDARKADTWSCGIILFAMLAGYLPWDDDPKNPDGHDISRLYNYILNTPLKFPEY--INP 301

Query: 66  EAQDLIAKILTVDPAARIKSREILKHPLLQKY 97
             +DL+ KIL +DP  RI  R I KHP L+ +
Sbjct: 302 VPRDLLRKILVIDPKKRINIRSIEKHPWLESH 333

>Kwal_56.23717 s56 complement(674222..676798) [2577 bp, 858 aa] {ON}
           YDR122W (KIN1) - Serine/threonine protein kinase [contig
           174] PARTIAL
          Length = 858

 Score = 75.5 bits (184), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 35/93 (37%), Positives = 59/93 (63%), Gaps = 7/93 (7%)

Query: 4   LRSCPVLPYHGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDEI 63
           L++CP   Y G E DVWS G++LF L+ G++PFD+E+ ++  L  K++ G+ E P    +
Sbjct: 104 LKACP---YTGPEVDVWSFGVVLFVLVCGKVPFDDENSSV--LHEKIKQGKVEYP--QHL 156

Query: 64  SPEAQDLIAKILTVDPAARIKSREILKHPLLQK 96
           S E   L++K+L VDP  R   ++++ H  +Q+
Sbjct: 157 SIEVISLLSKMLVVDPTKRASLKQVVNHQWMQR 189

>CAGL0M11396g Chr13 (1122109..1125687) [3579 bp, 1192 aa] {ON}
           similar to uniprot|P13186 Saccharomyces cerevisiae
           YLR096w KIN2 ser/thr protein kinase
          Length = 1192

 Score = 75.5 bits (184), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 57/86 (66%), Gaps = 4/86 (4%)

Query: 11  PYHGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDEISPEAQDL 70
           PY G E DVWS G++L+ L+ G++PFD+E+ ++  L  K++ G+ E P    +S E   L
Sbjct: 307 PYTGPEVDVWSFGVVLYVLVCGKVPFDDENSSV--LHEKIKRGKVEYP--QHLSIEVMSL 362

Query: 71  IAKILTVDPAARIKSREILKHPLLQK 96
           ++K+L VDP+ R   +++++HP + K
Sbjct: 363 LSKMLVVDPSRRASLKQVVEHPWMTK 388

>TPHA0G01710 Chr7 complement(350452..352869) [2418 bp, 805 aa] {ON}
           Anc_8.654 YPL141C
          Length = 805

 Score = 75.1 bits (183), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 38/89 (42%), Positives = 53/89 (59%), Gaps = 7/89 (7%)

Query: 11  PYHGFESDVWSCGIILFALLTGRLPFDEE----DG-NIRNLLLKVQSGQFEMPDSDEISP 65
           PY   ++DVWSCGIIL+A+L G LP+D++    DG +I  L L +     + P  + I+P
Sbjct: 221 PYEARKADVWSCGIILYAMLAGYLPWDDDPQNPDGDDIAKLYLYITKTALKFP--EYINP 278

Query: 66  EAQDLIAKILTVDPAARIKSREILKHPLL 94
             +DL+ KIL  DP  R+  R I KH  L
Sbjct: 279 IQRDLLRKILVSDPTKRLNIRNIEKHEWL 307

>ZYRO0F06842g Chr6 (561269..563800) [2532 bp, 843 aa] {ON} similar
           to Saccharomyces cerevisiae YPL141C and to YOR233W
           uniprot|Q01919 Saccharomyces cerevisiae YOR233W KIN4
           Nonessential protein kinase with unknown cellular role
          Length = 843

 Score = 73.9 bits (180), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 38/92 (41%), Positives = 55/92 (59%), Gaps = 7/92 (7%)

Query: 11  PYHGFESDVWSCGIILFALLTGRLPFDEE----DGN-IRNLLLKVQSGQFEMPDSDEISP 65
           PY   +SDVWSCG+IL+A+L G LP+D++    DGN I  L   +     + P  + I+P
Sbjct: 221 PYEARKSDVWSCGVILYAMLAGYLPWDDDPKNPDGNDIVRLYYYITRTPLKFP--EYITP 278

Query: 66  EAQDLIAKILTVDPAARIKSREILKHPLLQKY 97
            ++DL+ +IL  DP  RI  R I KH  L+ +
Sbjct: 279 LSRDLLRRILVSDPKKRITLRSIHKHEWLKPH 310

>NDAI0E01290 Chr5 complement(255593..257782) [2190 bp, 729 aa] {ON}
           Anc_8.654
          Length = 729

 Score = 73.9 bits (180), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 39/95 (41%), Positives = 53/95 (55%), Gaps = 7/95 (7%)

Query: 11  PYHGFESDVWSCGIILFALLTGRLPFDEEDGN-----IRNLLLKVQSGQFEMPDSDEISP 65
           PY   + D+WSCGIIL+A+L G LP+D++  N     I  L   +     + P    ISP
Sbjct: 230 PYRARKVDIWSCGIILYAMLAGYLPWDDDSQNPNGDDIGKLYQYITKTALKFP--AYISP 287

Query: 66  EAQDLIAKILTVDPAARIKSREILKHPLLQKYPSI 100
            A+DLI KILT +P+ RI    I KH  L+ + S 
Sbjct: 288 LARDLIRKILTANPSRRISISYICKHDWLKPHASF 322

>KLTH0G13288g Chr7 complement(1139058..1142486) [3429 bp, 1142 aa]
           {ON} similar to uniprot|P13186 Saccharomyces cerevisiae
           YLR096W KIN2 Serine/threonine protein kinase involved in
           regulation of exocytosis localizes to the cytoplasmic
           face of the plasma membrane closely related to Kin1p and
           to YDR122W uniprot|P13185 Saccharomyces cerevisiae
           YDR122W KIN1 Serine/threonine protein kinase involved in
           regulation of exocytosis; localizes to the cytoplasmic
           face of the plasma membrane; closely related to Kin2p
          Length = 1142

 Score = 73.6 bits (179), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 34/93 (36%), Positives = 60/93 (64%), Gaps = 7/93 (7%)

Query: 4   LRSCPVLPYHGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDEI 63
           L++CP   Y G E DVWS G++L+ L+ G++PFD+E+ ++  L  K++ G+ E P    +
Sbjct: 379 LKACP---YTGPEVDVWSFGVVLYVLVCGKVPFDDENSSV--LHEKIKQGKVEYP--QHL 431

Query: 64  SPEAQDLIAKILTVDPAARIKSREILKHPLLQK 96
           S E   L++K+L VDP+ R   ++++ H  +Q+
Sbjct: 432 SIEVISLLSKMLVVDPSKRATLKQVVNHQWMQR 464

>SAKL0H06754g Chr8 (594995..597649) [2655 bp, 884 aa] {ON} similar
           to uniprot|Q12152 Saccharomyces cerevisiae YPL150W
           Hypothetical ORF
          Length = 884

 Score = 73.2 bits (178), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 33/88 (37%), Positives = 54/88 (61%), Gaps = 3/88 (3%)

Query: 12  YHGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDEISPEAQDLI 71
           Y GF+ D+WS G+IL+ ++ G +PFDEED       +  +   +   + D +S +A+DLI
Sbjct: 204 YDGFKIDIWSLGVILYTMIHGTMPFDEEDETKTKWKIINEEPFY---NDDVVSKDAKDLI 260

Query: 72  AKILTVDPAARIKSREILKHPLLQKYPS 99
           +++L  DP+ R +  ++L HP LQ Y S
Sbjct: 261 SQLLCKDPSQRPQLSQVLAHPFLQPYGS 288

>TDEL0A06140 Chr1 complement(1074016..1076601) [2586 bp, 861 aa]
           {ON} Anc_8.668 YPL150W
          Length = 861

 Score = 72.8 bits (177), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 36/88 (40%), Positives = 55/88 (62%), Gaps = 7/88 (7%)

Query: 12  YHGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDE--ISPEAQD 69
           Y GF+ D+W+ G+IL+ ++ G +PFDE+D        K+ +   EMP+ +E  +SP+A+D
Sbjct: 204 YDGFKIDIWALGVILYTMINGSMPFDEDDEA--KTKWKIVN---EMPEINEDLVSPDAKD 258

Query: 70  LIAKILTVDPAARIKSREILKHPLLQKY 97
           LI ++L  DP  R    +IL HP LQ Y
Sbjct: 259 LIEQLLAKDPNERPSIEKILTHPFLQPY 286

>TBLA0B03970 Chr2 complement(904167..907793) [3627 bp, 1208 aa] {ON}
           Anc_8.654 YPL141C
          Length = 1208

 Score = 73.2 bits (178), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 38/89 (42%), Positives = 53/89 (59%), Gaps = 7/89 (7%)

Query: 11  PYHGFESDVWSCGIILFALLTGRLPFDEE----DGN-IRNLLLKVQSGQFEMPDSDEISP 65
           PY   ++D+WSCGIILFA+L G LP+D++    DGN I  L   + +   + P  + ISP
Sbjct: 254 PYEARKADIWSCGIILFAMLAGYLPWDDDPKNPDGNDIAKLYKYITTTPLKFP--EYISP 311

Query: 66  EAQDLIAKILTVDPAARIKSREILKHPLL 94
            A+DL+  IL   P  R   ++ILKH  L
Sbjct: 312 MARDLLRNILIPYPQKRATLKQILKHQWL 340

>KAFR0H02540 Chr8 complement(483399..485852) [2454 bp, 817 aa] {ON}
           Anc_8.654 YPL141C
          Length = 817

 Score = 72.8 bits (177), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 41/118 (34%), Positives = 62/118 (52%), Gaps = 18/118 (15%)

Query: 11  PYHGFESDVWSCGIILFALLTGRLPFDEE-----DGNIRNLLLKVQSGQFEMPDSDEISP 65
           PY   + D+WSCGIILFA+L G LP+D++       NI  L   + +   + P  + I+ 
Sbjct: 262 PYEARKVDIWSCGIILFAMLAGYLPWDDDPENPSGENIAKLYFYITTTPLKFP--EYITA 319

Query: 66  EAQDLIAKILTVDPAARIKSREILKHPLL-----------QKYPSIKDSKSIRNLPRE 112
             +DL+ +IL  DP  R+  R ILKH  L           +++ +I  S+SI  LP+ 
Sbjct: 320 IPRDLLRRILIADPKKRVDLRYILKHQWLKPHTPFLSISPEEWDNISRSQSILRLPKH 377

>YPL150W Chr16 (268188..270893) [2706 bp, 901 aa] {ON} Protein
           kinase of unknown cellular role; binds
           phosphatidylinositols and cardiolipin in a large-scale
           study
          Length = 901

 Score = 72.8 bits (177), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 35/101 (34%), Positives = 61/101 (60%), Gaps = 3/101 (2%)

Query: 12  YHGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDEISPEAQDLI 71
           Y GF+ D+WS G+IL+ L+TG LPFD++D       +  +  ++   D+  I  +A+DLI
Sbjct: 208 YDGFKIDIWSLGVILYTLITGYLPFDDDDEAKTKWKIVNEEPKY---DAKVIPDDARDLI 264

Query: 72  AKILTVDPAARIKSREILKHPLLQKYPSIKDSKSIRNLPRE 112
           +++L  +P  R    ++L+HP LQ Y S+   ++ + L R+
Sbjct: 265 SRLLAKNPGERPSLSQVLRHPFLQPYGSVVLDQTQKILCRQ 305

>Kwal_56.22476 s56 complement(145039..147132) [2094 bp, 697 aa] {ON}
           YMR001C (CDC5) - protein kinase which functions at the
           G(sub)2/M boundary [contig 185] FULL
          Length = 697

 Score = 72.4 bits (176), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 36/99 (36%), Positives = 58/99 (58%), Gaps = 3/99 (3%)

Query: 13  HGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDEISPEAQDLIA 72
           H +E D+WSCG++++ALL G+ PF  ++ NI  +  +++ G F  P    ISPEA  LI 
Sbjct: 255 HSYEVDIWSCGVMIYALLIGKPPFQAKEVNI--IYERIKCGDFVFPKDKFISPEALVLIK 312

Query: 73  KILTVDPAARIKSREILKHPLLQK-YPSIKDSKSIRNLP 110
            IL++DP  R    EI+ +   +  +PS  D+  + + P
Sbjct: 313 DILSIDPLERPSLDEIIDYVWFRGLFPSRIDASVLTSAP 351

>SAKL0H16632g Chr8 complement(1461613..1464801) [3189 bp, 1062 aa]
           {ON} similar to uniprot|P13186 Saccharomyces cerevisiae
           YLR096W KIN2 Serine/threonine protein kinase involved in
           regulation of exocytosis localizes to the cytoplasmic
           face of the plasma membrane closely related to Kin1p and
           to YDR122W uniprot|P13185 Saccharomyces cerevisiae
           YDR122W KIN1 Serine/threonine protein kinase involved in
           regulation of exocytosis; localizes to the cytoplasmic
           face of the plasma membrane; closely related to Kin2p
          Length = 1062

 Score = 72.4 bits (176), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 56/86 (65%), Gaps = 4/86 (4%)

Query: 11  PYHGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDEISPEAQDL 70
           PY G E DVWS G++L+ L+ G++PFD+E+ ++  L  K++ G+ E P    +S E   L
Sbjct: 278 PYIGPEVDVWSFGVVLYVLVCGKVPFDDENASV--LHEKIKQGKVEYP--QHLSIEVISL 333

Query: 71  IAKILTVDPAARIKSREILKHPLLQK 96
           ++K+L VDP+ R   ++++ H  +Q+
Sbjct: 334 LSKMLVVDPSKRATLKQVVSHQWMQR 359

>Smik_6.347 Chr6 complement(553316..556069) [2754 bp, 917 aa] {ON}
           YPL150W (REAL)
          Length = 917

 Score = 72.4 bits (176), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 55/89 (61%), Gaps = 3/89 (3%)

Query: 12  YHGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDEISPEAQDLI 71
           Y GF+ D+WS G+IL+ L+TG LPFD++D       +  +  ++   DS  I  +A+DLI
Sbjct: 208 YDGFKIDIWSLGVILYTLITGYLPFDDDDEVKTKWKIVNEEPKY---DSKFIPDDAKDLI 264

Query: 72  AKILTVDPAARIKSREILKHPLLQKYPSI 100
           +++L  +P  R    ++L+HP LQ Y S+
Sbjct: 265 SRLLAKNPGERPSLPQVLRHPFLQPYGSV 293

>NCAS0B05090 Chr2 (946126..949758) [3633 bp, 1210 aa] {ON} 
          Length = 1210

 Score = 72.4 bits (176), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 59/91 (64%), Gaps = 7/91 (7%)

Query: 11  PYHGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDEISPEAQDL 70
           PY G E DVWS G++L+ L+ G++PFD+E+ ++  L  K++ G+ + P  + +S E   L
Sbjct: 361 PYTGPEVDVWSFGVVLYVLVCGKVPFDDENSSV--LHEKIKQGKVDYP--NHLSIEVISL 416

Query: 71  IAKILTVDPAARIKSREILKHPLLQK---YP 98
           ++K+L VDP  R   +++++HP + +   YP
Sbjct: 417 LSKMLVVDPLRRASLKQVVEHPWMTRGYDYP 447

>CAGL0F00649g Chr6 (71961..73505) [1545 bp, 514 aa] {ON} similar to
           uniprot|P38623 Saccharomyces cerevisiae YLR248w RCK2
           Ca/calmodulin-dependent or uniprot|P38622 Saccharomyces
           cerevisiae YGL158w RCK1
          Length = 514

 Score = 71.2 bits (173), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 52/87 (59%), Gaps = 2/87 (2%)

Query: 13  HGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEM--PDSDEISPEAQDL 70
           + ++ D+W+ G IL+ +L G  PF E++ +  +L  K+  G ++   P  DEIS EAQDL
Sbjct: 298 YSYKVDIWAIGCILYTMLCGFPPFYEDEFSKESLGDKISRGNYKFLAPWWDEISIEAQDL 357

Query: 71  IAKILTVDPAARIKSREILKHPLLQKY 97
           I  +L VDPA R    ++L HP L  Y
Sbjct: 358 IRNLLQVDPAKRYDIDQLLAHPWLNHY 384

>KNAG0G02110 Chr7 (477260..480838) [3579 bp, 1192 aa] {ON} Anc_8.279
           YLR096W
          Length = 1192

 Score = 71.6 bits (174), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 55/86 (63%), Gaps = 4/86 (4%)

Query: 11  PYHGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDEISPEAQDL 70
           PY G E DVWS G++L+ L+ G++PFD+E  ++  L  K++ G  E P  + +S E   L
Sbjct: 308 PYLGPEVDVWSFGVVLYVLVCGKVPFDDEVSSV--LHEKIKQGNVEYP--NHLSIEVLSL 363

Query: 71  IAKILTVDPAARIKSREILKHPLLQK 96
           ++K+L VDP  R   +++++HP + +
Sbjct: 364 LSKMLVVDPERRASLKQVIEHPWMNR 389

>ACR133C Chr3 complement(581468..584023) [2556 bp, 851 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL150W
          Length = 851

 Score = 71.2 bits (173), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 56/89 (62%), Gaps = 3/89 (3%)

Query: 12  YHGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDEISPEAQDLI 71
           Y G++ D WS GIIL+ +L G +PFDE+D  +R   LK+   +  + D +  SP+A+DLI
Sbjct: 204 YDGYKVDTWSLGIILYTMLHGYMPFDEDD-TVRT-GLKIMHEEPAVLD-EYTSPQAKDLI 260

Query: 72  AKILTVDPAARIKSREILKHPLLQKYPSI 100
            ++L  + A R    E+L+HP LQ Y ++
Sbjct: 261 VRLLDKNAAQRPNLNEVLQHPFLQPYGAL 289

>Ecym_4291 Chr4 complement(620549..623986) [3438 bp, 1145 aa] {ON}
           similar to Ashbya gossypii AGR058W
          Length = 1145

 Score = 71.6 bits (174), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 55/86 (63%), Gaps = 4/86 (4%)

Query: 11  PYHGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDEISPEAQDL 70
           PY G E D+WS G++L+ L+ G++PFD+E+ ++  L  K++ G+ E P    +S +   L
Sbjct: 316 PYTGPEVDIWSFGVVLYVLVCGKVPFDDENASV--LHEKIKQGKVEYP--QHLSIDVISL 371

Query: 71  IAKILTVDPAARIKSREILKHPLLQK 96
           ++K+L VDP  R   ++++ H  +QK
Sbjct: 372 LSKMLVVDPLKRATLKQVVNHQWMQK 397

>NCAS0D02100 Chr4 (385878..388058) [2181 bp, 726 aa] {ON} Anc_6.31
          Length = 726

 Score = 71.2 bits (173), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 32/77 (41%), Positives = 49/77 (63%), Gaps = 2/77 (2%)

Query: 13  HGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDEISPEAQDLIA 72
           H FE D+WS G++++ALL G+ PF  +D N+  +  ++++ Q+  P    +S EA+ LIA
Sbjct: 268 HSFEVDIWSIGVMIYALLVGKPPFQAKDVNV--IYDRIKACQYGYPKDKYVSSEAKTLIA 325

Query: 73  KILTVDPAARIKSREIL 89
            IL VDP  R   REI+
Sbjct: 326 DILCVDPVERPSIREII 342

>Suva_16.169 Chr16 complement(292738..295314) [2577 bp, 858 aa] {ON}
           YPL141C (REAL)
          Length = 858

 Score = 71.2 bits (173), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 36/95 (37%), Positives = 54/95 (56%), Gaps = 7/95 (7%)

Query: 11  PYHGFESDVWSCGIILFALLTGRLPFDE-----EDGNIRNLLLKVQSGQFEMPDSDEISP 65
           PY   ++D+WSCG+IL+A+L G LP+D+     E  +I  L   + S   + P  D I P
Sbjct: 227 PYEARKADIWSCGVILYAMLAGYLPWDDDPNNPEGSDIGRLYNYICSTPLKFP--DYILP 284

Query: 66  EAQDLIAKILTVDPAARIKSREILKHPLLQKYPSI 100
             +DL+ +IL  DP  RI  ++I KH  L+ + S 
Sbjct: 285 IPRDLLRRILVSDPKRRINLKQIEKHGWLKSHSSF 319

>Smik_4.367 Chr4 (655941..659141) [3201 bp, 1066 aa] {ON} YDR122W
           (REAL)
          Length = 1066

 Score = 71.2 bits (173), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 32/81 (39%), Positives = 53/81 (65%), Gaps = 4/81 (4%)

Query: 11  PYHGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDEISPEAQDL 70
           PY G E DVWS G++LF L+ G++PFD+E+ ++  L  K++ G+ E P    +S E   L
Sbjct: 317 PYTGPEVDVWSFGVVLFVLVCGKVPFDDENSSV--LHEKIKQGKVEYP--QHLSIEVISL 372

Query: 71  IAKILTVDPAARIKSREILKH 91
           ++K+L VDP  R   +++++H
Sbjct: 373 LSKMLVVDPKRRATLKQVVEH 393

>AGR058W Chr7 (823626..826841) [3216 bp, 1071 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR096W (KIN2) and
           YDR122W (KIN1)
          Length = 1071

 Score = 71.2 bits (173), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 55/86 (63%), Gaps = 4/86 (4%)

Query: 11  PYHGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDEISPEAQDL 70
           PY G E D+WS G++L+ L+ G++PFD+E+ ++  L  K++ G+ E P    +S +   L
Sbjct: 255 PYTGPEVDIWSFGVVLYVLVCGKVPFDDENASV--LHEKIKQGKVEYP--QHLSIDVISL 310

Query: 71  IAKILTVDPAARIKSREILKHPLLQK 96
           ++K+L VDP  R   ++++ H  +QK
Sbjct: 311 LSKMLVVDPYKRATLKQVVHHQWMQK 336

>Kwal_26.8709 s26 (907885..910374) [2490 bp, 829 aa] {ON} YPL141C -
           Hypothetical ORF [contig 67] FULL
          Length = 829

 Score = 70.9 bits (172), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 37/92 (40%), Positives = 54/92 (58%), Gaps = 7/92 (7%)

Query: 11  PYHGFESDVWSCGIILFALLTGRLPFDEE----DG-NIRNLLLKVQSGQFEMPDSDEISP 65
           PY   ++DVWSCG+IL+A+L G LP+D++    DG +I  L   +     + P  D I+P
Sbjct: 222 PYEARKADVWSCGVILYAMLAGYLPWDDDPENPDGDDIGKLYRYITRTPLKFP--DYIAP 279

Query: 66  EAQDLIAKILTVDPAARIKSREILKHPLLQKY 97
             +DL+ +IL  DP  RI   + LKH  LQ +
Sbjct: 280 VPRDLLREILIPDPKRRITISKTLKHQWLQPH 311

>KAFR0B02800 Chr2 (571295..574582) [3288 bp, 1095 aa] {ON} Anc_8.279
           YLR096W
          Length = 1095

 Score = 70.9 bits (172), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 31/84 (36%), Positives = 55/84 (65%), Gaps = 4/84 (4%)

Query: 11  PYHGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDEISPEAQDL 70
           PY G E D+WS G++L+ L+ G++PFD+E+ ++  L  K++ G+ E P  + +S E   L
Sbjct: 300 PYIGPEVDIWSFGVVLYVLVCGKVPFDDENSSV--LHEKIKQGKVEYP--NHLSIEVISL 355

Query: 71  IAKILTVDPAARIKSREILKHPLL 94
           ++K+L VDP  R    ++++HP +
Sbjct: 356 LSKMLVVDPLKRANLTKVIEHPWM 379

>NCAS0C01590 Chr3 (293327..295921) [2595 bp, 864 aa] {ON} Anc_8.654
          Length = 864

 Score = 70.9 bits (172), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 53/92 (57%), Gaps = 7/92 (7%)

Query: 11  PYHGFESDVWSCGIILFALLTGRLPFDEEDGN-----IRNLLLKVQSGQFEMPDSDEISP 65
           PY   ++D+WSCG+IL+A+L G LP+D++ GN     I  L   +     + P  D I+P
Sbjct: 234 PYEAKKADIWSCGVILYAMLAGYLPWDDDAGNPDGDDISRLYHYITQTPLKFP--DYINP 291

Query: 66  EAQDLIAKILTVDPAARIKSREILKHPLLQKY 97
             +DL+ +IL  DP  RI  + I KH  L+ +
Sbjct: 292 IPRDLLRRILISDPRRRITIKYIEKHEWLKPH 323

>KNAG0J01670 Chr10 complement(304021..307050) [3030 bp, 1009 aa]
           {ON} 
          Length = 1009

 Score = 70.9 bits (172), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 33/87 (37%), Positives = 52/87 (59%), Gaps = 3/87 (3%)

Query: 11  PYHGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDEISPEAQDL 70
           PY GF+ D+WS G+IL+ +L+G +PFDE+D       +  +  ++   +S  ++ E +DL
Sbjct: 212 PYDGFKIDIWSLGVILYTMLSGSMPFDEDDEAKTKWKIINEEPEY---NSKFMTAEGEDL 268

Query: 71  IAKILTVDPAARIKSREILKHPLLQKY 97
           + K+L  D   R   REIL+H  LQ Y
Sbjct: 269 VRKLLQKDSNLRPSVREILQHEFLQPY 295

>TPHA0D01140 Chr4 (238656..240524) [1869 bp, 622 aa] {ON} Anc_8.654
           YPL141C
          Length = 622

 Score = 70.5 bits (171), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 31/91 (34%), Positives = 56/91 (61%), Gaps = 7/91 (7%)

Query: 9   VLPYHGFESDVWSCGIILFALLTGRLPFDEEDGNIRN-----LLLKVQSGQFEMPDSDEI 63
           V PY+  ++D+WSCG+IL+A+L G LP+D++  NI       L   +++   + P+   +
Sbjct: 251 VEPYNARKADIWSCGVILYAMLAGYLPWDDDPKNINGTDIVKLYKYIENQPLKFPEYINM 310

Query: 64  SPEAQDLIAKILTVDPAARIKSREILKHPLL 94
            P  +DL+ ++L +DPA R+  + IL+H  +
Sbjct: 311 VP--RDLLRRMLEIDPAKRMSMKHILQHAWI 339

>YPL141C Chr16 complement(283464..286061) [2598 bp, 865 aa] {ON}
           FRK1Protein kinase of unknown cellular role; similar to
           Kin4p; green fluorescent protein (GFP)-fusion protein
           localizes to the cytoplasm; interacts with rRNA
           transcription and ribosome biogenesis factors and the
           long chain fatty acyl-CoA synthetase Faa3
          Length = 865

 Score = 70.5 bits (171), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 35/95 (36%), Positives = 54/95 (56%), Gaps = 7/95 (7%)

Query: 11  PYHGFESDVWSCGIILFALLTGRLPFDE-----EDGNIRNLLLKVQSGQFEMPDSDEISP 65
           PY   ++D+WSCG+IL+A+L G LP+D+     E  +I  L   + S   + P  D I P
Sbjct: 227 PYEARKADIWSCGVILYAILAGYLPWDDDPNNPEGSDIGRLYNYINSTPLKFP--DYILP 284

Query: 66  EAQDLIAKILTVDPAARIKSREILKHPLLQKYPSI 100
             +DL+ ++L  DP  RI  ++I KH  L+ + S 
Sbjct: 285 IPRDLLRRMLVSDPKKRINLKQIKKHEWLKPHSSF 319

>TPHA0J00420 Chr10 complement(96445..98568) [2124 bp, 707 aa] {ON}
           Anc_6.31 YMR001C
          Length = 707

 Score = 70.5 bits (171), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 66/121 (54%), Gaps = 11/121 (9%)

Query: 13  HGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDEISPEAQDLIA 72
           H +E D+WS G++L+ALL G+ PF  +D N   +  +++   F  P    ISPEA+ LI 
Sbjct: 259 HSYEVDIWSIGVMLYALLIGKPPFQSKDVN--TIYERIKCCDFTFPKDKYISPEAKILIQ 316

Query: 73  KILTVDPAARIKSREILKHPLLQK-YPSIKDSKSIRNLPREDTYLNPLDSVNGSIDESII 131
            +L++DP  R    EI+ +   +  +P   +S  + N+P  D  L        ++++SI+
Sbjct: 317 DLLSLDPLERPSVDEIIDYVWFRGLFPPQIESDVMTNIPNYDNQL--------TMEQSIV 368

Query: 132 N 132
           N
Sbjct: 369 N 369

>CAGL0M08910g Chr13 complement(887703..889541) [1839 bp, 612 aa]
           {ON}
          Length = 612

 Score = 70.1 bits (170), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 50/79 (63%), Gaps = 4/79 (5%)

Query: 12  YHGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDEISPEAQDLI 71
           Y G E DVWSCG+IL+ +L  RLPFD+E  +I  L   + +G + +P    +SP A DLI
Sbjct: 212 YAGPEVDVWSCGVILYVMLCRRLPFDDE--SIPVLFKNISNGVYTLPKF--LSPGASDLI 267

Query: 72  AKILTVDPAARIKSREILK 90
            ++L V+P  RI   EI++
Sbjct: 268 KRMLIVNPLNRISIHEIMQ 286

>Suva_2.283 Chr2 (489490..492759) [3270 bp, 1089 aa] {ON} YDR122W
           (REAL)
          Length = 1089

 Score = 70.5 bits (171), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 32/81 (39%), Positives = 53/81 (65%), Gaps = 4/81 (4%)

Query: 11  PYHGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDEISPEAQDL 70
           PY G E DVWS G++LF L+ G++PFD+E+ ++  L  K++ G+ E P    +S E   L
Sbjct: 330 PYTGPEVDVWSFGVVLFVLVCGKVPFDDENSSV--LHEKIKQGKVEYP--QHLSIEVISL 385

Query: 71  IAKILTVDPAARIKSREILKH 91
           ++K+L VDP  R   +++++H
Sbjct: 386 LSKMLVVDPKRRATLKQVVEH 406

>YDR122W Chr4 (694700..697894) [3195 bp, 1064 aa] {ON}
           KIN1Serine/threonine protein kinase involved in
           regulation of exocytosis; localizes to the cytoplasmic
           face of the plasma membrane; closely related to Kin2p
          Length = 1064

 Score = 70.5 bits (171), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 32/81 (39%), Positives = 53/81 (65%), Gaps = 4/81 (4%)

Query: 11  PYHGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDEISPEAQDL 70
           PY G E DVWS G++LF L+ G++PFD+E+ ++  L  K++ G+ E P    +S E   L
Sbjct: 319 PYTGPEVDVWSFGVVLFVLVCGKVPFDDENSSV--LHEKIKQGKVEYP--QHLSIEVISL 374

Query: 71  IAKILTVDPAARIKSREILKH 91
           ++K+L VDP  R   +++++H
Sbjct: 375 LSKMLVVDPKRRATLKQVVEH 395

>Smik_12.155 Chr12 (312480..315968) [3489 bp, 1162 aa] {ON} YLR096W
           (REAL)
          Length = 1162

 Score = 70.5 bits (171), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 54/86 (62%), Gaps = 4/86 (4%)

Query: 11  PYHGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDEISPEAQDL 70
           PY G E D+WS GI+L+ L+ G++PFD+E+ +I  L  K++ G+ + P    +S EA  L
Sbjct: 306 PYTGPEVDIWSFGIVLYVLVCGKVPFDDENSSI--LHEKIKKGKVDYP--SHLSIEAISL 361

Query: 71  IAKILTVDPAARIKSREILKHPLLQK 96
           + K++ VDP  R   + ++ HP + +
Sbjct: 362 LTKMIVVDPLRRATLKTVVDHPWMNR 387

>Skud_4.383 Chr4 (666354..669551) [3198 bp, 1065 aa] {ON} YDR122W
           (REAL)
          Length = 1065

 Score = 70.5 bits (171), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 32/81 (39%), Positives = 53/81 (65%), Gaps = 4/81 (4%)

Query: 11  PYHGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDEISPEAQDL 70
           PY G E DVWS G++LF L+ G++PFD+E+ ++  L  K++ G+ E P    +S E   L
Sbjct: 317 PYTGPEVDVWSFGVVLFVLVCGKVPFDDENSSV--LHEKIKQGKVEYP--QHLSIEVISL 372

Query: 71  IAKILTVDPAARIKSREILKH 91
           ++K+L VDP  R   +++++H
Sbjct: 373 LSKMLVVDPKRRATLKQVVEH 393

>KLLA0F11319g Chr6 (1042436..1044967) [2532 bp, 843 aa] {ON} similar
           to uniprot|Q12152 Saccharomyces cerevisiae YPL150W
           Hypothetical ORF
          Length = 843

 Score = 70.1 bits (170), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 38/108 (35%), Positives = 64/108 (59%), Gaps = 7/108 (6%)

Query: 5   RSCPVLPYHGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDEIS 64
           R C    Y GF+ D+WS GIIL+ ++ G +PFDE+D +I+   LK+ + + +  + + IS
Sbjct: 201 RKC----YDGFKVDIWSLGIILYTMINGYMPFDEDD-DIKT-KLKIVNDELDF-NQEWIS 253

Query: 65  PEAQDLIAKILTVDPAARIKSREILKHPLLQKYPSIKDSKSIRNLPRE 112
            +A DLI  +L  +P  RI   ++L HP LQ +  +   K+ + L ++
Sbjct: 254 DDAIDLIQGMLRKNPNERISLAQVLSHPFLQPWGVVAKEKTDKVLLKQ 301

>NCAS0C01670 Chr3 complement(306682..309372) [2691 bp, 896 aa] {ON}
           Anc_8.668
          Length = 896

 Score = 70.1 bits (170), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 32/88 (36%), Positives = 53/88 (60%), Gaps = 3/88 (3%)

Query: 12  YHGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDEISPEAQDLI 71
           Y GF+ D+WS G+IL+ ++ G +PFDE+D       +  Q+ Q    + + ++ +A+DLI
Sbjct: 205 YDGFKIDIWSLGVILYTMINGSMPFDEDDETKTEWKIVHQTPQL---NENIVTADAKDLI 261

Query: 72  AKILTVDPAARIKSREILKHPLLQKYPS 99
            ++L  +P  R    +ILKHP LQ + S
Sbjct: 262 LRLLAKNPNDRPTVEQILKHPFLQPFGS 289

>ZYRO0F07194g Chr6 complement(581438..584254) [2817 bp, 938 aa] {ON}
           similar to uniprot|Q12152 Saccharomyces cerevisiae
           YPL150W Hypothetical ORF
          Length = 938

 Score = 70.1 bits (170), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 35/101 (34%), Positives = 57/101 (56%), Gaps = 3/101 (2%)

Query: 12  YHGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDEISPEAQDLI 71
           Y GF+ D+WS G+IL+ ++ G +PFDE+D       +      F   + + +S EA+DLI
Sbjct: 204 YDGFKIDIWSLGVILYTMINGTMPFDEDDETKTKWKI---VNDFPNFNDNFVSHEAKDLI 260

Query: 72  AKILTVDPAARIKSREILKHPLLQKYPSIKDSKSIRNLPRE 112
            ++L   P+ R    +IL HP LQ Y  I  S++ + + R+
Sbjct: 261 KRLLAKCPSERPTMEQILSHPFLQPYGQIMLSRTEKIIKRQ 301

>TPHA0J00820 Chr10 (193408..197064) [3657 bp, 1218 aa] {ON}
           Anc_8.279 YLR096W
          Length = 1218

 Score = 70.1 bits (170), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 54/86 (62%), Gaps = 4/86 (4%)

Query: 11  PYHGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDEISPEAQDL 70
           PY G E D+WS G++L+ L  G++PFD+E+ ++  L  K++ G+ + P    +S E   L
Sbjct: 353 PYVGPEVDIWSFGVVLYVLACGKVPFDDENSSV--LHEKIKQGKVDYP--QHLSIEVISL 408

Query: 71  IAKILTVDPAARIKSREILKHPLLQK 96
           ++K+L VDP  R   ++I+ HP + +
Sbjct: 409 LSKMLVVDPKKRASLQQIVNHPWMTR 434

>TDEL0A06000 Chr1 (1053427..1055799) [2373 bp, 790 aa] {ON}
           Anc_8.654 YPL141C
          Length = 790

 Score = 69.7 bits (169), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 54/92 (58%), Gaps = 7/92 (7%)

Query: 11  PYHGFESDVWSCGIILFALLTGRLPFDEE----DGN-IRNLLLKVQSGQFEMPDSDEISP 65
           PY   ++D+WSCG+IL+A+L G LP+D++    DGN I  L   +     + P  + I+P
Sbjct: 225 PYEARKADIWSCGVILYAMLAGYLPWDDDTKNPDGNDIGKLYQYITRTPLKFP--EYITP 282

Query: 66  EAQDLIAKILTVDPAARIKSREILKHPLLQKY 97
             +DL+ +IL  DP  RI  R I KH  ++ +
Sbjct: 283 LPRDLLRRILYPDPKRRISMRSIQKHEWVKPH 314

>Kpol_1072.29 s1072 complement(61987..64668) [2682 bp, 893 aa] {ON}
           complement(61987..64668) [2682 nt, 894 aa]
          Length = 893

 Score = 69.7 bits (169), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 33/90 (36%), Positives = 52/90 (57%), Gaps = 7/90 (7%)

Query: 11  PYHGFESDVWSCGIILFALLTGRLPFDE-----EDGNIRNLLLKVQSGQFEMPDSDEISP 65
           PY   ++D+WSCGIIL+A+L G LP+D+     E  +I  L   +     + P+   ISP
Sbjct: 226 PYEARKADIWSCGIILYAMLAGYLPWDDDPQNPEGDDIARLYYFITRTSLKFPEY--ISP 283

Query: 66  EAQDLIAKILTVDPAARIKSREILKHPLLQ 95
             +DL+ ++L  DP  R+  R+I +H  L+
Sbjct: 284 IPRDLLRRLLVSDPRKRLNIRQIQQHEWLR 313

>TBLA0C04600 Chr3 (1112043..1115990) [3948 bp, 1315 aa] {ON}
           Anc_8.279 YLR096W
          Length = 1315

 Score = 70.1 bits (170), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 53/81 (65%), Gaps = 4/81 (4%)

Query: 11  PYHGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDEISPEAQDL 70
           PY G E DVWS G++L+ L+ G++PFD+E+ ++  L  K++ G+ + P    +S E   L
Sbjct: 382 PYTGPEVDVWSFGVVLYVLVCGKVPFDDENSSV--LHEKIKQGKVDYP--QHLSIEVISL 437

Query: 71  IAKILTVDPAARIKSREILKH 91
           ++K+L VDP  R   R++++H
Sbjct: 438 LSKMLVVDPKKRATLRQVVEH 458

>KLLA0F19536g Chr6 (1808263..1811577) [3315 bp, 1104 aa] {ON}
           similar to uniprot|P13186 Saccharomyces cerevisiae
           YLR096W KIN2 Serine/threonine protein kinase involved in
           regulation of exocytosis localizes to the cytoplasmic
           face of the plasma membrane closely related to Kin1p and
           to YDR122W uniprot|P13185 Saccharomyces cerevisiae
           YDR122W KIN1 Serine/threonine protein kinase involved in
           regulation of exocytosis; localizes to the cytoplasmic
           face of the plasma membrane; closely related to Kin2p
          Length = 1104

 Score = 69.7 bits (169), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 30/86 (34%), Positives = 54/86 (62%), Gaps = 4/86 (4%)

Query: 11  PYHGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDEISPEAQDL 70
           PY G E D+WS G++++ L+ G++PFD+E+ ++  L  K++ G+ E P    +S E   L
Sbjct: 297 PYIGPEVDIWSFGVVIYVLVCGKVPFDDENASV--LHEKIKKGKVEYP--QHLSIECISL 352

Query: 71  IAKILTVDPAARIKSREILKHPLLQK 96
           ++K+L VDP  R   +++  H  +Q+
Sbjct: 353 LSKMLVVDPLKRASLKQVCNHQWMQR 378

>Skud_16.140 Chr16 complement(255090..257687) [2598 bp, 865 aa] {ON}
           YPL141C (REAL)
          Length = 865

 Score = 69.3 bits (168), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 34/92 (36%), Positives = 52/92 (56%), Gaps = 7/92 (7%)

Query: 11  PYHGFESDVWSCGIILFALLTGRLPFDEEDGN-----IRNLLLKVQSGQFEMPDSDEISP 65
           PY   ++D+WSCG+IL+A+L G LP+D++  N     I  L   + S   + P  D I P
Sbjct: 227 PYEARKADIWSCGVILYAMLAGYLPWDDDSNNPEGSDIGRLYNYINSTPLKFP--DYILP 284

Query: 66  EAQDLIAKILTVDPAARIKSREILKHPLLQKY 97
             +DL+ +IL  DP  R+  ++I KH  L  +
Sbjct: 285 IPRDLLRRILVPDPKKRMNLKQIKKHEWLNSH 316

>Skud_12.164 Chr12 (315700..319182) [3483 bp, 1160 aa] {ON} YLR096W
           (REAL)
          Length = 1160

 Score = 69.7 bits (169), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 30/86 (34%), Positives = 54/86 (62%), Gaps = 4/86 (4%)

Query: 11  PYHGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDEISPEAQDL 70
           PY G E D+WS GI+L+ L+ G++PFD+E+ +I  L  K++ G+ + P    +S EA  L
Sbjct: 305 PYTGPEVDIWSFGIVLYVLVCGKVPFDDENSSI--LHEKIKKGKVDYP--SHLSIEAISL 360

Query: 71  IAKILTVDPAARIKSREILKHPLLQK 96
           + +++ +DP  R   + ++ HP + +
Sbjct: 361 LTRMIVIDPLKRATLKNVVDHPWMNR 386

>Skud_16.132 Chr16 (239797..242571) [2775 bp, 924 aa] {ON} YPL150W
           (REAL)
          Length = 924

 Score = 69.3 bits (168), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 53/89 (59%), Gaps = 3/89 (3%)

Query: 12  YHGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDEISPEAQDLI 71
           Y GF+ D WS G+IL+ L+TG LPFD++D       +  +  ++   D   I  +A+DLI
Sbjct: 208 YDGFKIDTWSLGVILYTLITGSLPFDDDDEAKTKWKIVNEEPKY---DPKLIPDDAKDLI 264

Query: 72  AKILTVDPAARIKSREILKHPLLQKYPSI 100
           +++L  +P  R    ++L+HP LQ Y S+
Sbjct: 265 SRLLAKNPGERPSLPQVLRHPFLQPYGSV 293

>KLTH0D10714g Chr4 (880389..883007) [2619 bp, 872 aa] {ON} similar
           to uniprot|Q03002 Saccharomyces cerevisiae YPL141C
           Hypothetical ORF
          Length = 872

 Score = 69.3 bits (168), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 34/92 (36%), Positives = 52/92 (56%), Gaps = 7/92 (7%)

Query: 11  PYHGFESDVWSCGIILFALLTGRLPFDEE----DG-NIRNLLLKVQSGQFEMPDSDEISP 65
           PY   ++D+WSCG+I++A+L G LP+D++    DG +I  L   +     + P  D I+P
Sbjct: 222 PYEARKADIWSCGVIMYAMLAGYLPWDDDPENPDGDDIGKLYRYITRTPLKFP--DYIAP 279

Query: 66  EAQDLIAKILTVDPAARIKSREILKHPLLQKY 97
             +DL+  IL  DP  RI   + L H  LQ +
Sbjct: 280 VPRDLLRAILVADPKKRITIAQTLHHQWLQPH 311

>NDAI0J01250 Chr10 complement(291314..294844) [3531 bp, 1176 aa]
           {ON} 
          Length = 1176

 Score = 68.9 bits (167), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 37/101 (36%), Positives = 60/101 (59%), Gaps = 5/101 (4%)

Query: 11  PYHGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDEISPEAQDL 70
           PY G E DVWS G++L+ L+ G++PFD+E+ N+  L  K++ G+   P    +S E   L
Sbjct: 302 PYIGPEIDVWSFGVVLYVLVCGKVPFDDENSNV--LHEKIKQGRVFYPQF--LSIEVISL 357

Query: 71  IAKILTVDPAARIKSREILKHPLLQK-YPSIKDSKSIRNLP 110
           ++ +L VDP  R    +++KH  + K Y SI D+   + +P
Sbjct: 358 LSTMLVVDPFKRATLDQVMKHHWMVKDYDSIPDAHLPKRVP 398

>YLR096W Chr12 (332590..336033) [3444 bp, 1147 aa] {ON}
           KIN2Serine/threonine protein kinase involved in
           regulation of exocytosis; localizes to the cytoplasmic
           face of the plasma membrane; closely related to Kin1p
          Length = 1147

 Score = 68.9 bits (167), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 30/86 (34%), Positives = 54/86 (62%), Gaps = 4/86 (4%)

Query: 11  PYHGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDEISPEAQDL 70
           PY G E D+WS GI+L+ L+ G++PFD+E+ +I  L  K++ G+ + P    +S E   L
Sbjct: 298 PYTGPEVDIWSFGIVLYVLVCGKVPFDDENSSI--LHEKIKKGKVDYP--SHLSIEVISL 353

Query: 71  IAKILTVDPAARIKSREILKHPLLQK 96
           + +++ VDP  R   + +++HP + +
Sbjct: 354 LTRMIVVDPLRRATLKNVVEHPWMNR 379

>TDEL0F04060 Chr6 (749896..753276) [3381 bp, 1126 aa] {ON} Anc_8.279
           YLR096W
          Length = 1126

 Score = 68.6 bits (166), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 53/81 (65%), Gaps = 4/81 (4%)

Query: 11  PYHGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDEISPEAQDL 70
           PY G E DVWS G++L+ L+ G++PFD+E+ ++  L  K++ G+ E P    +S E   L
Sbjct: 277 PYTGPEVDVWSFGVVLYVLVCGKVPFDDENSSV--LHEKIKQGKVEYP--QHLSIEVISL 332

Query: 71  IAKILTVDPAARIKSREILKH 91
           ++K+L VDP  R   +++++H
Sbjct: 333 LSKMLVVDPHRRASLKQVVEH 353

>KAFR0A03730 Chr1 (761946..764312) [2367 bp, 788 aa] {ON} Anc_8.654
           YPL141C
          Length = 788

 Score = 68.2 bits (165), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 37/95 (38%), Positives = 52/95 (54%), Gaps = 7/95 (7%)

Query: 11  PYHGFESDVWSCGIILFALLTGRLPFDEEDGNIRN-----LLLKVQSGQFEMPDSDEISP 65
           PY   ++DVWSCGIILFA+L G LP+D++  N R      L   + +   + P    IS 
Sbjct: 215 PYKARKADVWSCGIILFAMLAGYLPWDDDPDNPRGDDIAKLYNYITTSPLKFPSY--ISA 272

Query: 66  EAQDLIAKILTVDPAARIKSREILKHPLLQKYPSI 100
             +DL+ KIL  +P  R+  REI  H  L+ + S 
Sbjct: 273 IPRDLLRKILVANPNQRLSLREIETHQWLKPHSSF 307

>Smik_6.339 Chr6 (538177..540774) [2598 bp, 865 aa] {ON} YPL141C
           (REAL)
          Length = 865

 Score = 68.2 bits (165), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 34/90 (37%), Positives = 51/90 (56%), Gaps = 7/90 (7%)

Query: 11  PYHGFESDVWSCGIILFALLTGRLPFDE-----EDGNIRNLLLKVQSGQFEMPDSDEISP 65
           PY   ++D+WSCG+IL+A+L G LP+D+     E  +I  L   +     + P  D I P
Sbjct: 227 PYEARKADIWSCGVILYAMLAGYLPWDDDPNNPEGSDIGRLYNYISLTPLKFP--DYILP 284

Query: 66  EAQDLIAKILTVDPAARIKSREILKHPLLQ 95
             +DL+ +IL  DP  RI  ++I KH  L+
Sbjct: 285 IPRDLLRRILVSDPKRRINLKQIKKHEWLK 314

>TPHA0C00470 Chr3 (81482..83377) [1896 bp, 631 aa] {ON} Anc_5.611
           YDR477W
          Length = 631

 Score = 67.8 bits (164), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 35/84 (41%), Positives = 51/84 (60%), Gaps = 4/84 (4%)

Query: 12  YHGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDEISPEAQDLI 71
           Y G E DVWSCG+IL+ LL  RLPFD+E  +I  L   + +G + +P+   +S  A  LI
Sbjct: 203 YAGPEVDVWSCGVILYVLLCRRLPFDDE--SIPTLFKNINNGVYTIPNF--LSEGAASLI 258

Query: 72  AKILTVDPAARIKSREILKHPLLQ 95
            K+L V+P  RI   +I++ P  +
Sbjct: 259 KKMLIVNPMNRITIGDIIQDPWFK 282

>Suva_2.651 Chr2 (1164264..1166165) [1902 bp, 633 aa] {ON} YDR477W
           (REAL)
          Length = 633

 Score = 67.8 bits (164), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 49/79 (62%), Gaps = 4/79 (5%)

Query: 12  YHGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDEISPEAQDLI 71
           Y G E DVWSCG+IL+ +L  RLPFD+E  +I  L   + +G + +P    +SP A  LI
Sbjct: 227 YAGPEVDVWSCGVILYVMLCRRLPFDDE--SIPVLFKNISNGVYSLPKF--LSPGAASLI 282

Query: 72  AKILTVDPAARIKSREILK 90
            ++L V+P  RI   EI++
Sbjct: 283 KRMLIVNPLNRISIHEIMQ 301

>Smik_4.754 Chr4 (1333667..1335565) [1899 bp, 632 aa] {ON} YDR477W
           (REAL)
          Length = 632

 Score = 67.8 bits (164), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 49/79 (62%), Gaps = 4/79 (5%)

Query: 12  YHGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDEISPEAQDLI 71
           Y G E DVWSCG+IL+ +L  RLPFD+E  +I  L   + +G + +P    +SP A  LI
Sbjct: 228 YAGPEVDVWSCGVILYVMLCRRLPFDDE--SIPVLFKNISNGVYTLPKF--LSPGAAGLI 283

Query: 72  AKILTVDPAARIKSREILK 90
            ++L V+P  RI   EI++
Sbjct: 284 KRMLIVNPLNRISIHEIMQ 302

>Suva_16.160 Chr16 (277393..280149) [2757 bp, 918 aa] {ON} YPL150W
           (REAL)
          Length = 918

 Score = 68.2 bits (165), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 38/103 (36%), Positives = 60/103 (58%), Gaps = 7/103 (6%)

Query: 12  YHGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMP--DSDEISPEAQD 69
           Y GF+ D+WS G+IL+ L+TG LPFD++D  ++     V     E P  DS  I  +A+D
Sbjct: 208 YDGFKIDIWSLGVILYTLITGSLPFDDDD-EVKTKWKIVN----EEPNYDSTLIPDDAKD 262

Query: 70  LIAKILTVDPAARIKSREILKHPLLQKYPSIKDSKSIRNLPRE 112
           LI+++L  +P  R    ++L H  LQ Y S+   ++ + L R+
Sbjct: 263 LISRLLAKNPKERPSLPQVLHHQFLQPYGSVVLDQTEKTLSRQ 305

>Kpol_1012.6 s1012 (11581..13467) [1887 bp, 628 aa] {ON}
           (11581..13467) [1887 nt, 629 aa]
          Length = 628

 Score = 67.8 bits (164), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 34/92 (36%), Positives = 54/92 (58%), Gaps = 7/92 (7%)

Query: 11  PYHGFESDVWSCGIILFALLTGRLPFDEE----DG-NIRNLLLKVQSGQFEMPDSDEISP 65
           PY   ++D+WS G+IL+A+L G LP+D++    DG NI  L   +     + PD   I P
Sbjct: 239 PYDARKADIWSAGVILYAMLAGYLPWDDDPENPDGSNIMRLYEYITKNNLKFPDY--IEP 296

Query: 66  EAQDLIAKILTVDPAARIKSREILKHPLLQKY 97
            A+DLI KIL + P +R+   ++ +H  L+ +
Sbjct: 297 LARDLIRKILVIQPKSRLNIVQVQQHEWLKPH 328

>YDR477W Chr4 (1412373..1414274) [1902 bp, 633 aa] {ON}
           SNF1AMP-activated serine/threonine protein kinase found
           in a complex containing Snf4p and members of the
           Sip1p/Sip2p/Gal83p family; required for transcription of
           glucose-repressed genes, thermotolerance, sporulation,
           and peroxisome biogenesis
          Length = 633

 Score = 67.8 bits (164), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 49/79 (62%), Gaps = 4/79 (5%)

Query: 12  YHGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDEISPEAQDLI 71
           Y G E DVWSCG+IL+ +L  RLPFD+E  +I  L   + +G + +P    +SP A  LI
Sbjct: 228 YAGPEVDVWSCGVILYVMLCRRLPFDDE--SIPVLFKNISNGVYTLPKF--LSPGAAGLI 283

Query: 72  AKILTVDPAARIKSREILK 90
            ++L V+P  RI   EI++
Sbjct: 284 KRMLIVNPLNRISIHEIMQ 302

>Skud_4.751 Chr4 (1332135..1334039) [1905 bp, 634 aa] {ON} YDR477W
           (REAL)
          Length = 634

 Score = 67.4 bits (163), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 49/79 (62%), Gaps = 4/79 (5%)

Query: 12  YHGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDEISPEAQDLI 71
           Y G E DVWSCG+IL+ +L  RLPFD+E  +I  L   + +G + +P    +SP A  LI
Sbjct: 229 YAGPEVDVWSCGVILYVMLCRRLPFDDE--SIPVLFKNISNGVYTLPKF--LSPGAAGLI 284

Query: 72  AKILTVDPAARIKSREILK 90
            ++L V+P  RI   EI++
Sbjct: 285 KRMLIVNPLNRISIHEIMQ 303

>TBLA0C01750 Chr3 (412762..415707) [2946 bp, 981 aa] {ON} Anc_8.654
           YPL141C
          Length = 981

 Score = 67.8 bits (164), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 35/90 (38%), Positives = 52/90 (57%), Gaps = 7/90 (7%)

Query: 11  PYHGFESDVWSCGIILFALLTGRLPFDEE----DGN-IRNLLLKVQSGQFEMPDSDEISP 65
           PY   ++D+WSCGIIL+A+L G LP+D++    DGN I  L   + +   + P  + I P
Sbjct: 268 PYEARKADLWSCGIILYAMLAGYLPWDDDIKNPDGNDIARLYYYITTTPLKFP--EYIQP 325

Query: 66  EAQDLIAKILTVDPAARIKSREILKHPLLQ 95
             +DL+ KIL  +   RI  R I+ H  L+
Sbjct: 326 LPRDLLRKILVPNYKKRINMRRIINHEWLK 355

>CAGL0J03872g Chr10 (368472..370457) [1986 bp, 661 aa] {ON} similar
           to uniprot|Q01919 Saccharomyces cerevisiae YOR233w KIN4
           ser/thr protein kinase or and similar to uniprot|Q03002
           Saccharomyces cerevisiae YPL141c
          Length = 661

 Score = 67.4 bits (163), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 34/92 (36%), Positives = 52/92 (56%), Gaps = 7/92 (7%)

Query: 11  PYHGFESDVWSCGIILFALLTGRLPFDEEDGN-----IRNLLLKVQSGQFEMPDSDEISP 65
           PY   ++DVWSCGIIL+A+L G LP+D++  N     I  L   +     + P  + I+P
Sbjct: 230 PYVARKADVWSCGIILYAMLAGYLPWDDDSTNPEGDDIGKLYQYITRTPLKFP--EYITP 287

Query: 66  EAQDLIAKILTVDPAARIKSREILKHPLLQKY 97
             +DL+ KIL  DP  R+  + I +H  L+ +
Sbjct: 288 IPRDLLRKILVPDPNKRVNMQYIHRHEWLKPH 319

>Ecym_2405 Chr2 (788655..791222) [2568 bp, 855 aa] {ON} similar to
           Ashbya gossypii ACR133C
          Length = 855

 Score = 67.4 bits (163), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 37/91 (40%), Positives = 54/91 (59%), Gaps = 7/91 (7%)

Query: 12  YHGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDE--ISPEAQD 69
           Y G++ D WS GIIL+ +L G +PFDEED  +    LK+ +   EMP   +   +  A+D
Sbjct: 204 YDGYKVDTWSLGIILYTMLHGFMPFDEEDPTLTG--LKIMN---EMPPIVDAYTNVHAKD 258

Query: 70  LIAKILTVDPAARIKSREILKHPLLQKYPSI 100
           LI K+L   P+ R    ++L+HP LQ Y +I
Sbjct: 259 LILKLLRKTPSERPSLNKVLEHPFLQPYGTI 289

>Kpol_1018.65 s1018 (189779..191584) [1806 bp, 601 aa] {ON}
           (189779..191584) [1806 nt, 602 aa]
          Length = 601

 Score = 67.0 bits (162), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 49/79 (62%), Gaps = 4/79 (5%)

Query: 12  YHGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDEISPEAQDLI 71
           Y G E DVWSCG+IL+ +L  RLPFD  D +I  L   + +G + +P    +SP A +LI
Sbjct: 215 YAGPEVDVWSCGVILYVMLCRRLPFD--DDSIPVLFKNISNGIYTLPKF--LSPGAANLI 270

Query: 72  AKILTVDPAARIKSREILK 90
            ++L V+P  RI   EI++
Sbjct: 271 KRMLIVNPLNRISMNEIME 289

>Suva_10.180 Chr10 (337364..340843) [3480 bp, 1159 aa] {ON} YLR096W
           (REAL)
          Length = 1159

 Score = 67.4 bits (163), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 30/86 (34%), Positives = 53/86 (61%), Gaps = 4/86 (4%)

Query: 11  PYHGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDEISPEAQDL 70
           PY G E D+WS GI+L+ L+ G++PFD+E+ +I  L  K++ G+ + P    +S +A  L
Sbjct: 306 PYTGPEVDIWSFGIVLYVLVCGKVPFDDENSSI--LHEKIKKGKVDYP--SHLSIDAVSL 361

Query: 71  IAKILTVDPAARIKSREILKHPLLQK 96
           + +++ VDP  R   + +  HP + +
Sbjct: 362 LTRMIVVDPLKRATLKNVTDHPWMNR 387

>Kpol_1066.46 s1066 (82874..86551) [3678 bp, 1225 aa] {ON}
           (82874..86551) [3678 nt, 1226 aa]
          Length = 1225

 Score = 67.8 bits (164), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 52/81 (64%), Gaps = 4/81 (4%)

Query: 11  PYHGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDEISPEAQDL 70
           PY G E DVWS G++L+ L+ G++PFD+E+ ++  L  K++ G+ E   S  +S E   L
Sbjct: 344 PYTGPEVDVWSFGVVLYVLVCGKVPFDDENSSV--LHEKIKQGKVEY--SQHLSIEVISL 399

Query: 71  IAKILTVDPAARIKSREILKH 91
           ++K+L VDP  R   ++++ H
Sbjct: 400 LSKMLVVDPKRRASLKQVVDH 420

>NCAS0B01470 Chr2 (241003..243186) [2184 bp, 727 aa] {ON} Anc_8.654
          Length = 727

 Score = 67.4 bits (163), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 49/89 (55%), Gaps = 7/89 (7%)

Query: 11  PYHGFESDVWSCGIILFALLTGRLPFDEEDGN-----IRNLLLKVQSGQFEMPDSDEISP 65
           PY   ++D+WSCGIIL+ +L G LP+D++  N     I  L   +     + P+   I+P
Sbjct: 223 PYKARKADIWSCGIILYGMLAGYLPWDDDKQNPNGEDIVRLYHYITKTPLKFPEY--ITP 280

Query: 66  EAQDLIAKILTVDPAARIKSREILKHPLL 94
             +DL+  IL  +P  R+ SR I KH  L
Sbjct: 281 LPRDLLRHILVSNPVRRMSSRHIKKHEWL 309

>KLTH0D11044g Chr4 complement(901388..903937) [2550 bp, 849 aa] {ON}
           similar to uniprot|Q12152 Saccharomyces cerevisiae
           YPL150W
          Length = 849

 Score = 67.4 bits (163), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 50/84 (59%), Gaps = 3/84 (3%)

Query: 11  PYHGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDEISPEAQDL 70
           PY G++ D WS GIIL+ ++ G +PFDEED +I+     V +  F   D + I    +DL
Sbjct: 203 PYEGYKIDTWSLGIILYTMIHGAMPFDEED-DIKTKYRIVNNEPFY--DDNFIDANGKDL 259

Query: 71  IAKILTVDPAARIKSREILKHPLL 94
           I ++L  DP+ R    ++L+HP +
Sbjct: 260 IMQLLQKDPSQRPSLTQVLQHPFM 283

>KAFR0C05860 Chr3 (1160586..1162520) [1935 bp, 644 aa] {ON}
           Anc_5.611 YDR477W
          Length = 644

 Score = 67.0 bits (162), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 49/79 (62%), Gaps = 4/79 (5%)

Query: 12  YHGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDEISPEAQDLI 71
           Y G E DVWSCG+IL+ +L  RLPFD+E  +I  L   + +G + +P    +SP A  LI
Sbjct: 222 YAGPEVDVWSCGVILYVMLCRRLPFDDE--SIPVLFKNISNGVYILPKF--LSPGASSLI 277

Query: 72  AKILTVDPAARIKSREILK 90
            ++L V+P  RI   EI++
Sbjct: 278 KRMLIVNPLNRISIHEIMQ 296

>Skud_7.114 Chr7 (211645..213153) [1509 bp, 502 aa] {ON} YGL158W
           (REAL)
          Length = 502

 Score = 66.6 bits (161), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 41/113 (36%), Positives = 55/113 (48%), Gaps = 11/113 (9%)

Query: 18  DVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEM--PDSDEISPEAQDLIAKIL 75
           D+W  G +LF LL G  PF E+  N   L+ K+  G +E   P  D+IS  A++ I  +L
Sbjct: 328 DMWGIGCVLFTLLCGYPPFYEK--NQSKLVRKISKGDYEFLAPWWDDISSGAKNAIIHLL 385

Query: 76  TVDPAARIKSREILKHPLLQKYPSIKDSKSIRNLPREDTYLNPLDSVNGSIDE 128
            VDP  R    + L  P L  Y  +       N P  +TY    D +NGS DE
Sbjct: 386 EVDPKKRYDIDDFLNDPWLNSYDCL-------NSPNSNTYATIEDILNGSFDE 431

>SAKL0H07084g Chr8 complement(619288..622047) [2760 bp, 919 aa] {ON}
           weakly similar to uniprot|Q03002 Saccharomyces
           cerevisiae YPL141C Hypothetical ORF
          Length = 919

 Score = 67.0 bits (162), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 30/92 (32%), Positives = 53/92 (57%), Gaps = 7/92 (7%)

Query: 11  PYHGFESDVWSCGIILFALLTGRLPFDEEDGN-----IRNLLLKVQSGQFEMPDSDEISP 65
           PY   ++D+WSCG+I++A+L G LP+D++  N     I  L   +     + P  + I+P
Sbjct: 225 PYEARKADIWSCGVIMYAMLAGYLPWDDDSENPEGDDIAKLYHYITKTPLKFP--EYINP 282

Query: 66  EAQDLIAKILTVDPAARIKSREILKHPLLQKY 97
             +DL+ +IL  +P  R+  R++ +H  LQ +
Sbjct: 283 VPRDLLRRILVSNPKKRLNLRQVEQHQWLQPH 314

>ZYRO0D06776g Chr4 complement(583027..586641) [3615 bp, 1204 aa]
           {ON} similar to uniprot|P13186 Saccharomyces cerevisiae
           YLR096W KIN2 Serine/threonine protein kinase involved in
           regulation of exocytosis localizes to the cytoplasmic
           face of the plasma membrane closely related to Kin1p and
           to YDR122W uniprot|P13185 Saccharomyces cerevisiae
           YDR122W KIN1 Serine/threonine protein kinase involved in
           regulation of exocytosis; localizes to the cytoplasmic
           face of the plasma membrane; closely related to Kin2p
          Length = 1204

 Score = 67.0 bits (162), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 53/81 (65%), Gaps = 4/81 (4%)

Query: 11  PYHGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDEISPEAQDL 70
           PY G E DVWS G++L+ L+ G++PFD+E+ ++  L  K++ G+ + P    +S E   L
Sbjct: 339 PYVGPEVDVWSFGVVLYVLVCGKVPFDDENSSV--LHEKIKQGKVDYP--QHLSIEVISL 394

Query: 71  IAKILTVDPAARIKSREILKH 91
           ++K+L VDP  R   +++++H
Sbjct: 395 LSKMLVVDPRKRASLKQVVEH 415

>Smik_7.115 Chr7 (201140..202663) [1524 bp, 507 aa] {ON} YGL158W
           (REAL)
          Length = 507

 Score = 66.2 bits (160), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 43/121 (35%), Positives = 61/121 (50%), Gaps = 12/121 (9%)

Query: 11  PYHGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEM--PDSDEISPEAQ 68
           PY   E D+W  G +LF LL G  PF E+      L+ K+  G +E   P  D+IS  A+
Sbjct: 327 PY-SMEVDMWGIGCVLFTLLCGYPPFYEKSHT--KLVKKICKGDYEFLAPWWDDISSGAK 383

Query: 69  DLIAKILTVDPAARIKSREILKHPLLQKYPSIKDSKSIRNLPREDTYLNPLDSVNGSIDE 128
           + I  +L VDP+ R    + L  P L  Y  +K S+S       +TY+     +NGS DE
Sbjct: 384 NAITHLLEVDPSKRYDINDFLNDPWLNSYDCLKPSQS-------ETYVTVDSILNGSFDE 436

Query: 129 S 129
           +
Sbjct: 437 A 437

>KLTH0C10912g Chr3 (898372..900465) [2094 bp, 697 aa] {ON} highly
           similar to uniprot|P32562 Saccharomyces cerevisiae
           YMR001C
          Length = 697

 Score = 66.6 bits (161), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 30/79 (37%), Positives = 48/79 (60%), Gaps = 2/79 (2%)

Query: 13  HGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDEISPEAQDLIA 72
           H +E D+WSCG++++ALL G+ PF  ++ NI  +  +++ G +  P    IS EA  LI 
Sbjct: 255 HSYEVDIWSCGVMIYALLIGKPPFQAKEVNI--IYERIKCGDYVFPRDKCISQEALTLIR 312

Query: 73  KILTVDPAARIKSREILKH 91
            IL++DP  R    EI+ +
Sbjct: 313 DILSIDPLERPSLDEIIDY 331

>Kwal_26.8751 s26 complement(928853..931399) [2547 bp, 848 aa] {ON}
           YPL150W - Hypothetical ORF [contig 67] FULL
          Length = 848

 Score = 66.6 bits (161), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 32/88 (36%), Positives = 50/88 (56%), Gaps = 5/88 (5%)

Query: 11  PYHGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFE-MPDSDEISPEAQD 69
           PY G++ D WS GIIL+ ++ G +PFDE D     +  K +   +    D+D I    ++
Sbjct: 203 PYEGYKIDTWSLGIILYTMIHGTMPFDEVD----EVKTKYKIVHYNPTYDNDYIDSNGKE 258

Query: 70  LIAKILTVDPAARIKSREILKHPLLQKY 97
           LI+++L  DP  R    ++L+HP LQ Y
Sbjct: 259 LISQLLEKDPNQRPSLTQVLQHPFLQPY 286

>KNAG0H03140 Chr8 complement(589553..592363) [2811 bp, 936 aa] {ON}
           Anc_8.279 YLR096W
          Length = 936

 Score = 66.6 bits (161), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 35/91 (38%), Positives = 57/91 (62%), Gaps = 5/91 (5%)

Query: 11  PYHGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDEISPEAQDL 70
           PY G E D+WS G+IL+ L+ G++PFD+E+ N   L  K++ G+   P +  +S E   L
Sbjct: 317 PYIGPEIDIWSFGVILYVLVVGKVPFDDENSNA--LHEKIKRGKVSYPAT--LSIECISL 372

Query: 71  IAKILTVDPAARIKSREILKHP-LLQKYPSI 100
           + K+LTV+P  R   +EI+ H  +++ Y +I
Sbjct: 373 LTKMLTVNPKRRATLKEIVTHHWMVRGYGNI 403

>YGL158W Chr7 (207033..208571) [1539 bp, 512 aa] {ON}  RCK1Protein
           kinase involved in the response to oxidative stress;
           identified as suppressor of S. pombe cell cycle
           checkpoint mutations
          Length = 512

 Score = 65.9 bits (159), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 41/113 (36%), Positives = 57/113 (50%), Gaps = 11/113 (9%)

Query: 18  DVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEM--PDSDEISPEAQDLIAKIL 75
           D+WS G +LF LL G  PF E+  N + LL K+  G +E   P  D IS  A++ +  +L
Sbjct: 338 DMWSIGCVLFTLLCGYPPFYEK--NEKTLLKKISRGDYEFLAPWWDNISSGAKNAVTHLL 395

Query: 76  TVDPAARIKSREILKHPLLQKYPSIKDSKSIRNLPREDTYLNPLDSVNGSIDE 128
            VDP  R    + L  P L  Y  +KDS S       ++Y +    +N S DE
Sbjct: 396 EVDPNKRYDIDDFLNDPWLNSYDCLKDSNS-------NSYASVQSILNDSFDE 441

>Smik_15.417 Chr15 (725513..727933) [2421 bp, 806 aa] {ON} YOR233W
           (REAL)
          Length = 806

 Score = 66.2 bits (160), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 32/90 (35%), Positives = 51/90 (56%), Gaps = 7/90 (7%)

Query: 11  PYHGFESDVWSCGIILFALLTGRLPFDEEDGN-----IRNLLLKVQSGQFEMPDSDEISP 65
           PY   ++DVWSCG+IL+A+L G LP+D++  N     I  L   +     + P+   I+P
Sbjct: 227 PYEARKADVWSCGVILYAMLAGYLPWDDDHENPTGDDIARLYQYITQTPLKFPEY--ITP 284

Query: 66  EAQDLIAKILTVDPAARIKSREILKHPLLQ 95
             +DL+ +IL  +P  R+  R I +H  L+
Sbjct: 285 VPRDLLRRILVPNPRRRVSLRSIERHEWLK 314

>KNAG0B03230 Chr2 complement(625072..626997) [1926 bp, 641 aa] {ON}
           Anc_5.611 YDR477W
          Length = 641

 Score = 65.9 bits (159), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 36/84 (42%), Positives = 49/84 (58%), Gaps = 4/84 (4%)

Query: 12  YHGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDEISPEAQDLI 71
           Y G E DVWSCG+IL+ +L  RLPFD+E  +I  L   + +G + +P    +S  A +LI
Sbjct: 218 YAGPEVDVWSCGVILYVMLCRRLPFDDE--SIPVLFKNISNGVYILPKF--LSLGAANLI 273

Query: 72  AKILTVDPAARIKSREILKHPLLQ 95
            K+L V+P  RI   EI K    Q
Sbjct: 274 KKMLIVNPLNRISISEIFKDEWFQ 297

>Suva_13.163 Chr13 complement(259136..261253) [2118 bp, 705 aa] {ON}
           YMR001C (REAL)
          Length = 705

 Score = 65.9 bits (159), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 62/121 (51%), Gaps = 9/121 (7%)

Query: 13  HGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDEISPEAQDLIA 72
           H FE D+WS G++L+ALL G+ PF   D N   +  +++   F  P    IS E + LI 
Sbjct: 258 HSFEVDIWSLGVMLYALLIGKPPFQARDVN--TIYERIKCRDFSFPKDKPISDEGKILIR 315

Query: 73  KILTVDPAARIKSREILKHPLLQKY--PSI-----KDSKSIRNLPREDTYLNPLDSVNGS 125
            IL++DP  R    EI+ +   +    PSI      ++ +  N+P E + +N  D +  S
Sbjct: 316 DILSLDPIERPSLTEIMDYVWFRGTFPPSIPSTVMSEASNFDNIPEEQSLINFKDCMEKS 375

Query: 126 I 126
           +
Sbjct: 376 L 376

>NCAS0A08080 Chr1 complement(1594221..1596092) [1872 bp, 623 aa]
           {ON} Anc_5.611
          Length = 623

 Score = 65.1 bits (157), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 49/79 (62%), Gaps = 4/79 (5%)

Query: 12  YHGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDEISPEAQDLI 71
           Y G E DVWSCG+IL+ +L  RLPFD+E  +I  L   + +G + +P    +S  A  LI
Sbjct: 219 YAGPEVDVWSCGVILYVMLCRRLPFDDE--SIPVLFKNINNGVYTIPKF--LSQGASTLI 274

Query: 72  AKILTVDPAARIKSREILK 90
            K+L V+P  RI  +EI++
Sbjct: 275 KKMLIVNPLNRISIQEIMQ 293

>TPHA0D02840 Chr4 (591733..593637) [1905 bp, 634 aa] {ON} 
          Length = 634

 Score = 65.1 bits (157), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 34/78 (43%), Positives = 47/78 (60%), Gaps = 4/78 (5%)

Query: 12  YHGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDEISPEAQDLI 71
           Y G E DVWSCG+IL+ +L  RLPFD  D +I  L   + +G + +P    +S  A +LI
Sbjct: 241 YAGPEVDVWSCGVILYVMLCRRLPFD--DDSIPALFKNISNGIYTLPKF--LSEGAANLI 296

Query: 72  AKILTVDPAARIKSREIL 89
            K+L V+P  RI   EI+
Sbjct: 297 KKMLIVNPLNRISMTEII 314

>Kpol_495.14 s495 (33810..35684) [1875 bp, 624 aa] {ON}
           (33810..35684) [1875 nt, 625 aa]
          Length = 624

 Score = 64.7 bits (156), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 49/79 (62%), Gaps = 4/79 (5%)

Query: 12  YHGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDEISPEAQDLI 71
           Y G E DVWSCG+IL+ +L  RLPFD+E  +I  L   + +G + +P+   +S  A  LI
Sbjct: 215 YAGPEVDVWSCGVILYVMLCRRLPFDDE--SIPILFKNISNGIYTLPNF--LSDGAASLI 270

Query: 72  AKILTVDPAARIKSREILK 90
            K+L V+P  RI   EI++
Sbjct: 271 KKMLIVNPINRISISEIMQ 289

>NCAS0B03740 Chr2 complement(668231..671380) [3150 bp, 1049 aa] {ON}
           Anc_8.279
          Length = 1049

 Score = 65.1 bits (157), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 50/81 (61%), Gaps = 4/81 (4%)

Query: 11  PYHGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDEISPEAQDL 70
           PY G E DVWS G++L+ L+ G++PFD+E+ N+  L  K++ G+   P    +S E   L
Sbjct: 275 PYIGPEIDVWSFGVVLYVLVCGKVPFDDENSNV--LHEKIKQGKVFYPQF--LSIEVISL 330

Query: 71  IAKILTVDPAARIKSREILKH 91
           ++K+L VDP  R    +++ H
Sbjct: 331 LSKMLVVDPFKRATLDQVMNH 351

>Kpol_1037.20 s1037 (41658..43772) [2115 bp, 704 aa] {ON}
           (41658..43772) [2115 nt, 705 aa]
          Length = 704

 Score = 64.7 bits (156), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 35/111 (31%), Positives = 59/111 (53%), Gaps = 3/111 (2%)

Query: 13  HGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDEISPEAQDLIA 72
           H +E D+WS G++L+ALL G+ PF  +D N   +  +++   F  P    IS EA+ LI 
Sbjct: 258 HSYEVDIWSIGVMLYALLIGKPPFQSKDVN--TIYERIKCCDFSFPKEKHISNEAKVLIQ 315

Query: 73  KILTVDPAARIKSREILKHPLLQK-YPSIKDSKSIRNLPREDTYLNPLDSV 122
            +L++DP  R    EI+ +   +  +P   +S  +  +P  D  L   +S+
Sbjct: 316 DLLSLDPLERPSISEIMDYVWFRGIFPPYIESTVMTEVPNYDKTLTHQESI 366

>KNAG0D01090 Chr4 complement(183319..184437) [1119 bp, 372 aa] {ON} 
          Length = 372

 Score = 63.5 bits (153), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 34/110 (30%), Positives = 58/110 (52%), Gaps = 16/110 (14%)

Query: 1   MRRLRSCPVLPY----------HGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLL-K 49
           +RR   C  + Y          +    D+W+ GI+ + LL G  PF+E   N ++L   +
Sbjct: 265 LRRRTFCGTIDYLSPEIVDYKEYDHNVDIWALGIVAYELLVGSPPFEE---NTKDLTYER 321

Query: 50  VQSGQFEMPDSDEISPEAQDLIAKILTVDPAARIKSREILKHPLLQKYPS 99
           ++ G    P   +++PEA+D I +IL ++P  R+  +EI+ HP + KY S
Sbjct: 322 IRRGDIVFPK--QVTPEARDFIERILVLEPKKRMTLKEIMSHPWILKYKS 369

>TBLA0E03360 Chr5 complement(838512..840476) [1965 bp, 654 aa] {ON}
           Anc_5.611 YDR477W
          Length = 654

 Score = 64.7 bits (156), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 48/79 (60%), Gaps = 4/79 (5%)

Query: 12  YHGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDEISPEAQDLI 71
           Y G E DVWSCG+IL+ +L  RLPFD+E  +I  L   + +G + +P    +S  A  LI
Sbjct: 217 YAGPEVDVWSCGVILYVMLCRRLPFDDE--SIPVLFKNINNGIYTLPRF--LSEGASSLI 272

Query: 72  AKILTVDPAARIKSREILK 90
            K+L V+P  RI   EI++
Sbjct: 273 KKMLIVNPLNRISIHEIMQ 291

>Ecym_8339 Chr8 (684113..686875) [2763 bp, 920 aa] {ON} similar to
           Ashbya gossypii ACR119W
          Length = 920

 Score = 64.7 bits (156), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 32/92 (34%), Positives = 50/92 (54%), Gaps = 7/92 (7%)

Query: 11  PYHGFESDVWSCGIILFALLTGRLPFDE-----EDGNIRNLLLKVQSGQFEMPDSDEISP 65
           PY   ++DVWSCG+IL+A+L G LP+D+     E  +I  L   +     + P+   I P
Sbjct: 244 PYEARKADVWSCGVILYAMLAGYLPWDDDPENPEGDDIAKLYHYITKSALKFPEY--IKP 301

Query: 66  EAQDLIAKILTVDPAARIKSREILKHPLLQKY 97
             +DL+ +IL  +P  R+   EI  H  L+ +
Sbjct: 302 LPRDLLRRILVSNPDTRLSVMEIKNHEWLRPH 333

>ACR119W Chr3 (560761..563556) [2796 bp, 931 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL141C and YOR233W
           (KIN4)
          Length = 931

 Score = 64.3 bits (155), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 32/92 (34%), Positives = 51/92 (55%), Gaps = 7/92 (7%)

Query: 11  PYHGFESDVWSCGIILFALLTGRLPFDEEDGN-----IRNLLLKVQSGQFEMPDSDEISP 65
           PY   ++DVWSCG+IL+A+L G LP+D++  N     I  L   +     + P  + I P
Sbjct: 224 PYSAQKADVWSCGVILYAMLAGYLPWDDDPENPEGEDIAKLYQYITHTSLKFP--EYIKP 281

Query: 66  EAQDLIAKILTVDPAARIKSREILKHPLLQKY 97
             +DL+ +IL  +P  R+   +I +H  LQ +
Sbjct: 282 IPRDLLKRILVSNPEVRLTVADIEQHAWLQPH 313

>Kpol_1072.19 s1072 (44906..47596) [2691 bp, 896 aa] {ON}
           (44906..47596) [2691 nt, 897 aa]
          Length = 896

 Score = 64.3 bits (155), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 52/88 (59%), Gaps = 7/88 (7%)

Query: 12  YHGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDE--ISPEAQD 69
           Y G++ D+W+ GI+L+ ++ G +PFDE+D   +   LK+ S     PD D    + ++ D
Sbjct: 206 YDGYKIDIWALGILLYTIINGTMPFDEDDP--KKTELKIISAS---PDYDNKYFNDDSID 260

Query: 70  LIAKILTVDPAARIKSREILKHPLLQKY 97
           L+ ++L+ DP+ R    +IL HP L  Y
Sbjct: 261 LVNRLLSKDPSMRPTIEQILMHPFLASY 288

>Smik_13.159 Chr13 complement(260249..262366) [2118 bp, 705 aa] {ON}
           YMR001C (REAL)
          Length = 705

 Score = 63.9 bits (154), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 61/121 (50%), Gaps = 9/121 (7%)

Query: 13  HGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDEISPEAQDLIA 72
           H FE D+WS G++L+ALL G+ PF   D N   +  +++   F  P    IS E + LI 
Sbjct: 258 HSFEVDIWSLGVMLYALLIGKPPFQARDVN--TIYERIKCRDFSFPKDKPISDEGKILIR 315

Query: 73  KILTVDPAARIKSREILKHPLLQKY--PSI-----KDSKSIRNLPREDTYLNPLDSVNGS 125
            IL++DP  R    EI+ +   +    PSI      +  +  N+P E + +N  D +  S
Sbjct: 316 DILSLDPIERPSLTEIMDYVWFRGTFPPSIPSTVMSEVPNFGNIPEEQSLVNFKDCMEKS 375

Query: 126 I 126
           +
Sbjct: 376 L 376

>Ecym_5588 Chr5 complement(1205102..1206943) [1842 bp, 613 aa] {ON}
           similar to Ashbya gossypii AEL230W
          Length = 613

 Score = 63.9 bits (154), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 52/150 (34%), Positives = 75/150 (50%), Gaps = 29/150 (19%)

Query: 12  YHGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDEISPEAQDLI 71
           Y G E DVWS G+IL+ +L  RLPFD+E  +I  L   + +G + +P    +SP A +LI
Sbjct: 216 YAGPEVDVWSSGVILYVMLCRRLPFDDE--SIPVLFKNISNGVYSIPKF--LSPGAANLI 271

Query: 72  AKILTVDPAARIKSREILKHPLLQKYPSIKDSKSIRNLPREDTYLNPLD-SVNGS----- 125
            K+L V+P  RI   EI++    +            +LP    YL P+D   +GS     
Sbjct: 272 KKMLIVNPLNRITIHEIMEDQWFKV-----------DLP---DYLIPVDLKTDGSGKRDG 317

Query: 126 ----IDESIINNLVVLWHGRDRNEITAQLK 151
               IDES++  L       DR+EI   L+
Sbjct: 318 EDEEIDESLVAILAKT-MSYDRDEIYEALE 346

>Skud_15.399 Chr15 (714789..717212) [2424 bp, 807 aa] {ON} YOR233W
           (REAL)
          Length = 807

 Score = 63.9 bits (154), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 31/91 (34%), Positives = 51/91 (56%), Gaps = 7/91 (7%)

Query: 12  YHGFESDVWSCGIILFALLTGRLPFDEEDGN-----IRNLLLKVQSGQFEMPDSDEISPE 66
           Y   ++DVWSCG+IL+A+L G LP+D++  N     I  L   +     + P+   I+P 
Sbjct: 228 YEARKADVWSCGVILYAMLAGYLPWDDDHENPTGDDIARLYQYITQTPLKFPEY--ITPV 285

Query: 67  AQDLIAKILTVDPAARIKSREILKHPLLQKY 97
            +DL+ +IL  +P  R+  R I +H  L+ +
Sbjct: 286 PRDLLRRILVPNPRRRVSVRAIQRHEWLKPH 316

>CAGL0B01925g Chr2 (176316..179150) [2835 bp, 944 aa] {ON} similar
           to uniprot|P13185 Saccharomyces cerevisiae YDR122w KIN1
           or uniprot|P13186 Saccharomyces cerevisiae YLR096w KIN2
          Length = 944

 Score = 63.9 bits (154), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 51/86 (59%), Gaps = 4/86 (4%)

Query: 11  PYHGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDEISPEAQDL 70
           PY G E DVWS G++L+ L+ G++PFD+E  N   L  K++ G+   P    +S +   L
Sbjct: 266 PYLGPEVDVWSFGVVLYVLVCGKVPFDDE--NSSALHEKIKKGKVTYPQF--LSIDVISL 321

Query: 71  IAKILTVDPAARIKSREILKHPLLQK 96
           ++KIL VDP  R   ++++ H  + K
Sbjct: 322 LSKILVVDPQKRATLQQVVNHQWMLK 347

>TPHA0G01630 Chr7 (336511..339126) [2616 bp, 871 aa] {ON} Anc_8.668
           YPL150W
          Length = 871

 Score = 63.5 bits (153), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 35/88 (39%), Positives = 48/88 (54%), Gaps = 7/88 (7%)

Query: 12  YHGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDE--ISPEAQD 69
           Y GF+ D+WS G+IL+ L+ G +PFDEED   R     +     E PD +E   +  + +
Sbjct: 204 YDGFKIDIWSLGVILYTLINGSMPFDEED-ETRTEWKIIN----EEPDYNEKIFNANSIE 258

Query: 70  LIAKILTVDPAARIKSREILKHPLLQKY 97
           LI  +L  DP  R    EILKH  L+ Y
Sbjct: 259 LIKSLLIKDPKKRPSMTEILKHKFLEPY 286

>SAKL0G06952g Chr7 (570584..572383) [1800 bp, 599 aa] {ON} similar
           to uniprot|P06782 Saccharomyces cerevisiae YDR477W SNF1
           Protein serine/threonine kinase required for release
           from glucose repression invertase expression sporulation
           and for expression of catabolite-repressed genes when
           glucose is limiting regulates Adr1p-dependent
           transcription primarily at the level of chromatin
           binding
          Length = 599

 Score = 63.2 bits (152), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 33/79 (41%), Positives = 49/79 (62%), Gaps = 4/79 (5%)

Query: 12  YHGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDEISPEAQDLI 71
           Y G E DVWS G+IL+ +L  RLPFD+E  +I  L   + +G + +P    +SP A +LI
Sbjct: 205 YAGPEVDVWSSGVILYVMLCRRLPFDDE--SIPVLFKNISNGVYTLPKF--LSPGASNLI 260

Query: 72  AKILTVDPAARIKSREILK 90
            ++L V+P  RI   EI++
Sbjct: 261 KRMLIVNPLNRITIHEIMQ 279

>YMR001C Chr13 complement(269019..271136) [2118 bp, 705 aa] {ON}
           CDC5Polo-like kinase with multiple functions in mitosis
           and cytokinesis through substrate phosphorylation, also
           functions in adaptation to DNA damage during meiosis;
           has similarity to Xenopus Plx1 and S. pombe Plo1p;
           possible Cdc28p substrate
          Length = 705

 Score = 63.2 bits (152), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 38/121 (31%), Positives = 62/121 (51%), Gaps = 9/121 (7%)

Query: 13  HGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDEISPEAQDLIA 72
           H FE D+WS G++L+ALL G+ PF   D N   +  +++   F  P    IS E + LI 
Sbjct: 258 HSFEVDIWSLGVMLYALLIGKPPFQARDVN--TIYERIKCRDFSFPRDKPISDEGKILIR 315

Query: 73  KILTVDPAARIKSREILKHPLLQKY--PSI-----KDSKSIRNLPREDTYLNPLDSVNGS 125
            IL++DP  R    EI+ +   +    PSI      ++ +  ++P E + +N  D +  S
Sbjct: 316 DILSLDPIERPSLTEIMDYVWFRGTFPPSIPSTVMSEAPNFEDIPEEQSLVNFKDCMEKS 375

Query: 126 I 126
           +
Sbjct: 376 L 376

>Suva_8.284 Chr8 (514891..517317) [2427 bp, 808 aa] {ON} YOR233W
           (REAL)
          Length = 808

 Score = 63.2 bits (152), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 31/91 (34%), Positives = 51/91 (56%), Gaps = 7/91 (7%)

Query: 12  YHGFESDVWSCGIILFALLTGRLPFDEEDGN-----IRNLLLKVQSGQFEMPDSDEISPE 66
           Y   ++DVWSCG+IL+A+L G LP+D++  N     I  L   +     + P+   I+P 
Sbjct: 228 YEARKADVWSCGVILYAMLAGYLPWDDDHENPTGDDIARLYQYITQTPLKFPEY--ITPI 285

Query: 67  AQDLIAKILTVDPAARIKSREILKHPLLQKY 97
            +DL+ +IL  +P  R+  R I +H  L+ +
Sbjct: 286 PRDLLRRILVPNPRRRVSLRAIQRHEWLKPH 316

>TPHA0F02430 Chr6 complement(535865..538261) [2397 bp, 798 aa] {ON}
           Anc_6.31 YMR001C
          Length = 798

 Score = 63.2 bits (152), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 50/79 (63%), Gaps = 2/79 (2%)

Query: 13  HGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDEISPEAQDLIA 72
           H FE+D+WS GI+++A++ G+ PF  +D  +  +  K++  Q+E P    I+ + + LI 
Sbjct: 269 HSFEADIWSLGIMIYAMVLGKPPFQAKD--VTTIYEKIKLCQYEFPPDKYITNDVKVLIQ 326

Query: 73  KILTVDPAARIKSREILKH 91
            +L +DP+ R +  +ILK+
Sbjct: 327 DLLVLDPSQRPRIMDILKY 345

>KLTH0G05698g Chr7 (453530..455323) [1794 bp, 597 aa] {ON} similar
           to uniprot|P06782 Saccharomyces cerevisiae YDR477W SNF1
           Protein serine/threonine kinase required for release
           from glucose repression invertase expression sporulation
           and for expression of catabolite- repressed genes when
           glucose is limiting regulates Adr1p- dependent
           transcription primarily at the level of chromatin
           binding
          Length = 597

 Score = 62.8 bits (151), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 50/145 (34%), Positives = 77/145 (53%), Gaps = 11/145 (7%)

Query: 12  YHGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDEISPEAQDLI 71
           Y G E DVWS G+IL+ +L  RLPFD+E  +I  L   + +G + +P    +SP A +LI
Sbjct: 203 YAGPEVDVWSSGVILYVMLCRRLPFDDE--SIPILFKNISNGIYTLPKF--LSPGAANLI 258

Query: 72  AKILTVDPAARIKSREILKHPL----LQKYPSIKDSKSIRNLPREDTYLNPLDSVNG-SI 126
            ++L V+P  RI   EI++       +Q Y    D KS  +  R++   +P     G  +
Sbjct: 259 KRMLIVNPLNRITIHEIMEDEWFKVDIQPYLIPPDLKSETDEHRQEGE-HPDGGEEGEEV 317

Query: 127 DESIINNLVVLWHGRDRNEITAQLK 151
           D+S++  L     G DR+EI   L+
Sbjct: 318 DDSLVTMLSKT-MGYDRDEIYEALE 341

>Kwal_47.18233 s47 complement(743846..745642) [1797 bp, 598 aa] {ON}
           YDR477W (SNF1) - protein serine/threonine kinase [contig
           197] FULL
          Length = 598

 Score = 62.8 bits (151), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 33/79 (41%), Positives = 49/79 (62%), Gaps = 4/79 (5%)

Query: 12  YHGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDEISPEAQDLI 71
           Y G E DVWS G+IL+ +L  RLPFD+E  +I  L   + +G + +P    +SP A +LI
Sbjct: 204 YAGPEVDVWSSGVILYVMLCRRLPFDDE--SIPVLFKNISNGIYTLPKF--LSPGAANLI 259

Query: 72  AKILTVDPAARIKSREILK 90
            ++L V+P  RI   EI++
Sbjct: 260 KRMLIVNPLNRITIHEIMQ 278

>KAFR0G02690 Chr7 complement(555573..557714) [2142 bp, 713 aa] {ON}
           Anc_6.31 YMR001C
          Length = 713

 Score = 62.8 bits (151), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 33/93 (35%), Positives = 52/93 (55%), Gaps = 4/93 (4%)

Query: 13  HGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDEISPEAQDLIA 72
           H +E D+WS G++++AL+ GR PF  +D N   +  +++   F  P    IS EA+ LI 
Sbjct: 271 HSYEVDIWSIGVMIYALIIGRPPFQSKDVN--TIYERIKCRDFSFPKDKLISSEAKILIQ 328

Query: 73  KILTVDPAARIKSREILKHPLLQKY--PSIKDS 103
            IL++DP  R    EI+ +   +    PS K+S
Sbjct: 329 DILSLDPLERPSVNEIMDYIWFRGCFPPSTKES 361

>TDEL0A04780 Chr1 (842715..844580) [1866 bp, 621 aa] {ON} Anc_5.611
           YDR477W
          Length = 621

 Score = 62.4 bits (150), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 33/79 (41%), Positives = 48/79 (60%), Gaps = 4/79 (5%)

Query: 12  YHGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDEISPEAQDLI 71
           Y G E DVWS G+IL+ +L  RLPFD+E  +I  L   + +G + +P    +SP A  LI
Sbjct: 215 YAGPEVDVWSSGVILYVMLCRRLPFDDE--SIPVLFKNISNGVYTLPKF--LSPGAAGLI 270

Query: 72  AKILTVDPAARIKSREILK 90
            ++L V+P  RI   EI++
Sbjct: 271 KRMLIVNPLNRISIHEIMQ 289

>KNAG0A03040 Chr1 complement(372150..374084) [1935 bp, 644 aa] {ON}
           Anc_8.654 YPL141C
          Length = 644

 Score = 62.4 bits (150), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 47/88 (53%), Gaps = 7/88 (7%)

Query: 12  YHGFESDVWSCGIILFALLTGRLPFDEEDGN-----IRNLLLKVQSGQFEMPDSDEISPE 66
           Y G + D+WSCG+IL+A+L G LP+D++  N     I  L   + +   + PD   ++P 
Sbjct: 238 YVGVKVDIWSCGVILYAMLAGYLPWDDDPSNPNGDDISKLYSYITATPLKFPDY--VNPL 295

Query: 67  AQDLIAKILTVDPAARIKSREILKHPLL 94
            +DL+ +IL  DP  R     I  H  L
Sbjct: 296 PRDLLRRILVADPRRRYTLGHIENHEWL 323

>NCAS0C03770 Chr3 complement(761101..765897) [4797 bp, 1598 aa] {ON}
            Anc_8.34
          Length = 1598

 Score = 62.8 bits (151), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 51/94 (54%), Gaps = 16/94 (17%)

Query: 14   GFESDVWSCGIILFALLTGRLPF--DEEDGNIRNLLLKVQSGQFEMPDSDEI-------S 64
            G + D WS G I+F LL G  PF  +  +G  R    K+ SG+ E P  D I       S
Sbjct: 1023 GDQCDWWSVGCIMFELLFGYPPFHTNTPEGVFR----KILSGKIEWPQFDSIEEEREILS 1078

Query: 65   PEAQDLIAKILTVDPAARIKSR---EILKHPLLQ 95
            PEA+DLI K+L VDP+ R+ +    EI +HP  +
Sbjct: 1079 PEAKDLIMKLLVVDPSKRLGANGADEIKQHPYFK 1112

>KNAG0E00850 Chr5 complement(158992..161127) [2136 bp, 711 aa] {ON}
           Anc_6.31 YMR001C
          Length = 711

 Score = 62.4 bits (150), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 36/113 (31%), Positives = 60/113 (53%), Gaps = 10/113 (8%)

Query: 13  HGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDEISPEAQDLIA 72
           H +E D+WS G++++ALL G+ PF  +D N+  +  ++++  F  P    IS EA+ LI 
Sbjct: 267 HSYEVDIWSIGVMIYALLIGKPPFQSKDVNM--IYERIKNRDFAFPKDKYISNEAKTLIH 324

Query: 73  KILTVDPAARIKSREILKHPLLQK-YPSIKDSKSIRNLPR-------EDTYLN 117
            IL+ DP  R    EI+ +   +  +PS   S  +   P        E++Y+N
Sbjct: 325 DILSTDPLERPSIEEIIDYVWFRGIFPSCTLSTVMSEDPNYEQIISAEESYIN 377

>CAGL0K10604g Chr11 complement(1030055..1031395) [1341 bp, 446 aa]
           {ON} similar to uniprot|P27466 Saccharomyces cerevisiae
           YFR014c CMK1 Ca2+/calmodulin-dependent ser/thr protein
           kinase type I
          Length = 446

 Score = 61.2 bits (147), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 34/91 (37%), Positives = 50/91 (54%), Gaps = 2/91 (2%)

Query: 13  HGFESDVWSCGIILFALLTGRLPFDEE--DGNIRNLLLKVQSGQFEMPDSDEISPEAQDL 70
           HG  SD+WS G+I + LL G  PF  E  DG +  +       +F+ P  D IS  A++ 
Sbjct: 243 HGKPSDIWSVGVITYTLLCGYSPFKAESVDGFLDEVTSDENPVKFQRPYWDGISELAKNF 302

Query: 71  IAKILTVDPAARIKSREILKHPLLQKYPSIK 101
           I +IL +DPA R  + E+L  P +Q   S++
Sbjct: 303 ILRILDLDPACRPSATELLNDPWIQSKCSLR 333

>Kpol_487.14 s487 complement(56520..58394) [1875 bp, 624 aa] {ON}
           complement(56520..58394) [1875 nt, 625 aa]
          Length = 624

 Score = 61.6 bits (148), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 33/92 (35%), Positives = 50/92 (54%), Gaps = 4/92 (4%)

Query: 13  HGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEM--PDSDEISPEAQDL 70
           +  + D+W  G +L+ +L G  PF +E  NI  L  K+  G++    P  DEIS  A++ 
Sbjct: 397 YSMKVDMWGIGCVLYTILCGFPPFYDEKINI--LTEKIARGEYTFLRPWWDEISDGAKNA 454

Query: 71  IAKILTVDPAARIKSREILKHPLLQKYPSIKD 102
           ++K+L VDP  R    E+L  P L  Y  +KD
Sbjct: 455 VSKLLEVDPEYRYDIDELLNDPWLNNYDCLKD 486

>AEL230W Chr5 (198401..200227) [1827 bp, 608 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR477W (SNF1)
          Length = 608

 Score = 61.2 bits (147), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 51/151 (33%), Positives = 75/151 (49%), Gaps = 27/151 (17%)

Query: 12  YHGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDEISPEAQDLI 71
           Y G E DVWS G+IL+ +L  RLPFD+E  +I  L   + +G + +P    +S  A +LI
Sbjct: 212 YAGPEVDVWSSGVILYVMLCRRLPFDDE--SIPVLFKNISNGVYSIPKF--LSQGAANLI 267

Query: 72  AKILTVDPAARIKSREILKHPLLQKYPSIKDSKSIRNLPREDTYLNPLD------SVNGS 125
            ++L V+P  RI   EI+           +D     +LP    YL P+D      S  G+
Sbjct: 268 KRMLIVNPLNRITIHEIM-----------EDEWFKVDLP---DYLVPVDMKADATSKPGT 313

Query: 126 IDESIINNLVVLW---HGRDRNEITAQLKEP 153
            DE I   LV +       D++EI   L++P
Sbjct: 314 DDERIDEALVAVLANTMSYDKDEIYEALEDP 344

>KLLA0A03806g Chr1 complement(338807..340615) [1809 bp, 602 aa] {ON}
           highly similar to uniprot|P06782 Saccharomyces
           cerevisiae YDR477W SNF1 Protein serine/threonine kinase
           required for release from glucose repression invertase
           expression sporulation and for expression of catabolite-
           repressed genes when glucose is limiting regulates
           Adr1p- dependent transcription primarily at the level of
           chromatin binding
          Length = 602

 Score = 61.2 bits (147), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 33/79 (41%), Positives = 48/79 (60%), Gaps = 4/79 (5%)

Query: 12  YHGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDEISPEAQDLI 71
           Y G E DVWS G+IL+ +L  RLPFD+E  +I  L   + +G + +P+   +S  A  LI
Sbjct: 208 YAGPEVDVWSSGVILYVMLCRRLPFDDE--SIPVLFKNISNGVYTIPNF--LSQGAASLI 263

Query: 72  AKILTVDPAARIKSREILK 90
            K+L V+P  RI   EI++
Sbjct: 264 KKMLIVNPVNRITVHEIMQ 282

>Skud_13.154 Chr13 complement(255263..257380) [2118 bp, 705 aa] {ON}
           YMR001C (REAL)
          Length = 705

 Score = 61.6 bits (148), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 38/121 (31%), Positives = 61/121 (50%), Gaps = 9/121 (7%)

Query: 13  HGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDEISPEAQDLIA 72
           H FE D+WS G++L+ALL G+ PF   D N   +  +++   F  P    IS E + LI 
Sbjct: 258 HSFEVDIWSLGVMLYALLIGKPPFQARDVN--TIYERIKCRDFSFPKDKPISDEGKILIR 315

Query: 73  KILTVDPAARIKSREILKHPLLQKY--PSI-----KDSKSIRNLPREDTYLNPLDSVNGS 125
            IL++DP  R    EI+ +   +    PSI      +  +  ++P E + +N  D +  S
Sbjct: 316 DILSLDPIERPSLTEIMDYVWFRGTFPPSIPATVMSEVPNFESVPDEQSLINFKDCMERS 375

Query: 126 I 126
           +
Sbjct: 376 L 376

>NCAS0A08880 Chr1 (1756271..1757539) [1269 bp, 422 aa] {ON}
           Anc_1.374
          Length = 422

 Score = 60.5 bits (145), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 44/84 (52%), Gaps = 2/84 (2%)

Query: 13  HGFESDVWSCGIILFALLTGRLPFDEE--DGNIRNLLLKVQSGQFEMPDSDEISPEAQDL 70
           HG   D+WS G+I + LL+G  PF  E  +G +          QF  P  D IS EA+D 
Sbjct: 217 HGKPCDIWSLGVITYTLLSGYSPFIAESVEGFLEECTRSRYPVQFHKPYWDSISDEAKDF 276

Query: 71  IAKILTVDPAARIKSREILKHPLL 94
           I K LT+DP  R  + E++  P +
Sbjct: 277 ILKALTIDPEERPSAEELMNDPWI 300

>NDAI0H03460 Chr8 complement(836849..838726) [1878 bp, 625 aa] {ON}
           Anc_1.390
          Length = 625

 Score = 60.8 bits (146), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 30/87 (34%), Positives = 49/87 (56%), Gaps = 4/87 (4%)

Query: 16  ESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEM--PDSDEISPEAQDLIAK 73
           ++D+W  G +L+ LL G  PF  +    +++  K++ G +    P  +EISPEAQ  +++
Sbjct: 405 KTDLWGIGCVLYTLLCGFPPFYADQN--KSITRKIRHGDYHFLAPWWNEISPEAQYCVSR 462

Query: 74  ILTVDPAARIKSREILKHPLLQKYPSI 100
           +L VDP  R    ++L  P L KY  I
Sbjct: 463 LLEVDPKKRYSIDDLLNDPWLNKYNDI 489

>Ecym_3035 Chr3 complement(70391..72613) [2223 bp, 740 aa] {ON}
           similar to Ashbya gossypii ACL006W
          Length = 740

 Score = 61.2 bits (147), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 38/120 (31%), Positives = 63/120 (52%), Gaps = 10/120 (8%)

Query: 13  HGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDEISPEAQDLIA 72
           H FE DVWS G++++ALL G+ PF  ++ N   +  +++   F  P    IS EA+ LI 
Sbjct: 249 HSFEVDVWSIGVMIYALLIGKPPFQAKEVN--TIYERIKVCDFNFPRDKPISSEAKVLIK 306

Query: 73  KILTVDPAARIKSREILKHPLLQKYPSIKDSKSIRNLPREDTYLNPLDSVNGSIDESIIN 132
            IL++DP  R    EI+++   +    ++ +  + N   E    + LD     + ES+IN
Sbjct: 307 DILSLDPLERPSLTEIMEYVWFRNVFPMRINGDVLNFVPE---YHDLD-----LQESLIN 358

>YOR233W Chr15 (775846..778248) [2403 bp, 800 aa] {ON}
           KIN4Serine/threonine protein kinase that inhibits the
           mitotic exit network (MEN) when the spindle position
           checkpoint is activated; localized asymmetrically to
           mother cell cortex, spindle pole body and bud neck
          Length = 800

 Score = 61.2 bits (147), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 31/91 (34%), Positives = 51/91 (56%), Gaps = 7/91 (7%)

Query: 12  YHGFESDVWSCGIILFALLTGRLPFDEEDGN-----IRNLLLKVQSGQFEMPDSDEISPE 66
           Y   ++DVWSCG+IL+A+L G LP+D++  N     I  L   +     + P+   I+P 
Sbjct: 228 YEARKADVWSCGVILYAMLAGYLPWDDDHENPTGDDIARLYKYITQTPLKFPEY--ITPI 285

Query: 67  AQDLIAKILTVDPAARIKSREILKHPLLQKY 97
            +DL+ +IL  +P  RI  + I +H  L+ +
Sbjct: 286 PRDLLRRILVPNPRRRINLQTIKRHVWLKPH 316

>ACL006W Chr3 (344395..346521) [2127 bp, 708 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR001C (CDC5)
          Length = 708

 Score = 60.8 bits (146), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 38/120 (31%), Positives = 62/120 (51%), Gaps = 10/120 (8%)

Query: 13  HGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDEISPEAQDLIA 72
           H FE D+WS G++++ALL G+ PF  ++ N   +  +++   F  P    IS EA+ LI 
Sbjct: 249 HSFEVDIWSIGVMIYALLIGKPPFQAKEVN--TIYERIKVCDFSFPKDKPISSEAKVLIK 306

Query: 73  KILTVDPAARIKSREILKHPLLQKYPSIKDSKSIRNLPREDTYLNPLDSVNGSIDESIIN 132
            IL++DP  R    EI+++   +     + +  I N   E    + LD     + ES+IN
Sbjct: 307 DILSLDPLERPSLAEIMEYVWFRNVFPARINGDILNFVPE---FHDLD-----LQESLIN 358

>KNAG0I01480 Chr9 (287733..289055) [1323 bp, 440 aa] {ON} Anc_1.374
           YFR014C
          Length = 440

 Score = 60.1 bits (144), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 46/84 (54%), Gaps = 2/84 (2%)

Query: 13  HGFESDVWSCGIILFALLTGRLPFDEED--GNIRNLLLKVQSGQFEMPDSDEISPEAQDL 70
           HG   D+WS GII + LL G  PF  ED  G +  ++   +   F  P  DEIS EA+  
Sbjct: 220 HGKPCDIWSVGIIAYTLLCGYSPFVAEDVDGFLDEIVENEEPIAFHSPYWDEISNEAKQF 279

Query: 71  IAKILTVDPAARIKSREILKHPLL 94
           I + +T+DP  R  + E+LK P +
Sbjct: 280 ILRAVTIDPFQRPTATELLKDPWI 303

>CAGL0F04741g Chr6 (478256..479584) [1329 bp, 442 aa] {ON} similar
           to uniprot|P22517 Saccharomyces cerevisiae YOL016c CMK2
           Ca2+/calmodulin-dependent ser/thr protein kinase type II
          Length = 442

 Score = 59.7 bits (143), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 36/110 (32%), Positives = 52/110 (47%), Gaps = 10/110 (9%)

Query: 13  HGFESDVWSCGIILFALLTGRLPFDEE--DGNIRNLLLKVQSGQFEMPDSDEISPEAQDL 70
           HG   D+WS G+I++ LL G   F  E  DG +           F  P  D IS EA++ 
Sbjct: 224 HGKPCDIWSIGVIVYTLLCGYSAFVAETVDGFLEECTQNKYPVTFHKPYWDNISDEAKNF 283

Query: 71  IAKILTVDPAARIKSREILKHPLLQK--------YPSIKDSKSIRNLPRE 112
           I + LT+DPA R  + E++K P +          YP I+    +R   R+
Sbjct: 284 ILRALTLDPAERPTAAELMKDPWITNTRPETANIYPEIRKGFDLRKKLRD 333

>SAKL0E01584g Chr5 complement(121830..123917) [2088 bp, 695 aa] {ON}
           highly similar to uniprot|P32562 Saccharomyces
           cerevisiae YMR001C
          Length = 695

 Score = 60.1 bits (144), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 35/121 (28%), Positives = 63/121 (52%), Gaps = 12/121 (9%)

Query: 13  HGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDEISPEAQDLIA 72
           H +E D+WS G++++ALL G+ PF  ++ NI  +  +++SG +  P     S E   LI 
Sbjct: 253 HSYEVDIWSIGVMIYALLIGKPPFQAKEVNI--IYERIKSGDYIFPREKPTSKEVMVLIQ 310

Query: 73  KILTVDPAARIKSREILKHPLLQK-YPSIKDSKSIRNLPREDTYLNPLDSVNGSIDESII 131
            IL++DP  R    EI+ +   +  +P+  +   + ++P  D         N  +D+S+ 
Sbjct: 311 DILSIDPIERPSLDEIMDYVWFRGIFPARINGDVLTSVPVYD---------NLDMDQSLA 361

Query: 132 N 132
           N
Sbjct: 362 N 362

>ZYRO0C07480g Chr3 (565426..567750) [2325 bp, 774 aa] {ON} highly
           similar to uniprot|P32562 Saccharomyces cerevisiae
           YMR001C
          Length = 774

 Score = 60.1 bits (144), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 37/127 (29%), Positives = 65/127 (51%), Gaps = 13/127 (10%)

Query: 13  HGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDEISPEAQDLIA 72
           H +E DVWS G++++ALL G+ PF  +D N   +  +++   F  P    IS EA+ L+ 
Sbjct: 321 HSYEVDVWSIGVMVYALLVGKPPFQAKDVN--TIYERIKCCDFIFPKEKPISHEAKVLVQ 378

Query: 73  KILTVDPAARIKSREILKHPLLQK-YPSIKDSKSIRNLPREDTYLNPLDSVNGSIDESII 131
            +L++DP  R    EI+ +   +  +P    S  +  +P  +  +        +++ES I
Sbjct: 379 DLLSLDPLERPSISEIMDYVWFRGIFPPYIQSNVMTEVPYYENRI--------TLEESFI 430

Query: 132 N--NLVV 136
           N  N V+
Sbjct: 431 NFKNCVI 437

>CAGL0J11638g Chr10 complement(1130744..1132984) [2241 bp, 746 aa]
           {ON} highly similar to uniprot|P32562 Saccharomyces
           cerevisiae YMR001c CDC5 involved in regulation of DNA
           replication
          Length = 746

 Score = 60.1 bits (144), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 48/79 (60%), Gaps = 2/79 (2%)

Query: 13  HGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDEISPEAQDLIA 72
           H +E D+WS G++L+ALL G+ PF  +D N   +  +++   F  P   +IS +A+ LI 
Sbjct: 257 HSYEVDIWSIGVMLYALLIGKPPFQAKDVN--TIYERIKQRNFAYPKDKKISQDAKYLID 314

Query: 73  KILTVDPAARIKSREILKH 91
            IL+++P  R   +EI+ +
Sbjct: 315 DILSLNPMERPSIQEIMDY 333

>TDEL0G04380 Chr7 (792278..794446) [2169 bp, 722 aa] {ON} Anc_6.31
           YMR001C
          Length = 722

 Score = 60.1 bits (144), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 46/79 (58%), Gaps = 2/79 (2%)

Query: 13  HGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDEISPEAQDLIA 72
           H +E D+WS G++++ALL G+ PF  +D N   +  +++   F  P    IS EA+ L+ 
Sbjct: 277 HSYEVDIWSIGVMIYALLIGKPPFQAKDVN--TIYERIKCCDFVFPKEKYISSEARILVQ 334

Query: 73  KILTVDPAARIKSREILKH 91
            +L++DP  R    E+L +
Sbjct: 335 DLLSLDPLERPSIMEVLDY 353

>NDAI0H00940 Chr8 complement(209645..211702) [2058 bp, 685 aa] {ON}
           Anc_5.611
          Length = 685

 Score = 59.7 bits (143), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 36/98 (36%), Positives = 54/98 (55%), Gaps = 5/98 (5%)

Query: 12  YHGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDEISPEAQDLI 71
           Y G E DVWS G+IL+ +L  RLPFD+E  +I  L   + +G + +P    +S  A  LI
Sbjct: 234 YAGPEVDVWSSGVILYVMLCRRLPFDDE--SIPVLFKNINNGVYTIPKF--LSQGASSLI 289

Query: 72  AKILTVDPAARIKSREILKHPLLQ-KYPSIKDSKSIRN 108
            ++L V+P  RI   EI++    +   P    S+ +RN
Sbjct: 290 KRMLIVNPLNRISISEIMQDEWFKVDLPEYLLSQDLRN 327

>KLTH0A06776g Chr1 complement(562932..567503) [4572 bp, 1523 aa] {ON}
            similar to uniprot|P53599 Saccharomyces cerevisiae
            YNR031C SSK2 Suppressor of Sensor Kinase (SLN1) A MAP
            kinase kinase kinase activator of Pbs2p
          Length = 1523

 Score = 60.1 bits (144), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 29/79 (36%), Positives = 44/79 (55%), Gaps = 2/79 (2%)

Query: 17   SDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQF-EMPDSDEISPEAQDLIAKIL 75
            SD+WS G ++  + TGR P+   D N   ++  V +G   ++P  DEISP+  D + K L
Sbjct: 1427 SDIWSLGCVILEMATGRRPWFNLD-NEWAIMYHVAAGHVPQLPSRDEISPQGTDFLLKCL 1485

Query: 76   TVDPAARIKSREILKHPLL 94
              DP  R  + E+L HP +
Sbjct: 1486 KQDPDKRATAMELLVHPWM 1504

>KLLA0F12188g Chr6 (1122745..1124385) [1641 bp, 546 aa] {ON} some
           similarities with uniprot|P38623 Saccharomyces
           cerevisiae YLR248W RCK2 Protein kinase involved in the
           response to oxidative stress identified as suppressor of
           S. pombe cell cycle checkpoint mutations
          Length = 546

 Score = 58.9 bits (141), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 30/90 (33%), Positives = 49/90 (54%), Gaps = 4/90 (4%)

Query: 13  HGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEM--PDSDEISPEAQDL 70
           +  + D+W  G +L+ +L G  PF +E   I  L  K+  G++    P  D+IS  A++ 
Sbjct: 352 YSMQVDMWGVGCVLYTVLCGFPPFFDE--KIDVLTEKISRGEYTFLRPWWDQISDGAKNC 409

Query: 71  IAKILTVDPAARIKSREILKHPLLQKYPSI 100
           + K+L VDPA R  S ++L+ P L  Y  +
Sbjct: 410 VRKLLEVDPAKRYTSEQLLQDPWLNSYDCL 439

>Kwal_56.24091 s56 (845680..846825) [1146 bp, 381 aa] {ON} YPL209C
           (IPL1) - Protein kinase [contig 166] FULL
          Length = 381

 Score = 58.2 bits (139), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 26/79 (32%), Positives = 47/79 (59%), Gaps = 4/79 (5%)

Query: 18  DVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDEISPEAQDLIAKILTV 77
           DVW+ G++ + LL G  PF+E+   +     ++       PD  ++SP A+DLI+++L  
Sbjct: 302 DVWALGVLTYELLVGSPPFEEDTKEL--TYKRIIKRDLRFPD--QVSPHARDLISRLLEY 357

Query: 78  DPAARIKSREILKHPLLQK 96
           DP  RI  +++ +HP ++K
Sbjct: 358 DPQNRIPLKDVKRHPWIKK 376

>KLLA0C06138g Chr3 (540409..542535) [2127 bp, 708 aa] {ON} similar
           to uniprot|P32562 Saccharomyces cerevisiae YMR001C
          Length = 708

 Score = 58.9 bits (141), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 36/121 (29%), Positives = 64/121 (52%), Gaps = 12/121 (9%)

Query: 13  HGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDEISPEAQDLIA 72
           H +E D+WS G++L+ALL G+ PF  ++  +  +  +++   F  P    +S +A++LI+
Sbjct: 266 HSYEVDIWSIGVMLYALLFGKPPFQAKE--VETIYERIKCRDFIFPADKPVSSDAKNLIS 323

Query: 73  KILTVDPAARIKSREILKHPLLQK-YPSIKDSKSIRNLPREDTYLNPLDSVNGSIDESII 131
            +L ++PAAR    EI  +   +  +PS   S   + +P  D         + S  ES+I
Sbjct: 324 HLLQLNPAARPSLYEITDNVWFRNTFPSRLPSTITKEIPNFD---------HLSFSESLI 374

Query: 132 N 132
           N
Sbjct: 375 N 375

>NDAI0C02680 Chr3 complement(621951..624203) [2253 bp, 750 aa] {ON}
           Anc_6.31
          Length = 750

 Score = 58.5 bits (140), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 25/70 (35%), Positives = 44/70 (62%), Gaps = 2/70 (2%)

Query: 13  HGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDEISPEAQDLIA 72
           H FE D+WS G++++ALL G+ PF  +D N+  +  +++  ++  P    +S EA+ LI 
Sbjct: 271 HSFEVDIWSIGVMIYALLVGKPPFQAKDVNV--IYERIKLCKYGYPKDKYVSKEAEILIH 328

Query: 73  KILTVDPAAR 82
            IL+++P  R
Sbjct: 329 DILSLNPLQR 338

>TPHA0O00670 Chr15 (125331..127088) [1758 bp, 585 aa] {ON} Anc_1.390
           YLR248W
          Length = 585

 Score = 58.5 bits (140), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 31/92 (33%), Positives = 49/92 (53%), Gaps = 4/92 (4%)

Query: 13  HGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEM--PDSDEISPEAQDL 70
           +  + D+W  G +L+ +L G  PF +E  N+  L  K+ +G F    P  DEIS  A+  
Sbjct: 378 YSMKVDMWGIGCVLYTILCGFPPFYDEKINV--LTEKIANGNFTFLNPWWDEISDGAKHA 435

Query: 71  IAKILTVDPAARIKSREILKHPLLQKYPSIKD 102
           ++K+L V+P  R  + E L  P L  Y  +K+
Sbjct: 436 VSKLLEVNPENRYDADEFLNDPWLNNYDCLKN 467

>ZYRO0A05544g Chr1 (450809..452704) [1896 bp, 631 aa] {ON} highly
           similar to uniprot|P06782 Saccharomyces cerevisiae
           YDR477W SNF1 Protein serine/threonine kinase required
           for release from glucose repression invertase expression
           sporulation and for expression of catabolite- repressed
           genes when glucose is limiting regulates Adr1p-
           dependent transcription primarily at the level of
           chromatin binding
          Length = 631

 Score = 58.5 bits (140), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 32/79 (40%), Positives = 47/79 (59%), Gaps = 4/79 (5%)

Query: 12  YHGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDEISPEAQDLI 71
           Y G E DVWS G+IL+ +L  RLPFD+E  +I  L   + +G + +P    +S  A  LI
Sbjct: 224 YAGPEVDVWSSGVILYVMLCRRLPFDDE--SIPVLFKNISNGVYTLPKF--LSEGAAGLI 279

Query: 72  AKILTVDPAARIKSREILK 90
            ++L V+P  RI   EI++
Sbjct: 280 KRMLIVNPLNRISILEIMQ 298

>Kpol_1018.54 s1018 (163688..166192) [2505 bp, 834 aa] {ON}
           (163688..166192) [2505 nt, 835 aa]
          Length = 834

 Score = 58.2 bits (139), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 45/81 (55%), Gaps = 2/81 (2%)

Query: 14  GFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDEISPEAQDLIAK 73
           G+ SD+W+ G ++F  L G  PF  E  N      K+ + +++  D  +IS   +DL+ K
Sbjct: 211 GYGSDIWALGCMIFQFLEGLPPFRGE--NELKTFEKIVALEYKWSDQFKISSLVKDLVRK 268

Query: 74  ILTVDPAARIKSREILKHPLL 94
           ILTV+P  RI   EI KH  L
Sbjct: 269 ILTVNPQDRITLSEIKKHSWL 289

>TDEL0B06160 Chr2 complement(1086672..1088327) [1656 bp, 551 aa]
           {ON} Anc_1.390 YLR248W
          Length = 551

 Score = 57.8 bits (138), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 51/94 (54%), Gaps = 4/94 (4%)

Query: 13  HGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQ--FEMPDSDEISPEAQDL 70
           +  E D+W  G +L+ +L G  PF +E  +I  L  K+  G+  F  P  DEIS  A++ 
Sbjct: 338 YSMEVDMWGIGCVLYTVLCGFPPFYDEKIDI--LTEKIARGEYTFLQPWWDEISDGAKNC 395

Query: 71  IAKILTVDPAARIKSREILKHPLLQKYPSIKDSK 104
           + K+L VDPA R    ++L    L  Y S+++ K
Sbjct: 396 VRKLLEVDPAKRYSIDDLLNDEWLNTYDSVRELK 429

>KLTH0H03982g Chr8 complement(363432..364628) [1197 bp, 398 aa] {ON}
           similar to uniprot|P38991 Saccharomyces cerevisiae
           YPL209C IPL1 Aurora kinase involved in regulating
           kinetochore-microtubule attachments associates with
           Sli5p which stimulates Ipl1p kinase activity and
           promotes its association with the mitotic spindle
           potential Cdc28p substrate
          Length = 398

 Score = 57.0 bits (136), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/79 (36%), Positives = 47/79 (59%), Gaps = 4/79 (5%)

Query: 18  DVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDEISPEAQDLIAKILTV 77
           DVW+ G++ + LL G  PF E+   +    +K +  +F     D IS +A+D+I+K+L  
Sbjct: 319 DVWALGVLTYELLVGTPPFLEDSKEMTYKRIKRRDLKF----PDHISSQARDIISKLLEY 374

Query: 78  DPAARIKSREILKHPLLQK 96
           +P ARI  R++ KHP + K
Sbjct: 375 EPNARIALRDVKKHPWILK 393

>NDAI0G03110 Chr7 complement(725984..731107) [5124 bp, 1707 aa] {ON}
            Anc_8.34
          Length = 1707

 Score = 58.2 bits (139), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 51/90 (56%), Gaps = 8/90 (8%)

Query: 14   GFESDVWSCGIILFALLTGRLPFDEE--DGNIRNLLL-KVQSGQFEMPDS--DEISPEAQ 68
            G   D WS G ILF L+ G  PF     +G  + +L  K++  +F+ P+   D ISPEA+
Sbjct: 1107 GDHCDWWSVGCILFELIFGYPPFHTSTPEGVFKKILAGKIEWPKFKSPEEERDFISPEAK 1166

Query: 69   DLIAKILTVDPAARIKS---REILKHPLLQ 95
            DLI K+LTVD + R+ +    EI  HP  +
Sbjct: 1167 DLILKLLTVDVSKRLGTNGAEEIKAHPYFK 1196

>Kpol_1023.26 s1023 (51805..54024) [2220 bp, 739 aa] {ON}
           (51805..54024) [2220 nt, 740 aa]
          Length = 739

 Score = 57.0 bits (136), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 47/79 (59%), Gaps = 2/79 (2%)

Query: 13  HGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDEISPEAQDLIA 72
           H FE D+WS G+++FA++TG+ PF  ++  +  +  +++   +  P    +S + + LI 
Sbjct: 275 HSFEVDIWSLGVMIFAMITGKPPFQAKE--VSTIYDRIKHCNYSFPTDKYVSKDVKKLIQ 332

Query: 73  KILTVDPAARIKSREILKH 91
            IL+++P  R   +EIL +
Sbjct: 333 DILSMNPMERPTIQEILNY 351

>TPHA0N00370 Chr14 (68298..69650) [1353 bp, 450 aa] {ON} Anc_7.41
           YOR351C
          Length = 450

 Score = 56.6 bits (135), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 31/87 (35%), Positives = 47/87 (54%), Gaps = 3/87 (3%)

Query: 13  HGFESDVWSCGIILFALLTGRLPFDEEDGNIRNL--LLKVQSGQFEMPDSDEISPEAQDL 70
           +  + D+WS G+I   +LTG  PF   DGN  N+  L ++    FE+     IS EAQ  
Sbjct: 353 YDMKCDMWSLGVIAHIMLTGISPF-YGDGNEMNIVKLSRIGKLNFELKQWGGISVEAQSF 411

Query: 71  IAKILTVDPAARIKSREILKHPLLQKY 97
           +A +L VD   R+ S++   HP + K+
Sbjct: 412 VASLLHVDTKERMDSKQCFDHPWILKH 438

>NCAS0A08770 Chr1 complement(1733181..1734890) [1710 bp, 569 aa]
           {ON} Anc_1.390
          Length = 569

 Score = 56.6 bits (135), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/95 (30%), Positives = 51/95 (53%), Gaps = 4/95 (4%)

Query: 12  YHGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEM--PDSDEISPEAQD 69
           ++  + D+W  G +L+ +L G  PF +E  ++  L  K+  G++    P  DEIS  A++
Sbjct: 355 HYSMKVDMWGVGCVLYTMLCGFPPFYDEKIDV--LTEKISRGEYTFLRPWWDEISAGAKN 412

Query: 70  LIAKILTVDPAARIKSREILKHPLLQKYPSIKDSK 104
            + ++L VDP  R    E L+ P L  Y  +K+ +
Sbjct: 413 AVIRLLEVDPNKRYDIDEFLEDPWLNTYDCLKEQE 447

>Ecym_1313 Chr1 complement(633556..634455) [900 bp, 299 aa] {ON}
           similar to Ashbya gossypii AAL029W
          Length = 299

 Score = 55.8 bits (133), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 42/85 (49%)

Query: 13  HGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDEISPEAQDLIA 72
           +  + D+W  G +L+ +L G  PF +E  ++   L+      F  P  DEISP A+  + 
Sbjct: 93  YSMKVDMWGIGCVLYTVLCGFPPFYDEKIDVLTELISKGQYTFLRPWWDEISPGAKMAVR 152

Query: 73  KILTVDPAARIKSREILKHPLLQKY 97
           K+L VDP  R    E L  P L  Y
Sbjct: 153 KLLEVDPEKRYDIDEFLNDPWLNTY 177

>NDAI0G05300 Chr7 (1289208..1290521) [1314 bp, 437 aa] {ON}
           Anc_1.374
          Length = 437

 Score = 56.6 bits (135), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 30/84 (35%), Positives = 44/84 (52%), Gaps = 2/84 (2%)

Query: 13  HGFESDVWSCGIILFALLTGRLPFDEE--DGNIRNLLLKVQSGQFEMPDSDEISPEAQDL 70
           HG   D+WS G+I + LL+G   F  E  +G +          +F  P  D IS EA+D 
Sbjct: 231 HGKPCDIWSLGVITYTLLSGYSAFIAESVEGFLEECTRSTYPVKFHSPYWDNISQEAKDF 290

Query: 71  IAKILTVDPAARIKSREILKHPLL 94
           I + LT+DP  R  + E+L+ P +
Sbjct: 291 ILRALTIDPNDRPTAEELLQDPWI 314

>KNAG0F02900 Chr6 (549477..551426) [1950 bp, 649 aa] {ON} 
          Length = 649

 Score = 56.6 bits (135), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 30/86 (34%), Positives = 47/86 (54%), Gaps = 5/86 (5%)

Query: 15  FESDVWSCGIILFALLTGRLPFDEEDGNIRN-----LLLKVQSGQFEMPDSDEISPEAQD 69
           F  D+WS GI+L++LL G  PF +    + N     L+ ++ SG  E P +  +   AQ 
Sbjct: 231 FPIDIWSMGIVLYSLLYGINPFIKSVDELHNVSLDELMQRITSGVIEFPTNKAVGAGAQQ 290

Query: 70  LIAKILTVDPAARIKSREILKHPLLQ 95
           LI K+L+ +P  RI   EI+  P ++
Sbjct: 291 LILKMLSQNPLERITLVEIVCDPWIR 316

>YFL033C Chr6 complement(69115..74427) [5313 bp, 1770 aa] {ON}
            RIM15Glucose-repressible protein kinase involved in
            signal transduction during cell proliferation in response
            to nutrients, specifically the establishment of
            stationary phase; identified as a regulator of IME2;
            substrate of Pho80p-Pho85p kinase
          Length = 1770

 Score = 57.0 bits (136), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 33/90 (36%), Positives = 47/90 (52%), Gaps = 12/90 (13%)

Query: 16   ESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDE-------ISPEAQ 68
            + D WS G I F LL G  PF  E  +   +  K+ SG  + P+          ++PEA+
Sbjct: 1168 QCDWWSVGCIFFELLLGYPPFHAETPDA--VFKKILSGVIQWPEFKNEEEEREFLTPEAK 1225

Query: 69   DLIAKILTVDPAARIKSR---EILKHPLLQ 95
            DLI K+L VDPA R+ ++   EI  HP  +
Sbjct: 1226 DLIEKLLVVDPAKRLGAKGIQEIKDHPYFK 1255

>KLLA0D07348g Chr4 (626999..629728) [2730 bp, 909 aa] {ON} similar
           to uniprot|Q03002 Saccharomyces cerevisiae YPL141C
           Hypothetical ORF
          Length = 909

 Score = 57.0 bits (136), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 32/91 (35%), Positives = 50/91 (54%), Gaps = 7/91 (7%)

Query: 12  YHGFESDVWSCGIILFALLTGRL-----PFDEEDGNIRNLLLKVQSGQFEMPDSDEISPE 66
           Y   ++DVWSCG+IL+A+L G L     P + +  +I  L   +     + P  + I+P 
Sbjct: 236 YEARKADVWSCGVILYAMLAGYLPWDDDPDNPDGDDIAKLYNYITKTSLKFP--EYINPI 293

Query: 67  AQDLIAKILTVDPAARIKSREILKHPLLQKY 97
            +D++ +IL  DP+ RI    ILKH  LQ +
Sbjct: 294 PRDILRRILVSDPSKRITVELILKHQWLQPH 324

>Skud_12.329 Chr12 (580813..582645) [1833 bp, 610 aa] {ON} YLR248W
           (REAL)
          Length = 610

 Score = 56.6 bits (135), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 28/91 (30%), Positives = 49/91 (53%), Gaps = 4/91 (4%)

Query: 12  YHGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEM--PDSDEISPEAQD 69
           ++  + D+W  G +L+ +L G  PF +E   I  L  K+  G++    P  DEISP A++
Sbjct: 396 HYSMKVDMWGIGCVLYTMLCGFPPFYDE--KIDTLTEKISRGEYTFLKPWWDEISPGAKN 453

Query: 70  LIAKILTVDPAARIKSREILKHPLLQKYPSI 100
            + K+L ++P+ R    ++L  P L  Y  +
Sbjct: 454 AVVKLLELEPSRRYDIDQLLDDPWLNSYDCL 484

>KLLA0F11143g Chr6 complement(1026129..1028570) [2442 bp, 813 aa]
           {ON} similar to uniprot|P22216 Saccharomyces cerevisiae
           YPL153C RAD53 Protein kinase required for cell-cycle
           arrest in response to DNA damage activated by trans
           autophosphorylation when interacting with
           hyperphosphorylated Rad9p
          Length = 813

 Score = 56.6 bits (135), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 48/80 (60%), Gaps = 4/80 (5%)

Query: 18  DVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQF-EMPDSD-EISPEAQDLIAKIL 75
           D+WS G +++ +LTG LPF  +  N   L  +++ G + E P  D  IS EA++ I  +L
Sbjct: 380 DMWSIGCLVYVILTGHLPFSGQSQN--ELFKQIKRGSYHEGPLKDYRISEEARNFIDCLL 437

Query: 76  TVDPAARIKSREILKHPLLQ 95
            VDP  R+ + + L+HP ++
Sbjct: 438 NVDPKERMNAGKALQHPWMK 457

>AFL101C Chr6 complement(249144..250247) [1104 bp, 367 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL209C
           (IPL1)
          Length = 367

 Score = 55.8 bits (133), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 29/86 (33%), Positives = 45/86 (52%), Gaps = 18/86 (20%)

Query: 18  DVWSCGIILFALLTGRLPFDEEDGNI-------RNLLLKVQSGQFEMPDSDEISPEAQDL 70
           DVW+ G++ + LL G  PF+EE   +       RNL+             D +  EA+ L
Sbjct: 288 DVWALGVLTYELLVGSPPFEEESKELTYKRILKRNLIF-----------PDHVDTEARHL 336

Query: 71  IAKILTVDPAARIKSREILKHPLLQK 96
           I+++L  DP  RI  +E+ KHP ++K
Sbjct: 337 ISRLLEYDPGDRIPLKEVKKHPWIEK 362

>Kwal_26.8796 s26 (946406..948796) [2391 bp, 796 aa] {ON} YPL153C
           (RAD53) - protein kinase, Mec1p and Tel1p regulate
           rad53p phosphorylation [contig 68] FULL
          Length = 796

 Score = 56.2 bits (134), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 49/81 (60%), Gaps = 6/81 (7%)

Query: 18  DVWSCGIILFALLTGRLPFDEEDGNIRNLLLK-VQSGQF-EMPDSD-EISPEAQDLIAKI 74
           D+WS G +++ +LTG LPF    G+ +N L K + +G + E P  D  IS +A+D I   
Sbjct: 375 DMWSIGCLVYVILTGHLPFS---GSTQNDLYKQITAGSYHEGPLKDYRISDDARDFIESF 431

Query: 75  LTVDPAARIKSREILKHPLLQ 95
           L VDP  R+ + + L+HP ++
Sbjct: 432 LQVDPRNRMTAEQALRHPWIK 452

>Smik_6.350 Chr6 (559997..562465) [2469 bp, 822 aa] {ON} YPL153C
           (REAL)
          Length = 822

 Score = 56.2 bits (134), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 50/84 (59%), Gaps = 6/84 (7%)

Query: 18  DVWSCGIILFALLTGRLPFDEEDGNIRNLLLK-VQSGQF-EMPDSD-EISPEAQDLIAKI 74
           D+WS G +++ +LTG LPF    G+ ++ L K +  G + E P  D  IS EA+D I  +
Sbjct: 390 DMWSMGCLVYVILTGHLPFS---GSTQDQLYKQIGRGSYHEGPLKDFRISEEARDFIDSL 446

Query: 75  LTVDPAARIKSREILKHPLLQKYP 98
           L VDP+ R+ + + L HP ++  P
Sbjct: 447 LQVDPSNRLTAAKALDHPWIKMGP 470

>Suva_16.97 Chr16 complement(165977..167083) [1107 bp, 368 aa] {ON}
           YPL209C (REAL)
          Length = 368

 Score = 55.5 bits (132), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 46/77 (59%), Gaps = 4/77 (5%)

Query: 18  DVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDEISPEAQDLIAKILTV 77
           DVW+ G++ F LLTG  PF+EE  +      ++ +   + P++  IS +AQDLI K+L  
Sbjct: 284 DVWALGVLTFELLTGAPPFEEEMKD--TTYKRIAALDIKFPNN--ISQDAQDLILKLLKY 339

Query: 78  DPAARIKSREILKHPLL 94
           DP  R++  ++  HP +
Sbjct: 340 DPKERMRLEDVKMHPWI 356

>Suva_16.157 Chr16 complement(270891..273389) [2499 bp, 832 aa] {ON}
           YPL153C (REAL)
          Length = 832

 Score = 56.2 bits (134), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 51/89 (57%), Gaps = 6/89 (6%)

Query: 18  DVWSCGIILFALLTGRLPFDEEDGNIRNLLLK-VQSGQF-EMPDSD-EISPEAQDLIAKI 74
           D+WS G +++ +LTG LPF    G+ ++ L K +  G + E P  D  IS EA+D I  +
Sbjct: 390 DMWSMGCLVYVILTGHLPFS---GSTQDQLYKQIGRGSYHEGPLKDFRISEEARDFIDSL 446

Query: 75  LTVDPAARIKSREILKHPLLQKYPSIKDS 103
           L VDP  R+ + + L HP ++  P +  S
Sbjct: 447 LQVDPNNRLTAAKALCHPWIKMNPLVSQS 475

>Suva_10.345 Chr10 (601536..603365) [1830 bp, 609 aa] {ON} YLR248W
           (REAL)
          Length = 609

 Score = 55.8 bits (133), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 28/91 (30%), Positives = 48/91 (52%), Gaps = 4/91 (4%)

Query: 12  YHGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEM--PDSDEISPEAQD 69
           ++  + D+W  G +L+ +L G  PF +E   I  L  K+  G++    P  DEISP A++
Sbjct: 395 HYSMKVDMWGIGCVLYTMLCGFPPFYDE--KIDTLTEKISRGEYTFLKPWWDEISPGAKN 452

Query: 70  LIAKILTVDPAARIKSREILKHPLLQKYPSI 100
            + K+L ++P+ R    + L  P L  Y  +
Sbjct: 453 AVGKLLELEPSRRYDIDQFLDDPWLNSYDCL 483

>AAL029W Chr1 (289989..291593) [1605 bp, 534 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR248W (RCK2) and
           YGL158W (RCK1)
          Length = 534

 Score = 55.8 bits (133), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 28/85 (32%), Positives = 43/85 (50%)

Query: 13  HGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDEISPEAQDLIA 72
           +  + D+W  G +L+ +L G  PF +E  ++   L+      F  P  DEISP A++ + 
Sbjct: 327 YSMKVDMWGIGCVLYTVLCGFPPFYDEKIDVLTELISKGQYTFLRPWWDEISPGAKNAVR 386

Query: 73  KILTVDPAARIKSREILKHPLLQKY 97
           ++L VDP  R    E L  P L  Y
Sbjct: 387 RLLEVDPDKRYDIDEFLADPWLNSY 411

>TBLA0D04420 Chr4 complement(1097314..1099356) [2043 bp, 680 aa]
           {ON} Anc_1.390 YLR248W
          Length = 680

 Score = 55.8 bits (133), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 30/98 (30%), Positives = 51/98 (52%), Gaps = 4/98 (4%)

Query: 13  HGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEM--PDSDEISPEAQDL 70
           +  + D+W  G +L+ +L G  PF +E  +I  L  K+ +G++    P  DEIS  A++ 
Sbjct: 394 YSMKVDMWGVGCVLYTMLCGFPPFYDERIDI--LTEKIANGEYTFLKPWWDEISDGAKNA 451

Query: 71  IAKILTVDPAARIKSREILKHPLLQKYPSIKDSKSIRN 108
           + ++L VDP  R    E L  P L+ Y    + +  +N
Sbjct: 452 VRRLLEVDPNKRYDVDEFLNDPWLKNYDCFTEQERQQN 489

>Kwal_0.155 s0 (84856..86619) [1764 bp, 587 aa] {ON} YLR248W (RCK2)
           - 1:1 [contig 80] FULL
          Length = 587

 Score = 55.5 bits (132), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 30/91 (32%), Positives = 47/91 (51%), Gaps = 4/91 (4%)

Query: 13  HGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEM--PDSDEISPEAQDL 70
           +  + D+W  G +L+ +L G  PF +E   I  L  K+  G+F    P  DEIS  A++ 
Sbjct: 382 YSMQVDMWGIGCVLYTVLCGFPPFYDE--KIDVLTEKISRGEFTFLRPWWDEISDGAKNA 439

Query: 71  IAKILTVDPAARIKSREILKHPLLQKYPSIK 101
           + ++L VDP+ R    E L  P L  Y  ++
Sbjct: 440 VRRLLEVDPSKRYTIDEFLADPWLNSYDCLR 470

>Kpol_1069.13 s1069 complement(27223..28506) [1284 bp, 427 aa] {ON}
           complement(27223..28506) [1284 nt, 428 aa]
          Length = 427

 Score = 55.5 bits (132), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 30/86 (34%), Positives = 47/86 (54%), Gaps = 6/86 (6%)

Query: 13  HGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSG----QFEMPDSDEISPEAQ 68
           HG   D+WS G+I + LL G  PF  E  ++   L +  SG    +F  P  D IS EA+
Sbjct: 217 HGKPCDIWSLGVITYTLLCGYSPFIAE--SVEGFLDECTSGKYPVKFHRPYWDTISDEAK 274

Query: 69  DLIAKILTVDPAARIKSREILKHPLL 94
           + I + L ++P+ R  + E+L+ P +
Sbjct: 275 EFILRALILEPSKRPTASELLEDPWI 300

>KNAG0E03200 Chr5 complement(641437..646020) [4584 bp, 1527 aa] {ON}
            Anc_8.34 YFL033C
          Length = 1527

 Score = 55.8 bits (133), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 43/124 (34%), Positives = 61/124 (49%), Gaps = 22/124 (17%)

Query: 17   SDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPD-------SDEISPEAQD 69
             D WS G I F LL G  PF         +  K+ S   + P+        + I+PEA+D
Sbjct: 924  CDWWSVGCIFFELLLGYPPF--HASTPERVFQKILSCDVQWPEFSSLEEEREVITPEAKD 981

Query: 70   LIAKILTVDPAARIKSR---EILKHPLLQ--KYPSIKDSK-----SIRNLPREDT-YLNP 118
            LI K+L +DP  R+ S    EI+KHP      + ++ DS+     SI N+  EDT Y +P
Sbjct: 982  LIIKLLELDPKKRLGSNGAIEIMKHPYFNGVDWDNVYDSEASFVPSIENM--EDTDYFDP 1039

Query: 119  LDSV 122
              +V
Sbjct: 1040 RGAV 1043

>CAGL0B03509g Chr2 complement(349638..351431) [1794 bp, 597 aa] {ON}
           similar to uniprot|P38623 Saccharomyces cerevisiae
           YLR248w RCK2 Ca/calmodulin-dependent or uniprot|P38622
           Saccharomyces cerevisiae YGL158w RCK1
          Length = 597

 Score = 55.5 bits (132), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 30/87 (34%), Positives = 44/87 (50%), Gaps = 4/87 (4%)

Query: 13  HGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEM--PDSDEISPEAQDL 70
           +  + D+W  G +L+ +L G  PF +E   I  L  K+  G++    P  DEISP A+  
Sbjct: 390 YSMQVDMWGIGCVLYTMLCGFPPFYDE--KIDVLTEKISRGEYTFLEPWWDEISPGAKHC 447

Query: 71  IAKILTVDPAARIKSREILKHPLLQKY 97
           + K+L VDP  R    E L  P L  +
Sbjct: 448 VKKLLEVDPRKRYTIDEFLADPWLNTF 474

>Kwal_14.1159 s14 complement(219896..224461) [4566 bp, 1521 aa] {ON}
            YFL033C (RIM15) - Trehalose-associated protein kinase
            related to S. pombe cek1+ [contig 244] FULL
          Length = 1521

 Score = 55.8 bits (133), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 31/89 (34%), Positives = 45/89 (50%), Gaps = 12/89 (13%)

Query: 17   SDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMP-------DSDEISPEAQD 69
            SD WS G +LF  + G  PF      +  +   + +G  + P       + + ISPEA+D
Sbjct: 979  SDWWSVGCMLFEFVFGYPPF--HASTVEEVFSNILAGNIDWPAFPDEATEREYISPEARD 1036

Query: 70   LIAKILTVDPAARI---KSREILKHPLLQ 95
            LI K+L VDP  R+    + EI +HP  Q
Sbjct: 1037 LIEKLLVVDPDKRLGANGAEEIFEHPYFQ 1065

>KLTH0H11858g Chr8 (1013677..1015374) [1698 bp, 565 aa] {ON} some
           similarities with uniprot|P38623 Saccharomyces
           cerevisiae YLR248W RCK2 Protein kinase involved in the
           response to oxidative stress identified as suppressor of
           S. pombe cell cycle checkpoint mutations
          Length = 565

 Score = 55.1 bits (131), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 30/91 (32%), Positives = 46/91 (50%), Gaps = 4/91 (4%)

Query: 13  HGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEM--PDSDEISPEAQDL 70
           +  + D+W  G +L+ +L G  PF +E   I  L  K+  G++    P  DEIS  A+  
Sbjct: 362 YSLQVDMWGIGCVLYTILCGFPPFYDE--KIDVLTEKISRGEYTFLRPWWDEISDGAKHA 419

Query: 71  IAKILTVDPAARIKSREILKHPLLQKYPSIK 101
           + K+L VDP+ R    E L  P L  Y  ++
Sbjct: 420 VRKLLEVDPSKRYNIDEFLADPWLNSYDCLR 450

>TBLA0A02050 Chr1 (495735..497039) [1305 bp, 434 aa] {ON} 
          Length = 434

 Score = 54.7 bits (130), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 28/106 (26%), Positives = 55/106 (51%), Gaps = 14/106 (13%)

Query: 1   MRRLRSCPVLPY----------HGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKV 50
           +RR   C  + Y          + +  D+W+ GI+ + L+ G  PF+EE  ++     ++
Sbjct: 328 LRRKTICGTIDYLAPELVTFKEYDYNVDIWALGILTYELIVGNPPFEEETKDLT--YKRI 385

Query: 51  QSGQFEMPDSDEISPEAQDLIAKILTVDPAARIKSREILKHPLLQK 96
            +     P +  +S +A+DLI ++L  DP+ R+   +++KHP + K
Sbjct: 386 INVDLNFPQT--VSMDARDLITRLLRFDPSKRMPLVDVMKHPWITK 429

>ACR142W Chr3 (597519..600032) [2514 bp, 837 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL153C (RAD53)
          Length = 837

 Score = 55.5 bits (132), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 49/86 (56%), Gaps = 6/86 (6%)

Query: 18  DVWSCGIILFALLTGRLPFDEEDGNIRNLLLK-VQSGQF-EMPDSDE-ISPEAQDLIAKI 74
           D+WS G +++ +LTG LPF    G+ +  L K + +G + E P  D  IS EA+D I  +
Sbjct: 406 DMWSIGCLVYVILTGHLPFS---GSTQEQLYKQIANGSYHEGPLKDYWISDEARDFIDSL 462

Query: 75  LTVDPAARIKSREILKHPLLQKYPSI 100
           L ++P  R+ +   L+HP L    SI
Sbjct: 463 LQINPVDRLTAERALQHPWLHPCTSI 488

>CAGL0K12562g Chr11 (1235695..1240743) [5049 bp, 1682 aa] {ON} similar
            to uniprot|P43565 Saccharomyces cerevisiae YFL033c RIM15
            protein kinase involved in expression of meiotic genes
          Length = 1682

 Score = 55.5 bits (132), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 37/92 (40%), Positives = 47/92 (51%), Gaps = 16/92 (17%)

Query: 16   ESDVWSCGIILFALLTGRLPFDEE--DGNIRNLLLKVQSGQFEMP--DSDE-----ISPE 66
            + D WS G ILF ++ G  PF  E  D   RN+L     G+ + P  DS E     ISPE
Sbjct: 1123 QCDWWSVGCILFEMVFGYPPFHAETPDQVFRNIL----EGKIDWPIFDSIEEEREYISPE 1178

Query: 67   AQDLIAKILTVDPAARI---KSREILKHPLLQ 95
            A+DLI K L  DP  R+    + EI  HP  +
Sbjct: 1179 AKDLIMKFLITDPHKRLGYNGTEEIKNHPYFK 1210

>Skud_15.144 Chr15 complement(254620..255969) [1350 bp, 449 aa] {ON}
           YOL016C (REAL)
          Length = 449

 Score = 54.7 bits (130), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 31/84 (36%), Positives = 42/84 (50%), Gaps = 2/84 (2%)

Query: 13  HGFESDVWSCGIILFALLTGRLPFDEE--DGNIRNLLLKVQSGQFEMPDSDEISPEAQDL 70
           HG   D+WS G+I + LL G  PF  E  +G +           F MP  D IS +A+  
Sbjct: 226 HGKPCDIWSIGVITYTLLCGYSPFIAESVEGFMEECTAYRYPVTFHMPYWDSISVDAKHF 285

Query: 71  IAKILTVDPAARIKSREILKHPLL 94
           I K L +DPA R  + E+L  P +
Sbjct: 286 ILKALRLDPADRPTATELLDDPWI 309

>KAFR0B05410 Chr2 complement(1111152..1112771) [1620 bp, 539 aa]
           {ON} Anc_8.279 YLR096W
          Length = 539

 Score = 54.7 bits (130), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 29/81 (35%), Positives = 50/81 (61%), Gaps = 6/81 (7%)

Query: 12  YHGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLK-VQSGQFEMPDSDEISPEAQDL 70
           Y G E D+WS G++L+ ++TG+LPF    G  +  L+K + SGQ + P+   +S +   L
Sbjct: 253 YIGPEVDIWSFGVVLYIMVTGKLPF---KGRSKGRLMKHILSGQVKFPNF--LSMDVISL 307

Query: 71  IAKILTVDPAARIKSREILKH 91
           +++IL +D + R    +I+KH
Sbjct: 308 LSRILEIDLSFRFSLSDIIKH 328

>KAFR0H02430 Chr8 complement(464446..466800) [2355 bp, 784 aa] {ON}
           Anc_8.676 YPL153C
          Length = 784

 Score = 55.1 bits (131), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 48/81 (59%), Gaps = 6/81 (7%)

Query: 18  DVWSCGIILFALLTGRLPFDEEDGNIRNLLLK-VQSGQF-EMPDSD-EISPEAQDLIAKI 74
           D+WS G +++ +LTG LPF    G+ +  L K +  G + E P  D  IS EA+D I  +
Sbjct: 377 DMWSMGCLVYVILTGHLPFS---GSTQEQLYKQISRGSYHEGPLKDYRISDEARDFIDSL 433

Query: 75  LTVDPAARIKSREILKHPLLQ 95
           L VDP+ R+ +   L+HP ++
Sbjct: 434 LQVDPSNRLTAARALEHPWIK 454

>TDEL0A06220 Chr1 (1088622..1091006) [2385 bp, 794 aa] {ON}
           Anc_8.676 YPL153C
          Length = 794

 Score = 54.7 bits (130), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 51/81 (62%), Gaps = 6/81 (7%)

Query: 18  DVWSCGIILFALLTGRLPFDEEDGNIRNLLLK-VQSGQF-EMPDSD-EISPEAQDLIAKI 74
           D+WS G +++ +LTG LPF    G+ +  L K +++G + E P  D  IS EA+D I  +
Sbjct: 382 DMWSMGCLVYVILTGHLPFS---GSTQEQLYKQIKNGSYHEGPLKDFRISDEARDFIDSL 438

Query: 75  LTVDPAARIKSREILKHPLLQ 95
           L V+P AR  +++ L+HP ++
Sbjct: 439 LQVNPNARPTAKKALEHPWIK 459

>Skud_16.129 Chr16 complement(233341..235824) [2484 bp, 827 aa] {ON}
           YPL153C (REAL)
          Length = 827

 Score = 54.7 bits (130), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 49/84 (58%), Gaps = 6/84 (7%)

Query: 18  DVWSCGIILFALLTGRLPFDEEDGNIRNLLLK-VQSGQF-EMPDSD-EISPEAQDLIAKI 74
           D+WS G +++ +LTG LPF    G+ ++ L K +  G + E P  D  IS EA+D I  +
Sbjct: 390 DMWSMGCLVYVILTGHLPFS---GSTQDQLYKQIGRGSYHEGPLKDFRISEEARDFIDLL 446

Query: 75  LTVDPAARIKSREILKHPLLQKYP 98
           L VDP  R+ + + L HP ++  P
Sbjct: 447 LQVDPNNRLTAAKALDHPWIKMNP 470

>KLTH0H11396g Chr8 complement(973355..974668) [1314 bp, 437 aa] {ON}
           similar to uniprot|P22517 Saccharomyces cerevisiae
           YOL016C CMK2 Calmodulin-dependent protein kinase and to
           YFR014C uniprot|P27466 Saccharomyces cerevisiae YFR014C
           CMK1 Calmodulin-dependent protein kinase
          Length = 437

 Score = 53.9 bits (128), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 30/86 (34%), Positives = 44/86 (51%), Gaps = 6/86 (6%)

Query: 13  HGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQ----FEMPDSDEISPEAQ 68
           HG   D+WS G++ + LL G  PF  E  ++   L +  SG+    F  P    IS +A+
Sbjct: 225 HGKPCDIWSLGVVTYTLLCGYSPFVAE--SVEGFLEECTSGRYPVTFHKPYWSSISDDAK 282

Query: 69  DLIAKILTVDPAARIKSREILKHPLL 94
           D I + LTV P  R  + E+L H  +
Sbjct: 283 DFILQALTVTPRYRPSATELLNHKWI 308

>KNAG0C01820 Chr3 (355604..357376) [1773 bp, 590 aa] {ON} 
          Length = 590

 Score = 54.3 bits (129), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 32/103 (31%), Positives = 51/103 (49%), Gaps = 5/103 (4%)

Query: 11  PYHGFESDVWSCGIILFALLTGRLPFD---EEDGNIRNLLLKVQSGQFEMPDSDEISPEA 67
           PY+   +D+WS GI  F L+TG +P++    ED N  + L     G  +M     +  + 
Sbjct: 253 PYYANVTDIWSIGIFTFVLITGAIPWELPAWEDVNYSSFL--ENDGNVDMGPWKRVDIQQ 310

Query: 68  QDLIAKILTVDPAARIKSREILKHPLLQKYPSIKDSKSIRNLP 110
             L+ KIL  DP+ RI   ++  HP   +   + +SK + N P
Sbjct: 311 LSLLRKILQQDPSERITLSKLRSHPWFTQKNKLMNSKGLCNDP 353

>NCAS0D04710 Chr4 complement(901442..903856) [2415 bp, 804 aa] {ON}
           Anc_6.371
          Length = 804

 Score = 54.7 bits (130), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 46/87 (52%), Gaps = 6/87 (6%)

Query: 13  HGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDEISPEAQDLIA 72
           H    D W+ GI++F +L G+ PF  +  N       + S  FE P+S++I+   ++LI 
Sbjct: 609 HTVAVDWWTLGILIFEMLFGKTPFKGDTTN--ETFANILSKDFEFPNSNDITRNCKNLIK 666

Query: 73  KILTVDPAARIKSR----EILKHPLLQ 95
           K+LT +   R+ S+    EI KH   +
Sbjct: 667 KLLTKNETKRLGSKMGAAEIKKHSFFK 693

>CAGL0M02233g Chr13 complement(267332..269635) [2304 bp, 767 aa]
           {ON} highly similar to uniprot|P22216 Saccharomyces
           cerevisiae YPL153c SPK1 ser/thr/tyr protein kinase
          Length = 767

 Score = 54.3 bits (129), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 33/92 (35%), Positives = 53/92 (57%), Gaps = 6/92 (6%)

Query: 18  DVWSCGIILFALLTGRLPFDEEDGNIRNLLL-KVQSGQF-EMPDSD-EISPEAQDLIAKI 74
           D+WS G ++F +LTG LPF    G+ +  L  +++ G + E P  D  IS EA+D I  +
Sbjct: 381 DMWSMGCLVFVILTGHLPF---SGSTQEQLYEQIRKGSYHEGPLKDFRISDEARDFIDGL 437

Query: 75  LTVDPAARIKSREILKHPLLQKYPSIKDSKSI 106
           L VD + R+   + L HP +++  S  D+ S+
Sbjct: 438 LQVDQSKRMTVDDALNHPWIKQCSSQFDANSM 469

>Ecym_2397 Chr2 complement(771343..773961) [2619 bp, 872 aa] {ON}
           similar to Ashbya gossypii ACR142W
          Length = 872

 Score = 54.3 bits (129), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 30/80 (37%), Positives = 46/80 (57%), Gaps = 4/80 (5%)

Query: 18  DVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQF-EMPDSD-EISPEAQDLIAKIL 75
           D+WS G +++ +LTG LPF         L  ++  G + E P  D +IS EA+D I  +L
Sbjct: 379 DMWSIGCLVYVILTGHLPF--SGSTQEQLYEQISRGSYHEGPLKDFKISDEARDFIDALL 436

Query: 76  TVDPAARIKSREILKHPLLQ 95
            V+P  R+ + + LKHP +Q
Sbjct: 437 QVNPRDRLTAAKALKHPWIQ 456

>SAKL0A04246g Chr1 complement(396019..397221) [1203 bp, 400 aa] {ON}
           similar to uniprot|P38991 Saccharomyces cerevisiae
           YPL209C IPL1 Aurora kinase involved in regulating
           kinetochore-microtubule attachments associates with
           Sli5p which stimulates Ipl1p kinase activity and
           promotes its association with the mitotic spindle
           potential Cdc28p substrate
          Length = 400

 Score = 53.9 bits (128), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 26/79 (32%), Positives = 46/79 (58%), Gaps = 4/79 (5%)

Query: 18  DVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDEISPEAQDLIAKILTV 77
           DVW+ G++ + LL G  PF+E    +    +  +  +F     D++S +A+DLI ++L  
Sbjct: 319 DVWALGVLAYELLVGTPPFEEASKELTYKRIVRRDLRF----PDQMSIDARDLIGRLLEN 374

Query: 78  DPAARIKSREILKHPLLQK 96
           DP+ RI  +++L HP + K
Sbjct: 375 DPSTRISLKDVLSHPWIVK 393

>YPL209C Chr16 complement(156490..157593) [1104 bp, 367 aa] {ON}
           IPL1Aurora kinase subunit of the conserved chromosomal
           passenger complex (CPC; Ipl1p-Sli15p-Bir1p-Nbl1p),
           involved in regulating kinetochore-microtubule
           attachments; helps maintain condensed chromosomes during
           anaphase and early telophase; required for SPB cohesion
           and prevention of multipolar spindle formation
          Length = 367

 Score = 53.5 bits (127), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 45/77 (58%), Gaps = 4/77 (5%)

Query: 18  DVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDEISPEAQDLIAKILTV 77
           D W+ G++ F LLTG  PF+EE  +      ++ +   +MP +  IS +AQDLI K+L  
Sbjct: 283 DAWALGVLAFELLTGAPPFEEEMKD--TTYKRIAALDIKMPSN--ISQDAQDLILKLLKY 338

Query: 78  DPAARIKSREILKHPLL 94
           DP  R++  ++  HP +
Sbjct: 339 DPKDRMRLGDVKMHPWI 355

>Kwal_23.6325 s23 complement(1533223..1537851) [4629 bp, 1542 aa] {ON}
            YNR031C (SSK2) - A MAP kinase kinase kinase; activator of
            Pbs2p [contig 17] FULL
          Length = 1542

 Score = 54.7 bits (130), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 44/79 (55%), Gaps = 2/79 (2%)

Query: 17   SDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQF-EMPDSDEISPEAQDLIAKIL 75
             D+WS G ++  ++TGR P+   D N   ++  V +G   ++P  +E+SP+  D + + L
Sbjct: 1443 GDIWSLGCVILEMVTGRRPWFNLD-NEWAIMYHVAAGHVPQLPTKEELSPQGIDFLLRCL 1501

Query: 76   TVDPAARIKSREILKHPLL 94
              DP  R  + E+L HP +
Sbjct: 1502 KQDPNKRSTAMELLLHPWM 1520

>SAKL0D07656g Chr4 complement(627469..628767) [1299 bp, 432 aa] {ON}
           similar to uniprot|P22517 Saccharomyces cerevisiae
           YOL016C CMK2 Calmodulin-dependent protein kinase and
           uniprot|P27466 Saccharomyces cerevisiae YFR014C CMK1
          Length = 432

 Score = 53.5 bits (127), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 41/136 (30%), Positives = 61/136 (44%), Gaps = 21/136 (15%)

Query: 13  HGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQ----FEMPDSDEISPEAQ 68
           HG   D+WS G+I + LL G  PF  E  ++   L +  SGQ    F  P  + IS EA+
Sbjct: 225 HGKPCDIWSIGVITYTLLCGYSPFIAE--SVDGFLEECTSGQYPVTFHKPYWNNISKEAK 282

Query: 69  DLIAKILTVDPAARIKSREILKHPLLQK--------YPSIKDSKSIRNLPRE-------D 113
             I ++LT+ P  R  + ++L    +           P I+   + RN  RE       +
Sbjct: 283 LFILRVLTISPKKRPTATDLLSDAWITSKTQQTNDLLPEIRKGFNARNKFREAVEIVKLN 342

Query: 114 TYLNPLDSVNGSIDES 129
             +  L S+ G  DES
Sbjct: 343 NRIKKLKSLYGQDDES 358

>Smik_6.46 Chr6 complement(84451..89733) [5283 bp, 1760 aa] {ON}
            YFL033C (REAL)
          Length = 1760

 Score = 54.3 bits (129), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 35/107 (32%), Positives = 50/107 (46%), Gaps = 18/107 (16%)

Query: 16   ESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDE-------ISPEAQ 68
            + D WS G I F LL G  PF  E  +   +  K+ SG  + P+          ++PEA+
Sbjct: 1158 QCDWWSVGCIFFELLLGYPPFHAETPDA--VFKKILSGVIQWPEFKNEEEEREFLTPEAK 1215

Query: 69   DLIAKILTVDPAARIKSREILKHPLLQKYPSIKDSKSIRNLPREDTY 115
            DLI K+L VDP+ R+    I +         IKD    +N+  E  Y
Sbjct: 1216 DLIEKLLVVDPSKRLGVNGIQE---------IKDQPYFKNVDWEHVY 1253

>TBLA0F00860 Chr6 (219628..222570) [2943 bp, 980 aa] {ON} Anc_3.162
           YDL028C
          Length = 980

 Score = 54.3 bits (129), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 44/87 (50%), Gaps = 8/87 (9%)

Query: 14  GFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEM------PDSDEISPEA 67
           G  SDVWSCG IL+ +  G+ P+    G  +N LL + + + E+      P+++ I   A
Sbjct: 848 GKPSDVWSCGCILYQMFYGKPPYGHYQG--QNRLLAIMNPEVEIKYPEFTPNNEPIPRSA 905

Query: 68  QDLIAKILTVDPAARIKSREILKHPLL 94
            D +   L  DP+ R    E+L +P  
Sbjct: 906 IDTMKACLYRDPSKRFTIEELLNNPFF 932

>TPHA0O01120 Chr15 complement(217462..218751) [1290 bp, 429 aa] {ON}
           Anc_1.374 YFR014C
          Length = 429

 Score = 53.5 bits (127), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 42/84 (50%), Gaps = 2/84 (2%)

Query: 13  HGFESDVWSCGIILFALLTGRLPFDEE--DGNIRNLLLKVQSGQFEMPDSDEISPEAQDL 70
           HG   D+WS G+I + LL+G   F  E  +G +           F  P  D+IS EA+  
Sbjct: 217 HGKACDIWSLGVITYTLLSGYSAFIAESVEGFLEECTSSTYPVTFHRPYWDKISDEAKKF 276

Query: 71  IAKILTVDPAARIKSREILKHPLL 94
           I   LT++P  R  + ++L HP +
Sbjct: 277 ILSALTIEPEERPTAEQLLSHPWI 300

>NDAI0G06150 Chr7 (1519393..1521780) [2388 bp, 795 aa] {ON}
           Anc_1.225
          Length = 795

 Score = 53.9 bits (128), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 30/91 (32%), Positives = 46/91 (50%), Gaps = 1/91 (1%)

Query: 8   PVLPYHGFESDVWSCGIILFALLTGRLPFDEED-GNIRNLLLKVQSGQFEMPDSDEISPE 66
           P +  +  +SD+WS G+ +  +  GR P+  E   NI + L  +  G      SD+ S E
Sbjct: 663 PDMATYTVQSDIWSLGLSILEMALGRYPYPPETFDNIFSQLSAIVDGPPPQLPSDKFSKE 722

Query: 67  AQDLIAKILTVDPAARIKSREILKHPLLQKY 97
           AQD ++  L   P  R+    +L+HP L KY
Sbjct: 723 AQDFVSLCLQKIPERRLNYSALLEHPWLVKY 753

>NCAS0B04490 Chr2 (814474..815523) [1050 bp, 349 aa] {ON} Anc_8.141
          Length = 349

 Score = 53.1 bits (126), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 47/77 (61%), Gaps = 4/77 (5%)

Query: 18  DVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDEISPEAQDLIAKILTV 77
           DVW+ G++ + L+ G  PF+E+   +     ++     + P++  +S + +DLI+K+L  
Sbjct: 270 DVWALGVLTYELIVGSPPFEEDTKELT--YKRILKNDIKFPET--VSHDVKDLISKLLKY 325

Query: 78  DPAARIKSREILKHPLL 94
           +P+ RI  R+++KHP +
Sbjct: 326 NPSERISMRDVMKHPWI 342

>TPHA0E02820 Chr5 complement(589816..590970) [1155 bp, 384 aa] {ON}
           Anc_6.222 YPL209C
          Length = 384

 Score = 53.1 bits (126), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 47/79 (59%), Gaps = 4/79 (5%)

Query: 18  DVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDEISPEAQDLIAKILTV 77
           DVW+ GII + L+ G  PF+E+   +     ++++     P    +S +A++LI+ +L +
Sbjct: 305 DVWALGIIAYELIVGTPPFEEDTKELT--YKRIKNCDLNFPA--HVSQDAKNLISSLLKL 360

Query: 78  DPAARIKSREILKHPLLQK 96
           +P+ RI   ++LKHP + K
Sbjct: 361 NPSERITLTDVLKHPWINK 379

>KLTH0D11242g Chr4 (918232..920619) [2388 bp, 795 aa] {ON} similar
           to uniprot|P22216 Saccharomyces cerevisiae YPL153C RAD53
           Protein kinase required for cell-cycle arrest in
           response to DNA damage activated by trans
           autophosphorylation when interacting with
           hyperphosphorylated Rad9p
          Length = 795

 Score = 53.9 bits (128), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 48/81 (59%), Gaps = 6/81 (7%)

Query: 18  DVWSCGIILFALLTGRLPFDEEDGNIRNLLLK-VQSGQF-EMPDSD-EISPEAQDLIAKI 74
           D+WS G +++ +LTG LPF    G+ +  L K + +G + E P  D  IS +A+D I   
Sbjct: 375 DMWSIGCLVYVILTGHLPFS---GSTQQELYKQISAGSYHEGPLKDYRISDDARDFIESF 431

Query: 75  LTVDPAARIKSREILKHPLLQ 95
           L V+P  R+ + + LKHP ++
Sbjct: 432 LQVNPRDRMTAEQALKHPWIR 452

>KNAG0I01360 Chr9 complement(262712..264556) [1845 bp, 614 aa] {ON}
           Anc_1.390 YLR248W
          Length = 614

 Score = 53.5 bits (127), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 32/95 (33%), Positives = 47/95 (49%), Gaps = 4/95 (4%)

Query: 13  HGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEM--PDSDEISPEAQDL 70
           +  + D+W  G +L+ +L G  PF   D  I  L  K+  G++    P  DEIS  A++ 
Sbjct: 386 YSMQVDLWGIGCVLYTMLCGFPPF--YDDKIDVLTEKISRGEYTFLSPWWDEISDGAKNC 443

Query: 71  IAKILTVDPAARIKSREILKHPLLQKYPSIKDSKS 105
           +  +L V+P  R    E L  P L KY S  + KS
Sbjct: 444 VRNLLEVNPEKRYDIDEFLADPWLNKYDSEVNLKS 478

>Skud_6.38 Chr6 complement(72416..77692) [5277 bp, 1758 aa] {ON}
            YFL033C (REAL)
          Length = 1758

 Score = 53.9 bits (128), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 35/107 (32%), Positives = 50/107 (46%), Gaps = 18/107 (16%)

Query: 16   ESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDE-------ISPEAQ 68
            + D WS G I F LL G  PF  E  +   +  K+ SG  + P+          ++PEA+
Sbjct: 1156 QCDWWSVGCIFFELLLGYPPFHAETPDA--VFKKILSGVIQWPEFKNEEEEREFLTPEAK 1213

Query: 69   DLIAKILTVDPAARIKSREILKHPLLQKYPSIKDSKSIRNLPREDTY 115
            DLI K+L VDP+ R+    I +         IKD    RN+  +  Y
Sbjct: 1214 DLIEKLLVVDPSKRLGVSGIQE---------IKDQPYFRNVDWDHVY 1251

>KLTH0G18612g Chr7 (1604066..1608640) [4575 bp, 1524 aa] {ON} similar
            to uniprot|P43565 Saccharomyces cerevisiae YFL033C RIM15
            Glucose-repressible protein kinase involved in signal
            transduction during cell proliferation in response to
            nutrients specifically the establishment of stationary
            phase originally identified as a regulator of IME2
          Length = 1524

 Score = 53.9 bits (128), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 31/89 (34%), Positives = 45/89 (50%), Gaps = 12/89 (13%)

Query: 17   SDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQF---EMPDSDE----ISPEAQD 69
            SD WS G +LF    G  PF      +  +   + +G+    E PD++     I PEA+D
Sbjct: 982  SDWWSVGCMLFEFFFGYPPFHAP--TVEEVFSNILAGKIDWPEFPDAETEKEYIPPEAKD 1039

Query: 70   LIAKILTVDPAARI---KSREILKHPLLQ 95
            L+ K+L VDP  R+    ++EI  HP  Q
Sbjct: 1040 LVEKLLVVDPNKRLGANGAQEIFDHPYFQ 1068

>YPL153C Chr16 complement(261727..264192) [2466 bp, 821 aa] {ON}
           RAD53Protein kinase, required for cell-cycle arrest in
           response to DNA damage; activated by trans
           autophosphorylation when interacting with
           hyperphosphorylated Rad9p; also interacts with ARS1 and
           plays a role in initiation of DNA replication
          Length = 821

 Score = 53.5 bits (127), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 48/84 (57%), Gaps = 6/84 (7%)

Query: 18  DVWSCGIILFALLTGRLPFDEEDGNIRNLLLK-VQSGQF-EMPDSD-EISPEAQDLIAKI 74
           D+WS G +++ +LTG LPF    G+ ++ L K +  G + E P  D  IS EA+D I  +
Sbjct: 390 DMWSMGCLVYVILTGHLPFS---GSTQDQLYKQIGRGSYHEGPLKDFRISEEARDFIDSL 446

Query: 75  LTVDPAARIKSREILKHPLLQKYP 98
           L VDP  R  + + L HP ++  P
Sbjct: 447 LQVDPNNRSTAAKALNHPWIKMSP 470

>Suva_15.155 Chr15 complement(267680..269038) [1359 bp, 452 aa] {ON}
           YOL016C (REAL)
          Length = 452

 Score = 53.1 bits (126), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 35/110 (31%), Positives = 50/110 (45%), Gaps = 10/110 (9%)

Query: 13  HGFESDVWSCGIILFALLTGRLPFDEE--DGNIRNLLLKVQSGQFEMPDSDEISPEAQDL 70
           HG   D+WS G+I + LL G  PF  E  +G +           F MP  D IS +A+  
Sbjct: 226 HGKPCDIWSVGVITYTLLCGYSPFIAESVEGFMEECTASRYPVTFHMPYWDNISVDAKRF 285

Query: 71  IAKILTVDPAARIKSREILKHPLLQK--------YPSIKDSKSIRNLPRE 112
           I K L ++PA R  + E+L  P +           P +K   S+R   R+
Sbjct: 286 ILKALILNPADRPTATELLDDPWITSKRVETSNILPDVKKGFSLRKKLRD 335

>KAFR0C03520 Chr3 (715667..720019) [4353 bp, 1450 aa] {ON} Anc_8.34
           YFL033C
          Length = 1450

 Score = 53.9 bits (128), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 34/88 (38%), Positives = 47/88 (53%), Gaps = 9/88 (10%)

Query: 16  ESDVWSCGIILFALLTGRLPF--DEEDGNIRNLL-LKVQSGQFEMPDSDE---ISPEAQD 69
           + D WS G ILF LL G  PF  +  D   R +L   +Q   F+ PD +E   +   A+D
Sbjct: 867 QCDWWSVGCILFELLLGYPPFTSNTTDEVFRKILDGNIQWPHFDSPDEEEEILLKNSAKD 926

Query: 70  LIAKILTVDPAARI---KSREILKHPLL 94
           LI+K+LT+D + R+    S EI  HP  
Sbjct: 927 LISKLLTIDASKRLGANGSSEIKNHPYF 954

>TDEL0B06320 Chr2 (1118534..1119868) [1335 bp, 444 aa] {ON}
           Anc_1.374 YFR014C
          Length = 444

 Score = 53.1 bits (126), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 29/94 (30%), Positives = 49/94 (52%), Gaps = 6/94 (6%)

Query: 13  HGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSG----QFEMPDSDEISPEAQ 68
           HG   D+WS G++ + LL+G  PF  E  ++   L +   G    +F  P  D IS +A+
Sbjct: 219 HGKPCDIWSLGVVTYTLLSGYSPFIAE--SVEGFLEECTEGSKPVKFHKPYWDGISDDAK 276

Query: 69  DLIAKILTVDPAARIKSREILKHPLLQKYPSIKD 102
           + I + L + P+ R  + E+L+ P +    S K+
Sbjct: 277 NFILRALVLSPSKRPTATELLEDPWITCCTSCKN 310

>SAKL0D08294g Chr4 (692455..693966) [1512 bp, 503 aa] {ON} some
           similarities with uniprot|P38623 Saccharomyces
           cerevisiae YLR248W RCK2 Protein kinase involved in the
           response to oxidative stress identified as suppressor of
           S. pombe cell cycle checkpoint mutations
          Length = 503

 Score = 53.1 bits (126), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 28/92 (30%), Positives = 48/92 (52%), Gaps = 4/92 (4%)

Query: 13  HGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEM--PDSDEISPEAQDL 70
           +  + D+W  G +L+ +L G  PF +E  ++  L  K+  G++    P  DEIS  A++ 
Sbjct: 297 YSMKVDMWGIGCVLYTVLCGFPPFYDEKIDV--LTEKISRGEYTFLRPWWDEISDGAKNA 354

Query: 71  IAKILTVDPAARIKSREILKHPLLQKYPSIKD 102
           + ++L V+P  R    E L  P L  Y  ++D
Sbjct: 355 VRRLLEVNPEKRYDIDEFLNDPWLNSYDCLRD 386

>KLTH0D06006g Chr4 complement(532589..535453) [2865 bp, 954 aa] {ON}
           similar to uniprot|Q03497 Saccharomyces cerevisiae
           YHL007C STE20 Signal transducing kinase of the PAK (p21-
           activated kinase) family involved in pheromone response
           and pseudohyphal/invasive growth pathways activated by
           Cdc42p binds Ste4p at a GBB motif present in
           noncatalytic domains of PAK kinases
          Length = 954

 Score = 53.5 bits (127), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 45/85 (52%), Gaps = 1/85 (1%)

Query: 13  HGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDEISPEAQDLIA 72
           +G + D+WS GI++  ++ G  P+  E   +R L L   +G  E+ D+D +S + +  + 
Sbjct: 837 YGPKVDIWSLGIMIIEMIEGEPPYLNET-PLRALYLIATNGTPELKDADSLSDDLKGFLG 895

Query: 73  KILTVDPAARIKSREILKHPLLQKY 97
             L VDP  R  + E+L  P +  Y
Sbjct: 896 WCLHVDPDERATASELLSDPFIATY 920

>ACR218W Chr3 (731433..736142) [4710 bp, 1569 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YFL033C (RIM15)
          Length = 1569

 Score = 53.5 bits (127), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 31/89 (34%), Positives = 47/89 (52%), Gaps = 12/89 (13%)

Query: 17   SDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMP-------DSDEISPEAQD 69
            SD WS G ILF  L G  PF      + ++   + SGQ + P       + + +SPEA+D
Sbjct: 1022 SDWWSVGCILFEFLLGYPPF--HASTVEDVFKNILSGQIDWPSFPNKETELEYLSPEAKD 1079

Query: 70   LIAKILTVDPAARI---KSREILKHPLLQ 95
            LI K+L  +P  R+    ++EI +HP  +
Sbjct: 1080 LILKLLESNPEERLGANGAQEIKEHPYFK 1108

>Ecym_1275 Chr1 complement(560481..561836) [1356 bp, 451 aa] {ON}
           similar to Ashbya gossypii AAR009W
          Length = 451

 Score = 52.8 bits (125), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 43/80 (53%), Gaps = 2/80 (2%)

Query: 13  HGFESDVWSCGIILFALLTGRLPFDEE--DGNIRNLLLKVQSGQFEMPDSDEISPEAQDL 70
           HG   D+WS G+I + LL G  PF  E  +G +  +        F  P  + IS EA++ 
Sbjct: 231 HGKPCDIWSLGVITYTLLCGYSPFVAESSEGFLEEVTRSKYPVTFHKPYWNSISVEAKEF 290

Query: 71  IAKILTVDPAARIKSREILK 90
           I K LT+DP+ R  + E+L+
Sbjct: 291 ILKALTLDPSERPTATELLQ 310

>Smik_6.414 Chr6 (666806..667909) [1104 bp, 367 aa] {ON} YPL209C
           (REAL)
          Length = 367

 Score = 52.4 bits (124), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 27/77 (35%), Positives = 45/77 (58%), Gaps = 4/77 (5%)

Query: 18  DVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDEISPEAQDLIAKILTV 77
           D W+ G++ F LLTG  PF+EE  +      ++ +   ++P +  IS +AQDLI K+L  
Sbjct: 283 DAWALGVLAFELLTGAPPFEEEMKD--TTYKRIAALDIKIPSN--ISQDAQDLILKLLKY 338

Query: 78  DPAARIKSREILKHPLL 94
           DP  R++  ++  HP +
Sbjct: 339 DPKDRMRLEDVKMHPWI 355

>ZYRO0D04752g Chr4 complement(397364..398215,398290..398907) [1470
           bp, 489 aa] {ON} highly similar to uniprot|P24719
           Saccharomyces cerevisiae YOR351C MEK1 Meiosis-specific
           serine/threonine protein kinase
          Length = 489

 Score = 52.8 bits (125), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 49/88 (55%), Gaps = 5/88 (5%)

Query: 14  GFES--DVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQ--FEMPDSDEISPEAQD 69
           G++S  D+WS G+I   +LTG  PF   DG  R+++   + G+  F     D ++  A+D
Sbjct: 347 GYDSKCDLWSLGVITHIMLTGISPF-YGDGTERSIIQNAKVGKLNFNAKQWDVVADTAKD 405

Query: 70  LIAKILTVDPAARIKSREILKHPLLQKY 97
            + K+L VD   R+ S   LKHP + K+
Sbjct: 406 FVRKLLEVDVNKRLDSNRSLKHPWISKH 433

>Skud_16.70 Chr16 complement(129918..131021) [1104 bp, 367 aa] {ON}
           YPL209C (REAL)
          Length = 367

 Score = 52.4 bits (124), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 27/77 (35%), Positives = 45/77 (58%), Gaps = 4/77 (5%)

Query: 18  DVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDEISPEAQDLIAKILTV 77
           D W+ GI+ F LLTG  PF+EE  +      ++ +   ++P +  +S +AQDLI K+L  
Sbjct: 283 DAWALGILAFELLTGAPPFEEEMKD--TTYKRIAALDIKIPSN--VSQDAQDLILKLLKY 338

Query: 78  DPAARIKSREILKHPLL 94
           DP  R++  ++  HP +
Sbjct: 339 DPKDRMRLEDVKMHPWI 355

>Skud_6.89 Chr6 (166257..167594) [1338 bp, 446 aa] {ON} YFR014C
           (REAL)
          Length = 446

 Score = 52.8 bits (125), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 28/86 (32%), Positives = 45/86 (52%), Gaps = 6/86 (6%)

Query: 13  HGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQ----FEMPDSDEISPEAQ 68
           HG   D+WS G+I + LL G   F  E   +++ L +  +G+    F  P  D +S +A+
Sbjct: 216 HGKPCDIWSIGVITYTLLCGYSAFKAE--RVQDFLDECTTGEHPVRFHRPYWDSVSGKAK 273

Query: 69  DLIAKILTVDPAARIKSREILKHPLL 94
             I K L +DPA R  + ++L  P +
Sbjct: 274 QFILKALNLDPAERPTAAQLLDDPWI 299

>Smik_12.321 Chr12 (579087..580919) [1833 bp, 610 aa] {ON} YLR248W
           (REAL)
          Length = 610

 Score = 53.1 bits (126), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 48/91 (52%), Gaps = 4/91 (4%)

Query: 12  YHGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEM--PDSDEISPEAQD 69
           ++  + D+W  G +L+ +L G  PF +E   I  L  K+  G++    P  DEIS  A++
Sbjct: 396 HYSMKVDMWGIGCVLYTMLCGFPPFYDE--KIDTLTEKISRGEYTFLKPWWDEISAGAKN 453

Query: 70  LIAKILTVDPAARIKSREILKHPLLQKYPSI 100
            +AK+L ++P+ R    + L  P L  +  +
Sbjct: 454 AVAKLLELEPSKRYDIDQFLNDPWLNSFDCL 484

>Ecym_6301 Chr6 complement(566248..567324) [1077 bp, 358 aa] {ON}
           similar to Ashbya gossypii AEL179W
          Length = 358

 Score = 52.4 bits (124), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 30/90 (33%), Positives = 47/90 (52%), Gaps = 11/90 (12%)

Query: 9   VLPYHGFESDVWSCGIILFALL--TGRLPFDEEDGNIRNLLLK--VQSGQFEMPDSDEIS 64
           +L Y GF  D+WS GII+F L   TG+L F  +   + +   K  V+SG+  M       
Sbjct: 249 LLSYKGFAVDIWSLGIIMFLLFNDTGKLKFPWKVAKLTDETFKEFVESGELSM------- 301

Query: 65  PEAQDLIAKILTVDPAARIKSREILKHPLL 94
            +  DL  K+L +DP  R  + +++K P +
Sbjct: 302 CKYGDLCKKLLVLDPGERATAAQLMKEPFV 331

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.312    0.127    0.353 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 84,511,247
Number of extensions: 3436283
Number of successful extensions: 15013
Number of sequences better than 10.0: 1187
Number of HSP's gapped: 14805
Number of HSP's successfully gapped: 1241
Length of query: 964
Length of database: 53,481,399
Length adjustment: 119
Effective length of query: 845
Effective length of database: 39,836,145
Effective search space: 33661542525
Effective search space used: 33661542525
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 71 (32.0 bits)