Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_33.13215na 1ON59859827770.0
KLTH0F01606gna 1ON60460523470.0
SAKL0C01650g1.50ON61356017890.0
SAKL0C01232gsingletonON61356017870.0
KLTH0F01584g1.50ON59659317800.0
Kwal_33.132041.50ON60759717370.0
Skud_3.381.50ON63362617190.0
CAGL0K05753g1.50ON66063917130.0
CAGL0B01012g1.50ON62359617030.0
Smik_3.531.50ON63362616960.0
Suva_3.1891.50ON63362616850.0
YCL025C (AGP1)1.50ON63362416840.0
Suva_2.6881.50ON66162816760.0
Kpol_2000.921.50ON63763016710.0
TDEL0C065101.50ON64259516350.0
YDR508C (GNP1)1.50ON66361616350.0
Skud_4.7841.50ON66362516340.0
KAFR0D04120na 1ON64861816320.0
TPHA0E036601.50ON64752916280.0
Smik_4.7901.50ON66362616250.0
NDAI0A006401.50ON64160516120.0
NCAS0B085801.50ON62757016090.0
KAFR0D005001.50ON61761915960.0
Ecym_10561.50ON60659915690.0
TPHA0B047501.50ON63962315660.0
KAFR0D041401.50ON63756615560.0
YBR068C (BAP2)3.284ON60959415510.0
TBLA0A051801.50ON67652615570.0
KAFR0D00510na 2ON61759515390.0
AFR698C1.50ON60960215360.0
KNAG0C005901.50ON63461215380.0
KAFR0D04130na 2ON64456815380.0
SAKL0D02948gna 3ON59460015290.0
KLLA0C01606g1.50ON62060215300.0
Kpol_2002.441.50ON62761815200.0
NCAS0A004201.50ON67964315220.0
Ecym_26643.285ON57558215110.0
TBLA0A05190na 1ON66752815180.0
KAFR0D00520na 1ON59858915120.0
NDAI0F043901.50ON66761215170.0
KNAG0F002701.50ON63457515090.0
SAKL0D02926g3.285ON58359314950.0
Suva_4.3073.284ON60959414930.0
Smik_2.2013.284ON60957614920.0
AGR039Cna 3ON58655814780.0
Skud_2.1913.284ON60959414780.0
SAKL0D02970g3.284ON60160714570.0
YDR046C (BAP3)3.284ON60459014550.0
NCAS0I015303.284ON59559814550.0
NDAI0A074903.284ON59659614460.0
KNAG0J022003.284ON60758414460.0
Smik_4.2843.284ON60457314430.0
Skud_4.3003.284ON60459814420.0
Suva_2.2033.284ON60460014390.0
CAGL0H08393g3.284ON61256014380.0
CAGL0L07546g3.284ON63459614340.0
NCAS0A106803.284ON59360014290.0
NDAI0A056203.284ON57157514180.0
TPHA0M012003.284ON60761314170.0
KNAG0H011503.284ON61759014130.0
Kpol_1065.133.284ON59660314080.0
KLTH0C05170g3.284ON59858314000.0
AGR040C3.285ON57359313930.0
ZYRO0F17446g1.50ON63360113940.0
Kwal_27.105383.284ON60261613850.0
KAFR0A011203.284ON59257113720.0
Ecym_2663na 3ON58956313650.0
AGR038C3.284ON58058813560.0
Ecym_26623.284ON58958413471e-180
KAFR0C004003.284ON58256513411e-179
Suva_4.3083.285ON61861013441e-179
TPHA0A039603.284ON61559513271e-177
Skud_2.1923.285ON61959613211e-176
Smik_2.2023.285ON61760313161e-175
TBLA0I020103.285ON62853213101e-174
TBLA0G031203.284ON67351513091e-173
Kpol_1052.163.284ON61358913011e-173
YBR069C (TAT1)3.285ON61960612881e-171
KNAG0J022103.285ON58158412511e-165
Kpol_1052.143.285ON60250412081e-159
TBLA0I020003.284ON66452212091e-158
NDAI0A075003.285ON61954412001e-157
SAKL0H08184gna 4ON59850211921e-156
NCAS0I015203.285ON61456411901e-156
ZYRO0G12342g3.284ON62057211601e-151
ADL272Wna 4ON56451711341e-148
Kwal_27.126811.244ON59357011161e-145
SAKL0G14014g5.158ON60552710991e-142
Ecym_8297na 4ON56951510921e-142
Suva_11.2731.244ON60156910931e-142
TPHA0B010901.244ON60658110931e-141
KLLA0A06886gsingletonON58759710831e-140
KLTH0E15642g1.244ON59659910751e-139
ZYRO0D03762g1.244ON60060410631e-137
TPHA0A002405.158ON60351910571e-136
KLLA0F01012gna 4ON55651810441e-135
TDEL0C00930singletonON59559210391e-133
SAKL0D04664g1.244ON59359910371e-133
Skud_11.2751.244ON60257210341e-133
NCAS0B079001.244ON61955810281e-132
KNAG0C02140singletonON59860110261e-131
AGR319W5.158ON62652710281e-131
KLLA0A11770g5.158ON58152510231e-131
Kpol_543.791.244ON60558910241e-131
Kwal_33.154075.158ON58752610201e-131
YKR039W (GAP1)1.244ON60259010201e-130
CAGL0B03773g5.158ON60552310191e-130
NDAI0B052201.244ON61156510201e-130
CAGL0L03267g1.244ON59756010181e-130
Smik_16.1155.158ON60352310171e-130
Ecym_60211.244ON60059810151e-130
Suva_7.4855.158ON60352310111e-129
SAKL0D00836gna 5ON60159010111e-129
KAFR0E018505.158ON5605249981e-128
KLLA0A06930g1.244ON58757310001e-128
Skud_7.5255.158ON60352310001e-127
KLTH0B02046g5.158ON5895309971e-127
Kpol_543.78singletonON6055849921e-126
KNAG0G009005.158ON6135279851e-125
Kpol_1010.325.158ON5995079821e-125
Ecym_47895.158ON5885279791e-124
YGR191W (HIP1)5.158ON6035239781e-124
Kwal_33.14276na 5ON5965269771e-124
TBLA0B077605.158ON6585199801e-124
NDAI0D021605.158ON5875199701e-123
NCAS0D018705.158ON5955229621e-122
AFR230C1.244ON6045629571e-121
NCAS0A089201.368ON5995359531e-121
TPHA0A047005.158ON5694899471e-120
NDAI0C029505.158ON6095229431e-119
Suva_2.716singletonON6035749421e-119
KLLA0A10813g1.368ON5846059401e-119
AEL030W1.368ON5825849391e-119
Smik_11.3021.244ON5535199181e-116
NCAS0A071105.158ON5925289211e-116
YOL020W (TAT2)1.368ON5925669181e-115
NDAI0G060301.368ON5996159151e-115
Smik_15.1461.368ON5935789131e-115
Skud_15.1381.368ON5925669111e-114
Kpol_534.221.368ON5926029071e-114
CAGL0D02178g1.368ON5775779031e-113
KLTH0C08052gna 6ON5995798981e-112
TPHA0A025001.368ON5905988911e-111
Suva_15.1481.368ON5925668861e-111
TBLA0C012101.368ON6005358871e-111
Ecym_27161.368ON5925738801e-110
SAKL0D04048gna 6ON5865688781e-110
KLTH0H13398g1.368ON5875358621e-107
YPL274W (SAM3)na 6ON5875898591e-107
KLLA0B06776gna 6ON5886038571e-106
TPHA0G03770singletonON6045838421e-104
TDEL0B00130singletonON5845848401e-104
Smik_6.483na 6ON5905938331e-103
Kwal_56.22951na 6ON5965758231e-101
KAFR0F04410singletonON5805928171e-101
KAFR0B00220singletonON5855808151e-100
Suva_16.31singletonON5865718151e-100
YLL061W (MMP1)na 7ON5835927952e-97
TDEL0H04510singletonON5845857917e-97
TDEL0E05700singletonON5845267917e-97
AER405Cna 6ON4975127707e-95
ZYRO0D17952gna 6ON5856057761e-94
Sklu_YGOB_Anc_1.3681.368ON5414917712e-94
Smik_12.2na 7ON5835737716e-94
TDEL0E00250singletonON5875847515e-91
Suva_16.18na 6ON5835647367e-89
Ecym_4758na 6ON5876027332e-88
Kwal_34.16254singletonOFF4814997165e-87
Kwal_YGOB_34.162541.368ON4914997167e-87
SAKL0C02662g1.83ON5485066892e-82
TBLA0A07060na 8ON6255206804e-80
SAKL0C02640gsingletonON5485066674e-79
TDEL0C061701.84ON5735006451e-75
KLLA0E16281gna 8ON6056106436e-75
Smik_6.473na 8ON6065256402e-74
Skud_16.12na 8ON6075186365e-74
KLTH0F02398g1.83ON5555096327e-74
KNAG0L02470singletonON6385256377e-74
Kwal_33.134011.83ON5595066311e-73
Smik_5.241.83ON5905106321e-73
YPL265W (DIP5)na 8ON6085256332e-73
TPHA0B044701.84ON5995066313e-73
Kpol_2000.641.84ON6105106297e-73
ZYRO0F16632g1.84ON6075116252e-72
Suva_16.40na 8ON6065226243e-72
Ecym_10881.84ON5675256213e-72
KNAG0C05920singletonON5995146218e-72
CAGL0J08162g1.84ON5975076191e-71
Ecym_10871.83ON5705306162e-71
NDAI0F041901.84ON5995096182e-71
CAGL0A01199gna 8ON6135366183e-71
Suva_5.41.83ON5905146163e-71
TBLA0A054601.84ON6085106164e-71
TDEL0C061801.83ON5835096128e-71
YEL063C (CAN1)1.83ON5905146139e-71
Kpol_358.3na 8ON5755196101e-70
NCAS0A006001.83ON5445296072e-70
KAFR0D039401.83ON5975706093e-70
NDAI0A006101.83ON5654956074e-70
KNAG0F004801.84ON5975116094e-70
SAKL0C02684gsingletonON5884926076e-70
SAKL0C02728g1.84ON5624816031e-69
TBLA0A054501.83ON6064846061e-69
KAFR0B06430singletonON5935306051e-69
NCAS0A006101.84ON6075626024e-69
TPHA0M00130singletonON6115226025e-69
CAGL0J08184g1.83ON5725055996e-69
Skud_5.261.83ON5905145997e-69
NCAS0B085701.83ON5325065957e-69
KLLA0C02343g1.83ON5815225944e-68
YNL268W (LYP1)1.84ON6115105955e-68
SAKL0G14916gna 8ON5815205927e-68
NDAI0I02660na 8ON5945325937e-68
AFR668W1.83ON5564745891e-67
YNL270C (ALP1)1.83ON5735155883e-67
Kwal_33.15545na 8ON5765065856e-67
ZYRO0F16654g1.83ON5805055849e-67
Smik_14.681.84ON6115045851e-66
NCAS0D02260na 8ON5975265841e-66
Kwal_33.134111.84ON5605105784e-66
KNAG0C007901.83ON5795075787e-66
Skud_14.701.83ON5735155751e-65
KLTH0F02420g1.84ON6215115782e-65
Smik_14.671.83ON5735155724e-65
KLTH0B01166gna 8ON5775265701e-64
TPHA0B044801.83ON6035035683e-64
KLLA0C02365g1.84ON5795075664e-64
KAFR0D007001.83ON5745255654e-64
Suva_14.751.84ON6115065675e-64
Suva_14.731.83ON4974875571e-63
Skud_14.711.84ON6125065632e-63
NDAI0F042001.83ON5665045569e-63
Ecym_2480na 8ON5865315561e-62
AFR667C1.84ON5635165514e-62
Skud_7.4singletonON3493515354e-62
Skud_51.1singletonON3483515355e-62
Skud_47.1singletonON3283265264e-61
YOR348C (PUT4)7.44ON6275905474e-61
SAKL0B10956g7.44ON5725305445e-61
Kpol_2000.651.83ON5954825431e-60
Smik_15.5327.44ON6316035451e-60
KNAG0L02460singletonON5885315332e-59
ACL135Wna 8ON5885275323e-59
Suva_8.4027.44ON6836055364e-59
ZYRO0D17908gna 8ON5184865257e-59
KAFR0C051607.44ON5845415201e-57
TPHA0H028507.44ON6015255123e-56
KNAG0E003907.44ON5995145114e-56
Skud_15.5157.44ON6265285115e-56
AFR156W7.44ON5585025085e-56
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_33.13215
         (598 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_33.13215 s33 complement(123154..124950) [1797 bp, 598 aa] {...  1074   0.0  
KLTH0F01606g Chr6 complement(122821..124635) [1815 bp, 604 aa] {...   908   0.0  
SAKL0C01650g Chr3 complement(139480..141321) [1842 bp, 613 aa] {...   693   0.0  
SAKL0C01232g Chr3 (110269..112110) [1842 bp, 613 aa] {ON} simila...   692   0.0  
KLTH0F01584g Chr6 complement(120227..122017) [1791 bp, 596 aa] {...   690   0.0  
Kwal_33.13204 s33 complement(120622..122445) [1824 bp, 607 aa] {...   673   0.0  
Skud_3.38 Chr3 complement(63096..64997) [1902 bp, 633 aa] {ON} Y...   666   0.0  
CAGL0K05753g Chr11 (565111..567093) [1983 bp, 660 aa] {ON} highl...   664   0.0  
CAGL0B01012g Chr2 (91330..93201) [1872 bp, 623 aa] {ON} similar ...   660   0.0  
Smik_3.53 Chr3 complement(77146..79047) [1902 bp, 633 aa] {ON} Y...   657   0.0  
Suva_3.189 Chr3 complement(285493..287394) [1902 bp, 633 aa] {ON...   653   0.0  
YCL025C Chr3 complement(76018..77919) [1902 bp, 633 aa] {ON}  AG...   653   0.0  
Suva_2.688 Chr2 complement(1219181..1221166) [1986 bp, 661 aa] {...   650   0.0  
Kpol_2000.92 s2000 (208509..210422) [1914 bp, 637 aa] {ON} (2085...   648   0.0  
TDEL0C06510 Chr3 (1196039..1197967) [1929 bp, 642 aa] {ON} Anc_1...   634   0.0  
YDR508C Chr4 complement(1466453..1468444) [1992 bp, 663 aa] {ON}...   634   0.0  
Skud_4.784 Chr4 complement(1386623..1388614) [1992 bp, 663 aa] {...   634   0.0  
KAFR0D04120 Chr4 (816117..818063) [1947 bp, 648 aa] {ON} Anc_1.5...   633   0.0  
TPHA0E03660 Chr5 (775232..777175) [1944 bp, 647 aa] {ON} Anc_1.5...   631   0.0  
Smik_4.790 Chr4 complement(1389278..1391269) [1992 bp, 663 aa] {...   630   0.0  
NDAI0A00640 Chr1 complement(118100..120025) [1926 bp, 641 aa] {O...   625   0.0  
NCAS0B08580 Chr2 complement(1646220..1648103) [1884 bp, 627 aa] ...   624   0.0  
KAFR0D00500 Chr4 complement(77541..79394) [1854 bp, 617 aa] {ON}      619   0.0  
Ecym_1056 Chr1 (102260..104080) [1821 bp, 606 aa] {ON} similar t...   608   0.0  
TPHA0B04750 Chr2 (1119282..1121201) [1920 bp, 639 aa] {ON} Anc_1...   607   0.0  
KAFR0D04140 Chr4 (821341..823254) [1914 bp, 637 aa] {ON}              603   0.0  
YBR068C Chr2 complement(373861..375690) [1830 bp, 609 aa] {ON}  ...   602   0.0  
TBLA0A05180 Chr1 complement(1267962..1269992) [2031 bp, 676 aa] ...   604   0.0  
KAFR0D00510 Chr4 complement(80174..82027) [1854 bp, 617 aa] {ON}      597   0.0  
AFR698C Chr6 complement(1726387..1728216) [1830 bp, 609 aa] {ON}...   596   0.0  
KNAG0C00590 Chr3 complement(100801..102705) [1905 bp, 634 aa] {O...   597   0.0  
KAFR0D04130 Chr4 (818573..820507) [1935 bp, 644 aa] {ON}              597   0.0  
SAKL0D02948g Chr4 (243064..244848) [1785 bp, 594 aa] {ON} simila...   593   0.0  
KLLA0C01606g Chr3 complement(123485..125347) [1863 bp, 620 aa] {...   593   0.0  
Kpol_2002.44 s2002 complement(89144..90370,90372..91028) [1884 b...   590   0.0  
NCAS0A00420 Chr1 complement(62649..64688) [2040 bp, 679 aa] {ON}...   590   0.0  
Ecym_2664 Chr2 complement(1280994..1282721) [1728 bp, 575 aa] {O...   586   0.0  
TBLA0A05190 Chr1 complement(1271605..1273608) [2004 bp, 667 aa] ...   589   0.0  
KAFR0D00520 Chr4 complement(82977..84773) [1797 bp, 598 aa] {ON}...   587   0.0  
NDAI0F04390 Chr6 (1073373..1075376) [2004 bp, 667 aa] {ON} Anc_1...   588   0.0  
KNAG0F00270 Chr6 complement(27784..29688) [1905 bp, 634 aa] {ON}...   585   0.0  
SAKL0D02926g Chr4 (240708..242459) [1752 bp, 583 aa] {ON} unipro...   580   0.0  
Suva_4.307 Chr4 complement(540768..542597) [1830 bp, 609 aa] {ON...   579   0.0  
Smik_2.201 Chr2 complement(355785..357614) [1830 bp, 609 aa] {ON...   579   0.0  
AGR039C Chr7 complement(779720..781480) [1761 bp, 586 aa] {ON} S...   573   0.0  
Skud_2.191 Chr2 complement(342307..344136) [1830 bp, 609 aa] {ON...   573   0.0  
SAKL0D02970g Chr4 (245449..247254) [1806 bp, 601 aa] {ON} unipro...   565   0.0  
YDR046C Chr4 complement(548762..550576) [1815 bp, 604 aa] {ON}  ...   565   0.0  
NCAS0I01530 Chr9 (286882..288669) [1788 bp, 595 aa] {ON}              565   0.0  
NDAI0A07490 Chr1 complement(1713048..1714838) [1791 bp, 596 aa] ...   561   0.0  
KNAG0J02200 Chr10 complement(407267..409090) [1824 bp, 607 aa] {...   561   0.0  
Smik_4.284 Chr4 complement(515341..517155) [1815 bp, 604 aa] {ON...   560   0.0  
Skud_4.300 Chr4 complement(525086..526900) [1815 bp, 604 aa] {ON...   560   0.0  
Suva_2.203 Chr2 complement(347891..349705) [1815 bp, 604 aa] {ON...   558   0.0  
CAGL0H08393g Chr8 (821998..823836) [1839 bp, 612 aa] {ON} highly...   558   0.0  
CAGL0L07546g Chr12 complement(833821..835725) [1905 bp, 634 aa] ...   556   0.0  
NCAS0A10680 Chr1 complement(2127039..2128820) [1782 bp, 593 aa] ...   555   0.0  
NDAI0A05620 Chr1 (1268907..1270622) [1716 bp, 571 aa] {ON}            550   0.0  
TPHA0M01200 Chr13 complement(244556..246379) [1824 bp, 607 aa] {...   550   0.0  
KNAG0H01150 Chr8 (193585..195438) [1854 bp, 617 aa] {ON}              548   0.0  
Kpol_1065.13 s1065 (28709..30499) [1791 bp, 596 aa] {ON} (28709....   546   0.0  
KLTH0C05170g Chr3 (449510..451306) [1797 bp, 598 aa] {ON} simila...   543   0.0  
AGR040C Chr7 complement(782283..784004) [1722 bp, 573 aa] {ON} S...   541   0.0  
ZYRO0F17446g Chr6 (1451431..1453332) [1902 bp, 633 aa] {ON} simi...   541   0.0  
Kwal_27.10538 s27 (380769..382577) [1809 bp, 602 aa] {ON} YBR068...   538   0.0  
KAFR0A01120 Chr1 complement(216442..218220) [1779 bp, 592 aa] {O...   533   0.0  
Ecym_2663 Chr2 complement(1278309..1280078) [1770 bp, 589 aa] {O...   530   0.0  
AGR038C Chr7 complement(777529..779271) [1743 bp, 580 aa] {ON} S...   526   0.0  
Ecym_2662 Chr2 complement(1275924..1277693) [1770 bp, 589 aa] {O...   523   e-180
KAFR0C00400 Chr3 (83280..85028) [1749 bp, 582 aa] {ON}                521   e-179
Suva_4.308 Chr4 complement(543427..545283) [1857 bp, 618 aa] {ON...   522   e-179
TPHA0A03960 Chr1 (877702..879549) [1848 bp, 615 aa] {ON}              515   e-177
Skud_2.192 Chr2 complement(344951..346810) [1860 bp, 619 aa] {ON...   513   e-176
Smik_2.202 Chr2 complement(358478..360331) [1854 bp, 617 aa] {ON...   511   e-175
TBLA0I02010 Chr9 complement(455681..457567) [1887 bp, 628 aa] {O...   509   e-174
TBLA0G03120 Chr7 (825095..827116) [2022 bp, 673 aa] {ON}              508   e-173
Kpol_1052.16 s1052 (44303..46144) [1842 bp, 613 aa] {ON} (44303....   505   e-173
YBR069C Chr2 complement(376574..378433) [1860 bp, 619 aa] {ON}  ...   500   e-171
KNAG0J02210 Chr10 complement(409847..411592) [1746 bp, 581 aa] {...   486   e-165
Kpol_1052.14 s1052 (39793..41601) [1809 bp, 602 aa] {ON} (39793....   469   e-159
TBLA0I02000 Chr9 complement(452716..454710) [1995 bp, 664 aa] {O...   470   e-158
NDAI0A07500 Chr1 complement(1715826..1717685) [1860 bp, 619 aa] ...   466   e-157
SAKL0H08184g Chr8 (704748..706544) [1797 bp, 598 aa] {ON} simila...   463   e-156
NCAS0I01520 Chr9 (284348..286192) [1845 bp, 614 aa] {ON}              462   e-156
ZYRO0G12342g Chr7 complement(976302..978164) [1863 bp, 620 aa] {...   451   e-151
ADL272W Chr4 (227414..229108) [1695 bp, 564 aa] {ON} Non-synteni...   441   e-148
Kwal_27.12681 s27 (1332647..1334428) [1782 bp, 593 aa] {ON} YKR0...   434   e-145
SAKL0G14014g Chr7 (1202476..1204293) [1818 bp, 605 aa] {ON} high...   427   e-142
Ecym_8297 Chr8 complement(602984..604693) [1710 bp, 569 aa] {ON}...   425   e-142
Suva_11.273 Chr11 (498611..500416) [1806 bp, 601 aa] {ON} YKR039...   425   e-142
TPHA0B01090 Chr2 complement(246708..248528) [1821 bp, 606 aa] {O...   425   e-141
KLLA0A06886g Chr1 complement(621646..623409) [1764 bp, 587 aa] {...   421   e-140
KLTH0E15642g Chr5 (1389937..1391727) [1791 bp, 596 aa] {ON} simi...   418   e-139
ZYRO0D03762g Chr4 complement(304207..306009) [1803 bp, 600 aa] {...   414   e-137
TPHA0A00240 Chr1 complement(28756..30567) [1812 bp, 603 aa] {ON}...   411   e-136
KLLA0F01012g Chr6 complement(90772..92442) [1671 bp, 556 aa] {ON...   406   e-135
TDEL0C00930 Chr3 complement(147777..149564) [1788 bp, 595 aa] {O...   404   e-133
SAKL0D04664g Chr4 complement(365852..367633) [1782 bp, 593 aa] {...   404   e-133
Skud_11.275 Chr11 (496787..498595) [1809 bp, 602 aa] {ON} YKR039...   402   e-133
NCAS0B07900 Chr2 (1500061..1501920) [1860 bp, 619 aa] {ON} Anc_1...   400   e-132
KNAG0C02140 Chr3 complement(416347..418143) [1797 bp, 598 aa] {O...   399   e-131
AGR319W Chr7 (1328425..1330305) [1881 bp, 626 aa] {ON} Syntenic ...   400   e-131
KLLA0A11770g Chr1 (1014918..1016663) [1746 bp, 581 aa] {ON} simi...   398   e-131
Kpol_543.79 s543 (197876..199693) [1818 bp, 605 aa] {ON} (197876...   399   e-131
Kwal_33.15407 s33 (1092383..1094146) [1764 bp, 587 aa] {ON} YGR1...   397   e-131
YKR039W Chr11 (515063..516871) [1809 bp, 602 aa] {ON}  GAP1Gener...   397   e-130
CAGL0B03773g Chr2 (373956..375773) [1818 bp, 605 aa] {ON} highly...   397   e-130
NDAI0B05220 Chr2 (1278386..1280221) [1836 bp, 611 aa] {ON} Anc_1...   397   e-130
CAGL0L03267g Chr12 (374784..376577) [1794 bp, 597 aa] {ON} highl...   396   e-130
Smik_16.115 Chr16 complement(214120..215931) [1812 bp, 603 aa] {...   396   e-130
Ecym_6021 Chr6 (37898..39700) [1803 bp, 600 aa] {ON} similar to ...   395   e-130
Suva_7.485 Chr7 (836820..838631) [1812 bp, 603 aa] {ON} YGR191W ...   394   e-129
SAKL0D00836g Chr4 complement(65731..67536) [1806 bp, 601 aa] {ON...   394   e-129
KAFR0E01850 Chr5 (381160..382842) [1683 bp, 560 aa] {ON} Anc_5.1...   389   e-128
KLLA0A06930g Chr1 complement(625498..627261) [1764 bp, 587 aa] {...   389   e-128
Skud_7.525 Chr7 (856072..857883) [1812 bp, 603 aa] {ON} YGR191W ...   389   e-127
KLTH0B02046g Chr2 complement(163199..164968) [1770 bp, 589 aa] {...   388   e-127
Kpol_543.78 s543 (193316..195133) [1818 bp, 605 aa] {ON} (193316...   386   e-126
KNAG0G00900 Chr7 complement(170122..171963) [1842 bp, 613 aa] {O...   384   e-125
Kpol_1010.32 s1010 (82500..84299) [1800 bp, 599 aa] {ON} (82500....   382   e-125
Ecym_4789 Chr4 complement(1531864..1533630) [1767 bp, 588 aa] {O...   381   e-124
YGR191W Chr7 (880420..882231) [1812 bp, 603 aa] {ON}  HIP1High-a...   381   e-124
Kwal_33.14276 s33 complement(596760..598550) [1791 bp, 596 aa] {...   380   e-124
TBLA0B07760 Chr2 complement(1834605..1836581) [1977 bp, 658 aa] ...   382   e-124
NDAI0D02160 Chr4 (505202..506965) [1764 bp, 587 aa] {ON} Anc_5.158    378   e-123
NCAS0D01870 Chr4 complement(343416..345203) [1788 bp, 595 aa] {O...   375   e-122
AFR230C Chr6 complement(855413..857227) [1815 bp, 604 aa] {ON} N...   373   e-121
NCAS0A08920 Chr1 (1765699..1767498) [1800 bp, 599 aa] {ON} Anc_1...   371   e-121
TPHA0A04700 Chr1 (1064463..1066172) [1710 bp, 569 aa] {ON} Anc_5...   369   e-120
NDAI0C02950 Chr3 (676753..678582) [1830 bp, 609 aa] {ON} Anc_5.158    367   e-119
Suva_2.716 Chr2 complement(1256781..1258592) [1812 bp, 603 aa] {...   367   e-119
KLLA0A10813g Chr1 complement(936126..937880) [1755 bp, 584 aa] {...   366   e-119
AEL030W Chr5 (577803..579551) [1749 bp, 582 aa] {ON} Syntenic ho...   366   e-119
Smik_11.302 Chr11 (505026..506684) [1659 bp, 553 aa] {ON} YKR039...   358   e-116
NCAS0A07110 Chr1 (1408106..1409884) [1779 bp, 592 aa] {ON} Anc_5...   359   e-116
YOL020W Chr15 (286172..287950) [1779 bp, 592 aa] {ON}  TAT2High ...   358   e-115
NDAI0G06030 Chr7 complement(1489584..1491383) [1800 bp, 599 aa] ...   357   e-115
Smik_15.146 Chr15 (252586..254367) [1782 bp, 593 aa] {ON} YOL020...   356   e-115
Skud_15.138 Chr15 (245592..247370) [1779 bp, 592 aa] {ON} YOL020...   355   e-114
Kpol_534.22 s534 (50849..52627) [1779 bp, 592 aa] {ON} (50849..5...   353   e-114
CAGL0D02178g Chr4 (222597..224330) [1734 bp, 577 aa] {ON} highly...   352   e-113
KLTH0C08052g Chr3 (685805..687604) [1800 bp, 599 aa] {ON} simila...   350   e-112
TPHA0A02500 Chr1 (533688..535460) [1773 bp, 590 aa] {ON} Anc_1.3...   347   e-111
Suva_15.148 Chr15 (258987..260765) [1779 bp, 592 aa] {ON} YOL020...   345   e-111
TBLA0C01210 Chr3 complement(260786..262588) [1803 bp, 600 aa] {O...   346   e-111
Ecym_2716 Chr2 (1386630..1388408) [1779 bp, 592 aa] {ON} similar...   343   e-110
SAKL0D04048g Chr4 (328883..330643) [1761 bp, 586 aa] {ON} simila...   342   e-110
KLTH0H13398g Chr8 complement(1169665..1171428) [1764 bp, 587 aa]...   336   e-107
YPL274W Chr16 (22938..24701) [1764 bp, 587 aa] {ON}  SAM3High-af...   335   e-107
KLLA0B06776g Chr2 (594172..595938) [1767 bp, 588 aa] {ON} simila...   334   e-106
TPHA0G03770 Chr7 complement(797508..799322) [1815 bp, 604 aa] {O...   328   e-104
TDEL0B00130 Chr2 (20136..21890) [1755 bp, 584 aa] {ON}                328   e-104
Smik_6.483 Chr6 (798526..800298) [1773 bp, 590 aa] {ON} YPL274W ...   325   e-103
Kwal_56.22951 s56 complement(345097..346887) [1791 bp, 596 aa] {...   321   e-101
KAFR0F04410 Chr6 (865219..866961) [1743 bp, 580 aa] {ON}              319   e-101
KAFR0B00220 Chr2 complement(52244..54001) [1758 bp, 585 aa] {ON}      318   e-100
Suva_16.31 Chr16 (39282..41042) [1761 bp, 586 aa] {ON} YLL061W (...   318   e-100
YLL061W Chr12 (17956..19707) [1752 bp, 583 aa] {ON}  MMP1High-af...   310   2e-97
TDEL0H04510 Chr8 complement(813321..815075) [1755 bp, 584 aa] {O...   309   7e-97
TDEL0E05700 Chr5 complement(1059079..1060833) [1755 bp, 584 aa] ...   309   7e-97
AER405C Chr5 complement(1413790..1415283) [1494 bp, 497 aa] {ON}...   301   7e-95
ZYRO0D17952g Chr4 complement(1489975..1491732) [1758 bp, 585 aa]...   303   1e-94
Sklu_YGOB_Anc_1.368 Chr4 complement(849414..850103,850105..85104...   301   2e-94
Smik_12.2 Chr12 (2207..3958) [1752 bp, 583 aa] {ON} YLL061W (REAL)    301   6e-94
TDEL0E00250 Chr5 (41958..43721) [1764 bp, 587 aa] {ON}                293   5e-91
Suva_16.18 Chr16 (17108..18859) [1752 bp, 583 aa] {ON} YLL061W (...   288   7e-89
Ecym_4758 Chr4 (1474661..1476424) [1764 bp, 587 aa] {ON} similar...   286   2e-88
Kwal_34.16254 s34 (264235..265677) [1443 bp, 481 aa] {OFF} YOL02...   280   5e-87
Kwal_YGOB_34.16254 s34 (264235..265707) [1473 bp, 491 aa] {ON} A...   280   7e-87
SAKL0C02662g Chr3 complement(249789..251435) [1647 bp, 548 aa] {...   270   2e-82
TBLA0A07060 Chr1 complement(1737650..1739527) [1878 bp, 625 aa] ...   266   4e-80
SAKL0C02640g Chr3 complement(247651..249297) [1647 bp, 548 aa] {...   261   4e-79
TDEL0C06170 Chr3 complement(1117792..1119513) [1722 bp, 573 aa] ...   253   1e-75
KLLA0E16281g Chr5 (1455271..1457088) [1818 bp, 605 aa] {ON} simi...   252   6e-75
Smik_6.473 Chr6 complement(778327..780147) [1821 bp, 606 aa] {ON...   251   2e-74
Skud_16.12 Chr16 (20144..21967) [1824 bp, 607 aa] {ON} YPL265W (...   249   5e-74
KLTH0F02398g Chr6 complement(202746..204413) [1668 bp, 555 aa] {...   248   7e-74
KNAG0L02470 Chr12 (440549..442465) [1917 bp, 638 aa] {ON}             249   7e-74
Kwal_33.13401 s33 complement(206763..208442) [1680 bp, 559 aa] {...   247   1e-73
Smik_5.24 Chr5 complement(34087..35859) [1773 bp, 590 aa] {ON} Y...   248   1e-73
YPL265W Chr16 (41043..42869) [1827 bp, 608 aa] {ON}  DIP5Dicarbo...   248   2e-73
TPHA0B04470 Chr2 complement(1047097..1048896) [1800 bp, 599 aa] ...   247   3e-73
Kpol_2000.64 s2000 complement(130912..132744) [1833 bp, 610 aa] ...   246   7e-73
ZYRO0F16632g Chr6 complement(1371112..1372935) [1824 bp, 607 aa]...   245   2e-72
Suva_16.40 Chr16 (56664..58484) [1821 bp, 606 aa] {ON} YPL265W (...   244   3e-72
Ecym_1088 Chr1 (184038..185741) [1704 bp, 567 aa] {ON} similar t...   243   3e-72
KNAG0C05920 Chr3 (1157993..1159792) [1800 bp, 599 aa] {ON}            243   8e-72
CAGL0J08162g Chr10 complement(803679..805472) [1794 bp, 597 aa] ...   243   1e-71
Ecym_1087 Chr1 complement(180832..182544) [1713 bp, 570 aa] {ON}...   241   2e-71
NDAI0F04190 Chr6 complement(1012142..1013941) [1800 bp, 599 aa] ...   242   2e-71
CAGL0A01199g Chr1 (121067..122908) [1842 bp, 613 aa] {ON} simila...   242   3e-71
Suva_5.4 Chr5 complement(7388..9160) [1773 bp, 590 aa] {ON} YEL0...   241   3e-71
TBLA0A05460 Chr1 (1348452..1350278) [1827 bp, 608 aa] {ON} Anc_1...   241   4e-71
TDEL0C06180 Chr3 (1120158..1121909) [1752 bp, 583 aa] {ON} Anc_1...   240   8e-71
YEL063C Chr5 complement(31694..33466) [1773 bp, 590 aa] {ON}  CA...   240   9e-71
Kpol_358.3 s358 (7369..9096) [1728 bp, 575 aa] {ON} (7369..9096)...   239   1e-70
NCAS0A00600 Chr1 complement(109246..110880) [1635 bp, 544 aa] {O...   238   2e-70
KAFR0D03940 Chr4 complement(767673..769466) [1794 bp, 597 aa] {O...   239   3e-70
NDAI0A00610 Chr1 complement(113913..115610) [1698 bp, 565 aa] {O...   238   4e-70
KNAG0F00480 Chr6 (73545..75338) [1794 bp, 597 aa] {ON}                239   4e-70
SAKL0C02684g Chr3 complement(251988..253754) [1767 bp, 588 aa] {...   238   6e-70
SAKL0C02728g Chr3 (255022..256710) [1689 bp, 562 aa] {ON} simila...   236   1e-69
TBLA0A05450 Chr1 complement(1345808..1347628) [1821 bp, 606 aa] ...   238   1e-69
KAFR0B06430 Chr2 complement(1333415..1335196) [1782 bp, 593 aa] ...   237   1e-69
NCAS0A00610 Chr1 (111522..113345) [1824 bp, 607 aa] {ON}              236   4e-69
TPHA0M00130 Chr13 complement(25769..27604) [1836 bp, 611 aa] {ON}     236   5e-69
CAGL0J08184g Chr10 (806631..808349) [1719 bp, 572 aa] {ON} simil...   235   6e-69
Skud_5.26 Chr5 complement(30850..32622) [1773 bp, 590 aa] {ON} Y...   235   7e-69
NCAS0B08570 Chr2 (1644264..1645862) [1599 bp, 532 aa] {ON}            233   7e-69
KLLA0C02343g Chr3 complement(203552..205297) [1746 bp, 581 aa] {...   233   4e-68
YNL268W Chr14 (138550..140385) [1836 bp, 611 aa] {ON}  LYP1Lysin...   233   5e-68
SAKL0G14916g Chr7 complement(1277225..1278970) [1746 bp, 581 aa]...   232   7e-68
NDAI0I02660 Chr9 complement(619959..621743) [1785 bp, 594 aa] {O...   233   7e-68
AFR668W Chr6 (1659910..1661580) [1671 bp, 556 aa] {ON} Syntenic ...   231   1e-67
YNL270C Chr14 complement(135940..137661) [1722 bp, 573 aa] {ON} ...   231   3e-67
Kwal_33.15545 s33 complement(1149997..1151727) [1731 bp, 576 aa]...   229   6e-67
ZYRO0F16654g Chr6 (1374093..1375835) [1743 bp, 580 aa] {ON} simi...   229   9e-67
Smik_14.68 Chr14 (117603..119438) [1836 bp, 611 aa] {ON} YEL063C...   229   1e-66
NCAS0D02260 Chr4 (421966..423759) [1794 bp, 597 aa] {ON}              229   1e-66
Kwal_33.13411 s33 (210461..212143) [1683 bp, 560 aa] {ON} YNL268...   227   4e-66
KNAG0C00790 Chr3 (138911..140650) [1740 bp, 579 aa] {ON}              227   7e-66
Skud_14.70 Chr14 complement(124390..126111) [1722 bp, 573 aa] {O...   226   1e-65
KLTH0F02420g Chr6 (205827..207692) [1866 bp, 621 aa] {ON} simila...   227   2e-65
Smik_14.67 Chr14 complement(114969..116690) [1722 bp, 573 aa] {O...   224   4e-65
KLTH0B01166g Chr2 (102227..103960) [1734 bp, 577 aa] {ON} simila...   224   1e-64
TPHA0B04480 Chr2 (1050173..1051984) [1812 bp, 603 aa] {ON} Anc_1...   223   3e-64
KLLA0C02365g Chr3 (208462..210201) [1740 bp, 579 aa] {ON} simila...   222   4e-64
KAFR0D00700 Chr4 complement(120768..122492) [1725 bp, 574 aa] {O...   222   4e-64
Suva_14.75 Chr14 (133164..134999) [1836 bp, 611 aa] {ON} YEL063C...   223   5e-64
Suva_14.73 Chr14 complement(130474..131967) [1494 bp, 497 aa] {O...   219   1e-63
Skud_14.71 Chr14 (127310..129148) [1839 bp, 612 aa] {ON} YEL063C...   221   2e-63
NDAI0F04200 Chr6 (1016214..1017914) [1701 bp, 566 aa] {ON}            218   9e-63
Ecym_2480 Chr2 complement(940315..942075) [1761 bp, 586 aa] {ON}...   218   1e-62
AFR667C Chr6 complement(1657505..1659196) [1692 bp, 563 aa] {ON}...   216   4e-62
Skud_7.4 Chr7 (9030..10079) [1050 bp, 349 aa] {ON} YKR039W (REAL)     210   4e-62
Skud_51.1 Chr51 (364..1407) [1044 bp, 348 aa] {ON} YKR039W (REAL)     210   5e-62
Skud_47.1 Chr47 (1..987) [987 bp, 328 aa] {ON} YPL274W (REAL)         207   4e-61
YOR348C Chr15 complement(986899..988782) [1884 bp, 627 aa] {ON} ...   215   4e-61
SAKL0B10956g Chr2 complement(949900..951618) [1719 bp, 572 aa] {...   214   5e-61
Kpol_2000.65 s2000 (134897..136684) [1788 bp, 595 aa] {ON} (1348...   213   1e-60
Smik_15.532 Chr15 complement(932437..934332) [1896 bp, 631 aa] {...   214   1e-60
KNAG0L02460 Chr12 (437963..439729) [1767 bp, 588 aa] {ON}             209   2e-59
ACL135W Chr3 (115359..117125) [1767 bp, 588 aa] {ON} Non-synteni...   209   3e-59
Suva_8.402 Chr8 complement(722727..724778) [2052 bp, 683 aa] {ON...   211   4e-59
ZYRO0D17908g Chr4 (1486514..1488070) [1557 bp, 518 aa] {ON} simi...   206   7e-59
KAFR0C05160 Chr3 (1025799..1027553) [1755 bp, 584 aa] {ON} Anc_7...   204   1e-57
TPHA0H02850 Chr8 complement(676524..678329) [1806 bp, 601 aa] {O...   201   3e-56
KNAG0E00390 Chr5 (61730..63529) [1800 bp, 599 aa] {ON} Anc_7.44 ...   201   4e-56
Skud_15.515 Chr15 complement(924662..926542) [1881 bp, 626 aa] {...   201   5e-56
AFR156W Chr6 (717642..719318) [1677 bp, 558 aa] {ON} Non-synteni...   200   5e-56
Ecym_8035 Chr8 (81434..83125) [1692 bp, 563 aa] {ON} similar to ...   199   8e-56
Kwal_26.6940 s26 (133377..135089) [1713 bp, 570 aa] {ON} YOR348C...   198   2e-55
CAGL0E05632g Chr5 complement(556856..558652) [1797 bp, 598 aa] {...   197   6e-55
TDEL0H04070 Chr8 complement(698717..700450) [1734 bp, 577 aa] {O...   194   8e-54
KLTH0D01474g Chr4 (139116..140990) [1875 bp, 624 aa] {ON} simila...   194   2e-53
KLLA0F23419g Chr6 complement(2187386..2189107) [1722 bp, 573 aa]...   192   3e-53
KLTH0D07128g Chr4 complement(624863..626494) [1632 bp, 543 aa] {...   190   1e-52
SAKL0F09790g Chr6 (750158..751834) [1677 bp, 558 aa] {ON} simila...   188   7e-52
TDEL0F02830 Chr6 complement(513358..515043) [1686 bp, 561 aa] {O...   188   1e-51
Smik_13.1 Chr13 (1838..3409) [1572 bp, 523 aa] {ON} YFL055W (REAL)    187   1e-51
KLLA0F27093g Chr6 (2501049..2502740) [1692 bp, 563 aa] {ON} simi...   187   3e-51
TBLA0C01240 Chr3 (270186..272075) [1890 bp, 629 aa] {ON} Anc_1.3...   188   3e-51
Suva_13.517 Chr13 (904704..906347) [1644 bp, 547 aa] {ON} YPL265...   186   4e-51
CAGL0M00154g Chr13 (22039..23691) [1653 bp, 550 aa] {ON} similar...   185   7e-51
NCAS0E02260 Chr5 (437115..438896) [1782 bp, 593 aa] {ON} Anc_7.44     186   7e-51
Smik_6.482 Chr6 complement(795927..797603) [1677 bp, 558 aa] {ON...   185   1e-50
SAKL0C13992g Chr3 complement(1242080..1243738) [1659 bp, 552 aa]...   182   7e-50
Skud_6.2 Chr6 (1506..3182) [1677 bp, 558 aa] {ON} YFL055W (REAL)      182   1e-49
TDEL0E05750 Chr5 (1074448..1076094) [1647 bp, 548 aa] {ON}            182   1e-49
TDEL0A08030 Chr1 (1405718..1407262) [1545 bp, 514 aa] {ON}            181   1e-49
SAKL0A09724g Chr1 complement(855698..857353) [1656 bp, 551 aa] {...   180   5e-49
YFL055W Chr6 (17004..18680) [1677 bp, 558 aa] {ON}  AGP3Low-affi...   180   9e-49
Kpol_367.7 s367 (23929..25683) [1755 bp, 584 aa] {ON} (23929..25...   179   2e-48
Kwal_26.9612 s26 complement(1291552..1293183) [1632 bp, 543 aa] ...   179   2e-48
NDAI0E03800 Chr5 (829594..831459) [1866 bp, 621 aa] {ON} Anc_7.44     178   8e-48
KNAG0L00110 Chr12 complement(8543..10258) [1716 bp, 571 aa] {ON}...   177   1e-47
KAFR0F02250 Chr6 (439217..440881) [1665 bp, 554 aa] {ON}              175   4e-47
SAKL0F16544g Chr6 complement(1364680..1366383) [1704 bp, 567 aa]...   175   5e-47
Kwal_26.8097 s26 (643310..644944) [1635 bp, 544 aa] {ON} YNL270C...   174   7e-47
NCAS0J00140 Chr10 complement(8478..10154) [1677 bp, 558 aa] {ON}      174   2e-46
KLTH0A00308g Chr1 (23428..25053) [1626 bp, 541 aa] {ON} weakly s...   172   4e-46
ZYRO0A00308g Chr1 complement(16982..18676) [1695 bp, 564 aa] {ON...   172   5e-46
Kwal_23.4026 s23 (534468..536072) [1605 bp, 534 aa] {ON} YPL265W...   171   1e-45
Kwal_23.2817 s23 complement(26637..28379) [1743 bp, 580 aa] {ON}...   171   2e-45
ZYRO0G07172g Chr7 complement(565863..567566) [1704 bp, 567 aa] {...   169   4e-45
ZYRO0C18502g Chr3 complement(1448075..1449802) [1728 bp, 575 aa]...   169   1e-44
Skud_16.2 Chr16 complement(1584..3074) [1491 bp, 496 aa] {ON} YP...   166   3e-44
NDAI0A01340 Chr1 (296616..298280) [1665 bp, 554 aa] {ON}              164   3e-43
NDAI0F04210 Chr6 (1018256..1018768) [513 bp, 170 aa] {ON}             153   5e-43
Kwal_8.590 s8 complement(17220..19109) [1890 bp, 629 aa] {ON} YO...   164   7e-43
KLLA0B14685g Chr2 complement(1289025..1290740) [1716 bp, 571 aa]...   163   1e-42
Kpol_526.10 s526 complement(18362..20104) [1743 bp, 580 aa] {ON}...   159   4e-41
Skud_16.3 Chr16 (4274..5350) [1077 bp, 358 aa] {ON} YPL274W (REAL)    153   1e-40
Suva_13.516 Chr13 complement(902560..903123,903176..903289) [678...   145   1e-39
KLTH0B00154g Chr2 complement(7385..9055) [1671 bp, 556 aa] {ON} ...   153   2e-39
KLTH0F04048g Chr6 (359492..361243) [1752 bp, 583 aa] {ON} weakly...   152   9e-39
Suva_78.1 Chr78 complement(3..695) [693 bp, 231 aa] {ON} YPL274W...   143   2e-38
Skud_30.1 Chr30 (3097..3933) [837 bp, 279 aa] {ON} YPL274W (REAL)     143   4e-38
AAR038W Chr1 (409071..410771) [1701 bp, 566 aa] {ON} Syntenic ho...   148   1e-37
TDEL0D00200 Chr4 (32432..34135) [1704 bp, 567 aa] {ON}                147   2e-37
TDEL0C05340 Chr3 complement(951770..953497) [1728 bp, 575 aa] {O...   147   5e-37
Skud_2.260 Chr2 complement(467322..469118) [1797 bp, 598 aa] {ON...   147   7e-37
NCAS0I00850 Chr9 (156277..158031) [1755 bp, 584 aa] {ON} Anc_3.3...   146   8e-37
TPHA0A02450 Chr1 (522439..524190) [1752 bp, 583 aa] {ON} Anc_3.3...   146   9e-37
ZYRO0C17182g Chr3 complement(1334883..1336619) [1737 bp, 578 aa]...   144   6e-36
YBR132C Chr2 complement(499652..501442) [1791 bp, 596 aa] {ON}  ...   144   7e-36
Suva_4.381 Chr4 complement(668597..670369) [1773 bp, 590 aa] {ON...   143   9e-36
NCAS0E01810 Chr5 complement(354074..354589) [516 bp, 171 aa] {ON...   132   4e-35
Suva_84.1 Chr84 (1..639) [639 bp, 213 aa] {ON} YPL274W (REAL)         132   6e-35
TBLA0C02520 Chr3 (595918..597660) [1743 bp, 580 aa] {ON} Anc_3.3...   140   8e-35
Smik_2.272 Chr2 complement(484274..486067) [1794 bp, 597 aa] {ON...   140   1e-34
Skud_7.6 Chr7 (10388..10840) [453 bp, 150 aa] {ON} YKR039W (REAL)     128   3e-34
KAFR0K01360 Chr11 complement(279140..280888) [1749 bp, 582 aa] {...   137   7e-34
CAGL0C00539g Chr3 (57175..57177,57724..59502) [1782 bp, 593 aa] ...   137   1e-33
Ecym_3430 Chr3 (807979..809658) [1680 bp, 559 aa] {ON} similar t...   136   1e-33
NDAI0A08190 Chr1 complement(1875783..1877543) [1761 bp, 586 aa] ...   136   2e-33
KLTH0F11286g Chr6 (959314..961062) [1749 bp, 582 aa] {ON} simila...   135   5e-33
KNAG0B01270 Chr2 (240862..242640) [1779 bp, 592 aa] {ON} Anc_3.3...   133   2e-32
SAKL0B04554g Chr2 complement(401845..403461) [1617 bp, 538 aa] {...   132   3e-32
Kwal_23.3847 s23 (457732..459471) [1740 bp, 579 aa] {ON} YBR132C...   131   8e-32
TBLA0F03240 Chr6 complement(790069..791826) [1758 bp, 585 aa] {O...   131   1e-31
KLLA0C15873g Chr3 (1381699..1383405) [1707 bp, 568 aa] {ON} simi...   130   2e-31
SAKL0H10890g Chr8 complement(940629..943046) [2418 bp, 805 aa] {...   128   2e-30
KLTH0E11792g Chr5 (1047925..1050339) [2415 bp, 804 aa] {ON} simi...   128   3e-30
SAKL0B08734g Chr2 complement(743379..745055) [1677 bp, 558 aa] {...   125   7e-30
KNAG0A05040 Chr1 complement(733928..736432) [2505 bp, 834 aa] {O...   123   9e-29
Kwal_YGOB_27.11900 s27 (994323..996518,996909..997118) [2406 bp,...   123   1e-28
ZYRO0D09086g Chr4 complement(780326..781966) [1641 bp, 546 aa] {...   122   1e-28
SAKL0H15092g Chr8 complement(1306212..1308764) [2553 bp, 850 aa]...   121   6e-28
Kwal_53.19461 s53 complement(2918..4615) [1698 bp, 565 aa] {ON} ...   117   5e-27
TDEL0F04660 Chr6 (877951..880473) [2523 bp, 840 aa] {ON} Anc_8.3...   117   9e-27
KLLA0B09922g Chr2 complement(867748..870141) [2394 bp, 797 aa] {...   115   3e-26
Kwal_27.11900 s27 (994323..996500) [2178 bp, 726 aa] {OFF} YDR16...   114   6e-26
KLTH0E00550g Chr5 (57109..58680) [1572 bp, 523 aa] {ON} similar ...   113   8e-26
KLLA0D16830g Chr4 (1426856..1429354) [2499 bp, 832 aa] {ON} simi...   110   1e-24
NDAI0J00870 Chr10 complement(191679..194192) [2514 bp, 837 aa] {...   110   2e-24
ZYRO0F13838g Chr6 (1139293..1141803) [2511 bp, 836 aa] {ON} simi...   110   2e-24
AGL171W Chr7 (377256..379811) [2556 bp, 851 aa] {ON} Syntenic ho...   109   4e-24
Ecym_4230 Chr4 complement(478376..480949) [2574 bp, 857 aa] {ON}...   109   4e-24
KLTH0G11726g Chr7 complement(986837..989311) [2475 bp, 824 aa] {...   108   9e-24
CAGL0E01089g Chr5 complement(96819..99380) [2562 bp, 853 aa] {ON...   107   2e-23
NCAS0B03380 Chr2 complement(589351..591888) [2538 bp, 845 aa] {O...   106   3e-23
Skud_4.418 Chr4 (745597..748152) [2556 bp, 851 aa] {ON} YDR160W ...   105   6e-23
Suva_2.323 Chr2 (570119..572674) [2556 bp, 851 aa] {ON} YDR160W ...   103   3e-22
YDR160W Chr4 (776163..778721) [2559 bp, 852 aa] {ON}  SSY1Compon...   100   4e-21
Smik_4.404 Chr4 (734205..736763) [2559 bp, 852 aa] {ON} YDR160W ...    99   8e-21
TDEL0C00100 Chr3 complement(1863..2399) [537 bp, 178 aa] {ON}          77   1e-15
Skud_7.5 Chr7 (10082..10387) [306 bp, 102 aa] {ON} YKR039W (REAL)      66   1e-12
TPHA0A04703 Chr1 (1067266..1067586) [321 bp, 106 aa] {ON}              50   4e-07
Skud_12.5 Chr12 (6025..6258,6262..6279,6283..6312,6359..6424,642...    39   0.031
KAFR0A06250 Chr1 complement(1262105..1263832) [1728 bp, 575 aa] ...    33   2.1  
NCAS0J01180 Chr10 (204451..206208) [1758 bp, 585 aa] {ON} Anc_4....    32   6.1  
NDAI0J01930 Chr10 (480261..482033) [1773 bp, 590 aa] {ON} Anc_4....    31   9.0  

>Kwal_33.13215 s33 complement(123154..124950) [1797 bp, 598 aa] {ON}
           YDR508C (GNP1) - high-affinity glutamine permease
           [contig 121] FULL
          Length = 598

 Score = 1074 bits (2777), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 532/598 (88%), Positives = 532/598 (88%)

Query: 1   MKDFELHNMKSPDNGVVESFDSVEVLKEESPRSDSRSDGLFRRFADSFRRHEAHNXXXXX 60
           MKDFELHNMKSPDNGVVESFDSVEVLKEESPRSDSRSDGLFRRFADSFRRHEAHN     
Sbjct: 1   MKDFELHNMKSPDNGVVESFDSVEVLKEESPRSDSRSDGLFRRFADSFRRHEAHNGGGGD 60

Query: 61  XXXXXXXXLTPIESASKHKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLV 120
                   LTPIESASKHKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLV
Sbjct: 61  GDDEDHEGLTPIESASKHKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLV 120

Query: 121 IGYAIVSSMLYCVIQSASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLP 180
           IGYAIVSSMLYCVIQSASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLP
Sbjct: 121 IGYAIVSSMLYCVIQSASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLP 180

Query: 181 LELVTASMTIKYWNQTINPDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXX 240
           LELVTASMTIKYWNQTINPDAFVTIFYVVLVAIN              NCCKVLM     
Sbjct: 181 LELVTASMTIKYWNQTINPDAFVTIFYVVLVAINFVGAAGYAEAEFFFNCCKVLMIIGFF 240

Query: 241 XXXXXXNCGGAGNDGYLGARYWHDPGAFRGSDSINRFKGIVAVLVNAAFAYGGAEFSVLT 300
                 NCGGAGNDGYLGARYWHDPGAFRGSDSINRFKGIVAVLVNAAFAYGGAEFSVLT
Sbjct: 241 ILGIIINCGGAGNDGYLGARYWHDPGAFRGSDSINRFKGIVAVLVNAAFAYGGAEFSVLT 300

Query: 301 AAEQQNPQKSIRSASKKLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSATHASPFVIA 360
           AAEQQNPQKSIRSASKKLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSATHASPFVIA
Sbjct: 301 AAEQQNPQKSIRSASKKLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSATHASPFVIA 360

Query: 361 VASHGVRVVPHFXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVL 420
           VASHGVRVVPHF                            EQGFAPRFLNYVDRCGRPVL
Sbjct: 361 VASHGVRVVPHFINAVILLSVLSVANSALYSSSRILLSLSEQGFAPRFLNYVDRCGRPVL 420

Query: 421 CLLVSCVFGLLSFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSA 480
           CLLVSCVFGLLSFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSA
Sbjct: 421 CLLVSCVFGLLSFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSA 480

Query: 481 DELGYVAWTGVWGAYYAMAMIVAILVGQFWVAISPVGSNKLDANNFFENYLAMPILIFLY 540
           DELGYVAWTGVWGAYYAMAMIVAILVGQFWVAISPVGSNKLDANNFFENYLAMPILIFLY
Sbjct: 481 DELGYVAWTGVWGAYYAMAMIVAILVGQFWVAISPVGSNKLDANNFFENYLAMPILIFLY 540

Query: 541 LGYKIWTRDWRLLIPSSEVDLVAHRKIFDAEVLRHEQLEEKEQLRHAPWTTRLANFWC 598
           LGYKIWTRDWRLLIPSSEVDLVAHRKIFDAEVLRHEQLEEKEQLRHAPWTTRLANFWC
Sbjct: 541 LGYKIWTRDWRLLIPSSEVDLVAHRKIFDAEVLRHEQLEEKEQLRHAPWTTRLANFWC 598

>KLTH0F01606g Chr6 complement(122821..124635) [1815 bp, 604 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn expression is
           fully dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p- Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 604

 Score =  908 bits (2347), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 447/605 (73%), Positives = 489/605 (80%), Gaps = 8/605 (1%)

Query: 1   MKDFELHNMKSPDNGVVESFDSVEVLKEESPRSDSRSDGLFRRFADSFRRHEAH------ 54
           MK FE+ N+KSP++GVVESFDSVEV+KE SPRS+   DGLF RF DSF+R E        
Sbjct: 1   MKGFEMKNIKSPEDGVVESFDSVEVVKETSPRSEGSRDGLFHRFVDSFKRPEEEYNGGDG 60

Query: 55  -NXXXXXXXXXXXXXLTPIESASKHKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHN 113
            +             L P + +SKHKTLKQNI+PRHVLMISLATGIGTGMLVGNGKSLHN
Sbjct: 61  IHSTHERVSGEDFERLAP-DDSSKHKTLKQNIKPRHVLMISLATGIGTGMLVGNGKSLHN 119

Query: 114 GGPASLVIGYAIVSSMLYCVIQSASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCL 173
           GGPASL+IGYAIVS+MLYCVIQSASELAIIYTSL+GGFNAYP+LLVDKAF FSVSWVYCL
Sbjct: 120 GGPASLLIGYAIVSTMLYCVIQSASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCL 179

Query: 174 QWLCVLPLELVTASMTIKYWNQTINPDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKV 233
           QWLC+LPLELVTASMTIKYWN +INPDAFV IFYVVL+ IN              N CKV
Sbjct: 180 QWLCILPLELVTASMTIKYWNDSINPDAFVVIFYVVLIVINFIGAAGYAEAEFFFNTCKV 239

Query: 234 LMXXXXXXXXXXXNCGGAGNDGYLGARYWHDPGAFRGSDSINRFKGIVAVLVNAAFAYGG 293
           LM           NCGGAGNDGYLG+ YWHDPGAFRG++ INRFKG+VAVLVNAAFAYGG
Sbjct: 240 LMLIGFFILGIIVNCGGAGNDGYLGSVYWHDPGAFRGNNGINRFKGLVAVLVNAAFAYGG 299

Query: 294 AEFSVLTAAEQQNPQKSIRSASKKLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSATH 353
           AEFSVLTAAEQQNPQKSIRSASKKLVYRI+GIY+MTA LLGFLVP+NS ELLGSG +ATH
Sbjct: 300 AEFSVLTAAEQQNPQKSIRSASKKLVYRIIGIYLMTAALLGFLVPYNSPELLGSGSAATH 359

Query: 354 ASPFVIAVASHGVRVVPHFXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVD 413
           ASPFVIA+ASHGV+VVPH                             EQGFAP+  NYVD
Sbjct: 360 ASPFVIAIASHGVKVVPHIINAVILLSVLSVANSALYSSSRILLSLSEQGFAPKLFNYVD 419

Query: 414 RCGRPVLCLLVSCVFGLLSFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAM 473
           R GRPV CLLVSCVFGLL FVAASPKEETVFTWLLAISGLSELFTWFSISLSHVR RR+M
Sbjct: 420 RRGRPVRCLLVSCVFGLLCFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRFRRSM 479

Query: 474 TVQGRSADELGYVAWTGVWGAYYAMAMIVAILVGQFWVAISPVGSNKLDANNFFENYLAM 533
            VQGRS DELGY +WTGVWGAYYAM MI+ IL+GQFWVAISPVGSNKLDANNFFENYLAM
Sbjct: 480 IVQGRSLDELGYQSWTGVWGAYYAMIMILLILIGQFWVAISPVGSNKLDANNFFENYLAM 539

Query: 534 PILIFLYLGYKIWTRDWRLLIPSSEVDLVAHRKIFDAEVLRHEQLEEKEQLRHAPWTTRL 593
           PILI LYLGYK+W RDWR++IP++EVDLV+HRKIFDAE+++ EQLEEKEQLRHA WT R 
Sbjct: 540 PILIGLYLGYKLWYRDWRVIIPANEVDLVSHRKIFDAEIMQSEQLEEKEQLRHASWTKRA 599

Query: 594 ANFWC 598
           A FWC
Sbjct: 600 AEFWC 604

>SAKL0C01650g Chr3 complement(139480..141321) [1842 bp, 613 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn expression is
           fully dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p-Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 613

 Score =  693 bits (1789), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 333/560 (59%), Positives = 406/560 (72%), Gaps = 10/560 (1%)

Query: 40  LFRRFADSFRRHEAHNXXXXXXXXXXXXXLTPIESASK-HKTLKQNIRPRHVLMISLATG 98
           LFRRFA+SF+R    N                 ++  K    LK+ I+ RHV+MISL TG
Sbjct: 63  LFRRFANSFKRAPGSNNPDKEDGS---------DAGDKGDNKLKKTIKSRHVVMISLGTG 113

Query: 99  IGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYCVIQSASELAIIYTSLAGGFNAYPSLL 158
           IGTGMLVGNGK+L NGGPA LVIGYAI+ S LYC+IQ+A ELA+ YTSL+GGFNAYPSLL
Sbjct: 114 IGTGMLVGNGKALRNGGPAGLVIGYAIMGSCLYCIIQAAGELAVCYTSLSGGFNAYPSLL 173

Query: 159 VDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKYWNQTINPDAFVTIFYVVLVAINXXXX 218
           +D A GFSV+WVYCLQWLCV+PLELVTAS+TIKYW  ++NPD FV IFYV+ +AIN    
Sbjct: 174 IDPALGFSVAWVYCLQWLCVMPLELVTASITIKYWTTSVNPDIFVAIFYVLTIAINVFGA 233

Query: 219 XXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGGAGNDGYLGARYWHDPGAFRGSDSINRFK 278
                     N CKVLM           NCGGAGNDGY+G +YW+DPG+F G   I+ FK
Sbjct: 234 RGYAEAEFFFNTCKVLMITGFFILGIIVNCGGAGNDGYIGGKYWNDPGSFSGDKPIDHFK 293

Query: 279 GIVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRILGIYIMTAILLGFLVP 338
           G+V+ LV AAFA+G  EF  LTAAEQ NP+KSI SA+KK++YRI+ I++ +  L+GFLVP
Sbjct: 294 GVVSTLVTAAFAFGATEFIALTAAEQANPRKSIPSAAKKVLYRIIVIFLGSITLVGFLVP 353

Query: 339 WNSDELLGSGGSATHASPFVIAVASHGVRVVPHFXXXXXXXXXXXXXXXXXXXXXXXXXX 398
            NS+EL+GSGGSATHASP+VIA+ASHGV+VVPHF                          
Sbjct: 354 HNSEELMGSGGSATHASPYVIAIASHGVKVVPHFINAVILLSVLSVGNSAFYSSSRLLLS 413

Query: 399 XXEQGFAPRFLNYVDRCGRPVLCLLVSCVFGLLSFVAASPKEETVFTWLLAISGLSELFT 458
             EQG+AP FL YVDR GRP L +++S VFGL+SFVAASPKEETVFTWLLAISGLS+LFT
Sbjct: 414 LAEQGYAPSFLKYVDREGRPTLAMIISAVFGLISFVAASPKEETVFTWLLAISGLSQLFT 473

Query: 459 WFSISLSHVRLRRAMTVQGRSADELGYVAWTGVWGAYYAMAMIVAILVGQFWVAISPVGS 518
           W +I LSH+R RRAM VQGRS  ELG+ +  GVWG+YYA  M++ IL+GQFW AI+P+G 
Sbjct: 474 WSAICLSHIRFRRAMKVQGRSLGELGFKSQVGVWGSYYATGMMLLILIGQFWTAIAPIGE 533

Query: 519 NKLDANNFFENYLAMPILIFLYLGYKIWTRDWRLLIPSSEVDLVAHRKIFDAEVLRHEQL 578
            KLDA  FFENYLAMPILI LY GYK+W RDW L IP+S++DL+++R+IFD +VL+ E  
Sbjct: 534 GKLDAEAFFENYLAMPILIALYFGYKVWKRDWTLYIPASKIDLISNRRIFDEDVLKQEDA 593

Query: 579 EEKEQLRHAPWTTRLANFWC 598
           E +E+LR++ W  R A FWC
Sbjct: 594 EFREKLRNSGWLRRAAEFWC 613

>SAKL0C01232g Chr3 (110269..112110) [1842 bp, 613 aa] {ON} similar
           to uniprot|P48813 Saccharomyces cerevisiae YDR508C GNP1
           High-affinity glutamine permease also transports Leu Ser
           Thr Cys Met and Asn expression is fully dependent on
           Grr1p and modulated by the Ssy1p-Ptr3p-Ssy5p (SPS)
           sensor of extracellular amino acids
          Length = 613

 Score =  692 bits (1787), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 333/560 (59%), Positives = 405/560 (72%), Gaps = 10/560 (1%)

Query: 40  LFRRFADSFRRHEAHNXXXXXXXXXXXXXLTPIESASK-HKTLKQNIRPRHVLMISLATG 98
           LFRRFA+SF+R    N                 ++  K    LK+ I+ RHV+MISL TG
Sbjct: 63  LFRRFANSFKRAPGSNNPDKEDGS---------DAGDKGDNKLKKTIKSRHVVMISLGTG 113

Query: 99  IGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYCVIQSASELAIIYTSLAGGFNAYPSLL 158
           IGTGMLVGNGK+L NGGPA LVIGYAI+ S LYC+IQ+A ELA+ YTSL+GGFNAYPSLL
Sbjct: 114 IGTGMLVGNGKALRNGGPAGLVIGYAIMGSCLYCIIQAAGELAVCYTSLSGGFNAYPSLL 173

Query: 159 VDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKYWNQTINPDAFVTIFYVVLVAINXXXX 218
           +D A GFSV+WVYCLQWLCV+PLELVTAS+TIKYW  ++NPD FV IFYVV++ IN    
Sbjct: 174 IDPALGFSVAWVYCLQWLCVMPLELVTASITIKYWTTSVNPDIFVAIFYVVIITINVFGA 233

Query: 219 XXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGGAGNDGYLGARYWHDPGAFRGSDSINRFK 278
                     N  KVLM           NCGGAGNDGY+G +YW+DPG+F G   I+ FK
Sbjct: 234 RGYAEAEFFFNTFKVLMISGFLILGIIVNCGGAGNDGYIGGKYWNDPGSFSGDKPIDHFK 293

Query: 279 GIVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRILGIYIMTAILLGFLVP 338
           G+V+ LV AAFA+G  EF  LTAAEQ NP+KSI SA+KK++YRIL +Y+ + IL+GFLVP
Sbjct: 294 GVVSTLVTAAFAFGATEFIALTAAEQANPRKSIPSAAKKILYRILVLYVGSIILIGFLVP 353

Query: 339 WNSDELLGSGGSATHASPFVIAVASHGVRVVPHFXXXXXXXXXXXXXXXXXXXXXXXXXX 398
            NS+EL+GSGGSATHASP+VIA+ASHGV+VVPH                           
Sbjct: 354 HNSEELMGSGGSATHASPYVIAIASHGVKVVPHLINAVILLSVISMGNSAFYSSSRLLLT 413

Query: 399 XXEQGFAPRFLNYVDRCGRPVLCLLVSCVFGLLSFVAASPKEETVFTWLLAISGLSELFT 458
             EQG+AP FL YVDR GRP L +++S VFGL+SFVAASPKEETVFTWLLAISGLS+LFT
Sbjct: 414 LAEQGYAPSFLKYVDREGRPTLAMVISSVFGLISFVAASPKEETVFTWLLAISGLSQLFT 473

Query: 459 WFSISLSHVRLRRAMTVQGRSADELGYVAWTGVWGAYYAMAMIVAILVGQFWVAISPVGS 518
           W +I LSH+R RRAM VQGRS  ELG+ +  GVWG+YYA  M++ IL+GQFW AI+P+G 
Sbjct: 474 WSAICLSHIRFRRAMKVQGRSLGELGFKSQVGVWGSYYATGMMLLILIGQFWTAIAPIGE 533

Query: 519 NKLDANNFFENYLAMPILIFLYLGYKIWTRDWRLLIPSSEVDLVAHRKIFDAEVLRHEQL 578
            KLDA  FFENYLAMPILI LY GYK+W RDW L IP+S++DL+++R+IFD +VL+ E  
Sbjct: 534 GKLDAEAFFENYLAMPILIALYFGYKVWKRDWTLYIPASKIDLISNRRIFDEDVLKQEDA 593

Query: 579 EEKEQLRHAPWTTRLANFWC 598
           E +E+LR++ W  R A FWC
Sbjct: 594 EYREKLRNSGWLRRAAEFWC 613

>KLTH0F01584g Chr6 complement(120227..122017) [1791 bp, 596 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn expression is
           fully dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p- Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 596

 Score =  690 bits (1780), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 331/593 (55%), Positives = 418/593 (70%), Gaps = 9/593 (1%)

Query: 6   LHNMKSPDNGVVESFDSVEVLKEESPRSDSRSDGLFRRFADSFRRHEAHNXXXXXXXXXX 65
           L ++KS  N   ES + V +   +    D +    F+R  +SF+R   H           
Sbjct: 13  LQDLKS--NTGSESIEKVSLPASDYQYHDGQVLSRFQRLTNSFKRAGEHGRGGDVDAEG- 69

Query: 66  XXXLTPIESASKHKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAI 125
                P+  A +   LKQ I  RH+ MISL TGIGTGMLVGNGK+LHNGGPA L IGYAI
Sbjct: 70  ----QPV--APRETKLKQTISSRHLFMISLGTGIGTGMLVGNGKALHNGGPAGLAIGYAI 123

Query: 126 VSSMLYCVIQSASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVT 185
           + S +YC+IQ+A E+A+ Y+SL+G FNAYPS+L+D A GFSV+WVYCLQWLCVLPLELVT
Sbjct: 124 MGSCIYCIIQAAGEMAVSYSSLSGNFNAYPSMLIDPALGFSVAWVYCLQWLCVLPLELVT 183

Query: 186 ASMTIKYWNQTINPDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXX 245
           A++TIKYW   +NPD FV IFYV+ V +N              N CKVLM          
Sbjct: 184 ATITIKYWTTAVNPDVFVVIFYVLTVLVNLFGARGYAEAEFFFNTCKVLMITGFFILGII 243

Query: 246 XNCGGAGNDGYLGARYWHDPGAFRGSDSINRFKGIVAVLVNAAFAYGGAEFSVLTAAEQQ 305
            NCGGAGNDGYLG +YWHDPGA  G+  I+ FKGI+A +V AAFA+G  EF  LTAAEQ 
Sbjct: 244 VNCGGAGNDGYLGGKYWHDPGALYGTKPIHHFKGIIATMVTAAFAFGATEFIALTAAEQA 303

Query: 306 NPQKSIRSASKKLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSATHASPFVIAVASHG 365
           NP+++I SA+KK+VYR+L I++   ILLGFLVP+NSDEL+GSGGSATHASP+VIA+ASHG
Sbjct: 304 NPRRAIPSAAKKIVYRVLLIFLAPIILLGFLVPYNSDELMGSGGSATHASPYVIAIASHG 363

Query: 366 VRVVPHFXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVS 425
           V+VVPHF                            EQ +AP +LNY+DR GRP+  +LVS
Sbjct: 364 VKVVPHFINAVILLSVLSVGNSAFYSSSRLLLSLSEQHYAPSWLNYIDREGRPIRAMLVS 423

Query: 426 CVFGLLSFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGY 485
           C+FGL++FVAASPKEETVFTWLLAISGLS+LFTW  I +SH+R R+A+ VQG+S  ELGY
Sbjct: 424 CIFGLIAFVAASPKEETVFTWLLAISGLSQLFTWICICVSHIRFRKALVVQGKSLGELGY 483

Query: 486 VAWTGVWGAYYAMAMIVAILVGQFWVAISPVGSNKLDANNFFENYLAMPILIFLYLGYKI 545
            + TGV G+YYA  ++  +L GQFWVAI+PVG++KLDANNFFENYLAMPILI LY GY++
Sbjct: 484 KSQTGVVGSYYATVIMACVLTGQFWVAIAPVGTDKLDANNFFENYLAMPILIALYFGYRV 543

Query: 546 WTRDWRLLIPSSEVDLVAHRKIFDAEVLRHEQLEEKEQLRHAPWTTRLANFWC 598
           W RDW+L IP  ++DLV+HRK+FD ++L+ E  E +E +R++ W +R+A+FWC
Sbjct: 544 WKRDWKLYIPLEQIDLVSHRKVFDEDLLKQEDAEYEESIRNSGWLSRVAHFWC 596

>Kwal_33.13204 s33 complement(120622..122445) [1824 bp, 607 aa] {ON}
           YDR508C (GNP1) - high-affinity glutamine permease
           [contig 121] FULL
          Length = 607

 Score =  673 bits (1737), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/597 (54%), Positives = 418/597 (70%), Gaps = 8/597 (1%)

Query: 3   DFELHNMKSPDNGVVESFDSVEVLKEESPRSDSRSDGLFRRFADSFRRHEAHNXXXXXXX 62
           D  +  +KS  N   ES + + +  ++    +  S   FRRFA +F R +          
Sbjct: 18  DIGMQELKS--NTGSESVERISLPGDDYKFHEDDSKSRFRRFARTFHRADGLGDGASGND 75

Query: 63  XXXXXXLTPIESASKHKT-LKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVI 121
                     E A + +T LKQ I  RHV M+SL TGIGTGMLVGNGK+LHNGGPA LVI
Sbjct: 76  VEFGA-----EVARQTETKLKQTITFRHVFMMSLGTGIGTGMLVGNGKALHNGGPAGLVI 130

Query: 122 GYAIVSSMLYCVIQSASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPL 181
           GYAI+ S LYC+IQ+A ELA+ Y+SL+G FNAYPS+L+++AFGFSV+W+YCLQWLCVLPL
Sbjct: 131 GYAIMGSCLYCIIQAAGELAVSYSSLSGNFNAYPSMLIEQAFGFSVAWIYCLQWLCVLPL 190

Query: 182 ELVTASMTIKYWNQTINPDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXX 241
           ELVTAS+TIKYW  ++NPD FV IFYV+++ +N              NCCKVLM      
Sbjct: 191 ELVTASITIKYWTTSVNPDIFVAIFYVLIILVNMFGARGYAEAEFFFNCCKVLMIIGFFI 250

Query: 242 XXXXXNCGGAGNDGYLGARYWHDPGAFRGSDSINRFKGIVAVLVNAAFAYGGAEFSVLTA 301
                NCGGAGNDGY+G RYW++PGAF G+  I+ FKGI++ +V AAFA+G  EF  LTA
Sbjct: 251 LGIIVNCGGAGNDGYIGGRYWNNPGAFYGTKPIHHFKGIISTMVTAAFAFGATEFIALTA 310

Query: 302 AEQQNPQKSIRSASKKLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSATHASPFVIAV 361
           AEQ NP+++I SA+KK+VYRIL I++   +L+GFLVP NS EL+GSG SATHASP+VIAV
Sbjct: 311 AEQANPRRAIPSAAKKVVYRILLIFLAPIVLIGFLVPHNSPELMGSGSSATHASPYVIAV 370

Query: 362 ASHGVRVVPHFXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLC 421
           ASHGVRVVPHF                            +Q +AP +L ++DR GRP+  
Sbjct: 371 ASHGVRVVPHFINAVILLSVLSVGNSAFYSSSRLLLALADQHYAPAWLKFIDRSGRPMRA 430

Query: 422 LLVSCVFGLLSFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSAD 481
           +LVSCVFGL+SFVAASPKEETVFTWLLAISGLS+LFTW SI +SH+R R+A+ VQG+   
Sbjct: 431 MLVSCVFGLISFVAASPKEETVFTWLLAISGLSQLFTWISICVSHIRFRKALIVQGKPIG 490

Query: 482 ELGYVAWTGVWGAYYAMAMIVAILVGQFWVAISPVGSNKLDANNFFENYLAMPILIFLYL 541
           ELGY + TGV G+YYA  ++  IL+GQFWVAI+P+GS KLDAN+FFENYLA+P+ + LY 
Sbjct: 491 ELGYKSQTGVAGSYYATFIMGCILIGQFWVAIAPMGSAKLDANSFFENYLALPLFVVLYF 550

Query: 542 GYKIWTRDWRLLIPSSEVDLVAHRKIFDAEVLRHEQLEEKEQLRHAPWTTRLANFWC 598
           G+KIW RDWRL IP  ++DL +HRK FD E+L+ E  E +E +R+  W  R+A++WC
Sbjct: 551 GFKIWKRDWRLYIPLEQIDLDSHRKTFDEELLKQEDAEYEENIRNKGWLRRIAHYWC 607

>Skud_3.38 Chr3 complement(63096..64997) [1902 bp, 633 aa] {ON}
           YCL025C (REAL)
          Length = 633

 Score =  666 bits (1719), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/626 (51%), Positives = 422/626 (67%), Gaps = 31/626 (4%)

Query: 4   FELHNMKSPDNGV--VESFDSVEVLKEES---PRSDSRSD------GLFRRFADSFRRHE 52
           +E  ++K+    +   E  + +E  + +S   P S    D         RRF DSF+R +
Sbjct: 8   YEQKDLKNSSTEIHATEQDNEIEYFETDSNDRPSSQPHLDYEQHNTSAVRRFFDSFKRAD 67

Query: 53  --AHNXXXXXXXXXXXXXLTPIE------------------SASKHKTLKQNIRPRHVLM 92
               +             ++P                    + +K  +LK+ I+PRHVLM
Sbjct: 68  QGGQDESEAVQMNDLTSAISPSSRNAQGLEKNDSTDKINPPAGNKSGSLKKTIQPRHVLM 127

Query: 93  ISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYCVIQSASELAIIYTSLAGGFN 152
           I+L TGIGTG+LVGNG +L + GPA L+IGYAI+ S+LYC+IQ+  ELA++Y++L GG+N
Sbjct: 128 IALGTGIGTGLLVGNGTALVHAGPAGLLIGYAIMGSILYCIIQACGELALVYSNLTGGYN 187

Query: 153 AYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKYWNQTINPDAFVTIFYVVLVA 212
           AYPS LVD  FGF+V+WVYCLQWLCV PLELVTASMTIKYW  ++NPD FV IFYV+++ 
Sbjct: 188 AYPSFLVDDGFGFAVAWVYCLQWLCVCPLELVTASMTIKYWTTSVNPDVFVIIFYVLVIT 247

Query: 213 INXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGGAGNDGYLGARYWHDPGAFRGSD 272
           IN              NCCK+LM           + GGAGNDG++G +YWHDPGAF G  
Sbjct: 248 INIFGARGYAEAEFFFNCCKILMMTGFFILSIIIDVGGAGNDGFIGGKYWHDPGAFNGKH 307

Query: 273 SINRFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRILGIYIMTAIL 332
           SI+RFKG+VA LV AAFA+GG+EF  +T AEQ NP+K+I  A+K+++YRIL +++ T I+
Sbjct: 308 SIDRFKGVVATLVTAAFAFGGSEFIAITTAEQSNPRKAIPGAAKQMIYRILFLFLATIIM 367

Query: 333 LGFLVPWNSDELLGSGGSATHASPFVIAVASHGVRVVPHFXXXXXXXXXXXXXXXXXXXX 392
           LGFLVP+NSD+LLGSGG  T ASP+VIA+ASHGVRVVPHF                    
Sbjct: 368 LGFLVPYNSDQLLGSGGGGTKASPYVIAIASHGVRVVPHFVNAVILLSVLSMANSSFYSS 427

Query: 393 XXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVSCVFGLLSFVAASPKEETVFTWLLAISG 452
                   EQG+AP+F +Y+DR GRP++ + VS +F +++F AASPKEE VFTWLLAISG
Sbjct: 428 ARLFLTLSEQGYAPKFFSYIDRAGRPLIAMGVSALFAVIAFCAASPKEEQVFTWLLAISG 487

Query: 453 LSELFTWFSISLSHVRLRRAMTVQGRSADELGYVAWTGVWGAYYAMAMIVAILVGQFWVA 512
           LS+LFTW +I  SH+R RRAM VQGRS  ELG+ + TGVWG+ YA  M++ IL+GQFWVA
Sbjct: 488 LSQLFTWTAICFSHIRFRRAMKVQGRSLGELGFKSQTGVWGSMYACIMMLLILIGQFWVA 547

Query: 513 ISPVGSNKLDANNFFENYLAMPILIFLYLGYKIWTRDWRLLIPSSEVDLVAHRKIFDAEV 572
           I+P+G  KLDA  FFENYLAMPILI LY+GYKIWT+DW+L I + ++DL +HR+IFD E+
Sbjct: 548 IAPIGEGKLDAQAFFENYLAMPILIALYVGYKIWTKDWKLFIRADKIDLESHRQIFDEEL 607

Query: 573 LRHEQLEEKEQLRHAPWTTRLANFWC 598
           ++ E  E +E+LR+ P+  R+A FWC
Sbjct: 608 IKQEDEEYRERLRNGPYWKRVAAFWC 633

>CAGL0K05753g Chr11 (565111..567093) [1983 bp, 660 aa] {ON} highly
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508c GNP1
          Length = 660

 Score =  664 bits (1713), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/639 (51%), Positives = 421/639 (65%), Gaps = 41/639 (6%)

Query: 1   MKDFELHNMKSPDNG--------------VVESFDSVEVLK---EESPRS------DSRS 37
           + ++ELHN+     G               VE FD   V     +E  +S      D   
Sbjct: 22  VSNYELHNIDDSKKGYDNLGSGSRGATTSAVEYFDKENVDGVNIDEKLQSTTEFGGDEMP 81

Query: 38  DGLFRRFADSFRRHEAHNXXXXXXXXXXXXXLTPIESAS-----------------KHKT 80
            G  RRF DSF+R E                LT   S +                 + + 
Sbjct: 82  RGNIRRFIDSFKRAEQQPNQQHNLAEDLENDLTTAISMNSLDRVQNKPTGNGQMKFEEEA 141

Query: 81  LKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYCVIQSASEL 140
           LK++I+PRHV+MISL TGIGTG+LVGN K+LHN GPA LVIGYAI+ S +YC+IQ+A E+
Sbjct: 142 LKKSIKPRHVVMISLGTGIGTGLLVGNAKALHNAGPAGLVIGYAIMGSCIYCIIQAAGEM 201

Query: 141 AIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKYWNQTINPD 200
           A++Y++L GGFN YPS+LVD  FGF+V+WVYCLQWLCV PLELVT S+TIKYW  T+NPD
Sbjct: 202 AVVYSNLLGGFNTYPSMLVDPGFGFAVAWVYCLQWLCVCPLELVTTSLTIKYWTTTVNPD 261

Query: 201 AFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGGAGNDGYLGAR 260
           AFV IFYVV++ I               NCCK+LM           N GGAGNDGYLGA+
Sbjct: 262 AFVVIFYVVIIFIQIFGARGYAEAEFFFNCCKILMIIGFYILGIIINAGGAGNDGYLGAK 321

Query: 261 YWHDPGAFRGSDSINRFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVY 320
           YWHDPGAFRG++ I RFKGI+A  V+AAFA+G  EF  LTAAEQ NP+K+I SA+KK++Y
Sbjct: 322 YWHDPGAFRGTNGIQRFKGIMATFVSAAFAFGATEFIALTAAEQSNPRKAIPSAAKKVLY 381

Query: 321 RILGIYIMTAILLGFLVPWNSDELLGSGGSATHASPFVIAVASHGVRVVPHFXXXXXXXX 380
           R++ I++ T  LLGFLVPW+SD+L+G+GGSAT ASP+V+A++ HGVRVVPHF        
Sbjct: 382 RVICIFVGTIALLGFLVPWDSDQLMGAGGSATKASPYVLAISIHGVRVVPHFINAVILIS 441

Query: 381 XXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVSCVFGLLSFVAASPKE 440
                               +QG+AP+F +YVDR GRP   +  + +FG+++F AASPKE
Sbjct: 442 VFSVANSAFYSSSRLLLGLAQQGYAPKFFDYVDRQGRPFRAMCCAALFGVIAFCAASPKE 501

Query: 441 ETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYVAWTGVWGAYYAMAM 500
           + VFTWLLAISGLS+LFTW +I +SH+R RRAMTVQGRS  E+G+ A  GV+G+YYA  M
Sbjct: 502 DQVFTWLLAISGLSQLFTWIAICVSHIRFRRAMTVQGRSLGEIGFKAQLGVYGSYYATIM 561

Query: 501 IVAILVGQFWVAISPVGSN-KLDANNFFENYLAMPILIFLYLGYKIWTRDWRLLIPSSEV 559
           +V  L+ QFWVAI+P+G+N  LDA  FFENYLAMPILI  Y GYK+W RDWRL I + ++
Sbjct: 562 MVLALIAQFWVAIAPIGNNGDLDAEGFFENYLAMPILIAFYFGYKLWKRDWRLFIRAKDI 621

Query: 560 DLVAHRKIFDAEVLRHEQLEEKEQLRHAPWTTRLANFWC 598
           DL ++R++FD E+L+ E  E KE+L++ P   R+ +FWC
Sbjct: 622 DLDSYRQVFDEELLKQEDEEYKEKLKNGPMWKRVVDFWC 660

>CAGL0B01012g Chr2 (91330..93201) [1872 bp, 623 aa] {ON} similar to
           uniprot|P25376 Saccharomyces cerevisiae YCL025c AGP1
           Asparagine/glutamine permease or uniprot|P48813
           Saccharomyces cerevisiae YDR508c GNP1
          Length = 623

 Score =  660 bits (1703), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/596 (53%), Positives = 402/596 (67%), Gaps = 20/596 (3%)

Query: 23  VEVLKEESPRSDSRSDGLFRRFADSFRRHEAHNXXXXXXXXXXXXXLTPIE--------- 73
           V V  E S   ++ +   FRRF DSF+R E  N                ++         
Sbjct: 28  VSVTPETSATPNTPAPSQFRRFVDSFKRAEQQNNSEITSAASCDGSSENLDKDGKEVADL 87

Query: 74  -----------SASKHKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIG 122
                      S  K+K LKQ I+PRHV++ISL TGIGTG+LVGN K+LHN GPA L+IG
Sbjct: 88  EVQENQVLTEKSNQKNKELKQTIKPRHVILISLGTGIGTGLLVGNAKALHNAGPAGLLIG 147

Query: 123 YAIVSSMLYCVIQSASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLE 182
           Y+I+ + LYC+IQ+A ELA+ Y+SL+GGFN YPS LVD AFGFSV+WVYC+QWLCV PLE
Sbjct: 148 YSIMGTCLYCIIQAAGELAVSYSSLSGGFNVYPSFLVDPAFGFSVAWVYCIQWLCVCPLE 207

Query: 183 LVTASMTIKYWNQTINPDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXX 242
           LVTASMTIKYW  T+N D FV IFYV+++ IN              NCCK+LM       
Sbjct: 208 LVTASMTIKYWTTTVNADIFVGIFYVLIIVINTFGARGYAEAEFFFNCCKILMMIGFFIL 267

Query: 243 XXXXNCGGAGNDGYLGARYWHDPGAFRGSDSINRFKGIVAVLVNAAFAYGGAEFSVLTAA 302
               N GGAGNDGY+G RYWH PGAF G   I+ FKGI+A +V AAFA+G  EF  LTAA
Sbjct: 268 GIVINTGGAGNDGYIGDRYWHTPGAFAGDRPIDHFKGIMATMVTAAFAFGATEFIALTAA 327

Query: 303 EQQNPQKSIRSASKKLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSATHASPFVIAVA 362
           EQ NP+K+I SA+KK++YRIL I++ +  L+GFLVP++SD+L+GSGGSAT ASP+V+AV+
Sbjct: 328 EQSNPRKAIPSAAKKVLYRILFIFLGSITLVGFLVPYDSDQLMGSGGSATKASPYVLAVS 387

Query: 363 SHGVRVVPHFXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCL 422
           +HGV+VVPHF                            +QG AP+F +YVDR GRP   +
Sbjct: 388 THGVKVVPHFINAVILLSVLSVGNSAFYSSSRLLYSLAQQGNAPKFFDYVDREGRPFRAM 447

Query: 423 LVSCVFGLLSFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADE 482
           + + VF ++SF AASPKEE VFTWLLAISGLS++FTWF+I LSH+R R+AM VQ RS  E
Sbjct: 448 VCAGVFAIISFCAASPKEEQVFTWLLAISGLSQVFTWFAICLSHIRFRKAMFVQKRSLGE 507

Query: 483 LGYVAWTGVWGAYYAMAMIVAILVGQFWVAISPVGSNKLDANNFFENYLAMPILIFLYLG 542
           +G+ A TGVWG+YY   M+V IL+ QFWVAI+P+G  KLDA  FFENYLAMPILI  Y+G
Sbjct: 508 IGFKAQTGVWGSYYVCFMLVMILIAQFWVAIAPIGEGKLDAQGFFENYLAMPILILFYVG 567

Query: 543 YKIWTRDWRLLIPSSEVDLVAHRKIFDAEVLRHEQLEEKEQLRHAPWTTRLANFWC 598
           YKIW +DW L I ++ +DL  HR+IFD E+L+ E  E +E+L++  +  R+A FWC
Sbjct: 568 YKIWKKDWSLFIRANNIDLDKHRQIFDEELLKQEDEEYREKLKNGGYLKRIAAFWC 623

>Smik_3.53 Chr3 complement(77146..79047) [1902 bp, 633 aa] {ON}
           YCL025C (REAL)
          Length = 633

 Score =  657 bits (1696), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/626 (50%), Positives = 419/626 (66%), Gaps = 31/626 (4%)

Query: 4   FELHNMKSPDNGV--VESFDSVEVLKEES--PRS-------DSRSDGLFRRFADSFRR-- 50
           +EL ++K+    +   E  + VE  + +S  P S       +  +    RRF DSF++  
Sbjct: 8   YELKDLKNSSTEIHATEQDNEVEYFETDSNDPSSSQPPLGYEQHNTSALRRFFDSFKKAD 67

Query: 51  HEAHNXXXXXXXXXXXXXLTP------------------IESASKHKTLKQNIRPRHVLM 92
             A               ++P                    + +K  +LK+ I+PRHVLM
Sbjct: 68  QSAEERVETAQMNDLASAISPSSRQRQELEKNESSDNIGARTGNKSDSLKKTIQPRHVLM 127

Query: 93  ISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYCVIQSASELAIIYTSLAGGFN 152
           I+L TGIGTG+LVGNG +L + GPA L+IGY I+ S+LYC+IQ+  E+A++Y++L GG+N
Sbjct: 128 IALGTGIGTGLLVGNGTALVHAGPAGLLIGYGIMGSILYCIIQACGEMALVYSNLTGGYN 187

Query: 153 AYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKYWNQTINPDAFVTIFYVVLVA 212
           AYPS LVD  FGF+V+WVYCLQWLCV PLELVTASMTIKYW  ++NPD FV IFYV+++ 
Sbjct: 188 AYPSFLVDDGFGFAVAWVYCLQWLCVCPLELVTASMTIKYWTTSVNPDVFVIIFYVLVIT 247

Query: 213 INXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGGAGNDGYLGARYWHDPGAFRGSD 272
           IN              NCCK+LM           + GGAGNDG++G +YWHDPGAF G  
Sbjct: 248 INIFGARGYAEAEFFFNCCKILMMTGFFILGIIIDVGGAGNDGFIGGKYWHDPGAFNGKH 307

Query: 273 SINRFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRILGIYIMTAIL 332
           SI+RFKG+VA LV AAFA+GG+EF  +T AEQ NP+K++  A+K+++YRIL +++ T IL
Sbjct: 308 SIDRFKGVVATLVTAAFAFGGSEFIAITTAEQANPRKAVPGAAKQMIYRILFLFLATIIL 367

Query: 333 LGFLVPWNSDELLGSGGSATHASPFVIAVASHGVRVVPHFXXXXXXXXXXXXXXXXXXXX 392
           LGFLVP+NS++LLGS G  T ASP+VIAVASHGVRVVPHF                    
Sbjct: 368 LGFLVPYNSNQLLGSSGGGTKASPYVIAVASHGVRVVPHFINAVILLSVLSMANSSFYSS 427

Query: 393 XXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVSCVFGLLSFVAASPKEETVFTWLLAISG 452
                   EQG+APR   Y+D+ GRP++ + VS +FG+++F AASPKE+ VFTWLLAISG
Sbjct: 428 ARILLTLSEQGYAPRVFTYIDKAGRPLIAMGVSALFGVIAFCAASPKEDQVFTWLLAISG 487

Query: 453 LSELFTWFSISLSHVRLRRAMTVQGRSADELGYVAWTGVWGAYYAMAMIVAILVGQFWVA 512
           LS+LFTW +I LSH+R RRAM VQGRS  ELG+ + TGVWG+ YA  M++ IL+GQFWVA
Sbjct: 488 LSQLFTWTAICLSHIRFRRAMKVQGRSLGELGFRSQTGVWGSTYACIMMILILIGQFWVA 547

Query: 513 ISPVGSNKLDANNFFENYLAMPILIFLYLGYKIWTRDWRLLIPSSEVDLVAHRKIFDAEV 572
           I+P+G  KLDA  FFENYLAMPILI LY+GYKIW +DW+L I + ++DL++HR+IFD E+
Sbjct: 548 IAPIGEGKLDAQAFFENYLAMPILIALYVGYKIWKKDWKLFIRADKIDLISHRQIFDEEL 607

Query: 573 LRHEQLEEKEQLRHAPWTTRLANFWC 598
           ++ E  E +E+L++ P   R+  FWC
Sbjct: 608 IKQEDEEFRERLKNGPCWKRVVAFWC 633

>Suva_3.189 Chr3 complement(285493..287394) [1902 bp, 633 aa] {ON}
           YCL025C (REAL)
          Length = 633

 Score =  653 bits (1685), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/626 (50%), Positives = 418/626 (66%), Gaps = 31/626 (4%)

Query: 4   FELHNMKSPDNGV--VESFDSVEVLKEESPRSDSRSDGL---------FRRFADSFRR-- 50
           +EL ++K+    V   E  + +E  + +S    S+   L          RRF DSF+R  
Sbjct: 8   YELKDLKNSSTEVHAAEQENEIEYFETDSNDRPSQQPHLDYEQHNTSAVRRFLDSFKRAD 67

Query: 51  HEAHNXXXXXXXXXXXXXLTP----------------IESASKHKT--LKQNIRPRHVLM 92
            +                ++P                I   + HK+  LK+ I+PRHVLM
Sbjct: 68  QDQEQEAEVAQMNDLTSAISPSSRQAHELEKDETTDKIAPHTGHKSDSLKKTIQPRHVLM 127

Query: 93  ISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYCVIQSASELAIIYTSLAGGFN 152
           I+L TGIGTG+LVGNG +L + GPA L+IGYAI+ S+LYC+IQ+  E+A++Y++L GG+N
Sbjct: 128 IALGTGIGTGLLVGNGTALVHAGPAGLLIGYAIMGSILYCIIQACGEMALVYSNLTGGYN 187

Query: 153 AYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKYWNQTINPDAFVTIFYVVLVA 212
           AYPS LVD  FGF+V+WVYCLQWLCV PLELVTASMTIKYW  ++NPD FV IFYV+++ 
Sbjct: 188 AYPSFLVDDGFGFAVAWVYCLQWLCVCPLELVTASMTIKYWTTSVNPDVFVIIFYVLVIT 247

Query: 213 INXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGGAGNDGYLGARYWHDPGAFRGSD 272
           IN              NCCK+LM           + GGAGNDGY+G +YWH+PGAF G  
Sbjct: 248 INIFGARGYAEAEFFFNCCKILMMTGFFILGIIIDVGGAGNDGYIGGKYWHEPGAFNGVH 307

Query: 273 SINRFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRILGIYIMTAIL 332
           +I+RFKG+VA LV AAFA+GG+EF  +T AEQ NP+K+I  A+K+++YRIL +++ T I+
Sbjct: 308 AIDRFKGVVATLVTAAFAFGGSEFIAITTAEQSNPRKAIPGAAKQMIYRILFLFLATIII 367

Query: 333 LGFLVPWNSDELLGSGGSATHASPFVIAVASHGVRVVPHFXXXXXXXXXXXXXXXXXXXX 392
           +GFLVP+NSD+LLGS G  T ASP+VIA+ASHGVRV PHF                    
Sbjct: 368 VGFLVPYNSDQLLGSSGGGTKASPYVIAIASHGVRVAPHFVNAVILLSVLSMANSSFYSS 427

Query: 393 XXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVSCVFGLLSFVAASPKEETVFTWLLAISG 452
                   EQG+AP+  +Y+DR GRP++ + VS +F +++F AASPKE+ VFTWLLAISG
Sbjct: 428 ARLFLTLSEQGYAPKIFSYIDRAGRPLIAMCVSALFAVIAFCAASPKEDQVFTWLLAISG 487

Query: 453 LSELFTWFSISLSHVRLRRAMTVQGRSADELGYVAWTGVWGAYYAMAMIVAILVGQFWVA 512
           LS+LFTW +I LSH+R RRAM VQGRS  ELG+ + TGVWG+ Y+  M++ IL+GQFWVA
Sbjct: 488 LSQLFTWTAICLSHIRFRRAMKVQGRSLGELGFKSQTGVWGSIYSCIMMILILIGQFWVA 547

Query: 513 ISPVGSNKLDANNFFENYLAMPILIFLYLGYKIWTRDWRLLIPSSEVDLVAHRKIFDAEV 572
           I+P+G  KLDA  FFENYLAMPILI LY+GYK+W +DW+L I + ++DL +HR+IFD E+
Sbjct: 548 IAPIGEGKLDAQAFFENYLAMPILIVLYVGYKMWNKDWKLFIRADKIDLTSHRQIFDEEL 607

Query: 573 LRHEQLEEKEQLRHAPWTTRLANFWC 598
           ++ E  E +E+LR  P+  R+  FWC
Sbjct: 608 IKQEDDEYRERLRTGPYWRRVLAFWC 633

>YCL025C Chr3 complement(76018..77919) [1902 bp, 633 aa] {ON}
           AGP1Low-affinity amino acid permease with broad
           substrate range, involved in uptake of asparagine,
           glutamine, and other amino acids; expression is
           regulated by the SPS plasma membrane amino acid sensor
           system (Ssy1p-Ptr3p-Ssy5p)
          Length = 633

 Score =  653 bits (1684), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/624 (50%), Positives = 416/624 (66%), Gaps = 26/624 (4%)

Query: 1   MKDFELHNMKSPDNGVVESFDSVEVLKEESPRS------DSRSDGLFRRFADSFRRHEA- 53
           +KD +  + +    G     +  E    + P S      +  +    RRF DSF+R +  
Sbjct: 10  LKDLKNSSTEIHATGQDNEIEYFETGSNDRPSSQPHLGYEQHNTSAVRRFFDSFKRADQG 69

Query: 54  -HNXXXXXXXXXXXXXLTP----------------IESASKHKT--LKQNIRPRHVLMIS 94
             +             ++P                I + + HK+  LK+ I+PRHVLMI+
Sbjct: 70  PQDEVEATQMNDLTSAISPSSRQAQELEKNESSDNIGANTGHKSDSLKKTIQPRHVLMIA 129

Query: 95  LATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYCVIQSASELAIIYTSLAGGFNAY 154
           L TGIGTG+LVGNG +L + GPA L+IGYAI+ S+LYC+IQ+  E+A++Y++L GG+NAY
Sbjct: 130 LGTGIGTGLLVGNGTALVHAGPAGLLIGYAIMGSILYCIIQACGEMALVYSNLTGGYNAY 189

Query: 155 PSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKYWNQTINPDAFVTIFYVVLVAIN 214
           PS LVD  FGF+V+WVYCLQWLCV PLELVTASMTIKYW  ++NPD FV IFYV+++ IN
Sbjct: 190 PSFLVDDGFGFAVAWVYCLQWLCVCPLELVTASMTIKYWTTSVNPDVFVIIFYVLVITIN 249

Query: 215 XXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGGAGNDGYLGARYWHDPGAFRGSDSI 274
                         NCCK+LM           + GGAGNDG++G +YWHDPGAF G  +I
Sbjct: 250 IFGARGYAEAEFFFNCCKILMMTGFFILGIIIDVGGAGNDGFIGGKYWHDPGAFNGKHAI 309

Query: 275 NRFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRILGIYIMTAILLG 334
           +RFKG+ A LV AAFA+GG+EF  +T AEQ NP+K+I  A+K+++YRIL +++ T ILLG
Sbjct: 310 DRFKGVAATLVTAAFAFGGSEFIAITTAEQSNPRKAIPGAAKQMIYRILFLFLATIILLG 369

Query: 335 FLVPWNSDELLGSGGSATHASPFVIAVASHGVRVVPHFXXXXXXXXXXXXXXXXXXXXXX 394
           FLVP+NSD+LLGS G  T ASP+VIAVASHGVRVVPHF                      
Sbjct: 370 FLVPYNSDQLLGSTGGGTKASPYVIAVASHGVRVVPHFINAVILLSVLSMANSSFYSSAR 429

Query: 395 XXXXXXEQGFAPRFLNYVDRCGRPVLCLLVSCVFGLLSFVAASPKEETVFTWLLAISGLS 454
                 EQG+AP+  +Y+DR GRP++ + VS +F +++F AASPKEE VFTWLLAISGLS
Sbjct: 430 LFLTLSEQGYAPKVFSYIDRAGRPLIAMGVSALFAVIAFCAASPKEEQVFTWLLAISGLS 489

Query: 455 ELFTWFSISLSHVRLRRAMTVQGRSADELGYVAWTGVWGAYYAMAMIVAILVGQFWVAIS 514
           +LFTW +I LSH+R RRAM VQGRS  ELG+ + TGVWG+ YA  M++ IL+ QFWVAI+
Sbjct: 490 QLFTWTAICLSHLRFRRAMKVQGRSLGELGFKSQTGVWGSAYACIMMILILIAQFWVAIA 549

Query: 515 PVGSNKLDANNFFENYLAMPILIFLYLGYKIWTRDWRLLIPSSEVDLVAHRKIFDAEVLR 574
           P+G  KLDA  FFENYLAMPILI LY+GYK+W +DW+L I + ++DL +HR+IFD E+++
Sbjct: 550 PIGEGKLDAQAFFENYLAMPILIALYVGYKVWHKDWKLFIRADKIDLDSHRQIFDEELIK 609

Query: 575 HEQLEEKEQLRHAPWTTRLANFWC 598
            E  E +E+LR+ P+  R+  FWC
Sbjct: 610 QEDEEYRERLRNGPYWKRVVAFWC 633

>Suva_2.688 Chr2 complement(1219181..1221166) [1986 bp, 661 aa] {ON}
           YDR508C (REAL)
          Length = 661

 Score =  650 bits (1676), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/628 (50%), Positives = 412/628 (65%), Gaps = 32/628 (5%)

Query: 2   KDFELHNMKSPDNGVVESFDSVEVLKEESPRSDSRSDGLFRRFADSFRRHEAHNXXXXXX 61
           K+ E++++ +P+N V    +++E   E       R     RRF DSF+R E  +      
Sbjct: 35  KEREINSI-APENEVEYFENTMEKTMENLEYEGDRKASHLRRFIDSFKRAEGSHPNSPDS 93

Query: 62  XXXXXXXLTPI------------------------------ESASKHKTLKQNIRPRHVL 91
                   TPI                              E     + LK+ I+PRH++
Sbjct: 94  SNSIGGGATPISTNDSSSQLDNELNPKGSFVTESGIKQPSQEQDQNQENLKKTIKPRHIV 153

Query: 92  MISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYCVIQSASELAIIYTSLAGGF 151
           M+SL TGIGTG+LVGN K L+N GPA LVIGYAI+ S +YC+IQ+  ELA+IY+ L GGF
Sbjct: 154 MMSLGTGIGTGLLVGNSKVLNNAGPAGLVIGYAIMGSCIYCIIQACGELAVIYSDLIGGF 213

Query: 152 NAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKYWNQTINPDAFVTIFYVVLV 211
           N YPS LVD A GFSV+WVYCLQWLCV PLELVTASMTIKYW   ++PD FV IFYV+++
Sbjct: 214 NTYPSFLVDPALGFSVAWVYCLQWLCVCPLELVTASMTIKYWTVKVDPDVFVVIFYVLII 273

Query: 212 AINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGGAGNDGYLGARYWHDPGAFRGS 271
            IN              NCCK+LM           +CGGAG DGY+G+RYWH+PGAFRG+
Sbjct: 274 VINVFGAKGYAEADFFFNCCKILMIIGFFILAIIIDCGGAGTDGYIGSRYWHNPGAFRGN 333

Query: 272 DSINRFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRILGIYIMTAI 331
             I RFKG+VA  V AAFA+G +E   +TA+EQ NP+K+I SA+KK++YRIL +++ + +
Sbjct: 334 TGIQRFKGVVATFVTAAFAFGMSEQLAMTASEQSNPRKAIPSAAKKMIYRILFVFLGSLV 393

Query: 332 LLGFLVPWNSDELLGSGGSATHASPFVIAVASHGVRVVPHFXXXXXXXXXXXXXXXXXXX 391
           L+GFLVP+ SD+LLG+ GSAT ASP+VIAVASHGVRVVPHF                   
Sbjct: 394 LVGFLVPYTSDQLLGASGSATKASPYVIAVASHGVRVVPHFINAVILLSVLSVANGAFYS 453

Query: 392 XXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVSCVFGLLSFVAASPKEETVFTWLLAIS 451
                    +QG AP+  +Y+DR GRP + +LVS +FG+++F A+SPKEE VFTWLLAIS
Sbjct: 454 SSRILMSLAKQGNAPKCFDYIDREGRPAVAMLVSSIFGIIAFCASSPKEEDVFTWLLAIS 513

Query: 452 GLSELFTWFSISLSHVRLRRAMTVQGRSADELGYVAWTGVWGAYYAMAMIVAILVGQFWV 511
           GLS+LFTW +I LSH+R RRAM VQGRS  E+GY +  G+WG+ YA+ M+V  L+ QFWV
Sbjct: 514 GLSQLFTWITICLSHIRFRRAMKVQGRSLGEVGYKSQVGIWGSMYAIVMMVLALIAQFWV 573

Query: 512 AISPV-GSNKLDANNFFENYLAMPILIFLYLGYKIWTRDWRLLIPSSEVDLVAHRKIFDA 570
           AISP+ G  KL A +FFENYLAMPILI LY+ YK+W +DW L IP+ ++DLV  R+IFD 
Sbjct: 574 AISPIGGGGKLSAQSFFENYLAMPILIALYVFYKVWKKDWTLFIPADKIDLVTDRQIFDE 633

Query: 571 EVLRHEQLEEKEQLRHAPWTTRLANFWC 598
           E+L+ E  E +E+LR+ P+  R+ +FWC
Sbjct: 634 ELLKQEDEEYQEKLRNGPYWKRVVDFWC 661

>Kpol_2000.92 s2000 (208509..210422) [1914 bp, 637 aa] {ON}
           (208509..210422) [1914 nt, 638 aa]
          Length = 637

 Score =  648 bits (1671), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/630 (51%), Positives = 408/630 (64%), Gaps = 35/630 (5%)

Query: 4   FELHNMKSPDNGVVESFD-SVEVLK--------EESPRSDSRSDGLF-RRFADSFRR--- 50
           +EL ++KS    +  + D  VE L         E S R+    +G F R F DSF+R   
Sbjct: 8   YELKDLKSGSAVITSTTDREVEYLDDQINNSYDESSVRNRKTKEGTFVRSFIDSFKRADR 67

Query: 51  -----HEAHNXXXXXXXXXXXXXL---TPIESA--------------SKHKTLKQNIRPR 88
                H+  N                 T  + A               K + LK+ I+PR
Sbjct: 68  NSNPLHDLDNDITTSISRTSMDAALNKTKFDDAISSSISETNKGHQNEKSEDLKKTIKPR 127

Query: 89  HVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYCVIQSASELAIIYTSLA 148
           HV+MISL TGIGTG+LVGNG  L   GPA+LVIGYAI+ + LYC+IQ+A ELA++Y+ L 
Sbjct: 128 HVIMISLGTGIGTGLLVGNGPVLSKAGPAALVIGYAIMGTCLYCIIQAAGELAVVYSDLN 187

Query: 149 GGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKYWNQTINPDAFVTIFYV 208
           GGFNAYPS LVD A GFSV+WVYCLQWLCV PLELVTASMTIKYW   ++PD FV IFYV
Sbjct: 188 GGFNAYPSFLVDPALGFSVAWVYCLQWLCVCPLELVTASMTIKYWTTKVDPDVFVVIFYV 247

Query: 209 VLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGGAGNDGYLGARYWHDPGAF 268
           +++AIN              NCCKVLM             GGAGNDGYLGA+YWHDPGAF
Sbjct: 248 LIIAINTFGARGYAEAEFFFNCCKVLMMTGFFILGIIITAGGAGNDGYLGAKYWHDPGAF 307

Query: 269 RGSDSINRFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRILGIYIM 328
            G  SI+RFKG++   V AAFA+G  EF  LTAAEQ NP+K+I SA+KK++YRI+ I++ 
Sbjct: 308 NGDKSIDRFKGVMDTFVTAAFAFGATEFIALTAAEQSNPRKAIPSAAKKVLYRIVCIFLA 367

Query: 329 TAILLGFLVPWNSDELLGSGGSATHASPFVIAVASHGVRVVPHFXXXXXXXXXXXXXXXX 388
           +  L+GFLVP+NSD+LLGSGGS   ASP+VIAV+SHGVRVVPHF                
Sbjct: 368 SITLIGFLVPYNSDQLLGSGGSGIKASPYVIAVSSHGVRVVPHFINAVILLSVLSVGNSA 427

Query: 389 XXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVSCVFGLLSFVAASPKEETVFTWLL 448
                       +QG+AP++ +YVDR GRP   +L+S +FG+++F A SPKE  VF+WLL
Sbjct: 428 FYSSSRLLLSLAQQGYAPKWFDYVDREGRPFRAMLMSALFGVIAFCATSPKETEVFSWLL 487

Query: 449 AISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYVAWTGVWGAYYAMAMIVAILVGQ 508
           AISGLS+LFTW +I +SH+R RRAM VQGRS  E+GY++ +GV+G+ YA  M+   L+ Q
Sbjct: 488 AISGLSQLFTWITICVSHIRFRRAMQVQGRSLGEVGYLSQSGVYGSAYAAIMLFLALIAQ 547

Query: 509 FWVAISPVGSNKLDANNFFENYLAMPILIFLYLGYKIWTRDWRLLIPSSEVDLVAHRKIF 568
           FWVAI+P+G  KLDA NFF+NYLAMPILI  Y GY++W RDW+L I + ++DL  HR+IF
Sbjct: 548 FWVAIAPIGEGKLDAENFFQNYLAMPILIAFYFGYRVWKRDWKLFIRAKDIDLDTHRQIF 607

Query: 569 DAEVLRHEQLEEKEQLRHAPWTTRLANFWC 598
           D  +LR E  E KE+LR+ P   R   FWC
Sbjct: 608 DENILRQEDEEYKEKLRNGPMWRRFLAFWC 637

>TDEL0C06510 Chr3 (1196039..1197967) [1929 bp, 642 aa] {ON} Anc_1.50
           YDR508C
          Length = 642

 Score =  634 bits (1635), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/595 (51%), Positives = 398/595 (66%), Gaps = 23/595 (3%)

Query: 27  KEESPRSDS-RSDG-----LFRRFADSFRRHEAHNXXXXXXXXXXXXXLTP--------- 71
            E  P  ++ R+DG     +F  F D FRR   HN             ++P         
Sbjct: 48  NESEPHGNTGRNDGSAKGNIFVNFIDGFRRQTNHNSAAEDLENELTTCVSPATLSDYKKS 107

Query: 72  --------IESASKHKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGY 123
                   +E  +K + LK++I+PRHV+MISL TGIGTG+LVGN K+L++ GPA L IGY
Sbjct: 108 GDSGSVDELEGKTKEEHLKKSIKPRHVVMISLGTGIGTGLLVGNAKALNDAGPAGLAIGY 167

Query: 124 AIVSSMLYCVIQSASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLEL 183
           AI+ S +YC+IQ+A E+A+ Y++L GGFNAYPS LV    GF+V+WVY LQW CV PLEL
Sbjct: 168 AIMGSCIYCIIQAAGEMAVTYSNLVGGFNAYPSFLVSPKLGFAVAWVYWLQWACVCPLEL 227

Query: 184 VTASMTIKYWNQTINPDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXX 243
           VTASMTIKYW   +NPD FV IFY +++ IN              NCCKVLM        
Sbjct: 228 VTASMTIKYWTTKVNPDVFVVIFYFLIIVINVFGARGYAEAEFFFNCCKVLMITGFFILG 287

Query: 244 XXXNCGGAGNDGYLGARYWHDPGAFRGSDSINRFKGIVAVLVNAAFAYGGAEFSVLTAAE 303
              NCGGAGNDGY+G +YWHDPGAFRG  +I+RFKG+ A LV AAFA+GG+EF  LTA+E
Sbjct: 288 IIINCGGAGNDGYIGGKYWHDPGAFRGDKAIDRFKGVAATLVTAAFAFGGSEFIALTASE 347

Query: 304 QQNPQKSIRSASKKLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSATHASPFVIAVAS 363
           Q NP+K+I +A+KK++YRI+ I++ + I++GFLVPWNSD+L+GS  S T ASP+VIA++S
Sbjct: 348 QSNPRKAIPAAAKKILYRIIIIFLGSIIMVGFLVPWNSDQLMGSDSSKTKASPYVIAISS 407

Query: 364 HGVRVVPHFXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLL 423
           HGVRVVPHF                            +QG+AP+F NY+DR GRP   ++
Sbjct: 408 HGVRVVPHFVNAVILLSVLSVGNSAFYSSSRILISLSQQGYAPKFFNYIDREGRPARAMV 467

Query: 424 VSCVFGLLSFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADEL 483
           +  +F +++F AAS KEE VFTWLLAISGLS++FTW +I LSH+R RRAM VQGRS  E+
Sbjct: 468 IGALFAVIAFCAASSKEEDVFTWLLAISGLSQIFTWAAICLSHIRFRRAMHVQGRSLGEI 527

Query: 484 GYVAWTGVWGAYYAMAMIVAILVGQFWVAISPVGSNKLDANNFFENYLAMPILIFLYLGY 543
           G+ +  GVWG+YYA  M+  +L+ QFWV ++P+G NKLDA +FFE+YLAM +LI  Y+GY
Sbjct: 528 GFKSELGVWGSYYAAGMMFLVLIAQFWVGLAPIGMNKLDAQSFFESYLAMLMLIAFYVGY 587

Query: 544 KIWTRDWRLLIPSSEVDLVAHRKIFDAEVLRHEQLEEKEQLRHAPWTTRLANFWC 598
             W +DW L I + ++DL  HR+IFD +VLR E  E KE+LR+ P   R+ NFWC
Sbjct: 588 MFWKKDWTLFIRAKDIDLDHHRQIFDEDVLRQEDEETKEKLRNGPLWKRILNFWC 642

>YDR508C Chr4 complement(1466453..1468444) [1992 bp, 663 aa] {ON}
           GNP1High-affinity glutamine permease, also transports
           Leu, Ser, Thr, Cys, Met and Asn; expression is fully
           dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p-Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 663

 Score =  634 bits (1635), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/616 (50%), Positives = 397/616 (64%), Gaps = 29/616 (4%)

Query: 12  PDNGVVESFDSVEVLKEESPRSDSRSDGLFRRFADSFRRHEAH----------NXXXXXX 61
           P+N V     +VE   E             RRF DSFRR E            N      
Sbjct: 48  PENEVEYFEKTVEKTIENMEYEGEHHASYLRRFIDSFRRAEGSHANSPDSSNSNGTTPIS 107

Query: 62  XXXXXXXL------------------TPIESASKHKTLKQNIRPRHVLMISLATGIGTGM 103
                  L                  +P E   K + LK++I+PRH +M+SL TGIGTG+
Sbjct: 108 TKDSSSQLDNELNRKSSYITVDGIKQSPQEQEQKQENLKKSIKPRHTVMMSLGTGIGTGL 167

Query: 104 LVGNGKSLHNGGPASLVIGYAIVSSMLYCVIQSASELAIIYTSLAGGFNAYPSLLVDKAF 163
           LVGN K L+N GP  L+IGYAI+ S +YC+IQ+  ELA+IY+ L GGFN YP  LVD A 
Sbjct: 168 LVGNSKVLNNAGPGGLIIGYAIMGSCVYCIIQACGELAVIYSDLIGGFNTYPLFLVDPAL 227

Query: 164 GFSVSWVYCLQWLCVLPLELVTASMTIKYWNQTINPDAFVTIFYVVLVAINXXXXXXXXX 223
           GFSV+W++CLQWLCV PLELVTASMTIKYW  ++NPD FV IFYV++V IN         
Sbjct: 228 GFSVAWLFCLQWLCVCPLELVTASMTIKYWTTSVNPDVFVVIFYVLIVVINVFGAKGYAE 287

Query: 224 XXXXXNCCKVLMXXXXXXXXXXXNCGGAGNDGYLGARYWHDPGAFRGSDSINRFKGIVAV 283
                NCCK+LM           +CGGAG DGY+G++YW DPGAFRG   I RFKG+VA 
Sbjct: 288 ADFFFNCCKILMIVGFFILAIIIDCGGAGTDGYIGSKYWRDPGAFRGDTPIQRFKGVVAT 347

Query: 284 LVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRILGIYIMTAILLGFLVPWNSDE 343
            V AAFA+G +E   +TA+EQ NP+K+I SA+KK++YRIL +++ +  L+GFLVP+ SD+
Sbjct: 348 FVTAAFAFGMSEQLAMTASEQSNPRKAIPSAAKKMIYRILFVFLASLTLVGFLVPYTSDQ 407

Query: 344 LLGSGGSATHASPFVIAVASHGVRVVPHFXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQG 403
           LLG+ GSAT ASP+VIAV+SHGVRVVPHF                            +QG
Sbjct: 408 LLGAAGSATKASPYVIAVSSHGVRVVPHFINAVILLSVLSVANGAFYTSSRILMSLAKQG 467

Query: 404 FAPRFLNYVDRCGRPVLCLLVSCVFGLLSFVAASPKEETVFTWLLAISGLSELFTWFSIS 463
            AP+  +Y+DR GRP   +LVS +FG+++F A+S KEE VFTWLLAISGLS+LFTW +I 
Sbjct: 468 NAPKCFDYIDREGRPAAAMLVSALFGVIAFCASSKKEEDVFTWLLAISGLSQLFTWITIC 527

Query: 464 LSHVRLRRAMTVQGRSADELGYVAWTGVWGAYYAMAMIVAILVGQFWVAISPV-GSNKLD 522
           LSH+R RRAM VQGRS  E+GY +  GVWG+ YA+ M+V  L+ QFWVAI+P+ G  KL 
Sbjct: 528 LSHIRFRRAMKVQGRSLGEVGYKSQVGVWGSAYAVLMMVLALIAQFWVAIAPIGGGGKLS 587

Query: 523 ANNFFENYLAMPILIFLYLGYKIWTRDWRLLIPSSEVDLVAHRKIFDAEVLRHEQLEEKE 582
           A +FFENYLAMPI I LY+ YK+W +DW L IP+ +VDLV+HR IFD E+L+ E  E KE
Sbjct: 588 AQSFFENYLAMPIWIALYIFYKVWKKDWSLFIPADKVDLVSHRNIFDEELLKQEDEEYKE 647

Query: 583 QLRHAPWTTRLANFWC 598
           +LR+ P+  R+ +FWC
Sbjct: 648 RLRNGPYWKRVLDFWC 663

>Skud_4.784 Chr4 complement(1386623..1388614) [1992 bp, 663 aa] {ON}
           YDR508C (REAL)
          Length = 663

 Score =  634 bits (1634), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/625 (49%), Positives = 409/625 (65%), Gaps = 36/625 (5%)

Query: 10  KSPDNGVVESFDSVEVLKEESPRS----DSRSD---GLFRRFADSFRRHE-AHNXXXXXX 61
           K  +N  +E  + VE  +    ++    + + D     F RF DSFRR E +H       
Sbjct: 39  KEKENASIERENEVEYFENTMEKTMENMEYKGDHQRSYFHRFIDSFRRAEGSHPNSPDST 98

Query: 62  XXXXXXXLTPIESAS---------------------------KHKTLKQNIRPRHVLMIS 94
                  ++  +S+S                           K + LK++I+PRH +M+S
Sbjct: 99  NLNGSTPISTKDSSSRLDNELNPKSSYITVDGIKQSSQEQEPKQENLKKSIKPRHTVMMS 158

Query: 95  LATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYCVIQSASELAIIYTSLAGGFNAY 154
           L TGIGTG+LVGN K L+N GP  L+IGYAI+ S +YC+IQ+  ELA+IY+ L GGFN Y
Sbjct: 159 LGTGIGTGLLVGNSKVLNNAGPGGLIIGYAIMGSCVYCIIQACGELAVIYSDLIGGFNTY 218

Query: 155 PSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKYWNQTINPDAFVTIFYVVLVAIN 214
           PS LVD A GFSV+W++CLQWLCV PLELVTASMTIKYW   +N D FV IFYV+++ IN
Sbjct: 219 PSFLVDPAVGFSVAWLFCLQWLCVCPLELVTASMTIKYWTVKVNADVFVIIFYVLILVIN 278

Query: 215 XXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGGAGNDGYLGARYWHDPGAFRGSDSI 274
                         NCCK+LM           +CGGAG DGY+G+RYW DPGAFRG  SI
Sbjct: 279 IFGAKGYAEADFFFNCCKILMITGFFILAIIIDCGGAGTDGYIGSRYWRDPGAFRGDTSI 338

Query: 275 NRFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRILGIYIMTAILLG 334
            RFKG+VA  V AAFA+G +E   +TA+EQ NP+K+I SA+KK++YRIL +++ +  L+G
Sbjct: 339 QRFKGVVATFVTAAFAFGMSEQLAMTASEQSNPRKAIPSAAKKMIYRILFVFLASLALVG 398

Query: 335 FLVPWNSDELLGSGGSATHASPFVIAVASHGVRVVPHFXXXXXXXXXXXXXXXXXXXXXX 394
           FLVP+ SD+LLG+ GSAT ASP+VIAV+SHGVRVVPHF                      
Sbjct: 399 FLVPYTSDQLLGAAGSATKASPYVIAVSSHGVRVVPHFINAVILLSVLSVANSAFYTSSR 458

Query: 395 XXXXXXEQGFAPRFLNYVDRCGRPVLCLLVSCVFGLLSFVAASPKEETVFTWLLAISGLS 454
                 +QG AP+  +Y+DR GRP + ++VS VFG+++F A+S KEE VFTWLLAISGLS
Sbjct: 459 ILMSLAKQGNAPKCFDYIDREGRPAVAMIVSAVFGVIAFCASSKKEEDVFTWLLAISGLS 518

Query: 455 ELFTWFSISLSHVRLRRAMTVQGRSADELGYVAWTGVWGAYYAMAMIVAILVGQFWVAIS 514
           +LFTW +I LSH+R R+ M VQGRS  E+GY +  GVWG+ YA+ ++V  L+GQFWVAIS
Sbjct: 519 QLFTWITICLSHIRFRKGMKVQGRSLGEVGYKSQVGVWGSAYAVVLMVLALIGQFWVAIS 578

Query: 515 PVGSN-KLDANNFFENYLAMPILIFLYLGYKIWTRDWRLLIPSSEVDLVAHRKIFDAEVL 573
           P+G + KL A +FFENYLAMPILI LY+ YK+W RDW L IP+ ++DLV+HR IFD E+L
Sbjct: 579 PIGGDKKLSAQSFFENYLAMPILIALYIFYKVWKRDWSLFIPADKIDLVSHRNIFDEELL 638

Query: 574 RHEQLEEKEQLRHAPWTTRLANFWC 598
           + E  E K++LR+ P+  R+ +FWC
Sbjct: 639 KQEDEEYKDRLRNGPFWKRVLDFWC 663

>KAFR0D04120 Chr4 (816117..818063) [1947 bp, 648 aa] {ON} Anc_1.50
           YDR508C
          Length = 648

 Score =  633 bits (1632), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/618 (49%), Positives = 405/618 (65%), Gaps = 27/618 (4%)

Query: 8   NMKSPD-NGVVESFDSVEVLKEESPRSDSR---------------SDGLFRRFADSFRRH 51
           + KSP+ + +VE F++   +      SDS                     R+  DSFRR 
Sbjct: 31  DAKSPEQDNIVEYFENTTGIPAAVNDSDSDFEYNGKKKILPSFNIKQPHLRKLIDSFRRA 90

Query: 52  EAHNX-XXXXXXXXXXXXLTPIESA----------SKHKTLKQNIRPRHVLMISLATGIG 100
           E  +              L+P+ +            K   L++ I+PRHVL++SL TGIG
Sbjct: 91  EDIDAPTNRDIENELTTTLSPLSATKDPQFAPHAEEKDDHLQKTIKPRHVLLMSLGTGIG 150

Query: 101 TGMLVGNGKSLHNGGPASLVIGYAIVSSMLYCVIQSASELAIIYTSLAGGFNAYPSLLVD 160
           TG+LVGNG +LH  GP  LVIGYAI+ S LYC+IQ+  E+A+ Y+ L G FNAYPS LVD
Sbjct: 151 TGLLVGNGSALHKAGPGGLVIGYAIMGSCLYCIIQACGEMAVAYSGLPGNFNAYPSFLVD 210

Query: 161 KAFGFSVSWVYCLQWLCVLPLELVTASMTIKYWNQTINPDAFVTIFYVVLVAINXXXXXX 220
           +AFGFSV+WVYCLQWLCV+PLELVTASMTI+YW  T+N D FV IFYV+++ IN      
Sbjct: 211 EAFGFSVAWVYCLQWLCVMPLELVTASMTIQYWTTTVNADVFVVIFYVLIIFINVFGAKG 270

Query: 221 XXXXXXXXNCCKVLMXXXXXXXXXXXNCGGAGNDGYLGARYWHDPGAFRGSDSINRFKGI 280
                   N CKVLM           N GGAGNDGY+GA+YWH+PGAFRG  SI+RFK +
Sbjct: 271 YAEAEFFFNSCKVLMMAGFFILAIVINTGGAGNDGYIGAKYWHNPGAFRGDKSIDRFKDV 330

Query: 281 VAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRILGIYIMTAILLGFLVPWN 340
           ++    AAFA+G +EF  + A+EQ NP+++I SA+K ++YRIL I++ +  L+GFLVP+N
Sbjct: 331 MSTFTTAAFAFGASEFIAIGASEQSNPRRAIPSAAKTMIYRILFIFLTSITLVGFLVPYN 390

Query: 341 SDELLGSGGSATHASPFVIAVASHGVRVVPHFXXXXXXXXXXXXXXXXXXXXXXXXXXXX 400
           S EL+GSG +AT ASP+VIAVASHGVRVVPHF                            
Sbjct: 391 STELMGSGSAATKASPYVIAVASHGVRVVPHFINAVILLSVLSVANSAFYSSCRILYSLS 450

Query: 401 EQGFAPRFLNYVDRCGRPVLCLLVSCVFGLLSFVAASPKEETVFTWLLAISGLSELFTWF 460
           +QG+AP + NY+DR GRP   +++S +F +++F A S KEE VFTWLLAISGLS+LFTW 
Sbjct: 451 QQGYAPSWFNYIDREGRPARAMIMSALFSVIAFCACSSKEEDVFTWLLAISGLSQLFTWI 510

Query: 461 SISLSHVRLRRAMTVQGRSADELGYVAWTGVWGAYYAMAMIVAILVGQFWVAISPVGSNK 520
           +I +SH+R RRAM VQGRS DE+G+ +  GVWG+ YA  M+   L+ +FWV+I+P+G + 
Sbjct: 511 AICVSHIRFRRAMKVQGRSVDEIGFKSQVGVWGSSYAAIMMTLALIAEFWVSIAPIGEDH 570

Query: 521 LDANNFFENYLAMPILIFLYLGYKIWTRDWRLLIPSSEVDLVAHRKIFDAEVLRHEQLEE 580
           LDA NFFENYLAMPILI LY GYKI  RDW+L I + ++DLV+HRKI+D E+++ E+ E 
Sbjct: 571 LDAQNFFENYLAMPILIVLYFGYKICKRDWKLFIRAKDIDLVSHRKIYDGELIKQEEEEF 630

Query: 581 KEQLRHAPWTTRLANFWC 598
           KE+LR+ P+  ++  FWC
Sbjct: 631 KERLRNGPFWKKVVAFWC 648

>TPHA0E03660 Chr5 (775232..777175) [1944 bp, 647 aa] {ON} Anc_1.50
           YDR508C
          Length = 647

 Score =  631 bits (1628), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/529 (55%), Positives = 382/529 (72%), Gaps = 1/529 (0%)

Query: 70  TPIESASKHKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSM 129
           TP + A+ +K LKQ IRPRHV+MISL TGIGTG+LVGNG +L N GPA LVIGY+I+ S+
Sbjct: 120 TPTD-ANDNKALKQTIRPRHVVMISLGTGIGTGLLVGNGTALKNAGPAGLVIGYSIMGSI 178

Query: 130 LYCVIQSASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMT 189
           +YC+IQ+  E+AI Y++L GG+N YPS LV+K FGF+++WVYC+QWL V PLELVTAS+T
Sbjct: 179 IYCIIQATGEMAIAYSNLPGGYNVYPSFLVEKGFGFAIAWVYCIQWLTVCPLELVTASLT 238

Query: 190 IKYWNQTINPDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCG 249
           IKYW  ++N D FV IFY +++ IN              NCCKVLM             G
Sbjct: 239 IKYWTTSVNSDIFVAIFYALIIIINVFGAKGYAEAEFFCNCCKVLMMIGFFILSITITAG 298

Query: 250 GAGNDGYLGARYWHDPGAFRGSDSINRFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNPQK 309
           GAGNDGYLG  YWH PGAFRG  SI+ FKGI   LV AAFAYGG EF  LTAAEQ NP+ 
Sbjct: 299 GAGNDGYLGGLYWHTPGAFRGDSSIDHFKGICGTLVTAAFAYGGTEFLALTAAEQSNPRA 358

Query: 310 SIRSASKKLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSATHASPFVIAVASHGVRVV 369
           +I SA+KK++YRI+ +Y+++ +++GFLVP++S  LLGS GSAT ASP+V+A + HGVRVV
Sbjct: 359 AIPSAAKKVLYRIICVYLISILMIGFLVPFDSTRLLGSDGSATSASPYVLAASLHGVRVV 418

Query: 370 PHFXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVSCVFG 429
           PHF                             QG+AP++ +Y+DR GRP   +L+S +FG
Sbjct: 419 PHFINAVILISVLSVGNSAFYSSSRLLMSLARQGYAPKWFDYIDREGRPARAMLMSALFG 478

Query: 430 LLSFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYVAWT 489
           +++F AASPKE  VFTWLLAISGLS+LFTW +I LSH+R R AM VQGRS  E+GY+A T
Sbjct: 479 VIAFCAASPKETEVFTWLLAISGLSQLFTWCAICLSHIRFRTAMKVQGRSLGEVGYLAQT 538

Query: 490 GVWGAYYAMAMIVAILVGQFWVAISPVGSNKLDANNFFENYLAMPILIFLYLGYKIWTRD 549
           GVWG++YA+ M+  I + QFWVAI+P+GS +L A NFFENYLAMPILI LYLGYKI+ +D
Sbjct: 539 GVWGSWYALFMMFLIYIAQFWVAIAPIGSGELSAQNFFENYLAMPILIVLYLGYKIYYKD 598

Query: 550 WRLLIPSSEVDLVAHRKIFDAEVLRHEQLEEKEQLRHAPWTTRLANFWC 598
           W LLI + ++DL +HR+IFD ++L+ E  E +++L++ P+  R+ +FWC
Sbjct: 599 WTLLIKAEDIDLQSHRQIFDEDLLKEEDFEYRQRLKNGPFWRRVVDFWC 647

>Smik_4.790 Chr4 complement(1389278..1391269) [1992 bp, 663 aa] {ON}
           YDR508C (REAL)
          Length = 663

 Score =  630 bits (1625), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/626 (49%), Positives = 404/626 (64%), Gaps = 30/626 (4%)

Query: 2   KDFELHNMKSPDNGVVESFDSVEVLKEESPRSDSRSDGLFRRFADSFRRHEAHNXX---- 57
           K+ E+ +++ P+N +    ++VE   E             RRF DSF+R E  +      
Sbjct: 39  KEKEIGSIE-PENEIEYFEETVEKNIESMEYQGENHASYLRRFIDSFKRAEGSHANSSDS 97

Query: 58  ------------------------XXXXXXXXXXXLTPIESASKHKTLKQNIRPRHVLMI 93
                                                P E   K + LK++I+PRH +M+
Sbjct: 98  SNSNTTTPIFTNDSSSQLDNELNRKSSYITVDGIKQAPQEQEQKQENLKKSIKPRHTVMM 157

Query: 94  SLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYCVIQSASELAIIYTSLAGGFNA 153
           SL TGIGTG+LVGN K L+N GP  L+IGYAI+ S +YC+IQ+  ELA+IY+ L GGFN 
Sbjct: 158 SLGTGIGTGLLVGNSKVLNNAGPGGLIIGYAIMGSCVYCIIQACGELAVIYSDLIGGFNT 217

Query: 154 YPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKYWNQTINPDAFVTIFYVVLVAI 213
           YP  LVD A GFSV+W++CLQWLCV PLELVTASMTIKYW   ++PD FV IFYV+++ I
Sbjct: 218 YPLFLVDPALGFSVAWLFCLQWLCVCPLELVTASMTIKYWTVKVDPDVFVVIFYVLIIVI 277

Query: 214 NXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGGAGNDGYLGARYWHDPGAFRGSDS 273
           N              NCCK+LM           +CGGAG DGY+G++YW DPGAFRG   
Sbjct: 278 NVFGAKGYAEADFFFNCCKILMIIGFFILAIIIDCGGAGTDGYIGSKYWRDPGAFRGDTP 337

Query: 274 INRFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRILGIYIMTAILL 333
           I RFKGIVA  V AAFA+G +E   +TA+EQ NP+K+I SA+KK++YRIL +++ +  L+
Sbjct: 338 IQRFKGIVATFVTAAFAFGMSEQLAMTASEQSNPRKAIPSAAKKMIYRILFVFLASLTLV 397

Query: 334 GFLVPWNSDELLGSGGSATHASPFVIAVASHGVRVVPHFXXXXXXXXXXXXXXXXXXXXX 393
           GFLVP+ SD+LLG+ GSAT ASP+VIAV+SHGVRVVPHF                     
Sbjct: 398 GFLVPYTSDQLLGAAGSATKASPYVIAVSSHGVRVVPHFINAVILLSVLSVANSAFYTSS 457

Query: 394 XXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVSCVFGLLSFVAASPKEETVFTWLLAISGL 453
                  +QG AP+  +Y+DR GRP + +LVS +FG+++F A+S KEE VFTWLLAISGL
Sbjct: 458 RILMSLAKQGNAPKCFDYIDREGRPAVAMLVSALFGVIAFCASSKKEEDVFTWLLAISGL 517

Query: 454 SELFTWFSISLSHVRLRRAMTVQGRSADELGYVAWTGVWGAYYAMAMIVAILVGQFWVAI 513
           S+LFTW +I LSH+R RRAM VQGRS  E+GY +  GVWG+ YA+ M++  L+ QFWVAI
Sbjct: 518 SQLFTWITICLSHIRFRRAMKVQGRSLGEVGYKSQVGVWGSAYAVLMMMLALIAQFWVAI 577

Query: 514 SPV-GSNKLDANNFFENYLAMPILIFLYLGYKIWTRDWRLLIPSSEVDLVAHRKIFDAEV 572
           +P+ G  KL A +FFENYLAMPILI LY+ +K+W  DW L IP+++VDLV+HR IFD E+
Sbjct: 578 APIGGGGKLSAQSFFENYLAMPILIALYIFFKVWKNDWSLFIPANKVDLVSHRNIFDEEL 637

Query: 573 LRHEQLEEKEQLRHAPWTTRLANFWC 598
           L+ E  E KE+LR+ P+  R+ +FWC
Sbjct: 638 LKQEDEEYKERLRNGPYWKRIVDFWC 663

>NDAI0A00640 Chr1 complement(118100..120025) [1926 bp, 641 aa] {ON}
           Anc_1.50
          Length = 641

 Score =  625 bits (1612), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/605 (50%), Positives = 405/605 (66%), Gaps = 12/605 (1%)

Query: 4   FELHNMKSPDNGVVESFDSVEVLKEESPRSDSRSDGLFRRFADSFRRHEAHNXXXXXXXX 63
           F   + + P + +   F+ +   ++++  S SR+   F+ F DSF+R +           
Sbjct: 39  FAQTDSQLPSSTLSNDFEPIS--QDQNTTSHSRTRAKFQNFIDSFKRADKEQPSTLEHDL 96

Query: 64  XXXXXLT---------PIESASKHKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNG 114
                 T         P E A K + LK +I+PRHV+MISL TGIGTGMLVGNG SL N 
Sbjct: 97  TKTFEGTLEPSEDGTQPAEVAGKSEELKHSIKPRHVIMISLGTGIGTGMLVGNGTSLANS 156

Query: 115 GPASLVIGYAIVSSMLYCVIQSASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQ 174
           GPA LVIGYAI+ S +YC+IQ+  E+A++Y+ L GGFN+YPS L++ A GFSV+WVYC+Q
Sbjct: 157 GPAGLVIGYAIMGSCIYCIIQATGEMAVLYSKLIGGFNSYPSFLIEPALGFSVAWVYCIQ 216

Query: 175 WLCVLPLELVTASMTIKYWNQTINPDAFVTIFYVVLVAINXXXXXX-XXXXXXXXNCCKV 233
           WLCV PLELVTASMTIKYW   ++PD FV IFYV+++ IN               N CK+
Sbjct: 217 WLCVCPLELVTASMTIKYWTTKVDPDVFVVIFYVLIILINVLGGAAGYAEAEFFFNSCKI 276

Query: 234 LMXXXXXXXXXXXNCGGAGNDGYLGARYWHDPGAFRGSDSINRFKGIVAVLVNAAFAYGG 293
           LM            CGGAG+DGY+G RYWHDPGAFRG  +I+RFKG+V+ LVNAAFA+G 
Sbjct: 277 LMLLGFFILGIILICGGAGDDGYIGGRYWHDPGAFRGEHAIDRFKGVVSTLVNAAFAFGL 336

Query: 294 AEFSVLTAAEQQNPQKSIRSASKKLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSATH 353
           +E   +TA+EQ NP+K+I SA+KK++YRI+ IY+ + +++GFLVPWNSD+LLGS G    
Sbjct: 337 SEMIGVTASEQSNPRKAIPSAAKKMIYRIVCIYLGSVVIVGFLVPWNSDQLLGSSGGGVK 396

Query: 354 ASPFVIAVASHGVRVVPHFXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVD 413
           ASP+V+AV++HGVRVVPHF                            EQG+AP+   YVD
Sbjct: 397 ASPYVLAVSTHGVRVVPHFINAVILLSVLSVANSAFYSSSRLLLGLAEQGYAPKIFKYVD 456

Query: 414 RCGRPVLCLLVSCVFGLLSFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAM 473
           R GRP + + V+ +  ++SF A SPKE+ VF WLLAISGLS+LFTW +I LSH+R RRAM
Sbjct: 457 REGRPTMGMCVAALVNVISFCATSPKEDQVFVWLLAISGLSQLFTWSAICLSHIRFRRAM 516

Query: 474 TVQGRSADELGYVAWTGVWGAYYAMAMIVAILVGQFWVAISPVGSNKLDANNFFENYLAM 533
            VQGRS  E+G+ +  GVWG++YA  M++ IL+ QFWVAI+P+G  +LD   FFENYLA 
Sbjct: 517 AVQGRSLGEIGFKSQCGVWGSWYAFIMMMLILIAQFWVAIAPIGEGRLDVQAFFENYLAA 576

Query: 534 PILIFLYLGYKIWTRDWRLLIPSSEVDLVAHRKIFDAEVLRHEQLEEKEQLRHAPWTTRL 593
           PILI LY GYKI+T+DWRL I + ++DL  +R +FD E++R E+ E KE++R+AP   ++
Sbjct: 577 PILIALYFGYKIYTKDWRLFIRAKDIDLDINRDVFDEELIRQEEEEYKEKMRNAPIWQKI 636

Query: 594 ANFWC 598
             FWC
Sbjct: 637 YEFWC 641

>NCAS0B08580 Chr2 complement(1646220..1648103) [1884 bp, 627 aa]
           {ON} Anc_1.50
          Length = 627

 Score =  624 bits (1609), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/570 (52%), Positives = 387/570 (67%), Gaps = 9/570 (1%)

Query: 37  SDGLFRRFADSFRRHEA-------HNXXXXXXXXXXXXXLTPIESASKHKTLKQNIRPRH 89
           S+  FRRF DSF++ E        H+               P E     + LK+ I+PRH
Sbjct: 59  SNTRFRRFIDSFKKAEGPQPGSLDHDVLAGDSDIEGKPRTEP-EKDDDARELKKTIKPRH 117

Query: 90  VLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYCVIQSASELAIIYTSLAG 149
           V+MISL TGIGTGMLVGNG SL N GPA LVIGYAI+ S +YC+IQ+  ELA++YT L G
Sbjct: 118 VVMISLGTGIGTGMLVGNGTSLANSGPAGLVIGYAIMGSCIYCIIQATGELAVLYTKLTG 177

Query: 150 GFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKYWNQTINPDAFVTIFYVV 209
           GFNAYPS+L+D AFGF+V+WVYC+QWLCV PLELVTASMTIKYW   ++PD FV IFY +
Sbjct: 178 GFNAYPSMLIDPAFGFAVAWVYCIQWLCVCPLELVTASMTIKYWTTKVDPDVFVVIFYCL 237

Query: 210 LVAINXXXXXX-XXXXXXXXNCCKVLMXXXXXXXXXXXNCGGAGNDGYLGARYWHDPGAF 268
           ++ IN               N  K+LM            CGGAGNDGY+G R WH+PG+F
Sbjct: 238 ILCINVLGGAAGYAEAEFFFNSFKILMLTGFFILGIVVICGGAGNDGYIGTRLWHNPGSF 297

Query: 269 RGSDSINRFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRILGIYIM 328
           RG   ++RFKG+V+ LVNAAFA+G +EF  +TA+EQ NP+K+I SA+KK++YRI+ IY+ 
Sbjct: 298 RGDKPVDRFKGVVSTLVNAAFAFGMSEFLGVTASEQSNPRKAIPSAAKKMLYRIICIYLG 357

Query: 329 TAILLGFLVPWNSDELLGSGGSATHASPFVIAVASHGVRVVPHFXXXXXXXXXXXXXXXX 388
           +  ++GFLVP++SD+LLGS G+AT ASP+V+A++ HGVRVVPHF                
Sbjct: 358 SVTIVGFLVPYDSDQLLGSSGAATKASPYVLAISLHGVRVVPHFINAVILLSVLSVGNSA 417

Query: 389 XXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVSCVFGLLSFVAASPKEETVFTWLL 448
                       + G+AP FLNYVDR GRP+    VS + G+++F A SPKE+ VF WLL
Sbjct: 418 FYSSSRQLLSLSQLGYAPSFLNYVDRNGRPLKAYCVSALVGVIAFCATSPKEDQVFVWLL 477

Query: 449 AISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYVAWTGVWGAYYAMAMIVAILVGQ 508
           AISGLS+LFTWFSI LSH+R RRAM VQGRS  E+G+ +  G++G+ Y+  M+V IL+ Q
Sbjct: 478 AISGLSQLFTWFSICLSHLRFRRAMRVQGRSMGEVGFKSQVGIYGSLYSCVMMVLILIAQ 537

Query: 509 FWVAISPVGSNKLDANNFFENYLAMPILIFLYLGYKIWTRDWRLLIPSSEVDLVAHRKIF 568
           FW A+ PVG  K D   FFENYLAMPI I LY G+KIW +DWRL I + ++DLV+HR+IF
Sbjct: 538 FWTALVPVGEGKPDVQAFFENYLAMPIFIVLYFGFKIWKKDWRLFIRAEDIDLVSHREIF 597

Query: 569 DAEVLRHEQLEEKEQLRHAPWTTRLANFWC 598
           D E+L+ E  E + +LR  P   R+ +FWC
Sbjct: 598 DEELLKQEDEEYRRKLRDGPMWRRVYDFWC 627

>KAFR0D00500 Chr4 complement(77541..79394) [1854 bp, 617 aa] {ON} 
          Length = 617

 Score =  619 bits (1596), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/619 (49%), Positives = 395/619 (63%), Gaps = 23/619 (3%)

Query: 1   MKDFELHNMKSPDNGVVESFDSVE------------VLKEESPRSDSRSDGLFRRFADSF 48
           M+D E  N K   N   E  DS++            VL EE     +   G F  F DSF
Sbjct: 1   MRDLE--NNKFTTNNYTEKSDSIDPIEQGDSDLQVTVLDEEKSEFSNGLRGRFDEFIDSF 58

Query: 49  RRHEA----HNXXXXXXXXXXXXXLTPIESASK----HKTLKQNIRPRHVLMISLATGIG 100
           RR E      N                +E ++     ++ LK+ I+PRHV+MI+L TG+G
Sbjct: 59  RRAEDVRILPNEMNPILSHESVFDTAVVEISAVDNQINEKLKKTIQPRHVIMITLGTGVG 118

Query: 101 TGMLVGNGKSLHNGGPASLVIGYAIVSSMLYCVIQSASELAIIYTSLAGGFNAYPSLLVD 160
           TG+LVGNG +L + GPA L+IGYAI+S+ +YCV+Q+  E+A+ Y +L GGF+AYP  L+D
Sbjct: 119 TGLLVGNGTTLSHAGPAGLIIGYAIMSTCIYCVMQAVGEMAVNYLTLIGGFSAYPGFLID 178

Query: 161 KAFGFSVSWVYCLQWLCVLPLELVTASMTIKYWNQTINPDAFVTIFYVVLVAINXXXXXX 220
               F+VSW+YC+QW CV PLELVTASMTI+YW   +N D FV IFY++++ IN      
Sbjct: 179 PGLNFAVSWIYCIQWFCVCPLELVTASMTIQYWTTKVNADIFVLIFYLLMIGINIFGGAR 238

Query: 221 XXXXXXXX-NCCKVLMXXXXXXXXXXXNCGGAGNDGYLGARYWHDPGAFRGSDSINRFKG 279
                    N CK+LM            CGGAGN G++GARYWH PGAFRG + INRFKG
Sbjct: 239 GYAEAEFFCNVCKILMMTGFFILGIILICGGAGNSGFIGARYWHSPGAFRGDNGINRFKG 298

Query: 280 IVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRILGIYIMTAILLGFLVPW 339
           IV+ LV AAFA+GG EF  +TA+EQ NP+K+I SA+KK++YR L IY+ + I++GFLVP+
Sbjct: 299 IVSTLVTAAFAFGGTEFLAITASEQANPRKAIPSAAKKVIYRALIIYVGSIIIVGFLVPY 358

Query: 340 NSDELLGSGGSATHASPFVIAVASHGVRVVPHFXXXXXXXXXXXXXXXXXXXXXXXXXXX 399
           NS ELLGS G AT ASP+VIAVASHG+RVVPHF                           
Sbjct: 359 NSSELLGSSGPATKASPYVIAVASHGIRVVPHFINAVILISVFSVADSAFYSSSRLLLTL 418

Query: 400 XEQGFAPRFLNYVDRCGRPVLCLLVSCVFGLLSFVAASPKEETVFTWLLAISGLSELFTW 459
             QGFAP+   YVD+ GRP L  +V  +  ++SF A S KE  VF WLL+ISGLSE+FTW
Sbjct: 419 ARQGFAPKIFTYVDKRGRPTLGFVVGAIIAIISFCACSSKEADVFNWLLSISGLSEVFTW 478

Query: 460 FSISLSHVRLRRAMTVQGRSADELGYVAWTGVWGAYYAMAMIVAILVGQFWVAISPVGSN 519
             ISLSH+R RRAM VQGRS DE+G+ +  GVWG+ YA  M++ +L+GQFWV I PVG +
Sbjct: 479 AIISLSHIRFRRAMKVQGRSLDEIGFKSQAGVWGSVYAFVMMILVLIGQFWVGIVPVGED 538

Query: 520 KLDANNFFENYLAMPILIFLYLGYKIWTRDWRLLIPSSEVDLVAHRKIFDAEVLRHEQLE 579
             DA +FF+ YLAMP+ I LY GYKIW RDWRL I +  +DL+AHR I+D E+LR E+ E
Sbjct: 539 SADAVSFFQAYLAMPVFIVLYFGYKIWNRDWRLFIRAKNIDLIAHRHIYDPELLRQERKE 598

Query: 580 EKEQLRHAPWTTRLANFWC 598
            +E+ R+AP   ++ NFWC
Sbjct: 599 MRERARNAPLWRKIYNFWC 617

>Ecym_1056 Chr1 (102260..104080) [1821 bp, 606 aa] {ON} similar to
           Ashbya gossypii AFR698C
          Length = 606

 Score =  608 bits (1569), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/599 (48%), Positives = 396/599 (66%), Gaps = 18/599 (3%)

Query: 5   ELHNMKSPDNGVVESFDSVEVLKEES-PRSD----SRSDGLFRRFADSFRRHEAHNXXXX 59
           EL ++KS +  V+   D+ E  ++ S  +SD       +  FRRF +SF++         
Sbjct: 21  ELKDVKSGN--VLTGSDTTEFFEKASVQKSDFEYFEGDETKFRRFVNSFKKAPGRENDQ- 77

Query: 60  XXXXXXXXXLTPIESASKHKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASL 119
                       ++  +KH+ LKQ IRPRHV+MISL TGIGTG+LVG GK+L+NGGP  L
Sbjct: 78  ----------ESLQDNNKHEKLKQTIRPRHVVMISLGTGIGTGLLVGTGKALYNGGPGGL 127

Query: 120 VIGYAIVSSMLYCVIQSASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVL 179
            +G+ ++ + +YCVIQ+A E+A+ Y +L+GGFNAYPS LVD  FGF+ +W+YC+QWLCV 
Sbjct: 128 AVGFFVMGTCVYCVIQAAGEMAVNYPALSGGFNAYPSFLVDPGFGFATAWLYCIQWLCVF 187

Query: 180 PLELVTASMTIKYWNQTINPDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXX 239
           PLELVTAS+TIKYW   INPD FV +FY++++ IN              N CKVLM    
Sbjct: 188 PLELVTASITIKYWTTAINPDIFVAVFYLLIIVINFFGARGYAEAEFFFNTCKVLMIIGF 247

Query: 240 XXXXXXXNCGGAGNDGYLGARYWHDPGAFRGSDSINRFKGIVAVLVNAAFAYGGAEFSVL 299
                  N G AGNDGY+GA+YW +PG+F G  +I+ FKG+V+ LVNAAF+ G +EF  L
Sbjct: 248 FIVGILVNTGAAGNDGYIGAKYWREPGSFGGHTAIDHFKGVVSTLVNAAFSLGCSEFVAL 307

Query: 300 TAAEQQNPQKSIRSASKKLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSATHASPFVI 359
           TAAEQ NP+KS+ SA+KK++Y++  +++ +  L+GFLVP NS EL+GS  S+ H SP+VI
Sbjct: 308 TAAEQANPRKSVPSAAKKMLYKVFVVFLGSVTLIGFLVPKNSSELMGSTDSSVHVSPYVI 367

Query: 360 AVASHGVRVVPHFXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPV 419
           AVASHGVRVVPHF                            EQG+AP    Y+DR GRP+
Sbjct: 368 AVASHGVRVVPHFINAVILLSVLSVGNSAFYSSSRLLLSLAEQGYAPPVFKYIDRQGRPL 427

Query: 420 LCLLVSCVFGLLSFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRS 479
           + ++VS   G L FVAASPKEETVF WLLAISGLS+LFTW SI +SH+R R+A+ VQGR 
Sbjct: 428 MAMMVSITMGCLCFVAASPKEETVFIWLLAISGLSQLFTWTSICISHIRFRKALLVQGRG 487

Query: 480 ADELGYVAWTGVWGAYYAMAMIVAILVGQFWVAISPVGSNKLDANNFFENYLAMPILIFL 539
            D LG+ A TGVWG+YY+  +++   + QFW  + P+GS+K +A +FFE YLA PI + L
Sbjct: 488 WDGLGFKAQTGVWGSYYSAVIMILTFIAQFWTCLIPMGSSKPNAESFFEGYLAFPIFVAL 547

Query: 540 YLGYKIWTRDWRLLIPSSEVDLVAHRKIFDAEVLRHEQLEEKEQLRHAPWTTRLANFWC 598
           Y GYKI+ ++W+L IP+ ++DL  HRKIFDA+VL+ E  E + +LR +    R+A  WC
Sbjct: 548 YFGYKIYNKNWQLFIPAEKIDLDLHRKIFDADVLKQEDAEYRAKLRDSSMWHRIAALWC 606

>TPHA0B04750 Chr2 (1119282..1121201) [1920 bp, 639 aa] {ON} Anc_1.50
           YDR508C
          Length = 639

 Score =  607 bits (1566), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/623 (49%), Positives = 408/623 (65%), Gaps = 32/623 (5%)

Query: 2   KDFELHNMKSPDNGVVESFDSVEVLKEESPRSDSRSDGLFRRFADSFRR--------HEA 53
           ++ E+  + S  NG   S +S++      P S + + G F+ F DSFRR        H+ 
Sbjct: 23  QENEVEYLDSQLNGDSSSNNSIK-----EPTS-TGAKGHFKSFVDSFRRGDHAKNALHDL 76

Query: 54  HNXXXXXXXXXX-----------XXXLTPIESASKHKT-------LKQNIRPRHVLMISL 95
            N                        +  + SA   K        L++ I+PRHV+MISL
Sbjct: 77  ENDITTSISHASLVHAVSKAREDDEIMQSVASAEHRKVNNTESDDLQKTIKPRHVIMISL 136

Query: 96  ATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYCVIQSASELAIIYTSLAGGFNAYP 155
            TGIGTG+LVGN   L   GPA LVIGY+I+ S LYC+IQ+A E+A++Y+ L GGFN YP
Sbjct: 137 GTGIGTGLLVGNSSVLSAAGPAPLVIGYSIMGSCLYCIIQAAGEMAVVYSDLNGGFNNYP 196

Query: 156 SLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKYWNQTINPDAFVTIFYVVLVAINX 215
           S L+D A GFSV+WVYCLQWLCV PLELVTAS+TIKYW   ++PD FV IFYV++++IN 
Sbjct: 197 SFLLDPALGFSVAWVYCLQWLCVCPLELVTASLTIKYWTTKVDPDVFVIIFYVLIISINV 256

Query: 216 XXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGGAGNDGYLGARYWHDPGAFRGSDSIN 275
                        N CKVLM             GGAGNDGYLGA+YWH+PGAFRG  +++
Sbjct: 257 FGARGYAEAEFFFNVCKVLMMIGFFILGIIITAGGAGNDGYLGAKYWHEPGAFRGEHAVD 316

Query: 276 RFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRILGIYIMTAILLGF 335
           RFKG++   V AAFA+G  EF  LTAAEQ NP+K+I SA+KK++YRI+ I++++ I+LGF
Sbjct: 317 RFKGVMDTFVAAAFAFGATEFIALTAAEQSNPRKAIPSAAKKVLYRIVLIFLVSIIMLGF 376

Query: 336 LVPWNSDELLGSGGSATHASPFVIAVASHGVRVVPHFXXXXXXXXXXXXXXXXXXXXXXX 395
           LVP++SD+LLGS GS   ASP+V+AV+ HGVRVVPHF                       
Sbjct: 377 LVPYDSDQLLGSSGSGVKASPYVLAVSLHGVRVVPHFINAVILLSVLSVGNSAFYSSSRL 436

Query: 396 XXXXXEQGFAPRFLNYVDRCGRPVLCLLVSCVFGLLSFVAASPKEETVFTWLLAISGLSE 455
                +QG+AP++ +YVDR GRP   +L+S +FG+++F A SPKE  VF WLLAISGLS+
Sbjct: 437 LLSLSQQGYAPKWFDYVDRQGRPARAMLMSALFGVIAFCATSPKETDVFNWLLAISGLSQ 496

Query: 456 LFTWFSISLSHVRLRRAMTVQGRSADELGYVAWTGVWGAYYAMAMIVAILVGQFWVAISP 515
           LFTWF+I +SHVR R AM VQGRS  E+G+ + TGV+G+ YA  M++  L+ QFWVAI+P
Sbjct: 497 LFTWFAICMSHVRFRYAMKVQGRSIGEVGFHSQTGVYGSLYAATMMILALMAQFWVAIAP 556

Query: 516 VGSNKLDANNFFENYLAMPILIFLYLGYKIWTRDWRLLIPSSEVDLVAHRKIFDAEVLRH 575
           +   KLDA NFF++YLAMPILI LY GYK++ RDW+L I + ++DL++HR+IFD  +L+ 
Sbjct: 557 LNEGKLDAQNFFQSYLAMPILIALYFGYKLYYRDWKLYIKADKIDLISHRQIFDENILKQ 616

Query: 576 EQLEEKEQLRHAPWTTRLANFWC 598
           E  E KE+LR+ P   R+A+FWC
Sbjct: 617 EDEEYKEKLRNGPAWRRIADFWC 639

>KAFR0D04140 Chr4 (821341..823254) [1914 bp, 637 aa] {ON} 
          Length = 637

 Score =  603 bits (1556), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/566 (50%), Positives = 380/566 (67%), Gaps = 9/566 (1%)

Query: 42  RRFADSFRRHEAHNXXXXXXXXXXXXXLTPIESASKHKT--------LKQNIRPRHVLMI 93
           R+F DSFRR E                L+P +S   H          L+++IRPRHVLM+
Sbjct: 72  RKFVDSFRRAEDDEETAEDLENELVSTLSPSKSKQLHGQKNGDDDAHLQKSIRPRHVLMM 131

Query: 94  SLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYCVIQSASELAIIYTSLAGGFNA 153
           SL TGIGTG+LVGNG +L   GP +LVIGY I+ S LYC+IQ+  E+A+ Y+ L G FNA
Sbjct: 132 SLGTGIGTGLLVGNGSALSKAGPGALVIGYGIMGSCLYCIIQACGEMAVCYSGLPGNFNA 191

Query: 154 YPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKYWNQTINPDAFVTIFYVVLVAI 213
           YPS LVD+   F V+WVYCLQWLCV+PLELVTASMTI YW   +N D FV IF+V++  I
Sbjct: 192 YPSFLVDEGMAFGVAWVYCLQWLCVMPLELVTASMTIDYWTTKVNSDVFVVIFFVLITLI 251

Query: 214 NXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGGAGNDGYLGARYWHDPGAFRGSDS 273
           N              N CKVLM           N GGAGNDGY+GA+YWH+PGAFRG  S
Sbjct: 252 NTFGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGNDGYIGAKYWHNPGAFRGDKS 311

Query: 274 INRFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRILGIYIMTAILL 333
           I+RFK +++    AAFA+G +EF  + A+EQ NP+++I SA+K ++YRIL I++ +  L+
Sbjct: 312 IDRFKDVMSTFTTAAFAFGASEFIAIGASEQSNPRRAIPSAAKTMIYRILFIFLTSITLV 371

Query: 334 GFLVPWNSDELL-GSGGSATHASPFVIAVASHGVRVVPHFXXXXXXXXXXXXXXXXXXXX 392
           GFLVP++S ELL   G +++ ASP+VIAVASHGVRVVPHF                    
Sbjct: 372 GFLVPYDSTELLGSGGSASSQASPYVIAVASHGVRVVPHFINAVILLSVLSVANSAYYSS 431

Query: 393 XXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVSCVFGLLSFVAASPKEETVFTWLLAISG 452
                   +QG+AP++  Y+DR GRP   +LV+ +FG+++F + S KEE VF WLL+I+G
Sbjct: 432 CRILYSLAQQGYAPKWFEYIDREGRPARAMLVTTIFGVIAFCSCSDKEEDVFAWLLSIAG 491

Query: 453 LSELFTWFSISLSHVRLRRAMTVQGRSADELGYVAWTGVWGAYYAMAMIVAILVGQFWVA 512
           LS+LFTW +I LSH+R RRAM VQGRS DE+G+ +  GVWG+ YA  M++  L+ +FWV+
Sbjct: 492 LSQLFTWTAICLSHIRFRRAMKVQGRSVDEIGFKSQVGVWGSGYAAIMMILALIAEFWVS 551

Query: 513 ISPVGSNKLDANNFFENYLAMPILIFLYLGYKIWTRDWRLLIPSSEVDLVAHRKIFDAEV 572
           I+P+G + LDA NFFENYLAMPILI LY GYKI+ +DW+L I + ++DL++HR IFD E+
Sbjct: 552 IAPIGEDHLDAQNFFENYLAMPILIVLYFGYKIYKKDWKLFIRAKDIDLISHRTIFDGEL 611

Query: 573 LRHEQLEEKEQLRHAPWTTRLANFWC 598
           +R E+ E KE+LR+ P   R+  FWC
Sbjct: 612 VRQEEEEYKEKLRNGPKWKRVVAFWC 637

>YBR068C Chr2 complement(373861..375690) [1830 bp, 609 aa] {ON}
           BAP2High-affinity leucine permease, functions as a
           branched-chain amino acid permease involved in the
           uptake of leucine, isoleucine and valine; contains 12
           predicted transmembrane domains
          Length = 609

 Score =  602 bits (1551), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/594 (48%), Positives = 386/594 (64%), Gaps = 6/594 (1%)

Query: 11  SPDNGVVESFDSVEVLKEESP-----RSDSRSDGLFRRFADSFRRHEAHNXXXXXXXXXX 65
           SPD+  + SF +    +  S      +  S SD L  RFADSF+R E             
Sbjct: 16  SPDSISIRSFSAGNNFQSSSSEKTYSKQKSGSDKLIHRFADSFKRAEGSTTRTKQINENT 75

Query: 66  XXXLTPIESASKHKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAI 125
                 +ES +    LK++++ RHV+M+SL TGIGTG+LV N K LH GGPA+L+IGY +
Sbjct: 76  SDLEDGVESITSDSKLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLHYGGPAALIIGYIL 135

Query: 126 VSSMLYCVIQSASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVT 185
           VS + Y +IQ+A E+A+ Y +L   FNAY S+ + K+FGF+  W+YC QWL VLPLEL+T
Sbjct: 136 VSFVTYFMIQAAGEMAVTYPTLPANFNAYSSIFISKSFGFATVWLYCFQWLTVLPLELIT 195

Query: 186 ASMTIKYWNQTINPDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXX 245
           ASMTI++WN  INPD ++ IFYV LV I+              NCCK+LM          
Sbjct: 196 ASMTIQFWNDKINPDIYILIFYVFLVFIHFFGVKAYGETEFIFNCCKILMIAGFIILSIV 255

Query: 246 XNCGGAGNDGYLGARYWHDPGAFRGSDSINRFKGIVAVLVNAAFAYGGAEFSVLTAAEQQ 305
            NCGGAGNDGY+GA YWH+PGAF G  SI RFK +  +LV A F++GG E   L+  EQ 
Sbjct: 256 INCGGAGNDGYIGATYWHNPGAFAGDTSIGRFKNVCYILVTAYFSFGGMELFALSVQEQS 315

Query: 306 NPQKSIRSASKKLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSATHASPFVIAVASHG 365
           NP+KS   A+K+ +YRI+ IY++T IL+GF VP+N D+L+G+GGSATHASP+V+A + HG
Sbjct: 316 NPRKSTPVAAKRSIYRIVVIYLLTMILIGFNVPYNDDQLMGAGGSATHASPYVLAASIHG 375

Query: 366 VRVVPHFXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVS 425
           V++VPH                             +QG+AP+FL+YVDR GRP+  L+V 
Sbjct: 376 VKIVPHIINAVILISVVSVANSSLYAGPRLICSLAQQGYAPKFLDYVDREGRPLRALIVC 435

Query: 426 CVFGLLSFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGY 485
           CVFG+++FVAAS KEE VFTWL AI+GLSELFTW SI LSH+R R+AM VQGRS DELGY
Sbjct: 436 CVFGVIAFVAASSKEEIVFTWLAAIAGLSELFTWTSIMLSHLRFRQAMKVQGRSLDELGY 495

Query: 486 VAWTGVWGAYYAMAMIVAILVGQFWVAISPVGS-NKLDANNFFENYLAMPILIFLYLGYK 544
            A TG+WG+ Y +   + + V QFWVA++P+G+  K DA +FF+NYLA PI +  Y GY 
Sbjct: 496 KATTGIWGSIYGVFFNILVFVAQFWVALAPLGNGGKCDAESFFQNYLAFPIWLAFYFGYM 555

Query: 545 IWTRDWRLLIPSSEVDLVAHRKIFDAEVLRHEQLEEKEQLRHAPWTTRLANFWC 598
           ++ RD+ LL P  ++DL  HR+I+D E++R E  E KE+LR+     +  +FWC
Sbjct: 556 VYNRDFTLLNPLDKIDLDFHRRIYDPELMRQEDEENKEKLRNMSLMRKAYHFWC 609

>TBLA0A05180 Chr1 complement(1267962..1269992) [2031 bp, 676 aa]
           {ON} 
          Length = 676

 Score =  604 bits (1557), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/526 (52%), Positives = 364/526 (69%)

Query: 73  ESASKHKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYC 132
           +    +  L+Q I+PRHV+M+SL TGIGTG+LVGN K L   GPA LVIGY I+ + +YC
Sbjct: 151 KKEDSNAELRQTIKPRHVIMMSLGTGIGTGLLVGNAKPLAAAGPAPLVIGYGIMGTCIYC 210

Query: 133 VIQSASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKY 192
           +IQ+  E+A+ Y +L G FN +PS LVD  F F+V+WVYC+QWLCV PLELVTASMTI+Y
Sbjct: 211 IIQACGEMAVAYGNLTGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTASMTIQY 270

Query: 193 WNQTINPDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGGAG 252
           W   ++PD FV IFYV+++ IN              N CKVLM           + G AG
Sbjct: 271 WTTKVDPDVFVVIFYVLILLINFFGAKGYAEAEFIFNTCKVLMICGFFILAICIDTGAAG 330

Query: 253 NDGYLGARYWHDPGAFRGSDSINRFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIR 312
            DGY+GA+YW+DPGAFRG   I RFKG++   V AAFA+G  EF  LTAAEQ NP+K+I 
Sbjct: 331 TDGYIGAKYWNDPGAFRGQTKIERFKGVMDTFVTAAFAFGATEFIALTAAEQSNPRKAIP 390

Query: 313 SASKKLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSATHASPFVIAVASHGVRVVPHF 372
           SA+KK++YR+L I++ T IL+GFLVP++SD+LLGSGGSAT ASP+V+A++ HGVRV  HF
Sbjct: 391 SAAKKIIYRVLVIFLNTIILIGFLVPYDSDQLLGSGGSATKASPYVLAISLHGVRVAQHF 450

Query: 373 XXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVSCVFGLLS 432
                                       +QG AP+  +YVDR GRP++ +  S V  +++
Sbjct: 451 VNAVILISVISVGNSAFYSSSRLLMSLAQQGSAPKIFDYVDREGRPLIAMCCSAVIAVIA 510

Query: 433 FVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYVAWTGVW 492
           F A SPKE  VFTWL+AI+GLS+LFTWF+I LSH+R RRAM VQGRS  E+GY++ TG+ 
Sbjct: 511 FCATSPKETEVFTWLMAIAGLSQLFTWFAICLSHLRFRRAMKVQGRSLGEMGYLSQTGIL 570

Query: 493 GAYYAMAMIVAILVGQFWVAISPVGSNKLDANNFFENYLAMPILIFLYLGYKIWTRDWRL 552
           G+ YA  M++  L+ QFWVA+ P+G++  DAN+FF NYLAMPILI  Y GYKIW RDWRL
Sbjct: 571 GSLYAAIMMILALIAQFWVALVPMGTHTPDANSFFSNYLAMPILIVFYFGYKIWKRDWRL 630

Query: 553 LIPSSEVDLVAHRKIFDAEVLRHEQLEEKEQLRHAPWTTRLANFWC 598
            I + ++DL++HR I+D E+LR E  E +E+LR+ P   R+A FWC
Sbjct: 631 FIRAKDIDLISHRTIYDEELLRQEDEEYREKLRNGPKWKRVAAFWC 676

>KAFR0D00510 Chr4 complement(80174..82027) [1854 bp, 617 aa] {ON} 
          Length = 617

 Score =  597 bits (1539), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/595 (48%), Positives = 384/595 (64%), Gaps = 17/595 (2%)

Query: 20  FDSVEVLKEESPR------SDSRSDGLFRRFADSFRRHEAHNXXXX---------XXXXX 64
           F+ V+V+  +S        + S +   FR F DSF+  E  +                  
Sbjct: 24  FNDVDVIDIDSAERNYELPTSSTTHSRFRNFIDSFKPPETTHHIETDMNPILSHQSVFDD 83

Query: 65  XXXXLTPIESASKHKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYA 124
               ++ ++     K LK+ I+PRHV+M+SL TGIGTG+LVGNG +L + GPA LVIGYA
Sbjct: 84  AKVEISQVDDELNEK-LKKTIQPRHVVMMSLGTGIGTGLLVGNGTTLAHAGPAGLVIGYA 142

Query: 125 IVSSMLYCVIQSASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELV 184
           I++S +YC+IQ+  E+A+ Y +L GGFNAYP  LVD A  FS++W+YC+QW CV PLELV
Sbjct: 143 IMASCIYCIIQAVGEMAVNYLTLVGGFNAYPGFLVDPALNFSIAWIYCIQWFCVCPLELV 202

Query: 185 TASMTIKYWNQTINPDAFVTIFYVVLVAINXXXXXX-XXXXXXXXNCCKVLMXXXXXXXX 243
           TASMTI+YW   +N D FV IFY++++AIN               N CK+LM        
Sbjct: 203 TASMTIQYWTTKVNADIFVLIFYILVLAINIFGGARGYAETEFICNSCKILMMIGFFILG 262

Query: 244 XXXNCGGAGNDGYLGARYWHDPGAFRGSDSINRFKGIVAVLVNAAFAYGGAEFSVLTAAE 303
               CGGAGNDG++G +YW DPGAFRGSD  NRFKG+V+ LV AAF++G  EF  +TA+E
Sbjct: 263 IVIICGGAGNDGFIGGKYWRDPGAFRGSDGPNRFKGVVSTLVTAAFSFGQTEFLAITASE 322

Query: 304 QQNPQKSIRSASKKLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSATHASPFVIAVAS 363
           Q NP+K+I SA+KK++YR L IY+ + I++G LVP++S ELLGS  +AT ASP+V+AV++
Sbjct: 323 QSNPRKAIPSAAKKVIYRALLIYLASIIIVGLLVPYDSSELLGSSSAATKASPYVLAVST 382

Query: 364 HGVRVVPHFXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLL 423
           HGVRVVPHF                             QG+AP+   +VDR GRP L  L
Sbjct: 383 HGVRVVPHFINAVILISVFSVADSAFYSSSRMLLTLARQGYAPKVFTFVDRTGRPSLGFL 442

Query: 424 VSCVFGLLSFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADEL 483
           V  V  +++F A S KE  VF WLLAISGLS++FTW  I LSH+R RRAM VQGRS DE+
Sbjct: 443 VGAVIAVMAFCACSSKETEVFNWLLAISGLSQVFTWALICLSHIRFRRAMKVQGRSIDEI 502

Query: 484 GYVAWTGVWGAYYAMAMIVAILVGQFWVAISPVGSNKLDANNFFENYLAMPILIFLYLGY 543
           GY +  GVWG+ YA  M++ I++GQ WV I PVG    D   FF++YLAMP+ I LYLGY
Sbjct: 503 GYKSQVGVWGSAYAFVMMILIMIGQCWVGIVPVGEGSADVQAFFQDYLAMPVFIVLYLGY 562

Query: 544 KIWTRDWRLLIPSSEVDLVAHRKIFDAEVLRHEQLEEKEQLRHAPWTTRLANFWC 598
           KIW RDWRL I + ++DL++HR I D E+LR E+ E +E+LR+ P   R+ +FWC
Sbjct: 563 KIWKRDWRLFIRAKDIDLISHRHIHDPEILRQEREEYQEKLRNGPVWRRVYDFWC 617

>AFR698C Chr6 complement(1726387..1728216) [1830 bp, 609 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR508C
           (GNP1) and YCL025C (AGP1)
          Length = 609

 Score =  596 bits (1536), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/602 (48%), Positives = 391/602 (64%), Gaps = 17/602 (2%)

Query: 3   DFELHNMKSPDNGVVESFDSVEVLKEESPRSD----SRSDGLFRRFADSFRRHEAHNXXX 58
           D EL ++KS      E+ +  E  K  + +SD       D  F+RF  SF+R  AH    
Sbjct: 19  DGELKDIKSGKVVTTETTEFFE--KTSAQKSDFEYLEGDDTRFKRFLSSFKR--AHGSGG 74

Query: 59  XXXXXXXXXXLTPIESASKHKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPAS 118
                            +KH+ LKQ I+ RH++MISL TGIGTG+LVG+G +LH+GGPA 
Sbjct: 75  TDT-------EGGGGQNAKHENLKQTIKSRHMIMISLGTGIGTGLLVGSGTALHDGGPAG 127

Query: 119 LVIGYAIVSSMLYCVIQSASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCV 178
             IG+ I+   +YCVIQ+A ELA+ YTSLAGGFNAYPS L+D A GF+ +WVYCLQWLCV
Sbjct: 128 SAIGFLIMGLCVYCVIQAAGELAVCYTSLAGGFNAYPSFLIDPALGFATAWVYCLQWLCV 187

Query: 179 LPLELVTASMTIKYW--NQTINPDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMX 236
            PLELVTAS+TIK+W  ++++NPD +V IFYV+++ IN              N CKVLM 
Sbjct: 188 FPLELVTASITIKFWPGSRSVNPDIYVAIFYVLIIVINFFGARGYAEAEFFFNSCKVLMM 247

Query: 237 XXXXXXXXXXNCGGAGNDGYLGARYWHDPGAFRGSDSINRFKGIVAVLVNAAFAYGGAEF 296
                     N G  G  GY+G +YW DPG+  G    + FKGIVA LVNAAF+ G +EF
Sbjct: 248 IGFFIVGILINTGAVGTSGYIGGKYWRDPGSLGGRTHFDHFKGIVATLVNAAFSLGCSEF 307

Query: 297 SVLTAAEQQNPQKSIRSASKKLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSATHASP 356
             LTAAEQ NP+KSI +A+KK++Y+I  +++ + IL+GFLVP +S EL+GS  S  H SP
Sbjct: 308 VALTAAEQANPRKSIPAAAKKMIYKIFVVFLGSVILIGFLVPKDSHELMGSNDSDLHVSP 367

Query: 357 FVIAVASHGVRVVPHFXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCG 416
           +VIAV  HGV VVP F                            EQ +AP+   Y+DR G
Sbjct: 368 YVIAVRMHGVNVVPSFINAVILLSVLSVGNSAFYSSSRLLHSLAEQNYAPKIFKYIDRAG 427

Query: 417 RPVLCLLVSCVFGLLSFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQ 476
           RP++ +++S +FG + FVAASPKEE VF WLLAISGLS+LFTW +I LSH+R RRA+ VQ
Sbjct: 428 RPLMAMIISILFGTICFVAASPKEEEVFKWLLAISGLSQLFTWSTICLSHIRFRRALAVQ 487

Query: 477 GRSADELGYVAWTGVWGAYYAMAMIVAILVGQFWVAISPVGSNKLDANNFFENYLAMPIL 536
           G S DELG+ A TG+ G+Y +  M+V  L+GQFWV++ P+G+ + DA +FF  YLAMP+ 
Sbjct: 488 GYSTDELGFKAQTGIIGSYVSAIMMVLALIGQFWVSLVPMGATEPDAESFFTGYLAMPMF 547

Query: 537 IFLYLGYKIWTRDWRLLIPSSEVDLVAHRKIFDAEVLRHEQLEEKEQLRHAPWTTRLANF 596
           +  Y GYKIW +DWRL I + ++DLV+HR+IFDA+VL+ E +E + +LR++    R+ANF
Sbjct: 548 LLFYFGYKIWNKDWRLFIRADQIDLVSHRRIFDADVLKQEDIEYRAKLRNSSIWHRIANF 607

Query: 597 WC 598
           WC
Sbjct: 608 WC 609

>KNAG0C00590 Chr3 complement(100801..102705) [1905 bp, 634 aa] {ON}
           Anc_1.50 YDR508C
          Length = 634

 Score =  597 bits (1538), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/612 (49%), Positives = 404/612 (66%), Gaps = 20/612 (3%)

Query: 7   HNMKSPDNGVVESFDSVEVLKEESPR-------SDSRS-------DGLFRRFADSFRRHE 52
           +N+ +     +E F++++     + R       +DS S        G FR F DSF+  E
Sbjct: 23  YNVSTEQENEIEYFETLKGKNAATTREEEYDFTTDSTSGRKRHGVKGYFRDFIDSFKPAE 82

Query: 53  AHNXXXXXXXXXXXXXLTPIESASKHK-----TLKQNIRPRHVLMISLATGIGTGMLVGN 107
                              IE   K +      LK+ I+PRHV++ISL TGIGTG+LVGN
Sbjct: 83  NPQPHTNLDMELVGVTSETIEQHKKDEGDTGDKLKKTIQPRHVILISLGTGIGTGLLVGN 142

Query: 108 GKSLHNGGPASLVIGYAIVSSMLYCVIQSASELAIIYTSLAGGFNAYPSLLVDKAFGFSV 167
           G +L   GPA LVIGY I+ S++YC+IQ+  E+A+ Y +L GGFNAYP+ L+D  F F+ 
Sbjct: 143 GATLAQAGPAGLVIGYGIMGSLIYCIIQACGEMAVNYLTLVGGFNAYPTFLIDPGFSFAT 202

Query: 168 SWVYCLQWLCVLPLELVTASMTIKYWNQTINPDAFVTIFYVVLVAINXXXXXX-XXXXXX 226
           +WVYCLQWLCV PLELVTASMTIKYW   ++PD FV IFYV ++ IN             
Sbjct: 203 AWVYCLQWLCVCPLELVTASMTIKYWTTKVDPDVFVIIFYVFILGINILGGARGYAEAEF 262

Query: 227 XXNCCKVLMXXXXXXXXXXXNCGGAGNDGYLGARYWHDPGAFRGSDSINRFKGIVAVLVN 286
             N CK+LM            CGGAG DGY+G RYWHDPGAFRG  +++RFKG+VA LV 
Sbjct: 263 IFNSCKILMMIGFFILGIIIICGGAGTDGYIGGRYWHDPGAFRGERAVDRFKGVVATLVT 322

Query: 287 AAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRILGIYIMTAILLGFLVPWNSDELLG 346
           AAF++G +EF  +TA+EQ NP+++I SA+KK++YR L IY+ + ILLGFLVP+NS +LLG
Sbjct: 323 AAFSFGQSEFIAVTASEQSNPRRAIPSAAKKIIYRALCIYLASIILLGFLVPYNSSQLLG 382

Query: 347 SGGSATHASPFVIAVASHGVRVVPHFXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAP 406
           +  +   ASP+V+AVA+HGVRVVPHF                            +QGFAP
Sbjct: 383 AQSNGIKASPYVLAVANHGVRVVPHFINAVIIISVLSVSNSAFYSSPRMLLTLSQQGFAP 442

Query: 407 RFLNYVDRCGRPVLCLLVSCVFGLLSFVAASPKEETVFTWLLAISGLSELFTWFSISLSH 466
           +  +YVDR GRP + ++V+ +F +++F A SPKE+ VFTWLLA+SGLS++FTW SI LSH
Sbjct: 443 KIFSYVDRAGRPTMGIIVASLFAVIAFCATSPKEDQVFTWLLAVSGLSQIFTWMSICLSH 502

Query: 467 VRLRRAMTVQGRSADELGYVAWTGVWGAYYAMAMIVAILVGQFWVAISPVGSNKLDANNF 526
           +R RRAMTVQGRS  E G+++  G++G+ Y+  ++  ILVGQFWVA+ PVGS K+DAN+F
Sbjct: 503 LRFRRAMTVQGRSLGECGFLSQVGIYGSAYSFFVLALILVGQFWVALKPVGSKKVDANSF 562

Query: 527 FENYLAMPILIFLYLGYKIWTRDWRLLIPSSEVDLVAHRKIFDAEVLRHEQLEEKEQLRH 586
           FENYLA PI I LY+GYK +T+DWRL I S ++DLVAHR+I+D ++LR E+ EE E+L++
Sbjct: 563 FENYLAAPIWIALYIGYKCYTKDWRLYIKSQDIDLVAHRQIYDEDILRQEREEETERLKN 622

Query: 587 APWTTRLANFWC 598
            P+  R  +FWC
Sbjct: 623 GPYWKRAYSFWC 634

>KAFR0D04130 Chr4 (818573..820507) [1935 bp, 644 aa] {ON} 
          Length = 644

 Score =  597 bits (1538), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/568 (51%), Positives = 385/568 (67%), Gaps = 11/568 (1%)

Query: 42  RRFADSFRRHEAHNXXXXXXXXXXXXXLTPIESASKHKT-----------LKQNIRPRHV 90
           +RF DSF+R E                L+P+ +A K              L+++I+PRHV
Sbjct: 77  KRFIDSFKRAEEGTEETKHMETELTTTLSPLSAAIKEHDVAITSKEEDAHLRKSIQPRHV 136

Query: 91  LMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYCVIQSASELAIIYTSLAGG 150
           LM SLATG+GTG+LVGNG +LH  GPA LVIGYAI+ + LYC+IQ+  E+A+ Y++L G 
Sbjct: 137 LMSSLATGVGTGLLVGNGSALHKAGPAGLVIGYAIMGTCLYCIIQACGEMAVSYSNLPGN 196

Query: 151 FNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKYWNQTINPDAFVTIFYVVL 210
           FNAYP+ LVD+ FGF+V+WVYC+QWLCV+PLELVTASMTI YW   +N D FV IFYV++
Sbjct: 197 FNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYWTTKVNNDIFVVIFYVLI 256

Query: 211 VAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGGAGNDGYLGARYWHDPGAFRG 270
           + IN              N CKVLM           N GGAG  GY+GA+YWHDPGAFRG
Sbjct: 257 ILINVFGAKGYAEADFFFNTCKVLMITGFFILAIIINAGGAGTSGYIGAKYWHDPGAFRG 316

Query: 271 SDSINRFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRILGIYIMTA 330
             SI+RFK ++A    AAFA+G +EF  + A+EQ NP+++I SA+K ++YRIL I++ + 
Sbjct: 317 DRSIDRFKDVMATFTTAAFAFGASEFIAIGASEQSNPRRAIPSAAKIMIYRILFIFLSSI 376

Query: 331 ILLGFLVPWNSDELLGSGGSATHASPFVIAVASHGVRVVPHFXXXXXXXXXXXXXXXXXX 390
            L+GFLVP++S EL+GSG   T ASP+V+A++SHGVRVVPHF                  
Sbjct: 377 ALVGFLVPYDSSELMGSGSGGTKASPYVLAISSHGVRVVPHFINAVILLAVLSVSNSAFY 436

Query: 391 XXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVSCVFGLLSFVAASPKEETVFTWLLAI 450
                     +QG+AP++ NY+DR GRP   +++S +FG+++F A S KEE VFTWLLAI
Sbjct: 437 SSCRILFSLSQQGYAPQWFNYIDREGRPARAMIISILFGIIAFCACSSKEEEVFTWLLAI 496

Query: 451 SGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYVAWTGVWGAYYAMAMIVAILVGQFW 510
           SGLS++FTW +I LSH+R RRAM VQGRS  ELG+ +  GVWG+ YA  M+   L+ +FW
Sbjct: 497 SGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGFRSQLGVWGSVYAATMLFLALIAEFW 556

Query: 511 VAISPVGSNKLDANNFFENYLAMPILIFLYLGYKIWTRDWRLLIPSSEVDLVAHRKIFDA 570
           V+I+P+G + LDA +FFENYLAMPILI  Y GYKI+ RDW+L I +  +DL+ HR IFDA
Sbjct: 557 VSIAPIGEDHLDAKSFFENYLAMPILIVFYFGYKIYNRDWKLFIRAKNIDLITHRNIFDA 616

Query: 571 EVLRHEQLEEKEQLRHAPWTTRLANFWC 598
           E++R E+ E +EQL++ P   RL +FWC
Sbjct: 617 EIIRQEEEEYREQLKNGPTWKRLVHFWC 644

>SAKL0D02948g Chr4 (243064..244848) [1785 bp, 594 aa] {ON} similar
           to uniprot|P38084 Saccharomyces cerevisiae YBR068C BAP2
           High-affinity leucine permease functions as a
           branched-chain amino acid permease involved in the
           uptake of leucine isoleucine and valine contains 12
           predicted transmembrane domains
          Length = 594

 Score =  593 bits (1529), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/600 (49%), Positives = 380/600 (63%), Gaps = 13/600 (2%)

Query: 2   KDFELHNMKSPDNGVVESFDSVEVLKEESPRSDSRSDGLFRRFADSFRRHEAHNXXXXXX 61
           +D    N KS    V    D+  V  +          G  R F DSF+R E         
Sbjct: 5   EDLSAKNTKSNTIAVEIPIDTESVHSQH---------GFVRNFMDSFKRAEPQGQTIREE 55

Query: 62  XXXX-XXXLTPIESASKHKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLV 120
                   +   +  +  K +KQ ++ RH+ MISL TGIGTG+LV NGK+LH GGP  LV
Sbjct: 56  KLENGLETVRTNDYNATQKKMKQTMKSRHITMISLGTGIGTGLLVANGKALHFGGPGGLV 115

Query: 121 IGYAIVSSMLYCVIQSASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLP 180
           IGY   S+MLYCVIQ+  EL + Y +L G +N+YPS LVD  F F+V+WVY LQW  VLP
Sbjct: 116 IGYVTTSTMLYCVIQACCELGVSYATLPGNYNSYPSFLVDSGFNFAVAWVYGLQWAIVLP 175

Query: 181 LELVTASMTIKYWNQTINPDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXX 240
           LELVT+SMTIKYWN +INPD FV IFY  +V I+              N CKVLM     
Sbjct: 176 LELVTSSMTIKYWNDSINPDVFVAIFYCFIVFIHFFGSQGYAESEFIFNSCKVLMMVGFI 235

Query: 241 XXXXXXNCGGAGNDGYLGARYWHDPGAFRGSDSINRFKGIVAVLVNAAFAYGGAEFSVLT 300
                 NC GA   GY+G +YWH PGAF G  +I+ FKGI +V V +AFAYGG+EF  LT
Sbjct: 236 IMGISVNC-GASKSGYIGGKYWHTPGAFVGEKAIDHFKGICSVWVQSAFAYGGSEFIALT 294

Query: 301 AAEQQNPQKSIRSASKKLVYRILGIYIMTAILLGFLVPWNSDELLGS-GGSATHASPFVI 359
           AAEQ NP+KS+  A+K+ +YR+L +++   IL+GFLVP++S  LLGS G +A+HASPFVI
Sbjct: 295 AAEQTNPRKSVPKATKRWLYRVLIVFLTPIILVGFLVPYDSPLLLGSPGQAASHASPFVI 354

Query: 360 AVASHGVRVVPHFXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPV 419
           A ASHGV+VVPH                             EQG  P+   YVDR GRP+
Sbjct: 355 AAASHGVKVVPHIINAVILISVISVGNSAFYSAPRILLSLAEQGMGPKVFTYVDRKGRPL 414

Query: 420 LCLLVSCVFGLLSFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRS 479
           + +L   +FGL+SFVAAS  EETVFTWL AI  LS+LFTW +ISLSH+R R AM  QGRS
Sbjct: 415 VTMLFVAIFGLISFVAASDNEETVFTWLSAIVSLSQLFTWSAISLSHIRFRDAMKTQGRS 474

Query: 480 ADELGYVAWTGVWGAYYAMAMIVAILVGQFWVAISPVGS-NKLDANNFFENYLAMPILIF 538
             ELGY A TG WG++YA+A  + +L  QFWVAI+P+G+  KLD NNFF+NYLA P+L+F
Sbjct: 475 LGELGYKANTGYWGSWYAIAFNIIVLAAQFWVAIAPIGNGGKLDVNNFFQNYLAFPVLVF 534

Query: 539 LYLGYKIWTRDWRLLIPSSEVDLVAHRKIFDAEVLRHEQLEEKEQLRHAPWTTRLANFWC 598
            Y GYK+W RDW+L IP+ +VDL +HRKIFDA++++ E  E KE++R++ +  R  +FWC
Sbjct: 535 FYFGYKLWYRDWKLFIPADKVDLESHRKIFDADLIKQEDFEHKERIRNSSFWVRALDFWC 594

>KLLA0C01606g Chr3 complement(123485..125347) [1863 bp, 620 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn expression is
           fully dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p-Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 620

 Score =  593 bits (1530), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/602 (49%), Positives = 402/602 (66%), Gaps = 13/602 (2%)

Query: 7   HNMKSPDNGVVESFDSVEVLKEESPRSDSRSD-------GLFRRFADSFRRHEAHNXXXX 59
           HN KS      E F S+E   E   ++ S+SD        ++ RF DSF+R +  N    
Sbjct: 22  HNDKSDTIIQSEGFPSIEGEAEYYEKTFSQSDEEYAAKSSVWHRFKDSFKRADHINTNIH 81

Query: 60  XXXXXXXXXLTPIES--ASKHKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPA 117
                    L P +S    K  +LK++I+PRHV+M+SLATGIGTG+LVGNGK+L  GGPA
Sbjct: 82  GNAELE---LNPSQSLLPEKGASLKRDIKPRHVVMMSLATGIGTGLLVGNGKALATGGPA 138

Query: 118 SLVIGYAIVSSMLYCVIQSASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLC 177
            L IGYAI+ S LY +IQ+A ELA+ Y +L G FN YPS LVD A  F+ + +YC+QWLC
Sbjct: 139 GLTIGYAIMGSCLYSIIQAAGELAVAYPTLTGNFNNYPSFLVDPAMCFATAALYCIQWLC 198

Query: 178 VLPLELVTASMTIKYWNQTINPDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXX 237
           V PLE+++A++TIKYWN +INP+ +  IFYV+++ IN              N CK+LM  
Sbjct: 199 VFPLEVISAAITIKYWNTSINPNVWCVIFYVMIIGINMCGSAGYAEADFFFNTCKILMFA 258

Query: 238 XXXXXXXXXNCGGAGNDGYLGARYWHDPGAFRGSDSINRFKGIVAVLVNAAFAYGGAEFS 297
                    NCGGAG+  Y+G +YW+DPGAF G   I+RFK IV+ LV AAFA+G +E  
Sbjct: 259 GFFILGIIINCGGAGDSVYIGGKYWNDPGAFNGDTGISRFKAIVSTLVTAAFAFGASEAV 318

Query: 298 VLTAAEQQNPQKSIRSASKKLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSATHASPF 357
            LTA+EQ NP+K+I SA+K+++YRI+ IY+ + IL+GFLVP+NS EL+GSG S+ H+SP+
Sbjct: 319 ALTASEQANPRKAIPSAAKQVLYRIIAIYLASIILVGFLVPYNSPELMGSGSSSVHSSPY 378

Query: 358 VIAVASHGVRVVPHFXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGR 417
           VIAVASHGV+VVP F                            E G+AP+F  YVDR GR
Sbjct: 379 VIAVASHGVKVVPSFINAVILISVLSVGNFSFYSSSRILLCLSEIGYAPKFFQYVDRQGR 438

Query: 418 PVLCLLVSCVFGLLSFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQG 477
           P+  ++V  + G + FV+AS  EE+VFTWL+A+SGLS+LFTW +I +SHVR R+AM VQ 
Sbjct: 439 PLYAMIVGALVGCICFVSASSAEESVFTWLMAVSGLSQLFTWTNICISHVRFRKAMQVQN 498

Query: 478 RSADELGYVAWTGVWGAYYAMAMIVAILVGQFWVAISPV-GSNKLDANNFFENYLAMPIL 536
           RS  ELG+ +  GVWG+YY + M++ + +GQFWVA+ PV G++  DA NFF NYLAMP+ 
Sbjct: 499 RSIGELGFRSQVGVWGSYYGIFMMILVFIGQFWVALFPVGGTDGADAENFFANYLAMPVF 558

Query: 537 IFLYLGYKIWTRDWRLLIPSSEVDLVAHRKIFDAEVLRHEQLEEKEQLRHAPWTTRLANF 596
           + LY G+KIW +DWRL IP+SE+DL++HRKIFD E+L+ E  E K +++HA    +L+NF
Sbjct: 559 LALYFGFKIWKKDWRLYIPASEIDLISHRKIFDEEILKQEDEEYKIKMKHASIWVKLSNF 618

Query: 597 WC 598
           WC
Sbjct: 619 WC 620

>Kpol_2002.44 s2002 complement(89144..90370,90372..91028) [1884 bp,
           627 aa] {ON} complement(89144..90370,90372..91028) [1884
           nt, 628 aa]
          Length = 627

 Score =  590 bits (1520), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/618 (48%), Positives = 392/618 (63%), Gaps = 32/618 (5%)

Query: 4   FELHNMKSPD--NGVVESFDS----VEVLK------------EESPRSDSRSDGLFRRFA 45
           +EL ++K PD  N  +   ++    VE +              ESP   ++     RRF 
Sbjct: 19  YELSDVKKPDGKNSYISDLETNDNEVEYISTDLNDKYGSSSINESP---AKKKSNLRRFV 75

Query: 46  DSFRRHEAHNXXXXXXXXXXXXXLTPIESASKHKTLKQNIRPRHVLMISLATGIGTGMLV 105
           DSF+R E H                  E AS    LKQ I+PRHV+MISL TGIGTG+LV
Sbjct: 76  DSFKRAE-HMIPADDKINEMTTAEPEAEMASVEDNLKQTIKPRHVIMISLGTGIGTGLLV 134

Query: 106 GNGKSLHNGGPASLVIGYAIVSSMLYCVIQSASELAIIYTSLAGGFNAYPSLLVDKAFGF 165
           GNG +L   GPA LV GYAI+ + +YC+IQSA E+A++Y+ L GGFNAYP++LV+  F  
Sbjct: 135 GNGSALVKAGPAGLVTGYAIMGTCVYCIIQSAGEMAVVYSKLNGGFNAYPTMLVEPGF-- 192

Query: 166 SVSWVYCLQWLCVLPLELVTASM-----TIKYWNQTINPDAFVTIFYVVLVAINXXXXXX 220
              WV C   +    ++ ++  +       KYW   ++PD FV IFYV+++ IN      
Sbjct: 193 ---WVCCRLGVLFTMVDCLSFGIGYCFDDYKYWTTRVDPDVFVVIFYVLIIVINVFGARG 249

Query: 221 XXXXXXXXNCCKVLMXXXXXXXXXXXNCGGAGNDGYLGARYWHDPGAFRGSDSINRFKGI 280
                   NCCKVLM           N GGAGNDGYLG  YW +PGAFRG   I+ FKG+
Sbjct: 250 YAEAEFFFNCCKVLMMAGFFILGIIINVGGAGNDGYLGNIYWRNPGAFRGDKGIDHFKGV 309

Query: 281 VAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRILGIYIMTAILLGFLVPWN 340
           VA LV AAFA+GG EF  LTAAEQ NP+K+I SA+KK++YRI+ +Y+ + IL+GFLVP+ 
Sbjct: 310 VATLVTAAFAFGGTEFIALTAAEQSNPRKAIPSAAKKVLYRIVLVYLTSIILIGFLVPFT 369

Query: 341 SDELLGSGGSATHASPFVIAVASHGVRVVPHFXXXXXXXXXXXXXXXXXXXXXXXXXXXX 400
           S ELLGSG +AT ASP+VIAVASHGVRVVPHF                            
Sbjct: 370 SPELLGSGSAATAASPYVIAVASHGVRVVPHFINAVILLSVLSVGNSAFYSSSRLLLSLS 429

Query: 401 EQGFAPRFLNYVDRCGRPVLCLLVSCVFGLLSFVAASPKEETVFTWLLAISGLSELFTWF 460
           +QG+AP++ +YVDR GRP   ++VS +FG+++F A SPKE  VFTWLLAISGLS++FTW 
Sbjct: 430 KQGYAPKWFDYVDREGRPSRAMIVSALFGVIAFCATSPKETEVFTWLLAISGLSQIFTWI 489

Query: 461 SISLSHVRLRRAMTVQGRSADELGYVAWTGVWGAYYAMAMIVAILVGQFWVAISPVGSNK 520
           SI LSH+R R AM  QGRS  E+G+ A TG+WG+YY++ +++  L+GQFWVAI+P+G+ +
Sbjct: 490 SICLSHIRFRAAMKAQGRSMGEVGFKAQTGIWGSYYSIFLMILTLIGQFWVAIAPIGTAE 549

Query: 521 LDANNFFENYLAMPILIFLYLGYKIWTRDWRLLIPSSEVDLVAHRKIFDAEVLRHEQLEE 580
           L A NFFENYLAMPILI  Y GYKIW +DW L I + ++DL++HR+IFD E+L+ E  E 
Sbjct: 550 LSARNFFENYLAMPILIGFYFGYKIWKKDWTLYIKAEDIDLISHRQIFDEELLKQEDYEL 609

Query: 581 KEQLRHAPWTTRLANFWC 598
           KE+L++ P   R+  FWC
Sbjct: 610 KEKLKNGPVWRRIVAFWC 627

>NCAS0A00420 Chr1 complement(62649..64688) [2040 bp, 679 aa] {ON}
           Anc_1.50
          Length = 679

 Score =  590 bits (1522), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/643 (46%), Positives = 401/643 (62%), Gaps = 47/643 (7%)

Query: 3   DFELHNMKSPDN-----GVVESFDSVEVLKEESPRSDSRSD------------------G 39
           DFE+ ++K  +       + E  + +E   E+S    S S                    
Sbjct: 37  DFEMKDVKPKEREIGTASITEQENIIEYFGEKSNDDTSSSPVTRQYVSGADFEEHTTKPS 96

Query: 40  LFRRFADSFRRHEAHNXXXXXXXXXXXXXL----------TP----------IESASKHK 79
             R F DSF+R E H              L          TP          I   SK  
Sbjct: 97  RIRNFMDSFKRAEQHPTNVNNNGANSESDLENMILYNEDGTPKPLPHHHDAQINDNSKSD 156

Query: 80  TLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYCVIQSASE 139
            LK+ I+PRHVLMISL TGIGTG+LVG G SL   GPA L+IG+ I+ S LYC+IQ+  E
Sbjct: 157 ELKKTIKPRHVLMISLGTGIGTGLLVGLGSSLVQAGPAGLIIGFGIMGSCLYCIIQAVGE 216

Query: 140 LAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKYWNQTINP 199
           LA+ Y+ L GGFNAYPS LVD+AF F+V+W+Y +QWLCV PLELVTASMTIKYW   ++P
Sbjct: 217 LAVAYSDLVGGFNAYPSFLVDEAFCFAVAWLYAIQWLCVCPLELVTASMTIKYWTTKVDP 276

Query: 200 DAFVTIFYVVLVAINXX-XXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGGAGNDGYLG 258
           D FV IFY++++ IN               N CK++M            CGGAG DGY+G
Sbjct: 277 DIFVIIFYILIIGINLLGGAAGYAEAEFIFNSCKIMMMIGFFILGITVICGGAGTDGYIG 336

Query: 259 ARYWHDPGAFRGSDSINRFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKL 318
           A+YWHDPGA RG  SI RFKG +A LVNAAFA+G +EF  +TA+EQ NP+K+I SA+KK+
Sbjct: 337 AKYWHDPGALRGDTSIQRFKGCMATLVNAAFAFGMSEFIGVTASEQSNPRKAIPSAAKKM 396

Query: 319 VYRILGIYIMTAILLGFLVPWNSDELLGSGGSATHASPFVIAVASHGVRVVPHFXXXXXX 378
           +YRIL +++ +  ++GFLVP+NSD+LLGS GS   ASP+V+A+++HGVRVVPHF      
Sbjct: 397 IYRILCMFLSSITIVGFLVPYNSDQLLGSTGSGVKASPYVLAISTHGVRVVPHFINAVIL 456

Query: 379 XXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVSCVFGLLSFVAASP 438
                                 EQG+AP+  +Y+DR GRP++ +  + +FG+++F A SP
Sbjct: 457 ISVLSVANSAYYSSSRMLLSLAEQGYAPKIYSYIDREGRPLVGMATAAIFGVIAFCATSP 516

Query: 439 KEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYVAWTGVWGAYYAM 498
           KE+ VF WLLAISGLS+LFTW +I +SH+R RRAM VQGRS  ELG+ +  G +G+ YA 
Sbjct: 517 KEDEVFVWLLAISGLSQLFTWMAICISHIRFRRAMHVQGRSIGELGFRSQVGWYGSAYAA 576

Query: 499 AMIVAILVGQFWVAISPVGSN---KLDANNFFENYLAMPILIFLYLGYKIWTRDWRLLIP 555
            M+  IL+ QFWVA+ P+ ++   KLDA NFFENYLAMPIL+  Y GYKIW +DW+L I 
Sbjct: 577 IMMFMILIAQFWVALVPINADLTIKLDAKNFFENYLAMPILLAFYFGYKIWKKDWKLFIR 636

Query: 556 SSEVDLVAHRKIFDAEVLRHEQLEEKEQLRHAPWTTRLANFWC 598
           +  +DL++HR IFD E+++ E+ E +E+LR  P   R+ +FWC
Sbjct: 637 AKNIDLISHRNIFDEELIKQEEDEYRERLRTGPKWRRVYDFWC 679

>Ecym_2664 Chr2 complement(1280994..1282721) [1728 bp, 575 aa] {ON}
           similar to Ashbya gossypii AGR040C
          Length = 575

 Score =  586 bits (1511), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/582 (50%), Positives = 379/582 (65%), Gaps = 22/582 (3%)

Query: 18  ESFDSVEVLKEESPRSDSRSDGLFRRFADSFRRHEAHNXXXXXXXXXXXXXLTPIESASK 77
           ES+D V      +     R  GLFR F DSF++ +  +                 E    
Sbjct: 15  ESYDRVTPAIALNANGGGR--GLFRDFVDSFKKKQDDDVVGYD------------EETGT 60

Query: 78  HKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYCVIQSA 137
              +K+ I+ RH+LMISL TGIGTG+LVGNG +L   GP  L+IGY + S+MLYC+IQ+A
Sbjct: 61  SSKMKKTIKSRHLLMISLGTGIGTGLLVGNGTALAKAGPGGLIIGYGVASAMLYCIIQAA 120

Query: 138 SELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKYWNQTI 197
            EL I Y+ + G + AY SLLVD A GFSVSWVYC+QW+ V PL+LVTA++TIKYW  T 
Sbjct: 121 GELGICYSGMTGNYTAYSSLLVDPALGFSVSWVYCIQWMTVFPLQLVTAAITIKYWTDT- 179

Query: 198 NPDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGGAGNDGYL 257
           NPD FV I Y ++V IN              N CKVLM           NCGGAGNDGY+
Sbjct: 180 NPDIFVAILYFLIVFINLFGAKGYAEAEFLFNTCKVLMMVGFVILGIIINCGGAGNDGYI 239

Query: 258 GARYWHDPGAFRGSDSINRFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKK 317
           GARYWH PGAF        FKG+  V   AAFAYGG E  VLTA+EQ+NP+KSI SA KK
Sbjct: 240 GARYWHTPGAFS-----TGFKGVCYVFCYAAFAYGGIEVMVLTASEQENPRKSIPSACKK 294

Query: 318 LVYRILGIYIMTAILLGFLVPWNSDELLGSGGSATHASPFVIAVASHGVRVVPHFXXXXX 377
           ++YRIL IY++T +++ FLVP+++ EL  S GSA+ ASPFVIA+ASHG+ VVPH      
Sbjct: 295 VIYRILLIYMLTTLIVCFLVPYDAPELT-STGSASRASPFVIAIASHGISVVPHIINAVI 353

Query: 378 XXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVSCVFGLLSFVAAS 437
                                  EQG+AP+  NYVDR GRP+LC LV+   GLL+F+AAS
Sbjct: 354 LVAVVSVGNSSLYSAPRLLLSLSEQGYAPKVFNYVDRQGRPLLCFLVAMFVGLLAFIAAS 413

Query: 438 PKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYVAWTGVWGAYYA 497
             EE VF+WLLAISGLS+LF W SI LSHVR R AM  QGRS  E+GY + TG WG+++A
Sbjct: 414 DAEEDVFSWLLAISGLSQLFIWISICLSHVRFRDAMKAQGRSLGEVGYKSQTGYWGSWFA 473

Query: 498 MAMIVAILVGQFWVAISPVGS-NKLDANNFFENYLAMPILIFLYLGYKIWTRDWRLLIPS 556
           + + + +LV QFWVAI+P+G+  KL A +FF++YLA P+LIF+Y GYKI+ +DWRL IP+
Sbjct: 474 IIVSLFVLVAQFWVAIAPIGNGGKLSAKDFFQSYLAAPVLIFIYFGYKIYYKDWRLCIPA 533

Query: 557 SEVDLVAHRKIFDAEVLRHEQLEEKEQLRHAPWTTRLANFWC 598
           +EVDL +HRKIFD + L+ E L+ KE++R A    ++ +FWC
Sbjct: 534 TEVDLNSHRKIFDEDELKQEDLDWKEKMRTASIWVKIYHFWC 575

>TBLA0A05190 Chr1 complement(1271605..1273608) [2004 bp, 667 aa]
           {ON} Anc_1.50 YDR508C
          Length = 667

 Score =  589 bits (1518), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/528 (52%), Positives = 361/528 (68%)

Query: 71  PIESASKHKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSML 130
           P+E   ++  LKQ I+PRHV+M+SL TGIGTG+LVGNG  L   GPA LVIGY I+ + L
Sbjct: 140 PVEQQDENAQLKQTIKPRHVIMMSLGTGIGTGLLVGNGTPLAQAGPAPLVIGYGIMGTCL 199

Query: 131 YCVIQSASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTI 190
           YC+IQ+  ELA+ Y+ + G FN +PS LVD  F F+V+WVYC+QWLCV PLELVT+SMTI
Sbjct: 200 YCIIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTSSMTI 259

Query: 191 KYWNQTINPDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGG 250
           KYW   ++PD FV IFYV+++ IN              NCCKV+M           N G 
Sbjct: 260 KYWTTKVDPDVFVVIFYVLILLINFFGAKGYAEAEFFFNCCKVMMMIGFFIMAICINTGA 319

Query: 251 AGNDGYLGARYWHDPGAFRGSDSINRFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNPQKS 310
           AG DGY+GA+YW+DPGAFRG   I RFKG++   V AAFA+G  EF  LTAAEQ NP+K+
Sbjct: 320 AGTDGYIGAKYWNDPGAFRGQTKIERFKGVMDTFVTAAFAFGATEFIALTAAEQSNPRKA 379

Query: 311 IRSASKKLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSATHASPFVIAVASHGVRVVP 370
           I SA+KK+ YRIL I++ + IL+GFLVP+NSD+L+GS      ASP+V+A + HGV VV 
Sbjct: 380 IPSAAKKVAYRILLIFLTSIILIGFLVPYNSDQLMGSSSGGNSASPYVLAASLHGVHVVQ 439

Query: 371 HFXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVSCVFGL 430
           HF                            + G+AP++ +YVDR GRP+  +L + +  +
Sbjct: 440 HFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSMLCAAIIAV 499

Query: 431 LSFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYVAWTG 490
           ++F A SPKE  VFTWLLAISGLS++FTWF+I +SH+R RR M VQGRS  ELG+ A TG
Sbjct: 500 IAFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGELGFRAQTG 559

Query: 491 VWGAYYAMAMIVAILVGQFWVAISPVGSNKLDANNFFENYLAMPILIFLYLGYKIWTRDW 550
           V G+YYA  M+   LV QFWVA+ P+ ++ LDA NFF+NYLAMPIL+ LY+G+K+W RD+
Sbjct: 560 VLGSYYAAIMLFLALVAQFWVALVPMNTHTLDAENFFQNYLAMPILLALYVGFKLWRRDF 619

Query: 551 RLLIPSSEVDLVAHRKIFDAEVLRHEQLEEKEQLRHAPWTTRLANFWC 598
           RL I +  +DL++HR IFD E+LR E  E KE+LR+ P   R+ +FWC
Sbjct: 620 RLFIRAKNIDLISHRIIFDEELLRQEDEEYKEKLRNGPKWKRVVDFWC 667

>KAFR0D00520 Chr4 complement(82977..84773) [1797 bp, 598 aa] {ON}
           Anc_1.50 YDR508C
          Length = 598

 Score =  587 bits (1512), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/589 (47%), Positives = 388/589 (65%), Gaps = 3/589 (0%)

Query: 13  DNGVVESFDSVEVLKEESPRSDSRSDGL--FRRFADSFRRHEAHNXXXXXXXXXXXXXLT 70
            +G+  S +   ++  E+  ++S S  +   + F DSF++ + +N              +
Sbjct: 10  KDGLHLSVNKNVIVTNENQINESHSKLIENLKDFVDSFKKIDDNNNQYEIEKNEINNIKS 69

Query: 71  PIESASKHKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSML 130
              +   +  L++ I+PRHV+MISL TGIGTG+LVGNG +LHN GPA L+IGY I++S +
Sbjct: 70  DQFNDKLNNQLQKTIQPRHVIMISLGTGIGTGLLVGNGATLHNAGPAGLLIGYIIMASCI 129

Query: 131 YCVIQSASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTI 190
           YC+IQ+  E+A+ Y +L GGFN YPS LVD A+ F+V+WVYC+QWLCV PLELVTASMTI
Sbjct: 130 YCIIQACGEMAVNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASMTI 189

Query: 191 KYWNQTINPDAFVTIFYVVLVAINXXXXXX-XXXXXXXXNCCKVLMXXXXXXXXXXXNCG 249
           KYWN+ ++PD FVTIFY++++AIN               N CK+LM            CG
Sbjct: 190 KYWNEKVDPDVFVTIFYLLIIAINLFGGARGYAEAEFFFNLCKILMIAGFFILGIILICG 249

Query: 250 GAGNDGYLGARYWHDPGAFRGSDSINRFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNPQK 309
           GAG  GY+G  YW++PGAFRG     RFKGIV+ LV AAF++G  EF  +TA+EQ NP+K
Sbjct: 250 GAGTSGYIGVSYWNNPGAFRGHTPGTRFKGIVSTLVTAAFSFGQTEFLAITASEQSNPRK 309

Query: 310 SIRSASKKLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSATHASPFVIAVASHGVRVV 369
           +I SA+KK++YR L IY+ + I++GFLVP+NS ELLGS  S T ASP+VIAVASHG+R+ 
Sbjct: 310 AIPSAAKKVIYRALFIYVGSIIIVGFLVPYNSPELLGSKSSQTKASPYVIAVASHGIRIA 369

Query: 370 PHFXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVSCVFG 429
           PHF                            +QG+AP+   Y+DR GRP+  ++ + +  
Sbjct: 370 PHFINAVILISVLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASLLA 429

Query: 430 LLSFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYVAWT 489
            ++F A+SPKE  VF+WLLAISGLS++FTW +I LSH+R RRAM +QGRS +ELGY +  
Sbjct: 430 TIAFCASSPKETEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELGYKSQV 489

Query: 490 GVWGAYYAMAMIVAILVGQFWVAISPVGSNKLDANNFFENYLAMPILIFLYLGYKIWTRD 549
           GVWG+ YA  ++  IL+GQFWVA+ P+ SN  +  NFF+ YLAMPIL+  Y GYK W +D
Sbjct: 490 GVWGSIYAATVMFLILIGQFWVALWPLNSNGANITNFFKEYLAMPILLLFYFGYKTWKKD 549

Query: 550 WRLLIPSSEVDLVAHRKIFDAEVLRHEQLEEKEQLRHAPWTTRLANFWC 598
           W L I + ++DL++HR I+D +VL+ E+ + KE L++     ++  FWC
Sbjct: 550 WNLFIRAKDIDLISHRHIYDEDVLKQEKNQYKENLKNGSLWLKIYAFWC 598

>NDAI0F04390 Chr6 (1073373..1075376) [2004 bp, 667 aa] {ON} Anc_1.50
          Length = 667

 Score =  588 bits (1517), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/612 (48%), Positives = 400/612 (65%), Gaps = 22/612 (3%)

Query: 6   LHNMKSPDNGVVESFDSVEVLKEESPRSDSRSDGLFRRFADSFRRHEAHNXXXXXXXXXX 65
             N K  + G+    DS      +  ++ ++     R F DSF+  E  N          
Sbjct: 59  FENTKIQEGGID---DSTITQTNDYEQNITKPTSRVRNFIDSFKPAEVKNSPEKDTASIT 115

Query: 66  XXXLT------------------PIESASKHKTLKQNIRPRHVLMISLATGIGTGMLVGN 107
              +                   P +  +K   LK+ I+PRHVLMISL TGIGTG+LVG 
Sbjct: 116 SNEMMIDEEILSLSNLDGQRVPPPRKIENKSDELKKTIKPRHVLMISLGTGIGTGLLVGL 175

Query: 108 GKSLHNGGPASLVIGYAIVSSMLYCVIQSASELAIIYTSLAGGFNAYPSLLVDKAFGFSV 167
           G SL   GPA L++G+ I+ + LYC+IQ+  E+A+ Y+ L GGFNAYPS LVD AFGFSV
Sbjct: 176 GSSLVAAGPAGLLLGFGIMGTCLYCIIQAVGEMAVAYSDLVGGFNAYPSFLVDPAFGFSV 235

Query: 168 SWVYCLQWLCVLPLELVTASMTIKYWNQTINPDAFVTIFYVVLVAINXXXXXX-XXXXXX 226
           +WVY LQWLCV PLELVTASMTIKYW   ++PD FV IFYV+++AIN             
Sbjct: 236 AWVYALQWLCVCPLELVTASMTIKYWTTKVDPDVFVIIFYVLILAINIVGGAAGYAEAEF 295

Query: 227 XXNCCKVLMXXXXXXXXXXXNCGGAGNDGYLGARYWHDPGAFRGSDSINRFKGIVAVLVN 286
             N CK+LM            CGGAGNDGY+G +YWH+PGAFRG  +I+RFKG++A LVN
Sbjct: 296 IFNSCKILMMIGFFILGIIIICGGAGNDGYIGGKYWHEPGAFRGEHAIDRFKGVMATLVN 355

Query: 287 AAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRILGIYIMTAILLGFLVPWNSDELLG 346
           AAFA+G +EF  +TA+EQ NP+K+I SA+KK++YRI+ +++ +  ++GFLVP++SD+LLG
Sbjct: 356 AAFAFGMSEFIGVTASEQSNPRKAIPSAAKKMLYRIVCMFLASITIVGFLVPYDSDQLLG 415

Query: 347 SGGSATHASPFVIAVASHGVRVVPHFXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAP 406
           S G    ASP+V+AV++HGV+VVPHF                            EQG+AP
Sbjct: 416 SSGGGVKASPYVLAVSTHGVKVVPHFINAVILISVLSVANSAFYSSSRMLLSLAEQGYAP 475

Query: 407 RFLNYVDRCGRPVLCLLVSCVFGLLSFVAASPKEETVFTWLLAISGLSELFTWFSISLSH 466
           +   Y+DR GRP++ + ++ +FG+++F A SPKE+ VF WLLAISGLS+LFTW +I +SH
Sbjct: 476 KIFCYIDREGRPLVGMAMASLFGVIAFCATSPKEDEVFVWLLAISGLSQLFTWIAICVSH 535

Query: 467 VRLRRAMTVQGRSADELGYVAWTGVWGAYYAMAMIVAILVGQFWVAISPVGSNKLDANNF 526
           VR RRAM VQG+S  ELG+ +  G WG+ YA  M+V IL+ QFWVAI+P+G  KLDA NF
Sbjct: 536 VRFRRAMHVQGKSIGELGFRSQVGAWGSSYAAIMMVCILIAQFWVAIAPIGEGKLDAKNF 595

Query: 527 FENYLAMPILIFLYLGYKIWTRDWRLLIPSSEVDLVAHRKIFDAEVLRHEQLEEKEQLRH 586
           FENYLAMPIL+ LY GYKI+T++W + I + ++DLV+HR IFD E+++ E+ E +E+LR+
Sbjct: 596 FENYLAMPILLALYFGYKIYTKNWTIFIRAKDIDLVSHRNIFDEEIIKQEEEEYREKLRN 655

Query: 587 APWTTRLANFWC 598
            P   R+ +FWC
Sbjct: 656 GPMWRRVYDFWC 667

>KNAG0F00270 Chr6 complement(27784..29688) [1905 bp, 634 aa] {ON}
           Anc_1.50 YDR508C
          Length = 634

 Score =  585 bits (1509), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/575 (49%), Positives = 380/575 (66%), Gaps = 8/575 (1%)

Query: 24  EVLKEES-PRSDSRSDGLFRRFADSFRRHEAHNXXXXXXXXXXXXXLTPIESASKHKTLK 82
           E  +EE+   SD  S   F +F DSF+R +                    E   ++  LK
Sbjct: 66  EKTQEETIHNSDGSSRSPFGKFVDSFKRVDEKQTTSDLESGLG-------EVPGENSDLK 118

Query: 83  QNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYCVIQSASELAI 142
           Q I+ RHVL+ISL TGIGTG+LVGN K L + GP  LVIGY+I+ S LYC+IQ+  ELA+
Sbjct: 119 QTIKKRHVLLISLGTGIGTGLLVGNAKVLRDAGPGGLVIGYSIMGSCLYCIIQACGELAV 178

Query: 143 IYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKYWNQTINPDAF 202
            Y+SL   FN YP+ LVDKAFGF+V+WVYCLQWLCV PLELVTASMTIKYW  ++NPD F
Sbjct: 179 CYSSLPSNFNIYPTFLVDKAFGFAVAWVYCLQWLCVCPLELVTASMTIKYWTTSVNPDIF 238

Query: 203 VTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGGAGNDGYLGARYW 262
           V+IF+V+++ IN              N CKVLM            CGGAG  GY+GA+YW
Sbjct: 239 VSIFFVLIIVINTFGARGYAEAEFFFNSCKVLMMAGFFILGIIITCGGAGTSGYIGAKYW 298

Query: 263 HDPGAFRGSDSINRFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRI 322
           H PGAF G+  I+ FKG++A    AAFA+G +EF  LTAAEQ NP+K+I  A+K ++YRI
Sbjct: 299 HSPGAFNGNRPIDHFKGVMATFTTAAFAFGASEFISLTAAEQSNPRKAIPKAAKMMIYRI 358

Query: 323 LGIYIMTAILLGFLVPWNSDELLGSGGSATHASPFVIAVASHGVRVVPHFXXXXXXXXXX 382
           L +++ +  L+GFLVP+NS  LLGSG  AT ASP+V+AVASHGVRVVPHF          
Sbjct: 359 LFVFLSSITLIGFLVPYNSPYLLGSGSDATKASPYVVAVASHGVRVVPHFINAVILLSVL 418

Query: 383 XXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVSCVFGLLSFVAASPKEET 442
                             +QG+AP+   Y+D+ GRP++ ++ S +F  ++F AASPKEE 
Sbjct: 419 SVGNSAFYSSSRLLNSLAQQGYAPKMFTYIDKRGRPLVAMVCSTLFMTIAFCAASPKEEQ 478

Query: 443 VFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYVAWTGVWGAYYAMAMIV 502
           VFTWLLAISGLS+LFTW +I +SH+R RRA+ VQG S  E+G+ +  G++G+ YA  M++
Sbjct: 479 VFTWLLAISGLSQLFTWVAICISHLRFRRALKVQGHSLGEIGFKSQVGIYGSLYAATMLI 538

Query: 503 AILVGQFWVAISPVGSNKLDANNFFENYLAMPILIFLYLGYKIWTRDWRLLIPSSEVDLV 562
             L+ QFWVA++P+G N LDA NFF+NYLAMPIL+ LY GYKI  RDW+  IP+  +DLV
Sbjct: 539 LALIAQFWVALAPIGGNGLDARNFFQNYLAMPILLVLYFGYKIRKRDWKFWIPAHRIDLV 598

Query: 563 AHRKIFDAEVLRHEQLEEKEQLRHAPWTTRLANFW 597
           +HRK+FD ++L+ E  E +++ ++     ++  F+
Sbjct: 599 SHRKVFDEDILKQEVAEIEQEKKNLSTGRKIQEFF 633

>SAKL0D02926g Chr4 (240708..242459) [1752 bp, 583 aa] {ON}
           uniprot|Q875S6 Saccharomyces kluyveri TAT1
          Length = 583

 Score =  580 bits (1495), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/593 (49%), Positives = 382/593 (64%), Gaps = 20/593 (3%)

Query: 11  SPDNGVVESFDSVEVLKEESPRSDSRS--DGLFRRFADSFRRH-EAHNXXXXXXXXXXXX 67
           S  N   E   +  +++  SP S   S   G   RF +SFRR  E+ +            
Sbjct: 6   STANSKKEEESTYAIIQTSSPCSKKYSYISGQVNRFINSFRRKGESEDVKELKGEN---- 61

Query: 68  XLTPIESASKHKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVS 127
                E       +K++I+ RH+LMISL TGIGTG+LVGNGK+L   GPA LVIGYA+ S
Sbjct: 62  -----EECGAATKMKKSIKSRHLLMISLGTGIGTGLLVGNGKALAKAGPAGLVIGYAVAS 116

Query: 128 SMLYCVIQSASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTAS 187
            MLYC+IQ+A EL I Y+ +AG + AY SLLVD A GFSVSWVYC+QW+ VLPL+LVTA+
Sbjct: 117 IMLYCIIQAAGELGICYSGMAGNYTAYSSLLVDPALGFSVSWVYCVQWMTVLPLQLVTAA 176

Query: 188 MTIKYWNQTINPDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXN 247
           MT++YW    NPD FV +F+VV++ IN              N CKVLM           N
Sbjct: 177 MTVRYWTNA-NPDIFVAVFFVVIMVINMFGAKGYAEAEFLFNICKVLMIAGFVILGIAIN 235

Query: 248 CGGAGNDGYLGARYWHDPGAFRGSDSINRFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNP 307
           CGGAG  GY+GA+YWH PG+F        FKG+  V   AAF+YGG E  VLTA+EQ+NP
Sbjct: 236 CGGAGTSGYIGAKYWHSPGSFAAG-----FKGVCYVFCYAAFSYGGIEVMVLTASEQENP 290

Query: 308 QKSIRSASKKLVYRILGIYIMTAILLGFLVPWNSDELLGSGG-SATHASPFVIAVASHGV 366
           +KSI +A KK++YRIL IY++T I++ FLVP+NS EL+GS G SA+HASP VIAVASHGV
Sbjct: 291 RKSIPNACKKVIYRILMIYMLTTIIVCFLVPYNSSELMGSSGESASHASPLVIAVASHGV 350

Query: 367 RVVPHFXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVSC 426
           ++VPH                             EQG+AP+FLNYVDR GRP++C  ++ 
Sbjct: 351 KIVPHIINAVILISVISVGNSSMYSAPRLLLSLSEQGYAPKFLNYVDRQGRPLICFAITL 410

Query: 427 VFGLLSFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYV 486
           +  L++FVAAS  EE +F WLLAISGLS++F W SI LSHVR R AM  QG S  ++GY 
Sbjct: 411 LVALIAFVAASDAEEDIFAWLLAISGLSQIFIWTSICLSHVRFRDAMHAQGLSLGQIGYK 470

Query: 487 AWTGVWGAYYAMAMIVAILVGQFWVAISPVGSN-KLDANNFFENYLAMPILIFLYLGYKI 545
           + TG WG+++A+ + V +L+ QFWVAI+P+G   +L+A  FF+NYLA PIL+  Y GYK+
Sbjct: 471 SQTGYWGSWFAIVISVLVLIAQFWVAIAPIGEEGRLNAETFFQNYLAFPILLGAYFGYKV 530

Query: 546 WTRDWRLLIPSSEVDLVAHRKIFDAEVLRHEQLEEKEQLRHAPWTTRLANFWC 598
           + +DWRL IP+SEVDL +HR I D E+LR E  E  E++ ++    RL +FWC
Sbjct: 531 YHKDWRLCIPASEVDLSSHRNISDEEILRQEDYEWNEKMSNSSIWVRLCHFWC 583

>Suva_4.307 Chr4 complement(540768..542597) [1830 bp, 609 aa] {ON}
           YDR046C (REAL)
          Length = 609

 Score =  579 bits (1493), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/594 (47%), Positives = 378/594 (63%), Gaps = 6/594 (1%)

Query: 11  SPDNGVVESFDSVEVLKEESPRSD-----SRSDGLFRRFADSFRRHEAHNXXXXXXXXXX 65
           SPD+  + SF +V  L+  S   +     +R++ L  RF DSF+R E             
Sbjct: 16  SPDSISIRSFSAVNNLQSSSSEKNYSGQTTRNNKLIHRFVDSFKRAEGSTTHTKQINENT 75

Query: 66  XXXLTPIESASKHKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAI 125
                 + S +    LK++++ RHV+M++L TGIGTG+LV N K LH GGPA+LVIGY +
Sbjct: 76  SDLEGDVNSFTSDSKLKKSMKSRHVVMMTLGTGIGTGLLVANAKGLHYGGPAALVIGYFL 135

Query: 126 VSSMLYCVIQSASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVT 185
           VS + Y +IQ+A E+A+ Y +L   FNAY S+ + K FGF+  WVYC QWL VLPLEL+T
Sbjct: 136 VSFVTYFMIQAAGEMAVTYPTLPANFNAYSSIFISKPFGFATVWVYCFQWLTVLPLELIT 195

Query: 186 ASMTIKYWNQTINPDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXX 245
           A+MTIK+WN TINPD F+ IF+V L+ I+              NCCK+LM          
Sbjct: 196 AAMTIKFWNDTINPDIFILIFFVFLLFIHFFGVKGYGETEFIFNCCKILMIAGFIILSVV 255

Query: 246 XNCGGAGNDGYLGARYWHDPGAFRGSDSINRFKGIVAVLVNAAFAYGGAEFSVLTAAEQQ 305
            NCGGAGNDGY+G +YW +PGAF G  S  RFK +  +LV A F++GG E   L+  EQ 
Sbjct: 256 INCGGAGNDGYIGGKYWRNPGAFAGDTSAGRFKNVCYILVTAYFSFGGMELFALSVQEQA 315

Query: 306 NPQKSIRSASKKLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSATHASPFVIAVASHG 365
           NP+K+   A+K+ +YRIL IY++T IL+GF VP+N D+L+G+GGSATHASP+V+A + HG
Sbjct: 316 NPRKTTPVAAKRSIYRILVIYLLTMILIGFNVPYNDDQLMGAGGSATHASPYVLAASIHG 375

Query: 366 VRVVPHFXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVS 425
           V+VVPH                             +QG+ P+FL+YVDR GRP++ L+V 
Sbjct: 376 VKVVPHIINAVILISVISVANSSLYAGPRLMCSLAQQGYGPKFLDYVDREGRPLIALIVC 435

Query: 426 CVFGLLSFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGY 485
            VFG++ FVAAS KEE VF WL AI+GLSELFTW SI LSH+R R+AM VQGRS DELGY
Sbjct: 436 SVFGVIGFVAASSKEEVVFAWLAAIAGLSELFTWTSIMLSHLRFRQAMKVQGRSLDELGY 495

Query: 486 VAWTGVWGAYYAMAMIVAILVGQFWVAISPVGS-NKLDANNFFENYLAMPILIFLYLGYK 544
            A TG+WG+ Y +   + + + QFWVA++P+ +  K  A +FF++YLA PI I  YLGY 
Sbjct: 496 KATTGIWGSAYGVFFNILVFIAQFWVALAPLNNGGKCSAESFFQSYLAFPIWIAFYLGYM 555

Query: 545 IWTRDWRLLIPSSEVDLVAHRKIFDAEVLRHEQLEEKEQLRHAPWTTRLANFWC 598
           I+ RD+  L P  ++DL  HR I+D E++R E LE +E+ R      +  +FWC
Sbjct: 556 IYNRDFTFLNPLDKIDLDFHRHIYDPELMRQEDLENEERKRDMSLMRKTYHFWC 609

>Smik_2.201 Chr2 complement(355785..357614) [1830 bp, 609 aa] {ON}
           YBR068C (REAL)
          Length = 609

 Score =  579 bits (1492), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 275/576 (47%), Positives = 375/576 (65%), Gaps = 5/576 (0%)

Query: 24  EVLKEESPRSDSRSDGLFRRFADSFRRHEAHNXXXXXXXXXXXXXLTPIESASKHKTLKQ 83
           ++  E+ P+ +     L  RF DSF+R E                   I+S +    LK+
Sbjct: 38  KIYSEQKPKRNR----LIHRFTDSFKRAEGSTTKIKPINENTSDLEDGIQSFTSDSKLKK 93

Query: 84  NIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYCVIQSASELAII 143
           +++ RHV+M+SL TGIGTG+LV N K LH GGPA+LVIGY +VS + Y +IQ+A E+A+ 
Sbjct: 94  SMKSRHVVMMSLGTGIGTGLLVANAKGLHYGGPAALVIGYVLVSFITYFMIQAAGEMAVT 153

Query: 144 YTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKYWNQTINPDAFV 203
           Y +L   FNAY S+ + K FGF+  W+YC QW  VLPLEL+TASMTI++WN  INPD ++
Sbjct: 154 YPTLPANFNAYSSIFISKPFGFATVWLYCFQWTTVLPLELITASMTIQFWNDKINPDIYI 213

Query: 204 TIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGGAGNDGYLGARYWH 263
            IFYV L+ ++              NCCK+LM           NCGGAGNDGY+G  YWH
Sbjct: 214 LIFYVFLLFVHFFGVKAYGETEFIFNCCKILMIAGFIVLSVVINCGGAGNDGYIGGAYWH 273

Query: 264 DPGAFRGSDSINRFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRIL 323
            PGAF G  SI RFK +  +LV A F++GG E  VL+  EQ NP+KS   A+K+ +YRI+
Sbjct: 274 KPGAFAGDTSIARFKNVCYILVTAYFSFGGMELFVLSVQEQTNPRKSTPVAAKRSIYRIV 333

Query: 324 GIYIMTAILLGFLVPWNSDELLGSGGSATHASPFVIAVASHGVRVVPHFXXXXXXXXXXX 383
            IY++T IL+GF VP+N D+LLG+GGSATHASP+V+A + HGVR+VPH            
Sbjct: 334 VIYLLTMILIGFNVPYNDDQLLGAGGSATHASPYVLAASIHGVRIVPHIINAVILISVVS 393

Query: 384 XXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVSCVFGLLSFVAASPKEETV 443
                            +QG+AP+FL+YVDR GRP+  L+V CV G+++FVAAS KEE V
Sbjct: 394 VANSSLYAGPRLICSLAQQGYAPKFLDYVDREGRPLRALIVCCVIGVIAFVAASSKEEIV 453

Query: 444 FTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYVAWTGVWGAYYAMAMIVA 503
           FTWL AI+GLSELFTW SI LSH+R R+AM VQGRS +ELGY A TG+WG+ Y     + 
Sbjct: 454 FTWLAAIAGLSELFTWTSIMLSHLRFRQAMKVQGRSLNELGYKATTGIWGSIYGSFFNIL 513

Query: 504 ILVGQFWVAISPVGS-NKLDANNFFENYLAMPILIFLYLGYKIWTRDWRLLIPSSEVDLV 562
           + + QFWVA++P+G+  K +A  FFE+YLA PI +  Y+GY I+ RD+ LL P  ++DL 
Sbjct: 514 VFIAQFWVALAPLGNGGKCNAEAFFESYLAAPIWLIFYIGYMIYNRDFTLLNPLDKIDLD 573

Query: 563 AHRKIFDAEVLRHEQLEEKEQLRHAPWTTRLANFWC 598
            HR+++D E++R E  E KE++++  + ++  +FWC
Sbjct: 574 FHRRVYDPELMRQEDEENKEKIKNMSFLSKAHHFWC 609

>AGR039C Chr7 complement(779720..781480) [1761 bp, 586 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR046C
           (BAP3) and YBR068C (BAP2); Tandem gene duplication in
           this genome
          Length = 586

 Score =  573 bits (1478), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/558 (51%), Positives = 368/558 (65%), Gaps = 9/558 (1%)

Query: 43  RFADSFRRHEAHNXXXXXXXXXXXXXLTPIESASKHKTLKQNIRPRHVLMISLATGIGTG 102
           RF DSF+R +                          +TLK NI+ RH+ MISL TGIGTG
Sbjct: 36  RFTDSFKRAQVDTAVDLEGKDADNGL------NKTQQTLKHNIKTRHLTMISLGTGIGTG 89

Query: 103 MLVGNGKSLHNGGPASLVIGYAIVSSMLYCVIQSASELAIIYTSLAGGFNAYPSLLVDKA 162
           +LV +GK+LH GGPA LVIGY   S+MLYCV+Q+  EL + Y +L G +NAYP+ LVDK 
Sbjct: 90  LLVASGKALHFGGPAGLVIGYVTTSTMLYCVVQACCELGVAYATLPGNYNAYPTFLVDKG 149

Query: 163 FGFSVSWVYCLQWLCVLPLELVTASMTIKYWNQTINPDAFVTIFYVVLVAINXXXXXXXX 222
           FGF+V+ VY LQW  VLPLELVTASMT+KYW  ++NPD FV IFYV L+ I+        
Sbjct: 150 FGFAVALVYGLQWATVLPLELVTASMTVKYWTSSVNPDVFVAIFYVFLLFIHFFGSRGYA 209

Query: 223 XXXXXXNCCKVLMXXXXXXXXXXXNCGGAGNDGYLGARYWHDPGAFRGSDSINRFKGIVA 282
                 N  KVL+              GA   GY+G +YWHDPGAF G  +I+RFKGI +
Sbjct: 210 EAEFIFNSLKVLLMAGFIIMAISLTA-GASEQGYIGGQYWHDPGAFGGDRAIDRFKGICS 268

Query: 283 VLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRILGIYIMTAILLGFLVPWNSD 342
           V V AAFAYGG+EF  LTAAEQ NP++S+  A+K+ +YR++ ++++  IL+GFLVP NSD
Sbjct: 269 VWVQAAFAYGGSEFIALTAAEQANPRESVPKATKRWLYRVVVVFLLPVILIGFLVPHNSD 328

Query: 343 ELLGS-GGSATHASPFVIAVASHGVRVVPHFXXXXXXXXXXXXXXXXXXXXXXXXXXXXE 401
           +LL + GGS + ASPFVIA A HGVRVVPH                             E
Sbjct: 329 QLLSAEGGSGSRASPFVIAAALHGVRVVPHIINFIILTSVISVGNSAMYSAPRILLSLAE 388

Query: 402 QGFAPRFLNYVDRCGRPVLCLLVSCVFGLLSFVAASPKEETVFTWLLAISGLSELFTWFS 461
            G  P+   YVDR GRP++ L+   +FGL++FVAAS +EE VFTWL AI+GLS+LFTW +
Sbjct: 389 HGMCPKIFTYVDRQGRPLVTLIFVSLFGLIAFVAASNQEENVFTWLSAIAGLSQLFTWTA 448

Query: 462 ISLSHVRLRRAMTVQGRSADELGYVAWTGVWGAYYAMAMIVAILVGQFWVAISPVGSN-K 520
           I++SHVR RRAM VQGRS  ELGY A TG  G+YYA+   V +L+ QFW+AI+P+  + +
Sbjct: 449 IAVSHVRFRRAMRVQGRSLGELGYRANTGALGSYYAIFFNVIVLIAQFWIAIAPIPKHGE 508

Query: 521 LDANNFFENYLAMPILIFLYLGYKIWTRDWRLLIPSSEVDLVAHRKIFDAEVLRHEQLEE 580
           LD   FF+NYLA P+L+  YLGYK+W RD+RL+IPSSEVDL++HR+IFD EVL  E+ E 
Sbjct: 509 LDVEFFFQNYLAFPVLVVFYLGYKLWKRDFRLVIPSSEVDLLSHRQIFDEEVLLQEEAER 568

Query: 581 KEQLRHAPWTTRLANFWC 598
           KE+LR++    RL +FWC
Sbjct: 569 KERLRNSTLFKRLLDFWC 586

>Skud_2.191 Chr2 complement(342307..344136) [1830 bp, 609 aa] {ON}
           YBR068C (REAL)
          Length = 609

 Score =  573 bits (1478), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 275/594 (46%), Positives = 381/594 (64%), Gaps = 6/594 (1%)

Query: 11  SPDNGVVESF---DSVEVLKEESPRSD--SRSDGLFRRFADSFRRHEAHNXXXXXXXXXX 65
           SP++  + SF   +  ++   E   S   S+S+ L  R A+SF+R E             
Sbjct: 16  SPESISIRSFSGGNDFQISSREKAYSGQPSKSEKLIHRLANSFKRAEGSITKTRQINENT 75

Query: 66  XXXLTPIESASKHKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAI 125
                 IES +    LK++++ RHV+M+SL TGIGTG+LV N K LH GGPA+LVIGY +
Sbjct: 76  SDLEDGIESITSDSKLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLHYGGPAALVIGYVL 135

Query: 126 VSSMLYCVIQSASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVT 185
           VS + Y +IQ+A E+A+ Y +L   FNAY S+ + K FGF+  W+YC QWL VLPLEL+T
Sbjct: 136 VSFVTYFMIQAAGEMAVTYPTLPANFNAYSSIFISKPFGFATVWLYCFQWLTVLPLELIT 195

Query: 186 ASMTIKYWNQTINPDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXX 245
           ASMTI+YWN  +NPD ++ IFY+ L+ I+              NCCK+LM          
Sbjct: 196 ASMTIQYWNDKLNPDVYILIFYIFLLFIHVFGVKAYGETEFIFNCCKILMIAGFIILSVV 255

Query: 246 XNCGGAGNDGYLGARYWHDPGAFRGSDSINRFKGIVAVLVNAAFAYGGAEFSVLTAAEQQ 305
            NCGGAG+DGY+G  YWH+PGAF G  SI RFK +  +LV   F++GG E   L+  EQ 
Sbjct: 256 INCGGAGDDGYIGGAYWHNPGAFAGDTSIARFKNVCYILVTGYFSFGGMELFALSVQEQS 315

Query: 306 NPQKSIRSASKKLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSATHASPFVIAVASHG 365
           NP+KS   A+K+ +YRI+ IY++T IL+GF VP+N D+L+G+GGSATHASP+V+A + HG
Sbjct: 316 NPRKSTPVAAKRSIYRIVIIYLLTMILIGFNVPYNDDQLMGAGGSATHASPYVLAASIHG 375

Query: 366 VRVVPHFXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVS 425
           V++VPH                             +QG+AP+FL+YVDR GRP+  L+V 
Sbjct: 376 VKIVPHIINAVILISVVSVANSSLYAGPRLICSLSQQGYAPKFLDYVDREGRPLRALIVC 435

Query: 426 CVFGLLSFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGY 485
           C+FG+++FVAAS KEE VFTWL AI+GLSELFTW SI LSH+R R+AM VQGRS DELGY
Sbjct: 436 CIFGVIAFVAASSKEEIVFTWLAAIAGLSELFTWTSIMLSHLRFRQAMKVQGRSLDELGY 495

Query: 486 VAWTGVWGAYYAMAMIVAILVGQFWVAISPVGSN-KLDANNFFENYLAMPILIFLYLGYK 544
            A TG+WG+ Y     + + + QFWVA++P+G++ +    +FFE+YLA PI +  + GY 
Sbjct: 496 KATTGIWGSVYGFFFNILVFIAQFWVALAPLGNDGRCSVESFFESYLAAPIWLTFFFGYM 555

Query: 545 IWTRDWRLLIPSSEVDLVAHRKIFDAEVLRHEQLEEKEQLRHAPWTTRLANFWC 598
           I+ RD+ LL P  ++DL  HR+I+D E++R E  E +E+ ++     +  +FWC
Sbjct: 556 IYNRDFTLLNPLDKIDLDFHRRIYDPELIRQEDQENEEKTKNMSLMRKAYHFWC 609

>SAKL0D02970g Chr4 (245449..247254) [1806 bp, 601 aa] {ON}
           uniprot|Q875S5 Saccharomyces kluyveri BAP2
          Length = 601

 Score =  565 bits (1457), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/607 (49%), Positives = 390/607 (64%), Gaps = 15/607 (2%)

Query: 1   MKDFELHNMKSPDNGVVESFDSVEVLKEESPRSDSRSDG-------LFRRFADSFRRHEA 53
           M    L N+ +      E   S   L+E S  S+  SDG           F +SF+R  A
Sbjct: 1   MSKKSLENLSNEKLPATECGSSNSNLRE-SISSNDLSDGDRGFVNRKLHNFCNSFKR--A 57

Query: 54  HNXXXXXXXXXXXXXLTPIESASKHKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHN 113
           ++             +  + S SK    KQ+++ RHV+M+SL TGIGTG+LV NGKSLH 
Sbjct: 58  NSDTFDASQDLEGASINSVRSNSK---FKQSMKSRHVVMMSLGTGIGTGLLVANGKSLHF 114

Query: 114 GGPASLVIGYAIVSSMLYCVIQSASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCL 173
           GGPA L+IGY++VS + Y ++Q+A E+A+ Y +L G FN Y S+ + K+FGF+  W+YCL
Sbjct: 115 GGPAGLLIGYSLVSVVAYIMMQAAGEMAVAYPTLPGNFNVYSSIFISKSFGFATVWLYCL 174

Query: 174 QWLCVLPLELVTASMTIKYWNQTINPDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKV 233
           QWL VLPLEL+TAS+TIKYWN +INPDAF+ IFY V+V I+              + CKV
Sbjct: 175 QWLTVLPLELITASLTIKYWNSSINPDAFIAIFYAVIVFIHFFGAAGYGEAEFIFSTCKV 234

Query: 234 LMXXXXXXXXXXXNCGGAGNDGYLGARYWHDPGAFRGSDSINRFKGIVAVLVNAAFAYGG 293
            M           NCGGAG  GY+G  YW +PGAF G   I  FKGI  VLV A F+YGG
Sbjct: 235 SMIAGFIILSIVINCGGAGTGGYIGGEYWRNPGAFAGGSPIGHFKGIAYVLVTAYFSYGG 294

Query: 294 AEFSVLTAAEQQNPQKSIRSASKKLVYRILGIYIMTAILLGFLVPWNSDELLGSGG-SAT 352
            E   LT  EQ NP+K++ SA+KK +YRIL IY++T IL+GFLVP+NSDEL+GS G SAT
Sbjct: 295 MELFALTVNEQANPRKAVPSATKKCIYRILIIYMLTMILIGFLVPYNSDELMGSSGKSAT 354

Query: 353 HASPFVIAVASHGVRVVPHFXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYV 412
           HASP+VIAVASHGV+VVPH                             EQG+AP+  +YV
Sbjct: 355 HASPYVIAVASHGVKVVPHIINAVILISVVSVGNSAMYSAPRLLNSLAEQGYAPKIFSYV 414

Query: 413 DRCGRPVLCLLVSCVFGLLSFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRA 472
           DR GRP++ L+   +FGLLSFVAAS KEE VFTWL AI+GLSELFTW +I LSHVR R A
Sbjct: 415 DRAGRPLVALVGCSIFGLLSFVAASDKEEQVFTWLAAIAGLSELFTWSAICLSHVRFRDA 474

Query: 473 MTVQGRSADELGYVAWTGVWGAYYAMAMIVAILVGQFWVAISPVGS-NKLDANNFFENYL 531
           M  QG S  ELGY + TG WG+ YA+   + + V QFWVA++P+G+  K DA  FF++YL
Sbjct: 475 MKYQGYSLSELGYKSKTGYWGSIYAIFFNIIVFVAQFWVALAPIGNGGKADAEAFFQSYL 534

Query: 532 AMPILIFLYLGYKIWTRDWRLLIPSSEVDLVAHRKIFDAEVLRHEQLEEKEQLRHAPWTT 591
           A PI I  Y+GYKI++++W+LL+P  E+DL +HR IFD  +L+ E  E KE+L+++ W  
Sbjct: 535 AFPIWISCYVGYKIYSKEWKLLVPLDEIDLNSHRHIFDKHILQQEDDEHKEKLKNSGWWV 594

Query: 592 RLANFWC 598
           ++ANFWC
Sbjct: 595 KMANFWC 601

>YDR046C Chr4 complement(548762..550576) [1815 bp, 604 aa] {ON}
           BAP3Amino acid permease involved in the uptake of
           cysteine, leucine, isoleucine and valine
          Length = 604

 Score =  565 bits (1455), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 273/590 (46%), Positives = 377/590 (63%), Gaps = 10/590 (1%)

Query: 13  DNGVVESFDS---VEVLKEESPRSDSRSDGLFRRFADSFRRHEAHNXXXXXXXXXXXXXL 69
           D+ +  +F++     +  E    S+   +GL  RF DSFRR E+                
Sbjct: 21  DSALYNNFNTSTTASLTPEIKEHSEESRNGLVHRFVDSFRRAESQRLEEDNDLEDGT--- 77

Query: 70  TPIESASKHKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSM 129
              +S   +  LK++++ RHV+M+SL TGIGTG+LV N K L   GP SLVIGY +VS +
Sbjct: 78  ---KSMKSNNHLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLSLAGPGSLVIGYVMVSFV 134

Query: 130 LYCVIQSASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMT 189
            Y ++Q+A E+ + Y +L G FNAY S+ + K+FGF+ +W++C+QWL VLPLEL+T+SMT
Sbjct: 135 TYFMVQAAGEMGVTYPTLPGNFNAYNSIFISKSFGFATTWLFCIQWLTVLPLELITSSMT 194

Query: 190 IKYWNQTINPDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCG 249
           +KYWN TIN D F+ IFYV L+ I+              N CK+LM           NCG
Sbjct: 195 VKYWNDTINADVFIVIFYVFLLFIHFFGVKAYGETEFIFNSCKILMVAGFIILSVVINCG 254

Query: 250 GAGNDGYLGARYWHDPGAFRGSDSINRFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNPQK 309
           GAG DGY+G +YW DPG+F       RFKGI  +LV+A F++GG E  VL+  EQ NP+K
Sbjct: 255 GAGVDGYIGGKYWRDPGSFAEGSGATRFKGICYILVSAYFSFGGIELFVLSINEQSNPRK 314

Query: 310 SIRSASKKLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSATHASPFVIAVASHGVRVV 369
           S   A+K+ VYRIL IY++T IL+GF VP N+D+L+GSGGSATHASP+V+A + H VRV+
Sbjct: 315 STPVAAKRSVYRILIIYLLTMILIGFNVPHNNDQLMGSGGSATHASPYVLAASIHKVRVI 374

Query: 370 PHFXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVSCVFG 429
           PH                             +QG+AP+FLNY+DR GRP+  L+V  + G
Sbjct: 375 PHIINAVILISVISVANSALYAAPRLMCSLAQQGYAPKFLNYIDREGRPLRALVVCSLVG 434

Query: 430 LLSFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYVAWT 489
           ++ FVA SP+EE  FTWL AI+GLSELFTW  I LSH+R R+AM VQGRS DE+GY A T
Sbjct: 435 VVGFVACSPQEEQAFTWLAAIAGLSELFTWSGIMLSHIRFRKAMKVQGRSLDEVGYKANT 494

Query: 490 GVWGAYYAMAMIVAILVGQFWVAISPVGS-NKLDANNFFENYLAMPILIFLYLGYKIWTR 548
           G+WG+YY +   + + + QFWVA+SP+G+  K DA  FFE+YLA P+ IF+Y+GY ++ R
Sbjct: 495 GIWGSYYGVFFNMLVFMAQFWVALSPIGNGGKCDAQAFFESYLAAPLWIFMYVGYMVYKR 554

Query: 549 DWRLLIPSSEVDLVAHRKIFDAEVLRHEQLEEKEQLRHAPWTTRLANFWC 598
           D+  L P  ++DL  HR+++D E++R E  E KE+L+++    R+  FWC
Sbjct: 555 DFTFLNPLDKIDLDFHRRVYDPEIMRQEDEENKERLKNSSIFVRVYKFWC 604

>NCAS0I01530 Chr9 (286882..288669) [1788 bp, 595 aa] {ON} 
          Length = 595

 Score =  565 bits (1455), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/598 (47%), Positives = 378/598 (63%), Gaps = 16/598 (2%)

Query: 8   NMKSPD-NGVVES-FDSVEVLKEESPRSDS---RSDGLFRRFADSFRRHEA-HNXXXXXX 61
           N  SP+ N +  S   +  V ++  P  D+   +    F RF DSF+R E  HN      
Sbjct: 7   NETSPEVNSITSSTLKTPNVTEKFEPYPDTTAVKHRTHFNRFVDSFKRAEVNHNGIDLED 66

Query: 62  XXXXXXXLTPIESASKHKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVI 121
                       S      LK+ ++ RHV+M+SL TGIGTG+LV N K L+  GPASLVI
Sbjct: 67  GT---------NSIQSDDNLKKAMKSRHVIMMSLGTGIGTGLLVANAKGLYLAGPASLVI 117

Query: 122 GYAIVSSMLYCVIQSASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPL 181
           GY +VS + Y VIQ+A E+A+ Y +L GGFN Y S+ V K FGF+  W++C+QWL VLPL
Sbjct: 118 GYFMVSFITYFVIQAAGEMAVTYPTLPGGFNNYASIFVSKPFGFATVWLFCIQWLTVLPL 177

Query: 182 ELVTASMTIKYWNQTINPDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXX 241
           EL+TASMTIKYWN  IN D FV I YV L+ I+              N CK+LM      
Sbjct: 178 ELITASMTIKYWNDKINADVFVVILYVFLLFIHFFGVRAYGEAEFIFNSCKILMIGGFVI 237

Query: 242 XXXXXNCGGAGNDGYLGARYWHDPGAFRGSDSINRFKGIVAVLVNAAFAYGGAEFSVLTA 301
                NCGGAG DGY+G +YW DPGAF   ++ +RFKG+  VLV A F+YGG E   L+ 
Sbjct: 238 LSIVVNCGGAGVDGYIGGKYWRDPGAFASDNAASRFKGVAFVLVTAYFSYGGVELFALSV 297

Query: 302 AEQQNPQKSIRSASKKLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSATHASPFVIAV 361
            EQ+NP++S  +A+K+ +YRIL IY++T IL+GF VP NSD+L+G+GGSATHASP+V+AV
Sbjct: 298 NEQENPRRSTPAAAKQSIYRILIIYLLTMILIGFNVPHNSDQLMGAGGSATHASPYVLAV 357

Query: 362 ASHGVRVVPHFXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLC 421
           + HGV+VVPH                             EQG+AP++ NYVDR GRP+  
Sbjct: 358 SIHGVKVVPHIINAVILISVTSVANSALYASPRLLRSLAEQGYAPKYFNYVDREGRPLRA 417

Query: 422 LLVSCVFGLLSFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSAD 481
           L++  +FG+++F A S +EE +FTWL AI+GLSELFTW SI LSHVR R AM  QG+S +
Sbjct: 418 LILCSIFGVIAFCACSDQEEVIFTWLAAIAGLSELFTWSSILLSHVRFRLAMKAQGKSLN 477

Query: 482 ELGYVAWTGVWGAYYAMAMIVAILVGQFWVAISPVGSNKL-DANNFFENYLAMPILIFLY 540
           ELGY++ TG+WG+ Y     V + + QFWVA+SP GS  +  A  FFE+YLA P+ +F Y
Sbjct: 478 ELGYISITGIWGSLYGCFFNVLVFIAQFWVALSPPGSKGVYSAEAFFESYLAFPVWLFFY 537

Query: 541 LGYKIWTRDWRLLIPSSEVDLVAHRKIFDAEVLRHEQLEEKEQLRHAPWTTRLANFWC 598
           LGY +++RD+  L    ++DL  HR+++D E+LR E  E KE++R+  WT +L NFWC
Sbjct: 538 LGYMLYSRDFTFLTDLKKIDLDNHRRLYDPELLRQEDEETKERIRNGGWTQKLLNFWC 595

>NDAI0A07490 Chr1 complement(1713048..1714838) [1791 bp, 596 aa]
           {ON} 
          Length = 596

 Score =  561 bits (1446), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/596 (46%), Positives = 378/596 (63%), Gaps = 26/596 (4%)

Query: 17  VESFDSVEVLKEESPRS------DS--RSDGLFRRFADSFRRHEAHNXXXXXXXXXXXXX 68
           +++FDS   L E + +S      DS  +    F +F DSFRR E  +             
Sbjct: 13  IKTFDSSVKLSEITEKSTPVFPLDSTLKRRTHFTKFVDSFRRAEDKHAD----------- 61

Query: 69  LTPIESASKHKT-----LKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGY 123
            + +E  SK  T     +K+ ++ RHV+M++L TGIGTG+LV NGK L   GPA LV+GY
Sbjct: 62  -SDLEDGSKSITSDDDHMKKAMKSRHVIMMTLGTGIGTGLLVANGKGLALAGPAPLVLGY 120

Query: 124 AIVSSMLYCVIQSASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLEL 183
            +VS + Y +IQ+A E+A+ Y ++   FN Y S+ V K FGF+  W++C+QWL VLPLEL
Sbjct: 121 GLVSFVTYFMIQAAGEMAVTYPTMPASFNTYASIFVSKPFGFATVWLFCIQWLTVLPLEL 180

Query: 184 VTASMTIKYWNQTINPDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXX 243
           +TASMTIKYWN TINPD F+ IFYV L+ I+              N CK+LM        
Sbjct: 181 ITASMTIKYWNDTINPDVFIVIFYVFLLFIHFFGVKAYGETEFIFNSCKILMIAGFIILS 240

Query: 244 XXXNCGGAGNDGYLGARYWHDPGAFRGSDSINRFKGIVAVLVNAAFAYGGAEFSVLTAAE 303
              NCGGAG DGY+G +YW +PGAF       RFKG+  +LV   F+YGG E   L+  E
Sbjct: 241 IVINCGGAGRDGYIGNKYWINPGAFASESPAARFKGVAYILVTGYFSYGGTELFSLSVNE 300

Query: 304 QQNPQKSIRSASKKLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSATHASPFVIAVAS 363
           Q+NP+KS  +A+K+ +YRIL IY++T IL+GF VP +SD+L+G+GGSATHASP+V+A + 
Sbjct: 301 QKNPRKSTPAAAKQSIYRILIIYLLTMILIGFNVPHDSDQLMGAGGSATHASPYVLAASL 360

Query: 364 HGVRVVPHFXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLL 423
           HGV+VVPHF                            EQG+AP++ NYVDR GRP+  L 
Sbjct: 361 HGVKVVPHFINAVILISVVSVANSALYASPRLMRSLAEQGYAPKWFNYVDREGRPLRALC 420

Query: 424 VSCVFGLLSFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADEL 483
           +  +FG++ FVA SP+EE  FTWL AI+GLSELFTW SI +SH+R R AM VQG+S +EL
Sbjct: 421 ICGLFGVIGFVACSPQEEQAFTWLAAIAGLSELFTWSSIFISHIRFRMAMKVQGKSLEEL 480

Query: 484 GYVAWTGVWGAYYAMAMIVAILVGQFWVAISPVGSN-KLDANNFFENYLAMPILIFLYLG 542
           GY A TG+WG+ Y++   + + + QFWVA+SP  SN K DA  FFE+YLA P+ +  Y G
Sbjct: 481 GYRATTGIWGSVYSVFFNMLVFIAQFWVALSPPKSNGKYDAEGFFESYLAAPLWLVFYFG 540

Query: 543 YKIWTRDWRLLIPSSEVDLVAHRKIFDAEVLRHEQLEEKEQLRHAPWTTRLANFWC 598
           Y I++RD+  L P  ++DL  HR+I+D E+LR E  E KE+LR++ W  RL +FWC
Sbjct: 541 YMIYSRDFTFLTPLDKIDLDFHRRIYDPELLRQEDAETKERLRNSGWLARLRSFWC 596

>KNAG0J02200 Chr10 complement(407267..409090) [1824 bp, 607 aa] {ON}
           
          Length = 607

 Score =  561 bits (1446), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 275/584 (47%), Positives = 372/584 (63%), Gaps = 10/584 (1%)

Query: 22  SVEVLKEESPRS-------DSRSDGLFRRFADSFRRHEAHNXXXXXXXXXXXXXLTPIES 74
           SV+ + E+S  S        + +  +FRRF DSF+  E +                   +
Sbjct: 27  SVDQINEKSVESYASNAEVGATNPTMFRRFVDSFKPAEDNKHSEVDSDVERNGDAAYSVN 86

Query: 75  ASKHKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYCVI 134
              H  LK+ ++ RHV+M++L TGIGTG+LV N K LH GGPA+LVIGY +VS + Y +I
Sbjct: 87  TDTH--LKKAMKTRHVIMMTLGTGIGTGLLVANAKGLHFGGPAALVIGYGLVSMVTYIMI 144

Query: 135 QSASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKYWN 194
           Q+A E+A+ Y +L G FN Y S+ V K FGF+  W++C+QWL VLPLEL+TAS+ IKYW 
Sbjct: 145 QAAGEMAVAYPTLPGNFNTYASIFVSKPFGFATVWLFCIQWLTVLPLELITASLIIKYWT 204

Query: 195 QTINPDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGGAGND 254
           + +N D FV IFYV L+ I+              N CK+LM           NCGGAG+D
Sbjct: 205 EKVNADVFVVIFYVFLLFIHFIGVKAYGETEFVFNLCKILMIAGFIIFSIVVNCGGAGHD 264

Query: 255 GYLGARYWHDPGAFRGSDSINRFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSA 314
           GY+G +YWH PGAF G+++  RFKG+  VLV+  F+YGG E  VL+  EQ+NP+KS   A
Sbjct: 265 GYIGGKYWHSPGAFAGTNAAERFKGVCYVLVSGYFSYGGTELYVLSVNEQENPRKSTPIA 324

Query: 315 SKKLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSATHASPFVIAVASHGVRVVPHFXX 374
           +K+ +YRIL IY++T IL+GF VP+N D+L+G+GGSATHASP+V+A + HGVRVVPH   
Sbjct: 325 AKQSIYRILVIYLLTMILIGFTVPFNDDQLMGAGGSATHASPYVLAASIHGVRVVPHIIN 384

Query: 375 XXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVSCVFGLLSFV 434
                                     EQG+AP+F+ YVDR GRP+  LL   VFG+++F 
Sbjct: 385 AVILIAVISVANSSLYAAPRLLCSLAEQGYAPKFMTYVDREGRPLYALLACAVFGVIAFS 444

Query: 435 AASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYVAWTGVWGA 494
           A S +EE VFTWL AI+GLSELFTW SI LSHVR R+AM +QGR  +E+GY+A TG WG+
Sbjct: 445 ACSDQEEQVFTWLAAIAGLSELFTWSSIMLSHVRFRQAMKLQGRDLNEVGYIANTGYWGS 504

Query: 495 YYAMAMIVAILVGQFWVAISPVGSNKLDANNFFENYLAMPILIFLYLGYKIWTRDWRLLI 554
            Y +   + + + QFWVA++P  S  + A +FFE+YLA PI I  Y GY IW +D+  L 
Sbjct: 505 VYGVVFNILVFIAQFWVALAPPKS-PITAQSFFESYLAFPIWIAFYFGYMIWNKDYTFLN 563

Query: 555 PSSEVDLVAHRKIFDAEVLRHEQLEEKEQLRHAPWTTRLANFWC 598
           P  ++DL  HR+I+D EVL+ E +E KE++R+    T+L  FWC
Sbjct: 564 PLDKIDLDHHRRIYDPEVLKQEDMENKERVRNGNIWTKLKWFWC 607

>Smik_4.284 Chr4 complement(515341..517155) [1815 bp, 604 aa] {ON}
           YBR068C (REAL)
          Length = 604

 Score =  560 bits (1443), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 267/573 (46%), Positives = 369/573 (64%), Gaps = 7/573 (1%)

Query: 27  KEESPRSDSRSDGLFRRFADSFRRHEAHNXXXXXXXXXXXXXLTPIESASKHKTLKQNIR 86
           +E    S+   +GL  RF DSF+R E+ +                  S   +  LK++++
Sbjct: 38  QEVKEHSEESRNGLVHRFVDSFKRAESQHLEDDNDLE------DGTRSMKSNNRLKKSMK 91

Query: 87  PRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYCVIQSASELAIIYTS 146
            RHV+M+SL TGIGTG+LV N K L   GP SLVIGY +VS + Y ++Q+A E+ + Y +
Sbjct: 92  SRHVVMMSLGTGIGTGLLVANAKGLKLAGPGSLVIGYVMVSFVTYFMVQAAGEMGVTYPT 151

Query: 147 LAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKYWNQTINPDAFVTIF 206
           L G FNAY S+ + K+FGF+ +W++C+QWL VLPLEL+T+SMTIKYWN  IN D F+ IF
Sbjct: 152 LPGNFNAYNSIFISKSFGFATTWIFCIQWLTVLPLELITSSMTIKYWNDKINSDVFIVIF 211

Query: 207 YVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGGAGNDGYLGARYWHDPG 266
           YV L+ I+              + CK+LM           NCGGAG DGY+G +YW DPG
Sbjct: 212 YVFLLFIHFFGVKAYGETEFIFSSCKILMIAGFIILSVVINCGGAGVDGYIGGKYWRDPG 271

Query: 267 AFRGSDSINRFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRILGIY 326
           +F   +   RFKGI  +LV A F++GG E  VL+  EQ NP+KS   A+K+ VYRIL IY
Sbjct: 272 SFAEGNGATRFKGICFILVTAYFSFGGIELFVLSINEQSNPRKSTPVAAKRSVYRILIIY 331

Query: 327 IMTAILLGFLVPWNSDELLGSGGSATHASPFVIAVASHGVRVVPHFXXXXXXXXXXXXXX 386
           ++T IL+GF VP N+D+L+GSG +ATHASP+V+A + H VRVVPH               
Sbjct: 332 LLTMILIGFNVPHNNDQLMGSGSAATHASPYVLAASIHKVRVVPHIINAVILISVISVAN 391

Query: 387 XXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVSCVFGLLSFVAASPKEETVFTW 446
                         +QG+AP+FL+Y+DR GRP+  L V C+ G++ FVA SP+EE  FTW
Sbjct: 392 SALYAAPRLMCSLAQQGYAPKFLDYIDREGRPLRALFVCCLVGVIGFVACSPQEEQAFTW 451

Query: 447 LLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYVAWTGVWGAYYAMAMIVAILV 506
           L AI+GLSELFTW  I LSH+R R+AM VQGRS DE+GY A TG+WG+YY +   + + +
Sbjct: 452 LAAIAGLSELFTWSGIMLSHIRFRKAMKVQGRSLDEVGYKANTGIWGSYYGVFFNILVFM 511

Query: 507 GQFWVAISPVGS-NKLDANNFFENYLAMPILIFLYLGYKIWTRDWRLLIPSSEVDLVAHR 565
            QFWVA+SP+G+  K +A  FFE+YLA P+ + +YLGY ++ RD+  L P  ++DL  HR
Sbjct: 512 AQFWVALSPIGNGGKCNAQAFFESYLAAPLWLCMYLGYMLYERDFTFLNPLDKIDLDYHR 571

Query: 566 KIFDAEVLRHEQLEEKEQLRHAPWTTRLANFWC 598
           +++D E++R E  E KE+L+++ +  R+ NFWC
Sbjct: 572 RVYDPEIIRQENEENKERLKNSSFFFRIYNFWC 604

>Skud_4.300 Chr4 complement(525086..526900) [1815 bp, 604 aa] {ON}
           YBR068C (REAL)
          Length = 604

 Score =  560 bits (1442), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 275/598 (45%), Positives = 375/598 (62%), Gaps = 7/598 (1%)

Query: 2   KDFELHNMKSPDNGVVESFDSVEVLKEESPRSDSRSDGLFRRFADSFRRHEAHNXXXXXX 61
           K+ E     SP      +  +  +  E    S+   +GL  RF DSFRR E+        
Sbjct: 13  KNTEFEVTDSPLYNNFNTSTTASLSPEVKEHSEESRNGLVHRFVDSFRRAESQ---CLEE 69

Query: 62  XXXXXXXLTPIESASKHKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVI 121
                    P++S   +  LK++++ RHV+M+SL TGIGTG+LV N K L   GP SLVI
Sbjct: 70  NNDLEDGTRPMKS---NNHLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLKLAGPGSLVI 126

Query: 122 GYAIVSSMLYCVIQSASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPL 181
           GY +VS + Y ++Q+A E+ + Y +L G FNAY S+ + K+FGF+ +W++C+QWL VLPL
Sbjct: 127 GYVLVSFITYFMVQAAGEMGVAYATLPGNFNAYNSIFISKSFGFATTWLFCIQWLTVLPL 186

Query: 182 ELVTASMTIKYWNQTINPDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXX 241
           EL+T+SMTIKYWN +IN D F+ IFYV L+ I+              N CK+LM      
Sbjct: 187 ELITSSMTIKYWNDSINADVFIVIFYVFLLFIHFFGVKAYGETEFIFNSCKILMVAGFII 246

Query: 242 XXXXXNCGGAGNDGYLGARYWHDPGAFRGSDSINRFKGIVAVLVNAAFAYGGAEFSVLTA 301
                NCGGAG DGY+G +YW DPG+F    +  RFKGI  +LV A F++GG E  VL+ 
Sbjct: 247 LSVVINCGGAGVDGYIGGKYWRDPGSFADGSNATRFKGICFILVTAYFSFGGIELFVLSI 306

Query: 302 AEQQNPQKSIRSASKKLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSATHASPFVIAV 361
            EQ N +KS   A+K+ VYRIL IY++T IL+GF VP N+D+L+GSG +ATHASP+V+A 
Sbjct: 307 NEQSNARKSTPLAAKRSVYRILIIYLLTMILIGFNVPHNNDQLMGSGSAATHASPYVLAA 366

Query: 362 ASHGVRVVPHFXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLC 421
           + H VRV+PH                             +QG+APRFLNY+DR GRP+  
Sbjct: 367 SIHKVRVIPHIINAVILISVISVANSALYAAPRLMCSLAQQGYAPRFLNYIDREGRPLRA 426

Query: 422 LLVSCVFGLLSFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSAD 481
           L V  + G++ FVA SP+EE  FTWL AI+GLSE+FTW  I LSH+R R+AM VQGRS  
Sbjct: 427 LAVCALVGVVGFVACSPQEEQAFTWLAAIAGLSEIFTWSGIMLSHIRFRKAMKVQGRSLG 486

Query: 482 ELGYVAWTGVWGAYYAMAMIVAILVGQFWVAISPVGS-NKLDANNFFENYLAMPILIFLY 540
           ELGY A TG+WG+YY +   + + + QFWVA+SP+G+  K D   FFE YLA P+ IF+Y
Sbjct: 487 ELGYKANTGIWGSYYGVFFNILVFMAQFWVALSPIGNGGKCDVQAFFEGYLAAPLWIFMY 546

Query: 541 LGYKIWTRDWRLLIPSSEVDLVAHRKIFDAEVLRHEQLEEKEQLRHAPWTTRLANFWC 598
           LGY ++ +D+ LL P  ++DL  HR+++D E++R E  E KE+LR++    R+ NFWC
Sbjct: 547 LGYMLYNKDFTLLNPLDKIDLDFHRRVYDPEIMRQEDEENKEKLRNSSIFFRMYNFWC 604

>Suva_2.203 Chr2 complement(347891..349705) [1815 bp, 604 aa] {ON}
           YDR046C (REAL)
          Length = 604

 Score =  558 bits (1439), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/600 (47%), Positives = 379/600 (63%), Gaps = 15/600 (2%)

Query: 3   DFELHNMKSPDN---GVVESFDSVEVLKEESPRSDSRSDGLFRRFADSFRRHEAHNXXXX 59
           +FE+ +    DN       SF S EV KE S  S S   GL  RF DSFRR E+      
Sbjct: 16  EFEVTDSALRDNFNTSTAASF-SPEV-KEHSEESRS---GLVHRFVDSFRRAESQRLEDD 70

Query: 60  XXXXXXXXXLTPIESASKHKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASL 119
                         S   +  LK++++ RHV+M+SL TGIGTG+LV N K L   GP SL
Sbjct: 71  NDLEDGT------RSMRSNNHLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLKLAGPGSL 124

Query: 120 VIGYAIVSSMLYCVIQSASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVL 179
           VIGY +VS + Y ++Q+A E+ + Y +L G FNAY S+ V K+FGF+ +W++C+QWL VL
Sbjct: 125 VIGYVLVSFVTYFMVQAAGEMGVTYPTLPGNFNAYNSIFVSKSFGFATTWLFCIQWLTVL 184

Query: 180 PLELVTASMTIKYWNQTINPDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXX 239
           PLEL+T+SMTIKYWN TIN D F+ IFYV L+ I+              N CK+LM    
Sbjct: 185 PLELITSSMTIKYWNDTINADVFIAIFYVFLLFIHFFGVKAYGETEFIFNSCKILMIAGF 244

Query: 240 XXXXXXXNCGGAGNDGYLGARYWHDPGAFRGSDSINRFKGIVAVLVNAAFAYGGAEFSVL 299
                  NCGGAG DGY+G  YW +PG+F    S  RFKGI  +LV A F++GG E  VL
Sbjct: 245 IILSVIINCGGAGVDGYIGGEYWRNPGSFADGSSATRFKGICFILVTAYFSFGGIELFVL 304

Query: 300 TAAEQQNPQKSIRSASKKLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSATHASPFVI 359
           +  EQ NP+KS   A+K+ +YRIL IY++T IL+GF VP ++D+L+GSG SATHASP+V+
Sbjct: 305 SINEQANPRKSTPVAAKRSIYRILIIYLLTMILIGFNVPHDNDQLMGSGSSATHASPYVL 364

Query: 360 AVASHGVRVVPHFXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPV 419
           A + HGV+V+PH                             +QG+AP+FLNY+DR GRP+
Sbjct: 365 AASIHGVKVIPHIINAVILISVISVANSALYAAPRLMCSLAQQGYAPKFLNYIDREGRPL 424

Query: 420 LCLLVSCVFGLLSFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRS 479
             L+V    GL+ FVA S +EE  FTWL AI+GLSE+FTW  I LSH+R R+AM VQGRS
Sbjct: 425 RALVVCSFVGLVGFVACSSQEEQAFTWLAAIAGLSEIFTWSGIMLSHIRFRKAMKVQGRS 484

Query: 480 ADELGYVAWTGVWGAYYAMAMIVAILVGQFWVAISPVGSN-KLDANNFFENYLAMPILIF 538
            DE+GY + TG+WG+YY +   + + + QFWVA+SP GS+ K D  +FF++YLA P+ IF
Sbjct: 485 LDEVGYKSNTGIWGSYYGVIFNILVFMAQFWVALSPPGSDGKCDVESFFQSYLAAPLWIF 544

Query: 539 LYLGYKIWTRDWRLLIPSSEVDLVAHRKIFDAEVLRHEQLEEKEQLRHAPWTTRLANFWC 598
           +YLGY I+ +D+ LL P  ++DL  HR+++D E++R E  E KE+LR++    R+ N WC
Sbjct: 545 MYLGYMIYNKDFTLLNPLDKIDLDFHRRVYDPEIMRQEDEENKERLRNSSVFFRMYNMWC 604

>CAGL0H08393g Chr8 (821998..823836) [1839 bp, 612 aa] {ON} highly
           similar to uniprot|P41815 Saccharomyces cerevisiae
           YDR046c PAP1
          Length = 612

 Score =  558 bits (1438), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 274/560 (48%), Positives = 363/560 (64%), Gaps = 19/560 (3%)

Query: 44  FADSFRRHEA---HNXXXXXXXXXXXXXLTPIESASKHKTLKQNIRPRHVLMISLATGIG 100
           F DSF+R +    HN                 ++ + H+  K+ ++ RHV+M+SL TGIG
Sbjct: 67  FIDSFKRADDSPDHNDLE--------------KTTTAHQEQKKTMKSRHVIMMSLGTGIG 112

Query: 101 TGMLVGNGKSLHNGGPASLVIGYAIVSSMLYCVIQSASELAIIYTSLAGGFNAYPSLLVD 160
           TG+LV NGK L   GPASLVI Y +VS + Y +IQ+A E+A+ Y +L G FNAY S  + 
Sbjct: 113 TGLLVSNGKGLSLAGPASLVIAYGLVSFVTYFMIQAAGEMAVTYPTLPGSFNAYTSFFIS 172

Query: 161 KAFGFSVSWVYCLQWLCVLPLELVTASMTIKYWNQTINPDAFVTIFYVVLVAINXXXXXX 220
           K FGF+ +W++C+QWL VLPLEL+TA+MTIKYWN +I+PD FV IFYV L+ I+      
Sbjct: 173 KPFGFATTWLFCIQWLTVLPLELITAAMTIKYWNTSIDPDVFVIIFYVFLMFIHFFGVQA 232

Query: 221 XXXXXXXXNCCKVLMXXXXXXXXXXXNCGGAGNDGYLGARYWHDPGAFRGSDSINRFKGI 280
                   N CK+LM           NCGGAG DGY+G +YWHDPGAF  S+  +RFKGI
Sbjct: 233 YGETEFIFNACKILMIGGFIIFAIVVNCGGAGKDGYIGGKYWHDPGAFASSNGASRFKGI 292

Query: 281 VAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRILGIYIMTAILLGFLVPWN 340
              LVNA F+YGG E  VL+  +Q+NP+KS  +A+K  VYRI+ IY++T IL+GF+VP N
Sbjct: 293 CYNLVNAYFSYGGNELFVLSVNDQKNPRKSTPAAAKSNVYRIVVIYLLTMILIGFVVPHN 352

Query: 341 SDELLG-SGGSATHASPFVIAVASHGVRVVPHFXXXXXXXXXXXXXXXXXXXXXXXXXXX 399
           S ELLG SGG+  HASP+V+A + HG++VVPH                            
Sbjct: 353 SSELLGASGGNGLHASPYVLAASIHGIKVVPHIINAVILIALISVANSSLYAGPRLLSSL 412

Query: 400 XEQGFAPRFLNYVDRCGRPVLCLLVSCVFGLLSFVAASPKEETVFTWLLAISGLSELFTW 459
            +QG+APRFL+YVDR GRP+  LL+S + G++ F A SP+EE VFTWL AISGLSELFTW
Sbjct: 413 AQQGYAPRFLSYVDRRGRPLTALLLSALVGVIGFAATSPREEEVFTWLAAISGLSELFTW 472

Query: 460 FSISLSHVRLRRAMTVQGRSADELGYVAWTGVWGAYYAMAMIVAILVGQFWVAISPVGS- 518
            SI  SH+R RRAM +Q +S D LGY A TG+WG+Y+ +   + +   QFWVA+SP  S 
Sbjct: 473 TSIMFSHIRFRRAMKLQNKSLDTLGYKANTGLWGSYFGVGFNILVFAAQFWVALSPPNSG 532

Query: 519 NKLDANNFFENYLAMPILIFLYLGYKIWTRDWRLLIPSSEVDLVAHRKIFDAEVLRHEQL 578
            K DAN+FF +YLAMPI +  Y GY  W +D+ +L   ++VDL  HRK++D E LR E L
Sbjct: 533 GKCDANSFFASYLAMPIWLVFYFGYMCWYKDFTVLTDLNQVDLDNHRKVYDPEFLRQEDL 592

Query: 579 EEKEQLRHAPWTTRLANFWC 598
           E KE+LR++ +  ++  FWC
Sbjct: 593 ENKERLRNSSFLVKIYEFWC 612

>CAGL0L07546g Chr12 complement(833821..835725) [1905 bp, 634 aa]
           {ON} highly similar to uniprot|P38084 Saccharomyces
           cerevisiae YBR068c BAP2 or uniprot|P41815 Saccharomyces
           cerevisiae YDR046c PAP1
          Length = 634

 Score =  556 bits (1434), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/596 (47%), Positives = 372/596 (62%), Gaps = 24/596 (4%)

Query: 21  DSVEVLKEESPRSDSRSDGLFRRFADSFRR----------HEAHNXXXXXXXXXXXXXLT 70
           DS     E  PR+      L  RF DSF+R           E  N               
Sbjct: 45  DSDNTSIESEPRTK-----LVHRFVDSFKRAQDVPTGRKSKEIGNNGGSKTKGGFEEDSL 99

Query: 71  PIESASKHKT------LKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYA 124
            +E  S H +      LK+ ++ RHV+M+SL TGIGTG+LV N K LH GGPA+LVIGY 
Sbjct: 100 DLE-GSDHDSIITNTHLKKAMKSRHVMMMSLGTGIGTGLLVANAKGLHFGGPAALVIGYV 158

Query: 125 IVSSMLYCVIQSASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELV 184
           +VS + Y +IQ+A E+A+ Y +L G FNAY S+ V  AFGF+  W++C+QWL VLPLEL+
Sbjct: 159 LVSFVTYFMIQAAGEMAVTYPTLPGNFNAYSSIFVSNAFGFATVWIFCIQWLTVLPLELI 218

Query: 185 TASMTIKYWNQTINPDAFVTIFYVVLVAINXX-XXXXXXXXXXXXNCCKVLMXXXXXXXX 243
           TAS+TIKYWN  IN D F+ IFYV L+ I+               N CK+LM        
Sbjct: 219 TASLTIKYWNDKINADVFIVIFYVFLLCIHLFGGVIAYGETEFLFNLCKILMVIGFIIMS 278

Query: 244 XXXNCGGAGNDGYLGARYWHDPGAFRGSDSINRFKGIVAVLVNAAFAYGGAEFSVLTAAE 303
              N GGAGN  Y+G ++WHDPGAF G  + +RFKGI  VLV+  F+YGG E   L+  E
Sbjct: 279 IVINAGGAGNREYIGGKFWHDPGAFAGKTAGSRFKGICYVLVSGYFSYGGTELFALSVNE 338

Query: 304 QQNPQKSIRSASKKLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSATHASPFVIAVAS 363
           Q NP++S   ASK  +YRIL IY++T IL+GF VP++SDEL+GSGGSATHASP+V+A + 
Sbjct: 339 QSNPRRSTPQASKSSLYRILIIYLLTMILIGFNVPYDSDELMGSGGSATHASPYVLAASL 398

Query: 364 HGVRVVPHFXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLL 423
           +GV++ PHF                            +QG+AP+FL+YVDR GRP+L L+
Sbjct: 399 NGVKIAPHFINAVILISVISVANSSLYAAPRLMCSLAQQGYAPKFLDYVDRQGRPLLALI 458

Query: 424 VSCVFGLLSFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADEL 483
              + G++ FVAASPKEE VFTWL AI+GLSELFTW SI LSHVR R AM +Q RS +EL
Sbjct: 459 ACLLVGVIGFVAASPKEEEVFTWLAAIAGLSELFTWSSIMLSHVRFRMAMKLQNRSLEEL 518

Query: 484 GYVAWTGVWGAYYAMAMIVAILVGQFWVAISPVGSN-KLDANNFFENYLAMPILIFLYLG 542
           GY A TG++G+ Y +   + +   QFW A+ P G + K +AN+FF NYLAMPI +  Y G
Sbjct: 519 GYKATTGIYGSIYGVCFNLLVFAAQFWTALFPFGGDGKANANSFFANYLAMPIWLVFYFG 578

Query: 543 YKIWTRDWRLLIPSSEVDLVAHRKIFDAEVLRHEQLEEKEQLRHAPWTTRLANFWC 598
           Y +WTRD++LL P  ++DL  HR+I+D E++R E  E KE+LR+  +  R+ +FWC
Sbjct: 579 YMLWTRDFQLLKPLDKIDLDFHRRIYDPELMRQEDEESKERLRNGSFMMRMYHFWC 634

>NCAS0A10680 Chr1 complement(2127039..2128820) [1782 bp, 593 aa]
           {ON} 
          Length = 593

 Score =  555 bits (1429), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/600 (46%), Positives = 379/600 (63%), Gaps = 19/600 (3%)

Query: 8   NMKSPDNGVVESFDSVEVLKEE--SPR------SDSRSDGLFRRFADSFRRHEAHNXXXX 59
           N+  P+      + S E L  E  SP        +SRS GL  RF DSF+R +       
Sbjct: 4   NVIQPNKEKTVDYSSTEYLPNELESPSFNLDATEESRS-GLVHRFVDSFKRAQDSTENDL 62

Query: 60  XXXXXXXXXLTPIESASKHKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASL 119
                      P+  AS    LK+ ++ RHV+M+ + TGIGTG+LV N   L  GGP SL
Sbjct: 63  EDGT------KPLGDASH---LKKAMKSRHVIMMCVGTGIGTGLLVANASGLSYGGPGSL 113

Query: 120 VIGYAIVSSMLYCVIQSASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVL 179
           VIGY +VS + Y +IQ+A E+A+ Y +L G FN+Y S+ + K FGF+  W++ +QWL V 
Sbjct: 114 VIGYVLVSFVTYFMIQAAGEMAVAYPTLPGNFNSYTSMFISKPFGFATVWLFFIQWLTVF 173

Query: 180 PLELVTASMTIKYWNQTINPDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXX 239
           PLEL+TAS+TIKYWN  IN D F+ IFYV L+ I+              N CKVLM    
Sbjct: 174 PLELITASLTIKYWNDKINADVFIVIFYVFLLFIHFFGVKAYGEAEFIFNSCKVLMIAGF 233

Query: 240 XXXXXXXNCGGAGNDGYLGARYWHDPGAFRGSDSINRFKGIVAVLVNAAFAYGGAEFSVL 299
                  NCGGAG DGY+GA+YW DPG+F   DS+ +FKGI  +LV A F+YGGAE   L
Sbjct: 234 IILSIVINCGGAGKDGYIGAKYWRDPGSFAEGDSVEKFKGICYILVTAYFSYGGAELFSL 293

Query: 300 TAAEQQNPQKSIRSASKKLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSATHASPFVI 359
           +  EQ+NP+KS   A+K+ +YRIL IY++T IL+GF VP N+D+L+GSGGSATHASP+V+
Sbjct: 294 SVNEQENPRKSTPQAAKQSIYRILIIYLLTMILIGFNVPHNNDQLMGSGGSATHASPYVL 353

Query: 360 AVASHGVRVVPHFXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPV 419
           A + HGV+VVPHF                            EQG+AP+FL+YVDR GRP+
Sbjct: 354 AASIHGVKVVPHFINAVILISVISVANSALYASPRLMCSLAEQGYAPKFLDYVDREGRPL 413

Query: 420 LCLLVSCVFGLLSFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRS 479
             L++  VFG++ FV+AS KEE VFTWL AI+GLSELFTW  I LSHVR R+ M + GRS
Sbjct: 414 RALILCAVFGVIGFVSASSKEEEVFTWLAAIAGLSELFTWSGIMLSHVRFRQCMKLHGRS 473

Query: 480 ADELGYVAWTGVWGAYYAMAMIVAILVGQFWVAISPVG-SNKLDANNFFENYLAMPILIF 538
            +E+G+ A TG+WG+ Y ++  + + + QFWVA++P     K+DA +FF++YLA PI +F
Sbjct: 474 EEEIGFRAVTGIWGSMYGISFNMLVFIAQFWVALAPPSLHGKVDAESFFQSYLAAPIWLF 533

Query: 539 LYLGYKIWTRDWRLLIPSSEVDLVAHRKIFDAEVLRHEQLEEKEQLRHAPWTTRLANFWC 598
            Y GY ++ RD+  L+P  ++DL  HR+I+D E++R E  E KE+++++    R+ +FWC
Sbjct: 534 FYFGYMLYKRDFTFLVPLDKIDLNFHRRIYDPELIRQEDEENKEKIKNSSVWVRMFHFWC 593

>NDAI0A05620 Chr1 (1268907..1270622) [1716 bp, 571 aa] {ON} 
          Length = 571

 Score =  550 bits (1418), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 272/575 (47%), Positives = 369/575 (64%), Gaps = 13/575 (2%)

Query: 29  ESPRSD----SRSDGLFRRFADSFRRHEAHNXXXXXXXXXXXXXLTPIESASKHKTLKQN 84
           +SPRSD    S+S+ L  RF DSFRR E+               +T          LK+ 
Sbjct: 5   QSPRSDDVEISKSN-LVHRFVDSFRRAESPELEENDLEDGTRSIVTKTH-------LKKA 56

Query: 85  IRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYCVIQSASELAIIY 144
           ++ RHV+M+S+ TGIGTG+LV N K L+  GPASL+IGY +VS + Y +IQ+A E+A+ Y
Sbjct: 57  MKSRHVVMMSIGTGIGTGLLVANAKGLYFSGPASLIIGYVLVSFVTYFMIQAAGEMAVAY 116

Query: 145 TSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKYWNQTINPDAFVT 204
            +L G FN+Y S  + K FGF+  W++ +QWL V PLEL+TAS+T+KYWN  IN D F+ 
Sbjct: 117 PTLPGSFNSYTSTFISKPFGFATVWLFFIQWLTVFPLELITASLTVKYWNDKINADVFII 176

Query: 205 IFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGGAGNDGYLGARYWHD 264
           IFY  L+ I+              N CKVLM           NCGGAG DGY+GA+YWHD
Sbjct: 177 IFYAFLLFIHFFGVKAYGETEFIFNSCKVLMVAGFIILSIVINCGGAGTDGYIGAKYWHD 236

Query: 265 PGAFRGSDSINRFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRILG 324
           PG+F     I RFKG+  +LV+A F+YGGAE   L+  EQ+NP+KS  +A+K+ +YRIL 
Sbjct: 237 PGSFADGPPITRFKGVCFILVSAYFSYGGAELFSLSVNEQENPRKSTPAAAKQSIYRILI 296

Query: 325 IYIMTAILLGFLVPWNSDELLGSGGSATHASPFVIAVASHGVRVVPHFXXXXXXXXXXXX 384
           IY+ T IL+GF VP NSDEL+G+G +ATHASP+V+A + H V+VVPHF            
Sbjct: 297 IYLATMILIGFNVPHNSDELMGAGSAATHASPYVLAASLHSVKVVPHFINAVILISVISV 356

Query: 385 XXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVSCVFGLLSFVAASPKEETVF 444
                           EQG+AP+FLNYVDR GRP+  L++  +FG++ FV+AS KEE VF
Sbjct: 357 ANSALYAAPRLMCSLAEQGYAPKFLNYVDREGRPLRGLILCALFGVIGFVSASSKEEEVF 416

Query: 445 TWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYVAWTGVWGAYYAMAMIVAI 504
           TWL AI+GLSELFTW  I LSH+R R+AM   G+S DE+G+ A TG+WG+YY  A  + +
Sbjct: 417 TWLAAIAGLSELFTWSGIMLSHIRFRQAMKFNGKSTDEIGFKAVTGIWGSYYGCAFNILV 476

Query: 505 LVGQFWVAISPVGS-NKLDANNFFENYLAMPILIFLYLGYKIWTRDWRLLIPSSEVDLVA 563
            + QFWVA+SP GS  K DA  FF++YLA PI +  Y GY I+ RD+ +L P  ++DL  
Sbjct: 477 FIAQFWVALSPPGSGGKCDAEAFFQSYLAAPIWLVFYFGYMIYKRDFTILNPLEKIDLDF 536

Query: 564 HRKIFDAEVLRHEQLEEKEQLRHAPWTTRLANFWC 598
           HR+I+D + ++ E  E KE+L+++    R+ ++WC
Sbjct: 537 HRRIYDPDFIKQEDEENKERLKNSSIWARIYHWWC 571

>TPHA0M01200 Chr13 complement(244556..246379) [1824 bp, 607 aa] {ON}
           Anc_3.284 YDR046C
          Length = 607

 Score =  550 bits (1417), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 275/613 (44%), Positives = 385/613 (62%), Gaps = 21/613 (3%)

Query: 1   MKDFELHNMKSPDNGVVESF-------------DSVEVLKEESPR-SDSRSDGLFRRFAD 46
           M DF   + KSPD  V+ +              D + +   ++   S  ++   +R F D
Sbjct: 1   MSDFVGKHEKSPDFSVINNSSLDYANNLASTNDDDISIASSQNRSLSHRKNTSYYRNFID 60

Query: 47  SFRRHEAHNXXXXXXXXXXXXXLTPIESASKHKTLKQNIRPRHVLMISLATGIGTGMLVG 106
           SF+R E  N                I+S S    +K++++ RHV+M+SL TGIGTG+LV 
Sbjct: 61  SFKRAEHGNLNEKSADLEDGT--ASIQSKSY---MKKSLKARHVIMMSLGTGIGTGLLVA 115

Query: 107 NGKSLHNGGPASLVIGYAIVSSMLYCVIQSASELAIIYTSLAGGFNAYPSLLVDKAFGFS 166
           N KSL  GGPASL+IGY IVS ++Y +IQ+A E+A+ Y +L G FN Y S+ + K++GF+
Sbjct: 116 NAKSLAYGGPASLIIGYVIVSFIVYFMIQAAGEMAVTYPTLPGNFNTYQSIFISKSWGFA 175

Query: 167 VSWVYCLQWLCVLPLELVTASMTIKYWNQTINPDAFVTIFYVVLVAINXXXXXXXXXXXX 226
             W++C+QW+ VLPLEL+T+S+TI+YW   +N D FV IFYV L+ I+            
Sbjct: 176 TVWLFCIQWITVLPLELITSSLTIQYWTD-LNGDIFVVIFYVFLLLIHFIGVKAYGETEF 234

Query: 227 XXNCCKVLMXXXXXXXXXXXNCGGAGNDGYLGARYWHDPGAFRGSDSINRFKGIVAVLVN 286
             N CK+LM           NCGGAGNDGY+G +YWH PG+F      +RFKGI  VLV 
Sbjct: 235 IFNLCKILMISGFIIFSIVVNCGGAGNDGYIGGKYWHTPGSFAEGGPTSRFKGICYVLVA 294

Query: 287 AAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRILGIYIMTAILLGFLVPWNSDELLG 346
             F+YGG E  VL+  EQ  P+K+  +A+KK +YRIL IY++T IL+GF VP NSD+L+G
Sbjct: 295 GYFSYGGTELYVLSVNEQAEPRKATPAAAKKSIYRILVIYLLTMILIGFNVPHNSDQLMG 354

Query: 347 SGGSATHASPFVIAVASHGVRVVPHFXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAP 406
           +GGS+THASP+V+A + HGV+VVPH                             EQG+AP
Sbjct: 355 AGGSSTHASPYVLAASIHGVKVVPHIINAVILISVVSVANSSLYASPRLLASLAEQGYAP 414

Query: 407 RFLNYVDRCGRPVLCLLVSCVFGLLSFVAASPKEETVFTWLLAISGLSELFTWFSISLSH 466
           + L Y+DR GRP++ LL+  VFG ++FVA+S KEE VFTWL AI+GLSE+FTW  I  SH
Sbjct: 415 KALTYIDREGRPLVALLLCAVFGCIAFVASSDKEEQVFTWLAAIAGLSEVFTWTGIMFSH 474

Query: 467 VRLRRAMTVQGRSADELGYVAWTGVWGAYYAMAMIVAILVGQFWVAISPVGS-NKLDANN 525
           VR R AM VQ +  DE+GY A  G++G+++     V +L+ QFWVA+SP GS   + A +
Sbjct: 475 VRFRLAMKVQNKDIDEVGYKATAGIYGSWFGSIFGVLVLIAQFWVALSPPGSGGAVSAES 534

Query: 526 FFENYLAMPILIFLYLGYKIWTRDWRLLIPSSEVDLVAHRKIFDAEVLRHEQLEEKEQLR 585
           FFENYLAMPI +F Y+ Y ++ ++W +L   S++DL AHR+I+D +++R E  E KE+L+
Sbjct: 535 FFENYLAMPIWVFFYIVYSVYNKEWTILTDLSKIDLDAHRRIYDPDLIRQEDAENKEKLK 594

Query: 586 HAPWTTRLANFWC 598
           ++P+  R+ NFWC
Sbjct: 595 NSPFWVRVYNFWC 607

>KNAG0H01150 Chr8 (193585..195438) [1854 bp, 617 aa] {ON} 
          Length = 617

 Score =  548 bits (1413), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 272/590 (46%), Positives = 369/590 (62%), Gaps = 15/590 (2%)

Query: 13  DNGVVESFDSVEVLKEESPRSDSRSDGLFRRFADSFRRHEAHNXXXXXXXXXXXXXLTPI 72
            NG+  S + +E L   +   ++   GL  RF DSF+R +                   +
Sbjct: 39  QNGMEHS-EKLENLASSTALDEAPRTGLVHRFMDSFKRADGQRAGFDD---------NDL 88

Query: 73  ESASK----HKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSS 128
           ES ++       LK++++ RHV+M++L TGIGTG+LV N   LH  GPA LV+ Y +VS 
Sbjct: 89  ESGTRSFISESHLKKSMKSRHVVMMTLGTGIGTGLLVANASGLHASGPAPLVLAYGLVSF 148

Query: 129 MLYCVIQSASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASM 188
           + Y +IQ+A E+A+ Y +L G FN+Y SL V K FGF+  W++ LQWL VLPLEL+T+S+
Sbjct: 149 VTYFMIQAAGEMAVTYPTLPGNFNSYMSLFVSKPFGFATVWLFLLQWLTVLPLELITSSL 208

Query: 189 TIKYWNQTINPDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNC 248
           TIKYWN  IN D FV IFYV L+ I+              N CK+LM           NC
Sbjct: 209 TIKYWNDKINSDVFVVIFYVFLLFIHFFGVQAYGETEFIFNSCKILMIAGFIIFSIVVNC 268

Query: 249 GGAGNDGYLGARYWHDPGAFRGSDSINRFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNPQ 308
           GGAG+DGY+G +YWHDPGAF    +I RFKGI  +LV A F+YGG E  VL+  EQ+NP+
Sbjct: 269 GGAGHDGYIGGKYWHDPGAFTSHTNIGRFKGICFILVTAYFSYGGTELYVLSVNEQENPR 328

Query: 309 KSIRSASKKLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSATHASPFVIAVASHGVRV 368
           KS   A+K+ +YRI+ IY++T IL+GF VP ++D+L+GS GSATHASP+V+A + HGVR+
Sbjct: 329 KSTPQAAKQSIYRIVVIYLLTMILIGFNVPHDNDQLMGSHGSATHASPYVLAASIHGVRI 388

Query: 369 VPHFXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVSCVF 428
           VPHF                            +QG+AP+FL Y+DR GRP+  L    +F
Sbjct: 389 VPHFINAVILISVISVANSSLYASPRLLCSLAQQGYAPKFLTYIDRQGRPLTALATCSLF 448

Query: 429 GLLSFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYVAW 488
           G++ F AAS +EE VFTWL AI+GLSELFTW  I LSHVR R+AM VQGR  +ELGY A 
Sbjct: 449 GVIGFAAASNQEEQVFTWLAAIAGLSELFTWSGIMLSHVRFRQAMKVQGRDLNELGYKAV 508

Query: 489 TGVWGAYYAMAMIVAILVGQFWVAISPVGSNKLDANNFFENYLAMPILIFLYLGYKIWTR 548
           +GVWG+ Y +   + +   QFWVA++P GS K  A +FFE+YLA PI    Y GY +W +
Sbjct: 509 SGVWGSVYGVFFNILVFFAQFWVALAPPGS-KPTALSFFESYLAFPIFFTFYFGYMLWNK 567

Query: 549 DWRLLIPSSEVDLVAHRKIFDAEVLRHEQLEEKEQLRHAPWTTRLANFWC 598
           D+  LIP   +DL  HR+++D E +R E+ E+K +L+++   TR+  FWC
Sbjct: 568 DFTFLIPLESIDLDFHRRVYDPEFIRQEREEKKIKLKNSSIWTRMYYFWC 617

>Kpol_1065.13 s1065 (28709..30499) [1791 bp, 596 aa] {ON}
           (28709..30499) [1791 nt, 597 aa]
          Length = 596

 Score =  546 bits (1408), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 275/603 (45%), Positives = 373/603 (61%), Gaps = 12/603 (1%)

Query: 1   MKDFELHNMKSPDNGVVESFDSVEVLKEESPRSDSRSDGLFRRFADSFRR---HEAHNXX 57
           M D      KSP     E    V      S   +S++ G FR F DS++R    + HN  
Sbjct: 1   MPDSFPKETKSPSYASSEHSSIVSANSYNSSAGNSKTRGYFRNFIDSYKRADPSQLHNAR 60

Query: 58  XXXXXXXXXXXLTPIESASKHKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPA 117
                         I S       K+++  RHV+M+SL TGIGTG+LV N K L+ GGP 
Sbjct: 61  SEDVE-------DGIASIRSDTQFKKSLSSRHVIMMSLGTGIGTGLLVANAKGLYYGGPG 113

Query: 118 SLVIGYAIVSSMLYCVIQSASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLC 177
           SL+IGY +VS + Y +IQ+A E+A+ Y +L G FNAY S+ + K++GF+  W++C+QWL 
Sbjct: 114 SLIIGYVLVSFVTYFMIQAAGEMAVAYPTLPGNFNAYQSIFISKSWGFATVWLFCIQWLT 173

Query: 178 VLPLELVTASMTIKYWNQTINPDAFVTIFYVVLVAINXXXXXXXX-XXXXXXNCCKVLMX 236
           VLPLEL+T+S+TIKYWN  IN D FV IFYV LVAI+               N CK+LM 
Sbjct: 174 VLPLELITSSLTIKYWNDKINADIFVMIFYVFLVAIHLVGGIRAYGETEFLFNSCKILMV 233

Query: 237 XXXXXXXXXXNCGGAGNDGYLGARYWHDPGAFRGSDSINRFKGIVAVLVNAAFAYGGAEF 296
                     N GGAGNDGY+G +YWH+PG+F   D+ +RFKGI  VLV+  F+YGG E 
Sbjct: 234 IGFIILSIVINAGGAGNDGYIGGKYWHEPGSFAEGDATSRFKGICLVLVSGYFSYGGTEL 293

Query: 297 SVLTAAEQQNPQKSIRSASKKLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSATHASP 356
            VL+  EQ  P+K+  +A+KK +YRIL IY++T IL+GF VP N+D+L+G+GGSATHASP
Sbjct: 294 YVLSVNEQAEPRKATPAAAKKSIYRILIIYLLTMILIGFNVPHNNDQLMGAGGSATHASP 353

Query: 357 FVIAVASHGVRVVPHFXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCG 416
           +V+A   HGV++VPHF                             QG+AP+ L+YVDR G
Sbjct: 354 YVLAATIHGVKIVPHFINAVILISVISVANSSLFAGPRLLSSLATQGYAPKILSYVDREG 413

Query: 417 RPVLCLLVSCVFGLLSFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQ 476
           RP++ L +S + GL++FV+ +  EE VFTWL AI+GLSE+FTW  I  SHVR R AM VQ
Sbjct: 414 RPLVALGISFLIGLIAFVSCTSHEEEVFTWLAAIAGLSEIFTWSGIMFSHVRFRAAMKVQ 473

Query: 477 GRSADELGYVAWTGVWGAYYAMAMIVAILVGQFWVAISPVGS-NKLDANNFFENYLAMPI 535
           G+  +ELGY A TGVWG+ Y     V +L+ QFWVA++P+G+  K DA  FFE+YLA PI
Sbjct: 474 GKDINELGYKANTGVWGSAYGAFFGVLVLIAQFWVALAPIGNGGKCDAEAFFESYLAFPI 533

Query: 536 LIFLYLGYKIWTRDWRLLIPSSEVDLVAHRKIFDAEVLRHEQLEEKEQLRHAPWTTRLAN 595
            +  Y GY I+ +D+ LL P  ++DL ++R+I+D E+++ E  E KE L+  P   ++  
Sbjct: 534 WVACYFGYMIYNKDFTLLSPLDKIDLDSYRRIYDPELIKQEDEENKENLKSRPLYYKIYR 593

Query: 596 FWC 598
           FWC
Sbjct: 594 FWC 596

>KLTH0C05170g Chr3 (449510..451306) [1797 bp, 598 aa] {ON} similar
           to uniprot|P38084 Saccharomyces cerevisiae YBR068C BAP2
           High-affinity leucine permease functions as a
           branched-chain amino acid permease involved in the
           uptake of leucine isoleucine and valine contains 12
           predicted transmembrane domains and to YDR046C
           uniprot|P41815 Saccharomyces cerevisiae YDR046C BAP3
           Amino acid permease involved in the uptake of cysteine,
           leucine, isoleucine and valine
          Length = 598

 Score =  543 bits (1400), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 266/583 (45%), Positives = 366/583 (62%), Gaps = 7/583 (1%)

Query: 18  ESFDSVEVLKEESPRSDSRSDGLFRRFADSFRRHEAHNXXXXXXXXXXXXXLTPIESASK 77
           ES  + E+            +G + RF DSF+R +  +                +++   
Sbjct: 21  ESVTASELYDSRPHAQHEEHEGAWCRFRDSFKRAQKRSVPQGGDLET-----ASVQTDLT 75

Query: 78  HKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYCVIQSA 137
              L+++IRPRHV M+S+ TGIGTG+LV NGKSL  GGP  L+IGYA VS + Y ++Q+A
Sbjct: 76  DGRLRRSIRPRHVAMMSVCTGIGTGLLVANGKSLRYGGPGGLIIGYAAVSVVAYIMMQAA 135

Query: 138 SELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKYWNQTI 197
            E+A+ Y S+ G FNAY S+ + K FGF+  W+YCLQWL V PLEL+TAS+TIKYW  ++
Sbjct: 136 GEMAVAYPSMPGNFNAYSSVFISKPFGFASVWLYCLQWLTVFPLELITASLTIKYWTDSV 195

Query: 198 NPDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGGAGNDGYL 257
           N D F+ IFYV ++ I+                CKVLM           NCGGAGN GY+
Sbjct: 196 NADVFIAIFYVFILFIHFFGSRGYGESEFIFGLCKVLMIAGFVILAIVINCGGAGNSGYI 255

Query: 258 GARYWHDPGAFRGSDSINRFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKK 317
           GARYWHDPGAF   D  ++FKG   VLV   F+YGG E   +T  EQ +P+++I SA+K+
Sbjct: 256 GARYWHDPGAFAVGDPASKFKGFCYVLVTGYFSYGGTELYAMTVNEQSSPRRAIHSATKQ 315

Query: 318 LVYRILGIYIMTAILLGFLVPWNSDELLGSGG-SATHASPFVIAVASHGVRVVPHFXXXX 376
            +YRIL IY++T +L+GFLVP  SDEL+GSGG SATHASP+V+AV+ HGV+VVPH     
Sbjct: 316 CIYRILVIYMLTMVLIGFLVPHTSDELMGSGGKSATHASPYVLAVSLHGVKVVPHIVNAV 375

Query: 377 XXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVSCVFGLLSFVAA 436
                                   EQG+AP+FL Y+DR GRP++ L+   V GLL+FVAA
Sbjct: 376 ILIAVVSVGNSAMYSGPRVLNALAEQGYAPKFLAYIDRAGRPLMALIACSVIGLLAFVAA 435

Query: 437 SPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYVAWTGVWGAYY 496
           S  EE VFTWL AI+GLSELFTW +I LSH+R R+AM   G S  +LGY + TG+WG+ Y
Sbjct: 436 SDHEEDVFTWLAAIAGLSELFTWSAILLSHIRFRQAMKYHGYSLSQLGYKSITGLWGSIY 495

Query: 497 AMAMIVAILVGQFWVAISPVGSN-KLDANNFFENYLAMPILIFLYLGYKIWTRDWRLLIP 555
            +   + + V QFWVA++P+G+N K D  +FF++YLA P+    +LGY +++ +W +L P
Sbjct: 496 GVCFNILVFVAQFWVALAPIGNNGKTDVLSFFQSYLAFPLWFVFFLGYMVYSGEWMILRP 555

Query: 556 SSEVDLVAHRKIFDAEVLRHEQLEEKEQLRHAPWTTRLANFWC 598
             ++D+   R ++D E +  E+LE K  L+++ W  RL +FWC
Sbjct: 556 LKDIDINHFRCVYDEERIEQEKLEHKTMLQNSNWLGRLKHFWC 598

>AGR040C Chr7 complement(782283..784004) [1722 bp, 573 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR069C
           (TAT1)
          Length = 573

 Score =  541 bits (1393), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 273/593 (46%), Positives = 366/593 (61%), Gaps = 20/593 (3%)

Query: 6   LHNMKSPDNGVVESFDSVEVLKEESPRSDSRSDGLFRRFADSFRRHEAHNXXXXXXXXXX 65
           + +M S  +   +    V+V        D R  G+ R F DSFRR    +          
Sbjct: 1   MQDMTSSISSSKKDESYVKVSPNTVGSGDERRTGIMRGFIDSFRRGRDVDLMCKADA--- 57

Query: 66  XXXLTPIESASKHKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAI 125
                  E  +  K +K+ I+ RH+LMI+L TGIGTG+LVGNG +L   GPA L++GY +
Sbjct: 58  -------EDGTTAK-MKKTIKTRHLLMITLGTGIGTGLLVGNGSALAKAGPAGLILGYVV 109

Query: 126 VSSMLYCVIQSASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVT 185
            S+MLY ++++A EL I Y+ + G + AY SLLVD A GFSVSWVYC+QW+ V PL+LVT
Sbjct: 110 SSAMLYLIVEAAGELGICYSGMTGNYTAYSSLLVDPAMGFSVSWVYCIQWMTVFPLQLVT 169

Query: 186 ASMTIKYWNQTINPDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXX 245
           A+M I+YW   INPD FV I Y V+V IN              N CKVLM          
Sbjct: 170 AAMIIQYWTD-INPDIFVAIIYAVIVFINLFGAKGYAEAEFFFNLCKVLMIIGFVILGVV 228

Query: 246 XNCGGAGNDGYLGARYWHDPGAFRGSDSINRFKGIVAVLVNAAFAYGGAEFSVLTAAEQQ 305
            NCGGAG  GY+G +YWH+P  F     +N FKG+  V   AAFAYGG E  VL+A+EQ+
Sbjct: 229 INCGGAGTSGYIGDKYWHEPRPF-----MNGFKGLCFVFCYAAFAYGGIEVMVLSASEQE 283

Query: 306 NPQKSIRSASKKLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSATHASPFVIAVASHG 365
           NP+KSI SA KK++YRI+ IY++T +++ FLVP +   L   G   + ASP VIAV+ HG
Sbjct: 284 NPRKSISSACKKVIYRIVLIYLLTTVIVCFLVPADHPSLASEG---SRASPLVIAVSFHG 340

Query: 366 VRVVPHFXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVS 425
           V++VPH                             EQG+AP+   Y+DR GRP+    V+
Sbjct: 341 VKIVPHIINAVILIAVVSVGNSSLYSAPRLLLSLAEQGYAPKIFTYIDRQGRPLPAFFVA 400

Query: 426 CVFGLLSFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGY 485
            VFGLL+F+AASP ++ VF WLLAISGLS++F W SI +SH+R R AM  QGRS  E+GY
Sbjct: 401 MVFGLLAFLAASPAQDDVFGWLLAISGLSQMFIWMSICISHIRFRDAMKAQGRSMGEVGY 460

Query: 486 VAWTGVWGAYYAMAMIVAILVGQFWVAISPVGSNKLDANNFFENYLAMPILIFLYLGYKI 545
            A TG WG++ A+     IL+ QFWVAISPV +  +DA +FF++YLA PIL+  Y GYKI
Sbjct: 461 KARTGYWGSWIAVVTAFLILIAQFWVAISPVETKGVDARSFFQSYLAFPILLLAYFGYKI 520

Query: 546 WTRDWRLLIPSSEVDLVAHRKIFDAEVLRHEQLEEKEQLRHAPWTTRLANFWC 598
           + +DWR+ IP+SEVDL++HR++FD + L+ E LE K +L+ +P   R+ +FWC
Sbjct: 521 YHKDWRICIPASEVDLISHRQVFDEDELKQEDLEWKLKLKSSPIWVRIYHFWC 573

>ZYRO0F17446g Chr6 (1451431..1453332) [1902 bp, 633 aa] {ON} similar
           to uniprot|P48813 Saccharomyces cerevisiae YDR508C GNP1
           High-affinity glutamine permease also transports Leu Ser
           Thr Cys Met and Asn expression is fully dependent on
           Grr1p and modulated by the Ssy1p-Ptr3p-Ssy5p (SPS)
           sensor of extracellular amino acids
          Length = 633

 Score =  541 bits (1394), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 266/601 (44%), Positives = 376/601 (62%), Gaps = 23/601 (3%)

Query: 10  KSPDNGVVESFDSV------------EVLKEESPRSDSRSDGLFRRFADSFRRHEA---- 53
           +SP +  VE FD +            E    E        + LFR F DSF+R E     
Sbjct: 24  RSPPDNEVEYFDKLGDARQYTSNLEGEGTPTEGVSRHRIKNPLFRNFIDSFKRGETTARI 83

Query: 54  ---HNXXXXXXXXXXXXXLTPIESAS---KHKTLKQNIRPRHVLMISLATGIGTGMLVGN 107
               N                I S     K + LK++I  RH++ +++ +G+GTG+LVGN
Sbjct: 84  ADLENDLTTAVSPQLSNYHGSIPSDEVVIKKEELKRDINQRHMVFMAIGSGVGTGLLVGN 143

Query: 108 GKSLHNGGPASLVIGYAIVSSMLYCVIQSASELAIIYTSLAGGFNAYPSLLVDKAFGFSV 167
             +L++ GPA L+IGYA++ + +YCVIQ+A EL + Y +L GGFNAYP++LV  +F FSV
Sbjct: 144 ASTLNSAGPAGLLIGYALMGTCVYCVIQAAGELGVTYANLIGGFNAYPAILVAPSFAFSV 203

Query: 168 SWVYCLQWLCVLPLELVTASMTIKYWNQTINPDAFVTIFYVVLVAINXXXXXXXXXXXXX 227
            W+Y LQWLC+ PLELVTAS+TIKYW   ++PD FV IFY++++ IN             
Sbjct: 204 GWIYTLQWLCMTPLELVTASLTIKYWTTKVDPDVFVVIFYLLILLINFFGSKGYAEADFF 263

Query: 228 XNCCKVLMXXXXXXXXXXXNCGGAGNDGYLGARYWHDPGAFRGSDSINRFKGIVAVLVNA 287
            NC K+ M            CGGAG+DGYLG +YWH+PGAFRG  +I+ FKG+ +V V +
Sbjct: 264 FNCMKLAMISGFFILGIVVACGGAGHDGYLGGKYWHNPGAFRGEKAIDHFKGVSSVFVTS 323

Query: 288 AFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRILGIYIMTAILLGFLVPWNSDELLGS 347
           AFA+GG+EF  L+A+EQ NP+KSI SA+K ++YRI+ +Y+ +  +LGFLVPW+S +L  S
Sbjct: 324 AFAFGGSEFVALSASEQANPRKSIPSAAKLILYRIIWVYLTSITILGFLVPWDSPQLQPS 383

Query: 348 GGSATHASPFVIAVASHGVRVVPHFXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPR 407
                  SP+V+A+A HGV+VVPH                             ++G+AP+
Sbjct: 384 -SDGKKTSPYVVAIAMHGVKVVPHLINAVILMAVLSVSNSAFFYSSRLLLSLSQRGYAPK 442

Query: 408 FLNYVDRCGRPVLCLLVSCVFGLLSFVAASPKEETVFTWLLAISGLSELFTWFSISLSHV 467
           + +YVDR GRPV  +L+S +FG++ F A S KE  VF+WLLAISGLS +FT+FSI +SH+
Sbjct: 443 WFDYVDRKGRPVRAMLISALFGVICFCATSKKETDVFSWLLAISGLSTIFTYFSICVSHI 502

Query: 468 RLRRAMTVQGRSADELGYVAWTGVWGAYYAMAMIVAILVGQFWVAISPVGSNKLDANNFF 527
           R+R AM VQGRS  ELG+ +  G +G++YA  ++V  L+ +FWVA++P+G  KLDA +FF
Sbjct: 503 RMRSAMKVQGRSLGELGFRSQVGTYGSFYACLLLVLSLMAEFWVALAPIGEGKLDAESFF 562

Query: 528 ENYLAMPILIFLYLGYKIWTRDWRLLIPSSEVDLVAHRKIFDAEVLRHEQLEEKEQLRHA 587
           ENYLA PI I  Y GY IW +D+R+ I S ++DL   R++FD ++++ E  E  EQ+R+A
Sbjct: 563 ENYLAAPIGIVFYFGYMIWKKDFRIFIRSKDIDLDFKRQVFDEDLIKQEDEEYAEQMRNA 622

Query: 588 P 588
           P
Sbjct: 623 P 623

>Kwal_27.10538 s27 (380769..382577) [1809 bp, 602 aa] {ON} YBR068C
           (BAP2) - probable amino acid permease for leucine,
           valine, and isoleucine [contig 35] FULL
          Length = 602

 Score =  538 bits (1385), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/616 (45%), Positives = 380/616 (61%), Gaps = 32/616 (5%)

Query: 1   MKDFELHNM---KSPDNGVVESFDSVEV----LKEESPRSDSRSDGLFRRFADSFRRHEA 53
           M+  E+H+M   K  D+       SV+     + +E    D+ +   + RF +SF+R E 
Sbjct: 1   MERSEIHSMSEIKDSDDSAQPVLSSVKSESGSIGQEWNAWDNENRNAWGRFVNSFKRAEK 60

Query: 54  HNXXXXXXXXXXXXXLTP----IESASKHKT-----LKQNIRPRHVLMISLATGIGTGML 104
           H+              TP    +E A+ H       LK++I+PRHV M+S+ TGIGTG+L
Sbjct: 61  HS--------------TPSNGDLEHATTHSVASSSPLKRSIKPRHVAMMSICTGIGTGLL 106

Query: 105 VGNGKSLHNGGPASLVIGYAIVSSMLYCVIQSASELAIIYTSLAGGFNAYPSLLVDKAFG 164
           V NGKSL  GGPA L+IGYA VS + Y ++Q+A E+A+ Y SL G FNAY S L+ + FG
Sbjct: 107 VANGKSLRFGGPAGLIIGYAAVSVVAYIMMQAAGEMAVAYPSLPGNFNAYSSQLISRPFG 166

Query: 165 FSVSWVYCLQWLCVLPLELVTASMTIKYWNQTINPDAFVTIFYVVLVAINXXXXXXXXXX 224
           F+  W+YC+QWL VLPLEL+TAS+TIKYWN +IN D F+ IFYV ++ I+          
Sbjct: 167 FATVWLYCIQWLTVLPLELITASLTIKYWNDSINADVFIAIFYVFILFIHFFGSRGYGES 226

Query: 225 XXXXNCCKVLMXXXXXXXXXXXNCGGAGNDGYLGARYWHDPGAFRGSDSINRFKGIVAVL 284
                 CKVLM           NCGGAG+  Y+GA+YW+DPGAF       +FKG+  VL
Sbjct: 227 EFIFGICKVLMIIGFVILSIVINCGGAGDRKYIGAKYWYDPGAFAVGSGATKFKGVAYVL 286

Query: 285 VNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRILGIYIMTAILLGFLVPWNSDEL 344
           V   F+YGG E   +T  EQ NP+++I+S +K+ +YRIL IY++T IL+GFLVP  S EL
Sbjct: 287 VTGYFSYGGTELYAMTVNEQSNPRRAIQSITKQCIYRILLIYMLTMILIGFLVPHTSSEL 346

Query: 345 LGSGG-SATHASPFVIAVASHGVRVVPHFXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQG 403
           +GS G SATHASP+V+AV+ HGV++VPH                             EQG
Sbjct: 347 MGSSGKSATHASPYVLAVSLHGVKIVPHIINAVILIAVISVGNSAMYSGPRILNTLAEQG 406

Query: 404 FAPRFLNYVDRCGRPVLCLLVSCVFGLLSFVAASPKEETVFTWLLAISGLSELFTWFSIS 463
           +APRFL YVDR GRP++ L+   VFGLL+FVAAS  EE VFTWL AI+GLSELFTW +I 
Sbjct: 407 YAPRFLAYVDRAGRPLVALIACSVFGLLAFVAASDCEEDVFTWLAAIAGLSELFTWSAIM 466

Query: 464 LSHVRLRRAMTVQGRSADELGYVAWTGVWGAYYAMAMIVAILVGQFWVAISPVGSN-KLD 522
           LSHVR R+AM    R   ELGY A TGV G+   ++  + + + QFWV+I+P G + KLD
Sbjct: 467 LSHVRFRQAMRYNNRPLSELGYKANTGVLGSVLGLSFNILVFIAQFWVSIAPFGKDGKLD 526

Query: 523 ANNFFENYLAMPILIFLYLGYKIWTRDWRLLIPSSEVDLVAHRKIFDAEVLRHEQLEEKE 582
             +FF++YLA P+ + L+ GY I  R+W ++ P  ++DL  +R I+D + L  E LE K 
Sbjct: 527 VLSFFQSYLAFPLWVVLFFGYMIVFRNWEIIKPLKDIDLDHYRSIYDQDRLYQEDLEHKI 586

Query: 583 QLRHAPWTTRLANFWC 598
            ++++ W  +L NFWC
Sbjct: 587 LIQNSSWARKLHNFWC 602

>KAFR0A01120 Chr1 complement(216442..218220) [1779 bp, 592 aa] {ON}
           Anc_3.284 YDR046C
          Length = 592

 Score =  533 bits (1372), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 258/571 (45%), Positives = 356/571 (62%), Gaps = 9/571 (1%)

Query: 28  EESPRSDSRSDGLFRRFADSFRRHEAHNXXXXXXXXXXXXXLTPIESASKHKTLKQNIRP 87
           E + R DS    +  RF +SF+R E                    ++      LK+ ++ 
Sbjct: 31  EPASRQDST---MIHRFVNSFKRAEQPPLKQDSDLEEDT------DTIVTDTQLKKTMKS 81

Query: 88  RHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYCVIQSASELAIIYTSL 147
           RHV+M+SL TGIGTG+LV N + LH  GPA LVI Y +VS + Y +IQ+A E+A++Y +L
Sbjct: 82  RHVVMMSLGTGIGTGLLVANAQGLHKAGPAPLVIAYGMVSFVTYFMIQAAGEMAVVYPTL 141

Query: 148 AGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKYWNQTINPDAFVTIFY 207
            G FNAY S  + K FGF+  W++ +QWL VLPLEL+TA+MT++YWN +IN D +V IFY
Sbjct: 142 PGNFNAYISTFISKPFGFATVWLFFIQWLTVLPLELITAAMTVQYWNDSINADVYVVIFY 201

Query: 208 VVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGGAGNDGYLGARYWHDPGA 267
           V L+ I+              N CK+L            N GGAGN GY+GA+YWHDPGA
Sbjct: 202 VFLLFIHFFGVKAYGETEFIFNLCKILFVGGFIIFSIVVNVGGAGNSGYIGAKYWHDPGA 261

Query: 268 FRGSDSINRFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRILGIYI 327
           F    +  RFKG+  VLV A F+YGG E   L+  EQ+NP++S  +A+K+ +YRI+ IY+
Sbjct: 262 FTSDTNAGRFKGVCYVLVTAYFSYGGMELFALSVNEQENPRRSTPTAAKQSIYRIVVIYL 321

Query: 328 MTAILLGFLVPWNSDELLGSGGSATHASPFVIAVASHGVRVVPHFXXXXXXXXXXXXXXX 387
           +T IL+GF VP NS+EL+GSGGS THASP+V+A + HGV+VVPH                
Sbjct: 322 LTMILVGFNVPSNSNELMGSGGSVTHASPYVLAASIHGVKVVPHIVNAVILISLISVGNS 381

Query: 388 XXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVSCVFGLLSFVAASPKEETVFTWL 447
                        +QGFAP+F++YVDR GRP+  L+V  VFG++ FVA S KEE VF WL
Sbjct: 382 ALYAAPRLMCALAQQGFAPKFMDYVDREGRPLFALIVCSVFGVIGFVACSSKEEQVFNWL 441

Query: 448 LAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYVAWTGVWGAYYAMAMIVAILVG 507
            AI+GL+ELFTW  I +SH+R R+AM +Q +S DE+GY +  GV+G+Y+ +   + + V 
Sbjct: 442 AAIAGLAELFTWSGIMISHIRFRQAMKLQNKSLDEVGYKSPFGVYGSYFGVFFNLLVFVA 501

Query: 508 QFWVAISPVGSNKLDANNFFENYLAMPILIFLYLGYKIWTRDWRLLIPSSEVDLVAHRKI 567
           QFWVA++P    ++ A+ FFE+YLA PI    Y GY IW RD+ L      VDL  HR+I
Sbjct: 502 QFWVALAPPMYTEMSADTFFESYLAFPIFFAFYFGYMIWKRDFTLFSDLESVDLDYHRRI 561

Query: 568 FDAEVLRHEQLEEKEQLRHAPWTTRLANFWC 598
           +D E+++ E  E+KE L+++P   R+  FWC
Sbjct: 562 YDPELVKQEDEEKKEMLKNSPMWKRMYYFWC 592

>Ecym_2663 Chr2 complement(1278309..1280078) [1770 bp, 589 aa] {ON}
           similar to Ashbya gossypii AGR039C
          Length = 589

 Score =  530 bits (1365), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/563 (49%), Positives = 368/563 (65%), Gaps = 9/563 (1%)

Query: 39  GLFRRFADSFRRHEA-HNXXXXXXXXXXXXXLTPIESASKHKTLKQNIRPRHVLMISLAT 97
           GLF+RF DSF+R +   +             L   +     + LK NI+ RH+ MISL T
Sbjct: 33  GLFQRFKDSFKRADVVEDVHEKEGQEEYATGLNKTQ-----QKLKHNIKTRHLTMISLGT 87

Query: 98  GIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYCVIQSASELAIIYTSLAGGFNAYPSL 157
           GIGTG+LV +GK+LH GGP  L+IGY   S+MLYCV+Q+  EL + Y +L G +NAYP+ 
Sbjct: 88  GIGTGLLVASGKALHYGGPGGLLIGYLTTSTMLYCVVQACCELGVAYATLPGNYNAYPTF 147

Query: 158 LVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKYWNQTINPDAFVTIFYVVLVAINXXX 217
           LVD+ FGF+V+ VY LQW  VLPLELVTASMTIKYW +++NPD FV IFY+ +V I+   
Sbjct: 148 LVDRGFGFAVALVYGLQWAIVLPLELVTASMTIKYWTESVNPDVFVAIFYLFIVFIHFFG 207

Query: 218 XXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGGAGNDGYLGARYWHDPGAFRGSDSINRF 277
                      N  KVL+           NC GA   GY+GA+YW +PG F G  SIN  
Sbjct: 208 SRGYAESEFIFNTLKVLLMAGFIIMGISLNC-GASKLGYIGAKYWSNPGTFAGERSINHL 266

Query: 278 KGIVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRILGIYIMTAILLGFLV 337
           KGI +V V +AFAYGG+EF  LTAAEQ NP++S+ SA+K+ +YR++ ++++   L+ FLV
Sbjct: 267 KGICSVWVQSAFAYGGSEFIALTAAEQANPRESVPSATKRWLYRVVVVFLIPIALICFLV 326

Query: 338 PWNSDELL-GSGGSATHASPFVIAVASHGVRVVPHFXXXXXXXXXXXXXXXXXXXXXXXX 396
           P+ SD+LL  SG SA+HASPFVIA A HGV++VPH                         
Sbjct: 327 PYTSDQLLSSSGASASHASPFVIAAAYHGVKIVPHIINAIILTSVISVGNSGMYSAPRIL 386

Query: 397 XXXXEQGFAPRFLNYVDRCGRPVLCLLVSCVFGLLSFVAASPKEETVFTWLLAISGLSEL 456
               E G  P+   YVDR GRP+  LL  CVFGLLSFVAAS  +E+VFTWL AI+GLS+L
Sbjct: 387 LSLAENGLCPKIFTYVDRAGRPLATLLFVCVFGLLSFVAASKNQESVFTWLTAIAGLSQL 446

Query: 457 FTWFSISLSHVRLRRAMTVQGRSADELGYVAWTGVWGAYYAMAMIVAILVGQFWVAISPV 516
           FTW SI+LSH+R R AM VQGRS  ELGY + TG  G+YYA+   + +LV QFW+AI+P+
Sbjct: 447 FTWTSIALSHIRFRAAMKVQGRSLGELGYTSTTGAIGSYYAVFFNIVVLVAQFWIAIAPI 506

Query: 517 GSN-KLDANNFFENYLAMPILIFLYLGYKIWTRDWRLLIPSSEVDLVAHRKIFDAEVLRH 575
             + +LDA +FF+NYLA  +L+  Y+GYKIW R+ +LLIP  ++DL  HR+IFD EVL+ 
Sbjct: 507 DKHGELDAESFFKNYLAFAVLVLFYVGYKIWYREVQLLIPVDKIDLETHRQIFDEEVLQQ 566

Query: 576 EQLEEKEQLRHAPWTTRLANFWC 598
           E+LE KE+++ A +  R   FWC
Sbjct: 567 EELERKERMKTASFKQRFIAFWC 589

>AGR038C Chr7 complement(777529..779271) [1743 bp, 580 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR046C
           (BAP3) and YBR068C (BAP2); Tandem gene duplication in
           this genome
          Length = 580

 Score =  526 bits (1356), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 257/588 (43%), Positives = 363/588 (61%), Gaps = 17/588 (2%)

Query: 19  SFDSVEVLKEE-------SPRSDS-RSDGLFRRFADSFRRHEAHNXXXXXXXXXXXXXLT 70
           S DSV    E+       SP   S  S G FRRF DSFRR +                  
Sbjct: 2   SADSVNKFNEKTVVQTAYSPSYASPESTGPFRRFVDSFRREDTSRSGDLEDGE------- 54

Query: 71  PIESASKHKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSML 130
            I S    K L+Q +R RHV+M+SL TGIGTG+LV N  SLH GGPA L+IGY +VS + 
Sbjct: 55  -INSTDTTK-LQQRMRTRHVVMMSLGTGIGTGLLVANAASLHYGGPAGLLIGYLLVSIVS 112

Query: 131 YCVIQSASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTI 190
           Y ++ +A E+A+ Y +L G FNAY S+ + K FGF+  W++CLQWL V PLEL+TA++ I
Sbjct: 113 YIMMHAAGEMAVAYPTLPGNFNAYSSIFISKPFGFATVWLFCLQWLTVFPLELITATIVI 172

Query: 191 KYWNQTINPDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGG 250
           KYW  ++N + FV IFY+ ++ I+              N CKVLM           N G 
Sbjct: 173 KYWKVSVNANVFVVIFYLFIICIHFFGARGYGETEFIFNMCKVLMIVGFVIVGILINVGA 232

Query: 251 AGNDGYLGARYWHDPGAFRGSDSINRFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNPQKS 310
            G+ GY+G RYW +PG+F     +++ KG   VLV A F++GG E   L+  E  NP+ +
Sbjct: 233 IGDTGYIGDRYWRNPGSFVSGTPLDKLKGTAYVLVTAYFSFGGMELYALSVNELPNPKTA 292

Query: 311 IRSASKKLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSATHASPFVIAVASHGVRVVP 370
           I SA KK VYRIL +Y++T I++GFLVP +SD L+GSG +  H SP+V+A+  HGV+V+P
Sbjct: 293 IPSACKKGVYRILLVYLLTMIMIGFLVPHDSDRLMGSGSNDVHPSPYVLAIEMHGVKVLP 352

Query: 371 HFXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVSCVFGL 430
           H                             +QG+AP+ L+Y+DR GRP++ L++  +FGL
Sbjct: 353 HIVNAVILISVISVGNSAMYSAPRLLCALAQQGYAPKQLDYIDREGRPLISLILCAIFGL 412

Query: 431 LSFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYVAWTG 490
           ++F AAS  +E +F WL AI+GLSELFTW SI LSH R R+AM +QGRS + LGY A TG
Sbjct: 413 IAFSAASDNQEKIFIWLAAIAGLSELFTWTSICLSHFRFRQAMKLQGRSLETLGYRAITG 472

Query: 491 VWGAYYAMAMIVAILVGQFWVAISPVGSNKLDANNFFENYLAMPILIFLYLGYKIWTRDW 550
            WG+ YA+   + + + QFWVA+ P+   K+D  +FF+NY+A P+ + ++LGY +++R+W
Sbjct: 473 QWGSLYAVFFNLLVFIAQFWVALVPIAKKKVDVLSFFQNYMAFPLWLIMFLGYMVYSRNW 532

Query: 551 RLLIPSSEVDLVAHRKIFDAEVLRHEQLEEKEQLRHAPWTTRLANFWC 598
            LL P  ++DL  HR+++D EVL+ E+ E KE++R++PW  ++ NFWC
Sbjct: 533 TLLNPLDKMDLDTHRRVYDVEVLKQEEYEFKERMRNSPWYVKVLNFWC 580

>Ecym_2662 Chr2 complement(1275924..1277693) [1770 bp, 589 aa] {ON}
           similar to Ashbya gossypii AGR038C
          Length = 589

 Score =  523 bits (1347), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 259/584 (44%), Positives = 363/584 (62%), Gaps = 17/584 (2%)

Query: 24  EVLKE--ESPR-----SDSRSDGLFRRFADSFRRHEAHNXXXXXXXXXXXXXLTPIESAS 76
           E ++E  ESP       D   DGLF+R  DSF+R E                L   E  S
Sbjct: 14  ESIREVAESPNIPISGGDGHRDGLFQRIVDSFKRVEGE--------VRNSSDLEDGEVTS 65

Query: 77  KHKT-LKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYCVIQ 135
            H T LKQN++ RHV+++SL TGIGTG+LV N  SLH GGP  L+IGY  VS + Y ++Q
Sbjct: 66  AHSTKLKQNMKTRHVVLMSLGTGIGTGLLVANASSLHFGGPGGLLIGYFFVSIISYIMMQ 125

Query: 136 SASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKYWNQ 195
           +A E+A+ Y +L G FNAY S+ + K FGF+  W++C+QW  +LPLEL+T+S+ +KYW  
Sbjct: 126 AAGEMAVAYPTLPGNFNAYSSIFISKPFGFATVWLFCIQWTTILPLELITSSIVVKYWTT 185

Query: 196 TINPDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGGAGNDG 255
            IN D FV IFY+ ++ I+              N CKVLM           NCG  G+DG
Sbjct: 186 KINADIFVLIFYLFILCIHFCGARGYGETEFIFNSCKVLMVAGFIIVGILINCGAVGDDG 245

Query: 256 YLGARYWHDPGAFRGSDSINRFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSAS 315
           Y+G +YWH+PGAF     I+RFKGI  VLV A F+YGG E   L+  E  NP+K+I SA 
Sbjct: 246 YIGGKYWHEPGAFAAGSGIDRFKGIAYVLVTAYFSYGGMELYALSVNELPNPRKAIPSAC 305

Query: 316 KKLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSATHASPFVIAVASHGVRVVPHFXXX 375
            K VYRIL IY++T +++GFLVP +S++LLGSG S  H SP+V+A++ HG+++VPH    
Sbjct: 306 AKGVYRILIIYMLTMVIIGFLVPHDSNKLLGSGSSGVHPSPYVLALSLHGIKIVPHIINA 365

Query: 376 XXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVSCVFGLLSFVA 435
                                    +QG+AP+ L+YVDR GRP++ L++  VFGL++FVA
Sbjct: 366 VILISVISVGNSAMYSGPRLLCSLAQQGYAPKILDYVDRQGRPLMALIICSVFGLIAFVA 425

Query: 436 ASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYVAWTGVWGAY 495
           AS  EE +F WL AISGLSELFTW +I LSH R RRAM +QGRS + LGY + TG WG+ 
Sbjct: 426 ASKYEEDIFGWLAAISGLSELFTWTAICLSHFRFRRAMKLQGRSLETLGYRSTTGEWGSL 485

Query: 496 YAMAMIVAILVGQFWVAISPVGS-NKLDANNFFENYLAMPILIFLYLGYKIWTRDWRLLI 554
           YA+   V +L+ Q WVA+ P+ +  K    + F++ LA+P+ + + +GY I T++W +L 
Sbjct: 486 YAVVFNVFVLIAQLWVAMIPMDNGGKFSVKSLFKSCLALPLWLSMAVGYMIVTKNWTILN 545

Query: 555 PSSEVDLVAHRKIFDAEVLRHEQLEEKEQLRHAPWTTRLANFWC 598
           P S + + +HR+ +D EV++ E LE K++++ + W  R++  WC
Sbjct: 546 PLSSISVDSHRRSYDVEVMKQEDLEYKQKMKRSKWYVRMSYTWC 589

>KAFR0C00400 Chr3 (83280..85028) [1749 bp, 582 aa] {ON} 
          Length = 582

 Score =  521 bits (1341), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 252/565 (44%), Positives = 350/565 (61%), Gaps = 11/565 (1%)

Query: 34  DSRSDGLFRRFADSFRRHEAHNXXXXXXXXXXXXXLTPIESASKHKTLKQNIRPRHVLMI 93
           + R+ G+F RF DSF+                      +ES  +H  LK+ ++ RHV+M+
Sbjct: 29  EGRASGVFHRFIDSFKPPVEDEKSDLEEMS--------MESTDRH--LKKAMKSRHVIMM 78

Query: 94  SLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYCVIQSASELAIIYTSLAGGFNA 153
           +L TG+GTG+LV N K L  GGP +LVIGY +VS + Y +IQ+A E+A+ Y +L G FN 
Sbjct: 79  TLGTGVGTGLLVANAKGLSYGGPGALVIGYILVSFVTYFMIQAAGEMAVTYPTLPGSFNT 138

Query: 154 YPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKYWNQTINPDAFVTIFYVVLVAI 213
           Y S  + K  GF+  W++ +QWL VLPLEL+T +MTI+YWN +IN D ++ IFYV L+ +
Sbjct: 139 YTSTFISKPVGFATVWLFLIQWLTVLPLELITGTMTIQYWNDSINADVWIVIFYVFLLCV 198

Query: 214 NXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGGAGNDGYLGARYWHDPGAFRGSDS 273
           +              N CK+L            N GGAG DGY+GA+YW +PG+F  S S
Sbjct: 199 HVFGVKAYGELEFIFNTCKILFIGGFIIFSIVVNAGGAGTDGYIGAKYWKNPGSFASSTS 258

Query: 274 INRFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRILGIYIMTAILL 333
             RFK +  VLV A F+YGG E  VL+  EQ NP++S   A+K+ +YRIL IY++T IL+
Sbjct: 259 AGRFKDVCYVLVTAYFSYGGTELYVLSVNEQANPRRSTPKAAKQSIYRILIIYLLTMILI 318

Query: 334 GFLVPWNSDELLGSGGSATHASPFVIAVASHGVRVVPHFXXXXXXXXXXXXXXXXXXXXX 393
           GF VP ++D+L+G+GGS+THASP+V+A + HGV+VVPH                      
Sbjct: 319 GFNVPHDNDQLMGAGGSSTHASPYVLAASIHGVKVVPHIINAVILICVTSMGNSSLYAAQ 378

Query: 394 XXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVSCVFGLLSFVAASPKEETVFTWLLAISGL 453
                  EQG+AP+ L Y+DR GRP++ L    V G+++F AAS +EE VFTWL AI+ L
Sbjct: 379 RLFASLAEQGYAPKCLAYIDREGRPIIALAACAVVGVIAFAAASSQEEQVFTWLAAIAAL 438

Query: 454 SELFTWFSISLSHVRLRRAMTVQGRSADELGYVAWTGVWGAYYAMAMIVAILVGQFWVAI 513
           SELFTW +I LSH+R R AM VQG+  +ELGY A TGVWG+ +     V + + QFWVA+
Sbjct: 439 SELFTWSTILLSHIRFRMAMKVQGKDLNELGYKALTGVWGSMWGFGFCVLVFIAQFWVAL 498

Query: 514 SPVGSNKLDANNFFENYLAMPILIFLYLGYKIWTRDWRLLIPSSEVDLVAHRKIFDAEVL 573
           SP G   + A  FFE+YLA P+ +F Y  Y +W RD+  L    ++DL AHR+I+D E L
Sbjct: 499 SPPGGT-ISAEGFFESYLAFPLWLFFYFAYMLWKRDFTFLTKLEDIDLDAHRRIYDPEFL 557

Query: 574 RHEQLEEKEQLRHAPWTTRLANFWC 598
           R E  E KE++R++ +  ++  FWC
Sbjct: 558 RQEDEERKEKIRNSSFWIKMKYFWC 582

>Suva_4.308 Chr4 complement(543427..545283) [1857 bp, 618 aa] {ON}
           YBR069C (REAL)
          Length = 618

 Score =  522 bits (1344), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 285/610 (46%), Positives = 377/610 (61%), Gaps = 42/610 (6%)

Query: 10  KSPDNGVVESFDSVEVLKEESPRSDS----RSDGLFRRFADSFRRHEAHNXXXXXXXXXX 65
           +  D  V E+ D  E L++++ R  +    +     ++F DSF+R    +          
Sbjct: 30  EKKDFTVTENQD--EGLQQQAKRQGTSGKFKLQNECKKFFDSFKRQLPADQN-------- 79

Query: 66  XXXLTPIESASKHKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAI 125
               + +ES  ++  L ++I+ RH++MISL TGIGTG+LVGNG+ L   GPA LV+GY I
Sbjct: 80  ----SELESQERN-NLTRSIKSRHLIMISLGTGIGTGLLVGNGQVLGTAGPAGLVLGYGI 134

Query: 126 VSSMLYCVIQSASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVT 185
            S MLYC+IQ+A EL + Y  L G +  Y S+LVD + GF+VS VY +QWL VLPL+LVT
Sbjct: 135 ASIMLYCIIQAAGELGLCYAGLTGNYTRYSSILVDPSLGFAVSVVYTIQWLTVLPLQLVT 194

Query: 186 ASMTIKYWNQTINPDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXX 245
           A+MTIKYW   +N D FV   ++ ++ IN              N CK+LM          
Sbjct: 195 AAMTIKYWTN-VNADIFVAAVFIFVIIINLFGSKGYAEAEFMFNICKILMVIGFVILAIV 253

Query: 246 XNCGGAGNDGYLGARYWHDPGAFRGSDSINRFKGIVAVLVNAAFAYGGAEFSVLTAAEQQ 305
            NCGGAG+  ++G +YWH+PG F      + FKG+  V   AAF+YGG E  +L+AAEQ+
Sbjct: 254 INCGGAGDRKFIGTKYWHNPGPFA-----HGFKGVCTVFCYAAFSYGGIEVLLLSAAEQE 308

Query: 306 NPQKSIRSASKKLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSAT-HASPFVIAVASH 364
           NP KSI +A KK+VYRIL IY++T IL+ FLVP+NSDELLGSG S+  HASPFVIAVASH
Sbjct: 309 NPTKSIPNACKKVVYRILFIYMLTTILICFLVPYNSDELLGSGSSSGSHASPFVIAVASH 368

Query: 365 GVRVVPHFXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLV 424
           GV+VVPHF                            EQGF P+ L YVDR GRP+LC LV
Sbjct: 369 GVKVVPHFINAVILISVISVANSSLYSAPRLLLSLAEQGFLPKCLAYVDRNGRPLLCFLV 428

Query: 425 SCVFGLLSFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELG 484
           S +FG + FVA S  EE VFTWLLAIS LS+LF W S+SLSH+R R AM  QGRS DE+G
Sbjct: 429 SIIFGCIGFVATSDAEEQVFTWLLAISSLSQLFIWMSMSLSHIRFRDAMAKQGRSMDEVG 488

Query: 485 YVAWTGVWGAYYAMAMIVAILVGQFWVAISPVGSN-KLDANNFFENYLAMPILIFLYLGY 543
           Y A TG WG++ A+ + +  LV QFWVAI+PV  + KLDAN FF+NYLAMPI++F Y G+
Sbjct: 489 YKAQTGYWGSWLAVLIALFFLVCQFWVAIAPVSKHGKLDANVFFQNYLAMPIVLFAYFGH 548

Query: 544 KIWTRDWRLLIPSSEVDLVAHRKIF------------DAEVLRHEQLEEKEQLRHA---P 588
           KI+T+ W+  IP+ ++DL +HR I+            D ++  +E  E  E    +    
Sbjct: 549 KIYTKSWKFWIPAEKIDLDSHRTIYVPPILMGTNKIDDDDLKEYETSESSENPNGSGSRK 608

Query: 589 WTTRLANFWC 598
           +  R+ANFWC
Sbjct: 609 FFKRMANFWC 618

>TPHA0A03960 Chr1 (877702..879549) [1848 bp, 615 aa] {ON} 
          Length = 615

 Score =  515 bits (1327), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 259/595 (43%), Positives = 360/595 (60%), Gaps = 8/595 (1%)

Query: 5   ELHNMKSPDNGVVESFDSVEVLKEESPRSDSRSDGLFRRFADSFRRHEAHNXXXXXXXXX 64
           E  +  + ++ + E   SVE +       ++   G FRR+ADSF+R E            
Sbjct: 28  ERIHTSTTNDYINEKLGSVEEVSSFDYVQEAAKTGRFRRWADSFKRAEKSTEAEDGESG- 86

Query: 65  XXXXLTPIESASKHKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYA 124
                  I + ++   LK+ ++ RHV+M+SL TGIGTG+LV N K L   GPA LVIGY 
Sbjct: 87  ------SIYNGNESTELKKAMKSRHVVMMSLGTGIGTGLLVANAKGLAISGPAPLVIGYG 140

Query: 125 IVSSMLYCVIQSASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELV 184
           +VS + Y +IQ+A EL + Y SL G FN Y   LV + FGF+  W+  +QWL V+PLEL+
Sbjct: 141 LVSFITYFMIQAAGELGVTYASLPGNFNVYFGTLVSRPFGFATVWLASVQWLTVIPLELI 200

Query: 185 TASMTIKYWNQTINPDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXX 244
           T ++TIKYW + +N D FV I YV L+ I+              N CK+LM         
Sbjct: 201 TCAITIKYWTEKVNGDIFVLIIYVFLLFIHIFGVKAYGEAEFLFNTCKILMIAGFIILSI 260

Query: 245 XXNCGGAGNDGYLGARYWHDPGAFRGSDSINRFKGIVAVLVNAAFAYGGAEFSVLTAAEQ 304
             N GGAGNDGY+G  YW++PGAF   ++ +RFK I  +LV   F+YGG E  VL+  EQ
Sbjct: 261 VINVGGAGNDGYIGGSYWNNPGAFASDNAASRFKSICYILVTGYFSYGGTELFVLSVNEQ 320

Query: 305 QNPQKSIRSASKKLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSATHASPFVIAVASH 364
           +NP+KS   A+K  +YRIL IY++T IL+GF VP +SD+L+GS GS+ HASP+V+A + H
Sbjct: 321 ENPRKSTPQAAKHSIYRILVIYLLTMILIGFNVPHDSDQLMGSAGSSAHASPYVLAASLH 380

Query: 365 GVRVVPHFXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLV 424
           GV+VVPHF                            +QGFAP+FL YVDR GRP+L + V
Sbjct: 381 GVKVVPHFINAVILIALISVANSSLYAAPRMMVSLAQQGFAPKFLTYVDREGRPLLGIAV 440

Query: 425 SCVFGLLSFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELG 484
             VFG++ F A+S KEE VFTWL AI+GLSELFTW +  LSH+R R+AM VQG++  E G
Sbjct: 441 CAVFGVIGFAASSDKEEDVFTWLAAIAGLSELFTWSAFFLSHIRFRQAMKVQGKNIKECG 500

Query: 485 YVAWTGVWGAYYAMAMIVAILVGQFWVAISPVGSN-KLDANNFFENYLAMPILIFLYLGY 543
           Y++ TG+WG+   +   + + + QFWVA+SP+G++ K DA  FF++YLA PI +  Y G 
Sbjct: 501 YLSVTGIWGSIIGLCFNILVFIAQFWVALSPIGNDGKCDAQAFFQSYLAFPIWLAFYFGC 560

Query: 544 KIWTRDWRLLIPSSEVDLVAHRKIFDAEVLRHEQLEEKEQLRHAPWTTRLANFWC 598
             + +D+ LL P   +DL  HR+I+D E L+ E L  K +L+   +  +L  F+C
Sbjct: 561 MFYYKDYTLLNPLESIDLDDHRRIYDPEELKKEDLATKAELKRRGFHAQLVAFFC 615

>Skud_2.192 Chr2 complement(344951..346810) [1860 bp, 619 aa] {ON}
           YBR069C (REAL)
          Length = 619

 Score =  513 bits (1321), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 276/596 (46%), Positives = 362/596 (60%), Gaps = 40/596 (6%)

Query: 24  EVLKEESPRSDSRSDGL---FRRFADSFRRHEAHNXXXXXXXXXXXXXLTPIESASKHKT 80
           E  ++ SP+   R   L   FR+F DSF+R    +              + +ES  K+  
Sbjct: 43  EPEQQGSPQKTDRKPKLRNEFRKFFDSFKRQLPSDQN------------SELESQEKN-N 89

Query: 81  LKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYCVIQSASEL 140
           L+++I+ RH++MISL TGIGTG+LVGNG+ L   GPA LV+GY I S MLYC+IQ+A EL
Sbjct: 90  LRKSIKSRHLVMISLGTGIGTGLLVGNGQVLGTAGPAGLVLGYGIASIMLYCIIQAAGEL 149

Query: 141 AIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKYWNQTINPD 200
            + Y  L G +  Y S+LVD + GF+VS VY +QWL VLPL+LVTA+MT+KYW   +N D
Sbjct: 150 GLCYAGLTGNYTRYSSILVDPSLGFAVSVVYTIQWLTVLPLQLVTAAMTVKYWTN-VNAD 208

Query: 201 AFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGGAGNDGYLGAR 260
            FV + ++ ++ IN              N CK+LM           NCGGAG+  Y+G  
Sbjct: 209 IFVAVVFIFVIIINLFGSRGYAEAEFIFNICKILMVAGFVILAIVINCGGAGDRRYIGTE 268

Query: 261 YWHDPGAFRGSDSINRFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVY 320
           YWH+PG F      + FKG+  V   AAF+YGG E  +L+AAEQ+NP +SI +A KK+VY
Sbjct: 269 YWHNPGPFA-----HGFKGVCTVFCYAAFSYGGIEVLLLSAAEQENPTESIPNACKKVVY 323

Query: 321 RILGIYIMTAILLGFLVPWNSDELL-GSGGSATHASPFVIAVASHGVRVVPHFXXXXXXX 379
           RIL IY++T IL+GFLVP+NSDELL     S +HASPFVIAV+SHGV+VVPHF       
Sbjct: 324 RILLIYMLTTILIGFLVPYNSDELLGSGSSSGSHASPFVIAVSSHGVKVVPHFINAVILI 383

Query: 380 XXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVSCVFGLLSFVAASPK 439
                                EQG  P+ L YVDR GRP+LC LVS  FG + FVA S  
Sbjct: 384 SVISVANSSLYSGPRLLLSLAEQGVLPKCLAYVDRNGRPLLCFLVSLAFGCIGFVATSNA 443

Query: 440 EETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYVAWTGVWGAYYAMA 499
           EE VFTWLLAIS LS+LF W S+ LSH+R R AM  QGRS DE+GY A TG WG++ A+ 
Sbjct: 444 EEQVFTWLLAISSLSQLFIWMSMCLSHIRFRDAMAKQGRSMDEVGYKAQTGYWGSWIAVL 503

Query: 500 MIVAILVGQFWVAISPVGSN-KLDANNFFENYLAMPILIFLYLGYKIWTRDWRLLIPSSE 558
           + V  LV QFWVAI+PV  + KLD   FF+NYLAMPI++  Y G+K++ + WR  IP+ +
Sbjct: 504 IAVFFLVCQFWVAIAPVSEHGKLDVKVFFQNYLAMPIVLLAYFGHKMYFKSWRFWIPAEK 563

Query: 559 VDLVAHRKIF-------------DAEVLRHEQLEEKEQLRHAPWT---TRLANFWC 598
           +DL +HR ++             D +V  +E  E  E L  +       ++ NFWC
Sbjct: 564 IDLDSHRNVYLPPTSTGADKIDDDDDVTEYETSESSENLHSSRLNKSFKKMVNFWC 619

>Smik_2.202 Chr2 complement(358478..360331) [1854 bp, 617 aa] {ON}
           YBR069C (REAL)
          Length = 617

 Score =  511 bits (1316), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 276/603 (45%), Positives = 364/603 (60%), Gaps = 37/603 (6%)

Query: 13  DNGVVESFD--SVEVLKEESPRSDSRSDGLFRRFADSFRRHEAHNXXXXXXXXXXXXXLT 70
           D  + E  D  S + +K +   + S+     ++   SF+R    +              +
Sbjct: 33  DFAITEKQDEESEQQVKPQKTGNKSKLQNECKKILSSFKRQLPPSQN------------S 80

Query: 71  PIESASKHKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSML 130
            +ES  K+  L ++I+ RH++MISL TGIGTG+LVGNG+ L   GPA LV+GY + S ML
Sbjct: 81  ELESQEKN-NLTKSIKSRHLVMISLGTGIGTGLLVGNGQVLGTAGPAGLVLGYGVASIML 139

Query: 131 YCVIQSASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTI 190
           YC+IQ+A EL + Y  L G +  YPS+LVD + GF+VS VY +QWL VLPL+LVTA+MT+
Sbjct: 140 YCIIQAAGELGLCYAGLTGNYTRYPSILVDPSLGFAVSVVYTIQWLTVLPLQLVTAAMTV 199

Query: 191 KYWNQTINPDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGG 250
           KYW  ++N D FV + ++ ++ IN              N CK+LM           NCGG
Sbjct: 200 KYWT-SVNSDIFVAVVFIFVIIINLFGSRGYAEAEFIFNICKILMVIGFVILAIIINCGG 258

Query: 251 AGNDGYLGARYWHDPGAFRGSDSINRFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNPQKS 310
           AG+  Y+G  YWH+PG F      + FKG+  V   AAF+YGG E  +L+AAEQ+NP KS
Sbjct: 259 AGDRKYIGTEYWHNPGPFA-----HGFKGVCTVFCYAAFSYGGIEVLLLSAAEQENPTKS 313

Query: 311 IRSASKKLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSA-THASPFVIAVASHGVRVV 369
           I +A KK+VYRIL IY++T IL+ FLVP+NSDELLGS  S+ +HASPFVIAVASHGV+VV
Sbjct: 314 IPNACKKVVYRILLIYMLTTILVCFLVPYNSDELLGSDDSSGSHASPFVIAVASHGVKVV 373

Query: 370 PHFXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVSCVFG 429
           PHF                            EQG  P+ L YVDR GRP+LC LVS  FG
Sbjct: 374 PHFINAVILISVISVANSSLYSGPRLLLSLAEQGVLPKCLAYVDRRGRPLLCFLVSLAFG 433

Query: 430 LLSFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYVAWT 489
            + FVA S  EE VFTWLLAIS LS+LF W S+SLSH+R R AM  QGRS +E+GY A T
Sbjct: 434 CIGFVATSDAEEEVFTWLLAISSLSQLFIWMSMSLSHIRFRDAMAKQGRSMNEVGYKAQT 493

Query: 490 GVWGAYYAMAMIVAILVGQFWVAISPVGSN-KLDANNFFENYLAMPILIFLYLGYKIWTR 548
           G WG++ A+ + V  LV QFWVAI+PV  + KL+   FF+NYLAMPI++  Y G+KI+ +
Sbjct: 494 GYWGSWLAVLIAVFFLVCQFWVAIAPVNDHGKLNVKVFFQNYLAMPIVLVAYFGHKIYFK 553

Query: 549 DWRLLIPSSEVDLVAHRKIF-----------DAEVLRHEQ---LEEKEQLRHAPWTTRLA 594
            W   IP+ ++DL +HR IF           D +V  +E    LE    LR      ++ 
Sbjct: 554 SWSFWIPADKIDLNSHRNIFVHSTLTEFDKADDDVKEYENQESLENLNNLRSRNLFKKMV 613

Query: 595 NFW 597
           N W
Sbjct: 614 NLW 616

>TBLA0I02010 Chr9 complement(455681..457567) [1887 bp, 628 aa] {ON}
           Anc_3.285 YBR069C
          Length = 628

 Score =  509 bits (1310), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 257/532 (48%), Positives = 337/532 (63%), Gaps = 26/532 (4%)

Query: 36  RSDGLFRRFADSFRRHEAHNXXXXXXXXXXXXXLTPIESASKHKTLKQNIRPRHVLMISL 95
           +   +F R  DSF+R +  N                 E A     L + ++PRH++MISL
Sbjct: 76  KRRNVFVRIVDSFKRQKVRNDG---------------EFAETETQLNKTMKPRHIVMISL 120

Query: 96  ATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYCVIQSASELAIIYTSLAGGFNAYP 155
            TGIGTG+LVGNG+ L   GPA LVIGY + S M+YCV+Q+A EL ++Y+ L G +  YP
Sbjct: 121 GTGIGTGLLVGNGQVLSKSGPAGLVIGYGVASIMIYCVVQAAGELGLVYSRLTGNYTTYP 180

Query: 156 SLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKYWNQTINPDAFVTIFYVVLVAINX 215
           + L+D A GF+VS +Y LQWL VLPL+LVTA+MTI+YW   +NPD FV    V+++AIN 
Sbjct: 181 TYLIDPAVGFAVSMLYTLQWLTVLPLQLVTAAMTIRYWTTNVNPDIFVAAILVLVIAINM 240

Query: 216 XXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGGAGNDGYLGARYWHDPGAFRGSDSIN 275
                        NCCK+LM           NCGGAG+  Y+G +YW  PGAF      N
Sbjct: 241 FGAKGYAEAEFFCNCCKLLMMAGFVILGIVINCGGAGDKEYIGVKYWQTPGAFA-----N 295

Query: 276 RFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRILGIYIMTAILLGF 335
            FKG+ AV   AAF+YGG E  VLTA EQ NP+K+I  A +K+VYR+L +Y++T I++ F
Sbjct: 296 GFKGVAAVFCYAAFSYGGIEVLVLTANEQANPRKAIPDACRKVVYRVLFLYMLTTIIVCF 355

Query: 336 LVPWNSDELLGSG--GSATHASPFVIAVASHGVRVVPHFXXXXXXXXXXXXXXXXXXXXX 393
           LVP+NS  LLGS   GS + ASPFVIAVASHGV+VVPH                      
Sbjct: 356 LVPYNSPALLGSNNDGSGSDASPFVIAVASHGVQVVPHIINAAILISVISVANSSLYSGP 415

Query: 394 XXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVSCVFGLLSFVAASPKEETVFTWLLAISGL 453
                  +QG+AP+  NY+DR GRP++C+LVS   GL++F+AA P  E VFTWLLA+SGL
Sbjct: 416 RLLLSLSQQGYAPKCFNYIDRRGRPIICVLVSVAMGLIAFLAAIPAREEVFTWLLAVSGL 475

Query: 454 SELFTWFSISLSHVRLRRAMTVQ---GRSADELGYVAWTGVWGAYYAMAMIVAILVGQFW 510
           S++F W SI++SH+R R A+  Q    R+ D + Y A TG  G+  A+A+ + ILV QFW
Sbjct: 476 SQIFIWMSITISHLRFRDAIRSQLGGLRARDVVEYTAQTGYVGSLVALAISIFILVCQFW 535

Query: 511 VAISPVGSN-KLDANNFFENYLAMPILIFLYLGYKIWTRDWRLLIPSSEVDL 561
           VAI+P+G N +LD   FFENYLA P+L+  YL YKIW RDWRL IP++E+DL
Sbjct: 536 VAIAPLGHNGQLDVQIFFENYLAAPVLLGGYLAYKIWHRDWRLCIPANEIDL 587

>TBLA0G03120 Chr7 (825095..827116) [2022 bp, 673 aa] {ON} 
          Length = 673

 Score =  508 bits (1309), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 245/515 (47%), Positives = 336/515 (65%), Gaps = 2/515 (0%)

Query: 74  SASKHKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYCV 133
           +AS+    K  ++ RHV+M++LATGIGTG+LV N KSLH  GPA LV+GY +VS + Y V
Sbjct: 147 AASEDMPKKGGMKARHVIMMTLATGIGTGLLVANAKSLHFSGPAGLVVGYFMVSFVTYFV 206

Query: 134 IQSASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKYW 193
           +Q+A E+AI Y +L GGFN Y SL + K FGF+  W++ L WL +LPLEL+T+S+T+KYW
Sbjct: 207 VQAAGEMAIAYPTLPGGFNTYQSLFISKPFGFATVWIFALNWLTILPLELITSSITVKYW 266

Query: 194 NQTINPDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGGAGN 253
             +INPD FV IFY+ L+ ++              N CK+LM           NCGGAG+
Sbjct: 267 TTSINPDIFVLIFYLFLLFVHFIGLRLYAEAEFFFNSCKILMITGFIIFSIVVNCGGAGH 326

Query: 254 DGYLGARYWHDPGAFRGSDSINRFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRS 313
           DGY+G +YWHDPG F   +   RFK +  VL+NA F+YGG E  VL+  EQ+NP+K++  
Sbjct: 327 DGYIGGKYWHDPGPFASDNGAARFKEVCYVLINAYFSYGGTELYVLSVNEQENPRKAVPV 386

Query: 314 ASKKLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSATHASPFVIAVASHGVRVVPHFX 373
           A+K  VYR+  IY++T IL+GF VP+NS +L+G+  S   ASP+V+A   HGV++VPHF 
Sbjct: 387 AAKTSVYRVAIIYLLTMILIGFNVPYNSPDLMGNANS-KDASPYVLAAQIHGVKIVPHFI 445

Query: 374 XXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVSCVFGLLSF 433
                                      EQGFAP+FL YVDR GRP+L L V  +FG+++F
Sbjct: 446 NAVILLSVISVANSALFAGPRLLATLAEQGFAPKFLTYVDRAGRPLLALCVCSLFGVIAF 505

Query: 434 VAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYVAWTGVWG 493
            A S KE+ VFTWL AI+GLSELF W  I LSH+R R AM   G+S DE+GY A TG+WG
Sbjct: 506 AATSKKEDEVFTWLAAIAGLSELFAWSGILLSHIRFRWAMKYHGKSMDEVGYKAITGIWG 565

Query: 494 AYYAMAMIVAILVGQFWVAISPVGS-NKLDANNFFENYLAMPILIFLYLGYKIWTRDWRL 552
           +YY +   + +L+ QFWVA+S  GS  ++ A +FFE+YLA  I +F YL Y I+ +DW +
Sbjct: 566 SYYGLFFNLLVLIAQFWVALSAPGSGGQVTAISFFESYLAFVIWVFFYLCYMIYNKDWTI 625

Query: 553 LIPSSEVDLVAHRKIFDAEVLRHEQLEEKEQLRHA 587
           LIP  ++D+   R+I+DA+ LR E+ E  E+ + +
Sbjct: 626 LIPLKDIDVDYQRRIYDADFLRQEKEESYEKYKQS 660

>Kpol_1052.16 s1052 (44303..46144) [1842 bp, 613 aa] {ON}
           (44303..46144) [1842 nt, 614 aa]
          Length = 613

 Score =  505 bits (1301), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 254/589 (43%), Positives = 360/589 (61%), Gaps = 14/589 (2%)

Query: 13  DNGVVESFDSVEVLKEES-PRSDSRSDGLFRRFADSFRRHEAHNXXXXXXXXXXXXXLTP 71
           D+G  +SF+ ++  +  S   S+    G  RR+ DS++R E                   
Sbjct: 36  DSGF-KSFNDIDTSERTSVESSEVYRSGRIRRWIDSYKRAEHPREHIDGFE--------- 85

Query: 72  IESASKHKT-LKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSML 130
            +  SK    LK+ ++ RHV+M+SL TGIGTG+L+ N K LH  GPA LVIGY +VS + 
Sbjct: 86  -DGESKDGIHLKKQMKTRHVVMMSLGTGIGTGLLIANAKGLHFAGPAPLVIGYGMVSFVT 144

Query: 131 YCVIQSASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTI 190
           Y +IQ+A ELA+ Y +L G FN+Y  +L+ K FGF+  W+  +QWL VLPLE + AS+TI
Sbjct: 145 YFMIQAAGELAVAYPTLPGNFNSYFGILISKPFGFATVWLAAVQWLTVLPLEFIAASLTI 204

Query: 191 KYWNQTINPDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGG 250
           KYWN  I+ D FV IFYV L+ I+              N CKVLM           N GG
Sbjct: 205 KYWNDRISGDVFVVIFYVFLLFIHFVGVRAYGETEFIFNLCKVLMIIGFIILSIVINAGG 264

Query: 251 AGNDGYLGARYWHDPGAFRGSDSINRFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNPQKS 310
           AGNDGY+G +YW+DPGAF G  + +RFKG+  +LV   F+YGG E  VL+  EQ+NP+KS
Sbjct: 265 AGNDGYIGGKYWNDPGAFAGETAGSRFKGVCYILVTGYFSYGGTELFVLSVNEQENPRKS 324

Query: 311 IRSASKKLVYRILGIYIMTAILLGFLVPWNSDELLGS-GGSATHASPFVIAVASHGVRVV 369
              A+K  +YRI+ IY++T IL+GF VP+N   L+G+   S +HASP+V+A + HGV++V
Sbjct: 325 TPQAAKHSIYRIVIIYLLTMILIGFNVPYNDPRLMGADDASGSHASPYVLAASIHGVKIV 384

Query: 370 PHFXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVSCVFG 429
           PHF                            EQGFAP+ + YVDR GRP++ L +  +FG
Sbjct: 385 PHFINAVVLIALISVGNSALYAAPRMMVSLAEQGFAPKIMAYVDREGRPLVSLGICALFG 444

Query: 430 LLSFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYVAWT 489
           L+ F A+S KEE VFTWL AI+GLSELFTW +  +SH+R R AM +QG+   E+G++A T
Sbjct: 445 LIGFAASSSKEEQVFTWLAAIAGLSELFTWSAFFISHIRFRWAMKLQGKDIKEVGFLAST 504

Query: 490 GVWGAYYAMAMIVAILVGQFWVAISPVGSNKLDANNFFENYLAMPILIFLYLGYKIWTRD 549
           G++G++Y +   + +   QFWVA+SP+GS K+ A +FFE+YLA PI +F Y GY +W +D
Sbjct: 505 GLYGSFYGLFFNILVFAAQFWVALSPIGSKKVGAESFFESYLAFPIWLFFYFGYMVWAKD 564

Query: 550 WRLLIPSSEVDLVAHRKIFDAEVLRHEQLEEKEQLRHAPWTTRLANFWC 598
           +  L P   +DL  HR+I+D E +     +EKE+ +++    ++  + C
Sbjct: 565 FTFLNPLESIDLDFHRRIYDPEEMAEINRQEKEEYKNSSIVGKIIYWLC 613

>YBR069C Chr2 complement(376574..378433) [1860 bp, 619 aa] {ON}
           TAT1Amino acid transport protein for valine, leucine,
           isoleucine, and tyrosine, low-affinity tryptophan and
           histidine transporter; overexpression confers FK506 and
           FTY720 resistance
          Length = 619

 Score =  500 bits (1288), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 283/606 (46%), Positives = 370/606 (61%), Gaps = 39/606 (6%)

Query: 13  DNGVVESFDSVEVLKEESPRSDSRS--DGLFRRFADSFRRHEAHNXXXXXXXXXXXXXLT 70
           D  + E  D V     E  R+DS+S      + F DSF+R    +              +
Sbjct: 33  DFTITEKQDEVSGQTAEPRRTDSKSILQRKCKEFFDSFKRQLPPDRN------------S 80

Query: 71  PIESASKHKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSML 130
            +ES  K+  L ++I+ RH++MISL TGIGTG+LVGNG+ L   GPA LV+GY I S ML
Sbjct: 81  ELESQEKN-NLTKSIKSRHLVMISLGTGIGTGLLVGNGQVLGTAGPAGLVLGYGIASIML 139

Query: 131 YCVIQSASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTI 190
           YC+IQ+A EL + Y  L G +  YPS+LVD + GF+VS VY +QWL VLPL+LVTA+MT+
Sbjct: 140 YCIIQAAGELGLCYAGLTGNYTRYPSILVDPSLGFAVSVVYTIQWLTVLPLQLVTAAMTV 199

Query: 191 KYWNQTINPDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGG 250
           KYW  ++N D FV + +V ++ IN              N CK+LM           NCGG
Sbjct: 200 KYWT-SVNADIFVAVVFVFVIIINLFGSRGYAEAEFIFNSCKILMVIGFVILAIIINCGG 258

Query: 251 AGNDGYLGARYWHDPGAFRGSDSINRFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNPQKS 310
           AG+  Y+GA YWH+PG F      + FKG+  V   AAF+YGG E  +L+AAEQ+NP KS
Sbjct: 259 AGDRRYIGAEYWHNPGPFA-----HGFKGVCTVFCYAAFSYGGIEVLLLSAAEQENPTKS 313

Query: 311 IRSASKKLVYRILGIYIMTAILLGFLVPWNSDELLG-SGGSATHASPFVIAVASHGVRVV 369
           I +A KK+VYRIL IY++T IL+ FLVP+NSDELLG S  S +HASPFVIAVASHGV+VV
Sbjct: 314 IPNACKKVVYRILLIYMLTTILVCFLVPYNSDELLGSSDSSGSHASPFVIAVASHGVKVV 373

Query: 370 PHFXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVSCVFG 429
           PHF                            EQG  P+ L YVDR GRP+LC  VS VFG
Sbjct: 374 PHFINAVILISVISVANSSLYSGPRLLLSLAEQGVLPKCLAYVDRNGRPLLCFFVSLVFG 433

Query: 430 LLSFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYVAWT 489
            + FVA S  EE VFTWLLAIS LS+LF W S+SLSH+R R AM  QGRS +E+GY A T
Sbjct: 434 CIGFVATSDAEEQVFTWLLAISSLSQLFIWMSMSLSHIRFRDAMAKQGRSMNEVGYKAQT 493

Query: 490 GVWGAYYAMAMIVAILVGQFWVAISPVGSN-KLDANNFFENYLAMPILIFLYLGYKIWTR 548
           G WG++ A+ + +  LV QFWVAI+PV  + KL+   FF+NYLAMPI++F Y G+KI+ +
Sbjct: 494 GYWGSWLAVLIAIFFLVCQFWVAIAPVNEHGKLNVKVFFQNYLAMPIVLFAYFGHKIYFK 553

Query: 549 DWRLLIPSSEVDLVAHRKIFDAEVLRH-EQLEEKEQL---------------RHAPWTTR 592
            W   IP+ ++DL +HR IF +  L   +++++ + L               R   +  R
Sbjct: 554 SWSFWIPAEKIDLDSHRNIFVSPSLTEIDKVDDNDDLKEYENSESSENPNSSRSRKFFKR 613

Query: 593 LANFWC 598
           + NFWC
Sbjct: 614 MTNFWC 619

>KNAG0J02210 Chr10 complement(409847..411592) [1746 bp, 581 aa] {ON}
           
          Length = 581

 Score =  486 bits (1251), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 259/584 (44%), Positives = 361/584 (61%), Gaps = 35/584 (5%)

Query: 4   FELHNMK---SPDNGVVESFDSVEVLKEESPRSDSRSDGLFRRFADSFRRHEAHNXXXXX 60
           FE+ ++    SP+  V+ +  S      E P +     G+   F DSF+R E  +     
Sbjct: 24  FEVKDISATVSPETNVITASSSAS---NEGPATPQPQLGVVASFLDSFKRKEHDD----- 75

Query: 61  XXXXXXXXLTPIESASKHKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLV 120
                        +A     L + IR RH++MISL TGIGTG+LVG G  L   GP  L+
Sbjct: 76  ------------STAGDENDLNKAIRSRHLIMISLGTGIGTGLLVGTGSVLSQSGPLGLI 123

Query: 121 IGYAIVSSMLYCVIQSASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLP 180
           IGY + S M++ +IQ+A EL I+Y+++ G F  YP++LVD AFGF++S++Y +QW+ VLP
Sbjct: 124 IGYIVSSLMVFLIIQAAGELGIVYSNVVGNFTRYPTILVDPAFGFAISFLYTIQWMIVLP 183

Query: 181 LELVTASMTIKYWNQTINPDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXX 240
           L+LVTA+MTI++WN  +N D FV   +VV+V IN              N CK++M     
Sbjct: 184 LQLVTAAMTIQFWNVGVNLDVFVLASFVVVVLINLGGARGYVEAEFFCNLCKIVMLTGFV 243

Query: 241 XXXXXXNCGGA--GNDGYLGARYWHDPGAFRGSDSINRFKGIVAVLVNAAFAYGGAEFSV 298
                   GG   G DGY+G +YW +PG F      N FKG+ +V   AAF+YGG E  V
Sbjct: 244 ILGIIITAGGIPNGPDGYIGGKYWRNPGLFA-----NGFKGVCSVFCYAAFSYGGVETLV 298

Query: 299 LTAAEQQNPQKSIRSASKKLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSATHASPFV 358
           L+AAEQ+NP KSI SA+KK++YRIL IY+++ I++ FLVP+ S +L+GS GS +H+SPFV
Sbjct: 299 LSAAEQKNPLKSIPSATKKVMYRILFIYLLSLIIVCFLVPYTSPDLMGSSGSGSHSSPFV 358

Query: 359 IAVASHGVRVVPHFXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRP 418
           IA+ASHGV VVPH                             + G AP+FLNY+D+ GRP
Sbjct: 359 IAIASHGVSVVPHLINAVILISVLSVANSALYVAPRLLLSLAQGGSAPKFLNYIDKRGRP 418

Query: 419 VLCLLVSCVFGLLSFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGR 478
             C LV  +FG++ FVAAS K E VFTWLL+ISGL ++F W SI +SH+R R AM VQG 
Sbjct: 419 TTCTLVVVLFGMIGFVAASDKREVVFTWLLSISGLGQIFIWISICVSHIRFRDAMRVQGH 478

Query: 479 SADELGYVAWTGVWGAYYAMAMIVAILVGQFWVAISPVGSN-KLDANNFFENYLAMPILI 537
              E+ Y A TG WG+Y A+A+ + +LV QFWVAI+PVG++ KLDA NFF+NYLA P+++
Sbjct: 479 PLTEIAYKAQTGYWGSYVAIALALFVLVCQFWVAIAPVGAHGKLDATNFFQNYLAFPVVL 538

Query: 538 FLYLGYKIWTRDWRLLIPSSEVDLVAHRKIFDAEVLRHEQLEEK 581
             YLG+K++ + W+LLIP+ +++L  +R ++  E    E LE+K
Sbjct: 539 CAYLGFKVYYKQWQLLIPADKIELDNNRNVYVPE----EALEDK 578

>Kpol_1052.14 s1052 (39793..41601) [1809 bp, 602 aa] {ON}
           (39793..41601) [1809 nt, 603 aa]
          Length = 602

 Score =  469 bits (1208), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 251/504 (49%), Positives = 325/504 (64%), Gaps = 9/504 (1%)

Query: 71  PIESASK-HKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSM 129
           P+E+  K    L ++I+ RH+LMISL TGIGTG+LVGNG+ L   GPA LVIGY + S M
Sbjct: 81  PLENEEKTENQLNRSIKSRHLLMISLGTGIGTGLLVGNGQVLAKSGPAGLVIGYGVASIM 140

Query: 130 LYCVIQSASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMT 189
           +Y ++Q+A EL I Y+ L G +  YPS+LVD A GF++S +Y LQWL V+PL+LVTA+MT
Sbjct: 141 VYFIVQAAGELGICYSGLTGNYIRYPSILVDPALGFAISIIYTLQWLTVMPLQLVTAAMT 200

Query: 190 IKYWNQTINPDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCG 249
           I YW   INP+ FV I  V++V  N              N  KVLM           N G
Sbjct: 201 IGYWTN-INPNIFVAIVLVIVVLTNCFGAKGYVEAEFLCNIFKVLMMVGFVLLAILINTG 259

Query: 250 GAGNDGYLGARYWHDPGAFRGSDSINRFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNPQK 309
             G DGY+G  YW +PGAF      N FKG+ +V   AAF+YGG E   LTAAEQ+NP K
Sbjct: 260 AIGTDGYIGTIYWKNPGAFA-----NGFKGVCSVFCYAAFSYGGIEVLALTAAEQENPIK 314

Query: 310 SIRSASKKLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSATHAS-PFVIAVASHGVRV 368
           +I SA KK VYRIL +Y++T IL+GFLVP++S +L+GS       S PFVIA+ASHGV+V
Sbjct: 315 AIPSACKKTVYRILFLYMLTTILIGFLVPYDSPQLMGSTSGGGSHSSPFVIAIASHGVKV 374

Query: 369 VPHFXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVSCVF 428
           VPH                             EQG  P+  NYVD+ GRP  C+L + +F
Sbjct: 375 VPHLINAVILISIVSVANSAFYSSTRLLLSLSEQGKIPKIFNYVDKEGRPWYCILFASLF 434

Query: 429 GLLSFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYVAW 488
           G + FVA+SP +E VFTWLLAISGLS++F W SI LSH+R RRAM  QG+S DE+GY A 
Sbjct: 435 GSIGFVASSPYKEEVFTWLLAISGLSQIFLWMSICLSHIRFRRAMIKQGKSLDEIGYKAP 494

Query: 489 TGVWGAYYAMAMIVAILVGQFWVAISPVGSN-KLDANNFFENYLAMPILIFLYLGYKIWT 547
           TG WG++ A+++ +  L+ QFWVAI+P+G + KLD   FF+NYLA PI++  YLGYK + 
Sbjct: 495 TGCWGSWIALSIALFSLISQFWVAIAPIGKDGKLDVLVFFQNYLAAPIVLIAYLGYKTYY 554

Query: 548 RDWRLLIPSSEVDLVAHRKIFDAE 571
           +DWRL IPS ++DL   R+I+  E
Sbjct: 555 KDWRLYIPSDKIDLSYGREIYVPE 578

>TBLA0I02000 Chr9 complement(452716..454710) [1995 bp, 664 aa] {ON}
           Anc_3.284 YDR046C
          Length = 664

 Score =  470 bits (1209), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 233/522 (44%), Positives = 317/522 (60%), Gaps = 4/522 (0%)

Query: 81  LKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYCVIQSASEL 140
           LK+ ++ RHV+M+SL TGIGTG+LV N   L   GPA LVIGY +VS + Y +IQ+A E+
Sbjct: 143 LKKTMKSRHVVMMSLGTGIGTGLLVSNASCLSLSGPAPLVIGYGLVSIITYLLIQAAGEM 202

Query: 141 AIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKYWNQTINPD 200
            + Y +L G FN Y S  + +  GF+  W+  +QWL V+PLEL+ ASMTIKYW  +I+PD
Sbjct: 203 GVAYPTLPGNFNTYISTFLSRPIGFATIWLSSIQWLTVVPLELIAASMTIKYWTTSISPD 262

Query: 201 AFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGGAGNDGYLGAR 260
            FV IFYV L  I+              N CK+LM           NCGGAG+DGY+G +
Sbjct: 263 VFVVIFYVFLNFIHFFGTAAYGETEFIFNLCKILMIIGFIILSIVINCGGAGHDGYIGGK 322

Query: 261 YWHDPGAFRGSDSINRFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVY 320
           YWH PGAF G +S +RFK +  +LV A F+YGG E  VLT  EQ NP+KS  +A+K  +Y
Sbjct: 323 YWHTPGAFVGKNSASRFKDVCYILVTAFFSYGGTELFVLTINEQPNPRKSTPTAAKTTIY 382

Query: 321 RILGIYIMTAILLGFLVPWNSDELL---GSGGSATHASPFVIAVASHGVRVVPHFXXXXX 377
           RIL +Y++T ILLGF VP+++  L     S G +   SP+V+A + HGV+VVPHF     
Sbjct: 383 RILIVYLLTMILLGFNVPYDNKNLFSATSSNGDSISISPYVLAASIHGVKVVPHFINAVV 442

Query: 378 XXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVSCVFGLLSFVAAS 437
                                  +QG AP+FL Y+DR GRP+  LL+  + G++ F AAS
Sbjct: 443 LIALISVANSATYAAPRMMASLAQQGMAPKFLAYIDREGRPIYGLLICSLLGVIGFAAAS 502

Query: 438 PKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYVAWTGVWGAYYA 497
            KE+ VF WL AI+GL+ LF W    LSH+R R AM VQG+  +E+GY A  G+WG+   
Sbjct: 503 DKEQEVFVWLAAIAGLATLFLWECFFLSHIRFRWAMKVQGKDINEVGYKAACGIWGSIIG 562

Query: 498 MAMIVAILVGQFWVAISPVGS-NKLDANNFFENYLAMPILIFLYLGYKIWTRDWRLLIPS 556
               V +L+  FWV+++P G  + + A NFFE  LA+PI IF  +GY +  +DW +  P 
Sbjct: 563 ACFNVLVLIANFWVSLTPPGQGSNVSAKNFFEQMLALPIWIFFAVGYMVIKKDWVIWNPI 622

Query: 557 SEVDLVAHRKIFDAEVLRHEQLEEKEQLRHAPWTTRLANFWC 598
             +DL   RKI+D E L+ E  E +E++R+A +  R   FWC
Sbjct: 623 ESIDLDYCRKIYDPEQLKREDEENRERIRNAGFWARCRAFWC 664

>NDAI0A07500 Chr1 complement(1715826..1717685) [1860 bp, 619 aa]
           {ON} 
          Length = 619

 Score =  466 bits (1200), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 252/544 (46%), Positives = 335/544 (61%), Gaps = 25/544 (4%)

Query: 41  FRRFADSFRRHEAHNXXXXXXXXXXXXXLTPIESASKHKTLKQNIRPRHVLMISLATGIG 100
           F+ F + F+R + +                  +   +   L + I+ RH+LMISL TGI 
Sbjct: 64  FKNFLNGFKRQKQNEEGA--------------DLEMQDTQLSKTIKARHLLMISLGTGIA 109

Query: 101 TGMLVGNGKSLHNGGPASLVIGYAIVSSMLYCVIQSASELAIIYTSLAGGFNAYPSLLVD 160
           TG+LVGNG+ L   GP  LVIGY I S M+YC+IQSA EL I Y  L G F  Y SLL+D
Sbjct: 110 TGLLVGNGQVLSKAGPGGLVIGYFISSVMIYCMIQSAGELGICYRGLVGNFTRYSSLLID 169

Query: 161 KAFGFSVSWVYCLQWLCVLPLELVTASMTIKYWNQTINPDAFVTIFYVVLVAINXXXXXX 220
            + GF++S +Y  QWL VLPL+LVTA++TI++W   +NPD FV I ++V++ +N      
Sbjct: 170 PSLGFALSILYTFQWLTVLPLQLVTAAITIEFWTD-LNPDIFVAIIFIVVIVVNLFGARG 228

Query: 221 XXXXXXXXNCCKVLMXXXXXXXXXXXNCGGAGNDGYLGARYWHDPGAFRGSDSINRFKGI 280
                   N CK+LM             GGAGNDGY+GA+YW +PGAF      N FKG+
Sbjct: 229 YAEAEFFCNLCKILMIIGFIILSIIIISGGAGNDGYIGAKYWKNPGAFA-----NGFKGV 283

Query: 281 VAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRILGIYIMTAILLGFLVPWN 340
             V   AAF+YGG E  VL+  EQ+NP K + +  KK+ YRIL IY++T IL+ FLVP+ 
Sbjct: 284 CTVFTYAAFSYGGIEVLVLSIDEQENPIKVVPNCCKKVAYRILFIYLLTTILVCFLVPYT 343

Query: 341 SDELLGS----GGSATHASPFVIAVASHGVRVVPHFXXXXXXXXXXXXXXXXXXXXXXXX 396
           S +LLGS      S +HASPFVIAV SHGV+VVPHF                        
Sbjct: 344 SPQLLGSLNKGENSGSHASPFVIAVESHGVKVVPHFINAVILISVISVANSSVYSSGRLL 403

Query: 397 XXXXEQGFAPRFLNYVDRCGRPVLCLLVSCVFGLLSFVAASPKEETVFTWLLAISGLSEL 456
               EQG  P+FLNY+D+ GRP+ C ++S  FGL+ FVA+S K + VFTWLLAISGLS+L
Sbjct: 404 LSLSEQGTFPQFLNYIDQRGRPIRCFVISLTFGLIGFVASSEKRQDVFTWLLAISGLSQL 463

Query: 457 FTWFSISLSHVRLRRAMTVQGRSADELGYVAWTGVWGAYYAMAMIVAILVGQFWVAISPV 516
           F W +I LSH+R R AM  Q +S DE+GY A TG WG++ A+ + +  LV QFWVAI+PV
Sbjct: 464 FIWLAICLSHIRFRDAMKTQKKSMDEVGYKAQTGYWGSWVAVLIGLFSLVTQFWVAIAPV 523

Query: 517 GSN-KLDANNFFENYLAMPILIFLYLGYKIWTRDWRLLIPSSEVDLVAHRKIFDAEVLRH 575
             N KLD  +FF+NYLA PI++  Y G+K++  +W  LIP S++DL +HRKI+  E +  
Sbjct: 524 DKNGKLDVMSFFQNYLAFPIVLVAYFGHKLYYGNWCPLIPLSKIDLDSHRKIYSPEEITE 583

Query: 576 EQLE 579
            +L+
Sbjct: 584 IELQ 587

>SAKL0H08184g Chr8 (704748..706544) [1797 bp, 598 aa] {ON} similar
           to uniprot|P48813 Saccharomyces cerevisiae YDR508C GNP1
           High-affinity glutamine permease also transports Leu Ser
           Thr Cys Met and Asn expression is fully dependent on
           Grr1p and modulated by the Ssy1p-Ptr3p-Ssy5p (SPS)
           sensor of extracellular amino acids
          Length = 598

 Score =  463 bits (1192), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 232/502 (46%), Positives = 320/502 (63%), Gaps = 6/502 (1%)

Query: 73  ESASKHKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYC 132
            + S+++ LKQ+I+P HV MI++ATGIGTG+LVGNGKS+ + G    ++GY I+ SML C
Sbjct: 62  HTGSENEKLKQSIKPYHVFMITMATGIGTGLLVGNGKSISDAGVGGTLVGYFIIGSMLVC 121

Query: 133 VIQSASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKY 192
            +QS  EL + + SLAGGFN+Y    VD +FGF+V+W++CLQW  VLPLELVTASMTIKY
Sbjct: 122 CMQSVGELVVAFPSLAGGFNSYGKRFVDPSFGFTVAWLFCLQWQIVLPLELVTASMTIKY 181

Query: 193 WNQTINPDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGGAG 252
           WN ++NP  FV IFY +++ I+              N  KVLM           + G AG
Sbjct: 182 WNNSLNPSIFVAIFYSLILGISFFGARGYADAEFLFNLSKVLMITGFIILGIIISFGAAG 241

Query: 253 NDGYLGARYWHDPGAFRGSDSINRFKGIVAVLVNAAFAYGGAEFSVLTAAEQQ--NPQKS 310
             GY+G +Y   PGAF   ++ N FK I + LVNA F+ GG EF  L+AAEQ   N  KS
Sbjct: 242 TSGYIGIKYLKTPGAF---NTRNTFKSICSTLVNACFSCGGVEFLALSAAEQARGNISKS 298

Query: 311 IRSASKKLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSATHASPFVIAVASHGVRVVP 370
           I+ A  +++ R+   YI++  ++G LVP+NS EL+GS     H+SP+VIAVASHGV+VVP
Sbjct: 299 IKRACGQVLVRMCVFYILSIFVIGLLVPYNSPELMGSSSEIIHSSPYVIAVASHGVKVVP 358

Query: 371 HFXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVSCVFGL 430
           H                             EQGFAP +   +D  GRP  CL+VS VFGL
Sbjct: 359 HLINAVILIAVVSVANSAMYSSSRTLHALAEQGFAPSYFAKLDSKGRPFRCLVVSGVFGL 418

Query: 431 LSFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYVAWTG 490
           LSF+A    +E+VF WLL+ISGLS +FTW  I ++H+R R AM  Q  S +ELG+ AW+G
Sbjct: 419 LSFIAEYKDQESVFVWLLSISGLSTIFTWTMICVAHLRFRAAMKDQNHSLEELGHRAWSG 478

Query: 491 VWGAYYAMAMIVAILVGQFWVAISPV-GSNKLDANNFFENYLAMPILIFLYLGYKIWTRD 549
           ++G+YY +A+    LV QFWV++ P+ G  + D  NFF+NY+A+P  + LY+G+KI+TR 
Sbjct: 479 IYGSYYVIAINSLTLVVQFWVSLFPLDGDGRPDFVNFFQNYMAVPFALCLYVGHKIYTRS 538

Query: 550 WRLLIPSSEVDLVAHRKIFDAE 571
           W+ +IP+ ++D+   R I+  E
Sbjct: 539 WQFIIPADKIDVDTSRDIYGVE 560

>NCAS0I01520 Chr9 (284348..286192) [1845 bp, 614 aa] {ON} 
          Length = 614

 Score =  462 bits (1190), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 254/564 (45%), Positives = 346/564 (61%), Gaps = 31/564 (5%)

Query: 17  VESFDSVEVLKEESP---------RSDSRSDGLFRRFADSFRRHEAHNXXXXXXXXXXXX 67
           +ES    E+   E P          S   +   F+ F  SF+R ++              
Sbjct: 43  IESTKKREIEVSEKPIASADTTVSTSKCNAKTYFQDFCHSFKRKDSDLDS---------- 92

Query: 68  XLTPIESASKHKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVS 127
                +  ++   L + I+ RH+LMISL TGI TG+LVGNG+ L   GPA L+IGY + S
Sbjct: 93  -----DVEAQDTQLSKTIKSRHLLMISLGTGIATGLLVGNGQVLAKAGPAGLIIGYTVSS 147

Query: 128 SMLYCVIQSASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTAS 187
            M+YC+I +A EL I Y  L G F  YPS+L+D + GF++S +Y LQWL VLPL+LVTA+
Sbjct: 148 IMIYCIIHAAGELGICYRGLVGNFTRYPSILIDPSLGFAISLLYTLQWLTVLPLQLVTAA 207

Query: 188 MTIKYWNQTINPDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXN 247
           +TI +W   +NPD FV   ++V++ +N              NCCK+LM            
Sbjct: 208 ITISFWTD-VNPDIFVLCVFIVVIIVNLFGARGYAETEFFCNCCKILMITGFIILSIVII 266

Query: 248 CGGAGNDGYLGARYWHDPGAFRGSDSINRFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNP 307
            GGAG DGY+GA+YW  PG F      + FKG+  V   AAF+YGG E  VL+  EQ++P
Sbjct: 267 TGGAGKDGYIGAKYWIHPGPFA-----HGFKGVCTVFTYAAFSYGGIEVVVLSIDEQEDP 321

Query: 308 QKSIRSASKKLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSATHASPFVIAVASHGVR 367
             ++ +A KK+VYRIL IY++T IL+ FLVP++S  LLGS  S +HASPFVIA+ SHGV+
Sbjct: 322 VSAVPNACKKVVYRILLIYLLTTILVCFLVPYDSPNLLGSSHSGSHASPFVIAIESHGVK 381

Query: 368 VVPHFXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVSCV 427
           VVPHF                            EQG  P++LN++D  GRP+ C ++S +
Sbjct: 382 VVPHFINAVILISVISVANSSLYSSSRLLLSLSEQGSLPQWLNFIDMNGRPIRCFIISIL 441

Query: 428 FGLLSFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYVA 487
           FG++ FVAAS K E VFTWLLAISGLS+LF W S+SLSH+RLR AM  QG+S DE+GY A
Sbjct: 442 FGMIGFVAASDKREDVFTWLLAISGLSQLFIWMSMSLSHIRLRDAMKSQGKSLDEIGYKA 501

Query: 488 WTGVWGAYYAMAMIVAILVGQFWVAISPVGSN-KLDANNFFENYLAMPILIFLYLGYKIW 546
            TG WG++ A+ +    LV QFWVAI+PV  + +LD  NFF+NYLA PI++  YLG+KI+
Sbjct: 502 QTGYWGSWLAVFIGFFSLVTQFWVAIAPVEKHGELDVVNFFQNYLAFPIVLVAYLGHKIY 561

Query: 547 TRDWRLLIPSSEVDLVAHRKIFDA 570
            ++WRL IP+ ++DL +HR+I+ A
Sbjct: 562 YKNWRLWIPADKIDLDSHRRIYSA 585

>ZYRO0G12342g Chr7 complement(976302..978164) [1863 bp, 620 aa] {ON}
           similar to uniprot|P41815 Saccharomyces cerevisiae
           YDR046C BAP3 Amino acid permease involved in the uptake
           of cysteine leucine isoleucine and valine
          Length = 620

 Score =  451 bits (1160), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 231/572 (40%), Positives = 341/572 (59%), Gaps = 16/572 (2%)

Query: 31  PRSDSRSDGLFRRFADSFRRHEAHNXXXXXXXXXXXXXLTPIESASKHKTLKQNIRPRHV 90
           P+      G+  R  DS+RR +                  P      +  LKQ ++ RHV
Sbjct: 61  PKQGFFQRGILGRVVDSYRRADIPGQD------------DPEGDMVSNAGLKQALKTRHV 108

Query: 91  LMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYCVIQSASELAIIYTSLAGG 150
            M+SL TGIGTG+L+ NGK L N GPA L+IGY +VS   Y ++Q+A ELA+ + ++ G 
Sbjct: 109 AMMSLGTGIGTGLLIANGKGLSNAGPAPLLIGYGLVSVNTYFMVQAAGELAVAFPTIPGS 168

Query: 151 FNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKYWNQTINPDAFVTIFYVVL 210
           FNAY S LV + FGF+ +W++ +QWL + P+EL+  +  +++W   ++ D FV IF+V L
Sbjct: 169 FNAYTSQLVSRPFGFATTWLFFVQWLTMFPMELIAMTFAVRFWTTRVDADVFVLIFFVFL 228

Query: 211 VAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGGAGNDGYLGARYWHDPGAFRG 270
             ++              N  KVLM             GGAG+ GY+GA+YWHDPGAF  
Sbjct: 229 FIVHFIGVEAYGETEFFLNLFKVLMVIGFVIFAICVAAGGAGDSGYIGAKYWHDPGAFVS 288

Query: 271 SDSINRFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRILGIYIMTA 330
             +  RFKG+  VLV+A F+YGG E  VL+  EQ+NP+K+I +A+K  +YRI+ IY++T 
Sbjct: 289 HTAEGRFKGVCYVLVSAYFSYGGTELFVLSVNEQENPRKTIPTATKTTIYRIIFIYLLTM 348

Query: 331 ILLGFLVPWNSDELLGS---GGSATHASPFVIAVASHGVRVVPHFXXXXXXXXXXXXXXX 387
           +L+GF VP N   L+GS          SP+V+A + H VRV+PHF               
Sbjct: 349 VLVGFTVPNNHPRLMGSPYAKEGVQSVSPYVLAASYHHVRVLPHFINAVVMLALVSMSNS 408

Query: 388 XXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVSCVFGLLSFVAASPKEETVFTWL 447
                        +QG+ P++ +Y+DR GRP   L++  + G+++F ++S K ET+F+WL
Sbjct: 409 AMYAAPRLICSLAQQGYCPKYFDYIDRRGRPTRALVLCFIIGVIAFASSSEKRETIFSWL 468

Query: 448 LAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYVAWTGVWGAYYAMAMIVAILVG 507
            AI+GLSELFTW SI LSHVR R A+ VQG+  +ELGY + TGVWG+ Y +   + +   
Sbjct: 469 SAIAGLSELFTWSSIMLSHVRFRAAIKVQGKDINELGYKSNTGVWGSAYGVFFSLLVFAA 528

Query: 508 QFWVAIS-PVGSNKLDANNFFENYLAMPILIFLYLGYKIWTRDWRLLIPSSEVDLVAHRK 566
           QFWVA+S P    K  A++FF++YLA+PI +  Y+G+ +WTRD+  LIP ++VDL ++R+
Sbjct: 529 QFWVALSAPNSGGKCSASDFFQSYLALPIWLTFYVGFMLWTRDFTFLIPLNKVDLDSYRR 588

Query: 567 IFDAEVLRHEQLEEKEQLRHAPWTTRLANFWC 598
            +D E+LR E  E K+ ++ A    +L +F+C
Sbjct: 589 YYDPELLRQEDEEHKQAMKSASIWIKLHSFFC 620

>ADL272W Chr4 (227414..229108) [1695 bp, 564 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YDR508C (GNP1)
          Length = 564

 Score =  441 bits (1134), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 223/517 (43%), Positives = 318/517 (61%), Gaps = 9/517 (1%)

Query: 75  ASKHKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYCVI 134
            S+  +L+Q+I+PRHV MIS+ATGIGTG+LVGNGKS+   G    +IGY I+  M+ C +
Sbjct: 19  GSEPASLRQSIKPRHVFMISMATGIGTGLLVGNGKSIATAGVGGTLIGYLIIGVMVVCCM 78

Query: 135 QSASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKYWN 194
           QS  EL + + SLAGGFN+Y    +D + GF VSW++CLQW+ VLPLELVTASMTIKYWN
Sbjct: 79  QSVGELVVAFPSLAGGFNSYGKKFIDPSLGFCVSWLFCLQWMVVLPLELVTASMTIKYWN 138

Query: 195 QTINPDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGGAGND 254
             ++P  FV+ FY+++  +N              NC KV++             GG GN 
Sbjct: 139 SNLSPSLFVSAFYILICIVNFFGSGGYAEAEFIFNCVKVMVLASFIVLGIVIITGGLGNS 198

Query: 255 GYLGARYWHDPGAFRGSDSINRFKGIVAVLVNAAFAYGGAEFSVLTAAEQQ--NPQKSIR 312
           G +G +Y   PGAF  + + N FK     LVNAAF+ GG EF  L+AAEQ   N  KSIR
Sbjct: 199 GPIGFQYLKTPGAF--NTNYNVFKATAGTLVNAAFSCGGVEFLALSAAEQNRDNMPKSIR 256

Query: 313 SASKKLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSATHASPFVIAVASHGVRVVPHF 372
            A +++  R+   Y+++  ++G LVP++S  L+GSG   TH SP+V A+A HGVR+VPH 
Sbjct: 257 RACRQVSIRMFVFYLLSISVVGLLVPYDSPMLMGSGSDTTHTSPYVAAIALHGVRIVPHI 316

Query: 373 XXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVSCVFGLLS 432
                                       EQ FAPR+   +++ G+P+ CL+VS + GL+S
Sbjct: 317 INAVILIAVVSVANSAMYSSSRTLHSLAEQNFAPRYFALLNKHGQPMRCLVVSAIVGLIS 376

Query: 433 FVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYVAWTGVW 492
           F+A    +E VF WLL+ISGLS +FTW +I ++H+R R A+ +QG+S D LGY + TGV 
Sbjct: 377 FIAEYRDQEAVFVWLLSISGLSTIFTWTTICIAHIRFRNALKLQGQSLDTLGYRSNTGVI 436

Query: 493 GAYYAMAMIVAILVGQFWVAISPVGSN-KLDANNFFENYLAMPILIFLYLGYKIWTRDWR 551
           G+Y A A+ V +++ QFWV++ P+ +N K DA  FF+NY+A+P+ + LYLG+K++T DW 
Sbjct: 437 GSYIATAINVVVIIVQFWVSLFPLENNGKPDAVKFFQNYMAVPVAVLLYLGHKLYTNDWT 496

Query: 552 LLIPSSEVDLVAHRKIFDAEVLRHEQLEEKEQLRHAP 588
             I +  VD+   R ++       + L  K  ++ AP
Sbjct: 497 PWIRTHCVDINTDRDVYAPS----DDLSTKGVVKLAP 529

>Kwal_27.12681 s27 (1332647..1334428) [1782 bp, 593 aa] {ON} YKR039W
           (GAP1) - 1:1 [contig 260] FULL
          Length = 593

 Score =  434 bits (1116), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 220/570 (38%), Positives = 334/570 (58%), Gaps = 9/570 (1%)

Query: 30  SPRSDSRSDGLFRRFADSFRRHEAHNXXXXXXXXXXXXXLTPIESASKHKTLKQNIRPRH 89
           SP     S   ++ F D F+R E                +T          L+++++ RH
Sbjct: 32  SPGQTQASKSRWQDFKDGFKRVELEELDPNLTEAEKIAIIT------AQSPLQRHLKNRH 85

Query: 90  VLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYCVIQSASELAIIYTSLAG 149
           + MI++   IGTG+ VG+GK+L  GGPA ++IG+ ++  M+YCV+ S  ELA+ +  ++G
Sbjct: 86  LQMIAIGGAIGTGLFVGSGKALRTGGPAGVLIGWGLIGLMIYCVVMSMGELAVTF-PVSG 144

Query: 150 GFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKYWNQTIN-PDAFVTIFYV 208
           GF  Y +  VD++FGF++++ Y LQWL VLPLE+V AS+T+ +W       D FV +FY+
Sbjct: 145 GFTTYATRFVDESFGFAINYNYMLQWLVVLPLEIVAASITVNFWGTPPKYRDGFVALFYI 204

Query: 209 VLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGGAGNDGYLGARYWHDPGAF 268
           V+V IN              +  KV+             CGG    GY+G +YWH+PGAF
Sbjct: 205 VIVIINFFGVRGYGEAEFVFSFIKVITVIGFIILGIVLVCGGGPVGGYIGGKYWHNPGAF 264

Query: 269 RGSDSINRFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRILGIYIM 328
            G D+ +RFKG+ +V V AAF++ G E   L +AE  NP+K++  A+K++ +RIL  YI+
Sbjct: 265 SGDDAGSRFKGVCSVFVTAAFSFAGTELVGLASAETANPRKALPRAAKQVFWRILLFYII 324

Query: 329 TAILLGFLVPWNSDELLGSGGSATHASPFVIAVASHGVRVVPHFXXXXXXXXXXXXXXXX 388
           +  L+G LVP  S+ L+G+      ASPFV+A+ +HG++ +P                  
Sbjct: 325 SLCLIGLLVPHTSERLIGTSSVDAAASPFVLAIQTHGIKGLPSVINVVILISVLSVGNSA 384

Query: 389 XXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVSCVFGLLSFVAASPKEETVFTWLL 448
                       EQG  P    Y+DR GRP++ ++ +CVFGLLSF+A S KE  VF WLL
Sbjct: 385 VYACSRSMVALAEQGSLPHIFAYIDRKGRPLVAIITTCVFGLLSFIAQSEKEGDVFNWLL 444

Query: 449 AISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYVAWTGVWGAYYAMAMIVAILVGQ 508
           A+SGLS LF+W +I + H+R RRA++ QGRS DEL +V++ G+ G+Y+ + +++ +L+ Q
Sbjct: 445 ALSGLSTLFSWGAICICHIRFRRALSAQGRSTDELAFVSYAGIAGSYFGVILVLLVLIAQ 504

Query: 509 FWVAISPVGSNKLDANNFFENYLAMPILIFLYLGYKIWTRDWRLLIPSSEVDLVAHRKIF 568
           FWVA+ P+G +  +A +FF  YL+ P+L+  Y+ +KIW R+W+L   + ++D+   R+  
Sbjct: 505 FWVAVWPIGGSP-NAEDFFSAYLSFPVLLAFYIFHKIWKRNWKLFTRAKDIDIDTGRREM 563

Query: 569 DAEVLRHEQLEEKEQLRHAPWTTRLANFWC 598
           D E LR E  EEK  L   PW  RL  FWC
Sbjct: 564 DTEALRQEIAEEKMLLSTRPWWYRLYFFWC 593

>SAKL0G14014g Chr7 (1202476..1204293) [1818 bp, 605 aa] {ON} highly
           similar to uniprot|P06775 Saccharomyces cerevisiae
           YGR191W HIP1 High-affinity histidine permease also
           involved in the transport of manganese ions
          Length = 605

 Score =  427 bits (1099), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 214/527 (40%), Positives = 315/527 (59%), Gaps = 3/527 (0%)

Query: 73  ESASKHKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYC 132
           ++A+  K L +++  RH+L +++   IGTG+ V +G SL+ GGPASL++ + IVS+ L+ 
Sbjct: 81  DTANDSK-LNKDLSVRHLLTLAVGGAIGTGLFVNSGASLNTGGPASLIVAWVIVSTCLFT 139

Query: 133 VIQSASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKY 192
           ++ +  ELA ++  + GGFN Y +  V+ +FGF+V+  Y  QW  +LPLELV AS+TI+Y
Sbjct: 140 IVNALGELAAVF-PVVGGFNVYITRFVEPSFGFAVNINYLAQWAVLLPLELVAASITIRY 198

Query: 193 WNQTINPDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGGAG 252
           WN TIN DA+V IFY  +   N              +  K+L             CGG  
Sbjct: 199 WNNTINSDAWVAIFYTAIFLANMLDVKSFGETEFVLSMIKILAIIGFTILGIVLACGGGP 258

Query: 253 NDGYLGARYWHDPGAFRGSDSINRFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIR 312
           +  Y+G RYW+DPGAF G     RFKG+ AV V AAF+Y G E   ++AAE  NP+ ++ 
Sbjct: 259 SGEYIGGRYWNDPGAFVGDTPGRRFKGVCAVFVTAAFSYSGTELVAVSAAESHNPRVTLP 318

Query: 313 SASKKLVYRILGIYIMTAILLGFLVPWNSDELL-GSGGSATHASPFVIAVASHGVRVVPH 371
            ASK+  + I   YI    ++G LVP+N + LL G+      ASP VIA+ + G++ +P 
Sbjct: 319 KASKRTFWLITLCYITVLTIIGCLVPYNDERLLNGNSSVDAAASPLVIAIENGGIKGLPS 378

Query: 372 FXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVSCVFGLL 431
                                        E G  P+ LNY+D+ GRP+  +  + +FGLL
Sbjct: 379 LMNAIILIAILSVANSAVYACSRCMVAMAEIGNLPKRLNYIDKRGRPLYAIFATLIFGLL 438

Query: 432 SFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYVAWTGV 491
           SF+AAS K+E VFTWL A+SGLS LF WFSI+LSH+R R+AM  Q RS +EL +V+ TGV
Sbjct: 439 SFIAASDKQEEVFTWLSALSGLSTLFCWFSINLSHIRFRQAMKAQDRSLNELPFVSITGV 498

Query: 492 WGAYYAMAMIVAILVGQFWVAISPVGSNKLDANNFFENYLAMPILIFLYLGYKIWTRDWR 551
           +G++Y   +I  +L+  FW ++ PVGS+  DA +FFE YL++PI I  YLG+K++ +DWR
Sbjct: 499 YGSWYGCIVIFLVLIASFWTSLFPVGSDGADAESFFEGYLSLPIFIVCYLGHKVYKKDWR 558

Query: 552 LLIPSSEVDLVAHRKIFDAEVLRHEQLEEKEQLRHAPWTTRLANFWC 598
           L + + ++DL   R+  D ++L+ E   E+EQ+   P+  R  N WC
Sbjct: 559 LYVKTKDMDLDTGRREIDLDILKQEIRLEREQMAQKPFYIRFLNVWC 605

>Ecym_8297 Chr8 complement(602984..604693) [1710 bp, 569 aa] {ON}
           similar to Ashbya gossypii ADL272W
          Length = 569

 Score =  425 bits (1092), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 217/515 (42%), Positives = 314/515 (60%), Gaps = 8/515 (1%)

Query: 77  KHKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYCVIQS 136
           K + L+Q+IRPRHV MIS+ATGIGTG+LVGNGKS+   G    +IGY I+  ML C +QS
Sbjct: 37  KKEVLRQSIRPRHVFMISMATGIGTGLLVGNGKSIACAGIGGTLIGYGIIGVMLVCCMQS 96

Query: 137 ASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKYWNQT 196
             EL + + SL+GGFN+Y    +D + GFSVSW++CLQW+ VLPLELVT SMTIKYWN +
Sbjct: 97  VGELVVAFPSLSGGFNSYGKRFIDPSLGFSVSWLFCLQWMIVLPLELVTGSMTIKYWNAS 156

Query: 197 INPDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGGAGNDGY 256
           ++P  FV++FY ++  +N              N  KV++           + G  G  G 
Sbjct: 157 LSPSLFVSVFYALICVVNSFGSGGYAEAEFIFNSLKVVVIIGFIILGVLIDTGCVGTSGT 216

Query: 257 LGARYWHDPGAFRGSDSINRFKGIVAVLVNAAFAYGGAEFSVLTAAEQQ--NPQKSIRSA 314
           +G RY  DPG F  + + N  K     LVNAAF+ GG EF  L+AAEQ   N  KSI  A
Sbjct: 217 IGFRYLIDPGMF--NKNYNIIKATAGTLVNAAFSCGGVEFLALSAAEQNRDNMPKSIGRA 274

Query: 315 SKKLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSATHASPFVIAVASHGVRVVPHFXX 374
             ++  RI   Y+++  ++G LVP NS  L+GSG +  H+SP+V AVA +G+ VVPH   
Sbjct: 275 CNQVSIRIFVFYLLSISVVGLLVPHNSPILMGSGSNMIHSSPYVAAVAMNGITVVPHIIN 334

Query: 375 XXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVSCVFGLLSFV 434
                                     EQ FAP++   +++ G+P+ CL +S +FGL+SFV
Sbjct: 335 AVILIAVISVANSAMYSSSRTLHSLAEQNFAPKYFTKLNKHGQPMRCLFISALFGLISFV 394

Query: 435 AASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYVAWTGVWGA 494
           A    +E +F WLL+ISGLS +FTW +I ++H+R R A+  +G+S + LGY + TGV G+
Sbjct: 395 AEYRDQEAIFIWLLSISGLSTIFTWTTICIAHIRFRDAIKSRGQSLETLGYKSITGVAGS 454

Query: 495 YYAMAMIVAILVGQFWVAISPVGSN-KLDANNFFENYLAMPILIFLYLGYKIWTRDWRLL 553
           Y A  + + ILV QFWV++ P+ SN K +   FF+NY+A+P+ +  Y+G+K++T++W LL
Sbjct: 455 YIATVINLVILVVQFWVSLFPLESNGKPNIVQFFQNYMAVPVALLFYIGHKVYTKNWSLL 514

Query: 554 IPSSEVDLVAHRKIFDAEVLRHEQLEEKEQLRHAP 588
           I +S VD+   R I+   +   E  + K  ++++P
Sbjct: 515 IRASNVDITTDRDIYCPTI---EDPKIKVLMQNSP 546

>Suva_11.273 Chr11 (498611..500416) [1806 bp, 601 aa] {ON} YKR039W
           (REAL)
          Length = 601

 Score =  425 bits (1093), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 222/569 (39%), Positives = 340/569 (59%), Gaps = 13/569 (2%)

Query: 33  SDSRSDGLFRRFADSFRRHEAHNXXXXXXXXXXXXXLTPIESASKHKTLKQNIRPRHVLM 92
           ++  S   ++ F DSF+R E                +T          LK  ++ RH+ M
Sbjct: 43  TEKGSGSKWKDFRDSFKRVEPVEVDPNLTEAEKVAFIT------AQTPLKHQLKNRHLQM 96

Query: 93  ISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYCVIQSASELAIIYTSLAGGFN 152
           I++   IGTG+LVG+GK+L  GGPASL+IG+  + +M+Y ++ +  ELA+++  ++GGF 
Sbjct: 97  IAIGGAIGTGLLVGSGKALRTGGPASLLIGWGSMGTMIYAMVMALGELAVVF-PISGGFT 155

Query: 153 AYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKYWNQTINP---DAFVTIFYVV 209
            Y +  +D++FGF+ ++ Y LQWL  LPLE+V+AS+T+ YW    +P   D FV +F++V
Sbjct: 156 TYATRFIDESFGFAANFNYMLQWLVTLPLEIVSASITVNYWGT--DPKYRDGFVALFWLV 213

Query: 210 LVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGGAGNDGYLGARYWHDPGAFR 269
           +V IN              +  KV+            NCGG    GY+G +Y+HDPGAF 
Sbjct: 214 IVCINMFGVKGYGEAEFVFSIIKVITIIGFIILGIILNCGGGPEKGYIGGKYFHDPGAFA 273

Query: 270 GSDSINRFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRILGIYIMT 329
           G     +FKG+ +V V AAF++ G+E   L A+E  +P+KS+  A+K++ +RI   YI++
Sbjct: 274 GDTPGAKFKGVCSVFVTAAFSFAGSELVGLAASESVDPRKSVPKAAKQVFWRITLFYILS 333

Query: 330 AILLGFLVPWNSDELLGSGGSATHASPFVIAVASHGVRVVPHFXXXXXXXXXXXXXXXXX 389
            +++G LVP+N   L+G+      ASPFVIA+ +HG++ +P                   
Sbjct: 334 LLMIGLLVPYNDSRLIGASSVDAAASPFVIAIVTHGIKGLPSVVNVVILIAVLSVGNSAI 393

Query: 390 XXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVSCVFGLLSFVAASPKEETVFTWLLA 449
                      EQGF P+   YVDR GRP++ ++++   GL++FVAAS KEE VF WLLA
Sbjct: 394 FACSRTFVALAEQGFLPQIFAYVDRKGRPLVGIIITSAVGLIAFVAASNKEEDVFNWLLA 453

Query: 450 ISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYVAWTGVWGAYYAMAMIVAILVGQF 509
           +SGLS LFTW  I + H+R R+A+T QGRS DEL + + TGVWG+Y+ + MIV + + QF
Sbjct: 454 LSGLSSLFTWGGICICHIRFRKALTSQGRSVDELSFKSPTGVWGSYWGLFMIVIMFIAQF 513

Query: 510 WVAISPVGSNKLDANNFFENYLAMPILIFLYLGYKIWTRDWRLLIPSSEVDLVAHRKIFD 569
           +VA+ PV  +   A  FFE YL+ P+++ +Y+G+KI+ R+W+LLIP+ E+D+ + R+  D
Sbjct: 514 YVALFPVNGSP-SAEGFFEAYLSFPLVLAMYIGHKIYKRNWKLLIPAGEMDIDSGRREVD 572

Query: 570 AEVLRHEQLEEKEQLRHAPWTTRLANFWC 598
            E+L+ E  EEK  L   P   R+ +FWC
Sbjct: 573 LELLKQEIAEEKAILATKPAWFRVYSFWC 601

>TPHA0B01090 Chr2 complement(246708..248528) [1821 bp, 606 aa] {ON}
           Anc_1.244 YKR039W
          Length = 606

 Score =  425 bits (1093), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 223/581 (38%), Positives = 341/581 (58%), Gaps = 11/581 (1%)

Query: 21  DSVEVLKE--ESPRSDSRSDGLFRRFADSFRRHEAHNXXXXXXXXXXXXXLTPIESASKH 78
           +S+++ KE     ++       +R+F DSF+R E                +T       H
Sbjct: 33  ESIDIKKETFNYNQTGEEKGSKWRQFIDSFKRVEVPELDPNLTEQERIAIIT------AH 86

Query: 79  KTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYCVIQSAS 138
             LK +++ RH+ MI++   IGTG+ VG+G +L   GPASL+IG++I  SM+Y ++ + +
Sbjct: 87  TPLKHHLKSRHLQMIAIGGAIGTGLFVGSGTALRTAGPASLIIGWSITGSMIYSMVMAVA 146

Query: 139 ELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKYWNQ-TI 197
           E+A++Y  ++GGF  Y +  +D++FGF+ ++ Y LQWL VLPLE+V+AS+T+ YW   T 
Sbjct: 147 EMAVLY-PISGGFTTYATRFIDESFGFANNFNYMLQWLVVLPLEIVSASITVNYWGTPTK 205

Query: 198 NPDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGGAGNDGYL 257
             D FV +F++V+V IN              +  KV+             CGG    GY+
Sbjct: 206 YRDGFVALFWLVIVIINLFGVKGYGEAEFIFSTIKVITVVGFIILGLVLVCGGGPTGGYV 265

Query: 258 GARYWHDPGAFRGSDSINRFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKK 317
           GA+YWHDPGAF G+ +  +F+G  +V V AAF++ G+E   +  +E +NP+K++  A+K+
Sbjct: 266 GAKYWHDPGAFVGATAGAQFQGFCSVFVTAAFSFSGSELIGIAGSEAENPRKAVPPAAKQ 325

Query: 318 LVYRILGIYIMTAILLGFLVPWNSDELLGSGGSATHASPFVIAVASHGVRVVPHFXXXXX 377
           + +RIL  YI++ + +G LVP N   L+GS      ASPFVIA+  HG+R +P       
Sbjct: 326 VFWRILLFYILSLLFIGLLVPSNDSRLIGSSNVDAAASPFVIAITVHGIRGLPSVINVVI 385

Query: 378 XXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVSCVFGLLSFVAAS 437
                                  EQGF P+ ++Y+DR GRP++ + +S  FGL++FVA S
Sbjct: 386 LIAVLSVGNSAIYTCSRTLVALAEQGFLPKVVSYIDRSGRPLVGIAISSFFGLVAFVAQS 445

Query: 438 PKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYVAWTGVWGAYYA 497
            KE  VF WLLAISGLS  FTW +I L H+R R A+  Q RS DEL +V+  GV+G+Y+ 
Sbjct: 446 DKEGDVFNWLLAISGLSSFFTWGAICLCHIRFRAALKAQNRSTDELPFVSPLGVFGSYWG 505

Query: 498 MAMIVAILVGQFWVAISPVGSNKLDANNFFENYLAMPILIFLYLGYKIWTRDWRLLIPSS 557
           + +IV +L  QF+VAI PVG     A NFF  YL++P+++ +Y+ +K+WT++W++ IP  
Sbjct: 506 LFLIVLMLAAQFYVAIFPVGDTP-SATNFFSAYLSLPVVLVMYIAHKLWTKNWKIFIPLG 564

Query: 558 EVDLVAHRKIFDAEVLRHEQLEEKEQLRHAPWTTRLANFWC 598
           ++DL   RK  D ++LR E  EE+  L   P   R+  FWC
Sbjct: 565 QLDLDTGRKQLDLDLLRQEVAEERATLAARPRWFRIYTFWC 605

>KLLA0A06886g Chr1 complement(621646..623409) [1764 bp, 587 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 587

 Score =  421 bits (1083), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 234/597 (39%), Positives = 341/597 (57%), Gaps = 18/597 (3%)

Query: 3   DFELHNMKSPDNGVVESFDSVEVLKEESPRSDSRSDGLFRRFADSFRRHEAHNXXXXXXX 62
           D+ +      ++G     +S     + SP   +R    + RF DSF+R +  +       
Sbjct: 8   DYSIDQETQLESGEFHEQNSYVSQSDASPVEGTR----WERFRDSFKRADTQDLDPNLTD 63

Query: 63  XXXXXXLTPIESASKHKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIG 122
                 LT       +  LK+ ++ RH+ MI++   IGTG+ VG+GK+L   GPA ++IG
Sbjct: 64  AEKMAILT------ANAPLKRTLKSRHLQMIAIGGAIGTGLFVGSGKALATAGPAGILIG 117

Query: 123 YAIVSSMLYCVIQSASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLE 182
           +A+  +M+YC++ +  ELA+ +  +AGGF  Y S  VD++FGF+ + +Y LQWL VLPLE
Sbjct: 118 WALTGTMIYCMVMAMGELAVTF-PIAGGFTTYASRFVDESFGFAFNTIYMLQWLVVLPLE 176

Query: 183 LVTASMTIKYWNQTIN-PDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXX 241
           +V AS+T+ YW       D FV +FYVV+VAIN              +  KV+       
Sbjct: 177 IVAASITVNYWGTPDKYRDGFVALFYVVIVAINFFGVKGYGEAEFIFSFIKVITVIGYII 236

Query: 242 XXXXXNCGGAGNDGYLGARYWHDPGAFRGSDSINRFKGIVAVLVNAAFAYGGAEFSVLTA 301
                 CGG    GY+G R WH+PGAF      N FKG+ +V V AAF++ G+E   L A
Sbjct: 237 LGVILVCGGGPQGGYIGGRLWHNPGAFA-----NGFKGVCSVFVTAAFSFAGSELVGLAA 291

Query: 302 AEQQNPQKSIRSASKKLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSATHASPFVIAV 361
           AE  NP+KS+ SA+K++ +RI   YI+  +++G LVP+ SD L+G       ASPFVI++
Sbjct: 292 AETANPRKSLPSAAKQVFWRITLFYILALLMVGLLVPYTSDRLIGQSSVDAAASPFVISI 351

Query: 362 ASHGVRVVPHFXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLC 421
            + G++ +P                               QG  P+   Y+DR GRP++ 
Sbjct: 352 QNAGIKGLPSVINVVILIAVLSVGNSAVFACSRSMAALANQGSLPKIFGYIDRTGRPLVG 411

Query: 422 LLVSCVFGLLSFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSAD 481
           ++V+CVFGLLSF+AASPKE  VF WLLA+SGLS LFTW  I L H+R+RRA+  Q R+  
Sbjct: 412 IIVTCVFGLLSFIAASPKEGEVFDWLLALSGLSSLFTWGGIMLCHIRVRRALAAQNRTTA 471

Query: 482 ELGYVAWTGVWGAYYAMAMIVAILVGQFWVAISPVGSNKLDANNFFENYLAMPILIFLYL 541
           EL + A TGVWG+ Y   +I+ IL+ QFW+A+ P+G +K  A+ FFE YL+ PILI  Y+
Sbjct: 472 ELSFTAPTGVWGSVYGFVLIILILMAQFWIALFPIG-DKPSASAFFEAYLSFPILIAFYI 530

Query: 542 GYKIWTRDWRLLIPSSEVDLVAHRKIFDAEVLRHEQLEEKEQLRHAPWTTRLANFWC 598
           G+KIW ++W+L I +  +D+   R+  D E L+ E  EEK  +   P+  R+  FWC
Sbjct: 531 GHKIWKKNWKLFIRAKNIDIDTGRRETDIEALKQEIAEEKAFIASKPFYYRMYKFWC 587

>KLTH0E15642g Chr5 (1389937..1391727) [1791 bp, 596 aa] {ON} similar
           to uniprot|P19145 Saccharomyces cerevisiae YKR039W GAP1
           General amino acid permease localization to the plasma
           membrane is regulated by nitrogen source
          Length = 596

 Score =  418 bits (1075), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 219/599 (36%), Positives = 341/599 (56%), Gaps = 11/599 (1%)

Query: 2   KDFELHNMKSPDNGVVESFDSVEVLKEESPRSDSRSDG-LFRRFADSFRRHEAHNXXXXX 60
           K+F ++  + P  G      S E    E   S   S G  ++ F D F+R E  +     
Sbjct: 7   KNF-VYAQEEPLEGRDVGHSSYETGSGEITDSKPTSSGSRWQDFVDGFKRVELGDLDPNL 65

Query: 61  XXXXXXXXLTPIESASKHKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLV 120
                      +  A+    L+++++ RH+ MI++   IGTG+ VG+G +L  GGPA+++
Sbjct: 66  TQA------EKVAIATARSPLQRHLKNRHLQMIAIGGAIGTGLFVGSGSALRTGGPAAVL 119

Query: 121 IGYAIVSSMLYCVIQSASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLP 180
           IG+ ++  M+Y V+ +  ELA+ +  +AGGF  Y    VD +FGF+++++Y LQWL VLP
Sbjct: 120 IGWGLIGLMIYSVVMAMGELAVTF-PVAGGFTTYIPRFVDDSFGFAINYIYMLQWLVVLP 178

Query: 181 LELVTASMTIKYWNQTIN-PDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXX 239
           LE+V AS+T+ YW       D FV +FYVV+V IN              +  KV      
Sbjct: 179 LEIVAASITVNYWGTPAKYRDGFVALFYVVIVIINMFGVKGYGEAEFVFSIIKVTTVVGF 238

Query: 240 XXXXXXXNCGGAGNDGYLGARYWHDPGAFRGSDSINRFKGIVAVLVNAAFAYGGAEFSVL 299
                   CGG    GY+G +YWH+PGAF G ++  RFK + +V V AAF++ G E   L
Sbjct: 239 IILGIVLICGGGPVGGYVGGKYWHNPGAFNGDNAGQRFKAVCSVFVTAAFSFAGTELVGL 298

Query: 300 TAAEQQNPQKSIRSASKKLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSATHASPFVI 359
            AAE +NP+K++  A+K++ +RI   YI++  L+G LVP+ S+ L+GS      ASPFV+
Sbjct: 299 AAAETENPRKALPRAAKQVFWRITLFYIISLCLIGLLVPYTSENLIGSSSVDAAASPFVL 358

Query: 360 AVASHGVRVVPHFXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPV 419
           A+ +HG+  +P                              +QGF P+  +Y+DR GRP+
Sbjct: 359 AIKTHGISGLPSVINVVILISVLSVGNSSVYACSRTLSALADQGFLPQIFSYIDRKGRPL 418

Query: 420 LCLLVSCVFGLLSFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRS 479
           + +L +C FGLL F+A S KE  VF WL+A+SGLS LFTW  I + H+R RRA+  QGRS
Sbjct: 419 VGILATCTFGLLCFIAQSKKEGDVFNWLMALSGLSSLFTWGFICICHLRFRRALAAQGRS 478

Query: 480 ADELGYVAWTGVWGAYYAMAMIVAILVGQFWVAISPVGSNKLDANNFFENYLAMPILIFL 539
            DEL + ++ GVWG+Y+ + +I  + + QFW+A+ P+G    +A++FF+ YL++ +++F 
Sbjct: 479 TDELAFTSYVGVWGSYFGVILICLVFIAQFWIAVWPMGGTP-NASDFFQAYLSVVVVLFF 537

Query: 540 YLGYKIWTRDWRLLIPSSEVDLVAHRKIFDAEVLRHEQLEEKEQLRHAPWTTRLANFWC 598
           YL +K++TR+W     + ++D+   R+  D + L+ E  EEK +L   PW  R+ + WC
Sbjct: 538 YLAHKLYTRNWTFAKRAKDIDIDTGRRELDLDALKQEIAEEKLRLSTKPWWYRVYHLWC 596

>ZYRO0D03762g Chr4 complement(304207..306009) [1803 bp, 600 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 600

 Score =  414 bits (1063), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 223/604 (36%), Positives = 343/604 (56%), Gaps = 19/604 (3%)

Query: 2   KDFELHNMKS----PDNGVVESFDSVE--VLKEESPRSDSRSDGLFRRFADSFRRHEAHN 55
           KD E  N++     PD     S++  +  + +EE    DSR    +++  DSF+R E   
Sbjct: 9   KDVEAGNVQVKETLPDVETGASYEHYDNYIDEEEQGPPDSR----WKKIKDSFKRAEVPE 64

Query: 56  XXXXXXXXXXXXXLTPIESASKHKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGG 115
                           I  A+    L+  ++ RH+ MIS+   IGTG+ VG+G +L   G
Sbjct: 65  LDPNLTEA------EKIAIATARSPLQHQLKNRHLQMISIGGAIGTGLFVGSGTALRTAG 118

Query: 116 PASLVIGYAIVSSMLYCVIQSASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQW 175
           PA ++IG+ I  SM+YC++ S +ELAI +  +AGGF  Y +  +D+++GF+ ++ Y LQW
Sbjct: 119 PAGILIGWIIAGSMIYCMVMSVAELAIAF-PVAGGFTTYATRFIDESYGFANNFNYMLQW 177

Query: 176 LCVLPLELVTASMTIKYWNQTIN-PDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVL 234
           +  LPLE+V AS+T+ YW+      D FV +F+VV+V IN              + CK+L
Sbjct: 178 IVTLPLEIVAASITVNYWHTDKKYRDGFVALFWVVIVIINMFGVRGYGEAEFIFSICKIL 237

Query: 235 MXXXXXXXXXXXNCGGAGNDGYLGARYWHDPGAFRGSDSINRFKGIVAVLVNAAFAYGGA 294
           M            CGG    GY+GARYW+ PGAF G  S  +FKG  +V V AAF++ G+
Sbjct: 238 MIVGFIILAIILICGGGPGTGYIGARYWYHPGAFAGDTSGRKFKGFCSVFVTAAFSFAGS 297

Query: 295 EFSVLTAAEQQNPQKSIRSASKKLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSATHA 354
           E   L AAE  NP+K +  A+K++ +RI   Y++  +L+G LVP+    L+G       A
Sbjct: 298 ELVGLAAAEASNPRKDVPGAAKQVFWRITMFYVLCLLLIGMLVPYTDPRLIGGSSVDAAA 357

Query: 355 SPFVIAVASHGVRVVPHFXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDR 414
           SPFVIA+ + G+  +P                              +QGF P+  +Y+DR
Sbjct: 358 SPFVIAIKNQGISGLPTLVNVVILIAVLSVGNSAVYACSRTLSALADQGFLPKCFSYIDR 417

Query: 415 CGRPVLCLLVSCVFGLLSFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMT 474
            GRP++ + V+  FGL++FVA S KE  VF WL+A+SGLS LFTW +I L H+R RRA+ 
Sbjct: 418 MGRPMVGIAVTSAFGLIAFVAQSDKEGEVFDWLMALSGLSSLFTWATICLCHIRFRRALA 477

Query: 475 VQGRSADELGYVAWTGVWGAYYAMAMIVAILVGQFWVAISPVGSNKLDANNFFENYLAMP 534
            QGRS +EL + +  GVWGA + + + + +L  QF+VA+ P+G+    AN+FF+ YL++P
Sbjct: 478 AQGRSTNELAFASPAGVWGAAWGLFLCIIMLAAQFYVALFPLGAPP-SANDFFQGYLSLP 536

Query: 535 ILIFLYLGYKIWTRDWRLLIPSSEVDLVAHRKIFDAEVLRHEQLEEKEQLRHAPWTTRLA 594
           I++ ++LG+KIW ++W+L I + ++D+   R+  D ++LR +  EE+  L   P   R+ 
Sbjct: 537 IVLAMWLGHKIWKKNWKLFIKAEDMDIDTGRRELDLDLLRQQVEEERAALAAKPMWYRIY 596

Query: 595 NFWC 598
            F+C
Sbjct: 597 KFFC 600

>TPHA0A00240 Chr1 complement(28756..30567) [1812 bp, 603 aa] {ON}
           Anc_5.158 YGR191W
          Length = 603

 Score =  411 bits (1057), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 215/519 (41%), Positives = 311/519 (59%), Gaps = 2/519 (0%)

Query: 81  LKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYCVIQSASEL 140
           + Q++  RH++ +++   IGTG+ V +G SL+ GGPASLVIG+ IVS+ L+ VI S  EL
Sbjct: 86  MNQDLNVRHLITLAVGGAIGTGLFVNSGASLNTGGPASLVIGWTIVSTALFTVINSLGEL 145

Query: 141 AIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKYWNQTINPD 200
           A  Y  + GGFN Y +  VD +F FSV+  Y +QWL +LPLELV AS+TI+YW+ TIN D
Sbjct: 146 AAAY-PVVGGFNVYMTRFVDPSFAFSVNLNYLVQWLVLLPLELVAASLTIRYWDDTINSD 204

Query: 201 AFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGGAGNDGYLGAR 260
           A+V IFY +++  N              +  K+L             CGG    GY+G +
Sbjct: 205 AWVAIFYTLILIANLLDVKSFGETEFILSLVKILAIIGFFILGIVLTCGGGPKGGYIGGK 264

Query: 261 YWHDPGAFRGSDSINRFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVY 320
           YWHDPGAF G  +  +FKG+ +V V AAF+Y G E   ++AAE QNP+K+I +A+K+  +
Sbjct: 265 YWHDPGAFVGDSAGTQFKGLCSVFVTAAFSYAGIEMIAVSAAESQNPRKTIPTAAKRTFW 324

Query: 321 RILGIYIMTAILLGFLVPWNSDELL-GSGGSATHASPFVIAVASHGVRVVPHFXXXXXXX 379
            I   YI    L+G LV +N   LL GS      ASP VIA+ + G++ +P         
Sbjct: 325 IITFSYITILTLVGCLVAYNDTRLLNGSSSVDVAASPLVIAIENGGIKGLPSLMNAIILI 384

Query: 380 XXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVSCVFGLLSFVAASPK 439
                                  G  P+ L+ VD+ GRP+  +  +  FGLLSFVAAS K
Sbjct: 385 AILSVANSAVYACSRCMVSMALIGNLPKGLSVVDKRGRPLRAIFTTLFFGLLSFVAASDK 444

Query: 440 EETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYVAWTGVWGAYYAMA 499
           +E VFTWL A+SGLS +F W  I+++H+R R+AMTVQ RS DE+ Y++ TG++G+YY  A
Sbjct: 445 QEEVFTWLSALSGLSTIFCWMGINIAHIRFRQAMTVQNRSLDEMPYLSQTGIYGSYYGTA 504

Query: 500 MIVAILVGQFWVAISPVGSNKLDANNFFENYLAMPILIFLYLGYKIWTRDWRLLIPSSEV 559
           ++  +L+  FW ++ P+G +  DA  FFE YL+ PILI  Y+G+K++ ++WR++ P  E+
Sbjct: 505 ILFLVLIASFWTSLFPLGGDGADAEAFFEGYLSFPILIACYIGHKLYFKNWRIMTPLEEI 564

Query: 560 DLVAHRKIFDAEVLRHEQLEEKEQLRHAPWTTRLANFWC 598
           DL+  RK  D ++L+ E   E+E LR + +  R    WC
Sbjct: 565 DLLTGRKEVDIDILKEELKIEREALRQSSFMKRFLLIWC 603

>KLLA0F01012g Chr6 complement(90772..92442) [1671 bp, 556 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn
          Length = 556

 Score =  406 bits (1044), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 205/518 (39%), Positives = 307/518 (59%), Gaps = 5/518 (0%)

Query: 81  LKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYCVIQSASEL 140
           LKQ+I+P HV M+S ATGIGTG+LVGNG+S+   G    ++GY I+  ML C +Q+  EL
Sbjct: 37  LKQSIKPFHVFMMSTATGIGTGLLVGNGRSIAIAGVGGTLVGYLIIGIMLTCCMQTVGEL 96

Query: 141 AIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKYWNQTINPD 200
            + + S+ GGF +Y    +D + GF++SW++ L W  VLPLE+  ASMTI +WN+ INP 
Sbjct: 97  VVAFPSMPGGFTSYGKRFIDPSVGFTISWLFFLNWTVVLPLEICVASMTINFWNENINPS 156

Query: 201 AFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGGAGNDGYLGAR 260
             V + Y ++  +N              NC KVLM           N G  G  GYLG +
Sbjct: 157 IVVALCYSLVCGVNFFGARCYADADCIFNCLKVLMILGFIILGIFVNTGVVGTSGYLGFK 216

Query: 261 YWHDPGAFRGSDSINRFKGIVAVLVNAAFAYGGAEFSVLTAAEQ--QNPQKSIRSASKKL 318
           Y+H PG FR  + +  FK I A L+ A F+ GG EF  L+ AEQ  ++  +SI+ AS ++
Sbjct: 217 YFHSPGFFRNDEGL--FKSIAATLITACFSTGGTEFVALSCAEQNTEDMPRSIKRASIQV 274

Query: 319 VYRILGIYIMTAILLGFLVPWNSDELLGSGGSATHASPFVIAVASHGVRVVPHFXXXXXX 378
           V RI  I+ ++ +++G LVP+NS  L+GSG   THASP+V+A+ ++GVR++PH       
Sbjct: 275 VVRIAIIFCVSLMIIGLLVPFNSPYLMGSGSELTHASPYVVALTTNGVRIIPHIVNAIIL 334

Query: 379 XXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVSCVFGLLSFVAASP 438
                                 EQGFA ++   +D  G+P  CL VS   GL SF+A   
Sbjct: 335 LSIISVANNAMYSSSRTLHSLAEQGFAMKYFCKLDESGKPFRCLCVSAFTGLFSFIAEYK 394

Query: 439 KEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYVAWTGVWGAYYAM 498
            +ETVF WLL+ISGLS +FTW    +SH+R R+AM  Q ++ D+LGY +  GV+G+Y ++
Sbjct: 395 DQETVFVWLLSISGLSTIFTWSMTCVSHLRFRKAMKDQDQALDQLGYQSPCGVYGSYISL 454

Query: 499 AMIVAILVGQFWVAISPVGSN-KLDANNFFENYLAMPILIFLYLGYKIWTRDWRLLIPSS 557
            +   IL+ QFWV++ P+ SN +L+  +F +NY+A+PI I LYLG+K +T +W+  I + 
Sbjct: 455 FICAIILIVQFWVSLFPLESNGRLNVVSFLQNYMAVPITIVLYLGHKAYTGNWKPFIRAP 514

Query: 558 EVDLVAHRKIFDAEVLRHEQLEEKEQLRHAPWTTRLAN 595
           E+D+   R I+  + +  ++    E L      ++L++
Sbjct: 515 EIDIQTDRDIYCVDEVTGKKSVFVELLDSGDMCSKLSD 552

>TDEL0C00930 Chr3 complement(147777..149564) [1788 bp, 595 aa] {ON} 
          Length = 595

 Score =  404 bits (1039), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 221/592 (37%), Positives = 331/592 (55%), Gaps = 13/592 (2%)

Query: 10  KSPDNGVVESFDSVEVLKEESPRSDSRSDGLFRRFADSFRRHEAHNXXXXXXXXXXXXXL 69
           K  DN VVE+     V  ++S  S + +   + RF +SF+R E                 
Sbjct: 14  KGGDNVVVENISQEPVSYDQSQGSSTEAHSRWGRFKESFKRAEEMELDPNLTEAER---- 69

Query: 70  TPIESASKHKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSM 129
             I   +    LK +++ RH+ MI++   IGTG+ VG+G +L   GPA ++IG+ +  +M
Sbjct: 70  --IAIKTAQSPLKHHLKNRHLQMIAIGGAIGTGLFVGSGTALRTAGPAGILIGWGLTGTM 127

Query: 130 LYCVIQSASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMT 189
           +Y ++ +  ELA+++  +AGGF  Y +  VD++FGF+ +++Y LQWL VLPLE+V AS+T
Sbjct: 128 IYSMVMAVGELAVVF-PVAGGFTTYATRFVDESFGFAANFIYMLQWLVVLPLEIVAASIT 186

Query: 190 IKYWNQTINP---DAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXX 246
           + YW    +P   D FV +FYVV+V IN              +  KV+            
Sbjct: 187 VNYWGT--DPKYRDGFVALFYVVIVIINMFGVKGYGEAEFIFSFIKVITVIGFIIMAIVL 244

Query: 247 NCGGAGNDGYLGARYWHDPGAFRGSDSINRFKGIVAVLVNAAFAYGGAEFSVLTAAEQQN 306
            CGG  +  Y+GA+YW++PGAF G  +  +F+G   V V AAF++ G+E   L  +E + 
Sbjct: 245 ICGGGKDHKYIGAQYWYNPGAFVGDTAGQQFQGFCTVFVTAAFSFAGSELVGLAGSEAEE 304

Query: 307 PQKSIRSASKKLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSATHASPFVIAVASHGV 366
           P+KS+  A+K++ +RI   YI+  +L+G LVP +S  L+G+      ASPFVIA+ +HG+
Sbjct: 305 PRKSVPGAAKQVFWRITLFYILCLLLIGMLVPSDSPRLIGASSVDAAASPFVIAIVNHGI 364

Query: 367 RVVPHFXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVSC 426
           + +P                              +QGF P    Y+DR GRP++ + +S 
Sbjct: 365 KGLPSVVNVVILIAVLSVGNSAIYSCSRTLAALADQGFLPSICGYIDRGGRPLVGIAISA 424

Query: 427 VFGLLSFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYV 486
            FGL++FVA S KE  VF WL+A+SGLS LFTW  I L H+R R A+  QGRS DEL + 
Sbjct: 425 FFGLIAFVAQSKKEGDVFNWLMALSGLSSLFTWAGICLCHIRYRGALAAQGRSTDELPFQ 484

Query: 487 AWTGVWGAYYAMAMIVAILVGQFWVAISPVGSNKLDANNFFENYLAMPILIFLYLGYKIW 546
           A  GVWG+Y+   M + + + QF+V + P G+ K +A +FF  YL+  I I LY  +KIW
Sbjct: 485 APAGVWGSYWGFFMCILMFIAQFYVGLFPPGT-KPNAYDFFLAYLSFCIFIALYAFHKIW 543

Query: 547 TRDWRLLIPSSEVDLVAHRKIFDAEVLRHEQLEEKEQLRHAPWTTRLANFWC 598
            R+W+L IP  ++D+   R+  D +VLR E  EE+  L   P+  R   FWC
Sbjct: 544 KRNWKLFIPLKDLDIDTGRREVDLDVLREELAEERAALAARPFWYRSWKFWC 595

>SAKL0D04664g Chr4 complement(365852..367633) [1782 bp, 593 aa] {ON}
           highly similar to uniprot|P19145 Saccharomyces
           cerevisiae YKR039W GAP1 General amino acid permease;
           localization to the plasma membrane is regulated by
           nitrogen source
          Length = 593

 Score =  404 bits (1037), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 230/599 (38%), Positives = 344/599 (57%), Gaps = 21/599 (3%)

Query: 5   ELHNMKSPDNGVVES--FDSVEVLKEESPRSDSRSDGLFRRFADSFRRHEAHNXXXXXXX 62
           E  N        VES  F + E   EES  S       ++ F +SF+R E          
Sbjct: 11  EKKNYSYAQEQYVESGEFTNHEASNEESSGSK------WQDFKNSFKRMEVVELDPNLTE 64

Query: 63  XXXXXXLTPIESASKHKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIG 122
                    I  A+ +  LK++++ RH+ MI++   IGTG+ VG+GK+L   GPA ++IG
Sbjct: 65  A------EKIAIATANSPLKRHLKNRHLQMIAIGGAIGTGLFVGSGKALRTAGPAGILIG 118

Query: 123 YAIVSSMLYCVIQSASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLE 182
           +A+  +M+YC++ +  ELA+ +  ++GGF  Y +  +D++FG++ ++ Y LQWL VLPLE
Sbjct: 119 WALTGTMIYCMVMAMGELAVTF-PVSGGFTTYATRFIDESFGYANNFNYMLQWLVVLPLE 177

Query: 183 LVTASMTIKYWNQTINP---DAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXX 239
           +V AS+T+ YW    +P   D FV +FYVV+V+IN              +  KV+     
Sbjct: 178 IVAASITVNYWGT--DPKYRDGFVALFYVVIVSINMFGVKGYGEAEFVFSFIKVITVIGF 235

Query: 240 XXXXXXXNCGGAGNDGYLGARYWHDPGAFRGSDSINRFKGIVAVLVNAAFAYGGAEFSVL 299
                   CGG    GY+G   WH+PGAF G+ +  RFKG+ +V V AAF++ G+E   L
Sbjct: 236 IILGIILVCGGGPVGGYIGGANWHNPGAFVGNTAGKRFKGVCSVFVTAAFSFAGSELVGL 295

Query: 300 TAAEQQNPQKSIRSASKKLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSATHASPFVI 359
            +AE  NP+KS+  A+K++ +RI   YI++  L+G LVP+N   L+G+      ASPFV+
Sbjct: 296 ASAETANPRKSLPRAAKQVFWRITLFYIISLCLIGLLVPYNDTRLIGASSVDAAASPFVL 355

Query: 360 AVASHGVRVVPHFXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPV 419
           A+ +HG++ +P                              EQGF P+   Y+DR GRP+
Sbjct: 356 AIKNHGIKGLPSVVNVVILIAVLSVGNSAVFGCSRTLTALAEQGFLPKIFGYIDRKGRPL 415

Query: 420 LCLLVSCVFGLLSFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRS 479
           + +  +  FGLLSF+AASPKE  VF WLLA+SGLS LFTW +I + H+R RRA++ QGRS
Sbjct: 416 VGIGFTSFFGLLSFIAASPKEGEVFDWLLALSGLSSLFTWMAICICHLRFRRALSAQGRS 475

Query: 480 ADELGYVAWTGVWGAYYAMAMIVAILVGQFWVAISPVGSNKLDANNFFENYLAMPILIFL 539
            DEL +V+  GVWG+ Y   +I+ IL  QFW+A+ P+GS   DA +FFE+YL++P+++ +
Sbjct: 476 TDELSFVSPAGVWGSIYGTVLIMLILAAQFWIALFPIGSPP-DAKDFFESYLSLPVVLVM 534

Query: 540 YLGYKIWTRDWRLLIPSSEVDLVAHRKIFDAEVLRHEQLEEKEQLRHAPWTTRLANFWC 598
           Y+G+K + R+W+L I +  +D+   R+  D E L+ E  EEK  L       R   FWC
Sbjct: 535 YIGHKCYKRNWKLFIRAENIDIDTGRREVDIEALKVELAEEKAVLASKSLWIRSYYFWC 593

>Skud_11.275 Chr11 (496787..498595) [1809 bp, 602 aa] {ON} YKR039W
           (REAL)
          Length = 602

 Score =  402 bits (1034), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 220/572 (38%), Positives = 338/572 (59%), Gaps = 13/572 (2%)

Query: 30  SPRSDSRSDGLFRRFADSFRRHEAHNXXXXXXXXXXXXXLTPIESASKHKTLKQNIRPRH 89
           +   ++ S   ++ F DSFRR E                +T          LK +++ RH
Sbjct: 41  TTNDEAGSGSKWQDFKDSFRRVEPVEVDPNLTEAEKVAFVT------AQTPLKHHLKNRH 94

Query: 90  VLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYCVIQSASELAIIYTSLAG 149
           + MI++   IGTG+LVG+G +L  GGPASL+IG+    +M+Y ++ +  ELA+I+  ++G
Sbjct: 95  LQMIAIGGAIGTGLLVGSGTALRTGGPASLLIGWGSTGTMIYSMVMALGELAVIF-PISG 153

Query: 150 GFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKYWNQTINP---DAFVTIF 206
           GF  Y +  +D++FG++ ++ Y LQWL VLPLE+V+AS+T+ +W    +P   D FV +F
Sbjct: 154 GFTTYATRFIDESFGYANNFNYMLQWLVVLPLEIVSASITVNFWGT--DPKYRDGFVALF 211

Query: 207 YVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGGAGNDGYLGARYWHDPG 266
           ++V+V IN              +  KV+            NCGG    GY+G +YWHDPG
Sbjct: 212 WLVIVIINMFGVKGYGEAEFVFSFIKVITVVGFIILGIILNCGGGPEGGYIGGKYWHDPG 271

Query: 267 AFRGSDSINRFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRILGIY 326
           AF G     +FKG+ +V V +AF++ G+E   L A+E  +P+KS+  A+K++ +RI   Y
Sbjct: 272 AFAGDTPGAKFKGLCSVFVTSAFSFAGSELVGLAASESVDPRKSVPKAAKQVFWRITLFY 331

Query: 327 IMTAILLGFLVPWNSDELLGSGGSATHASPFVIAVASHGVRVVPHFXXXXXXXXXXXXXX 386
           I++ +++G LVP+N   L+G+      ASPFVIA+ +HG++ +P                
Sbjct: 332 ILSLLMVGLLVPYNDPNLIGASSVDAAASPFVIAIKTHGIKGLPTVVNVVILIAVLSVGN 391

Query: 387 XXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVSCVFGLLSFVAASPKEETVFTW 446
                         EQ F P+   YVDR GRP++ + V+  FGL++FVAAS KE  VF W
Sbjct: 392 SAIYACSRTMVALAEQRFLPQIFAYVDRKGRPLVGIAVTSAFGLIAFVAASKKEGDVFNW 451

Query: 447 LLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYVAWTGVWGAYYAMAMIVAILV 506
           LLA+SGLS LFTW  I + H+R R+A+T QGR  DEL + + TGVWG+Y+ + M+V + +
Sbjct: 452 LLALSGLSSLFTWGGICICHIRFRKALTAQGRDLDELSFKSPTGVWGSYWGLFMVVIMFI 511

Query: 507 GQFWVAISPVGSNKLDANNFFENYLAMPILIFLYLGYKIWTRDWRLLIPSSEVDLVAHRK 566
            QF+VA+ PVG++   A  FFE YL+ P+++ +YLG+KI+ R+W+L IP+ ++D+   R+
Sbjct: 512 AQFYVALFPVGASP-SAEGFFEAYLSFPLVVAMYLGHKIYKRNWKLFIPAEDMDIDTGRR 570

Query: 567 IFDAEVLRHEQLEEKEQLRHAPWTTRLANFWC 598
             D E+L+ E  EEK  +   P   R+ NFWC
Sbjct: 571 EVDLELLKQEIAEEKAIMATKPKWYRIWNFWC 602

>NCAS0B07900 Chr2 (1500061..1501920) [1860 bp, 619 aa] {ON}
           Anc_1.244
          Length = 619

 Score =  400 bits (1028), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 219/558 (39%), Positives = 326/558 (58%), Gaps = 9/558 (1%)

Query: 42  RRFADSFRRHEAHNXXXXXXXXXXXXXLTPIESASKHKTLKQNIRPRHVLMISLATGIGT 101
           ++F DSF++ E                   I  A+    L+  ++ R   MI++   IG+
Sbjct: 70  QKFKDSFKKAEDVELDPNLTEAER------IAQATAKAPLQHTLKGRQQTMIAIGGAIGS 123

Query: 102 GMLVGNGKSLHNGGPASLVIGYAIVSSMLYCVIQSASELAIIYTSLAGGFNAYPSLLVDK 161
           G+ VG+  +L  GGPA L+IG+ + S+M+Y ++ +  ELA+++  +AGGF  Y +  VD+
Sbjct: 124 GLFVGSSTALRTGGPAGLIIGWGLTSTMIYSMVMALGELAVVF-PVAGGFTTYATRFVDE 182

Query: 162 AFGFSVSWVYCLQWLCVLPLELVTASMTIKYWNQ-TINPDAFVTIFYVVLVAINXXXXXX 220
           +FG++ ++ Y LQWL VLPLE+V+AS+T+ YW   T   D FV +F++V+V IN      
Sbjct: 183 SFGYANNFNYALQWLVVLPLEIVSASITVNYWGTPTRYRDGFVALFWLVIVIINMFGVKG 242

Query: 221 XXXXXXXXNCCKVLMXXXXXXXXXXXNCGGAGNDGYLGARYWHDPGAFRGSDSINRFKGI 280
                   +  KV              CGG    G++GA+YWHDPGAF G  S  +FKG+
Sbjct: 243 FGEAEFVFSIIKVTTVIGFIILGIVLVCGGGPKGGFVGAKYWHDPGAFVGHGSGAQFKGV 302

Query: 281 VAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRILGIYIMTAILLGFLVPWN 340
            +V V AAF++ G+E   +TAAE  NP+KSI  A+K++V+RI+  Y+ T  ++G LVP+N
Sbjct: 303 CSVFVTAAFSFAGSELIGITAAEAANPRKSIPGAAKQVVWRIVLFYMGTLTMIGLLVPYN 362

Query: 341 SDELLGSGGSATHASPFVIAVASHGVRVVPHFXXXXXXXXXXXXXXXXXXXXXXXXXXXX 400
              L+G+      ASPFVIA+ +HG++ +P                              
Sbjct: 363 DKRLIGASSVDAAASPFVIAIVTHGIKGLPSVINVVILIAVLSVGNSAIFACSRTIAALS 422

Query: 401 EQGFAPRFLNYVDRCGRPVLCLLVSCVFGLLSFVAASPKEETVFTWLLAISGLSELFTWF 460
           +QGF P+   Y+DR GRP++ + ++  FGLL+FVAAS KE  VF WLLA+SGLS LFTW 
Sbjct: 423 DQGFLPKVFGYIDRSGRPLVGIAITSTFGLLAFVAASKKEGEVFNWLLALSGLSSLFTWG 482

Query: 461 SISLSHVRLRRAMTVQGRSADELGYVAWTGVWGAYYAMAMIVAILVGQFWVAISPVGSNK 520
            I L H+R R A+  QGR  +EL +V+  GV G+Y+ + MIV + + QF+VA+ P G  K
Sbjct: 483 GICLCHIRFRMALKAQGRDTNELTFVSPAGVAGSYWGLFMIVLMFIAQFYVALFPPG-GK 541

Query: 521 LDANNFFENYLAMPILIFLYLGYKIWTRDWRLLIPSSEVDLVAHRKIFDAEVLRHEQLEE 580
            DA  FF++YL+ PI++  Y G+KI+ R+W+L IP  ++D+   R+  D E+L+ E +EE
Sbjct: 542 PDAEVFFQSYLSFPIVVATYFGHKIYKRNWKLFIPLEDMDIDTGRRETDMELLKQEIMEE 601

Query: 581 KEQLRHAPWTTRLANFWC 598
           K  L   PW  R   FWC
Sbjct: 602 KAILASKPWYIRAYAFWC 619

>KNAG0C02140 Chr3 complement(416347..418143) [1797 bp, 598 aa] {ON} 
          Length = 598

 Score =  399 bits (1026), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 224/601 (37%), Positives = 338/601 (56%), Gaps = 17/601 (2%)

Query: 5   ELHNMKSPDNGVVESFDSVEVLKEE--SPRSDSRSDG-LFRRFADSFRRHEAHNXXXXXX 61
           ++ + K     V   F S E L  +  S  S+    G ++ RF DSFR  E         
Sbjct: 8   DISDGKDAHLRVESEFISQEPLSHDLSSTGSEEHKKGKVWTRFVDSFRERE------RLE 61

Query: 62  XXXXXXXLTPIESASKHKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVI 121
                  L  I   + +  L+ +++ RH+ MI++   IGTG+ VG+G +L   GPA ++I
Sbjct: 62  VDPNMSELDQIAFRTANSPLQHHLKNRHLQMIAIGGAIGTGLFVGSGTALRTAGPAGILI 121

Query: 122 GYAIVSSMLYCVIQSASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPL 181
           G+ +  +M+Y ++ +  ELA+++  ++GGF  Y +  +D+++GF+ +  Y LQWL VLPL
Sbjct: 122 GWGLTGTMIYSMVMALGELAVLF-PVSGGFTTYATRFIDESYGFANNINYMLQWLVVLPL 180

Query: 182 ELVTASMTIKYWNQTINP---DAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXX 238
           E+V AS+T+ YW    NP   D FV +F++ +  IN              +  KV+    
Sbjct: 181 EIVAASITVNYWGT--NPRYRDGFVALFWLAIFIINLFGVKGYGEAEFIFSIIKVITVVG 238

Query: 239 XXXXXXXXNCGGAGNDGYLGARYWHDP-GAFRGSDSINRFKGIVAVLVNAAFAYGGAEFS 297
                   NCGG    GY+G RYWH P GAF G  +  RFKG+ +V V AAF++ G+E  
Sbjct: 239 FIILGIILNCGGGPVKGYIGGRYWHHPYGAFVGDSAGARFKGVCSVFVTAAFSFAGSELV 298

Query: 298 VLTAAEQQNPQKSIRSASKKLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSATHASPF 357
            L +AE  NP+KS+  A+K++ +RI   Y++   ++G LVP+    L+G+      ASPF
Sbjct: 299 GLASAETANPRKSVPKAAKQVFWRITLFYLLALGMVGLLVPYTEKRLIGASSVDAAASPF 358

Query: 358 VIAVASHGVRVVPHFXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGR 417
           VIA+ +HG+R +P                              EQ F P+F  Y+DR GR
Sbjct: 359 VIAITTHGIRGLPSVVNVVILIAVLSVGNSAIYACSRTLCALAEQNFLPKFFGYIDRSGR 418

Query: 418 PVLCLLVSCVFGLLSFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQG 477
           P+  +LV+  FGL++FVA S KE  VF WLLA+SGLS LFTW  I L H+R R+A++ QG
Sbjct: 419 PLYSILVTSGFGLVAFVAQSKKEGEVFNWLLALSGLSSLFTWGGICLCHIRFRKALSAQG 478

Query: 478 RSADELGYVAWTGVWGAYYAMAMIVAILVGQFWVAISPVGSNKLDANNFFENYLAMPILI 537
           R  DEL +V+  GV+G+Y+ + MI+ + + QF+VA+ P G+ K +A  FFE YL+ PI+I
Sbjct: 479 RGTDELSFVSPAGVYGSYWGLFMIILMFIAQFYVALFPPGA-KPNAKAFFEAYLSFPIVI 537

Query: 538 FLYLGYKIWTRDWRLLIPSSEVDLVAHRKIFDAEVLRHEQLEEKEQLRHAPWTTRLANFW 597
             YLG+KI+ ++W++ I + ++D+   RK  D ++LR E  EE+  L   PW  R   FW
Sbjct: 538 ACYLGHKIYKKNWKIFIKAEDMDIDTGRKDDDLDLLRQEVAEERAVLATKPWWYRWWVFW 597

Query: 598 C 598
           C
Sbjct: 598 C 598

>AGR319W Chr7 (1328425..1330305) [1881 bp, 626 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR191W (HIP1)
          Length = 626

 Score =  400 bits (1028), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 211/527 (40%), Positives = 307/527 (58%), Gaps = 2/527 (0%)

Query: 73  ESASKHKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYC 132
           ++A     L +N+  RH+L +++   IGTG+ V +G SL+ GGP S++I + ++S+ L+ 
Sbjct: 101 DAARNSSQLSKNLSIRHLLTLAVGGAIGTGLFVNSGASLNTGGPGSILIAWTLISTCLFT 160

Query: 133 VIQSASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKY 192
           ++ S  ELA  +  + GGFN Y +  V+ +FGF+V+  Y  QW  +LPLEL  AS+TIKY
Sbjct: 161 IVNSLGELASAF-PVVGGFNVYITRFVEPSFGFAVNISYLAQWAVLLPLELAAASITIKY 219

Query: 193 WNQTINPDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGGAG 252
           WN  IN DA+V IFYV +   N              +  K+L             CGG  
Sbjct: 220 WNNKINSDAWVAIFYVCIALANMLDVKSFGETEFVLSMVKILAIFGFAILGTVLICGGGP 279

Query: 253 NDGYLGARYWHDPGAFRGSDSINRFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIR 312
             G++GA+YWHDPGAF G     +FKG+ +V V AAF+Y G E   ++AAE  NP+ +I 
Sbjct: 280 VGGFIGAKYWHDPGAFVGDTPGAQFKGLCSVFVTAAFSYSGTELVGVSAAESINPRYTIP 339

Query: 313 SASKKLVYRILGIYIMTAILLGFLVPWNSDELL-GSGGSATHASPFVIAVASHGVRVVPH 371
            ASK+  + I   Y++   + G LVP N   LL G       ASP VIA+ + G+R VP 
Sbjct: 340 RASKRSFWLITSSYLLVLTIAGCLVPSNDPRLLNGMSSVDVAASPLVIAIENGGIRGVPS 399

Query: 372 FXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVSCVFGLL 431
                                        + G  P+  NY+DR GRP++ +L + VFGLL
Sbjct: 400 LMNAIILIAIISVANSSVYACSRCMVSMAQVGNLPKVFNYIDRKGRPLVAILATLVFGLL 459

Query: 432 SFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYVAWTGV 491
           SFVAAS K+E +FTWL A+SGLS LF WF+I++SH+R RRAM  Q RS DEL Y++ TGV
Sbjct: 460 SFVAASDKQEAIFTWLSALSGLSTLFCWFAINISHIRFRRAMCAQQRSLDELPYLSLTGV 519

Query: 492 WGAYYAMAMIVAILVGQFWVAISPVGSNKLDANNFFENYLAMPILIFLYLGYKIWTRDWR 551
            G++Y  A+++ +LV  FW ++ P GS+   A +FFE YL+ PI +  Y+ +K++ RDWR
Sbjct: 520 LGSWYGAAVLLFVLVLSFWTSLFPPGSSGPSAESFFEGYLSFPIFLICYISHKLYKRDWR 579

Query: 552 LLIPSSEVDLVAHRKIFDAEVLRHEQLEEKEQLRHAPWTTRLANFWC 598
           L IP+ ++D+ + R+  D E L+ ++L E+ +    P+  R   FWC
Sbjct: 580 LFIPAGQIDVDSGRRALDIEELKEQKLREQAETAKKPFYVRWWIFWC 626

>KLLA0A11770g Chr1 (1014918..1016663) [1746 bp, 581 aa] {ON} similar
           to uniprot|P06775 Saccharomyces cerevisiae YGR191W HIP1
           High-affinity histidine permease also involved in the
           transport of manganese ions
          Length = 581

 Score =  398 bits (1023), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 215/525 (40%), Positives = 313/525 (59%), Gaps = 4/525 (0%)

Query: 76  SKHKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYCVIQ 135
           +K   L +++  RH+L +++   IGTG+ V +G SL  GGPASLVI + I+S+ L+ ++ 
Sbjct: 59  TKDSKLNKDLSIRHLLTLAVGGAIGTGLFVNSGDSLSTGGPASLVIAWTIISTCLFTIVN 118

Query: 136 SASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKYWNQ 195
           S  EL+  +  + GGFN Y +  V+ +FGF+V++ Y  QW  +LPLEL  AS+TI+YWN+
Sbjct: 119 SLGELSATF-PVVGGFNVYVTRFVEPSFGFAVNFNYLAQWAILLPLELCAASITIRYWNK 177

Query: 196 TINPDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGGAGNDG 255
           +INPDA+V+IFYV +   N              +  K+L             CGG  + G
Sbjct: 178 SINPDAWVSIFYVAIAFANMLDVKSFGETEFVLSMVKILAIIGFTILGIVLICGGGPSGG 237

Query: 256 YLGARYWHDPGAFRGSDSINRFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSAS 315
           ++G +YW+DPGAF G     RFKG+ AV + AAF+Y G E   ++AAE +NP+ ++  A+
Sbjct: 238 FIGGKYWNDPGAFVGDTPAQRFKGLSAVFITAAFSYSGLELVGVSAAESRNPRVTLPKAA 297

Query: 316 KKLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSATHA--SPFVIAVASHGVRVVPHFX 373
           K+  + I   Y++   L+G LVP N D LL +G S+  A  SP VIA+ + G++ +P   
Sbjct: 298 KRTFWLITMSYLVILTLIGCLVPSN-DPLLLNGTSSVDAAASPLVIAIQNGGIKGLPSLM 356

Query: 374 XXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVSCVFGLLSF 433
                                      E G  PR L +VD+ GRP+  + ++ + GLLSF
Sbjct: 357 NAIILIALLSVANSAVYACSRCIISMAEIGNLPRSLAHVDKKGRPLYAIAITLLVGLLSF 416

Query: 434 VAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYVAWTGVWG 493
           +AAS K + VFTWL A+SGLS LF WF+I+L+H+R R AM  Q RS +EL YV+ TG WG
Sbjct: 417 IAASNKRDEVFTWLSALSGLSTLFCWFAINLAHLRFRHAMKHQNRSLEELPYVSMTGEWG 476

Query: 494 AYYAMAMIVAILVGQFWVAISPVGSNKLDANNFFENYLAMPILIFLYLGYKIWTRDWRLL 553
           ++Y   +I  +L+  FW ++ P G N  DA +FFE+YL++PI I  YLG+KIW R+ RL 
Sbjct: 477 SWYGCIVIGLVLIASFWTSLFPAGGNGADATSFFESYLSLPIFIACYLGHKIWKRNLRLY 536

Query: 554 IPSSEVDLVAHRKIFDAEVLRHEQLEEKEQLRHAPWTTRLANFWC 598
           I  SEVD+ + R   DA  L+ E+  E E ++  P+  RL NFWC
Sbjct: 537 IKLSEVDVDSGRTDTDAATLKQEKEAEAELMKTKPFYIRLWNFWC 581

>Kpol_543.79 s543 (197876..199693) [1818 bp, 605 aa] {ON}
           (197876..199693) [1818 nt, 606 aa]
          Length = 605

 Score =  399 bits (1024), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 218/589 (37%), Positives = 337/589 (57%), Gaps = 11/589 (1%)

Query: 11  SPDNGVVESFDSVEVLKEESPRSDSRSDGLFRRFADSFRRHEAHNXXXXXXXXXXXXXLT 70
           S  + V ES +S +   + S  +  RS   +  F DSF+R E                L 
Sbjct: 26  SGQDIVSESLESFDNQIDSSNYASHRSA--WGNFLDSFKRVEVEEVDPNLTD------LE 77

Query: 71  PIESASKHKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSML 130
            I   +    L+  ++ RH+ MI++   IGTG+ VG+G++L   GPA ++IG++I  +M+
Sbjct: 78  KIAIKTARSPLQHKLKSRHLQMIAIGGAIGTGLFVGSGRALRTAGPAGILIGWSITGTMI 137

Query: 131 YCVIQSASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTI 190
           + ++ +  ELA+++  ++GGF  Y +  +D++FGF+ ++ Y LQWL VLPLE+V AS+T+
Sbjct: 138 FTMVMALGELAVMF-PVSGGFTTYATRFIDESFGFACNFNYMLQWLVVLPLEIVAASITV 196

Query: 191 KYWNQTIN-PDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCG 249
            YW   +   D FV +F++V+V IN              +  KV              CG
Sbjct: 197 AYWETPVRYTDGFVALFWLVVVIINMFGVRGYGEAEFVFSIIKVTAVIGFIILGIVLVCG 256

Query: 250 GAGNDGYLGARYWHDPGAFRGSDSINRFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNPQK 309
           G    GY+GARYWH+PGAF GS S  +F G  +V V AAF++ G+E   L  +E +NP+K
Sbjct: 257 GGPVGGYVGARYWHNPGAFVGSTSGQKFHGFCSVFVTAAFSFAGSELIGLAGSEAKNPRK 316

Query: 310 SIRSASKKLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSATHASPFVIAVASHGVRVV 369
           ++ SA+K++ +RIL  YI+  +L+GFLVP+N   L+ S      ASPFVIA+ +HG+  +
Sbjct: 317 AVPSAAKQVFWRILLFYIICLLLIGFLVPYNDPRLISSSSVDASASPFVIAIVTHGISGL 376

Query: 370 PHFXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVSCVFG 429
           P                              EQGF P+ ++Y+DR GRP++ + +S  FG
Sbjct: 377 PSVINVVILISVLSVGNSAIYSCSRTLVALSEQGFLPKIVSYIDRKGRPLVGIAISSTFG 436

Query: 430 LLSFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYVAWT 489
           L++FVAAS K+  +F WLLAISGLS  FTW +I + H+R R A+  QGR  DEL +V+  
Sbjct: 437 LIAFVAASNKQNEMFNWLLAISGLSSFFTWSAICICHIRFRGALKAQGRGTDELPFVSPA 496

Query: 490 GVWGAYYAMAMIVAILVGQFWVAISPVGSNKLDANNFFENYLAMPILIFLYLGYKIWTRD 549
           GV G+Y+ + + + +L+ QF++A+ P+G +   A  FF  YLA P+++  Y+ +K+W ++
Sbjct: 497 GVIGSYWGLFLNILMLIAQFYIALFPIGGSP-SAYEFFSAYLAAPVILAFYIAHKLWKKN 555

Query: 550 WRLLIPSSEVDLVAHRKIFDAEVLRHEQLEEKEQLRHAPWTTRLANFWC 598
           W+ LIP  +VD+   R+  D  +L+ E  EEK  L   PW  R+  FWC
Sbjct: 556 WKFLIPLEDVDIDTGRRDTDVNLLKQEIAEEKAALAMRPWWYRVYVFWC 604

>Kwal_33.15407 s33 (1092383..1094146) [1764 bp, 587 aa] {ON} YGR191W
           (HIP1) - histidine permease [contig 290] FULL
          Length = 587

 Score =  397 bits (1020), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 209/526 (39%), Positives = 306/526 (58%), Gaps = 2/526 (0%)

Query: 74  SASKHKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYCV 133
           S ++     +++  RH+L +++   IGTG+ V +G +L  GGP SLVI + I+S+ L+ +
Sbjct: 63  SDAEDSRYNKDLSVRHLLTLAVGGAIGTGLFVNSGSALTTGGPGSLVIDWVIISTCLFTI 122

Query: 134 IQSASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKYW 193
           + +  EL+  +  + GGFN Y S  V+ +FGF+V+  Y  QW  +LPLELV AS+TI+YW
Sbjct: 123 VNALGELSSTF-PVVGGFNVYISRFVEPSFGFAVNLNYLAQWAVLLPLELVAASLTIRYW 181

Query: 194 NQTINPDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGGAGN 253
           N TIN DA+V IFY ++   N              +  K+L             CGG   
Sbjct: 182 NSTINSDAWVAIFYTIIFLANLLDVKSFGETEFVLSMVKILAIIGFTILGIVLTCGGGPE 241

Query: 254 DGYLGARYWHDPGAFRGSDSINRFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRS 313
            GY+G +YW +PGAF G+ S  RF G+ +V V AAF+Y G E   ++AAE  NP+ ++  
Sbjct: 242 GGYIGGKYWSNPGAFVGNTSSQRFHGLCSVFVTAAFSYSGTELIAVSAAESVNPRITLPK 301

Query: 314 ASKKLVYRILGIYIMTAILLGFLVPWNSDELL-GSGGSATHASPFVIAVASHGVRVVPHF 372
           A K+  + I   YI+   L+G LVP +   LL GS      ASP VIA+ + G++ +P  
Sbjct: 302 ACKRTFWLITVCYIVVLTLVGCLVPSDDPRLLHGSSSVDVAASPLVIAIENGGIKGLPSL 361

Query: 373 XXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVSCVFGLLS 432
                                         G  P+  +YVDR GRP+  +L + +FGLLS
Sbjct: 362 MNAIILIAVLSVANSAVYACSRCMASMARIGNLPKTFSYVDRKGRPLYAILATLIFGLLS 421

Query: 433 FVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYVAWTGVW 492
           F+AAS K+ETVFTWL A+SGLS LF WF+I++SH+R R  M  +GRS DEL +V+ TGVW
Sbjct: 422 FIAASNKQETVFTWLSALSGLSTLFCWFAINVSHIRFRYTMKQRGRSLDELPFVSMTGVW 481

Query: 493 GAYYAMAMIVAILVGQFWVAISPVGSNKLDANNFFENYLAMPILIFLYLGYKIWTRDWRL 552
           G+YY   +I  +LV  FW A+ P       A +FFE YL+ PIL+  Y+G+K++T+ WRL
Sbjct: 482 GSYYGCVIIFVVLVVCFWTALFPSTEGVASAESFFETYLSFPILLVCYIGHKLYTKSWRL 541

Query: 553 LIPSSEVDLVAHRKIFDAEVLRHEQLEEKEQLRHAPWTTRLANFWC 598
           L P++E+D+ + R+  D EVL+ E+  E++ +R   + TR  + WC
Sbjct: 542 LTPTTEIDIDSGRRAVDIEVLKDEKRMEEQAMREKSYLTRFLHLWC 587

>YKR039W Chr11 (515063..516871) [1809 bp, 602 aa] {ON}  GAP1General
           amino acid permease; Gap1p senses the presence of amino
           acid substrates to regulate localization to the plasma
           membrane when needed
          Length = 602

 Score =  397 bits (1020), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 219/590 (37%), Positives = 338/590 (57%), Gaps = 25/590 (4%)

Query: 12  PDNGVVESFDSVEVLKEESPRSDSRSDGLFRRFADSFRRHEAHNXXXXXXXXXXXXXLTP 71
           P NG   S D            ++ S   ++ F DSF+R +                +T 
Sbjct: 35  PSNGSAVSID------------ETGSGSKWQDFKDSFKRVKPIEVDPNLSEAEKVAIIT- 81

Query: 72  IESASKHKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLY 131
                    LK +++ RH+ MI++   IGTG+LVG+G +L  GGPASL+IG+    +M+Y
Sbjct: 82  -----AQTPLKHHLKNRHLQMIAIGGAIGTGLLVGSGTALRTGGPASLLIGWGSTGTMIY 136

Query: 132 CVIQSASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIK 191
            ++ +  ELA+I+  ++GGF  Y +  +D++FG++ ++ Y LQWL VLPLE+V+AS+T+ 
Sbjct: 137 AMVMALGELAVIF-PISGGFTTYATRFIDESFGYANNFNYMLQWLVVLPLEIVSASITVN 195

Query: 192 YWNQTINP---DAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNC 248
           +W    +P   D FV +F++ +V IN              +  KV+            NC
Sbjct: 196 FWGT--DPKYRDGFVALFWLAIVIINMFGVKGYGEAEFVFSFIKVITVVGFIILGIILNC 253

Query: 249 GGAGNDGYLGARYWHDPGAFRGSDSINRFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNPQ 308
           GG    GY+G +YWHDPGAF G     +FKG+ +V V AAF++ G+E   L A+E   P+
Sbjct: 254 GGGPTGGYIGGKYWHDPGAFAGDTPGAKFKGVCSVFVTAAFSFAGSELVGLAASESVEPR 313

Query: 309 KSIRSASKKLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSATHASPFVIAVASHGVRV 368
           KS+  A+K++ +RI   YI++ +++G LVP+N   L+G+      ASPFVIA+ +HG++ 
Sbjct: 314 KSVPKAAKQVFWRITLFYILSLLMIGLLVPYNDKSLIGASSVDAAASPFVIAIKTHGIKG 373

Query: 369 VPHFXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVSCVF 428
           +P                              EQ F P   +YVDR GRP++ + V+  F
Sbjct: 374 LPSVVNVVILIAVLSVGNSAIYACSRTMVALAEQRFLPEIFSYVDRKGRPLVGIAVTSAF 433

Query: 429 GLLSFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYVAW 488
           GL++FVAAS KE  VF WLLA+SGLS LFTW  I + H+R R+A+  QGR  DEL + + 
Sbjct: 434 GLIAFVAASKKEGEVFNWLLALSGLSSLFTWGGICICHIRFRKALAAQGRGLDELSFKSP 493

Query: 489 TGVWGAYYAMAMIVAILVGQFWVAISPVGSNKLDANNFFENYLAMPILIFLYLGYKIWTR 548
           TGVWG+Y+ + M++ + + QF+VA+ PVG +   A  FFE YL+ P+++ +Y+G+KI+ R
Sbjct: 494 TGVWGSYWGLFMVIIMFIAQFYVAVFPVGDSP-SAEGFFEAYLSFPLVMVMYIGHKIYKR 552

Query: 549 DWRLLIPSSEVDLVAHRKIFDAEVLRHEQLEEKEQLRHAPWTTRLANFWC 598
           +W+L IP+ ++D+   R+  D ++L+ E  EEK  +   P   R+ NFWC
Sbjct: 553 NWKLFIPAEKMDIDTGRREVDLDLLKQEIAEEKAIMATKPRWYRIWNFWC 602

>CAGL0B03773g Chr2 (373956..375773) [1818 bp, 605 aa] {ON} highly
           similar to uniprot|P06775 Saccharomyces cerevisiae
           YGR191w HIP1 Histidine permease
          Length = 605

 Score =  397 bits (1019), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 215/523 (41%), Positives = 314/523 (60%), Gaps = 2/523 (0%)

Query: 77  KHKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYCVIQS 136
            +  L +++  RH+L +++   IGTG+ V +G SL  GGPASLVIG+ IVS+ L+ VI S
Sbjct: 84  NNTNLNKDLSVRHLLTLAVGGAIGTGLFVNSGASLTTGGPASLVIGWVIVSTCLFTVINS 143

Query: 137 ASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKYWNQT 196
             ELA  +  + GGFN Y +  ++ +F F+++  Y  QWL +LPLELV AS+TI+YWN  
Sbjct: 144 LGELAAAF-PVVGGFNVYITRFIEPSFAFAINLNYLAQWLVLLPLELVAASITIRYWNDK 202

Query: 197 INPDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGGAGNDGY 256
           IN DA+V IFY  +   N              +  K+L             CGG  + GY
Sbjct: 203 INSDAWVAIFYTAIALANMLDVKSFGETEFILSMVKILAIIGFGILGIVLTCGGGPHGGY 262

Query: 257 LGARYWHDPGAFRGSDSINRFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASK 316
           +G +YWH+PGAF G  + ++FKG+ +V V AAF+Y G E + ++AAE +NP+++I  A+K
Sbjct: 263 IGGKYWHNPGAFVGHSAGSQFKGLCSVFVTAAFSYSGIEMTAVSAAESRNPKETIPKAAK 322

Query: 317 KLVYRILGIYIMTAILLGFLVPWNSDELL-GSGGSATHASPFVIAVASHGVRVVPHFXXX 375
           +  + I   Y+    L+G LVP+N   LL GS      ASP VIA+ + G++ +P     
Sbjct: 323 RTFWLITVSYVGILTLIGCLVPYNDPRLLNGSSSVDAAASPLVIAIENGGIKGLPSLMNA 382

Query: 376 XXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVSCVFGLLSFVA 435
                                      G  P+FL+ VD+ GRP+  +L++  FGLLSF+A
Sbjct: 383 IILIAIVSVANSAVYACSRCMVSMAHIGNLPKFLSKVDKRGRPLNAILLTLFFGLLSFIA 442

Query: 436 ASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYVAWTGVWGAY 495
           AS K+E VFTWL A+SGLS +F W +I+LS +R R AM  QGRS DE+ +++ +G WGA+
Sbjct: 443 ASDKQEEVFTWLSALSGLSTIFCWMAINLSLIRFRDAMKAQGRSLDEMPFLSQSGTWGAW 502

Query: 496 YAMAMIVAILVGQFWVAISPVGSNKLDANNFFENYLAMPILIFLYLGYKIWTRDWRLLIP 555
           Y + ++  +LV  FW ++ PVGS+   A +FFE YL++PILI  Y+G+K+W RDWRLL+P
Sbjct: 503 YGVIVLFLVLVASFWTSLFPVGSSTASAKSFFEGYLSLPILIACYVGHKLWKRDWRLLVP 562

Query: 556 SSEVDLVAHRKIFDAEVLRHEQLEEKEQLRHAPWTTRLANFWC 598
             E+DL + R++ DAE    E   E+E L +A + TR  + WC
Sbjct: 563 LMEMDLDSGRRVLDAETREEELRVEREYLANASFFTRFLHIWC 605

>NDAI0B05220 Chr2 (1278386..1280221) [1836 bp, 611 aa] {ON}
           Anc_1.244
          Length = 611

 Score =  397 bits (1020), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 209/565 (36%), Positives = 324/565 (57%), Gaps = 9/565 (1%)

Query: 35  SRSDGLFRRFADSFRRHEAHNXXXXXXXXXXXXXLTPIESASKHKTLKQNIRPRHVLMIS 94
           S+S   + R  DSF+R E                   I   +    LK  ++ RH+ M++
Sbjct: 55  SKSVSRWTRIKDSFKRAEKEEVDPNLTEAER------IAINTAKAPLKHTLKGRHMQMVA 108

Query: 95  LATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYCVIQSASELAIIYTSLAGGFNAY 154
           +   IG+G+ VG+  +L   GPA +VIG+ + S+M+YC++ +  ELA+++  ++GGF  Y
Sbjct: 109 IGGAIGSGLFVGSSTALRTAGPAGIVIGWGLTSTMIYCMVMALGELAVVF-PVSGGFTTY 167

Query: 155 PSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKYWNQTIN-PDAFVTIFYVVLVAI 213
            +  +D++FGF+ ++ Y LQWL  LPLE+V+AS+T+ YW       D FV +F++V+V I
Sbjct: 168 ATRFIDESFGFASNFNYALQWLATLPLEIVSASITVNYWQTPERYRDGFVALFWLVIVII 227

Query: 214 NXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGGAGNDGYLGARYWHDPGAFRGSDS 273
           N              +  KVL              GG    G++G RYWH+PGAF G ++
Sbjct: 228 NLFGVRGFGEAEFVFSTIKVLTVIGFIILGIVLVAGGGPEGGFVGGRYWHNPGAFVGDNA 287

Query: 274 INRFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRILGIYIMTAILL 333
             +FKG+ +V V AAF++ G+E   +TAAE  NP+KS+  A+K++V+RI+  Y+ + I++
Sbjct: 288 GTQFKGVCSVFVTAAFSFAGSELVGITAAEAANPRKSVPRAAKQVVWRIVLFYMGSLIMI 347

Query: 334 GFLVPWNSDELLGSGGSATHASPFVIAVASHGVRVVPHFXXXXXXXXXXXXXXXXXXXXX 393
           G LVP+    L+G+      ASPFVIA+ +HG+R +P                       
Sbjct: 348 GLLVPYTDPRLIGASSVDASASPFVIAIVTHGIRGLPSVINVVILIAVLSVGNSAIFAGS 407

Query: 394 XXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVSCVFGLLSFVAASPKEETVFTWLLAISGL 453
                  EQGF P    Y+DR GRP++ ++V   FGL++F+AAS K+  VF WL+A+SGL
Sbjct: 408 RTIAALSEQGFLPEIFGYIDRKGRPLVGIIVISTFGLIAFIAASKKQGEVFAWLMALSGL 467

Query: 454 SELFTWFSISLSHVRLRRAMTVQGRSADELGYVAWTGVWGAYYAMAMIVAILVGQFWVAI 513
           S LFTW  I L H+R R A+  QGRS +EL +V+  G+ G+ + + M++ + + QF+VA+
Sbjct: 468 SSLFTWGGICLCHIRFRMALKAQGRSTNELPFVSPAGIIGSSWGLFMLLLMFIAQFYVAL 527

Query: 514 SPVGSNKLDANNFFENYLAMPILIFLYLGYKIWTRDWRLLIPSSEVDLVAHRKIFDAEVL 573
            P GS K  A  FFE+YL+ PI++  Y G+KI+ ++W+L I + ++D+   R+  D E+L
Sbjct: 528 FPPGS-KPSAEVFFESYLSFPIVLAFYFGHKIYKKNWKLFIKAEDMDIDTGRRETDLELL 586

Query: 574 RHEQLEEKEQLRHAPWTTRLANFWC 598
           + E  EEK  L    W  R   FWC
Sbjct: 587 KQEIEEEKAILATKGWWYRQYQFWC 611

>CAGL0L03267g Chr12 (374784..376577) [1794 bp, 597 aa] {ON} highly
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039w GAP1 general amino acid permease
          Length = 597

 Score =  396 bits (1018), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 213/560 (38%), Positives = 327/560 (58%), Gaps = 13/560 (2%)

Query: 42  RRFADSFRRHEAHNXXXXXXXXXXXXXLTPIESASKHKTLKQNIRPRHVLMISLATGIGT 101
           R+F DSF+  +                +  I   + H  LK +++ RH+ MI++   IGT
Sbjct: 48  RKFKDSFKPLDE------AVVTDDMSDIEKIAHRTAHAPLKHHLKNRHLQMIAIGGAIGT 101

Query: 102 GMLVGNGKSLHNGGPASLVIGYAIVSSMLYCVIQSASELAIIYTSLAGGFNAYPSLLVDK 161
           G+ VG+G +L   GPA ++IG+ +  +M+YC++ +  EL++++  ++GGF  Y +  +D+
Sbjct: 102 GLFVGSGTALRTAGPAGILIGWGLTGTMIYCMVMAMGELSVVF-PISGGFTTYATRFIDE 160

Query: 162 AFGFSVSWVYCLQWLCVLPLELVTASMTIKYWNQTINP---DAFVTIFYVVLVAINXXXX 218
           +FGF+ ++ Y LQWLCVLPLE+V AS+T+ YW    +P   D FV +F+VV+V IN    
Sbjct: 161 SFGFANNFNYMLQWLCVLPLEIVAASITVNYWGT--DPKYRDGFVALFWVVIVIINLFGV 218

Query: 219 XXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGGAGNDGYLGARYWHDPGAFRGSDSINRFK 278
                     +  KVL            NCGG    GY+G +Y+HDPGAF G  +  RF+
Sbjct: 219 KGYGEAEFVFSIIKVLTVIGFIIMGIVLNCGGGPEGGYIGGKYFHDPGAFVGDTAGARFQ 278

Query: 279 GIVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRILGIYIMTAILLGFLVP 338
           G+ +V V AAF++ G+E   + AAE   P+KS+  A+K++ +RI   Y+++ +++G LVP
Sbjct: 279 GVCSVFVTAAFSFAGSELIGIAAAESAEPRKSVPKAAKQVFWRITLFYMLSLLMVGLLVP 338

Query: 339 WNSDELLGSGGSATHASPFVIAVASHGVRVVPHFXXXXXXXXXXXXXXXXXXXXXXXXXX 398
           +  + L+G+      ASPFVIA+ SHG+R +P                            
Sbjct: 339 YTDERLIGASSVDAAASPFVIAITSHGIRGLPSVVNVVILIAVLSVGNSAVYGCSRTLCA 398

Query: 399 XXEQGFAPRFLNYVDRCGRPVLCLLVSCVFGLLSFVAASPKEETVFTWLLAISGLSELFT 458
             +Q F P+   Y+DR GRP+  +  +  FGL++FVA S KE  VF WLLA+SGLS LFT
Sbjct: 399 LAQQNFLPKIFGYIDRSGRPLFGIAFTSAFGLVAFVAQSKKEGEVFAWLLALSGLSSLFT 458

Query: 459 WFSISLSHVRLRRAMTVQGRSADELGYVAWTGVWGAYYAMAMIVAILVGQFWVAISPVGS 518
           W  I   H+R R A+T QGRS DEL + A  G++G+ + + MIV + + QF+VA+ P G 
Sbjct: 459 WGGICFCHIRFRAALTAQGRSTDELPFKAPAGIYGSMWGLFMIVLMFMAQFYVALFPPG- 517

Query: 519 NKLDANNFFENYLAMPILIFLYLGYKIWTRDWRLLIPSSEVDLVAHRKIFDAEVLRHEQL 578
            K  A  FF++YL+ P+++  Y G+K++ R+W+LLIP S++D+   R+  D +VLR E  
Sbjct: 518 GKPSAEVFFQSYLSFPVVLAFYFGHKLYARNWKLLIPLSKLDIDTGRREMDLDVLRQEIA 577

Query: 579 EEKEQLRHAPWTTRLANFWC 598
           EEK+ +   PW  R  +FWC
Sbjct: 578 EEKQMMSTRPWWYRWYSFWC 597

>Smik_16.115 Chr16 complement(214120..215931) [1812 bp, 603 aa] {ON}
           YGR191W (REAL)
          Length = 603

 Score =  396 bits (1017), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 212/523 (40%), Positives = 305/523 (58%), Gaps = 2/523 (0%)

Query: 77  KHKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYCVIQS 136
            +  L +++  RH+L +++   IGTG+ V  G +L  GGPASLVI + I+S+ L+ VI S
Sbjct: 82  NNTNLSKDLSVRHLLTLAVGGAIGTGLYVNTGAALSTGGPASLVIDWVIISTCLFTVINS 141

Query: 137 ASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKYWNQT 196
             EL+  +  + GGFN Y    V+ +F F+V+  Y  QWL +LPLELV AS+TIKYWN  
Sbjct: 142 LGELSAAF-PVVGGFNVYSMRFVEPSFAFAVNLNYLAQWLVLLPLELVAASITIKYWNDK 200

Query: 197 INPDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGGAGNDGY 256
           IN DA+V IFY  +   N              +  K+L            +CGG  + GY
Sbjct: 201 INSDAWVAIFYATIALANMLDVKSFGETEFVLSMIKILSIIGFTILGIVLSCGGGPHGGY 260

Query: 257 LGARYWHDPGAFRGSDSINRFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASK 316
           +G +YWHDPGAF G  S  +FKG+ +V V AAF+Y G E + ++AAE +NP+++I  A+K
Sbjct: 261 IGGKYWHDPGAFVGHSSGTQFKGLCSVFVTAAFSYSGIEMTAVSAAESKNPRETIPKAAK 320

Query: 317 KLVYRILGIYIMTAILLGFLVPWNSDELL-GSGGSATHASPFVIAVASHGVRVVPHFXXX 375
           +  + I   Y+    L+G LVP N   LL GS      +SP VIA+ + G++ +P     
Sbjct: 321 RTFWLITASYVAILTLIGCLVPSNDPRLLNGSSSVDAASSPLVIAIENGGIKGLPSLMNA 380

Query: 376 XXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVSCVFGLLSFVA 435
                                      G  P+FLN VD+ GRP+  +L++  FGLLSFVA
Sbjct: 381 IILIAVVSVANSAVYACSRCMVAMAHIGNLPKFLNRVDKRGRPMNAILLTLFFGLLSFVA 440

Query: 436 ASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYVAWTGVWGAY 495
           AS K+  VFTWL A+SGLS +F W +I+LSH+R R+AM VQ RS DEL +++ TGV G++
Sbjct: 441 ASDKQAEVFTWLSALSGLSTIFCWMAINLSHIRFRQAMKVQERSLDELPFISQTGVKGSW 500

Query: 496 YAMAMIVAILVGQFWVAISPVGSNKLDANNFFENYLAMPILIFLYLGYKIWTRDWRLLIP 555
           Y   ++  +L+  FW ++ P+GS+  +A +FFE YL+ PILI  Y G+KI+TR+W L++ 
Sbjct: 501 YGFIVLFLVLIASFWTSLFPLGSSGANAESFFEGYLSFPILIVCYFGHKIYTRNWTLMVK 560

Query: 556 SSEVDLVAHRKIFDAEVLRHEQLEEKEQLRHAPWTTRLANFWC 598
             ++DL   RK  D  + R E   E+E L    + TR  +FWC
Sbjct: 561 LEDIDLDTGRKQVDLALRREEMKVERETLAKRSFMTRFLHFWC 603

>Ecym_6021 Chr6 (37898..39700) [1803 bp, 600 aa] {ON} similar to
           Ashbya gossypii AFR230C
          Length = 600

 Score =  395 bits (1015), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 210/598 (35%), Positives = 343/598 (57%), Gaps = 14/598 (2%)

Query: 3   DFELHNMKSPDNGVVESFDSVEVLKEES-PRSDSRSDGLFRRFADSFRRHEAHNXXXXXX 61
           D +  N  S    VVES  S E     S P+S S+    ++ F DSF+R ++ +      
Sbjct: 15  DEKNKNYISNQENVVESGASQEDYSNSSYPKSGSK----WKDFKDSFKRMDSVDLDPNLT 70

Query: 62  XXXXXXXLTPIESASKHKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVI 121
                  LT          L++ ++ RH+ MI++   IGTG+ +G+ K+L   GPA ++I
Sbjct: 71  DAQKIAILT------SQSPLQRKLKNRHLQMIAIGGAIGTGLFIGSSKALRTAGPAGILI 124

Query: 122 GYAIVSSMLYCVIQSASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPL 181
           G+ ++++M+ C+  S  E+A+ +  ++GG+  Y +  +D+++GF+ +  Y +Q L VLPL
Sbjct: 125 GWGLMATMILCMCLSLGEMAVTF-PVSGGYTTYATRFIDESYGFANNINYMMQALVVLPL 183

Query: 182 ELVTASMTIKYWN-QTINPDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXX 240
           E+V AS+T+ YW  ++    AFV +F++ +V+IN              +  KV+      
Sbjct: 184 EIVAASITVDYWGPKSQYRAAFVALFWLCIVSINMFGVKGYGEAEFVFSLIKVVTVIGFI 243

Query: 241 XXXXXXNCGGAGNDGYLGARYWHDPGAFRGSDSINRFKGIVAVLVNAAFAYGGAEFSVLT 300
                  CGG     Y+G+++W +PGAF G  +  +FKGI +V V AAF++   E   L 
Sbjct: 244 ILGVILVCGGGPTHEYIGSKFWSNPGAFVGDTAGQKFKGICSVFVTAAFSFANTELVGLA 303

Query: 301 AAEQQNPQKSIRSASKKLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSATHASPFVIA 360
           AAE ++P+KS+  A+K++ +RI   YI++ +++G LVP+    LLGS      ASPFV+A
Sbjct: 304 AAETEDPRKSVPKAAKQVFWRITLFYILSLLMVGLLVPYTDPRLLGSSIVDAAASPFVLA 363

Query: 361 VASHGVRVVPHFXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVL 420
           + +HG++ +P                              EQGF P    Y+DR GRP++
Sbjct: 364 LKNHGIKGLPSVINVVILTAVLSVGNSSVFSCSRCLTALSEQGFLPNVFGYIDRKGRPLV 423

Query: 421 CLLVSCVFGLLSFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSA 480
            ++ S  FGLL F+A S + + +F W+L++SGLS LF W +ISL H+R R+A++ Q RS 
Sbjct: 424 SIIFSSAFGLLCFLAVSHQVQEIFDWMLSLSGLSSLFIWLTISLCHIRFRKALSAQNRSI 483

Query: 481 DELGYVAWTGVWGAYYAMAMIVAILVGQFWVAISPVGSNKLDANNFFENYLAMPILIFLY 540
           DEL + +  G+WG+YY++ +I+ +L+ QFW+A+ P G  K  A+NFF+ YL+MPI + +Y
Sbjct: 484 DELAFASPIGIWGSYYSVFLIIVVLILQFWIALFP-GHQKPSASNFFKAYLSMPIAVAMY 542

Query: 541 LGYKIWTRDWRLLIPSSEVDLVAHRKIFDAEVLRHEQLEEKEQLRHAPWTTRLANFWC 598
           LG+KI+T++W+LLI    +D+   R+  D E+ + E LE+   +   P+  R+ NFWC
Sbjct: 543 LGHKIYTKNWKLLIDPKYMDIDTGRRELDIELFKQELLEQNAIMAKKPFIYRVYNFWC 600

>Suva_7.485 Chr7 (836820..838631) [1812 bp, 603 aa] {ON} YGR191W
           (REAL)
          Length = 603

 Score =  394 bits (1011), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 211/523 (40%), Positives = 301/523 (57%), Gaps = 2/523 (0%)

Query: 77  KHKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYCVIQS 136
            +  L + +  RH+L +++   IGTG+ V  G +L  GGPASLVI + I+S+ L+ VI S
Sbjct: 82  NNTNLSKELSVRHLLTLAVGGAIGTGLFVNTGAALSTGGPASLVIDWVIISTCLFTVINS 141

Query: 137 ASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKYWNQT 196
             EL+  +  + GGFN Y    V+ +F F+V+  Y  QWL +LPLELV AS+TIKYWN  
Sbjct: 142 LGELSAAF-PVVGGFNVYSMRFVEPSFAFAVNLNYLAQWLVLLPLELVAASITIKYWNDK 200

Query: 197 INPDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGGAGNDGY 256
           IN DA+V IFY  +   N              +  K+L            +CGG  + GY
Sbjct: 201 INSDAWVAIFYATIAMANMLDVKSFGETEFVLSMIKILAIIGFTILGIVLSCGGGPHGGY 260

Query: 257 LGARYWHDPGAFRGSDSINRFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASK 316
           +G +YW+DPGAF G DS  +FKG+ +V V AAF+Y G E + ++AAE +NP+++I  A+K
Sbjct: 261 IGGKYWNDPGAFVGHDSGTKFKGLCSVFVTAAFSYSGIEMTAVSAAESKNPRETIPKAAK 320

Query: 317 KLVYRILGIYIMTAILLGFLVPWNSDELL-GSGGSATHASPFVIAVASHGVRVVPHFXXX 375
           +  + I   Y+    L+G LVP N   LL GS      +SP VIA+ +  ++ +P     
Sbjct: 321 RTFWLITISYVTILTLIGCLVPSNDPRLLNGSSSVDAASSPLVIAIENGRIKGLPSLMNA 380

Query: 376 XXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVSCVFGLLSFVA 435
                                      G  P+FL  VD+ GRP+  ++++  FGLLSFVA
Sbjct: 381 IILIAVVSVANSAVYACSRCMVAMAHIGNLPKFLRRVDKRGRPINAIVLTLFFGLLSFVA 440

Query: 436 ASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYVAWTGVWGAY 495
           AS K+  VFTWL A+SGLS +F W +I+LSH+R R+AM  Q RS DEL +++ TGVWG+ 
Sbjct: 441 ASDKQAEVFTWLSALSGLSTIFCWMAINLSHIRFRQAMKFQERSLDELPFISQTGVWGSI 500

Query: 496 YAMAMIVAILVGQFWVAISPVGSNKLDANNFFENYLAMPILIFLYLGYKIWTRDWRLLIP 555
           Y   ++  +L+  FW ++ P+GS+  +A +FFE YL+ PILI  Y G+KI+TRDWRLL+ 
Sbjct: 501 YGFVVLFLVLIASFWTSMFPIGSSGANAESFFEGYLSFPILIVCYFGHKIYTRDWRLLVK 560

Query: 556 SSEVDLVAHRKIFDAEVLRHEQLEEKEQLRHAPWTTRLANFWC 598
             ++DL   RK  D  + R E   E+E L    + TR    WC
Sbjct: 561 LEDMDLDTGRKQVDLNLRRQEMKIEQETLAKRSFLTRFLRVWC 603

>SAKL0D00836g Chr4 complement(65731..67536) [1806 bp, 601 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 601

 Score =  394 bits (1011), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 217/590 (36%), Positives = 333/590 (56%), Gaps = 19/590 (3%)

Query: 11  SPDNGVVESFDSVEVLKEESPRSDSRSDGLFRRFADSFRRHEAHNXXXXXXXXXXXXXLT 70
           SPD   VES  + +  K++   +D  +   F+ F D FR     +               
Sbjct: 29  SPD---VESDQNHDYYKDKVHVNDP-NKSRFQNFVDGFRELRMEDVDPNLTA------AE 78

Query: 71  PIESASKHKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSML 130
               A+    LK++++ RH+ MI++   IGTG+ VG+GK+L  GGPA++VI + +  SM+
Sbjct: 79  RAAIATASSPLKRHLKNRHLQMIAIGGSIGTGLFVGSGKALRIGGPAAVVIAWIMTGSMV 138

Query: 131 YCVIQSASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTI 190
           Y V+Q+  ELA+    ++G + +Y S  ++ +FGF++++ Y +  L  +PLEL+ AS+T+
Sbjct: 139 YSVVQALGELAVA-LPVSGSYLSYVSRFIEPSFGFAIAYNYLIGNLITMPLELIAASITV 197

Query: 191 KYWN-QTINPDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCG 249
            YW+  +   DAFV +FY+V+V IN              +  KV              CG
Sbjct: 198 NYWDVDSKYADAFVALFYIVIVGINLFGVKGYGEAEFVFSVIKVTAIVGFIILGIVLVCG 257

Query: 250 GAGND-GYLGARYWHDPGAFRGSDSINRFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNPQ 308
           G  +D GY+GARYW++PG F      + FKG  A+ V +AF++ G+E   L AAE +NP+
Sbjct: 258 GGPSDEGYIGARYWYNPGGFA-----HGFKGFAAIFVTSAFSFAGSEMFALAAAETENPR 312

Query: 309 KSIRSASKKLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSATHASPFVIAVASHGVRV 368
           K +  A+K++ +RI   Y+++  L+G LVP+    L  +      ASPFVIA+A  G++ 
Sbjct: 313 KDLPRAAKQVFWRITLFYVISLTLIGCLVPYTDKHLFAASSVDASASPFVIAIARAGIKG 372

Query: 369 VPHFXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVSCVF 428
           +P                                GF PR   YVDR GRP++ +L+  +F
Sbjct: 373 LPSVVNVVILIAVLSVGNCCVYAASRAVLSLAHYGFLPRRFGYVDRKGRPLVGILLCAIF 432

Query: 429 GLLSFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYVAW 488
           GLLSF++AS     VF W+LAISGL+  F W SI + H+R RRA++VQGRS DEL Y A 
Sbjct: 433 GLLSFLSASSNYGEVFDWMLAISGLNSFFIWGSICVCHLRFRRALSVQGRSTDELSYKAQ 492

Query: 489 TGVWGAYYAMAMIVAILVGQFWVAISPVGSNKLDANNFFENYLAMPILIFLYLGYKIWTR 548
           TG+WG+ Y + +I  +L  QFWVA+ P+G +  +AN+FF  YL++P++IF Y  +K++TR
Sbjct: 493 TGIWGSLYGIGLIFIVLCFQFWVALFPIGGSP-NANHFFSAYLSLPVVIFFYTCHKLYTR 551

Query: 549 DWRLLIPSSEVDLVAHRKIFDAEVLRHEQLEEKEQLRHAPWTTRLANFWC 598
            W  LI SS++D+   R+  D E+L+ E  EE++ +R  P   R+  FWC
Sbjct: 552 SWTFLIKSSDIDIDTGRREMDLELLKQEIQEEQQYIRSKPIWYRIYRFWC 601

>KAFR0E01850 Chr5 (381160..382842) [1683 bp, 560 aa] {ON} Anc_5.158
           YGR191W
          Length = 560

 Score =  389 bits (998), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 209/524 (39%), Positives = 316/524 (60%), Gaps = 4/524 (0%)

Query: 77  KHKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYCVIQS 136
            +  L +N+  RH++ +++   IGTG+ V +G +L +GGPASLV+G+ I+S+ L+ VI S
Sbjct: 39  NNTNLSKNLSVRHLVTLAVGGSIGTGLFVNSGTALSDGGPASLVVGWVIISTCLFTVINS 98

Query: 137 ASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKYWNQT 196
             ELA  +  + GGFN Y +  VD + GF+V+  Y  QWL +LPLELV AS+TIKYWN  
Sbjct: 99  LGELAAAF-PIVGGFNVYITRFVDPSVGFAVNLNYLAQWLVLLPLELVAASLTIKYWNDK 157

Query: 197 INPDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGGAGNDGY 256
           IN DA+V IFYV +V  N              +  K+L              GG  + GY
Sbjct: 158 INSDAWVAIFYVTIVLANMLEVKSFGETEFVLSMVKILAIIGFTILGIVLASGGGPSGGY 217

Query: 257 LGARYWHDPGAFRGSDSINRFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASK 316
           LG +YW++PGAF G  + ++FKG+ +V V AAF++ G E   ++AAE +NP+K I  A+K
Sbjct: 218 LGFKYWNNPGAFVGGTNASKFKGLCSVFVTAAFSFSGIEMIAVSAAESKNPRKVIPKAAK 277

Query: 317 KLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSA-THASPFVIAVASHGVRVVPHFXXX 375
           +  + +   Y++   L+G LVP+N   LL +  S    ASP VIA+ + G++ +P     
Sbjct: 278 RTFWLVTSSYVVILTLVGCLVPYNDSRLLNAATSVDAAASPLVIAIENGGIKGLPSLMNA 337

Query: 376 XXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVSCVFGLLSFVA 435
                                      G  P+ L+ VD+ GRP+  L+V+ +FGLLSF+A
Sbjct: 338 IILIAIVSVANSAVYACSRCMVSMAHIGNLPKVLSKVDKKGRPMNALIVTLIFGLLSFIA 397

Query: 436 ASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYVAWTGVWGAY 495
           AS K+  VFTWL A+SGLS +F W +I+ S +R RRAM VQ RS DEL Y++ TG+WGA+
Sbjct: 398 ASDKQNEVFTWLSALSGLSTIFCWMAINYSLIRFRRAMQVQNRSLDELPYLSQTGIWGAW 457

Query: 496 YAMAMIVAILVGQFWVAISPVGSNKLDANNFFENYLAMPILIFLYLGYKIW-TRDWRLLI 554
           Y + ++  ++V  FW ++ P+GS   DA +FFE++L++PIL+  Y G+K++  R+WRL I
Sbjct: 458 YGVLVLFLVIVASFWTSMFPLGSAHADAESFFESFLSLPILLVCYFGHKLYFARNWRLQI 517

Query: 555 PSSEVDLVAHRKIFDAEVLRHEQLEEKEQLRHAPWTTRLANFWC 598
            + E+D+ + RKI D E L+ E+ EE+E+  ++ +  +  + WC
Sbjct: 518 GAEEMDIDSGRKIIDEEGLKQER-EEEEKAMNSSFLIKFWHVWC 560

>KLLA0A06930g Chr1 complement(625498..627261) [1764 bp, 587 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 587

 Score =  389 bits (1000), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 233/573 (40%), Positives = 333/573 (58%), Gaps = 22/573 (3%)

Query: 32  RSDSRSDGLFR--RFADSFRRHEAHNXXXXXXXXXXXXXLTPIESA---SKHKTLKQNIR 86
           +SD+   G  R  RF DSFR  E  +             LTP E     + +  LK+ ++
Sbjct: 31  QSDTSRVGGTRWERFKDSFREAETVDLDPS---------LTPAEKMAILTANAPLKRTLK 81

Query: 87  PRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYCVIQSASELAIIYTS 146
            RH+ MI +   IGTG+ VG+GKSL   GPA ++IG+A+  +M+YC++ +  ELA+ +  
Sbjct: 82  SRHLQMIGIGGAIGTGLFVGSGKSLATAGPAGILIGWALTGTMIYCMVMAMGELAVTF-P 140

Query: 147 LAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKYWNQTIN-PDAFVTI 205
           +AGG+  Y S  VD++FGF+ + VY + WL  LPLE+V AS+T+ YW       DAFV +
Sbjct: 141 VAGGYTTYASRFVDESFGFAFNTVYAMGWLITLPLEIVAASITVNYWGTPAKYRDAFVAL 200

Query: 206 FYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGGAGNDGYLGARYWHDP 265
           FYVV+V IN              +  KV+             CGG    GY+G R WH+P
Sbjct: 201 FYVVIVGINLFGVKGYGEAEFIFSFIKVIAVIGFIILGVILVCGGGPQGGYIGGRLWHNP 260

Query: 266 GAFRGSDSINRFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRILGI 325
           GAF      N FKG+ +V V AAF++ G+E   L AAE  NP+KSI SA+K++ +RI   
Sbjct: 261 GAFA-----NGFKGVCSVFVTAAFSFAGSELVGLAAAETANPRKSIPSAAKQVFWRITLF 315

Query: 326 YIMTAILLGFLVPWNSDELLGSGGSATHASPFVIAVASHGVRVVPHFXXXXXXXXXXXXX 385
           YI+  +++G LVP+ SD L+G       ASPFVI++ + G++ +P               
Sbjct: 316 YILALLMVGLLVPYTSDRLIGQSSVDAAASPFVISIQNAGIKGLPSVINVVILIAVLSVG 375

Query: 386 XXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVSCVFGLLSFVAASPKEETVFT 445
                           QG  P+   Y+DR GRP++ ++V+CVFGLLSF+AASPKE  VF 
Sbjct: 376 NCAVFGCSRSMAALANQGSLPKIFGYIDRTGRPLVGIVVTCVFGLLSFIAASPKEGEVFD 435

Query: 446 WLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYVAWTGVWGAYYAMAMIVAIL 505
           WLLA+SGLS LFTW  I L H+R+RRA+  Q R+  EL + A T VWG+ Y++ +I+ IL
Sbjct: 436 WLLALSGLSSLFTWGGILLCHIRVRRALAAQNRTTAELSFTAPTDVWGSVYSLILIILIL 495

Query: 506 VGQFWVAISPVGSNKLDANNFFENYLAMPILIFLYLGYKIWTRDWRLLIPSSEVDLVAHR 565
           + QFW+A+ P+G  K  A  FFE YL+ PI I  Y+G+KIW ++W+L I +S++D+ + R
Sbjct: 496 IAQFWIALFPIG-GKPSAAAFFEAYLSFPIYIVFYIGHKIWKKNWKLFIKASDIDIDSGR 554

Query: 566 KIFDAEVLRHEQLEEKEQLRHAPWTTRLANFWC 598
           +  D E L+ E  EEK  +   P+  R+  FWC
Sbjct: 555 RETDIEALKQEIAEEKAFIASKPFYYRMYKFWC 587

>Skud_7.525 Chr7 (856072..857883) [1812 bp, 603 aa] {ON} YGR191W
           (REAL)
          Length = 603

 Score =  389 bits (1000), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 209/523 (39%), Positives = 302/523 (57%), Gaps = 2/523 (0%)

Query: 77  KHKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYCVIQS 136
            +  L +++  RH+L +++   IGTG+ V  G +L  GGPASLVI + I+ + L+ VI S
Sbjct: 82  NNTNLNKDLSVRHLLTLAVGGAIGTGLYVNTGTALSTGGPASLVIDWVIIGTCLFTVINS 141

Query: 137 ASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKYWNQT 196
             EL+  +  + GGFN Y    V+ +F F+V+  Y  QWL +LPLELV AS+TIKYWN  
Sbjct: 142 LGELSAAF-PVVGGFNVYGMRFVEPSFAFAVNLNYLAQWLVLLPLELVAASITIKYWNDK 200

Query: 197 INPDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGGAGNDGY 256
           IN DA+V IFY  +   N              +  K+L            +CGG  + GY
Sbjct: 201 INSDAWVAIFYATIALANMLDVKSFGETEFVLSMIKILSIIGFSILGIVLSCGGGPHGGY 260

Query: 257 LGARYWHDPGAFRGSDSINRFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASK 316
           +G +YW +PGAF G +S  +FKG+ +V V AAF+Y G E + ++AAE +NP+++I  A+K
Sbjct: 261 IGGKYWRNPGAFVGHNSGTKFKGLCSVFVTAAFSYSGIEMTAVSAAESKNPRETIPKAAK 320

Query: 317 KLVYRILGIYIMTAILLGFLVPWNSDELL-GSGGSATHASPFVIAVASHGVRVVPHFXXX 375
           +  + I   Y+    L+G LVP N   LL GS      +SP VIA+ +  ++ +P     
Sbjct: 321 RTFWLITASYVTILTLIGCLVPSNDPRLLNGSSSVDAASSPLVIAIENGRIKGLPSLMNA 380

Query: 376 XXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVSCVFGLLSFVA 435
                                      G  P+FLN VD+ GRP+  +L++  FGLLSFVA
Sbjct: 381 IILIAVVSVANSAVYACSRCMVAMAHIGNLPKFLNRVDKRGRPMNAILLTLFFGLLSFVA 440

Query: 436 ASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYVAWTGVWGAY 495
           AS KE  VFTWL A+SGLS +F W +I+LSH+R R+AM VQ RS DEL +++ TGV G++
Sbjct: 441 ASNKEAEVFTWLSALSGLSTIFCWMAINLSHIRFRKAMKVQERSLDELPFISQTGVLGSW 500

Query: 496 YAMAMIVAILVGQFWVAISPVGSNKLDANNFFENYLAMPILIFLYLGYKIWTRDWRLLIP 555
           Y   ++  +L+  FW ++ P+GS+   A +FFE YL+ PILI  Y G+KI+TR+W L++ 
Sbjct: 501 YGFVVLFLVLIASFWTSLFPIGSSGASAESFFEGYLSFPILIVCYFGHKIYTRNWTLMVK 560

Query: 556 SSEVDLVAHRKIFDAEVLRHEQLEEKEQLRHAPWTTRLANFWC 598
             ++DL   RK  D  + R E   E+E L    + TR  +FWC
Sbjct: 561 IEDIDLDTGRKQVDLTLRREEMKIERENLAKKSFITRFLHFWC 603

>KLTH0B02046g Chr2 complement(163199..164968) [1770 bp, 589 aa] {ON}
           similar to uniprot|P06775 Saccharomyces cerevisiae
           YGR191W HIP1 High-affinity histidine permease also
           involved in the transport of manganese ions
          Length = 589

 Score =  388 bits (997), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 205/530 (38%), Positives = 304/530 (57%), Gaps = 2/530 (0%)

Query: 70  TPIESASKHKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSM 129
           T  E   +     +++  RH+L +++   IGTG+ V +G +L  GGP SLVI + I+S+ 
Sbjct: 61  TSQEVEDQDARYNKDLSVRHLLTLAVGGAIGTGLFVNSGAALTTGGPGSLVIDWVIISTC 120

Query: 130 LYCVIQSASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMT 189
           L+ ++ +  EL+  +  + GGFN Y S  V+ +FGF+V+  Y  QW  +LPLELV AS+T
Sbjct: 121 LFTIVNALGELSSTF-PVVGGFNVYISRFVEPSFGFAVNLNYLAQWAVLLPLELVAASLT 179

Query: 190 IKYWNQTINPDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCG 249
           I+YWN TIN DA+V IFY +++  N              +  K+L             CG
Sbjct: 180 IRYWNHTINSDAWVAIFYTIILLANLLDVKSFGETEFVLSMVKILAIIGFTILGIVLTCG 239

Query: 250 GAGNDGYLGARYWHDPGAFRGSDSINRFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNPQK 309
           G    GY+G +YW +PGAF G  + +RF G+ +V V AAF+Y G E   ++AAE  NP+ 
Sbjct: 240 GGPKGGYIGGKYWSNPGAFVGHTAGDRFHGLCSVFVTAAFSYSGTELIAVSAAESVNPRI 299

Query: 310 SIRSASKKLVYRILGIYIMTAILLGFLVPWNSDELL-GSGGSATHASPFVIAVASHGVRV 368
           ++  A K+  + I   YI+   L+G LV  +   LL GS      ASP VIA+ + G++ 
Sbjct: 300 TLPKACKRTFWLITVCYIVVLTLVGCLVSSDDPRLLNGSSSVDVAASPLVIAIENGGIKG 359

Query: 369 VPHFXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVSCVF 428
           +P                              + G  P+   YVDR GRP+  ++ + +F
Sbjct: 360 LPSLMNAIILIAVLSVANSAVYACSRCMASMAQIGNLPKVFTYVDRKGRPLYAIVATLIF 419

Query: 429 GLLSFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYVAW 488
           GLLSF+AAS K+E VFTWL A+SGLS LF WF+I++SH+R RR M  +GR+ DEL +V+ 
Sbjct: 420 GLLSFIAASDKQEEVFTWLSALSGLSTLFCWFAINVSHIRFRRTMKERGRTLDELPFVSM 479

Query: 489 TGVWGAYYAMAMIVAILVGQFWVAISPVGSNKLDANNFFENYLAMPILIFLYLGYKIWTR 548
           TGVWG+YY   +I  +LV  FW ++ P G    +A +FFE YL+ PIL+  Y G+K++TR
Sbjct: 480 TGVWGSYYGCIVIFIVLVVCFWTSLFPGGGEGANAESFFETYLSFPILLACYFGHKLYTR 539

Query: 549 DWRLLIPSSEVDLVAHRKIFDAEVLRHEQLEEKEQLRHAPWTTRLANFWC 598
            WRLL P+ E+DL + R+  D E+++ E+  E++ +R      R  + WC
Sbjct: 540 SWRLLTPTKEIDLDSGRRAVDLELMKDEKRIEEQAMRQKSLFARFIHLWC 589

>Kpol_543.78 s543 (193316..195133) [1818 bp, 605 aa] {ON}
           (193316..195133) [1818 nt, 606 aa]
          Length = 605

 Score =  386 bits (992), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 222/584 (38%), Positives = 330/584 (56%), Gaps = 19/584 (3%)

Query: 19  SFDSVEVLKEESPRSDSRSDGLFRRFADSFRRHEAHNXXXXXXXXXXXXXLTPIES---A 75
           S+  +     ES    SR    +R F DSF+R E                LT IE     
Sbjct: 36  SYKDLSNTTPESTIDKSR----WRNFLDSFKRIEVEEVDPN---------LTDIEKIAIK 82

Query: 76  SKHKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYCVIQ 135
           +    L+  ++ RH+ MI++   IGTG+ VG+GK+L   GPA ++IG+ I  +M++ ++ 
Sbjct: 83  TARSPLQHKLKSRHLQMIAIGGAIGTGLFVGSGKALRTAGPAGILIGWGITGTMIFTMVM 142

Query: 136 SASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKYWNQ 195
           +  ELA+++  ++GGF  Y +  +D++FGF+ ++ Y  QWL  LPLE+V AS+T+ YW  
Sbjct: 143 ALGELAVVF-PVSGGFLTYATRFIDESFGFANNFNYMFQWLVALPLEIVAASITVDYWET 201

Query: 196 TIN-PDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGGAGND 254
            +   D FV +F++V+V IN              +  KV+             CGG    
Sbjct: 202 PVRYTDGFVALFWLVVVIINMFGVRGYGEAEFVFSLIKVIAVIGFIILGIILVCGGGPVG 261

Query: 255 GYLGARYWHDPGAFRGSDSINRFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSA 314
           GY+G RYWHDPGAF G     RFKG  +V V AAF++ G+E   + +AE +NP+KS+  A
Sbjct: 262 GYVGGRYWHDPGAFAGHSPGRRFKGFCSVFVTAAFSFAGSELVGIASAESKNPRKSVPQA 321

Query: 315 SKKLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSATHASPFVIAVASHGVRVVPHFXX 374
           +K++ +RIL  YI+  +L+G LVP+    LLGS G    ASPFVIA+ +HG+  +P    
Sbjct: 322 AKQVFWRILLFYILCLLLVGLLVPYTDPRLLGSSGVDASASPFVIAIVTHGISGLPSVVN 381

Query: 375 XXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVSCVFGLLSFV 434
                                     EQGF P+ + Y+DR GRP++ + +   FGL++FV
Sbjct: 382 VVILISVLSVGNSSIYTCSRTLVALSEQGFLPKTVAYIDRKGRPLVGIAICSGFGLIAFV 441

Query: 435 AASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYVAWTGVWGA 494
           AAS K+E +F WLLAISG+S   TW SI   H+R R A+ V GRS DEL + +  G+ G+
Sbjct: 442 AASNKKEQMFNWLLAISGISSFLTWGSICFCHIRFRSALKVNGRSDDELPFKSPVGIIGS 501

Query: 495 YYAMAMIVAILVGQFWVAISPVGSNKLDANNFFENYLAMPILIFLYLGYKIWTRDWRLLI 554
           Y+ M + V +LV QF+ A+ P+GS+  +A +FF  YLA PI++  Y+ +K+W R+W+LLI
Sbjct: 502 YWGMCLAVLMLVAQFYNALFPIGSSP-NAYDFFSAYLAAPIVLAFYIAHKLWKRNWKLLI 560

Query: 555 PSSEVDLVAHRKIFDAEVLRHEQLEEKEQLRHAPWTTRLANFWC 598
           P  ++D+   R+  D  +L+ E  EEK  L   PW  R+  FWC
Sbjct: 561 PLKDIDIDTGRRETDINLLKQEIAEEKAALAMRPWWYRVYVFWC 604

>KNAG0G00900 Chr7 complement(170122..171963) [1842 bp, 613 aa] {ON}
           Anc_5.158 YGR191W
          Length = 613

 Score =  384 bits (985), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 218/527 (41%), Positives = 310/527 (58%), Gaps = 2/527 (0%)

Query: 73  ESASKHKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYC 132
           E    H  + +++  RH+L +++   IGTG+ V +G +L +GGPASLVI + I+S+ L+ 
Sbjct: 88  EDVDGHPQMNKDLDVRHLLTLAVGGAIGTGLFVNSGAALSSGGPASLVIDWVIISTCLFT 147

Query: 133 VIQSASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKY 192
           V+ S  ELA  +  + GGFN Y +  +D +FGF+V+  Y  QWL +LPLELV AS+TI+Y
Sbjct: 148 VVNSLGELAAAF-PVVGGFNVYITRFIDPSFGFAVNINYLAQWLVLLPLELVAASITIRY 206

Query: 193 WNQTINPDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGGAG 252
           WN  IN DA+V IFY  +   N              +  K+L            +CGG  
Sbjct: 207 WNDKINSDAWVAIFYAAIAFANMLDVKSFGETEFILSMIKILAIVGFTILGIVLSCGGGP 266

Query: 253 NDGYLGARYWHDPGAFRGSDSINRFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIR 312
             GY+G +YWHDPGAF G  S  +FKG+ +V V AAF+Y G E + ++AAE  NP+++I 
Sbjct: 267 KGGYIGGKYWHDPGAFVGETSGTKFKGLCSVFVTAAFSYSGMELTAVSAAESLNPRETIP 326

Query: 313 SASKKLVYRILGIYIMTAILLGFLVPWNSDELL-GSGGSATHASPFVIAVASHGVRVVPH 371
            A+K+  + I   Y+    L+G LVP+N+ +LL GS      +SP VIA+ + G+R +P 
Sbjct: 327 KAAKRTFWLITLSYVTILTLIGCLVPYNNPKLLNGSSSVDAASSPLVIAIENGGIRGLPS 386

Query: 372 FXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVSCVFGLL 431
                                             PRFL  VDR GRP+   L++  FGLL
Sbjct: 387 LMNAIILIAIVSVANSAVYACSRCMVSMARIRNLPRFLGRVDRKGRPLNATLLTLFFGLL 446

Query: 432 SFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYVAWTGV 491
           SF+AAS K+E VFTWL A+SGLS +F W +I+LSH+R R+AM  QG S DEL Y++ TGV
Sbjct: 447 SFIAASDKQEEVFTWLSALSGLSTIFAWMAINLSHIRFRQAMAHQGISLDELPYISMTGV 506

Query: 492 WGAYYAMAMIVAILVGQFWVAISPVGSNKLDANNFFENYLAMPILIFLYLGYKIWTRDWR 551
            G++Y + ++  +LV  FW ++ P+G    DA +FFE YL+ PILI  Y+G+K++ R  R
Sbjct: 507 SGSWYGVIVLFLVLVASFWTSLFPLGGKGADATSFFEGYLSFPILIVCYVGHKLYIRKKR 566

Query: 552 LLIPSSEVDLVAHRKIFDAEVLRHEQLEEKEQLRHAPWTTRLANFWC 598
           LLI  +++DLV+ RK+ D EV R E   EKEQL    +  R  + WC
Sbjct: 567 LLIDVADMDLVSDRKVVDVEVCREEMRIEKEQLAKRSFFARFLHLWC 613

>Kpol_1010.32 s1010 (82500..84299) [1800 bp, 599 aa] {ON}
           (82500..84299) [1800 nt, 600 aa]
          Length = 599

 Score =  382 bits (982), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 202/507 (39%), Positives = 305/507 (60%), Gaps = 2/507 (0%)

Query: 81  LKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYCVIQSASEL 140
           L +++  RH+L +++   IGTG+ V +G SL+ GGPASLVIG+ IVS+ L+ VI S  EL
Sbjct: 89  LNKDLNIRHLLTLAVGGAIGTGLFVNSGASLNTGGPASLVIGWVIVSTALFTVINSLGEL 148

Query: 141 AIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKYWNQTINPD 200
           A  Y  + GGF+ Y +  +D +  FS++  Y +QWL +LPLELV AS+TI+YWN  IN D
Sbjct: 149 AAAY-PVVGGFSVYMTRFIDPSIAFSINLNYLVQWLVLLPLELVAASITIRYWNDKINSD 207

Query: 201 AFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGGAGNDGYLGAR 260
           A+V+IFY V+  +N              +  K+L            +CGG    GY+G +
Sbjct: 208 AWVSIFYTVIGLLNMLDVKSFGETEFVLSFIKILAIIGFTILGIVLSCGGGPVGGYIGGK 267

Query: 261 YWHDPGAFRGSDSINRFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVY 320
           YWHDPGAF G  + ++FKG+ +V V AAF+Y G E   ++AAE  +P+K+I  A+K+  +
Sbjct: 268 YWHDPGAFVGHTAGSQFKGLCSVFVTAAFSYSGIEMIAVSAAESIDPRKTIPVAAKRTFW 327

Query: 321 RILGIYIMTAILLGFLVPWNSDELL-GSGGSATHASPFVIAVASHGVRVVPHFXXXXXXX 379
            I   Y+    L+G LVP++   LL GS      +SP VIA+ + G++ +P         
Sbjct: 328 LITASYVTILTLIGCLVPYDDPRLLNGSSSVDVASSPLVIAIENGGIKGLPSLMNAIILI 387

Query: 380 XXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVSCVFGLLSFVAASPK 439
                                  G  P+ L  +D+ GRP+   LV+  FGL+SFVAAS K
Sbjct: 388 AVLSVANSAVYACSRYMVSMAIIGNLPKQLGRIDKKGRPINATLVTLFFGLISFVAASDK 447

Query: 440 EETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYVAWTGVWGAYYAMA 499
           +  VFTWL A+SGLS +F W  I++SH+R RRAM +QGRS +E+ Y++  GV+G++Y   
Sbjct: 448 QAEVFTWLSALSGLSTIFCWMGINISHIRFRRAMDIQGRSLEEMPYLSQVGVYGSWYGCI 507

Query: 500 MIVAILVGQFWVAISPVGSNKLDANNFFENYLAMPILIFLYLGYKIWTRDWRLLIPSSEV 559
           ++  +L+  FW ++ PVGS++ +A  FFE YL++PIL+  Y+G+K + ++WRL  P +E+
Sbjct: 508 ILFLVLIAAFWTSLFPVGSSQANATTFFEGYLSLPILLACYVGHKFYFKNWRLFTPYNEI 567

Query: 560 DLVAHRKIFDAEVLRHEQLEEKEQLRH 586
           DL + ++  D E+LR E+  E+  L+ 
Sbjct: 568 DLDSGKRDIDLELLREEKKMEELALKK 594

>Ecym_4789 Chr4 complement(1531864..1533630) [1767 bp, 588 aa] {ON}
           similar to Ashbya gossypii AGR319W
          Length = 588

 Score =  381 bits (979), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 194/527 (36%), Positives = 310/527 (58%), Gaps = 2/527 (0%)

Query: 73  ESASKHKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYC 132
            +  +   L +++  RH+L +++   IGTG+ V +G +L+ GGPASLVI + I+S+ L+ 
Sbjct: 63  NTTKRSLNLNRDLSIRHLLTLAVGGAIGTGLFVNSGSALNIGGPASLVIAWTIISTCLFT 122

Query: 133 VIQSASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKY 192
           ++ +  ELA ++  + GGFN Y + LVD + GF+V+  Y  QW  +LPLELV AS+TI+Y
Sbjct: 123 IVNALGELAAVF-PVVGGFNVYVTRLVDPSLGFAVNINYLAQWAVLLPLELVAASITIRY 181

Query: 193 WNQTINPDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGGAG 252
           WN ++N DA+V +FYV +   +              +  K+L             CGG  
Sbjct: 182 WNNSVNSDAWVAVFYVCIFLASLLDVKSFGETEFILSMVKILAIGGFTILGIVLICGGGP 241

Query: 253 NDGYLGARYWHDPGAFRGSDSINRFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIR 312
            +GY+GA+YW+DPG+F G+   ++FKG+ +V V AAF+Y G E   ++AAE  NP+ ++ 
Sbjct: 242 KNGYIGAKYWNDPGSFVGASPGSQFKGLCSVFVTAAFSYSGTELVGVSAAESANPRYTLP 301

Query: 313 SASKKLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSA-THASPFVIAVASHGVRVVPH 371
            ASK+  + I   Y++   ++G LV  +  +LL +  S    ASP VIA+ + G++ +P 
Sbjct: 302 KASKRTFWLITLSYLLVLTIIGCLVRHDDPKLLSASSSVDVAASPLVIAIENGGIQGLPS 361

Query: 372 FXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVSCVFGLL 431
                                        E G  PR   Y+D  GRP++ ++ + VFGLL
Sbjct: 362 LMNAIILIAIISVANSSVYACSRCMVSMAEIGNLPRIFTYIDNRGRPIVAIIFTLVFGLL 421

Query: 432 SFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYVAWTGV 491
           SF+AAS K+E +F WL A+SGLS LF W +I++SH+R RRA+  QG S DEL Y++ TGV
Sbjct: 422 SFIAASNKQEEIFVWLSALSGLSTLFCWLAINISHIRFRRALNTQGYSLDELPYLSMTGV 481

Query: 492 WGAYYAMAMIVAILVGQFWVAISPVGSNKLDANNFFENYLAMPILIFLYLGYKIWTRDWR 551
            G++Y   +I+ +L+  FW ++ P GS+  D  +FF+ YL++PI +F ++G+K++ R+W 
Sbjct: 482 IGSWYGCVVIILVLIASFWTSLFPAGSSGADWESFFKGYLSLPIFLFCFVGHKLYKRNWS 541

Query: 552 LLIPSSEVDLVAHRKIFDAEVLRHEQLEEKEQLRHAPWTTRLANFWC 598
            +I S+++D+   R++ D E L  E+ E  E +    +  +L N WC
Sbjct: 542 WMIRSNKIDVNTGRRMIDKEELEKEKQEFNEYMARKSFIAKLWNLWC 588

>YGR191W Chr7 (880420..882231) [1812 bp, 603 aa] {ON}
           HIP1High-affinity histidine permease, also involved in
           the transport of manganese ions
          Length = 603

 Score =  381 bits (978), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 209/523 (39%), Positives = 304/523 (58%), Gaps = 2/523 (0%)

Query: 77  KHKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYCVIQS 136
            +  L +++  RH+L +++   IGTG+ V  G +L  GGPASLVI + I+S+ L+ VI S
Sbjct: 82  NNTNLSKDLSVRHLLTLAVGGAIGTGLYVNTGAALSTGGPASLVIDWVIISTCLFTVINS 141

Query: 137 ASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKYWNQT 196
             EL+  +  + GGFN Y    ++ +F F+V+  Y  QWL +LPLELV AS+TIKYWN  
Sbjct: 142 LGELSAAF-PVVGGFNVYSMRFIEPSFAFAVNLNYLAQWLVLLPLELVAASITIKYWNDK 200

Query: 197 INPDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGGAGNDGY 256
           IN DA+V IFY  +   N              +  K+L            +CGG  + GY
Sbjct: 201 INSDAWVAIFYATIALANMLDVKSFGETEFVLSMIKILSIIGFTILGIVLSCGGGPHGGY 260

Query: 257 LGARYWHDPGAFRGSDSINRFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASK 316
           +G +YWHDPGAF G  S  +FKG+ +V V AAF+Y G E + ++AAE +NP+++I  A+K
Sbjct: 261 IGGKYWHDPGAFVGHSSGTQFKGLCSVFVTAAFSYSGIEMTAVSAAESKNPRETIPKAAK 320

Query: 317 KLVYRILGIYIMTAILLGFLVPWNSDELL-GSGGSATHASPFVIAVASHGVRVVPHFXXX 375
           +  + I   Y+    L+G LVP N   LL GS      +SP VIA+ + G++ +P     
Sbjct: 321 RTFWLITASYVTILTLIGCLVPSNDPRLLNGSSSVDAASSPLVIAIENGGIKGLPSLMNA 380

Query: 376 XXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVSCVFGLLSFVA 435
                                      G  P+FLN VD+ GRP+  +L++  FGLLSFVA
Sbjct: 381 IILIAVVSVANSAVYACSRCMVAMAHIGNLPKFLNRVDKRGRPMNAILLTLFFGLLSFVA 440

Query: 436 ASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYVAWTGVWGAY 495
           AS K+  VFTWL A+SGLS +F W +I+LSH+R R+AM VQ RS DEL +++ TGV G++
Sbjct: 441 ASDKQAEVFTWLSALSGLSTIFCWMAINLSHIRFRQAMKVQERSLDELPFISQTGVKGSW 500

Query: 496 YAMAMIVAILVGQFWVAISPVGSNKLDANNFFENYLAMPILIFLYLGYKIWTRDWRLLIP 555
           Y   ++  +L+  FW ++ P+G +   A +FFE YL+ PILI  Y+G+K++TR+W L++ 
Sbjct: 501 YGFIVLFLVLIASFWTSLFPLGGSGASAESFFEGYLSFPILIVCYVGHKLYTRNWTLMVK 560

Query: 556 SSEVDLVAHRKIFDAEVLRHEQLEEKEQLRHAPWTTRLANFWC 598
             ++DL   RK  D  + R E   E+E L    + TR  +FWC
Sbjct: 561 LEDMDLDTGRKQVDLTLRREEMRIERETLAKRSFVTRFLHFWC 603

>Kwal_33.14276 s33 complement(596760..598550) [1791 bp, 596 aa] {ON}
           YKR039W (GAP1) - general amino acid permease [contig
           104] FULL
          Length = 596

 Score =  380 bits (977), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 197/526 (37%), Positives = 306/526 (58%), Gaps = 9/526 (1%)

Query: 75  ASKHKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYCVI 134
           A+    LK++++ RH+ MI++   IGTG+ VG+GK+L  GGPA++++ + +  SM+Y V+
Sbjct: 78  ATARSPLKRHLKNRHLQMIAIGGSIGTGLFVGSGKALRIGGPAAVILAWILTGSMVYSVV 137

Query: 135 QSASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKYWN 194
           Q+  EL +    ++G + +Y S  +D +FGF++++ Y +  L  +PLE+V AS+T+ YWN
Sbjct: 138 QAIGELCVA-LPVSGSYLSYVSRFIDPSFGFAIAYNYLVGNLVTMPLEIVAASITVDYWN 196

Query: 195 QTIN-PDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGGAGN 253
                 D FV +FYV ++ IN              +  KVL             CGG  N
Sbjct: 197 VDHKYADGFVALFYVTVLLINFLGVKGYGEAEFVFSIIKVLAIVGFIILGIVLVCGGGSN 256

Query: 254 D-GYLGARYWHDPGAFRGSDSINRFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIR 312
           + GY+G +YWH+PG F      + FKG  A+ V +AF++ G+E   L AAE +NP++ + 
Sbjct: 257 NTGYIGTKYWHNPGGFA-----HGFKGFAAIFVTSAFSFSGSEMFALGAAESKNPRRDLP 311

Query: 313 SASKKLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSATHASPFVIAVASHGVRVVPHF 372
            A+K++ +RI   Y+++  L+G LVP+ +  L  S      ASPFVIA+   G+  +P  
Sbjct: 312 KAAKQVFWRITLFYLISLTLIGCLVPYTNKHLFASSSVDASASPFVIAIKEAGISGLPSV 371

Query: 373 XXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVSCVFGLLS 432
                                         G+ P+   YVDR GRP+  L++S VFGLLS
Sbjct: 372 INVVILVAVLSVGNTCVFASSRATLSLAHYGYLPKKFAYVDRKGRPLAGLILSMVFGLLS 431

Query: 433 FVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYVAWTGVW 492
           F+++S  +  VF W+LA+SGL   FTW SI + H+R R+ +  QGRS DEL + A TG+W
Sbjct: 432 FLSSSKHKGVVFEWMLAVSGLCSFFTWGSICVCHLRFRQGLRAQGRSTDELAFKAQTGIW 491

Query: 493 GAYYAMAMIVAILVGQFWVAISPVGSNKLDANNFFENYLAMPILIFLYLGYKIWTRDWRL 552
           G+ Y + +I  +L  QFWVA+ P+ S    A +FFE YL++P++I  Y+G+K+++R+WRL
Sbjct: 492 GSIYGITLISVVLCFQFWVALFPL-SKSPSAYHFFEQYLSLPVVIVFYMGHKVYSRNWRL 550

Query: 553 LIPSSEVDLVAHRKIFDAEVLRHEQLEEKEQLRHAPWTTRLANFWC 598
           +IP+ E+DL   R+  D E+L+ E  EE E +R  P   R+  FWC
Sbjct: 551 VIPAKELDLDTGRREVDLELLKQEIKEENESIRSRPIWYRIYRFWC 596

>TBLA0B07760 Chr2 complement(1834605..1836581) [1977 bp, 658 aa]
           {ON} Anc_5.158 YGR191W
          Length = 658

 Score =  382 bits (980), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 208/519 (40%), Positives = 306/519 (58%), Gaps = 2/519 (0%)

Query: 81  LKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYCVIQSASEL 140
           + +++  RH+L +++   IGTG+ V +G SL+ GGPASLVIG+ IVS+ L+ VI S  EL
Sbjct: 141 MNKDLSVRHLLTLAVGGAIGTGLFVNSGSSLNTGGPASLVIGWVIVSTALFTVINSLGEL 200

Query: 141 AIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKYWNQTINPD 200
           A  +  + GGF+ Y    VD +F F+V+  Y LQWL +LPLELV AS+TI+YWN +IN D
Sbjct: 201 AAAF-PVVGGFSVYMDKFVDPSFAFAVNLNYLLQWLVLLPLELVAASITIRYWNSSINSD 259

Query: 201 AFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGGAGNDGYLGAR 260
           A+V+IFYV +   N              +  K+L            +CGG  +  Y+G +
Sbjct: 260 AWVSIFYVAIGLANMLDVKSFGETEFVLSLVKILAIIGFFILGIVLDCGGGPSHEYIGGK 319

Query: 261 YWHDPGAFRGSDSINRFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVY 320
           YWHDPGAF G+ S ++FKG+ +V V AAF++ G E + ++AAE +NP+++I  A+K+  +
Sbjct: 320 YWHDPGAFVGTTSGSKFKGLCSVFVTAAFSFSGIEMTAVSAAESRNPRETIPKAAKRTFW 379

Query: 321 RILGIYIMTAILLGFLVPWNSDELL-GSGGSATHASPFVIAVASHGVRVVPHFXXXXXXX 379
            I G Y+    L+G LVP+N   L+ GS      +SP VIA+ +  +  +P         
Sbjct: 380 LITGSYVSILTLVGCLVPYNDPRLMNGSSSVDAASSPLVIAIENGHIHGLPSLMNAIILI 439

Query: 380 XXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVSCVFGLLSFVAASPK 439
                                +    P+    VDR GRP+  +     FGLLSFVAAS K
Sbjct: 440 AILSVANSSVYACSRCMVSMSKIETLPKVFAKVDRRGRPIPAICFVLFFGLLSFVAASDK 499

Query: 440 EETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYVAWTGVWGAYYAMA 499
           +  VFTWL A+SGLS +F W  I+L H+R R+ M VQ  S DEL +++ TG+WG+ Y + 
Sbjct: 500 QAEVFTWLSALSGLSTIFCWMGINLCHIRFRQGMHVQQISLDELPFLSQTGIWGSIYGIV 559

Query: 500 MIVAILVGQFWVAISPVGSNKLDANNFFENYLAMPILIFLYLGYKIWTRDWRLLIPSSEV 559
           ++  +LV  FW ++ PVGS+K +A +FFE YL+ PIL+  Y+ +K++ ++WR  IP+S++
Sbjct: 560 ILFLVLVASFWTSLFPVGSSKANATSFFEGYLSFPILLGCYIAHKVYFKNWRWYIPASKM 619

Query: 560 DLVAHRKIFDAEVLRHEQLEEKEQLRHAPWTTRLANFWC 598
           DL + RK  D EV+R E   EKE L    +  R  + WC
Sbjct: 620 DLHSGRKQVDLEVVREELRLEKEHLAQRSFFYRFLHVWC 658

>NDAI0D02160 Chr4 (505202..506965) [1764 bp, 587 aa] {ON} Anc_5.158
          Length = 587

 Score =  378 bits (970), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 202/519 (38%), Positives = 304/519 (58%), Gaps = 2/519 (0%)

Query: 81  LKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYCVIQSASEL 140
           L +N+  RH+L +++   IG G+ V +G +L +GGPASLVI + I+S+ L+ VI +  E+
Sbjct: 70  LNKNLSIRHLLTLAVGGAIGVGLFVNSGAALASGGPASLVIDWVIISTCLFTVINALGEM 129

Query: 141 AIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKYWNQTINPD 200
           A  +  + GGFN Y +  VD + GF+V+  Y  QWL +LPLELV ASMTIKYWN TIN D
Sbjct: 130 AAAF-PVVGGFNVYITRFVDPSVGFAVNINYLAQWLVLLPLELVAASMTIKYWNDTINSD 188

Query: 201 AFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGGAGNDGYLGAR 260
           A+V IFY V+   N              +  K+L            +CGG    GYLG +
Sbjct: 189 AWVAIFYAVIAFANMLEVKSFGETEFVLSMVKILAIIGFTILGIVLSCGGGPQGGYLGGK 248

Query: 261 YWHDPGAFRGSDSINRFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVY 320
           YWH+PG+F G  S  +FKG+ +V V AAF+Y G E + ++AAE ++P+++I  A+K+  +
Sbjct: 249 YWHNPGSFVGHTSGTKFKGLCSVFVTAAFSYSGIEMTAVSAAESKDPRRTIPKAAKRTFW 308

Query: 321 RILGIYIMTAILLGFLVPWNSDELL-GSGGSATHASPFVIAVASHGVRVVPHFXXXXXXX 379
            I   YI    L+G LVP++   LL GS      +SP VIA+ + G++ +P         
Sbjct: 309 LITASYITILTLIGCLVPYDEPRLLSGSSSVDAASSPLVIAIENGGIKGLPSLMNAIILI 368

Query: 380 XXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVSCVFGLLSFVAASPK 439
                                  G  P+ L ++D+ GRPV  +L +  FGLLSFVAAS K
Sbjct: 369 SIISVANSAVYACSRCMVAMAHIGNLPQVLKHIDKKGRPVNAILFTLFFGLLSFVAASDK 428

Query: 440 EETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYVAWTGVWGAYYAMA 499
           +  VFTWL A+SGLS +F W +I++SH+R R+AM  Q +S DEL Y++ TGVWG++Y + 
Sbjct: 429 QAEVFTWLSALSGLSTIFCWMAINISHIRFRQAMKKQRKSLDELPYLSQTGVWGSWYGVI 488

Query: 500 MIVAILVGQFWVAISPVGSNKLDANNFFENYLAMPILIFLYLGYKIWTRDWRLLIPSSEV 559
           ++  +L+  FW ++ P+G +  DA +FF+ YL+ PILI  Y+G+K+  R  ++++   ++
Sbjct: 489 VLFLVLIVSFWTSLFPLGGSGADAESFFQGYLSFPILIACYVGHKLVYRKKQIVVALEDM 548

Query: 560 DLVAHRKIFDAEVLRHEQLEEKEQLRHAPWTTRLANFWC 598
           D+   R+  D  + R E  EE+E L  + +  R  + WC
Sbjct: 549 DIDTGRRQVDLTIRRQEMKEEQEHLAKSSFFARFLHVWC 587

>NCAS0D01870 Chr4 complement(343416..345203) [1788 bp, 595 aa] {ON}
           Anc_5.158
          Length = 595

 Score =  375 bits (962), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 203/522 (38%), Positives = 303/522 (58%), Gaps = 2/522 (0%)

Query: 78  HKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYCVIQSA 137
           +K+L +++  RH+L +++   IG G+ V +G +L +GGPASLVI + I+S+ L+ VI S 
Sbjct: 75  NKSLNKDLSIRHLLTLAVGGAIGVGLFVNSGAALASGGPASLVIDWVIISTCLFTVINSL 134

Query: 138 SELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKYWNQTI 197
            ELA  +  + GGFN Y +  VD +F F+V+  Y  QWL +LPLELV AS+TIKYWN TI
Sbjct: 135 GELAAAF-PVVGGFNVYITRFVDPSFAFAVNLNYLAQWLVLLPLELVAASITIKYWNSTI 193

Query: 198 NPDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGGAGNDGYL 257
           N DA+V IFY V+   N              +  K+L            +CGG    GYL
Sbjct: 194 NSDAWVAIFYTVITLANMLDVKSFGETEFVLSMVKILAIIGFTILGIVLSCGGGPKGGYL 253

Query: 258 GARYWHDPGAFRGSDSINRFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKK 317
           G +YWH+PGAF G  S  +FKG+ +V V AAF+Y G E + ++AAE ++P+K+I  A+K+
Sbjct: 254 GGKYWHNPGAFVGHTSGTKFKGLCSVFVTAAFSYSGIEMTAVSAAESKDPRKTIPKAAKR 313

Query: 318 LVYRILGIYIMTAILLGFLVPWNSDELL-GSGGSATHASPFVIAVASHGVRVVPHFXXXX 376
             + I   Y+    L+G LVP++   L+ G+      ASP VIA+ + G++ +       
Sbjct: 314 TFWLITASYVTILTLVGCLVPYDDPRLMSGTSSVDAAASPLVIAIENGGIKGLDSLMNAI 373

Query: 377 XXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVSCVFGLLSFVAA 436
                                     G  P+ L  VD+ GRP+   LV+  FGLLSF+AA
Sbjct: 374 ILISIISVANSAVYACSRCMVSMAHIGNLPKKLGKVDKRGRPINATLVTLFFGLLSFIAA 433

Query: 437 SPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYVAWTGVWGAYY 496
           S K+  VFTWL A+SGLS +F W +I++SH+R R+AM  Q RS DE+ Y++ TGVWG+ Y
Sbjct: 434 SDKQNEVFTWLSALSGLSTIFCWMAINISHIRFRQAMIKQNRSLDEMPYLSQTGVWGSLY 493

Query: 497 AMAMIVAILVGQFWVAISPVGSNKLDANNFFENYLAMPILIFLYLGYKIWTRDWRLLIPS 556
            + ++  +LV  FW ++ P+G +  D  +FFE YL++PILI  Y+G+K++ ++W  ++  
Sbjct: 494 GVVVLFLVLVASFWTSLFPLGGDSADVQSFFEGYLSLPILIVCYIGHKLYFKNWSWVVTL 553

Query: 557 SEVDLVAHRKIFDAEVLRHEQLEEKEQLRHAPWTTRLANFWC 598
            E+DL   RK  D  + R E + E+  +    +  R  + WC
Sbjct: 554 EEMDLDTGRKALDPHLHRAEVIAEEAAVAKMSFIKRFWHVWC 595

>AFR230C Chr6 complement(855413..857227) [1815 bp, 604 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YKR039W
           (GAP1)
          Length = 604

 Score =  373 bits (957), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 195/562 (34%), Positives = 310/562 (55%), Gaps = 16/562 (2%)

Query: 44  FADSFRRHEAHNXXXXXXXXXXXXXLTPIESASKHKTLKQNIRPRHVLMISLATGIGTGM 103
           F D+FRR E                 T          L + ++ RH+ MI++   IG G+
Sbjct: 52  FVDTFRRAEMPVIDPNLSEAEKLAIRT------AAAPLSRRLKNRHLQMIAIGGAIGVGL 105

Query: 104 LVGNGKSLHNGGPASLVIGYAIVSSMLYCVIQSASELAIIYTSLAGGFNAYPSLLVDKAF 163
            VG+GK+L   GPA ++IG+ + ++M+  +  S  ELA+ +  ++GG+  Y +  +D+++
Sbjct: 106 FVGSGKALATAGPAGVLIGWGLTATMILIMCLSLGELAVTF-PVSGGYITYAARFIDESW 164

Query: 164 GFSVSWVYCLQWLCVLPLELVTASMTIKYWNQTINPD---AFVTIFYVVLVAINXXXXXX 220
           GF+ ++ Y +Q + V+PLE+V AS+T+ YW+   +P    AFV +F+VV+V+IN      
Sbjct: 165 GFANNFNYMMQAMVVMPLEIVAASVTVGYWDT--DPKYKLAFVALFWVVIVSINLFGVRG 222

Query: 221 XXXXXXXXNCCKVLMXXXXXXXXXXXNCGGAGNDGYLGARYWHDPGAFRGSDSINRFKGI 280
                   +  KV+              GG  +   +G +YW+DPG F G+   ++FKG+
Sbjct: 223 FGEAESIFSLIKVITIIGFIIMGVVLISGGGPDHEVIGGKYWNDPGPFVGNAPSDKFKGV 282

Query: 281 VAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRILGIYIMTAILLGFLVPWN 340
            +V V AAF++ G+E   L AAE + P+KSI  A+K++ +RI   YI++ +++G LVP N
Sbjct: 283 CSVFVTAAFSFAGSELIGLAAAETREPRKSIPKAAKQVFWRITLFYILSLLIVGLLVPSN 342

Query: 341 SDELLGSGGSATHASPFVIAVASHGVRVVPHFXXXXXXXXXXXXXXXXXXXXXXXXXXXX 400
           ++ LL         SPFVIA+  H +RV+P                              
Sbjct: 343 NEHLLAPQQIDAAHSPFVIAMDMHRIRVLPSIINVVILTAVISVGNSSVYSSSRTMCALA 402

Query: 401 EQGFAPRFLNYVDRCGRPVLCLLVSCVFGLLSFVAASPKEETVFTWLLAISGLSELFTWF 460
           E GF P+   Y+DR GRP+  +  + +FGLL FVA + +E  +F WLLAISGLS  FTW 
Sbjct: 403 EHGFLPKIFGYIDRKGRPLFAICFTSLFGLLCFVAGAKEEGEIFDWLLAISGLSSFFTWL 462

Query: 461 SISLSHVRLRRAMTVQGRSADELGYVAWTGVWGAYYAMAMIVAILVGQFWVAISPVGSNK 520
           +I+L+H+R R A+  QGR+ +EL + + TG  G+ YA+ +I  +LV QFWVA+ P   + 
Sbjct: 463 TINLAHMRFRMALKAQGRTTNELSFTSPTGFIGSCYAVGLICVVLVAQFWVALYPPSPDG 522

Query: 521 LDANN----FFENYLAMPILIFLYLGYKIWTRDWRLLIPSSEVDLVAHRKIFDAEVLRHE 576
             A      FF+ YL+  + I +YL +KIW+R+W+  I + E+D+   R+  D E+ + E
Sbjct: 523 TSAKPSPILFFKQYLSFAVAIVMYLAHKIWSRNWKFFIKAKEMDIDTGRRELDLELFKEE 582

Query: 577 QLEEKEQLRHAPWTTRLANFWC 598
             +E+  L   P+  R+ NFWC
Sbjct: 583 LAQERALLAQKPFIIRVFNFWC 604

>NCAS0A08920 Chr1 (1765699..1767498) [1800 bp, 599 aa] {ON}
           Anc_1.368
          Length = 599

 Score =  371 bits (953), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 191/535 (35%), Positives = 305/535 (57%), Gaps = 17/535 (3%)

Query: 71  PIESASKHKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSML 130
           P++ +     LK++++ RH++MI++   IGTG+ VG+G+++  GGP ++VIG+AI  S +
Sbjct: 75  PLDGSFDTNNLKRSLKARHLIMIAIGGSIGTGLFVGSGQAIATGGPLAVVIGWAIAGSQI 134

Query: 131 YCVIQSASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTI 190
              I    E+ + +  + G F  Y +  +D +  F +S +Y +QW  VLPLE+++++MT+
Sbjct: 135 IGTIHGLGEITVRF-PVVGAFANYSTRFLDPSLSFVISTIYVIQWFFVLPLEIISSAMTV 193

Query: 191 KYWNQTINPDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGG 250
           +YWNQ+I+P  +V IFY  +V+IN              +  KVL             CGG
Sbjct: 194 QYWNQSIDPVVWVAIFYCAIVSINLFGARGFGEAEFVFSSVKVLTICGFIILCIVLICGG 253

Query: 251 AGNDGYLGARYWHDPGAFRGSDSINRFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNPQKS 310
             +  ++GA+YWHDPG        + F G+++VLV A+++ GG E   L + E     K 
Sbjct: 254 GPDHDFVGAKYWHDPGCLA-----HGFPGVLSVLVVASYSLGGTEMVCLASGETD--PKE 306

Query: 311 IRSASKKLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSATHASPFVIAVASHGVRVVP 370
           + SA K+  +RIL  ++++  L+GFLVP+ ++ LLG  GS+ + SPFVIA+  H ++V+P
Sbjct: 307 LPSAIKQTFWRILFFFLVSLTLIGFLVPYTNENLLG--GSSVNNSPFVIAIKLHQIKVLP 364

Query: 371 HFXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVSCVFGL 430
                                          QG  PRF  Y+DR GRP+  ++ + +FGL
Sbjct: 365 SIVNAVILISILSVGNSCIFASSRTLCSMAHQGLIPRFFGYIDRAGRPLTGIITNSLFGL 424

Query: 431 LSFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYVAWTG 490
           L+F+  S     VF WL+AI+GL+    W SI++SH+R R AM  QGRS DEL +V+  G
Sbjct: 425 LAFLVKSSSMSEVFDWLMAIAGLATCIVWLSINISHIRFRLAMKAQGRSLDELEFVSAVG 484

Query: 491 VWGAYYAMAMIVAILVGQFWVAISPVG---SNKLDANNFFENYLAMPILIFLYLGYKIWT 547
           +WG+ Y+  +   ILV QF+ A+ P+G   ++ + A  FF++YL   I+I L++G+KI+ 
Sbjct: 485 IWGSAYSAVINSLILVAQFYCALWPIGGWENSSIRAKKFFQSYLCALIMIVLFVGHKIFY 544

Query: 548 R----DWRLLIPSSEVDLVAHRKIFDAEVLRHEQLEEKEQLRHAPWTTRLANFWC 598
           R     W  ++P +++DL   RK  D E+L+ E  E    LR +PW  R  +FWC
Sbjct: 545 RYKTGKWWSMLPLNKIDLETDRKNIDIEILKQEIAERNRHLRASPWYVRWYHFWC 599

>TPHA0A04700 Chr1 (1064463..1066172) [1710 bp, 569 aa] {ON}
           Anc_5.158 YGR191W
          Length = 569

 Score =  369 bits (947), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 194/489 (39%), Positives = 290/489 (59%), Gaps = 2/489 (0%)

Query: 79  KTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYCVIQSAS 138
           + L +++  RH+L +++   IGTG+ V +G SL+ GGPASL+IG+ I+SS L+ VI +  
Sbjct: 76  ENLNKDLDIRHLLTLAIGGSIGTGLFVNSGTSLNTGGPASLIIGWVIISSALFTVINALG 135

Query: 139 ELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKYWNQTIN 198
           ELA  +  + GGFN Y +  VD +F F+V+  Y + W+  LPLELV AS+TI+YWN+ IN
Sbjct: 136 ELAATFP-IVGGFNVYMTRFVDPSFAFAVNLNYLILWIVSLPLELVAASITIRYWNREIN 194

Query: 199 PDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGGAGNDGYLG 258
            DA+VTIF+V +  +N              +  K+L              GG    GY+G
Sbjct: 195 SDAWVTIFFVFIALLNMMDVKFFSEAEFVMSIIKILAIVGFFILGIVLAVGGGPTGGYIG 254

Query: 259 ARYWHDPGAFRGSDSINRFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKL 318
            +YW+DPGAF G  + +RFKG+ +V V AAF+Y G E + ++AAE +NP+K+I  A+K+ 
Sbjct: 255 GKYWNDPGAFHGDSAGSRFKGLCSVFVIAAFSYSGVEMTAVSAAESKNPRKTIPKATKRT 314

Query: 319 VYRILGIYIMTAILLGFLVPWNSDELL-GSGGSATHASPFVIAVASHGVRVVPHFXXXXX 377
            + I   YI    L+G LVP+N   LL GS      ASP VIA+ + G++ +P       
Sbjct: 315 FWVITFSYISILTLIGILVPYNDKRLLSGSSSVDASASPLVIAIENAGIKGLPSLMNAII 374

Query: 378 XXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVSCVFGLLSFVAAS 437
                                       P+  + VD+ GRP+  +  +   GLLSF+AAS
Sbjct: 375 LIALLSVANSCVYVCSRVMVSMALTNTLPKVFSKVDKRGRPLYSIFATLFVGLLSFIAAS 434

Query: 438 PKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYVAWTGVWGAYYA 497
            K+E VFTWL AI GLS +F W  I+L+H+R R A+  Q RS DEL Y++ +G+WG++Y 
Sbjct: 435 DKQEEVFTWLSAICGLSTIFCWIGINLAHIRFRAALKFQNRSLDELAYISQSGIWGSWYG 494

Query: 498 MAMIVAILVGQFWVAISPVGSNKLDANNFFENYLAMPILIFLYLGYKIWTRDWRLLIPSS 557
           + ++V +L+  FWV++ PVG +  DA  FFE YL+ PILI  Y+G+K++ ++W+ +IP  
Sbjct: 495 VIILVLVLIASFWVSLFPVGESSADAEAFFEGYLSFPILIASYIGHKVYIKNWKWVIPLE 554

Query: 558 EVDLVAHRK 566
           E+D+   +K
Sbjct: 555 EIDIDLGKK 563

>NDAI0C02950 Chr3 (676753..678582) [1830 bp, 609 aa] {ON} Anc_5.158
          Length = 609

 Score =  367 bits (943), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 199/522 (38%), Positives = 298/522 (57%), Gaps = 2/522 (0%)

Query: 78  HKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYCVIQSA 137
           ++ L +++  RH++ +++   IG G+ V +G +L +GGPASLVI + I+S+ L+ VI + 
Sbjct: 89  NENLNKDLSIRHLITLAVGGSIGVGLFVNSGAALASGGPASLVIDWVIISTCLFTVINAL 148

Query: 138 SELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKYWNQTI 197
            ELA  Y  + GGFN Y +  VD +  F+++  Y  QWL +LPLELV AS+TIKYWN TI
Sbjct: 149 GELAAAY-PVVGGFNVYITRFVDPSVAFAINLNYLAQWLVLLPLELVAASITIKYWNDTI 207

Query: 198 NPDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGGAGNDGYL 257
           N DA+V IFY V+   N              +  K+L             CGG    G+L
Sbjct: 208 NSDAWVAIFYSVIALANMLDVKSFGETEFVLSMVKILAIIGFTILGIVLACGGGPQGGFL 267

Query: 258 GARYWHDPGAFRGSDSINRFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKK 317
           G  YWHDPG+F G     +FKG+ +V V AAF+Y G E + ++AAE ++P+K+I  A+K+
Sbjct: 268 GGHYWHDPGSFVGDKPGTQFKGLCSVFVTAAFSYSGIELTAVSAAESKDPRKTIPKATKR 327

Query: 318 LVYRILGIYIMTAILLGFLVPWNSDELL-GSGGSATHASPFVIAVASHGVRVVPHFXXXX 376
             + +   Y+    ++G LVP++   LL GS      ASP VI++ + G++ +       
Sbjct: 328 TFWLVTASYVTILTIIGCLVPFDDPRLLNGSSSVDAAASPLVISIKNAGIKGLDSLMNAI 387

Query: 377 XXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVSCVFGLLSFVAA 436
                                     G  P+ L+ VD+ GRPV  +L +  FGLLSF+AA
Sbjct: 388 ILISIVSVANSAVYACSRCMVSMAHIGNLPKVLSRVDKRGRPVNAILSTLFFGLLSFIAA 447

Query: 437 SPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYVAWTGVWGAYY 496
           S K+  VFTWL A+SGLS +F W +I+ SH+R R AM VQ ++ DEL Y++  GV G++Y
Sbjct: 448 SDKQAEVFTWLSALSGLSTIFCWMAINYSHIRFRAAMKVQNKTLDELPYLSQCGVIGSWY 507

Query: 497 AMAMIVAILVGQFWVAISPVGSNKLDANNFFENYLAMPILIFLYLGYKIWTRDWRLLIPS 556
            + ++  +LV  FW ++ P+GS   D  +FFE YL++PILI  Y+G+K++ R+ ++L+  
Sbjct: 508 GVIVLFLVLVASFWTSLFPLGSGTADVTSFFEGYLSLPILIACYVGHKLYVRNLQVLVKL 567

Query: 557 SEVDLVAHRKIFDAEVLRHEQLEEKEQLRHAPWTTRLANFWC 598
            ++DL   RK  DA   R E L EK  L    +  R  + WC
Sbjct: 568 EDMDLETGRKHIDAHEHRAEILAEKAALSQKSFIKRFWHVWC 609

>Suva_2.716 Chr2 complement(1256781..1258592) [1812 bp, 603 aa] {ON}
           YKR039W (REAL)
          Length = 603

 Score =  367 bits (942), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 207/574 (36%), Positives = 324/574 (56%), Gaps = 13/574 (2%)

Query: 30  SPRSDSRSDGLFR----RFADSFRRHEAHNXXXXXXXXXXXXXLTPIESASKHKTLKQNI 85
           S  +D+ S G  R    RF DSF+R E                   I  A+    LK  +
Sbjct: 38  SNNNDNESRGSIRCKWTRFVDSFKRIELEELDPNLTDA------EKIAIATARSPLKHTL 91

Query: 86  RPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYCVIQSASELAIIYT 145
           + RH+ MI++   IGTG+ VG+GK+L   GPA ++IG+ +  +M+Y ++ +  ELA+++ 
Sbjct: 92  KSRHLHMIAVGGAIGTGLFVGSGKALRTAGPAGILIGWTVTGTMIYSMVMAVGELAVVF- 150

Query: 146 SLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKYWNQTIN-PDAFVT 204
            ++GGF  Y +  +D++FGF++++ Y LQWL  LPLE+V+AS+T+ YW       D FV 
Sbjct: 151 PVSGGFTTYATRFIDESFGFAINFNYMLQWLITLPLEIVSASITVNYWGVDAKYRDGFVA 210

Query: 205 IFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGGAGNDGYLGARYWHD 264
           +F+V  V IN                 KV+             CGG    GY+GA+YWH 
Sbjct: 211 LFWVFTVIINLFGVKGYGEAEFVFAIIKVVTIIGFIIMAVILICGGGPVGGYIGAKYWHH 270

Query: 265 PGAFRGSDSINRFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRILG 324
           PGAF G  +  +FKG   V + A+F++GG+E   +  +E +NP+KS+  A+K++ +RI  
Sbjct: 271 PGAFVGDTAGQKFKGFCTVFITASFSFGGSEVVGVAGSESENPRKSVPGAAKQVFWRITL 330

Query: 325 IYIMTAILLGFLVPWNSDELLGSGGSATHASPFVIAVASHGVRVVPHFXXXXXXXXXXXX 384
            Y++  +L+G LVP+N   L+G+      ASPFVIAV + G+R +P              
Sbjct: 331 FYVLCLLLIGMLVPYNDKRLIGASSVDAAASPFVIAVVNQGIRGLPSVINVVILISVLSV 390

Query: 385 XXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVSCVFGLLSFVAASPKEETVF 444
                           EQGF P+ + Y+DR GRP++ + ++  FGL++FVA S  E  VF
Sbjct: 391 GNSSIYLCSRTLTALAEQGFLPKIVAYIDRNGRPLVAIGIASAFGLIAFVAESSHEGEVF 450

Query: 445 TWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYVAWTGVWGAYYAMAMIVAI 504
            WLLA+SGLS LF+W +I + H+R RRA+  QGRS DEL +V+  G+ G+Y+ + + V +
Sbjct: 451 NWLLALSGLSSLFSWSAICICHIRFRRALVAQGRSTDELPFVSTVGIAGSYWGIFICVLM 510

Query: 505 LVGQFWVAISPVGSNKLDANNFFENYLAMPILIFLYLGYKIWTRDWRLLIPSSEVDLVAH 564
           L+ QF+V + P G++  +A +FF  YL+ PI++  Y+ +KIW ++W+L I + ++D+   
Sbjct: 511 LIAQFYVGLFPAGASP-NAKDFFMAYLSFPIVLAFYIFHKIWKKNWKLYIKAEDMDIDTG 569

Query: 565 RKIFDAEVLRHEQLEEKEQLRHAPWTTRLANFWC 598
           R+  D ++L+ E   E+  L   P   R   FWC
Sbjct: 570 RREVDRDLLKQEVAAERADLAARPIWYRCWKFWC 603

>KLLA0A10813g Chr1 complement(936126..937880) [1755 bp, 584 aa] {ON}
           similar to uniprot|P38967 Saccharomyces cerevisiae
           YOL020W TAT2 Tryptophan permease high affinity
          Length = 584

 Score =  366 bits (940), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 197/605 (32%), Positives = 326/605 (53%), Gaps = 41/605 (6%)

Query: 5   ELHNMKSPDNGVVESFDSVEVLKEESP----RSDSRSDGLFRRFADSFRRHEAHNXXXXX 60
           ++ N+ SP +G +E   S  ++ +E+     + + ++  + RR  DSF+           
Sbjct: 10  KMDNLLSPSSGDLEMKFSDGIMSKETEIDLDKKEDKNKNIVRRMIDSFK----------- 58

Query: 61  XXXXXXXXLTPIESASKHKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLV 120
                     P++ +     LK+ ++ RH++MI++   IGTG+ VG+GK+L  GGP +++
Sbjct: 59  ---------PPLDGSYHSDNLKRKLKSRHLIMIAIGGSIGTGLFVGSGKALATGGPLAMI 109

Query: 121 IGYAIVSSMLYCVIQSASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLP 180
           IG++I  S +   I    E+ + +  + G F  Y + L+D +  F VS +Y  QW  VLP
Sbjct: 110 IGWSIAGSQMVGTIHGLGEITMRF-PVVGAFANYSTRLLDPSISFMVSSIYICQWYFVLP 168

Query: 181 LELVTASMTIKYWNQTINPDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXX 240
           +EL+ ++MT+++W   ++P  +V IFYV++V++N              +  KV+      
Sbjct: 169 IELIASAMTVQFWTTKVDPVVWVAIFYVIVVSVNLFGVKVFGEAEFAFSLVKVITIIGFI 228

Query: 241 XXXXXXNCGGAGNDGYLGARYWHDPGAFRGSDSINRFKGIVAVLVNAAFAYGGAEFSVLT 300
                  CGG  +  ++G  YWH PGA       N FKG+ +V V A+++ GG+E   L 
Sbjct: 229 ILSIILICGGGPDHRFIGTEYWHHPGALA-----NGFKGVASVFVTASYSLGGSEMVCLC 283

Query: 301 AAEQQNPQKSIRSASKKLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSATHASPFVIA 360
           +AE     K +  A K++ +RI+  ++++  L+GFLVP+ ++ LLG  GS+ + SPFVIA
Sbjct: 284 SAETD--PKELPHAIKQVFWRIVFFFLVSLTLVGFLVPYTNENLLG--GSSVNNSPFVIA 339

Query: 361 VASHGVRVVPHFXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVL 420
           +   G+RV+P                               QG  PR   YVDR GRP++
Sbjct: 340 IKLSGIRVLPSIINAVILISILSVGNSCIFASSRTLCSMAHQGLIPRVFGYVDRAGRPLV 399

Query: 421 CLLVSCVFGLLSFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSA 480
            ++V+ +FGLL+F+  S     VF WL+AI+GL+    W SI++SH+R R AM  Q RS 
Sbjct: 400 GIIVNSLFGLLAFLVKSASMGVVFDWLMAIAGLATCVVWLSINISHIRFRLAMKAQNRSL 459

Query: 481 DELGYVAWTGVWGAYYAMAMIVAILVGQFWVAISPVG---SNKLDANNFFENYLAMPILI 537
           DEL + +  GV+G+ Y+  + + IL+ QF++++ PVG   S++    +FF+NYL   +L+
Sbjct: 460 DELEFKSSVGVYGSIYSATVNILILIAQFYISLWPVGGWTSSQQRTESFFKNYLCALVLV 519

Query: 538 FLYLGYKIW----TRDWRLLIPSSEVDLVAHRKIFDAEVLRHEQLEEKEQLRHAPWTTRL 593
           F+++ +KI+    T  W    P +E+DL   RK  D E+++ E  E +  L   PW  R 
Sbjct: 520 FVFVTHKIYFKCSTGKWFDFKPLAEIDLETDRKNIDIEIVKQEVREREMYLASKPWYIRF 579

Query: 594 ANFWC 598
            NFWC
Sbjct: 580 YNFWC 584

>AEL030W Chr5 (577803..579551) [1749 bp, 582 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOL020W (TAT2) Newly
           annotated start codon according to experimentaly
           determined 5' end of mRNA using 5' RACE.
          Length = 582

 Score =  366 bits (939), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 196/584 (33%), Positives = 319/584 (54%), Gaps = 39/584 (6%)

Query: 24  EVLKEESPRSDSRSD--GLFRRFADSFRRHEAHNXXXXXXXXXXXXXLTPIESASKHKTL 81
            VL+E     +SR++  GL RR  DSF+                     P++ +     L
Sbjct: 29  SVLEESRLLEESRTNKRGLVRRCIDSFK--------------------PPVDGSFDPDNL 68

Query: 82  KQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYCVIQSASELA 141
           K+ ++ RH++MI++   IGTG+ +G+GK+L  GGP +++IG+ +  + +   I    E+ 
Sbjct: 69  KRTLKSRHLIMIAIGGSIGTGLFIGSGKALATGGPLAVLIGWTLAGTQMVGTIHGLGEVT 128

Query: 142 IIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKYWNQTINPDA 201
           + +  + G F  Y +  +D +  F VS +Y LQW  VLPLE++ +++T+++W  +++P  
Sbjct: 129 VRF-PVVGAFANYSTRFLDPSVSFVVSSIYVLQWFFVLPLEIIASAITMEFWTTSVDPVV 187

Query: 202 FVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGGAGNDGYLGARY 261
           +V +FY ++++IN              +  K++              GG     ++GARY
Sbjct: 188 WVAVFYTLIISINLFGVRWFGKPKFVFSVIKMVPICGFIILCLVLILGGGPTHEFIGARY 247

Query: 262 WHDPGAFRGSDSINRFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYR 321
           WHDPGA       N FKG+ AV+V A+++ GG+E + L + E     K I  A K++ +R
Sbjct: 248 WHDPGALA-----NGFKGVAAVMVTASYSLGGSEMTCLASGETD--PKEIPHAIKQIFWR 300

Query: 322 ILGIYIMTAILLGFLVPWNSDELLGSGGSATHASPFVIAVASHGVRVVPHFXXXXXXXXX 381
           I+  ++++  L+GFLVP+ +D+LLG  GS  + SPFVIA+  H +RV+PH          
Sbjct: 301 IIFFFLVSLTLVGFLVPYTNDQLLG--GSNVNNSPFVIAIKMHNIRVLPHIINGVILVSI 358

Query: 382 XXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVSCVFGLLSFVAASPKEE 441
                               QG  PR   YVDR GRP+  +L + +FGLL+F+  S    
Sbjct: 359 LSVGNSCIFASSRTLCSMAHQGLLPRIFGYVDRAGRPLTGILTNSLFGLLAFLVKSSSTG 418

Query: 442 TVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYVAWTGVWGAYYAMAMI 501
           TVFTWL+A++GL+    W SI++SH+R R AM  QG+S DEL +V+  G+WG+ Y+  M 
Sbjct: 419 TVFTWLMAVAGLATAVVWLSINVSHIRFRLAMKAQGKSLDELEFVSAVGMWGSVYSGVMN 478

Query: 502 VAILVGQFWVAISPV---GSNKLDANNFFENYLAMPILIFLYLGYKIWTR----DWRLLI 554
           V +LV QF+V++ P+      +     FF+NYL   IL+F+++ +KI+ R     W  ++
Sbjct: 479 VVVLVAQFYVSLWPIEGWKDPRGRTEAFFQNYLCALILLFMFVAHKIYYRSTTGQWWKIL 538

Query: 555 PSSEVDLVAHRKIFDAEVLRHEQLEEKEQLRHAPWTTRLANFWC 598
           P +E+DL + RK  D EV++HE    K+ +    W  R  ++WC
Sbjct: 539 PLAEIDLESGRKNIDIEVVKHEVAARKKYISEQRWYIRYYHYWC 582

>Smik_11.302 Chr11 (505026..506684) [1659 bp, 553 aa] {ON} YKR039W
           (REAL)
          Length = 553

 Score =  358 bits (918), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 200/519 (38%), Positives = 306/519 (58%), Gaps = 13/519 (2%)

Query: 34  DSRSDGLFRRFADSFRRHEAHNXXXXXXXXXXXXXLTPIESASKHKTLKQNIRPRHVLMI 93
           ++ S   ++ F DSF+R E                +T          LK +++ RH+ MI
Sbjct: 45  EAGSGSKWQDFKDSFKRVEPIAVDPNLTEAEKVAIVT------AQTPLKHHLKNRHLQMI 98

Query: 94  SLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYCVIQSASELAIIYTSLAGGFNA 153
           ++   IGTG+LVG+G +L  GGPASL+IG+    +M+Y ++ +  ELA+I+  ++GGF  
Sbjct: 99  AIGGAIGTGLLVGSGTALRTGGPASLLIGWGSTGTMIYAMVMALGELAVIF-PISGGFTT 157

Query: 154 YPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKYWNQTINP---DAFVTIFYVVL 210
           Y +  +D++FG++ ++ Y LQWL VLPLE+V+AS+T+ +W    +P   D FV +F+VV+
Sbjct: 158 YATRFIDESFGYANNFNYMLQWLVVLPLEIVSASITVNFWGT--DPKYRDGFVALFWVVI 215

Query: 211 VAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGGAGNDGYLGARYWHDPGAFRG 270
           V IN              +  KV+            NCGG    GY+G +YWHDPGAF G
Sbjct: 216 VIINMFGVKGYGEAEFVFSFIKVITVVGFIILGIILNCGGGPEGGYIGGKYWHDPGAFAG 275

Query: 271 SDSINRFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRILGIYIMTA 330
                +FKG+ +V V +AF++ G+E   L A+E   P+KS+  A+K++ +RI   YI++ 
Sbjct: 276 DTPGAKFKGVCSVFVTSAFSFAGSELVGLAASESVEPRKSVPKAAKQVFWRITLFYILSL 335

Query: 331 ILLGFLVPWNSDELLGSGGSATHASPFVIAVASHGVRVVPHFXXXXXXXXXXXXXXXXXX 390
           +++G LVP+N   L+G+      ASPFVIA+ +HG++ +P                    
Sbjct: 336 LMIGLLVPYNDKNLIGASSVDAAASPFVIAIKTHGIKGLPSVVNVVILIAVLSVGNSAIY 395

Query: 391 XXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVSCVFGLLSFVAASPKEETVFTWLLAI 450
                     EQ F P+   YVDR GRP++ + V+  FGL++FVAAS KE  VF WLLA+
Sbjct: 396 ACSRTMVALAEQRFLPQIFAYVDRKGRPLVGIGVTSAFGLIAFVAASKKEGDVFNWLLAL 455

Query: 451 SGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYVAWTGVWGAYYAMAMIVAILVGQFW 510
           SGLS LFTW  I + H+R R+A+T QGR  DEL + + TGVWG+Y+ + M+V + + QF+
Sbjct: 456 SGLSSLFTWGGICICHIRFRKALTAQGRDLDELSFKSPTGVWGSYWGLFMVVIMFIAQFY 515

Query: 511 VAISPVGSNKLDANNFFENYLAMPILIFLYLGYKIWTRD 549
           VA+ PVG +   A  FFE YL+ P+++ +Y+G+KI+ R+
Sbjct: 516 VALFPVGGSP-SAEGFFEAYLSFPLVMAMYIGHKIYKRN 553

>NCAS0A07110 Chr1 (1408106..1409884) [1779 bp, 592 aa] {ON}
           Anc_5.158
          Length = 592

 Score =  359 bits (921), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 201/528 (38%), Positives = 303/528 (57%), Gaps = 4/528 (0%)

Query: 73  ESASKHKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYC 132
           E    +  L +N+  RH+L +++   IG G+ V +G +L +GGPASLVI + I+S+ L+ 
Sbjct: 67  EDDINNVNLNKNLSIRHLLTLAVGGSIGVGLFVNSGAALASGGPASLVIDWIIISTCLFT 126

Query: 133 VIQSASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKY 192
           VI +  E+A  +  + GGFN Y +  +D + GF+V+  Y  QWL +LPLELV ASMTIKY
Sbjct: 127 VINALGEMAAAF-PVVGGFNVYITRFIDPSVGFAVNINYLAQWLVLLPLELVAASMTIKY 185

Query: 193 WNQTINPDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGGAG 252
           WN+TIN DA+V IFY V+   N              +  K+L             CGG  
Sbjct: 186 WNETINSDAWVAIFYCVIALANMLEVKSFGETEFVLSMIKILAIIGFTILGIVLACGGGP 245

Query: 253 NDGYLGARYWHDPGAFRGSDSINRFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIR 312
           + G++G +YW+ PG+F G +S  +FKG+ +V V AAF+Y G E + ++AAE ++P+ +I 
Sbjct: 246 HGGFIGGKYWNHPGSFVGHNSGTKFKGLCSVFVTAAFSYSGIEMTAVSAAESKDPRTTIP 305

Query: 313 SASKKLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSATHA--SPFVIAVASHGVRVVP 370
            A+K+  + I   Y+    L+G LVP++   LL SG S+  A  SP VIA+ + G++ +P
Sbjct: 306 KAAKRTFWLITASYVTILTLIGCLVPYDDPRLL-SGTSSVDAASSPLVIAIENDGIKGLP 364

Query: 371 HFXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVSCVFGL 430
                                           G  PR LN VD  GRP+  ++ +  FGL
Sbjct: 365 SLMNAIILISIISVANSAVYACSRCMVAMAHIGNVPRILNRVDTKGRPMNAIIFTLFFGL 424

Query: 431 LSFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYVAWTG 490
           LSFVAAS ++  VFTWL A+SGLS +F W +I+LSH+R R++M  Q RS DEL +++ TG
Sbjct: 425 LSFVAASDRQADVFTWLSALSGLSTIFCWMAINLSHIRFRQSMAKQNRSLDELPFLSQTG 484

Query: 491 VWGAYYAMAMIVAILVGQFWVAISPVGSNKLDANNFFENYLAMPILIFLYLGYKIWTRDW 550
           VWG++Y   ++  +LV  FW ++ P+G    DA +FFE YL+ PIL+  Y G+K++ R  
Sbjct: 485 VWGSWYGTIVLFLVLVASFWTSLFPLGGTSADAESFFEGYLSFPILLACYFGHKLYVRKR 544

Query: 551 RLLIPSSEVDLVAHRKIFDAEVLRHEQLEEKEQLRHAPWTTRLANFWC 598
             ++  +++DL   R+  D +V R E   E+E+L    +     + WC
Sbjct: 545 EFMVGLADMDLDTGRRQVDLDVRREELRREREELAKQSFFKSFLHVWC 592

>YOL020W Chr15 (286172..287950) [1779 bp, 592 aa] {ON}  TAT2High
           affinity tryptophan and tyrosine permease,
           overexpression confers FK506 and FTY720 resistance
          Length = 592

 Score =  358 bits (918), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 194/566 (34%), Positives = 306/566 (54%), Gaps = 37/566 (6%)

Query: 40  LFRRFADSFRRHEAHNXXXXXXXXXXXXXLTPIESASKHKTLKQNIRPRHVLMISLATGI 99
           +F+R  DSF+                    +P++ +     LK+ ++PRH++MI++   I
Sbjct: 57  IFQRCVDSFK--------------------SPLDGSFDTSNLKRTLKPRHLIMIAIGGSI 96

Query: 100 GTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYCVIQSASELAIIYTSLAGGFNAYPSLLV 159
           GTG+ VG+GK++  GGP  +VIG+AI  S +   I    E+ + +  + G F  Y +  +
Sbjct: 97  GTGLFVGSGKAIAEGGPLGVVIGWAIAGSQIIGTIHGLGEITVRF-PVVGAFANYGTRFL 155

Query: 160 DKAFGFSVSWVYCLQWLCVLPLELVTASMTIKYWNQTINPDAFVTIFYVVLVAINXXXXX 219
           D +  F VS +Y LQW  VLPLE++ A+MT++YWN +I+P  +V IFY V+V+IN     
Sbjct: 156 DPSISFVVSTIYVLQWFFVLPLEIIAAAMTVQYWNSSIDPVIWVAIFYAVIVSINLFGVR 215

Query: 220 XXXXXXXXXNCCKVLMXXXXXXXXXXXNCGGAGNDGYLGARYWHDPGAFRGSDSINRFKG 279
                    +  K +             CGG  +  ++GA+YWHDPG        N F G
Sbjct: 216 GFGEAEFAFSTIKAITVCGFIILCVVLICGGGPDHEFIGAKYWHDPGCLA-----NGFPG 270

Query: 280 IVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRILGIYIMTAILLGFLVPW 339
           +++VLV A+++ GG E + L + E     K + SA K++ +RIL  ++++  L+GFLVP+
Sbjct: 271 VLSVLVVASYSLGGIEMTCLASGETD--PKGLPSAIKQVFWRILFFFLISLTLVGFLVPY 328

Query: 340 NSDELLGSGGSATHASPFVIAVASHGVRVVPHFXXXXXXXXXXXXXXXXXXXXXXXXXXX 399
            +  LLG  GS+   SPFVIA+  H ++ +P                             
Sbjct: 329 TNQNLLG--GSSVDNSPFVIAIKLHHIKALPSIVNAVILISVLSVGNSCIFASSRTLCSM 386

Query: 400 XEQGFAPRFLNYVDRCGRPVLCLLVSCVFGLLSFVAASPKEETVFTWLLAISGLSELFTW 459
             QG  P +  Y+DR GRP++ ++ + +FGLL+F+  S     VF WL+AI+GL+    W
Sbjct: 387 AHQGLIPWWFGYIDRAGRPLVGIMANSLFGLLAFLVKSGSMSEVFNWLMAIAGLATCIVW 446

Query: 460 FSISLSHVRLRRAMTVQGRSADELGYVAWTGVWGAYYAMAMIVAILVGQFWVAISPVG-- 517
            SI+LSH+R R AM  QG+S DEL +V+  G+WG+ Y+  +   IL+ QF+ ++ P+G  
Sbjct: 447 LSINLSHIRFRLAMKAQGKSLDELEFVSAVGIWGSAYSALINCLILIAQFYCSLWPIGGW 506

Query: 518 -SNKLDANNFFENYLAMPILIFLYLGYKIW----TRDWRLLIPSSEVDLVAHRKIFDAEV 572
            S K  A  FF+NYL   I++F+++ +KI+    T  W  +    ++DL   RK  D E+
Sbjct: 507 TSGKERAKIFFQNYLCALIMLFIFIVHKIYYKCQTGKWWGVKALKDIDLETDRKDIDIEI 566

Query: 573 LRHEQLEEKEQLRHAPWTTRLANFWC 598
           ++ E  E+K  L   PW  R  +FWC
Sbjct: 567 VKQEIAEKKMYLDSRPWYVRQFHFWC 592

>NDAI0G06030 Chr7 complement(1489584..1491383) [1800 bp, 599 aa]
           {ON} 
          Length = 599

 Score =  357 bits (915), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 197/615 (32%), Positives = 328/615 (53%), Gaps = 48/615 (7%)

Query: 2   KDFELHNMKSPDNGVVESF--DSVEVLKEESPRSDSRSDG---------LFRRFADSFRR 50
           ++ E++   + +   ++S+   S     ++S   D  ++G         +F+R  DSF+ 
Sbjct: 15  QNSEIYEFTTFEPKALDSYKSSSFRTFTKQSKDDDDIAEGHSSYQPPRNIFQRCIDSFK- 73

Query: 51  HEAHNXXXXXXXXXXXXXLTPIESASKHKTLKQNIRPRHVLMISLATGIGTGMLVGNGKS 110
                               P++ +     LK+ ++ RH++MI++   IGTG+ +G+G++
Sbjct: 74  -------------------PPLDGSFHTHNLKRTLKARHLIMIAIGGSIGTGLFIGSGQA 114

Query: 111 LHNGGPASLVIGYAIVSSMLYCVIQSASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWV 170
           L +GGP +L+IG++I  + +   I    E+ + +  + G F  Y +  +D +  F +S +
Sbjct: 115 LASGGPLALIIGWSIAGTQIVGTIHGLGEITVRF-PVVGAFANYSTRFLDPSISFVISTI 173

Query: 171 YCLQWLCVLPLELVTASMTIKYWNQTINPDAFVTIFYVVLVAINXXXXXXXXXXXXXXNC 230
           Y +QW  VLPLE++ ++MTI+YWNQ+I+P  +V IFY V+V+IN              + 
Sbjct: 174 YVIQWFFVLPLEIIASAMTIQYWNQSIDPVVWVAIFYCVIVSINLFGARGFGEAEFLFSS 233

Query: 231 CKVLMXXXXXXXXXXXNCGGAGNDGYLGARYWHDPGAFRGSDSINRFKGIVAVLVNAAFA 290
            KV+             CGG  +  ++GARYWHDPG        + F G+++VLV A+++
Sbjct: 234 IKVITIIGFIILCIVLICGGGPDHDFVGARYWHDPGCLS-----HGFPGVLSVLVVASYS 288

Query: 291 YGGAEFSVLTAAEQQNPQKSIRSASKKLVYRILGIYIMTAILLGFLVPWNSDELLGSGGS 350
            GG E   L + E  NP++ + SA K+  +RIL  ++++  L+GFLVP+ +  LLG  GS
Sbjct: 289 LGGTEMVCLASGET-NPRE-LPSAIKQTFWRILFFFLISLTLIGFLVPYTNPNLLG--GS 344

Query: 351 ATHASPFVIAVASHGVRVVPHFXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLN 410
           + + SPFVIA+  H ++ +P                               QG  P+F  
Sbjct: 345 SVNNSPFVIAIKLHHIKALPSIVNAVILISIMSVGNSCIFASSRTLCSMAHQGLIPKFFG 404

Query: 411 YVDRCGRPVLCLLVSCVFGLLSFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLR 470
           Y+DR GRP+  +L + +FGLL+F+  S     VF WL+AI+GL+    W SI++SH+R R
Sbjct: 405 YIDRAGRPLTGILTNSLFGLLAFLVKSSSMGEVFDWLMAIAGLATCIVWLSINISHIRFR 464

Query: 471 RAMTVQGRSADELGYVAWTGVWGAYYAMAMIVAILVGQFWVAISPVGSNKLD---ANNFF 527
            AM  QG+S DEL +V+  G+WG+ Y+  +   IL+ QF+ A+ P+G  K     A  FF
Sbjct: 465 LAMKAQGKSLDELEFVSAVGMWGSAYSALINSLILIAQFYCALWPIGGWKDSSERAKTFF 524

Query: 528 ENYLAMPILIFLYLGYKIWTR----DWRLLIPSSEVDLVAHRKIFDAEVLRHEQLEEKEQ 583
           ++YL   I+ FL++ +K++ R     W  ++   ++DL   RK  D +VL+ E  E    
Sbjct: 525 QSYLCALIMAFLFVCHKVFYRYKTGKWWAIMDLDKIDLETDRKNIDIDVLKQEIAERNRH 584

Query: 584 LRHAPWTTRLANFWC 598
           L+ +PW  R  +FWC
Sbjct: 585 LQASPWYVRWYHFWC 599

>Smik_15.146 Chr15 (252586..254367) [1782 bp, 593 aa] {ON} YOL020W
           (REAL)
          Length = 593

 Score =  356 bits (913), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 193/578 (33%), Positives = 306/578 (52%), Gaps = 37/578 (6%)

Query: 28  EESPRSDSRSDGLFRRFADSFRRHEAHNXXXXXXXXXXXXXLTPIESASKHKTLKQNIRP 87
           ++    +  +  +F+R  DSF+                     P++ +     LK+ ++P
Sbjct: 46  QDDDDGEHSNRNIFQRCVDSFK--------------------PPLDGSFDTSNLKRTLKP 85

Query: 88  RHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYCVIQSASELAIIYTSL 147
           RH++MI++   IGTG+ VG+GK++  GGP  +V+G+ I  S +   I    E+ + +  +
Sbjct: 86  RHLIMIAIGGSIGTGLFVGSGKAIAEGGPLGVVLGWTIAGSQIIGTIHGLGEITVRF-PV 144

Query: 148 AGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKYWNQTINPDAFVTIFY 207
            G F  Y +  +D +  F VS +Y LQW  VLPLE++ A+MT++YWN +I+P  +V IFY
Sbjct: 145 VGAFANYGTRFLDPSISFVVSTIYVLQWFFVLPLEIIAAAMTVQYWNSSIDPVIWVAIFY 204

Query: 208 VVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGGAGNDGYLGARYWHDPGA 267
            V+V IN              +  K +             CGG  +  ++GA+YWHDPG 
Sbjct: 205 AVIVCINLFGARGFGEAEFAFSTVKAITVCGFIILSIVLICGGGPDHEFIGAKYWHDPGC 264

Query: 268 FRGSDSINRFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRILGIYI 327
                  N F G++AVLV A+++ GG E + L + E     K +  A K++ +RIL  ++
Sbjct: 265 LA-----NGFPGVLAVLVVASYSLGGIEMTCLASGETD--PKGLPGAIKQVFWRILFFFL 317

Query: 328 MTAILLGFLVPWNSDELLGSGGSATHASPFVIAVASHGVRVVPHFXXXXXXXXXXXXXXX 387
            +  L+GFLVP+ +  LLG  GS+   SPFVIA+  H ++V+P                 
Sbjct: 318 ASLTLVGFLVPYTNQNLLG--GSSVDNSPFVIAMKLHHIKVLPTIVNAVILISVLSVGNS 375

Query: 388 XXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVSCVFGLLSFVAASPKEETVFTWL 447
                         QG  P +  Y+DR GRP++ ++ + +FGLL+F+  S     VF WL
Sbjct: 376 CIFASSRTLCSMAHQGLIPWWFGYIDRAGRPLVGIMANSLFGLLAFLVKSGSMADVFNWL 435

Query: 448 LAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYVAWTGVWGAYYAMAMIVAILVG 507
           +AI+GL+    W SI+LSH+R R AM  QG+S DEL +V+  G+WG+ Y+  +   IL+ 
Sbjct: 436 MAIAGLATCIVWLSINLSHIRFRLAMKAQGKSLDELEFVSAVGIWGSAYSALINCLILIA 495

Query: 508 QFWVAISPVG---SNKLDANNFFENYLAMPILIFLYLGYKIW----TRDWRLLIPSSEVD 560
           QF+ ++ P+G   S K  A  FF+NYL   I++F+++ +KI+    T  W  +    ++D
Sbjct: 496 QFYCSLWPIGGWSSGKERAKLFFQNYLCALIMLFIFVVHKIYYKCQTGKWWGVKSLKDID 555

Query: 561 LVAHRKIFDAEVLRHEQLEEKEQLRHAPWTTRLANFWC 598
           L   RK  D E+++ E +E K  L   PW  R  +FWC
Sbjct: 556 LETDRKDIDIEIIKQEIMERKMHLDSRPWYVRQFHFWC 593

>Skud_15.138 Chr15 (245592..247370) [1779 bp, 592 aa] {ON} YOL020W
           (REAL)
          Length = 592

 Score =  355 bits (911), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 191/566 (33%), Positives = 307/566 (54%), Gaps = 37/566 (6%)

Query: 40  LFRRFADSFRRHEAHNXXXXXXXXXXXXXLTPIESASKHKTLKQNIRPRHVLMISLATGI 99
           +F+R  DSF+                     P++ +     LK+ ++PRH++MI++   I
Sbjct: 57  IFQRCVDSFK--------------------PPLDGSFDTSNLKRTLKPRHLIMIAIGGSI 96

Query: 100 GTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYCVIQSASELAIIYTSLAGGFNAYPSLLV 159
           GTG+ VG+GK++  GGP  +V+G+ I  S +   +    E+ + +  + G F  Y +  +
Sbjct: 97  GTGLFVGSGKAIAEGGPLGVVLGWTIAGSQIIGTVHGLGEITVRF-PVVGAFANYGTRFL 155

Query: 160 DKAFGFSVSWVYCLQWLCVLPLELVTASMTIKYWNQTINPDAFVTIFYVVLVAINXXXXX 219
           D +  F VS +Y LQW  VLPLE++ A+MT++YWN +I+P  +V IFY V+V+IN     
Sbjct: 156 DPSISFVVSTIYVLQWFFVLPLEIIAAAMTVQYWNSSIDPVIWVAIFYAVIVSINLFGAR 215

Query: 220 XXXXXXXXXNCCKVLMXXXXXXXXXXXNCGGAGNDGYLGARYWHDPGAFRGSDSINRFKG 279
                    +  K +             CGG  +  ++GA+YWHDPG        + F G
Sbjct: 216 GFGEAEFAFSTVKAITVGGFIILCIVLICGGGPDHEFIGAKYWHDPGCLA-----HGFPG 270

Query: 280 IVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRILGIYIMTAILLGFLVPW 339
           +++VLV A+++ GG E + L + E     K + SA K++ +RI+  ++++  L+GFLVP+
Sbjct: 271 VLSVLVVASYSLGGIEMTCLASGETD--PKGLPSAIKQVFWRIIFFFLVSLTLVGFLVPY 328

Query: 340 NSDELLGSGGSATHASPFVIAVASHGVRVVPHFXXXXXXXXXXXXXXXXXXXXXXXXXXX 399
            +  LLG  GS+   SPFVIA+  H ++V+P                             
Sbjct: 329 TNQNLLG--GSSVDNSPFVIAIKLHHIKVLPSIVNAVILISVLSVGNSCIFASSRTLCSM 386

Query: 400 XEQGFAPRFLNYVDRCGRPVLCLLVSCVFGLLSFVAASPKEETVFTWLLAISGLSELFTW 459
             QG  P +  Y+DR GRP++ ++ + +FGLL+F+  S     VF WL+AI+GL+    W
Sbjct: 387 AHQGLIPWWFGYIDRAGRPLVGIMANSLFGLLAFLVKSGSMSEVFNWLMAIAGLATCIVW 446

Query: 460 FSISLSHVRLRRAMTVQGRSADELGYVAWTGVWGAYYAMAMIVAILVGQFWVAISPVG-- 517
            SI+LSHVR R AM  QG+S DEL +V+  G+WG+ Y+  +   IL+ QF+ ++ P+G  
Sbjct: 447 LSINLSHVRFRLAMKAQGKSLDELEFVSAVGIWGSVYSALINCLILIAQFYCSLWPIGGW 506

Query: 518 -SNKLDANNFFENYLAMPILIFLYLGYKIWTR----DWRLLIPSSEVDLVAHRKIFDAEV 572
            S+K  A  FF+NYL   I++F+++ +KI+ R     W  +    ++DL   RK  D E+
Sbjct: 507 TSSKERAKIFFQNYLCALIMVFIFVIHKIYYRCQMGKWWGVKELKDIDLETDRKDIDIEI 566

Query: 573 LRHEQLEEKEQLRHAPWTTRLANFWC 598
           ++ E  E+K+ L   PW  R  +FWC
Sbjct: 567 VKQEIAEKKKYLDSRPWYVRQFHFWC 592

>Kpol_534.22 s534 (50849..52627) [1779 bp, 592 aa] {ON}
           (50849..52627) [1779 nt, 593 aa]
          Length = 592

 Score =  353 bits (907), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 200/602 (33%), Positives = 316/602 (52%), Gaps = 46/602 (7%)

Query: 5   ELHNMKSPDNGVVESFDSVEVLKEESPRSDSRSDGLFRRFADSFRRHEAHNXXXXXXXXX 64
           E  N    DN +     S    KE+ P        ++RR  DSF+               
Sbjct: 29  ESDNKNIDDNFIPHDTLSTISRKEKKPP-------IYRRIIDSFK--------------- 66

Query: 65  XXXXLTPIESASKHK-TLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGY 123
                 P E  S H   LK++++ RH++MI++   IGTG+ +G+G++L  GGP +++IG+
Sbjct: 67  ------PPEDGSFHTGNLKKSLKSRHLIMIAIGGSIGTGLFIGSGQALATGGPLAVIIGW 120

Query: 124 AIVSSMLYCVIQSASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLEL 183
           A+  S +   I    E+ + +  + G F +Y +  +D +  F VS +Y LQW  VLPLE+
Sbjct: 121 AVAGSQIVGTIHGLGEITVRF-PVVGAFASYTTRFLDPSISFVVSTIYVLQWFFVLPLEI 179

Query: 184 VTASMTIKYWNQTINPDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXX 243
           + +++T++YWN +I+P  FV IFY V+V+IN              +  K++         
Sbjct: 180 IASAITVQYWNDSIDPVVFVAIFYCVIVSINLFGARGFGEAEFIFSTVKIITICGFIILC 239

Query: 244 XXXNCGGAGNDGYLGARYWHDPGAFRGSDSINRFKGIVAVLVNAAFAYGGAEFSVLTAAE 303
                GG  +  Y+GA+YWH+PG+       + FKG+++VLV A+++ GG E + L + E
Sbjct: 240 IVLIAGGGPDHEYIGAKYWHNPGSLA-----HGFKGVLSVLVVASYSLGGTEMTCLASGE 294

Query: 304 QQNPQKSIRSASKKLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSATHASPFVIAVAS 363
                K + SA K++ +RIL  ++++  L+GFLVP+ +  LLG  GS+   SPFVIA+  
Sbjct: 295 TD--PKELPSAIKQVFWRILFFFLVSLTLVGFLVPYTNPNLLG--GSSVDNSPFVIAIKI 350

Query: 364 HGVRVVPHFXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLL 423
           H ++V+P                               Q   P +  Y+DR GRP+  ++
Sbjct: 351 HNIKVLPSIVNAVILVSILSVGNSCIFASSRTLCSMAHQHLIPWWFGYIDRAGRPLTGII 410

Query: 424 VSCVFGLLSFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADEL 483
           ++ +FGLL+F+  S     VF WL+AI+GL+    W SI++ HVR R AM  Q R+ DEL
Sbjct: 411 INSLFGLLAFLVKSSSVTEVFDWLMAIAGLATCIVWLSINICHVRFRLAMKAQNRTLDEL 470

Query: 484 GYVAWTGVWGAYYAMAMIVAILVGQFWVAISPVG---SNKLDANNFFENYLAMPILIFLY 540
            +V+  G+WG+ Y+  +   ILV QF++A+ P+G    +   A  FF+NYL   ILI L+
Sbjct: 471 EFVSAVGIWGSVYSGIVNALILVAQFYIALWPIGGWTDSGTRAKKFFQNYLCALILIVLF 530

Query: 541 LGYKIWTR----DWRLLIPSSEVDLVAHRKIFDAEVLRHEQLEEKEQLRHAPWTTRLANF 596
           +G+KI+ R     W   I   ++DL   RK  D E+++ E  E+K  L   PW  R  + 
Sbjct: 531 IGHKIYYRVTTGHWWEYIALKDIDLDTDRKNVDIEIIKQEIHEKKMYLASKPWYVRQFHV 590

Query: 597 WC 598
           WC
Sbjct: 591 WC 592

>CAGL0D02178g Chr4 (222597..224330) [1734 bp, 577 aa] {ON} highly
           similar to uniprot|P38967 Saccharomyces cerevisiae
           YOL020w SCM2 high affinity tryptophan transport protein
          Length = 577

 Score =  352 bits (903), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 188/577 (32%), Positives = 307/577 (53%), Gaps = 37/577 (6%)

Query: 29  ESPRSDSRSDGLFRRFADSFRRHEAHNXXXXXXXXXXXXXLTPIESASKHKTLKQNIRPR 88
           ESP        +F+R  DSF+                     P++ +     LK+ ++ R
Sbjct: 31  ESPEPVVTKRNIFQRCVDSFK--------------------PPVDGSFDTSNLKRTLKSR 70

Query: 89  HVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYCVIQSASELAIIYTSLA 148
           H++MI++   IGTG+ +G+G++L  GGP +++IG+ I  S +   I    E+ + +  + 
Sbjct: 71  HLIMIAIGGSIGTGLFIGSGQALATGGPLAVIIGWTIAGSQIVGTIHGLGEITVRF-PVV 129

Query: 149 GGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKYWNQTINPDAFVTIFYV 208
           G F  Y +  +D +  F VS +Y +QW  VLPLE++ +++TI+YWN +I+P  +V IFY 
Sbjct: 130 GAFADYSTRFLDPSISFVVSTIYVIQWFFVLPLEIIASAITIQYWNSSIDPVVWVAIFYG 189

Query: 209 VLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGGAGNDGYLGARYWHDPGAF 268
           V+V+IN              +  K +             CGG  +  ++GA+YWHDPGA 
Sbjct: 190 VIVSINLFGARGFGEAEFVFSTIKAITICGFIILCIVLICGGGPDHEFIGAKYWHDPGAL 249

Query: 269 RGSDSINRFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRILGIYIM 328
                 + F G+++VLV A+++ GG E + L + E     K + SA K++ +RIL  ++ 
Sbjct: 250 A-----HGFPGVLSVLVVASYSLGGTEMTCLASGETD--PKELPSAIKQVFWRILFFFLA 302

Query: 329 TAILLGFLVPWNSDELLGSGGSATHASPFVIAVASHGVRVVPHFXXXXXXXXXXXXXXXX 388
           +  L+GFLVP+ ++ LLG  GS+   SPFVIA+  H ++ +P                  
Sbjct: 303 SLTLVGFLVPYTNENLLG--GSSVDNSPFVIAIKLHHIKALPSIVNAVILISILSVGNSC 360

Query: 389 XXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVSCVFGLLSFVAASPKEETVFTWLL 448
                        QG  PRF  Y+DR GRP+  ++ + +FGLL+F+  S     VF WL+
Sbjct: 361 IFASSRTLCSMAHQGLIPRFFGYIDRAGRPLAGIVTNSLFGLLAFLVKSSSVSEVFDWLM 420

Query: 449 AISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYVAWTGVWGAYYAMAMIVAILVGQ 508
           AI+GL+    W SI+LSH+R R AM  Q ++ DEL +V+  G+WG+ Y+  + V IL+ Q
Sbjct: 421 AIAGLATCIVWLSINLSHIRFRLAMKAQNKTLDELEFVSAVGIWGSAYSALINVLILIAQ 480

Query: 509 FWVAISPVG---SNKLDANNFFENYLAMPILIFLYLGYKIWTR----DWRLLIPSSEVDL 561
           F++++ P+G    +   A  FF++YL   I++ ++  +K++ R     W  + P  ++DL
Sbjct: 481 FYISLWPIGGWTDSSQRAKKFFQSYLCALIMLLIFCIHKVYYRVSFGKWWDVKPLKDIDL 540

Query: 562 VAHRKIFDAEVLRHEQLEEKEQLRHAPWTTRLANFWC 598
              RK  D +V++ E  E K  L+  PW  R  +FWC
Sbjct: 541 ETGRKNVDIDVIKAEIAERKMYLKKKPWIVRWYHFWC 577

>KLTH0C08052g Chr3 (685805..687604) [1800 bp, 599 aa] {ON} similar
           to uniprot|Q7LGU1 Saccharomyces cerevisiae YPL274W SAM3
           High-affinity S-adenosylmethionine permease, required
           for utilization of S-adenosylmethionine as a sulfur
           source; has similarity to S-methylmethionine permease
           Mmp1p
          Length = 599

 Score =  350 bits (898), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 202/579 (34%), Positives = 314/579 (54%), Gaps = 27/579 (4%)

Query: 31  PRSDSRSDGLFRRFADSFRRHEAHNXXXXXXXXXXXXXLTPIESASK------HKTLKQN 84
           P    +      R   SFRR +A               L+ ++   +      ++ L++ 
Sbjct: 37  PFQRKQMSSRMNRITQSFRRQDA--------VEYADVDLSMMDEQQRRNYVLANQPLQKT 88

Query: 85  IRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYCVIQSASELAIIY 144
           +  RH++MI++   +GTG+ +G G SL +G P SL+IG+ IV  M++CV+QSA+ELA  Y
Sbjct: 89  LSQRHLMMIAIGGTLGTGLFIGIGYSLSSG-PGSLLIGFLIVGLMMFCVVQSAAELACQY 147

Query: 145 TSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKYWNQTINPDAFVT 204
             ++G +  + S  ++ + GF+V+  Y L WL   P EL+  +MT++YWN+++NP  +V 
Sbjct: 148 -PVSGSYAVHVSRFMEPSIGFTVATNYALAWLISFPSELIGCAMTLQYWNKSVNPAVWVA 206

Query: 205 IFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGGAGND-GYLGARYWH 263
           IFYV ++++N              +  KV+             CGG  N  GY+G +YWH
Sbjct: 207 IFYVFIMSLNMFGVRSYGEAEFWMSLFKVVAIVIFIIIGIVLICGGGPNSTGYIGTKYWH 266

Query: 264 DPGAFRGSDSINRFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRIL 323
           DPG+F    +   FKG+    V+AAF++GGAE  VLTA+E +  + S+  A+K   +RI 
Sbjct: 267 DPGSF----AKPVFKGLCNTFVSAAFSFGGAELVVLTASESRKVE-SVSRAAKGTFWRIA 321

Query: 324 GIYIMTAILLGFLVPWNSDELLGSGGSAT-HASPFVIAVASHGV--RVVPHFXXXXXXXX 380
             YI T I++G LVP+ +++LLG        ASPFVIA++  G       HF        
Sbjct: 322 IFYITTVIVIGCLVPYTNEQLLGGDNDEDITASPFVIALSGQGSMGTKASHFMNTVILIA 381

Query: 381 XXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVSCVFGLLSFVAASPKE 440
                                 G  P+   YVD+ GRP++ + +  VFGLL F+ AS  E
Sbjct: 382 VLSVCNSAVYASSRIIQALGVCGQLPKICGYVDQKGRPLVGIAICGVFGLLGFLVASDNE 441

Query: 441 ETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYVAWTGVWGAYYAMAM 500
             VFTWL A+  +S  FTWF I  S VR R A+  QGRS+DE+ + +  G++G +    +
Sbjct: 442 GDVFTWLFALCSISSFFTWFCICASQVRFRFALRAQGRSSDEIAHKSMLGIYGGFLGCLL 501

Query: 501 IVAILVGQFWVAISPVGSNKLDANNFFENYLAMPILIFLYLGYKIW-TRDWRLLIPSSEV 559
              ++ G+ +V+I P+G +   A  FF+  L++PI+I +Y+G+K++  +  R+LIP+ E+
Sbjct: 502 NALLIAGEIYVSIFPLGGDP-SAKQFFQYCLSIPIMIAVYIGHKLFANKSKRVLIPAQEI 560

Query: 560 DLVAHRKIFDAEVLRHEQLEEKEQLRHAPWTTRLANFWC 598
           DL   RKI D E  +HE LE+KE+L   P   R+  FWC
Sbjct: 561 DLETGRKIKDLEQFKHEVLEDKEKLASKPLYYRIYRFWC 599

>TPHA0A02500 Chr1 (533688..535460) [1773 bp, 590 aa] {ON} Anc_1.368
           YOL020W
          Length = 590

 Score =  347 bits (891), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 199/598 (33%), Positives = 326/598 (54%), Gaps = 46/598 (7%)

Query: 11  SPDNGVVESFDSVEVLKEESPRSDSRSDGLFRRFADSFRRHEAHNXXXXXXXXXXXXXLT 70
           S +  + + ++  E L + + ++++R+  +F+R  DSF+                     
Sbjct: 29  SDNKNIDDKYEHAESLTDYT-KTENRN--IFQRVIDSFK--------------------- 64

Query: 71  PIESASKHKT-LKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSM 129
           P  + S H + LK++++ RH++MI++   IGTG+ +G+G++L NGGP +LV+G++I  S 
Sbjct: 65  PPANGSFHTSNLKRSLKSRHLIMIAIGGSIGTGLFIGSGQALANGGPLALVLGWSIAGSQ 124

Query: 130 LYCVIQSASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMT 189
           +   I    E+ + +  + G F  Y +  +D +  F +S +Y LQW  VLPLE++++++T
Sbjct: 125 IVGTIHGLGEITVRF-PVVGAFANYQTRFLDPSLSFVISTIYVLQWFFVLPLEILSSAIT 183

Query: 190 IKYWNQTINPDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCG 249
           ++YWN TI+P  FV IFY  +V+IN              +  KV+             CG
Sbjct: 184 VQYWNDTIDPVVFVAIFYCAIVSINLFGVRGFGEAEFVFSTIKVITVTGFIILCIILICG 243

Query: 250 GAGNDGYLGARYWHDPGAFRGSDSINRFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNPQK 309
           G     ++GA+YWHDPG        N F+G ++VL+ A+++ GG E + L + E     K
Sbjct: 244 GGPTHEFIGAKYWHDPGCLA-----NGFRGFLSVLITASYSLGGTEMTCLASGETD--PK 296

Query: 310 SIRSASKKLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSATHASPFVIAVASHGVRVV 369
            + SA K++ +RIL  ++++  L+GFLVP+ ++ LLG  GS+   SPFVIA+  H ++V+
Sbjct: 297 ELPSAIKQVFWRILFFFLVSLTLVGFLVPYTNENLLG--GSSVDNSPFVIAIKLHNIKVL 354

Query: 370 PHFXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVSCVFG 429
           P                               QG  P +  Y+DR GRP+  ++++ +FG
Sbjct: 355 PSIVNAVILISILSVGNSCIFASSRTLCSMAHQGLIPWWFGYIDRAGRPLTGIVINSLFG 414

Query: 430 LLSFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYVAWT 489
           LL+F+  S     VF WL+AI+GL+    W SI++ H+R R AM  Q ++ DEL +V+  
Sbjct: 415 LLAFLVKSSSVSEVFDWLMAIAGLATCIVWLSINICHIRFRLAMKAQNKTIDELEFVSAV 474

Query: 490 GVWGAYYAMAMIVAILVGQFWVAISPVG---SNKLDANNFFENYL-AMPILIF-----LY 540
           GVWG+ Y+  +   IL+ QF+V++ P+G    +K  A  FF+NYL A+  LIF     LY
Sbjct: 475 GVWGSVYSAIINSLILIVQFYVSLWPIGGWTDSKDRAGKFFQNYLCAIVSLIFFICHKLY 534

Query: 541 LGYKIWTRDWRLLIPSSEVDLVAHRKIFDAEVLRHEQLEEKEQLRHAPWTTRLANFWC 598
             YK  T+ W  +IP  ++DL   RK  D ++++ E  E K+ L   PW  RL + WC
Sbjct: 535 FRYK--TKKWWEIIPLKDIDLDTGRKNIDIDIVKEEIKERKQYLATKPWYIRLMHHWC 590

>Suva_15.148 Chr15 (258987..260765) [1779 bp, 592 aa] {ON} YOL020W
           (REAL)
          Length = 592

 Score =  345 bits (886), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 190/566 (33%), Positives = 304/566 (53%), Gaps = 37/566 (6%)

Query: 40  LFRRFADSFRRHEAHNXXXXXXXXXXXXXLTPIESASKHKTLKQNIRPRHVLMISLATGI 99
           +F+R  DSF+                     P++ +     LK+ ++PRH++MI++   I
Sbjct: 57  IFQRCVDSFK--------------------PPLDGSFDTSNLKRTLKPRHLIMIAIGGSI 96

Query: 100 GTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYCVIQSASELAIIYTSLAGGFNAYPSLLV 159
           GTG+ VG+GK++  GGP  +V+G+ I  S +   I    E+ + +  + G F  Y +  +
Sbjct: 97  GTGLFVGSGKAIAEGGPLGVVLGWTIAGSQIIGTIHGLGEITVRF-PVVGAFANYGTRFL 155

Query: 160 DKAFGFSVSWVYCLQWLCVLPLELVTASMTIKYWNQTINPDAFVTIFYVVLVAINXXXXX 219
           D +  F VS +Y LQW  VLPLE++ A+MT++YWN +I+P  +V IFYV++V+IN     
Sbjct: 156 DPSISFVVSTIYVLQWFFVLPLEIIAAAMTVQYWNSSIDPVVWVAIFYVIIVSINLFGVR 215

Query: 220 XXXXXXXXXNCCKVLMXXXXXXXXXXXNCGGAGNDGYLGARYWHDPGAFRGSDSINRFKG 279
                    +  K +              GG  +  Y+GA+YW+DPG        N F G
Sbjct: 216 GFGEAEFAFSTIKAITVCGFIILCIVLIFGGGPDHEYVGAKYWYDPGCLA-----NGFPG 270

Query: 280 IVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRILGIYIMTAILLGFLVPW 339
           I++VLV A+++ GG E + L + E     K + SA K++ +RIL  ++++  L+GFLVP+
Sbjct: 271 ILSVLVVASYSLGGIEMTCLASGETD--PKGLPSAIKQVFWRILFFFLVSLTLVGFLVPY 328

Query: 340 NSDELLGSGGSATHASPFVIAVASHGVRVVPHFXXXXXXXXXXXXXXXXXXXXXXXXXXX 399
            +  LLG  GS+   SPFVIA+  H ++V+P                             
Sbjct: 329 TNQNLLG--GSSVDNSPFVIAIKLHHIKVLPSIVNVVILISVLSVGNSCIFASSRTLCSM 386

Query: 400 XEQGFAPRFLNYVDRCGRPVLCLLVSCVFGLLSFVAASPKEETVFTWLLAISGLSELFTW 459
             QG  P +  Y+DR GRP++ ++ + +FGLL+F+  S     VF WL+AI+GL+    W
Sbjct: 387 AHQGLIPWWFGYIDRAGRPLVGIMANSLFGLLAFLVKSGSMGDVFNWLMAIAGLATCIVW 446

Query: 460 FSISLSHVRLRRAMTVQGRSADELGYVAWTGVWGAYYAMAMIVAILVGQFWVAISPVG-- 517
            SI++SH+R R AM  QG+  DEL +V+  G+WG+ Y+  +   IL+ QF+ ++ P+G  
Sbjct: 447 LSINVSHIRFRMAMKAQGKKLDELEFVSAVGIWGSAYSALINCLILLAQFYCSLWPIGGW 506

Query: 518 SNKLD-ANNFFENYLAMPILIFLYLGYKIW----TRDWRLLIPSSEVDLVAHRKIFDAEV 572
            N  D A  FF+NYL   I++F+++ +KI+    T  W  +    ++DL   RK  D E+
Sbjct: 507 KNSSDRAKIFFQNYLCALIVLFIFIAHKIYYKCQTGQWWGIKALKDIDLETDRKNIDIEI 566

Query: 573 LRHEQLEEKEQLRHAPWTTRLANFWC 598
           ++ E  E+K  L   PW  R  ++WC
Sbjct: 567 VKQEIAEKKMYLDSCPWYVRHFHYWC 592

>TBLA0C01210 Chr3 complement(260786..262588) [1803 bp, 600 aa] {ON} 
          Length = 600

 Score =  346 bits (887), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 183/535 (34%), Positives = 302/535 (56%), Gaps = 17/535 (3%)

Query: 71  PIESASKHKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSML 130
           P + +     LK+ ++ RH++MI++   IGTG+ +G+G++L  GGP +++IG+AI  S +
Sbjct: 76  PEDGSFDTSNLKKTLKARHLIMIAIGGSIGTGLFIGSGQALATGGPLAVIIGWAIAGSQI 135

Query: 131 YCVIQSASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTI 190
              I    E+ + +  + G F  Y +  +D +  F VS +Y +QW  VLPLE+++++MT+
Sbjct: 136 IGTIHGLGEITVRF-PVVGAFANYSTRFLDPSISFVVSTIYVIQWFFVLPLEIISSAMTV 194

Query: 191 KYWNQTINPDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGG 250
           +YWN++I+P  +V IFYV +V+IN              +  KV+              GG
Sbjct: 195 QYWNESIDPVVWVAIFYVTIVSINLFGVRGFGEAEFIFSTIKVITISGFILLCIILIAGG 254

Query: 251 AGNDGYLGARYWHDPGAFRGSDSINRFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNPQKS 310
             +  Y+G+RYWH+PG        N F G+++V+V A+++ GG E + L + E     K 
Sbjct: 255 GPDHVYVGSRYWHNPGCLA-----NGFPGVLSVMVVASYSLGGTEMTCLASGETD--PKE 307

Query: 311 IRSASKKLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSATHASPFVIAVASHGVRVVP 370
           + SA K++ +RIL  ++++  L+GFLVP+ ++ LLG  GS+   SPFVIA+  H ++V+P
Sbjct: 308 LPSAIKQVFWRILFFFLVSLTLVGFLVPYTNENLLG--GSSVDNSPFVIAIKIHHIKVLP 365

Query: 371 HFXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVSCVFGL 430
                                          Q   P +  Y+DR GRP++ ++ + +FGL
Sbjct: 366 SIVNAVILISILSVGNSCIFASSRTLCSMAHQHLLPWWFGYIDRAGRPLVGIITNSLFGL 425

Query: 431 LSFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYVAWTG 490
           L+F+  S     VF WL+AI+GL+    W SI++SH+R R AM  QGRS +EL +V+  G
Sbjct: 426 LAFLVKSGSMSEVFDWLMAIAGLATCIVWLSINVSHIRFRLAMKAQGRSLNELEFVSAVG 485

Query: 491 VWGAYYAMAMIVAILVGQFWVAISPVG--SNKLD-ANNFFENYLAMPILIFLYLGYKI-- 545
           +WG+ Y+  +   ILV QF++++ P+G   N  D A  FF++YL   I++ +++G+KI  
Sbjct: 486 IWGSVYSAIINCLILVAQFYISLWPIGGWKNSEDRAKKFFQSYLCALIMVCIWIGHKIYY 545

Query: 546 WTRDWRL--LIPSSEVDLVAHRKIFDAEVLRHEQLEEKEQLRHAPWTTRLANFWC 598
           W +  ++    P +E+DL   RK  D +VL+ E  E K  L+  PW  R  ++WC
Sbjct: 546 WRQTGKIWAFTPLAEIDLDEGRKNIDLDVLKQEIHERKMYLKSRPWYIRFYHYWC 600

>Ecym_2716 Chr2 (1386630..1388408) [1779 bp, 592 aa] {ON} similar to
           Ashbya gossypii AEL030W
          Length = 592

 Score =  343 bits (880), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 191/573 (33%), Positives = 302/573 (52%), Gaps = 37/573 (6%)

Query: 33  SDSRSDGLFRRFADSFRRHEAHNXXXXXXXXXXXXXLTPIESASKHKTLKQNIRPRHVLM 92
           ++ R   + +R  DSF+                     P++ +     +K+ ++ RH++M
Sbjct: 50  TEERKRNVVQRVIDSFK--------------------PPVDGSFDPSNMKRALKSRHLIM 89

Query: 93  ISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYCVIQSASELAIIYTSLAGGFN 152
           I++ + IGTG+ VG+GK+L  GGP +L+IG+ +  + +   I    EL +    + G F 
Sbjct: 90  IAIGSSIGTGLFVGSGKALATGGPLALIIGWTLAGTQMIGTIHGLGELTV-RLPVVGAFA 148

Query: 153 AYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKYWNQTINPDAFVTIFYVVLVA 212
            Y +  +D +  F +S +Y +QW  VLPLE++ + +T+++W Q+++P  +V +FY ++V+
Sbjct: 149 DYSTRFLDPSVSFVISSIYVMQWFFVLPLEIIASCITMRFWTQSVDPIIWVALFYTMIVS 208

Query: 213 INXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGGAGNDGYLGARYWHDPGAFRGSD 272
           IN              +  KV+              GG     Y+G+RYWHDPG      
Sbjct: 209 INLLGVRGFGEAEFIFSSVKVITICGFIILCIVLILGGGPTHQYVGSRYWHDPGPLA--- 265

Query: 273 SINRFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRILGIYIMTAIL 332
             N FKG+ AV+V A+++ GG+E + L + E     K +  A K++ +RIL  ++++  L
Sbjct: 266 --NGFKGVAAVMVTASYSLGGSEMTCLASGETD--PKELPHAIKQIFWRILFFFLVSLTL 321

Query: 333 LGFLVPWNSDELLGSGGSATHASPFVIAVASHGVRVVPHFXXXXXXXXXXXXXXXXXXXX 392
           +GFLVP+ ++ LLG  GS+   SPFV+A+  H V+VVPH                     
Sbjct: 322 VGFLVPYTNENLLG--GSSAENSPFVLALYLHHVKVVPHIVNGVILVSILSVGNSCIFAS 379

Query: 393 XXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVSCVFGLLSFVAASPKEETVFTWLLAISG 452
                    QG  P    YVDR GRP++ +L + +FGLL+F+        VF+WL+AI+G
Sbjct: 380 SRTLCSMAHQGLIPHIFGYVDRGGRPLVGILANSIFGLLAFLVKFSSISNVFSWLMAIAG 439

Query: 453 LSELFTWFSISLSHVRLRRAMTVQGRSADELGYVAWTGVWGAYYAMAMIVAILVGQFWVA 512
           L+    W SI++SHVR R AM  Q +S DEL +V+  GVWG+ YA  +    LV QF++A
Sbjct: 440 LATCVVWLSINVSHVRFRLAMKAQNKSLDELQFVSSVGVWGSVYAGVLNFLTLVAQFYIA 499

Query: 513 ISPV---GSNKLDANNFFENYLAMPILIFLYLGYKIWTR----DWRLLIPSSEVDLVAHR 565
           + PV     +K  A  FF+NYL   ILI ++  +K + R     W  +   SEVDL   R
Sbjct: 500 LWPVEGWKDSKSRAEAFFKNYLCALILIAMFAAHKCYFRITTGKWWGIKKLSEVDLDTGR 559

Query: 566 KIFDAEVLRHEQLEEKEQLRHAPWTTRLANFWC 598
              D E+++ E  E K+ LR+  W TR   +WC
Sbjct: 560 VNIDIEIIKEEVAERKKFLRNKAWYTRYYYYWC 592

>SAKL0D04048g Chr4 (328883..330643) [1761 bp, 586 aa] {ON} similar
           to uniprot|Q7LGU1 Saccharomyces cerevisiae YPL274W SAM3
           High-affinity S-adenosylmethionine permease, required
           for utilization of S-adenosylmethionine as a sulfur
           source; has similarity to S-methylmethionine permease
           Mmp1p
          Length = 586

 Score =  342 bits (878), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 198/568 (34%), Positives = 303/568 (53%), Gaps = 27/568 (4%)

Query: 42  RRFADSFRRHEAHNXXXXXXXXXXXXXLTPIESASK------HKTLKQNIRPRHVLMISL 95
           +RF DSF++HE                L+ +E   +      H+  K+ +  RH+ MIS+
Sbjct: 35  KRFRDSFKKHEP--------ILPENVDLSQMEDYERTNYLLAHQPYKRTLSQRHLTMISI 86

Query: 96  ATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYCVIQSASELAIIYTSLAGGFNAYP 155
              +GTG+ +G G SL   GP +L+IG+ I+   ++CV+Q A+EL+  Y  ++G F  + 
Sbjct: 87  GGTLGTGLFIGLGYSL-TSGPGNLLIGFTIIGISIFCVVQCAAELSCQY-PVSGSFATHV 144

Query: 156 SLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKYWNQTINPDAFVTIFYVVLVAINX 215
           S  +D + GF+VS  Y L WL   P EL+  ++T++YWN ++NP  ++ IFYV ++ +N 
Sbjct: 145 SRFIDSSVGFTVSTNYALAWLISFPSELIGCAITLRYWNDSVNPAVWIAIFYVFIMCLNL 204

Query: 216 XXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGGAGN-DGYLGARYWHDPGAFRGSDSI 274
                        +  K+              CGG  + +GY+GA+YWHDPGAF      
Sbjct: 205 FGVRGFAETEFWLSLIKIAAIVIFIIIGIVLICGGGPHSNGYIGAKYWHDPGAFVKP--- 261

Query: 275 NRFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRILGIYIMTAILLG 334
             FKG+    V+AAF++GGAE  VLTA E +  + SI  A+K   +RI   YI T +++G
Sbjct: 262 -VFKGLCNTFVSAAFSFGGAELVVLTANESRKIE-SISRAAKGTFWRIAVFYITTVVIIG 319

Query: 335 FLVPWNSDELLGSGGSA-THASPFVIAVASHGV--RVVPHFXXXXXXXXXXXXXXXXXXX 391
            LVP   + LLG+       ASPFVIA+++ G     V HF                   
Sbjct: 320 CLVPSTDERLLGAASDVDVTASPFVIALSNTGSFGDKVSHFMNAVILIAVLSVCNSCVYA 379

Query: 392 XXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVSCVFGLLSFVAASPKEETVFTWLLAIS 451
                         P F  Y+DR GRP++ + +  VFGLL F+ AS KE  VFTWL A+ 
Sbjct: 380 ASRVIQSLGASRQLPSFCGYIDRKGRPLVGIGICGVFGLLGFLVASSKEGEVFTWLFALC 439

Query: 452 GLSELFTWFSISLSHVRLRRAMTVQGRSADELGYVAWTGVWGAYYAMAMIVAILVGQFWV 511
            +S  FTWF I  S VR R A+  QGRS+DE+ Y +  G WG      + + ++ G+ +V
Sbjct: 440 SISSFFTWFCICFSQVRFRLALRAQGRSSDEIAYKSMLGFWGGVLGCVLNILLIAGEIYV 499

Query: 512 AISPVGSNKLDANNFFENYLAMPILIFLYLGYKIWTRDWR-LLIPSSEVDLVAHRKIFDA 570
           ++ P+G +  +A  FF+  L++PI+IF+Y  ++I+  +W   +I + ++DL   RK  D 
Sbjct: 500 SLFPLGGSP-NAEGFFQYCLSIPIMIFVYFCHRIYRNNWTDWIISTKKIDLDTGRKAEDL 558

Query: 571 EVLRHEQLEEKEQLRHAPWTTRLANFWC 598
           E+++HE L EK ++   P   R+  FWC
Sbjct: 559 ELMKHEILTEKARIASKPLYYRIYRFWC 586

>KLTH0H13398g Chr8 complement(1169665..1171428) [1764 bp, 587 aa]
           {ON} similar to uniprot|P38967 Saccharomyces cerevisiae
           YOL020W TAT2 Tryptophan permease high affinity
          Length = 587

 Score =  336 bits (862), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 184/535 (34%), Positives = 292/535 (54%), Gaps = 17/535 (3%)

Query: 71  PIESASKHKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSML 130
           P++ +     LK++++ RH++MI++   IGTG+ +G+GK+L  GGP +L+IG+ +  + +
Sbjct: 63  PLDGSFHSDNLKKSLKARHLIMIAIGGSIGTGLFIGSGKALAVGGPLALIIGWTVAGTQM 122

Query: 131 YCVIQSASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTI 190
              I    E+ + +  + G F  Y +  ++ +  F V  +Y LQW  VLPLE++ A+MT+
Sbjct: 123 VGTIHGLGEITVRF-PVVGAFADYGTRFLEPSISFVVVLIYVLQWCFVLPLEIIAAAMTV 181

Query: 191 KYWNQTINPDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGG 250
           +YW  ++ P A+V IFY  +  +N              +  KVL             CGG
Sbjct: 182 EYWGSSVPPVAWVAIFYAFIALVNLLGVRGFGEAEFIFSLIKVLTIIGFIILCVVLICGG 241

Query: 251 AGNDGYLGARYWHDPGAFRGSDSINRFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNPQKS 310
                ++GA+YW DPG        N FKG+ AV V A+++ GG E + L + E     K 
Sbjct: 242 GPKHEFVGAKYWSDPGPLA-----NGFKGVAAVFVIASYSLGGTEMACLASGETD--PKE 294

Query: 311 IRSASKKLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSATHASPFVIAVASHGVRVVP 370
           + SA K++ +RI+  ++++  L+GFLVP+ ++ L+G  GS+   SPFVIA+  HG++ +P
Sbjct: 295 LPSAIKQVFWRIVFFFLVSLTLVGFLVPYTNENLMG--GSSVDNSPFVIAIRLHGIKALP 352

Query: 371 HFXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVSCVFGL 430
                                          QG  PR   Y+DR GRP++ +L +  FGL
Sbjct: 353 SVVNAVILVSLLSVGNSCIFASSRTLCSMAHQGLIPRIFGYIDRAGRPLVGILTNLAFGL 412

Query: 431 LSFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYVAWTG 490
           L+F+  S   + VFTWL+AI+GL+    W SI++SH+R R AM  QG S DEL +V+  G
Sbjct: 413 LAFLVKSSSSDDVFTWLMAIAGLATCVVWLSINVSHIRFRMAMKAQGVSLDELEFVSAVG 472

Query: 491 VWGAYYAMAMIVAILVGQFWVAISPVG---SNKLDANNFFENYLAMPILIFLYLGYKIWT 547
           V+G+ Y+  + V ILV QF+V++ PVG   S      NFF+NYL   IL+ L+ G+KI+ 
Sbjct: 473 VYGSVYSATINVLILVAQFYVSLWPVGGWSSPSTRTENFFQNYLCSLILLLLFAGHKIYY 532

Query: 548 R----DWRLLIPSSEVDLVAHRKIFDAEVLRHEQLEEKEQLRHAPWTTRLANFWC 598
           R     W       ++DL+   ++ D E+ +HE  E++ +L   P   RL + WC
Sbjct: 533 RISTGKWWGFKALRDIDLLTDMRVTDTELSKHELHEKRVKLAQKPLIVRLYHQWC 587

>YPL274W Chr16 (22938..24701) [1764 bp, 587 aa] {ON}
           SAM3High-affinity S-adenosylmethionine permease,
           required for utilization of S-adenosylmethionine as a
           sulfur source; has similarity to S-methylmethionine
           permease Mmp1p
          Length = 587

 Score =  335 bits (859), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 199/589 (33%), Positives = 307/589 (52%), Gaps = 20/589 (3%)

Query: 18  ESFDSVEVLKEESPRSDSRSDGLFRRFADSFRRHEAH---NXXXXXXXXXXXXXLTPIES 74
           + F  +E      P    RS  L RR  DSF++   H                    + S
Sbjct: 11  DKFTKIETESTTIPNDSDRSGSLIRRMKDSFKQSNLHVIPEDLENSEQTEQEKIQWKLAS 70

Query: 75  ASKHKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYCVI 134
               K L Q    RH+ MI++   +GTG+ +G G SL +G PA+L+IG+ +V + ++CV+
Sbjct: 71  QPYQKVLSQ----RHLTMIAIGGTLGTGLFIGLGYSLASG-PAALLIGFLLVGTSMFCVV 125

Query: 135 QSASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKYWN 194
           QSA+EL+  +  ++G +  + S  +D++ GF+V+  Y L WL   P EL+  ++TI YWN
Sbjct: 126 QSAAELSCQFP-VSGSYATHVSRFIDESVGFTVATNYALAWLISFPSELIGCALTISYWN 184

Query: 195 QTINPDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGGAGND 254
           QT+NP  +V IFYV ++ +N              +  KV+              GG  N 
Sbjct: 185 QTVNPAVWVAIFYVFIMVLNLFGVRGFAETEFALSIIKVIAIFIFIIIGIVLIAGGGPNS 244

Query: 255 -GYLGARYWHDPGAFRGSDSINRFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRS 313
            GY+GA+YWHDPGAF    +   FK +    V+AAF++GG+E  +LT+ E +N   +I  
Sbjct: 245 TGYIGAKYWHDPGAF----AKPVFKNLCNTFVSAAFSFGGSELVLLTSTESKNIS-AISR 299

Query: 314 ASKKLVYRILGIYIMTAILLGFLVPWNSDELL-GSGGSATHASPFVIAVASHGVR--VVP 370
           A+K   +RI   YI T +++G LVP+N   LL GS      ASPFVIA+++ G     V 
Sbjct: 300 AAKGTFWRIAIFYITTVVIIGCLVPYNDPRLLSGSNSEDVSASPFVIALSNTGSMGAKVS 359

Query: 371 HFXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVSCVFGL 430
           +F                              G  P   +Y+DR GRP++ + +S  FGL
Sbjct: 360 NFMNVVILVAVVSVCNSCVYASSRLIQALGASGQLPSVCSYMDRKGRPLVGIGISGAFGL 419

Query: 431 LSFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYVAWTG 490
           L F+ AS KE+ VFTWL A+  +S  FTWF I +S +R R A+  QGRS DE+ Y +  G
Sbjct: 420 LGFLVASKKEDEVFTWLFALCSISSFFTWFCICMSQIRFRMALKAQGRSNDEIAYKSILG 479

Query: 491 VWGAYYAMAMIVAILVGQFWVAISPVGSNKLDANNFFENYLAMPILIFLYLGYKIWTRDW 550
           V+G      +   ++ G+ +V+ +PVGS    A  FFE  L++PI+I +Y  ++ + RDW
Sbjct: 480 VYGGILGCVLNALLIAGEIYVSAAPVGSPS-SAEAFFEYCLSIPIMIVVYFAHRFYRRDW 538

Query: 551 R-LLIPSSEVDLVAHRKIFDAEVLRHEQLEEKEQLRHAPWTTRLANFWC 598
           +   I  SE+DL     + + E+ + ++  E++ +   P+  ++  FWC
Sbjct: 539 KHFYIKRSEIDLDTGCSVENLELFKAQKEAEEQLIASKPFYYKIYRFWC 587

>KLLA0B06776g Chr2 (594172..595938) [1767 bp, 588 aa] {ON} similar
           to uniprot|Q7LGU1 Saccharomyces cerevisiae YPL274W SAM3
           High-affinity S-adenosylmethionine permease, required
           for utilization of S-adenosylmethionine as a sulfur
           source; has similarity to S-methylmethionine permease
           Mmp1p
          Length = 588

 Score =  334 bits (857), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 203/603 (33%), Positives = 313/603 (51%), Gaps = 20/603 (3%)

Query: 1   MKDFELHNMKSPDNGVVESFDSVEVLKEESPRSDSRSDGLFRRFADSFRRHEAHNXXXXX 60
           M D      K P   V E+F       E+  RS      LF R  DSF+R E        
Sbjct: 1   MTDLAKDLAKDPTQ-VSENFTQSLYTDEDGSRS------LFTRVKDSFKRQELVETEGID 53

Query: 61  XXXXXXXXLTPIESASKHKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLV 120
                             +  ++N+  RH+ MI++   +GTG+ +G G SL +G P +L+
Sbjct: 54  LDTYSMTDYQRTNYLLAKQPYQKNLSQRHLTMIAIGGTLGTGLFIGIGWSLASG-PGNLL 112

Query: 121 IGYAIVSSMLYCVIQSASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLP 180
           IG+ +    ++CV+Q A+EL+  Y  ++G F ++ S  VD ++GF+V+  YCL W    P
Sbjct: 113 IGFLLTGLAIFCVVQCAAELSCQY-PVSGSFASHVSRFVDPSWGFTVTTNYCLAWSISFP 171

Query: 181 LELVTASMTIKYWNQTINPDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXX 240
            EL+  +MTI YW+ ++NP  +V IF++ ++A+N              +  K+L      
Sbjct: 172 SELIGCAMTIGYWDSSVNPVVWVIIFWLFIMALNLFGVRGFAETEYVLSIFKILAIIIFL 231

Query: 241 XXXXXXNCGGAGN-DGYLGARYWHDPGAFRGSDSINRFKGIVAVLVNAAFAYGGAEFSVL 299
                  CGG  N +GY+G +YWHDPG+F+       FK +    V+AAF++GG E  VL
Sbjct: 232 IIGVVLICGGGPNSNGYIGTKYWHDPGSFKAP----VFKSLCNTFVSAAFSFGGTELVVL 287

Query: 300 TAAEQQNPQKSIRSASKKLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSA-THASPFV 358
           TAAE +  + SI  A+K   +R++  Y+ T +++G LVP+  + LLG   S    ASPFV
Sbjct: 288 TAAESRKVE-SISRAAKGTFWRVIVFYVSTVVVIGCLVPYTDERLLGGDTSEDIAASPFV 346

Query: 359 IAVASHGV--RVVPHFXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCG 416
           IA+A+ G     V +F                              G  P    YVDR G
Sbjct: 347 IALANTGKFGERVSNFMNAVILIAVLSVCNSCVYAASRVIQSLGASGQLPSICGYVDRKG 406

Query: 417 RPVLCLLVSCVFGLLSFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQ 476
           RP+  +LV  +FG L F+ AS K   VF WL A+  +S +F WFSI  S++R R A+  Q
Sbjct: 407 RPLFGILVVGLFGFLPFIVASNKVSEVFDWLFALCSISSMFIWFSICYSYLRYRWALKKQ 466

Query: 477 GRSADELGYVAWTGVWGAYYAMAMIVAILVGQFWVAISPVGSNKLDANNFFENYLAMPIL 536
            RSADE+ Y +  G+WGAY  + +   ++VG+ +V++ P+G +   A  FF+  L++PI+
Sbjct: 467 NRSADEIAYKSMLGIWGAYLGLLLSALLIVGEIYVSLFPLGESP-SAEAFFKYCLSIPIM 525

Query: 537 IFLYLGYKIWTRDWR-LLIPSSEVDLVAHRKIFDAEVLRHEQLEEKEQLRHAPWTTRLAN 595
           I +Y+G+K +T +W+  +IP S +DL       D E+++HE   ++ +L   P   R+  
Sbjct: 526 IAVYIGHKSYTGNWKSFVIPLSGIDLDTGLSHSDVEIMKHELEIQRVKLASKPLYYRIFR 585

Query: 596 FWC 598
           FWC
Sbjct: 586 FWC 588

>TPHA0G03770 Chr7 complement(797508..799322) [1815 bp, 604 aa] {ON} 
          Length = 604

 Score =  328 bits (842), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 196/583 (33%), Positives = 308/583 (52%), Gaps = 17/583 (2%)

Query: 24  EVLKEESPRSDSR--SDG-LFRRFADSFRRHEAHNXXXXXXXXXXXXXLTPIESASKHKT 80
           E   EES  S +R  S+G  F RF DSF R +                   I+     + 
Sbjct: 31  EAFTEESSASYTRNYSEGTFFERFKDSFTRVDNIEPYSELDGDKYTKD-EQIQMTLAAQP 89

Query: 81  LKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYCVIQSASEL 140
            K+++  RH+ MI++   +GTG+ +G G SL +G PASL+IG+ IV + ++CV+QSA+EL
Sbjct: 90  YKKSLHQRHLTMIAIGGTLGTGLFIGLGYSLASG-PASLLIGFLIVGTSMFCVVQSAAEL 148

Query: 141 AIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKYWNQTINPD 200
           +  Y  ++G +  + S  +D++ GF+VS  Y L WL   P EL+  SMTI YWN +INP 
Sbjct: 149 SCQYP-VSGSYATHVSRFLDESLGFTVSTNYALAWLISFPSELIGISMTISYWNDSINPC 207

Query: 201 AFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGGA-GNDGYLGA 259
            ++ IFYV ++ +N              +  KV+             CGG   + GY+G 
Sbjct: 208 VWIAIFYVFIMILNLFGVKGFAETEFWLSLIKVIAIIIFIIVGIVLICGGGPESSGYIGT 267

Query: 260 RYWHDPGAFRGSDSINRFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLV 319
           +YWHDPG+F    +   FKG+    V+AAF++GG+E  +LTAAE +N   +I  A+K   
Sbjct: 268 KYWHDPGSF----APPVFKGLCNTFVSAAFSFGGSELVLLTAAESKNIS-AISRAAKGTF 322

Query: 320 YRILGIYIMTAILLGFLVPWNSDELLGSGGSA-THASPFVIAVASHGV--RVVPHFXXXX 376
           +RI   YI T +++G LVP+N   LLG        ASPFV+A+ S     R + +F    
Sbjct: 323 WRIAVFYIATVVIIGCLVPYNDRRLLGGASDEDVSASPFVLALGSSTDLGRKLSNFMNFV 382

Query: 377 XXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVSCVFGLLSFVAA 436
                                     G  P    Y+D+ GRP++ + +  VFGLL F+ A
Sbjct: 383 ILIAVVSVANSCVYASSRVIQALGSSGQLPSICGYIDKSGRPLVGIAICGVFGLLGFLVA 442

Query: 437 SPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYVAWTGVWGAYY 496
           S  E TVFTWL A+  +S  FTWF I  S VR R A+  Q RS D++ + +  G++G   
Sbjct: 443 SSNERTVFTWLFALCSISSFFTWFCICFSQVRFRLALKKQNRSTDDIAFKSMLGIYGGIL 502

Query: 497 AMAMIVAILVGQFWVAISPVGSNKLDANNFFENYLAMPILIFLYLGYKIWTRDWRLLIPS 556
              + + +++G+ +V+ SP+G     A  FFEN L++P+++ +++ ++ + ++WR    S
Sbjct: 503 GSILNILLIMGEIYVSASPLGEPS-SAEAFFENCLSIPLMLLVFIAHRFYRKNWRDWYKS 561

Query: 557 -SEVDLVAHRKIFDAEVLRHEQLEEKEQLRHAPWTTRLANFWC 598
             E+DL       D E+ +H++ + K +++  P   ++  FWC
Sbjct: 562 LDEIDLDTGCSYDDIELFKHQREQIKHKIQSKPLYYKIYRFWC 604

>TDEL0B00130 Chr2 (20136..21890) [1755 bp, 584 aa] {ON} 
          Length = 584

 Score =  328 bits (840), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 194/584 (33%), Positives = 301/584 (51%), Gaps = 14/584 (2%)

Query: 20  FDSVEVLKEESPRSDSRSDGLFRRFADSFRRHEAHNXXXXXXXXXXXXXLTPIESASKHK 79
           F   E L      + S S+ L  R  +SF+RHE                   I+     +
Sbjct: 10  FAKTEALSSSVSLNTSESNSLMGRIKNSFKRHEL-TLISEDQEINDVPEQERIQRRLASQ 68

Query: 80  TLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYCVIQSASE 139
             ++ +  RH+ MI++   +GTG+ +G G SL +G P +L+IG+ +V + ++CV+QSA+E
Sbjct: 69  PYQKVLDQRHLTMIAIGGTLGTGLFIGLGYSLASG-PGALLIGFLLVGTSMFCVVQSAAE 127

Query: 140 LAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKYWNQTINP 199
           L+  Y  ++G +  + S  VD++ GF+VS  Y L WL   P EL+  S+TI YWNQ++NP
Sbjct: 128 LSCQYP-VSGSYATHVSRFVDESVGFTVSTNYALAWLISFPSELIGCSITITYWNQSVNP 186

Query: 200 DAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGGA-GNDGYLG 258
             +V IFY+ ++ +N              +  KVL              GG   + GY+G
Sbjct: 187 AVWVAIFYIFIMGLNLFGVRGFAETEFFLSIIKVLAIIIFIIIGIVLIAGGGPDSSGYIG 246

Query: 259 ARYWHDPGAFRGSDSINRFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKL 318
            +YWH PG+F    +   FK +    V+AAF++GG+E  +LT+ E +N   SI  A+K  
Sbjct: 247 TKYWHQPGSF----AQPVFKNLCNTFVSAAFSFGGSELVLLTSTEARNV-SSIARAAKGT 301

Query: 319 VYRILGIYIMTAILLGFLVPWNSDELL-GSGGSATHASPFVIAVASHGVR--VVPHFXXX 375
            +RI   YI T +++G LVP+  + LL GS      ASPFVIA+++ G     V +F   
Sbjct: 302 FWRIAVFYITTVVIIGCLVPYTDERLLNGSSSEDVSASPFVIALSNSGSMGGKVANFMNV 361

Query: 376 XXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVSCVFGLLSFVA 435
                                      G  P+  +++D+ GRP++ + +S VFGLL F+ 
Sbjct: 362 IILIAVLSVCNSCVYASSRIIQALGAAGQLPKACSFIDKKGRPLVGIAISGVFGLLGFLV 421

Query: 436 ASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYVAWTGVWGAY 495
           A  KE  VFTWL A+  +S  FTWF I LS VR R A+  QGR   ++ Y +  GV+G  
Sbjct: 422 ACDKEGEVFTWLFALCSISSFFTWFCICLSQVRFRMALRAQGRPKSDIAYKSMLGVYGGI 481

Query: 496 YAMAMIVAILVGQFWVAISPVGSNKLDANNFFENYLAMPILIFLYLGYKIWTRDW-RLLI 554
               +   ++ G+ +VA SPVG     A  FFE  L++PI+I +Y G++ +  DW    I
Sbjct: 482 VGCVLNFLLIAGEIYVASSPVGGES-SARGFFEYCLSIPIMIVVYFGHRFYRNDWGNWYI 540

Query: 555 PSSEVDLVAHRKIFDAEVLRHEQLEEKEQLRHAPWTTRLANFWC 598
               +DL     I + E+ R ++ +E+E++   P+  R+  FWC
Sbjct: 541 KRRNIDLDTGCSIENVELFRQQREQEQEKISSRPFYYRIYRFWC 584

>Smik_6.483 Chr6 (798526..800298) [1773 bp, 590 aa] {ON} YPL274W
           (REAL)
          Length = 590

 Score =  325 bits (833), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 202/593 (34%), Positives = 309/593 (52%), Gaps = 25/593 (4%)

Query: 18  ESFDSVEVLKEESP----RSDSRSDGLFRRFADSFRRHEAH---NXXXXXXXXXXXXXLT 70
           + F  +E      P    RSD +S+ L RR  DSF++   H                   
Sbjct: 11  DKFTKIETESTMIPTGLERSD-KSESLIRRMKDSFKQSNLHVIPEDLENSEQTEQEKIQW 69

Query: 71  PIESASKHKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSML 130
            + S    K L Q    RH+ MI++   +GTG+ +G G SL +G PA+L+IG+ IV + +
Sbjct: 70  KLASQPYQKVLSQ----RHLTMIAIGGTLGTGLFIGLGYSLASG-PAALLIGFLIVGTSM 124

Query: 131 YCVIQSASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTI 190
           +CV+QSA+EL+  +  ++G +  + S  +D++ GF+V+  Y L WL   P EL+  S+TI
Sbjct: 125 FCVVQSAAELSCQF-PVSGSYATHVSRFIDESVGFTVATNYALAWLISFPSELIGCSLTI 183

Query: 191 KYWNQTINPDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGG 250
            YWNQT+NP  +V IFY  ++ +N              +  KV+              GG
Sbjct: 184 SYWNQTVNPAVWVAIFYTFIMVLNLFGVKGFAETEFALSIIKVVAIIIFIIIGIVLIAGG 243

Query: 251 AGND-GYLGARYWHDPGAFRGSDSINRFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNPQK 309
             N  GY+G +YWH+PGAF    +   FK +    V+AAF++GG+E  +LT+ E ++   
Sbjct: 244 GPNSTGYIGTKYWHNPGAF----AKPVFKNLCNTFVSAAFSFGGSELVLLTSTESKDIS- 298

Query: 310 SIRSASKKLVYRILGIYIMTAILLGFLVPWNSDELL-GSGGSATHASPFVIAVASHGVR- 367
           +I  A+K   +RI   YI T +++G LVP+N   LL GS      ASPFVIA+ + G   
Sbjct: 299 AISRAAKGTFWRIAIFYITTVVIIGCLVPYNDSRLLSGSTSEDISASPFVIALRNTGSMG 358

Query: 368 -VVPHFXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVSC 426
             V +F                              G  P   +Y+DR GRP++ + +S 
Sbjct: 359 AKVSNFMNVVILVAVVSVCNSCVYASSRLIQALGASGQLPSVCSYMDRKGRPLVGIGISG 418

Query: 427 VFGLLSFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYV 486
            FGLL F+ AS KE+ VFTWL A+  +S  FTWF I LS VR R A+  QGRS DE+ Y 
Sbjct: 419 AFGLLGFLVASNKEDEVFTWLFALCSISSFFTWFCICLSQVRFRMALKTQGRSKDEIAYK 478

Query: 487 AWTGVWGAYYAMAMIVAILVGQFWVAISPVGSNKLDANNFFENYLAMPILIFLYLGYKIW 546
           +  GV+G      +   ++ G+ +V+ +PVGS    A  FFE  L++PI+I +Y+ ++I+
Sbjct: 479 SILGVYGGVLGCVLNALLIAGEVYVSAAPVGSPS-SAKAFFEYCLSIPIMIVVYIAHRIY 537

Query: 547 TRDWRL-LIPSSEVDLVAHRKIFDAEVLRHEQLEEKEQLRHAPWTTRLANFWC 598
            +D R   I  SE+DL     + + E+ + ++  EK+ +   P+  ++  FWC
Sbjct: 538 RKDRRRWYIKRSEIDLDTGCSVENLELFKAQKEAEKQLIASKPFYYKIYRFWC 590

>Kwal_56.22951 s56 complement(345097..346887) [1791 bp, 596 aa] {ON}
           YPL274W (SAM3) - High affinity S-adenosylMethionine
           Permease [contig 184] FULL
          Length = 596

 Score =  321 bits (823), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 198/575 (34%), Positives = 309/575 (53%), Gaps = 19/575 (3%)

Query: 32  RSDSRSDGLFRRFADSFRRHEAHNXXXXXXXXXXXXXLTPIESASKHKTLKQNIRPRHVL 91
           R   +S       A SF+R EA N                 E A  ++  ++++  RH++
Sbjct: 33  RFKQKSRRQIHDIAHSFQRQEAPNSEGVDLSLLSEEQRRNYELA--NQPYEKSLSQRHLM 90

Query: 92  MISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYCVIQSASELAIIYTSLAGGF 151
           MIS+   +GTG+ +G G SL +G P SL+IG+ IV  M++CV+QSA+E+A  Y  ++G F
Sbjct: 91  MISIGGTLGTGLFIGLGFSLASG-PGSLLIGFLIVGLMMFCVVQSAAEMACQYP-VSGSF 148

Query: 152 NAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKYWNQTINPDAFVTIFYVVLV 211
           + + S  ++ + GF+VS  Y L WL   P EL+  ++T++YW+ ++N   +V IFYV ++
Sbjct: 149 STHVSRFMEPSIGFTVSTNYALAWLISFPSELIGCAITLRYWS-SVNGAVWVAIFYVFIM 207

Query: 212 AINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGGAGND-GYLGARYWHDPGAFRG 270
            +N              +  KV+             CGG  +  GY+G +YWH+PG+F  
Sbjct: 208 QLNLFGVRGYGEAEFWMSLFKVVAIVIFIIIGIVLICGGGPHSSGYIGTKYWHNPGSF-- 265

Query: 271 SDSINRFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRILGIYIMTA 330
             +   FKG+    ++AAF++GGAE  VLTA+E +  + S+  A+K   +RI   YI T 
Sbjct: 266 --AKPVFKGLCNTFISAAFSFGGAELVVLTASESKKVE-SVSRAAKGTFWRIAIFYITTV 322

Query: 331 ILLGFLVPWNSDELLGSG-GSATHASPFVIAVASHGV--RVVPHFXXXXXXXXXXXXXXX 387
           +++G LVP+  D LLG   G    ASPFVIA++  G     V HF               
Sbjct: 323 VVIGCLVPYTDDRLLGGDTGEDITASPFVIALSGQGSMGTKVSHFMNAVILIAVLSVCNS 382

Query: 388 XXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVSCVFGLLSFVAASPKEETVFTWL 447
                          G  PR   Y+D+ GRP++ + +  VFGLL F+ A  K++ VFTWL
Sbjct: 383 CVYASSRVIQALGACGQLPRACGYIDKKGRPLVGIAICGVFGLLGFLVACDKQDDVFTWL 442

Query: 448 LAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYVAWTGVWGAYYAMAMIVAILVG 507
            A+  +S  FTWF I +S VR R A+  QGRS DE+ + +  G++G      + + ++ G
Sbjct: 443 FALCSISSFFTWFCICVSQVRFRLALRAQGRSTDEIAHKSMLGIYGGILGGVLNILLIAG 502

Query: 508 QFWVAISPVGSNKLDANNFFENYLAMPILIFLYL---GYKIWTRDW-RLLIPSSEVDLVA 563
           + +V+I P+G +   A  FF+  +++PI+I +Y     YK   RD  R+L+P SE+DL +
Sbjct: 503 EIYVSIFPLGGSP-SAEQFFQYCMSIPIMIVVYALHKTYKATRRDAKRILVPLSEIDLDS 561

Query: 564 HRKIFDAEVLRHEQLEEKEQLRHAPWTTRLANFWC 598
            R+I D E+ +HE  E+K ++   P   R+  FWC
Sbjct: 562 GRRIQDIELFKHELEEDKARIAAKPLYYRIYRFWC 596

>KAFR0F04410 Chr6 (865219..866961) [1743 bp, 580 aa] {ON} 
          Length = 580

 Score =  319 bits (817), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 185/592 (31%), Positives = 312/592 (52%), Gaps = 30/592 (5%)

Query: 23  VEVLKEESPRSDS--------RSDGLFRRFADSFRRHEAHNXXXXXXXXXXXXXLTPIES 74
           V+  +  S R+DS        +   L R F +SF+R +                   ++ 
Sbjct: 3   VDTKENSSLRNDSVSTSISSIKDTSLLRNFKNSFKRVDQDQNKFDDEK------YNSVDE 56

Query: 75  ASKH---KTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLY 131
             K    + L++ ++ RH+ MI++   +GTG+ +G G+SL +G P SL+IGY IV   ++
Sbjct: 57  GQKRLVDQPLRKTLQQRHLTMIAIGGTLGTGLFIGLGESLASG-PGSLLIGYIIVGIAVF 115

Query: 132 CVIQSASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIK 191
           CV+QSA+EL+  Y  ++G +    +  ++++FGF+V+  YCL WL   P ELV ++M I+
Sbjct: 116 CVVQSAAELSCQY-PVSGSYATLVTRFMNESFGFTVATNYCLAWLVCFPSELVGSAMVIR 174

Query: 192 YWNQTINPDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGGA 251
           YWN ++N   ++ IF+V ++ +N              +  K++             CGG 
Sbjct: 175 YWNDSVNSCVWIAIFWVFVMCLNLFGVEGYAETEFWLSIIKIIAIIIFIIIGIVLICGGG 234

Query: 252 GND-GYLGARYWHDPGAFRGSDSINRFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNPQKS 310
            N  GY+G +YWHDPG+F        FK +    V+AA+++GG E  VLT+AE +    S
Sbjct: 235 PNSTGYIGTKYWHDPGSFAHP----VFKSLCNTFVSAAYSFGGCEIVVLTSAESRKIS-S 289

Query: 311 IRSASKKLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSA-THASPFVIAVASHGV--R 367
           I  A+K   +RI   Y++T +++G LVP+  ++L+ +  S    ASPFVIA+++ G    
Sbjct: 290 IARAAKGTFWRITIFYLVTIVIIGCLVPYTDNKLISATSSEDVTASPFVIALSNCGAMGT 349

Query: 368 VVPHFXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVSCV 427
            V HF                                 P    Y+DR GRP++ + +  +
Sbjct: 350 RVSHFMNTVILVSTISVSNSCVYASSRIIQALGAMNQLPSICGYIDRRGRPLVGIAICGL 409

Query: 428 FGLLSFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYVA 487
           FGLL F+ A+  E  +FTWL +++ ++   TWFSI    VR R A+  QGRS DE+ Y +
Sbjct: 410 FGLLGFLVAAENEAAIFTWLYSLTSVAYFVTWFSICWCQVRFRMALKRQGRSNDEIAYKS 469

Query: 488 WTGVWGAYYAMAMIVAILVGQFWVAISPVGSNKLDANNFFENYLAMPILIFLYLGYKIWT 547
             G++G Y    + + +++G+ +++I P+  +   AN FF+N L++PI++  + G+KI+ 
Sbjct: 470 MLGIYGGYVGAILNIVLIIGEVYISIFPLNESP-SANIFFQNCLSIPIMLVSFFGHKIYC 528

Query: 548 RDWR-LLIPSSEVDLVAHRKIFDAEVLRHEQLEEKEQLRHAPWTTRLANFWC 598
           + W+   + + ++DL     I D E+ + E  EEKE++  +P   R+  FWC
Sbjct: 529 KGWKDWFVRAKDIDLDTGNSITDFEIFKAEIEEEKERIASSPLYYRIYRFWC 580

>KAFR0B00220 Chr2 complement(52244..54001) [1758 bp, 585 aa] {ON} 
          Length = 585

 Score =  318 bits (815), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 188/580 (32%), Positives = 305/580 (52%), Gaps = 15/580 (2%)

Query: 24  EVLKEESPRSDSRSDGLFRRFADSFRRHEAHNXXXXXXXXXXXXXLTPIESASKHKTLKQ 83
           + +K  S  S S       RF DSF+R +                   +  A   + LK+
Sbjct: 16  DSVKTGSEFSSSEKGTFLYRFRDSFKRVDLDATIDEDDSKYTAEEKVQLRLA--KQPLKK 73

Query: 84  NIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYCVIQSASELAII 143
            +  RH+ MI++   +GTG+ +G G SL +G P  L+IG+ +V   ++CV+QSA+EL+  
Sbjct: 74  ALMQRHLTMIAIGGTLGTGLFIGLGYSLASG-PGCLLIGFILVGLSMFCVVQSAAELSCQ 132

Query: 144 YTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKYWNQTINPDAFV 203
           Y  ++G +  + +  +D++ GF+VS  Y L WL   P EL+ ++M I+YWN +++P  ++
Sbjct: 133 Y-PVSGSYATHVTRFIDESIGFTVSTNYALAWLISFPSELMGSAMVIQYWNDSVDPAVWI 191

Query: 204 TIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGGA-GNDGYLGARYW 262
            IFY+ ++ +N              +  K+L             CGG  G+ GY+G +YW
Sbjct: 192 AIFYLFVMFLNLFGVEGFAETEFWLSIIKILAIIIFIIIGIVLICGGGPGSSGYIGTKYW 251

Query: 263 HDPGAFRGSDSINRFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRI 322
           H+PG+F        FK +    V+AAF++GGAE  +LTAAE +    +I  A+K   +RI
Sbjct: 252 HNPGSFAHP----VFKSLCNTFVSAAFSFGGAELVLLTAAESKKIS-AISRAAKGTFWRI 306

Query: 323 LGIYIMTAILLGFLVPWNSDELLG-SGGSATHASPFVIAVASHGV--RVVPHFXXXXXXX 379
              YI T +++G LVP+  + LLG S      ASPFVIA+ + G     V +F       
Sbjct: 307 AVFYITTVVIIGCLVPYTDERLLGASSDEDVTASPFVIALTNAGSMGSSVANFMNVIILV 366

Query: 380 XXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVSCVFGLLSFVAASPK 439
                                  G  PR   Y+D+ GRP++ +++  +FGLL+F+    +
Sbjct: 367 AVISVCNSCVYASSRVIQALGSAGQLPRICGYIDKKGRPLVGIVICGIFGLLAFLIDCSE 426

Query: 440 EETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYVAWTGVWGAYYAMA 499
           E TVFTWL A+  +S  FTWF I  S VR R A+  Q RS DE+ Y +  G++G      
Sbjct: 427 EGTVFTWLFALCSISSFFTWFCICFSQVRYRIALKKQNRSNDEIAYKSMLGIYGGILGSL 486

Query: 500 MIVAILVGQFWVAISPVGSNKLDANNFFENYLAMPILIFLYLGYKIWTRDWR-LLIPSSE 558
           + + +++G+ +V+ISP+  +   A+ FFEN L++PI+I +Y+ +K + + WR L IP   
Sbjct: 487 LNILLIMGELYVSISPLDESP-SASAFFENCLSIPIMIVVYIFHKTYKKGWRSLFIPLKH 545

Query: 559 VDLVAHRKIFDAEVLRHEQLEEKEQLRHAPWTTRLANFWC 598
           +DL   R + +  + + ++ E+K  +   P+  R+  FWC
Sbjct: 546 IDLDTGRAVENLALFKQQREEQKIIIASKPFYYRVYRFWC 585

>Suva_16.31 Chr16 (39282..41042) [1761 bp, 586 aa] {ON} YLL061W
           (REAL)
          Length = 586

 Score =  318 bits (815), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 193/571 (33%), Positives = 298/571 (52%), Gaps = 16/571 (2%)

Query: 18  ESFDSVEVLKEESPRSDSRSDGLFRRFADSFRRHEAHNXXXXXXXXXXXXXLTPIESASK 77
           + F  +E      P     S  L RR  DSF++    N                I+    
Sbjct: 11  DKFTKIETESATIPGGSDHSGSLMRRMKDSFKQSNL-NVITEDLENSEQSEQEKIQWKLA 69

Query: 78  HKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYCVIQSA 137
            +  ++ ++ RH+ MI++   +GTG+ +G G SL +G PA+L+IG+ +V + ++CV+QSA
Sbjct: 70  SQPYQKVLKQRHLTMIAIGGTLGTGLFIGLGYSLASG-PAALLIGFLLVGTSMFCVVQSA 128

Query: 138 SELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKYWNQTI 197
           +EL+  +  ++G +  + S  +D++ GF+V+  Y L WL   P EL+  S+TI YWNQT+
Sbjct: 129 AELSCQF-PVSGSYATHVSRFIDQSIGFTVATNYALSWLISFPSELIGCSLTISYWNQTV 187

Query: 198 NPDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGGAGND-GY 256
           NP  +V IFYV ++ +N              +  KV+              GG  N  GY
Sbjct: 188 NPAVWVAIFYVFIMCLNLFGVKGFAETEFALSIIKVISIFIFIIIGIVLIAGGGPNSTGY 247

Query: 257 LGARYWHDPGAFRGSDSINRFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASK 316
           +G RYWH+PG+F    +   FK +    V+AAF++GG+E  +LT+ E +N   SI  A+K
Sbjct: 248 IGTRYWHNPGSF----AKPVFKNLCNTFVSAAFSFGGSELVLLTSTESKNI-SSISRAAK 302

Query: 317 KLVYRILGIYIMTAILLGFLVPWNSDELL-GSGGSATHASPFVIAVA---SHGVRVVPHF 372
              +RI   YI T +++G LVP+N   LL GS      ASPFVIA++   S G RV  +F
Sbjct: 303 GTFWRIAIFYITTVVIIGCLVPYNDPRLLNGSTSEDISASPFVIALSNTGSMGTRV-SNF 361

Query: 373 XXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVSCVFGLLS 432
                                         G  P    Y+DR GRP++ + +S +FGLL 
Sbjct: 362 MNVVILVAVVSVCNSCVYASSRLIQALGASGQLPEICAYMDRKGRPLVGIGISGIFGLLG 421

Query: 433 FVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYVAWTGVW 492
           F+ AS KE  VFTWL A+  +S  FTWF I +S VR R A+  QGRS +E+ Y +  GV+
Sbjct: 422 FLVASNKEGEVFTWLFALCSISSFFTWFCICMSQVRFRMALKAQGRSKNEIAYKSMLGVY 481

Query: 493 GAYYAMAMIVAILVGQFWVAISPVGSNKLDANNFFENYLAMPILIFLYLGYKIWTRDWR- 551
           G      +   ++ G+ +V+ +PVG     A  FFE  L++PI+I +Y+ ++I+  DW+ 
Sbjct: 482 GGVLGCVLNALLIAGEIYVSAAPVGGTS-TAKGFFEYCLSIPIMIVVYISHRIYRGDWKN 540

Query: 552 LLIPSSEVDLVAHRKIFDAEVLRHEQLEEKE 582
             I  S++DL     + + E+   ++  EKE
Sbjct: 541 WYIKKSKIDLDTGCSVENLELFNEQKQAEKE 571

>YLL061W Chr12 (17956..19707) [1752 bp, 583 aa] {ON}
           MMP1High-affinity S-methylmethionine permease, required
           for utilization of S-methylmethionine as a sulfur
           source; has similarity to S-adenosylmethionine permease
           Sam3p
          Length = 583

 Score =  310 bits (795), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 188/592 (31%), Positives = 310/592 (52%), Gaps = 19/592 (3%)

Query: 17  VESFDSVEVLKEESPRS-----DSRSDGLFRRFADSFRRHEAHNXXXXXXXXXXXXXLTP 71
           ++ F+S ++ K +   S      +  + L  RF +SF+R+++                  
Sbjct: 1   MDEFESTKLSKVQFSTSVLSTPSNEGNNLIHRFKNSFKRNDSPAIQEGLLYSELSEE-EK 59

Query: 72  IESASKHKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLY 131
           I+    ++  K+ +  RH+ MI++   +GTG+ +G G+SL +G PASL+IG+ +V + + 
Sbjct: 60  IQWDLANQPYKKVLDQRHLTMIAIGGTLGTGLFIGLGESLASG-PASLLIGFLLVGASML 118

Query: 132 CVIQSASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIK 191
           CV+Q  +EL+  Y  ++G +  + S  +D + GFS+   Y L WL   P ELV  S+TI 
Sbjct: 119 CVVQCGAELSCQYP-VSGSYALHASRFIDPSVGFSIGINYLLMWLISYPSELVGCSLTIS 177

Query: 192 YWNQTINPDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGGA 251
           YW  ++NP A+V I +V+ + +N              +  K++              GG 
Sbjct: 178 YWAPSVNPAAWVAIAFVLSMLLNLFGARGFAESEFYMSIFKIVALFIFIIIGIVLIAGGG 237

Query: 252 GND-GYLGARYWHDPGAFRGSDSINRFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNPQKS 310
            +  GY+G +YWHDPG+F    ++  FK +    V+AA+++ G E  VLT+ E ++   S
Sbjct: 238 PDSTGYIGTKYWHDPGSF----AVPVFKNLCNTFVSAAYSFSGTEMVVLTSTEARS-VSS 292

Query: 311 IRSASKKLVYRILGIYIMTAILLGFLVPWNSDELL-GSGGSATHASPFVIAVASHGV--R 367
           +  A+K   +RI+  YI+T I++G LVP+N   L+ GS      ASPFVIA+++ G    
Sbjct: 293 VSRAAKGTFWRIIIFYIVTVIIIGCLVPYNDPRLISGSSSEDITASPFVIALSNTGAMGT 352

Query: 368 VVPHFXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVSCV 427
            V HF                              G  P+   Y+DR GRP++ + +   
Sbjct: 353 RVSHFMNAVILIAVFSVCNSCVYASSRLIQGLATAGQLPKICAYMDRNGRPLVGMAICGA 412

Query: 428 FGLLSFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYVA 487
           FGLL F+  S  + TVFTWL A+  +S   TWF I    VR R AM  QGRS D++ Y +
Sbjct: 413 FGLLGFLVVSKNQGTVFTWLFALCSISFFTTWFCICFCQVRFRMAMKAQGRSKDDIIYRS 472

Query: 488 WTGVWGAYYAMAMIVAILVGQFWVAISPVGSNKLDANNFFENYLAMPILIFLYLGYKIWT 547
             G++G  +   + V +++G+ +V+ +PVGS    A NFFE  +++PI+I +Y+G++I+ 
Sbjct: 473 TLGIYGGIFGCILNVLLVIGEIYVSAAPVGSPS-SAANFFEYCMSIPIMIAVYIGHRIYR 531

Query: 548 RDWR-LLIPSSEVDLVAHRKIFDAEVLRHEQLEEKEQLRHAPWTTRLANFWC 598
           RDWR   I   ++DL +   + D E  + E+ E+K+ +   P   R+  F+C
Sbjct: 532 RDWRHWYIKRMDIDLDSGHSLEDFEATKLERDEDKKYVSSKPLYYRIYRFFC 583

>TDEL0H04510 Chr8 complement(813321..815075) [1755 bp, 584 aa] {ON} 
          Length = 584

 Score =  309 bits (791), Expect = 7e-97,   Method: Compositional matrix adjust.
 Identities = 198/585 (33%), Positives = 293/585 (50%), Gaps = 25/585 (4%)

Query: 22  SVEVLKEESPRSDSRSDGLFRRFADSFRRH---EAHNXXXXXXXXXXXXXLTPIESASKH 78
           SV   KE    S +      R + DSF+R    E  +                + S    
Sbjct: 17  SVSASKEHGAYSSA-----VRDWRDSFKRQDLLEMPDALEYNDLTEREKTQLKLASQPYK 71

Query: 79  KTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYCVIQSAS 138
           K L Q    RH+ MIS+   +GTG+ +G G +L +G PA+L+IGY +V + ++CVIQSAS
Sbjct: 72  KVLSQ----RHLTMISIGGTLGTGLFIGLGAALTSG-PAALLIGYLLVGASMFCVIQSAS 126

Query: 139 ELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKYWNQTIN 198
           ELA  +  + G ++++ +  VD++ GF+V   Y L WL + P EL+  S+TI YWN TIN
Sbjct: 127 ELACQF-PVTGSYSSHVTRFVDESVGFTVGTNYTLAWLVLFPSELIGCSLTISYWNSTIN 185

Query: 199 PDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGGAGNDG-YL 257
           P  +V IF V ++ IN              +  KVL              GG  + G Y+
Sbjct: 186 PAVWVAIFLVFVLWINLFGVRLFAETEFVLSIIKVLAIVIFIIIGIVLIAGGGQDSGGYI 245

Query: 258 GARYWHDPGAFRGSDSINRFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKK 317
           G RYWHDPG F    +   FK +    V+AAF+YGG+E  +LT  E +N   SI  A+K 
Sbjct: 246 GTRYWHDPGPF----AKPVFKNLCNTFVSAAFSYGGSEMVLLTGTESKNIS-SIARAAKG 300

Query: 318 LVYRILGIYIMTAILLGFLVPWNSDELLGSGGSAT-HASPFVIAVASHGV--RVVPHFXX 374
             YRI   YI T +++G LVP+N   LL +  S    ASPFVIA+ + G     V +F  
Sbjct: 301 TFYRIAIFYITTVVVIGCLVPYNDPRLLNASSSEDISASPFVIALGNTGSMGSKVSNFMN 360

Query: 375 XXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVSCVFGLLSFV 434
                                       G  P    Y+D  GRP++ + ++  FGLL F+
Sbjct: 361 AIILVSVVSVCNSTVYASSRLIQALGAAGHLPGICGYMDMKGRPLVGIAITGAFGLLGFL 420

Query: 435 AASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYVAWTGVWGA 494
            A+ K+  VFTWL A+  ++   TWF I L+ VR R AM  + RS + + Y +  G++G 
Sbjct: 421 VATNKQSEVFTWLFALCSIASFVTWFCICLAQVRFRLAMKARKRSKEHIAYRSMLGIYGG 480

Query: 495 YYAMAMIVAILVGQFWVAISPVGSNKLDANNFFENYLAMPILIFLYLGYKIWTRDWR-LL 553
                +   ++ G+ +V+  PV   K  A  FFE  L++PI+I ++LG+KI+  DW+   
Sbjct: 481 IAGCIVNFLLIAGEIYVSAWPV-DGKSSAEGFFEYDLSIPIMIIVFLGHKIYRNDWKNWY 539

Query: 554 IPSSEVDLVAHRKIFDAEVLRHEQLEEKEQLRHAPWTTRLANFWC 598
           +   ++DL     I + E+ + ++  EKE L   P   R+  FWC
Sbjct: 540 VKRRDMDLDTGCSIENLELFQSQKESEKEDLACKPLYYRIYRFWC 584

>TDEL0E05700 Chr5 complement(1059079..1060833) [1755 bp, 584 aa]
           {ON} 
          Length = 584

 Score =  309 bits (791), Expect = 7e-97,   Method: Compositional matrix adjust.
 Identities = 183/526 (34%), Positives = 278/526 (52%), Gaps = 13/526 (2%)

Query: 78  HKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYCVIQSA 137
           ++  ++ +  RH+ MI++   +GTG+ +G G +L   GPA+L+IGY +V + ++CVIQSA
Sbjct: 67  NQPYQKVLHQRHLSMIAIGGTLGTGLFIGLGAAL-TSGPAALLIGYLLVGTSMFCVIQSA 125

Query: 138 SELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKYWNQTI 197
           +ELA  +  ++G + ++ S  VD++ GF+V+  Y L WL + P EL+  S+TI YWN +I
Sbjct: 126 AELACQF-PVSGSYASHVSRFVDESLGFTVATNYTLAWLVLFPSELIGCSLTISYWNSSI 184

Query: 198 NPDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGGAGN-DGY 256
           NP  +V+IF V ++ IN              +  KVL              GG  +  GY
Sbjct: 185 NPAVWVSIFLVFVLWINLFGVRIFAETEFILSIIKVLAIIIFIIIGIVLIAGGGPDPGGY 244

Query: 257 LGARYWHDPGAFRGSDSINRFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASK 316
           +G +YWHDPG F    +   FK +    V AAF++GG E  +LT  E +N   SI  A+K
Sbjct: 245 IGTKYWHDPGPF----AKPVFKNLCQTFVAAAFSFGGTEMVLLTGTESKN-VSSIARAAK 299

Query: 317 KLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSA-THASPFVIAVASHGVR--VVPHFX 373
              YRI   Y+ T +++G LVP+N   LL +  S    ASPFVIA+++ G     V HF 
Sbjct: 300 GTFYRIAIFYVTTVVVIGCLVPYNDPRLLSASSSEDISASPFVIALSNTGSMGAKVSHFM 359

Query: 374 XXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVSCVFGLLSF 433
                                        G  P+   Y+DR GRP++ + VS  FGLL F
Sbjct: 360 NAVILVAVVSVCNSTVYASSRLIQALGTAGQLPKIFGYMDRKGRPLVGIAVSATFGLLGF 419

Query: 434 VAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYVAWTGVWG 493
           + A+ K+  VFTWL A+  ++   TWFSI L+ VR R AM  + RS D + Y +  G+WG
Sbjct: 420 LVATKKQSEVFTWLFALCSVAAFVTWFSICLAQVRYRMAMRARKRSLDSIAYKSILGIWG 479

Query: 494 AYYAMAMIVAILVGQFWVAISPVGSNKLDANNFFENYLAMPILIFLYLGYKIWTRDW-RL 552
                 +   ++ G+ +V+  P  + K  A  FF+  L++PI+I ++LG+KI   DW   
Sbjct: 480 GVVGCIVNFLLVAGEVYVSAFPANA-KSSAEGFFKYTLSIPIMIVVFLGHKIHRNDWGNW 538

Query: 553 LIPSSEVDLVAHRKIFDAEVLRHEQLEEKEQLRHAPWTTRLANFWC 598
            +   ++DL     I D E+ + ++  EK  L   P   R+  FWC
Sbjct: 539 YVKRKDMDLDTGCSIEDFELFQAQKEAEKRALASRPLYYRVYRFWC 584

>AER405C Chr5 complement(1413790..1415283) [1494 bp, 497 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YPL274W
           (SAM3)
          Length = 497

 Score =  301 bits (770), Expect = 7e-95,   Method: Compositional matrix adjust.
 Identities = 180/512 (35%), Positives = 274/512 (53%), Gaps = 20/512 (3%)

Query: 92  MISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYCVIQSASELAIIYTSLAGGF 151
           MIS+   +GTG+ +G G+SL +G P +L+IG+ IV   ++CVIQSA+EL+  Y  ++G F
Sbjct: 1   MISIGGTLGTGLFIGIGQSLQSG-PGTLLIGFLIVGVSIFCVIQSAAELSCQY-PVSGSF 58

Query: 152 NAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKYWNQTINPDAFVTIFYVVLV 211
           +++ S  ++ + GF+VS  Y L WL   P ELV  +MTI YWN+ I P  +V I Y++++
Sbjct: 59  SSHVSRFIEPSLGFTVSCAYALSWLISFPNELVGLAMTIGYWNEDIPPAVWVLIGYLLVI 118

Query: 212 AINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGGAGN--DGYLGARYWHDPGAFR 269
            +N              +  KVL             CGG  N  +GYLG +YWHDPGAFR
Sbjct: 119 GLNLFAVRGFAESEFWLSIIKVLAIIIFLIIGIVIICGGGPNNKEGYLGGKYWHDPGAFR 178

Query: 270 GSDSINRFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRILGIYIMT 329
                  F  +    V+AAF +GGAE  +LTA E +  + SI  A+K   +RI   YI T
Sbjct: 179 PP----FFSSLCQTFVSAAFTFGGAELVLLTANESRKIE-SISRAAKGTFWRIAIFYIST 233

Query: 330 AILLGFLVPWNSDELLGSGGSATHASPFVIAVASHGV--RVVPHFXXXXXXXXXXXXXXX 387
            I++G LVP+ S  L    G +  ASPFVIA+++ G     V HF               
Sbjct: 234 VIVIGCLVPYTSPAL---DGESIRASPFVIALSNTGSFGTNVSHFMNAVIVAAVLSVCNS 290

Query: 388 XXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVSCVFGLLSFVAASPKEETVFTWL 447
                          G  P    Y+D+ GRP++ + V  VFGLL+F+  + K + VF WL
Sbjct: 291 CVYAASRVIQSLGACGQLPEIFGYIDKKGRPLVGIGVCAVFGLLAFLVETTKVKDVFNWL 350

Query: 448 LAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYVAWTGVWGAYYAMAMIVAILVG 507
            A+  ++  F WF I +S +R RRA+ VQG   +E+ Y +  G W       +   ++ G
Sbjct: 351 FALCSIAAFFVWFCICVSQLRYRRALKVQGFPTEEIAYQSMLGKWSGVIGTLLNFLLICG 410

Query: 508 QFWVAISPVGSNKLDANNFFENYLAMPILIFLYLGYKIWTRDWRL-LIPSSEVDLVAHRK 566
           + +V++        D   FF+N +++P+LI  Y  ++++ RDW+  LIP+ ++DL   RK
Sbjct: 411 EIYVSV-----KDGDVETFFQNCMSIPLLIIFYFCHRLYRRDWKTWLIPARDLDLNTGRK 465

Query: 567 IFDAEVLRHEQLEEKEQLRHAPWTTRLANFWC 598
             D E+++HE +  + ++  +PW  R   FWC
Sbjct: 466 PEDLEMMKHELIVSRARIASSPWYYRAYRFWC 497

>ZYRO0D17952g Chr4 complement(1489975..1491732) [1758 bp, 585 aa]
           {ON} similar to uniprot|Q7LGU1 Saccharomyces cerevisiae
           YPL274W SAM3 High-affinity S-adenosylmethionine
           permease, required for utilization of
           S-adenosylmethionine as a sulfur source; has similarity
           to S-methylmethionine permease Mmp1p
          Length = 585

 Score =  303 bits (776), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 192/605 (31%), Positives = 309/605 (51%), Gaps = 48/605 (7%)

Query: 14  NGVVESFDSVEVLKEESPRSDSRSDGLFRRFADSFRRHEAHNXXXXXXXXXXXXXLTPIE 73
           NG +++ +++  +  ES + D  S    +R  DSF++ E                L PI+
Sbjct: 9   NGKLQTTNTLTQI--ESQQDDFSSP--LKRLKDSFKQSE----------------LAPID 48

Query: 74  SASKHKTLKQN---------------IRPRHVLMISLATGIGTGMLVGNGKSLHNGGPAS 118
             S    L +                +  RH+ MI++   +GTG+ +G G SL  G P +
Sbjct: 49  EDSGFDGLSEKEKIQLKLASQPYEKVLSQRHLTMIAIGGTLGTGLFIGLGYSLACG-PGA 107

Query: 119 LVIGYAIVSSMLYCVIQSASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCV 178
           L+IG+ +V + ++CV+QSA+EL+  +  ++G +  + S  +D++ GF+V+  Y L WL  
Sbjct: 108 LLIGFLLVGTSIFCVVQSAAELSCQF-PVSGSYATHVSRFIDQSIGFTVATNYALSWLIS 166

Query: 179 LPLELVTASMTIKYWNQTINPDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXX 238
            P EL+  S+TI YW+QT NP  +V IFYV ++ +N              +  K+L    
Sbjct: 167 FPSELIGCSLTISYWDQTTNPAVWVAIFYVFIMTLNLFGVRGFAEVEFVLSVIKILAIII 226

Query: 239 XXXXXXXXNCGGA-GNDGYLGARYWHDPGAFRGSDSINRFKGIVAVLVNAAFAYGGAEFS 297
                     GG   + GY+G +YWHDPG+F        FK +    V+AAF++GG+E  
Sbjct: 227 FIIIGIILIAGGGPDSKGYIGTKYWHDPGSFNNP----VFKNLCNTFVSAAFSFGGSELV 282

Query: 298 VLTAAEQQNPQKSIRSASKKLVYRILGIYIMTAILLGFLVPWNSDELL-GSGGSATHASP 356
           +LT+ E ++   +I  A+K   +RI   YI T +++G LVP+  D LL G       ASP
Sbjct: 283 LLTSKESKSVS-AISRAAKGTFWRIAIFYITTVVIIGCLVPYTDDRLLNGRSDEDVTASP 341

Query: 357 FVIAVASHGV--RVVPHFXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDR 414
           FVIA+++ G   + V  F                              G  P+   Y+DR
Sbjct: 342 FVIALSNTGSMGKKVSDFMNVVILIAVVSVCNSCVYAASRVIQALGASGQLPKICGYIDR 401

Query: 415 CGRPVLCLLVSCVFGLLSFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMT 474
            GRP++ + +S +FGLL F+ AS +E  VFTWL A+  +S  FTWF I  S +R R A+ 
Sbjct: 402 RGRPLVGIAISGIFGLLGFLVASSEESKVFTWLFALCSISSFFTWFCICYSQIRFRMALK 461

Query: 475 VQGRSADELGYVAWTGVWGAYYAMAMIVAILVGQFWVAISPVGSNKLDANNFFENYLAMP 534
            QGRS D++ Y +  GV+G      + + ++ G+ +V+ SPVG  K  A  FFE  L++P
Sbjct: 462 YQGRSTDQIAYKSMLGVYGGILGCILNILLIAGEIYVSASPVG-EKSTAEGFFEYCLSIP 520

Query: 535 ILIFLYLGYKIWTRDW-RLLIPSSEVDLVAHRKIFDAEVLRHEQLEEKEQLRHAPWTTRL 593
           I+I +Y+ ++I+ +DW    I  S++DL     + + E+ + ++ EEK      P+  ++
Sbjct: 521 IMISVYVLHRIYRKDWTHWYIKRSDIDLDTGCSVENIELFKEQREEEKIYAATKPFYYKI 580

Query: 594 ANFWC 598
             F C
Sbjct: 581 YRFLC 585

>Sklu_YGOB_Anc_1.368 Chr4 complement(849414..850103,850105..851040)
           [1626 bp, 541 aa] {ON} ANNOTATED BY YGOB -
          Length = 541

 Score =  301 bits (771), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 166/491 (33%), Positives = 264/491 (53%), Gaps = 32/491 (6%)

Query: 28  EESPRSDSRSDGLFRRFADSFRRHEAHNXXXXXXXXXXXXXLTPIESAS-KHKTLKQNIR 86
           +  P   +    LF R  DSF+                     P E+ S    +LK++++
Sbjct: 44  QVQPNKKAYKRNLFHRCIDSFK---------------------PPENGSFDPDSLKRSLK 82

Query: 87  PRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYCVIQSASELAIIYTS 146
            RH++MI++   IGTG+ VG+GK+L  GGP +++IG+ I  + +   I    E+ + +  
Sbjct: 83  SRHLIMIAIGGSIGTGLFVGSGKALAIGGPLAVIIGWLIAGTQMVGTIHGLGEITVRF-P 141

Query: 147 LAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKYWNQTINPDAFVTIF 206
           + G F  Y +  +D +  F VS +Y LQW  VLPLE++ ++MTI++WN +I+P  +V IF
Sbjct: 142 VVGAFADYGTRFLDPSLSFVVSSIYVLQWFFVLPLEIIASAMTIQFWNTSIDPVVWVAIF 201

Query: 207 YVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGGAGNDGYLGARYWHDPG 266
           YV +VAIN              +  KV+              GG     Y+GARYWHDPG
Sbjct: 202 YVTIVAINLFGVRGFGEAEFLFSSIKVITISGFIILCIVLIVGGGPTHEYVGARYWHDPG 261

Query: 267 AFRGSDSINRFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRILGIY 326
           A       + FKG+ +V V A+++ GG+E + L + E     K + SA K++ +RI+  +
Sbjct: 262 ALA-----HGFKGVASVFVTASYSLGGSEMACLASGETD--PKELPSAIKQVFWRIIFFF 314

Query: 327 IMTAILLGFLVPWNSDELLGSGGSATHASPFVIAVASHGVRVVPHFXXXXXXXXXXXXXX 386
           +++  L+GFLVP+ +  LLG  GS+ + SPFVIA   + ++V+P                
Sbjct: 315 LVSLTLVGFLVPYTNQNLLG--GSSVNNSPFVIACNLYHIKVLPSIINAVILVSIMSVGN 372

Query: 387 XXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVSCVFGLLSFVAASPKEETVFTW 446
                          QG  P+   YVDR GRP++ ++ + +FGLL+F+  S     VF W
Sbjct: 373 SCIFASSRTLCSMAHQGLIPQIFGYVDRAGRPLVGIITNSLFGLLAFLVKSSSMSEVFNW 432

Query: 447 LLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYVAWTGVWGAYYAMAMIVAILV 506
           L+AI+GL+    W SI++SH+R R AM  Q ++ DEL +V+  G+WG+ Y+  + V IL+
Sbjct: 433 LMAIAGLATCVVWLSINVSHIRFRMAMKAQDKTLDELEFVSAVGIWGSVYSAVVNVLILI 492

Query: 507 GQFWVAISPVG 517
            QF++++ PVG
Sbjct: 493 AQFYISLWPVG 503

>Smik_12.2 Chr12 (2207..3958) [1752 bp, 583 aa] {ON} YLL061W (REAL)
          Length = 583

 Score =  301 bits (771), Expect = 6e-94,   Method: Compositional matrix adjust.
 Identities = 187/573 (32%), Positives = 301/573 (52%), Gaps = 16/573 (2%)

Query: 33  SDSRSDG--LFRRFADSFRRHEAHNXXXXXXXXXXXXXLTPIESASKHKTLKQNIRPRHV 90
           S + +DG  L  RF +SF+R+++ +                I+    ++  K+ +  RH+
Sbjct: 20  STTSNDGNNLIHRFKNSFKRNDS-SAIQDGLLYSELTEEEKIQWDLANQPYKKVLSQRHL 78

Query: 91  LMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYCVIQSASELAIIYTSLAGG 150
            MI++   +GTG+ +G G+SL +G PASL+IG+ +V + + CV+Q  +EL+  Y  ++G 
Sbjct: 79  TMIAIGGTLGTGLFIGLGESLASG-PASLLIGFLLVGASMLCVVQCGAELSCQYP-VSGS 136

Query: 151 FNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKYWNQTINPDAFVTIFYVVL 210
           +  + S  +D + GFS+   Y L WL   P ELV  S+TI YW  ++NP A+V I +V+ 
Sbjct: 137 YALHASRFIDPSVGFSIGINYLLMWLISYPSELVGCSLTISYWAPSVNPAAWVAIAFVLS 196

Query: 211 VAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGGAGND-GYLGARYWHDPGAFR 269
           + +N              +  K++              GG  +  GY+G +YWHDPG+F 
Sbjct: 197 MLLNMFGARGFAESEFYMSIFKIVALFIFIIIGIILIAGGGPDSTGYIGTKYWHDPGSF- 255

Query: 270 GSDSINRFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRILGIYIMT 329
              +   FK +    V+AA+++ G E  VLT+ E +N   S+  A+K   +RI+  YI+T
Sbjct: 256 ---APPVFKNLCNTFVSAAYSFSGTEMVVLTSTEARN-VSSVSRAAKGTFWRIVIFYIVT 311

Query: 330 AILLGFLVPWNSDELL-GSGGSATHASPFVIAVASHGV--RVVPHFXXXXXXXXXXXXXX 386
            I++G LVP+N   L+ GS      ASPFVIA+++ G   + V HF              
Sbjct: 312 VIIIGCLVPYNDSRLINGSSSEDITASPFVIALSNTGTMGKRVSHFMNAVILIAVFSVCN 371

Query: 387 XXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVSCVFGLLSFVAASPKEETVFTW 446
                           G  PR   Y+DR GRP++ + +   FGLL F+  S  + TVFTW
Sbjct: 372 SCVYASSRLIQGLATAGQLPRICAYMDRNGRPLVGMAICGAFGLLGFLVVSKNQGTVFTW 431

Query: 447 LLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYVAWTGVWGAYYAMAMIVAILV 506
           L A+  +S   TWF I    VR R AM  QGRS D++ Y +  G++G      + V +++
Sbjct: 432 LFALCSISFFTTWFCICFCQVRFRMAMKAQGRSKDDIIYRSSLGIYGGIVGCILNVLLVI 491

Query: 507 GQFWVAISPVGSNKLDANNFFENYLAMPILIFLYLGYKIWTRDWR-LLIPSSEVDLVAHR 565
           G+ +V+ +PVGS    A NFFE  +++PI+I +Y+G++I+ +DWR   I   ++DL +  
Sbjct: 492 GEIYVSAAPVGSPS-SAANFFEYCMSIPIMIAVYIGHRIYRKDWRHWYIKRRDIDLDSGH 550

Query: 566 KIFDAEVLRHEQLEEKEQLRHAPWTTRLANFWC 598
            + D E  + E+  +K  +   P   R+  F+C
Sbjct: 551 SLEDFEATKLERDHDKRYVASRPLYYRIYRFFC 583

>TDEL0E00250 Chr5 (41958..43721) [1764 bp, 587 aa] {ON} 
          Length = 587

 Score =  293 bits (751), Expect = 5e-91,   Method: Compositional matrix adjust.
 Identities = 185/584 (31%), Positives = 299/584 (51%), Gaps = 23/584 (3%)

Query: 23  VEVLKEESPRSDSRSDGLFRRFADSFRRHEAHNXXXXXXXXXXXXXLTPIESAS---KHK 79
           VE++   S  + SRS   FR F +SF+R  A               LT  E        +
Sbjct: 19  VELIASASA-TGSRSH--FREFMESFKRDGA----VTVPSDLEYDELTEEEKVQWDLATQ 71

Query: 80  TLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYCVIQSASE 139
             K+ +  RH+ MI++   +GTG+ +G G SL +G P SL+IG+ +V   + CV+Q  +E
Sbjct: 72  PYKKVLDQRHLTMIAIGGTLGTGLFIGLGLSLASG-PGSLLIGFMLVGISMLCVVQCGAE 130

Query: 140 LAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKYWNQTINP 199
           L+  Y  ++G +  + S  +D + GFSV   Y L WL   P ELV  S+T+ YWN ++NP
Sbjct: 131 LSCQY-PVSGSYALHASRFIDPSVGFSVGMNYLLMWLVSFPSELVGCSLTLSYWNNSVNP 189

Query: 200 DAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVL-MXXXXXXXXXXXNCGGAGNDGYLG 258
             +V IF+V ++ +N              +  KV+ +             GG GN GY+G
Sbjct: 190 AVWVAIFFVFVMLLNLFGVRGFAETEFYMSIFKVISLFVFIIIGIVLITGGGPGNTGYIG 249

Query: 259 ARYWHDPGAFRGSDSINRFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKL 318
            +YW DPG+F    +   FK      V+AA+++ G E  VLT+ E ++   SI  A+K  
Sbjct: 250 TKYWQDPGSF----ATPAFKNFCNTFVSAAYSFSGTEMVVLTSTEVRDIS-SISRAAKGT 304

Query: 319 VYRILGIYIMTAILLGFLVPWNSDELL-GSGGSATHASPFVIAVASHGV--RVVPHFXXX 375
            +RI   YI+T +++G LVP+N + LL G+      ASPFVIA+++ G       +F   
Sbjct: 305 FWRIALFYIVTVVIIGCLVPYNDERLLSGATSEDISASPFVIALSNTGSMGSKAANFMNV 364

Query: 376 XXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVSCVFGLLSFVA 435
                                      G  P    Y+DR GRP++ + ++ VFGLL F+ 
Sbjct: 365 VILVAVVSVCNWCVYASSRLIQGLATAGQLPSICGYMDRNGRPLVGIAITGVFGLLGFLV 424

Query: 436 ASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYVAWTGVWGAY 495
           AS  + TVFTWL A+  +S   TWF I    +R R AM  Q RSAD++ Y++  G++G  
Sbjct: 425 ASKDQSTVFTWLFALCSISFFTTWFCICFCQIRFRMAMKAQKRSADDIVYISPLGIYGGV 484

Query: 496 YAMAMIVAILVGQFWVAISPVGSNKLDANNFFENYLAMPILIFLYLGYKIWTRDW-RLLI 554
               + V ++ G+ +V+  PVG     A NFF+  +++PI+I +YLG++I+ +DW    I
Sbjct: 485 LGCVLNVLLVAGEIYVSAFPVGQPS-SAENFFQYCMSIPIMIVVYLGHRIYRKDWSHWYI 543

Query: 555 PSSEVDLVAHRKIFDAEVLRHEQLEEKEQLRHAPWTTRLANFWC 598
            + ++D  +   + + + ++  + ++K  +   P+  ++  F+C
Sbjct: 544 KAKDIDRDSGYTLAELDNIKMRKEKDKAHIASRPFYYKVYRFFC 587

>Suva_16.18 Chr16 (17108..18859) [1752 bp, 583 aa] {ON} YLL061W
           (REAL)
          Length = 583

 Score =  288 bits (736), Expect = 7e-89,   Method: Compositional matrix adjust.
 Identities = 179/564 (31%), Positives = 290/564 (51%), Gaps = 14/564 (2%)

Query: 40  LFRRFADSFRRHEAHNXXXXXXXXXXXXXLTPIESASKHKTLKQNIRPRHVLMISLATGI 99
           L RRF +SF+R +A +                ++    ++  K+ +  RH+ MI++   +
Sbjct: 29  LVRRFKNSFKRKDA-SVIQEGLLYSELSEEEKVQWDLANQPYKKVLDQRHLTMIAIGGTL 87

Query: 100 GTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYCVIQSASELAIIYTSLAGGFNAYPSLLV 159
           GTG+ +G G+SL +G PASL+IG+ +V + + CV+Q  +EL+  Y  ++G +  + S  +
Sbjct: 88  GTGLFIGLGESLASG-PASLLIGFLLVGASMLCVVQCGAELSCQY-PVSGSYALHASRFI 145

Query: 160 DKAFGFSVSWVYCLQWLCVLPLELVTASMTIKYWNQTINPDAFVTIFYVVLVAINXXXXX 219
           D + GFSV   Y L WL   P ELV  S+T+ YW  ++NP  +V I + + + +N     
Sbjct: 146 DPSAGFSVGINYLLMWLISFPSELVGCSLTMTYWAPSVNPAVWVAIAFTLSMLLNLFGAR 205

Query: 220 XXXXXXXXXNCCKVLMXXXXXXXXXXXNCGGA-GNDGYLGARYWHDPGAFRGSDSINRFK 278
                    +  K++              GG   + GY+G +YW+DPG+F    +   FK
Sbjct: 206 GFAESEFYMSIFKIVALFIFIIIGIILIAGGGPESTGYIGTKYWYDPGSF----APPAFK 261

Query: 279 GIVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRILGIYIMTAILLGFLVP 338
                 V+AA+++ G E  VLT+AE ++   S+  A+K   +RI   YI+T I++G LVP
Sbjct: 262 NFCNTFVSAAYSFSGTEMVVLTSAEARD-VSSVSRAAKGTFWRIAVFYIVTVIIIGCLVP 320

Query: 339 WNSDELL-GSGGSATHASPFVIAVASHGV--RVVPHFXXXXXXXXXXXXXXXXXXXXXXX 395
           +N   L+ GS      ASPFVIA+++ G     V  F                       
Sbjct: 321 YNDPRLINGSSSEDITASPFVIALSNTGAMGTRVSQFMNAVILIAVFSVCNSCVYASSRL 380

Query: 396 XXXXXEQGFAPRFLNYVDRCGRPVLCLLVSCVFGLLSFVAASPKEETVFTWLLAISGLSE 455
                  G  P+   Y+DR GRP++ + +   FGLL F+  S  + TVFTWL A+  +S 
Sbjct: 381 IQGLATAGQLPKICGYMDRNGRPLVGMAICGAFGLLGFLVVSKDQGTVFTWLFALCSISF 440

Query: 456 LFTWFSISLSHVRLRRAMTVQGRSADELGYVAWTGVWGAYYAMAMIVAILVGQFWVAISP 515
             TWF I    +R R AM  QG+  D++ Y +  G++G      + V +++G+ +V+ +P
Sbjct: 441 FTTWFCICFCQIRFRMAMKAQGKPDDDIIYKSPLGIYGGVVGCTLNVLLVIGEIYVSAAP 500

Query: 516 VGSNKLDANNFFENYLAMPILIFLYLGYKIWTRDWR-LLIPSSEVDLVAHRKIFDAEVLR 574
           VG     A NFFE  +++PI+I +Y+G++I+ RDWR   I   ++DL +   + D E  +
Sbjct: 501 VGMPS-SAANFFEYCMSIPIMIAVYIGHRIYRRDWRHWYIKREDIDLDSGHSLEDLEATK 559

Query: 575 HEQLEEKEQLRHAPWTTRLANFWC 598
             + +EKE +   P   RL  F+C
Sbjct: 560 LRRDQEKEYVASRPLYYRLYRFFC 583

>Ecym_4758 Chr4 (1474661..1476424) [1764 bp, 587 aa] {ON} similar to
           Ashbya gossypii AER405C
          Length = 587

 Score =  286 bits (733), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 187/602 (31%), Positives = 310/602 (51%), Gaps = 26/602 (4%)

Query: 5   ELHNMKSPDNGVVESFDSVEVLKEESPRSDSRSDGLFRRFADSFRRHEAHNXXXXXXXXX 64
           E+  MK   +    SF + E   E+  ++  R    F +F  SF+RHEA           
Sbjct: 4   EVDVMKDAGSVSSASFHNQEYDSEKGGKAGKR----FDKFIGSFQRHEA-----IIPEDV 54

Query: 65  XXXXLTPIESAS---KHKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVI 121
               L   E ++    H+  ++ +  RH+ MIS+   +GTG+ +G G SL +G  A L+ 
Sbjct: 55  DLSLLNDYERSNFILAHQPYQKTLSQRHLTMISIGGTLGTGLFIGIGSSLASGPGALLLG 114

Query: 122 GYAIVSSMLYCVIQSASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPL 181
              +  S ++CVIQ+A+EL+  Y  ++G F+ + S  ++ + GF VS  Y L WL   P 
Sbjct: 115 FLLVGLS-IFCVIQAAAELSCQYP-VSGSFSTHVSRFIEPSVGFMVSTSYALSWLISFPS 172

Query: 182 ELVTASMTIKYWNQTINPDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXX 241
           ELV  ++TI YWN +++P  +V IFY++++A+N              +  K++       
Sbjct: 173 ELVGLTLTIGYWNNSVSPGIWVAIFYLLIMAMNLFSVRGFAETEYWLSIIKIIAITIFII 232

Query: 242 XXXXXNCGGAGND--GYLGARYWHDPGAFRGSDSINRFKGIVAVLVNAAFAYGGAEFSVL 299
                 CGG  N+  GYLG +YWHDPGAF+       F GI    V+AAF++GGAE  +L
Sbjct: 233 IGIVVICGGGPNNQAGYLGTKYWHDPGAFKKP----YFSGICNTFVSAAFSFGGAELVLL 288

Query: 300 TAAEQQNPQKSIRSASKKLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSATHASPFVI 359
           TA E +  + SI  A+K   +RI   YI T  ++  LVP++++ LLG+G    + SPFVI
Sbjct: 289 TANESRKVE-SISRAAKGTFWRIAIFYISTVAVISCLVPYDNETLLGNGEGVAN-SPFVI 346

Query: 360 AVASHGV--RVVPHFXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGR 417
           ++A+ G   + V HF                              G  P    Y+D+ GR
Sbjct: 347 SLANTGQFGKNVSHFMNAIILAAVLSVCNSSVYAASRVIQALGACGQLPSVCGYIDKKGR 406

Query: 418 PVLCLLVSCVFGLLSFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQG 477
           P++ + +  VFGLL+F+        VF WL A+  ++   TW+SI LS +R RRA+ VQG
Sbjct: 407 PLVGIAICGVFGLLAFLVEYDNVTEVFNWLFALCSIAAFVTWWSICLSQLRFRRALKVQG 466

Query: 478 RSADELGYVAWTGVWGAYYAMAMIVAILVGQFWVAISPVGSNKLDANNFFENYLAMPILI 537
              +E+ Y +  G+W     + +   ++ G+ +VAI     ++  A  FF+  +++P++I
Sbjct: 467 LGKEEIAYESMMGIWSGVVGIVLNTMLICGEIYVAIH-ASIDEHSAKTFFQYCMSIPVMI 525

Query: 538 FLYLGYKIWTRDWRL-LIPSSEVDLVAHRKIFDAEVLRHEQLEEKEQLRHAPWTTRLANF 596
            +Y  ++I+ ++W    + + ++DL   +K  D E+++HE +  + ++  +P   R+  F
Sbjct: 526 TVYAAHRIYNKNWHTWFVRAKDIDLSTGKKAEDIELMKHEIMVSRAKIAASPLYYRIYRF 585

Query: 597 WC 598
           WC
Sbjct: 586 WC 587

>Kwal_34.16254 s34 (264235..265677) [1443 bp, 481 aa] {OFF} YOL020W
           (TAT2) - Tryptophan permease, high affinity [contig 265]
           PARTIAL
          Length = 481

 Score =  280 bits (716), Expect = 5e-87,   Method: Compositional matrix adjust.
 Identities = 160/499 (32%), Positives = 253/499 (50%), Gaps = 34/499 (6%)

Query: 2   KDFELHNMKSPDNGVVESFDSVEVLKEESP--RSDSRSDGLFRRFADSFRRHEAHNXXXX 59
           K  E H         ++S D  E    E+   R  S +  + +R  DSF+          
Sbjct: 12  KGIESHLEAYASGQEIKSSDFSEKTTPENDGVRRRSTNRNVLQRMVDSFK---------- 61

Query: 60  XXXXXXXXXLTPIESASKHK-TLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPAS 118
                      P E  S H   LK++++ RH++MI++   IGTG+ +G+GK+L  GGP +
Sbjct: 62  -----------PPEDGSFHSDNLKKSLKARHLVMIAIGGSIGTGLFIGSGKALALGGPLA 110

Query: 119 LVIGYAIVSSMLYCVIQSASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCV 178
           L+IG+ I  + +   I    E+ + +  + G F  Y +  ++ +  F V  +Y LQW  V
Sbjct: 111 LIIGWTIAGTQMVGTIHGLGEITVRF-PVVGAFADYGTRFLEPSISFVVVLIYVLQWCFV 169

Query: 179 LPLELVTASMTIKYWNQTINPDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXX 238
           LPLE++ A+MT++YW+ +++P  +V IFY ++  IN              +  KV+    
Sbjct: 170 LPLEIIAAAMTVEYWDTSVSPVVWVAIFYGIIALINLVGVRGFGEAEFVFSLIKVITIVG 229

Query: 239 XXXXXXXXNCGGAGNDGYLGARYWHDPGAFRGSDSINRFKGIVAVLVNAAFAYGGAEFSV 298
                    CGG     ++GA+YWHDPG        N FKG+  VLV A+++ GG E + 
Sbjct: 230 FIILCIVLICGGGPKKEFVGAKYWHDPGPLA-----NGFKGVAGVLVIASYSLGGTEMAC 284

Query: 299 LTAAEQQNPQKSIRSASKKLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSATHASPFV 358
           L + E     K + SA K++ +RI+  ++++  L+GFLVP+ +  L+G  GS+   SPFV
Sbjct: 285 LASGETD--PKELPSAIKQVFWRIVFFFLVSLTLVGFLVPYTNQNLMG--GSSVDNSPFV 340

Query: 359 IAVASHGVRVVPHFXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRP 418
           IA+  HG+  +P                               QG  PR   Y+DR GRP
Sbjct: 341 IAIRLHGINALPSIVNAVILVSLLSVGNSCIFASSRTLCSMAHQGLIPRVFGYIDRAGRP 400

Query: 419 VLCLLVSCVFGLLSFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGR 478
           +  +L + +FGLL+F+  S     VFTWL+AI+GL+    W SI++SH+R R AM  QG 
Sbjct: 401 LTGILTNLLFGLLAFLVKSGSAGDVFTWLMAIAGLATCVVWLSINISHIRFRLAMKAQGV 460

Query: 479 SADELGYVAWTGVWGAYYA 497
             +EL +V+  G++G+ Y+
Sbjct: 461 DLEELEFVSGVGIYGSVYS 479

>Kwal_YGOB_34.16254 s34 (264235..265707) [1473 bp, 491 aa] {ON}
           ANNOTATED BY YGOB - YOL020W (TAT2) - Tryptophan
           permease, high affinity [contig 265] PARTIAL
          Length = 491

 Score =  280 bits (716), Expect = 7e-87,   Method: Compositional matrix adjust.
 Identities = 160/499 (32%), Positives = 253/499 (50%), Gaps = 34/499 (6%)

Query: 2   KDFELHNMKSPDNGVVESFDSVEVLKEESP--RSDSRSDGLFRRFADSFRRHEAHNXXXX 59
           K  E H         ++S D  E    E+   R  S +  + +R  DSF+          
Sbjct: 12  KGIESHLEAYASGQEIKSSDFSEKTTPENDGVRRRSTNRNVLQRMVDSFK---------- 61

Query: 60  XXXXXXXXXLTPIESASKHK-TLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPAS 118
                      P E  S H   LK++++ RH++MI++   IGTG+ +G+GK+L  GGP +
Sbjct: 62  -----------PPEDGSFHSDNLKKSLKARHLVMIAIGGSIGTGLFIGSGKALALGGPLA 110

Query: 119 LVIGYAIVSSMLYCVIQSASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCV 178
           L+IG+ I  + +   I    E+ + +  + G F  Y +  ++ +  F V  +Y LQW  V
Sbjct: 111 LIIGWTIAGTQMVGTIHGLGEITVRF-PVVGAFADYGTRFLEPSISFVVVLIYVLQWCFV 169

Query: 179 LPLELVTASMTIKYWNQTINPDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXX 238
           LPLE++ A+MT++YW+ +++P  +V IFY ++  IN              +  KV+    
Sbjct: 170 LPLEIIAAAMTVEYWDTSVSPVVWVAIFYGIIALINLVGVRGFGEAEFVFSLIKVITIVG 229

Query: 239 XXXXXXXXNCGGAGNDGYLGARYWHDPGAFRGSDSINRFKGIVAVLVNAAFAYGGAEFSV 298
                    CGG     ++GA+YWHDPG        N FKG+  VLV A+++ GG E + 
Sbjct: 230 FIILCIVLICGGGPKKEFVGAKYWHDPGPLA-----NGFKGVAGVLVIASYSLGGTEMAC 284

Query: 299 LTAAEQQNPQKSIRSASKKLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSATHASPFV 358
           L + E     K + SA K++ +RI+  ++++  L+GFLVP+ +  L+G  GS+   SPFV
Sbjct: 285 LASGETD--PKELPSAIKQVFWRIVFFFLVSLTLVGFLVPYTNQNLMG--GSSVDNSPFV 340

Query: 359 IAVASHGVRVVPHFXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRP 418
           IA+  HG+  +P                               QG  PR   Y+DR GRP
Sbjct: 341 IAIRLHGINALPSIVNAVILVSLLSVGNSCIFASSRTLCSMAHQGLIPRVFGYIDRAGRP 400

Query: 419 VLCLLVSCVFGLLSFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGR 478
           +  +L + +FGLL+F+  S     VFTWL+AI+GL+    W SI++SH+R R AM  QG 
Sbjct: 401 LTGILTNLLFGLLAFLVKSGSAGDVFTWLMAIAGLATCVVWLSINISHIRFRLAMKAQGV 460

Query: 479 SADELGYVAWTGVWGAYYA 497
             +EL +V+  G++G+ Y+
Sbjct: 461 DLEELEFVSGVGIYGSVYS 479

>SAKL0C02662g Chr3 complement(249789..251435) [1647 bp, 548 aa] {ON}
           uniprot|Q875R1 Saccharomyces kluyveri CAN1 Plasma
           membrane arginine permease requires phosphatidyl
           ethanolamine (PE) for localization exclusively
           associated with lipid rafts mutation confers canavanine
           resistance
          Length = 548

 Score =  270 bits (689), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 161/506 (31%), Positives = 250/506 (49%), Gaps = 14/506 (2%)

Query: 77  KHKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYCVIQS 136
           K   +K+ ++PRH+ MI+L   IGTG+ +     L N GP   +I Y  + ++ Y V QS
Sbjct: 38  KETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYSVTQS 97

Query: 137 ASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKYWNQT 196
             E+A  +  +   F  +    +  A G +  ++Y L W     LEL      I++W   
Sbjct: 98  LGEMAT-FIPVTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALELSVVGQIIQFWTDA 156

Query: 197 INPDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGGAGNDGY 256
           +   A++ IF+V+L   N               C KVL             CG AG  G 
Sbjct: 157 VPLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFIMVCG-AGKTGP 215

Query: 257 LGARYWHDPGAFRG---SDSIN--RFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSI 311
           +G RYW +PG +     S  +N  RF G V+ L++AAF Y G E   +TA E  NP+K++
Sbjct: 216 VGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTV 275

Query: 312 RSASKKLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSATHASPFVIAVASHGVRVVPH 371
             A  K+ +RIL  YI++ + +G LVP+N D  L S  S   +SPFVIA+ + G +V+PH
Sbjct: 276 PRAINKVFFRILFFYILSLLFIGLLVPFN-DPKLKSEDSYISSSPFVIAIENSGTKVLPH 334

Query: 372 FXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVSCVFGLL 431
                                          G AP++L +  + G P   +L + V G L
Sbjct: 335 IFNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAVLTTSVLGFL 394

Query: 432 SFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYVAWTGV 491
           +++ +S     VF WLL I+ ++  FTW  IS+SH+R  +A+  QG S D+L + A    
Sbjct: 395 AYLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQGISRDDLPFKAKFMP 454

Query: 492 WGAYYAMAMIVAILVGQFWVAISPVGSNKLDANNFFENYLAMPILIFLYLGYKIWTRDWR 551
           WGAYYA   I  I++ Q + A +P    K   ++FF  Y+++ +    ++G++IW R   
Sbjct: 455 WGAYYAAFFIGVIIIIQGFTAFAP----KFKVSDFFTAYISVMLFFVFWIGFQIWFRG-P 509

Query: 552 LLIPSSEVDLVAHRKIFDAEVLRHEQ 577
           L I + ++DL   R+  D +V+  EQ
Sbjct: 510 LFIKTEDIDLDTDRREID-DVVWEEQ 534

>TBLA0A07060 Chr1 complement(1737650..1739527) [1878 bp, 625 aa]
           {ON} 
          Length = 625

 Score =  266 bits (680), Expect = 4e-80,   Method: Compositional matrix adjust.
 Identities = 168/520 (32%), Positives = 262/520 (50%), Gaps = 19/520 (3%)

Query: 77  KHKT-LKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYCVIQ 135
           KH   LK+N++ RHV MI++   +GTG+L+G G SL   GPAS+ I Y+ V  +++  + 
Sbjct: 94  KHTDGLKKNLQARHVSMIAIGGSLGTGLLIGTGTSLSAAGPASMFIAYSFVGILVFFTMA 153

Query: 136 SASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKYW-- 193
           +  E+A  Y  +  GF +Y S  VD A GF+V + Y  ++L + P +L  AS+ I+YW  
Sbjct: 154 AIGEMAS-YIPM-DGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWID 211

Query: 194 NQTINPDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGGAGN 253
             T+NP  ++TIF VV+V IN              +  KVL+             GG  +
Sbjct: 212 RDTVNPGVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKVLVMLGLILLMFILMLGGGPD 271

Query: 254 DGYLGARYWHDPGAFRG-SDSIN----RFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNPQ 308
              LG RYW  PGAF+  SD+I+    +F   V+V V A FAY G E + + AAE  NP+
Sbjct: 272 HDRLGFRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPR 331

Query: 309 KSIRSASKKLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSATH--ASPFVIAVASHGV 366
           KS+  A K  V+RI+  Y++T  LLG  V +N   LL + G+ T   ASPFV+A+ + G+
Sbjct: 332 KSVPRAVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLAAKGAGTSAAASPFVVAIQNSGI 391

Query: 367 RVVPHFXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVSC 426
           RV+PH                               G AP         G P   L V  
Sbjct: 392 RVLPHIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCV 451

Query: 427 VFGLLSFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYV 486
           +F LL+++  S     VF + + +  +  L +W  I ++++   RA+ VQG    +  Y 
Sbjct: 452 LFALLAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYS 511

Query: 487 AWTGVWGAYYAMAMIVAI-LVGQFWVAISPVGSNKLDANNFFENYLAMPILIFLYLGYKI 545
           A    +G Y+++A  V I  +  F V +     +  D  NF   Y+ +P+ +  Y GYK 
Sbjct: 512 APFQPYGTYFSLAWCVFIAFIKNFTVFL----GHSFDYKNFITGYIGLPVFVIFYFGYKF 567

Query: 546 WTRDWRLLIPSSEVDLVAHRKIFDAEVLRHEQLEEKEQLR 585
             +    ++ S EVDL   +++FD + +  + L++++Q+R
Sbjct: 568 IKK--TKIVKSHEVDLFTGKEVFDQQEIEGKILDQEKQIR 605

>SAKL0C02640g Chr3 complement(247651..249297) [1647 bp, 548 aa] {ON}
           highly similar to uniprot|Q875R1 Saccharomyces kluyveri
           CAN1 and similar to YEL063C uniprot|P04817 Saccharomyces
           cerevisiae YEL063C CAN1 Plasma membrane arginine
           permease requires phosphatidyl ethanolamine (PE) for
           localization exclusively associated with lipid rafts
           mutation confers canavanine resistance
          Length = 548

 Score =  261 bits (667), Expect = 4e-79,   Method: Compositional matrix adjust.
 Identities = 156/506 (30%), Positives = 250/506 (49%), Gaps = 13/506 (2%)

Query: 77  KHKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYCVIQS 136
           K   +K+ ++PRH+ MI+L   IGTG+ +     L N GP   +I Y  + ++ Y V QS
Sbjct: 38  KETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMVSQS 97

Query: 137 ASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKYWNQT 196
             E+A  +  +   F  +    +  A G +  ++Y L W     LEL      I++W   
Sbjct: 98  LGEMAT-FIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFWTDA 156

Query: 197 INPDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGGAGNDGY 256
           +   A++ I +VVLV+ N               C KVL             CG AG  G 
Sbjct: 157 VPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCG-AGKTGP 215

Query: 257 LGARYWHDPGAFRG---SDSIN--RFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSI 311
           +G RYW +PG +     S  +N  RF G V+ L++AAF Y G E   +TA E  NP+K++
Sbjct: 216 VGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTV 275

Query: 312 RSASKKLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSATHASPFVIAVASHGVRVVPH 371
             A  K+ +RIL  YI++ + +G LVP+N D  L S  S   +SPFVIA+ + G +V+PH
Sbjct: 276 PRAINKVFFRILFFYILSLLFIGLLVPFN-DPKLKSEDSYISSSPFVIAIENSGTKVLPH 334

Query: 372 FXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVSCVFGLL 431
                                          G AP++L +  + G P   +L + + G L
Sbjct: 335 IFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTTSLVGFL 394

Query: 432 SFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYVAWTGV 491
           +++ +S     VF WLL I+ ++  F W  IS++H+R  +A+  QG S D+L + A    
Sbjct: 395 AYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPFKAKFMP 454

Query: 492 WGAYYAMAMIVAILVGQFWVAISPVGSNKLDANNFFENYLAMPILIFLYLGYKIWTRDWR 551
           WGAYYA   I  I++ Q + A +P    K + ++FF  Y+++ +   +++G++IW R   
Sbjct: 455 WGAYYAAFFIGVIIIIQGFTAFAP----KFNVSDFFTAYVSVILFFAVWIGFQIWFRG-P 509

Query: 552 LLIPSSEVDLVAHRKIFDAEVLRHEQ 577
           L   + ++DL   R+  D +V   ++
Sbjct: 510 LFKKTEDIDLDTDRREIDNDVWEEDE 535

>TDEL0C06170 Chr3 complement(1117792..1119513) [1722 bp, 573 aa]
           {ON} Anc_1.84 YNL268W
          Length = 573

 Score =  253 bits (645), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 160/500 (32%), Positives = 246/500 (49%), Gaps = 14/500 (2%)

Query: 73  ESASKHKT-LKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLY 131
           E A  H T +K+ ++ RH+ MI+L   IGTG+ VG    L N GP   +I Y  + S++Y
Sbjct: 58  EEAGYHDTRVKRALKQRHIGMIALGGTIGTGLFVGIATPLSNAGPVGSLIAYLFMGSIVY 117

Query: 132 CVIQSASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIK 191
            + QS  E+A  +  +      +    +  AFG +  ++Y   W     +E+      I+
Sbjct: 118 FITQSLGEMAT-FIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEISVIGQVIQ 176

Query: 192 YWNQTINPDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGGA 251
           +W   +   A++ IF+V +  +N                 KV+             CGG+
Sbjct: 177 FWTSAVPLAAWIAIFWVFVSLLNFFPVKVYGEIEFWVASIKVIAIVGYLIYALVIVCGGS 236

Query: 252 GNDGYLGARYWHDPGAFRG---SDSIN--RFKGIVAVLVNAAFAYGGAEFSVLTAAEQQN 306
            + G +G RYW +PG +     SD  N  RF G V+ L+NAAF Y G E   +TA E  N
Sbjct: 237 -SQGPIGFRYWRNPGPWGPGIISDDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAAN 295

Query: 307 PQKSIRSASKKLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSATHASPFVIAVASHGV 366
           P+KS+  A  K+V+RI+  YIM+   +G LVP+N D  L S  +   +SPFVI++ + G 
Sbjct: 296 PRKSVPRAINKVVFRIVIFYIMSLFFVGMLVPFN-DPRLASNVAVIASSPFVISIQNAGT 354

Query: 367 RVVPHFXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVSC 426
           RV+PH                             + G AP+   YV R G P L ++ + 
Sbjct: 355 RVLPHIFNAVVMLTIISAANSNVYVGSRVLYALSQTGNAPKQFGYVTRHGVPYLGVIATS 414

Query: 427 VFGLLSFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYV 486
           + GLL+F+  +    T F WL+ IS L+ L  W  ISLSH+R  +A+  +G S D+L + 
Sbjct: 415 LLGLLAFLVVNNNANTAFNWLINISTLAGLCAWLFISLSHIRFMQALKFRGISRDDLPFK 474

Query: 487 AWTGVWGAYYAMAMIVAILVGQFWVAISPVGSNKLDANNFFENYLAMPILIFLYLGYKIW 546
           A    WGAYYA   +  I+  Q + A SP    K D + FF  Y+++ IL+ L +G +++
Sbjct: 475 AKLMPWGAYYAAFFVTVIIFIQGFEAFSP----KFDVSGFFTAYISLIILVVLLIGCQLY 530

Query: 547 TRDWRLLIPSSEVDLVAHRK 566
            R  R L    ++D+   R+
Sbjct: 531 YRC-RFLWKLEDIDIDTDRR 549

>KLLA0E16281g Chr5 (1455271..1457088) [1818 bp, 605 aa] {ON} similar
           to uniprot|P53388 Saccharomyces cerevisiae YPL265W DIP5
           Dicarboxylic amino acid permease mediates high-affinity
           and high-capacity transport of L-glutamate and
           L-aspartate also a transporter for Gln Asn Ser Ala and
           Gly
          Length = 605

 Score =  252 bits (643), Expect = 6e-75,   Method: Compositional matrix adjust.
 Identities = 175/610 (28%), Positives = 281/610 (46%), Gaps = 44/610 (7%)

Query: 2   KDFELHNMKSPDNGVVESFDSVEVLKEESPRSDSRSDGLFRRFADSFRRHEAHNXXXXXX 61
           +D E   +   DN V+E   S ++  +   +SDS+  G+        +    H       
Sbjct: 18  EDIEKQQLFGDDNIVIER--SSQLFYDG--QSDSKVHGITSGHGSDVKNVVTHTS----- 68

Query: 62  XXXXXXXLTPIESASKHK--TLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASL 119
                      E   KH    LK+ +  RHV MI++   +GTG+L+G G SL   GPA++
Sbjct: 69  -----------EFDGKHDGIRLKKALEARHVSMIAIGGSLGTGLLIGTGSSLALAGPAAI 117

Query: 120 VIGYAIVSSMLYCVIQSASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVL 179
           +I YA V  +++ V+    E+A  Y  L  GF +Y +   D A GF+V + Y  ++  ++
Sbjct: 118 LIAYAFVGLLVFFVMSCLGEMAA-YIPL-DGFTSYSTRYADPALGFAVGYAYLFKYWIIV 175

Query: 180 PLELVTASMTIKYW--NQTINPDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXX 237
           P +L   ++ I+YW     +NP  ++TI  V ++ IN              +  K+ +  
Sbjct: 176 PNQLTAGALVIQYWVDRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVML 235

Query: 238 XXXXXXXXXNCGGAGNDGYLGARYWHDPGAFRG-----SDSINRFKGIVAVLVNAAFAYG 292
                     CGG  N   LG +YW +PGAF+      + +  RF    +V V A FAY 
Sbjct: 236 GLIILLLVLACGGGPNHEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYL 295

Query: 293 GAEFSVLTAAEQQNPQKSIRSASKKLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSA- 351
           G E   +  +E +NP+K++  A K  +YRI+  Y+++  LLG  VP+N D LL S  SA 
Sbjct: 296 GTELCGIVVSECKNPRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFN-DPLLISAKSAK 354

Query: 352 --THASPFVIAVASHGVRVVPHFXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFL 409
               ASPFV+A+ + G+ V+PH                                 APR  
Sbjct: 355 TSASASPFVVAIVNAGIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIF 414

Query: 410 NYVDRCGRPVLCLLVSCVFGLLSFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRL 469
              ++ G P   LLV  +F LL+++  S     VFT+ +    +  L +W SI ++++R 
Sbjct: 415 AKTNKQGVPYWSLLVGVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRF 474

Query: 470 RRAMTVQGRSADELGYVAWTGVWGAYYAMAMIVAI-LVGQFWVAISPVGSNKLDANNFFE 528
            +A  VQG     L Y +    +GA++++   + I L+  F   +     +  D  +F  
Sbjct: 475 DKAFRVQGIDKSTLAYQSPLQPYGAWFSLFFCILIGLIKNFPAFL----GDTFDYKSFIT 530

Query: 529 NYLAMPILIFLYLGYKIWTRDWRLLIPSSEVDLVAHRKIFDAEVLRHEQLEEKEQLRHAP 588
            Y+ +P  I  Y+GYK+W +    +IPS EVDLV+ ++  D E    + L+E+     A 
Sbjct: 531 GYIGIPTYIISYIGYKLWYK--TKIIPSEEVDLVSFKEAVDLEEEEGKMLDEERAAHLAA 588

Query: 589 WTTRLANFWC 598
               L   WC
Sbjct: 589 HGKDLK--WC 596

>Smik_6.473 Chr6 complement(778327..780147) [1821 bp, 606 aa] {ON}
           YPL265W (REAL)
          Length = 606

 Score =  251 bits (640), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 153/525 (29%), Positives = 261/525 (49%), Gaps = 22/525 (4%)

Query: 73  ESASKHKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYC 132
           +   ++  LK+ ++ RH+ MI++   +GTG+L+G G +L  GGP +++I YA V  +++ 
Sbjct: 72  DGKDENTRLKKELKARHISMIAIGGSLGTGLLIGTGTALLTGGPVAMLIAYAFVGLLVFF 131

Query: 133 VIQSASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKY 192
            +    E+A  Y  L  GF +Y S  VD A GF++ + Y  ++  + P +L  A++ I+Y
Sbjct: 132 TMACLGEMAS-YIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQY 189

Query: 193 W--NQTINPDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGG 250
           W     +NP  ++TIF VV+VAIN              +  KV++             GG
Sbjct: 190 WISRDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKVMVMLGLILLLFIIMLGG 249

Query: 251 AGNDGYLGARYWHDPGAFRG-----SDSINRFKGIVAVLVNAAFAYGGAEFSVLTAAEQQ 305
             +   LG RYW DPGAF+      + S  +F   VAV V + F+Y G E + +  +E +
Sbjct: 250 GPDHDRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAE 309

Query: 306 NPQKSIRSASKKLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSATH--ASPFVIAVAS 363
           NP+KS+  A K  VYRI+  Y+ T  LLG  V +N   LL + G +    ASPFV+A+ +
Sbjct: 310 NPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQN 369

Query: 364 HGVRVVPHFXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLL 423
            G++V+PH                               G AP+      + G P   L+
Sbjct: 370 SGIKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALI 429

Query: 424 VSCVFGLLSFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADEL 483
           +S +F  L+++  S     +F + + +  +  + +W +I + ++   +A   QG    + 
Sbjct: 430 LSVLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKF 489

Query: 484 GYVAWTGVWGAYYAMAMIVAI-LVGQFWVAISPVGSNKLDANNFFENYLAMPILIFLYLG 542
            YVA    +GAY+A++  + I L+  F V +     +K D   F   Y+ +P+ I  + G
Sbjct: 490 AYVAPGQRYGAYFALSFCILIALIKNFTVFL----GHKFDYKTFITGYIGLPVYILSWAG 545

Query: 543 YKIWTRDWRLLIPSSEVDLVAHRKIFDAEV----LRHEQLEEKEQ 583
           YK+  +    +I S++VDL   ++I+D E     ++ ++ EE+ Q
Sbjct: 546 YKLIYK--TKVIKSTDVDLYTFKEIYDREEEEGRIKDQEREERLQ 588

>Skud_16.12 Chr16 (20144..21967) [1824 bp, 607 aa] {ON} YPL265W
           (REAL)
          Length = 607

 Score =  249 bits (636), Expect = 5e-74,   Method: Compositional matrix adjust.
 Identities = 153/518 (29%), Positives = 261/518 (50%), Gaps = 20/518 (3%)

Query: 81  LKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYCVIQSASEL 140
           L+++++ RH+ MI++   +GTG+L+G G +L  GGP +++I YA V  +++  +    E+
Sbjct: 81  LRKDLKARHISMIAIGGSLGTGLLIGTGTALMTGGPVAMLIAYAFVGLLVFFTMACLGEM 140

Query: 141 AIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKYW--NQTIN 198
           A  Y  L  GF +Y S  VD A GF++ + Y  ++  + P +L  A++ I+YW     +N
Sbjct: 141 AS-YIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWVSRDRVN 198

Query: 199 PDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGGAGNDGYLG 258
           P  ++TIF VV+VAIN              +  KVL+             GG  +   LG
Sbjct: 199 PGVWITIFMVVIVAINVIGVKFFGEFEFWLSSFKVLVMLGLILLLFIIMLGGGPDHDRLG 258

Query: 259 ARYWHDPGAFRGSDSI-----NRFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRS 313
            RYW DPGAF+   +       +F   +AV V + F+Y G E + +  +E QNP+KS+  
Sbjct: 259 FRYWRDPGAFKEYSAAIGGGKGKFVSFLAVFVYSLFSYTGIELTGIVCSEAQNPRKSVPK 318

Query: 314 ASKKLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSA--THASPFVIAVASHGVRVVPH 371
           A K  VYRI+  Y+ T  LLG  V +N   L+ + G A    ASPFV+A+ + G++V+PH
Sbjct: 319 AIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLISTKGKALSAAASPFVVAIQNSGIKVLPH 378

Query: 372 FXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVSCVFGLL 431
                                          G AP+  +  ++ G P   L+ S +F  L
Sbjct: 379 IFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFSKTNKWGVPYNALIFSVLFCCL 438

Query: 432 SFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYVAWTGV 491
           +++  S     +F + + +  +  + +W +I + ++   +A   QG    +  YVA    
Sbjct: 439 AYMNVSAGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVAPGQR 498

Query: 492 WGAYYAMAMIVAI-LVGQFWVAISPVGSNKLDANNFFENYLAMPILIFLYLGYKIWTRDW 550
           +GAY+A+   + I L+  F V +     +K D   F   Y+ +P+ +F ++GYK+  +  
Sbjct: 499 YGAYFALVFCIFIALIKNFTVFL----GHKFDYKTFITGYIGLPVYVFSWVGYKLIYK-- 552

Query: 551 RLLIPSSEVDLVAHRKIFDAEVL--RHEQLEEKEQLRH 586
             +I S++VDL   ++I+D E    + E  E++E+L+ 
Sbjct: 553 TKVIKSTDVDLYTFKEIYDREEEQGKIEDQEKEERLKK 590

>KLTH0F02398g Chr6 complement(202746..204413) [1668 bp, 555 aa] {ON}
           similar to uniprot|P04817 Saccharomyces cerevisiae
           YEL063C CAN1 Plasma membrane arginine permease requires
           phosphatidyl ethanolamine (PE) for localization
           exclusively associated with lipid rafts mutation confers
           canavanine resistance
          Length = 555

 Score =  248 bits (632), Expect = 7e-74,   Method: Compositional matrix adjust.
 Identities = 153/509 (30%), Positives = 253/509 (49%), Gaps = 13/509 (2%)

Query: 74  SASKHKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYCV 133
           ++S+ + +++ ++PRHV MI+L   IGTG+ VG    L + GP   +I Y  + S+ + V
Sbjct: 42  ASSQERGIQRALKPRHVSMIALGGTIGTGLFVGIANPLRDAGPVGSLISYLFMGSLAFFV 101

Query: 134 IQSASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKYW 193
            QS  E+A  +  +A  F  +    +  A G +  ++YC  W     LEL      I+YW
Sbjct: 102 TQSLGEMAT-FIPVASSFTVFTRRFLSPALGAANGYMYCFSWCITFALELSIVGEIIQYW 160

Query: 194 NQTINPDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGGAGN 253
              +   A++ IF+V +   N                 KV+             CG AG 
Sbjct: 161 TLGVPNAAWIIIFWVPISLSNLVSVKFYGEFQFWIALIKVIAIVGFLIYCLCMVCG-AGK 219

Query: 254 DGYLGARYWHDPGAF-----RGSDSINRFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNPQ 308
            G +G RYW +PG +       S S  RF G V+ LVNAAF Y G E   ++A E  NP+
Sbjct: 220 TGPVGFRYWRNPGPWGDGIISKSKSEGRFLGWVSSLVNAAFTYQGTELVGVSAGESANPR 279

Query: 309 KSIRSASKKLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSATHASPFVIAVASHGVRV 368
           K++  A +K+  RIL  Y+ +   +G LVP+N D  L S  + + +SPF+IA+ + G R 
Sbjct: 280 KTVPKAIRKVFLRILLFYVGSLFFIGLLVPFN-DPKLDSTANYSASSPFIIAIQNSGTRA 338

Query: 369 VPHFXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVSCVF 428
           +P                              ++G AP+ +  ++R G P +C+ +  +F
Sbjct: 339 LPDIFNAVILTTIISAANSNVYVGSRVLYGLAKEGLAPKIIGRINRHGVPYICVGIVSLF 398

Query: 429 GLLSFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYVAW 488
           G L +++ S      F WLL I+ ++  F W  ISL H+R  +A+  QG S D+L + A 
Sbjct: 399 GFLGYLSVSSGSAKAFDWLLNITAIAGFFAWLFISLCHIRFMQALKYQGISRDDLPFKAK 458

Query: 489 TGVWGAYYAMAMIVAILVGQFWVAISPVGSNKLDANNFFENYLAMPILIFLYLGYKIWTR 548
              WGAYYA   I+ I++ Q + A +P    K + +NFF  Y+++ + I +++ +++  +
Sbjct: 459 LMPWGAYYAAFFILLIIIIQGFTAFAP----KFNVSNFFAAYVSVFLFIAVWVIFQVIFK 514

Query: 549 DWRLLIPSSEVDLVAHRKIFDAEVLRHEQ 577
             RL+    +VD+ + R+  +AEV   ++
Sbjct: 515 S-RLIHKVEDVDIDSDRREIEAEVWEDDE 542

>KNAG0L02470 Chr12 (440549..442465) [1917 bp, 638 aa] {ON} 
          Length = 638

 Score =  249 bits (637), Expect = 7e-74,   Method: Compositional matrix adjust.
 Identities = 157/525 (29%), Positives = 253/525 (48%), Gaps = 20/525 (3%)

Query: 81  LKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYCVIQSASEL 140
           LK+ ++ RH+ MI++   +GTG+L+  G+SL   GP S +I Y  V  M++  +    E+
Sbjct: 65  LKKQLKSRHISMIAIGGSLGTGLLIATGESLKVAGPVSTLIAYTFVGIMVFFTMACLGEM 124

Query: 141 AIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKYW--NQTIN 198
           A        GF +Y S   D A GF+V + Y +++  + P +L  A+M ++YW    T+N
Sbjct: 125 ATFIP--LDGFTSYASRYCDPALGFAVGYAYLIKYFILPPNQLTAAAMVMQYWVPRDTVN 182

Query: 199 PDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGGAGNDGYLG 258
           P  +VT+ + V+  IN              +  KVL+             GGAG+   LG
Sbjct: 183 PGIWVTLVFAVITVINIFGVRFFGEFEFWLSSLKVLIMIGLIILLFVIMLGGAGSHDRLG 242

Query: 259 ARYWHDPGAFRG-----SDSINRFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRS 313
            RYW  PGAF       S S+ +F   VAVLV   FAY G E + + AAE  NP++S+  
Sbjct: 243 FRYWKHPGAFNDYSDDISGSLGKFVSFVAVLVLGVFAYLGIELTGIVAAEASNPRRSVPK 302

Query: 314 ASKKLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSATHASPFVIAVASHGVRVVPHFX 373
           A K   YRIL  Y+++  LLG  VP+N ++L+ +  ++  ASPF IA+ + G+ V+P   
Sbjct: 303 AIKLTFYRILVFYVVSIFLLGMCVPYNDEKLVTTNENSLTASPFSIAILNAGITVLPDIF 362

Query: 374 XXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVSCVFGLLSF 433
                                          AP+   + +R G P   L VSC+F LL++
Sbjct: 363 NGCLLIFVFSAANSDLYVASRNLYSLAVDNKAPKIFAHTNRWGIPYNSLFVSCLFCLLAY 422

Query: 434 VAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYVAWTGVWG 493
           +  S     VF + + +  ++ L TW SI ++++   RA+  Q        YVA    +G
Sbjct: 423 MTVSSSSAQVFKYFVNVVSIAGLLTWISILITYICFDRAVRAQHVDKSTFAYVAPFQPYG 482

Query: 494 AYYAMAMIVAI-LVGQFWVAISPVGSNKLDANNFFENYLAMPILIFLYLGYKIWTRDWRL 552
           AY ++     I ++  F V +        D   F   Y+ +PI +  Y GYKI  +    
Sbjct: 483 AYVSLFFCCLIAIIKNFTVFL-----GHFDYKTFITGYIGLPIFVLCYFGYKITCKSE-- 535

Query: 553 LIPSSEVDLVAHRKIFDAEVLRH---EQLEEKEQLRHAPWTTRLA 594
           +  +  VDLV+ + + D E + +   EQL+ +E + +  ++  +A
Sbjct: 536 IRSARYVDLVSQKSLVDREQVEYELIEQLKREEMIANTKYSIVIA 580

>Kwal_33.13401 s33 complement(206763..208442) [1680 bp, 559 aa] {ON}
           YEL063C (CAN1) - arginine permease [contig 118] FULL
          Length = 559

 Score =  247 bits (631), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 152/506 (30%), Positives = 241/506 (47%), Gaps = 17/506 (3%)

Query: 73  ESASKHKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYC 132
            S      +++ ++PRHV MI+L   IGTG+ +G    L N GP   +I Y  + S+ YC
Sbjct: 45  SSGHGRNAVQRQLKPRHVSMIALGGTIGTGLFIGIESPLRNAGPVGALISYLFMGSIAYC 104

Query: 133 VIQSASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKY 192
           V QS  E+A  +  +   F  +    +    G +  ++YC  W     LEL      I+Y
Sbjct: 105 VTQSLGEMAT-FIPVTSSFTVFTRRFLSLPLGAANGYMYCFSWSVTYALELSIVGQIIEY 163

Query: 193 WNQTINPDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGGAG 252
           W   +   A++ IF+V +   N                 KV+             CG AG
Sbjct: 164 WTSAVPNAAWIAIFWVPITLSNLVPVKFYGEFQFWIALIKVVAIIGFLVYCLCMVCG-AG 222

Query: 253 NDGYLGARYWHDPGAFRGSDSI-------NRFKGIVAVLVNAAFAYGGAEFSVLTAAEQQ 305
             G +G RYW +PG +   D I        RF G V+ LVNAAF Y G E   ++A E  
Sbjct: 223 KTGPVGFRYWRNPGPW--GDGIISHDIHEGRFLGWVSSLVNAAFTYQGTELVGISAGESA 280

Query: 306 NPQKSIRSASKKLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSATHASPFVIAVASHG 365
           NP+K++  A  K+ +RIL  Y+ +   +G LVP+N DE L S  S +  SPF+IA+ + G
Sbjct: 281 NPRKTVPKAINKVFFRILLFYVGSLFFIGLLVPFN-DEKLTSSDSYSAGSPFIIAIQNSG 339

Query: 366 VRVVPHFXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVS 425
            +++P                              ++  APRF    +R G P + +L  
Sbjct: 340 TKILPDIFNAVILATIISAANSNVYVGSRVLYGLAKERLAPRFFARTNRHGVPDVAVLFV 399

Query: 426 CVFGLLSFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGY 485
             FG L +++ S      F WLL I+ ++  F+W  ISL HVR  +A+ +QG S D+L +
Sbjct: 400 ANFGFLGYLSVSNGASKAFDWLLNITAIAGFFSWLFISLCHVRFMQALKLQGISRDDLPF 459

Query: 486 VAWTGVWGAYYAMAMIVAILVGQFWVAISPVGSNKLDANNFFENYLAMPILIFLYLGYKI 545
            A    WGAYY+   I  I++ Q + +++P      + +NFF  Y+++ + + ++  ++ 
Sbjct: 460 KAKLMPWGAYYSAFFITLIIIIQGFTSLAPT----FNVSNFFAAYISVFMFLVIWAVFQC 515

Query: 546 WTRDWRLLIPSSEVDLVAHRKIFDAE 571
           W R  R++     VD+ + R+  DA+
Sbjct: 516 WYRT-RIIHRIEHVDIDSDRREVDAQ 540

>Smik_5.24 Chr5 complement(34087..35859) [1773 bp, 590 aa] {ON}
           YEL063C (REAL)
          Length = 590

 Score =  248 bits (632), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 153/510 (30%), Positives = 252/510 (49%), Gaps = 15/510 (2%)

Query: 77  KHKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYCVIQS 136
           ++  +K+ ++ RH+ MI+L   IGTG+ +G  K L N GP   +I Y  + S+ Y V QS
Sbjct: 80  RNAEVKRELKQRHIGMIALGGTIGTGLFIGLSKPLANAGPVGALISYLFMGSLAYSVTQS 139

Query: 137 ASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKYWNQT 196
             E+A  +  +   F  +    +  AFG +  ++Y   W     LEL      I++W   
Sbjct: 140 LGEMAT-FIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIEFWTNK 198

Query: 197 INPDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGGAGNDGY 256
           +   A+++IF+V++  +N                 KVL             CG AG  G 
Sbjct: 199 VPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCG-AGVTGP 257

Query: 257 LGARYWHDPGAF-----RGSDSINRFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSI 311
           +G RYW +PGA+         +  RF G V+ L+NAAF + G E   +TA E  NP+K++
Sbjct: 258 VGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTV 317

Query: 312 RSASKKLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSATHASPFVIAVASHGVRVVPH 371
             A KK+V+RIL  YI + + +G LVP+N D  L +  S    SPF+IA+ + G +V+PH
Sbjct: 318 PRAIKKVVFRILTFYIGSLLFIGLLVPYN-DPKLTTATSYVSVSPFIIAIENSGTKVLPH 376

Query: 372 FXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVSCVFGLL 431
                                        +   AP+FL+   + G P + + ++ VFG L
Sbjct: 377 IFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFITAVFGAL 436

Query: 432 SFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYVAWTGV 491
           +++  S   + VF WLL I+G++  F W  IS+SH+R  +A+  +G S DEL + A    
Sbjct: 437 AYMETSTGGDKVFEWLLNITGVAGFFAWLLISISHIRFMQALKYRGISRDELPFKAKLMP 496

Query: 492 WGAYYAMAMIVAILVGQFWVAISPVGSNKLDANNFFENYLAMPILIFLYLGYKIWTRDWR 551
             AY+A   ++ I++ Q + A +P    K D  +F   Y+++ + + +++ ++I  R  R
Sbjct: 497 GLAYFAATFMIIIILIQGFTAFAP----KFDGIDFLAAYISIFLFLAIWILFEIIFRC-R 551

Query: 552 LLIPSSEVDLVAHRKIFDAEVLRHEQLEEK 581
            +    +VD+ + R+  D E +  E  E K
Sbjct: 552 FIWKIEDVDIDSDRR--DIEAIVWEDHEPK 579

>YPL265W Chr16 (41043..42869) [1827 bp, 608 aa] {ON}
           DIP5Dicarboxylic amino acid permease, mediates
           high-affinity and high-capacity transport of L-glutamate
           and L-aspartate; also a transporter for Gln, Asn, Ser,
           Ala, and Gly
          Length = 608

 Score =  248 bits (633), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 154/525 (29%), Positives = 260/525 (49%), Gaps = 20/525 (3%)

Query: 73  ESASKHKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYC 132
           +   ++  L+++++ RH+ MI++   +GTG+L+G G +L  GGP +++I YA V  +++ 
Sbjct: 74  DGKDENTRLRKDLKARHISMIAIGGSLGTGLLIGTGTALLTGGPVAMLIAYAFVGLLVFY 133

Query: 133 VIQSASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKY 192
            +    E+A  Y  L  GF +Y S  VD A GF++ + Y  ++  + P +L  A++ I+Y
Sbjct: 134 TMACLGEMAS-YIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQY 191

Query: 193 W--NQTINPDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGG 250
           W     +NP  ++TIF VV+VAIN              +  KV++             GG
Sbjct: 192 WISRDRVNPGVWITIFLVVIVAINVVGVKFFGEFEFWLSSFKVMVMLGLILLLFIIMLGG 251

Query: 251 AGNDGYLGARYWHDPGAFRGSDSI-----NRFKGIVAVLVNAAFAYGGAEFSVLTAAEQQ 305
             N   LG RYW DPGAF+   +       +F   VAV V + F+Y G E + +  +E +
Sbjct: 252 GPNHDRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAE 311

Query: 306 NPQKSIRSASKKLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSATH--ASPFVIAVAS 363
           NP+KS+  A K  VYRI+  Y+ T  LLG  V +N   LL + G +    ASPFV+A+ +
Sbjct: 312 NPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQN 371

Query: 364 HGVRVVPHFXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLL 423
            G+ V+PH                               G AP+      R G P   L+
Sbjct: 372 SGIEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALI 431

Query: 424 VSCVFGLLSFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADEL 483
           +S +F  L+++  S     +F + + +  +  + +W +I + ++   +A   QG    + 
Sbjct: 432 LSVLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKF 491

Query: 484 GYVAWTGVWGAYYAMAMIVAI-LVGQFWVAISPVGSNKLDANNFFENYLAMPILIFLYLG 542
            YVA    +GAY+A+   + I L+  F V +     +K D   F   Y+ +P+ I  + G
Sbjct: 492 AYVAPGQRYGAYFALFFCILIALIKNFTVFL----GHKFDYKTFITGYIGLPVYIISWAG 547

Query: 543 YKIWTRDWRLLIPSSEVDLVAHRKIFDAEVL--RHEQLEEKEQLR 585
           YK+  +    +I S++VDL   ++I+D E    R +  E++E+L+
Sbjct: 548 YKLIYK--TKVIKSTDVDLYTFKEIYDREEEEGRMKDQEKEERLK 590

>TPHA0B04470 Chr2 complement(1047097..1048896) [1800 bp, 599 aa]
           {ON} Anc_1.84 YNL268W
          Length = 599

 Score =  247 bits (631), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 152/506 (30%), Positives = 247/506 (48%), Gaps = 14/506 (2%)

Query: 77  KHKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYCVIQS 136
           +   +K+ ++ RH+ MI+L   IGTG+ VG    L N GP   +I Y  + S++Y + QS
Sbjct: 90  QDTRVKRALKQRHIGMIALGGTIGTGLFVGISTPLGNAGPVGALIAYIFMGSIIYFITQS 149

Query: 137 ASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKYWNQT 196
             E+A  +  +      +    +  AFG +  ++Y   W     +E+      I+YW   
Sbjct: 150 LGEMAT-FIPVTSSITVFSKRFLSPAFGVTNGYMYWFNWAITYAVEISVVGQVIQYWTDA 208

Query: 197 INPDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGGAGNDGY 256
           +   A++ IF+V +  +N                 KVL             CGG+ + G 
Sbjct: 209 VPLAAWIAIFWVFVTLLNFFPVKVYGEVEFWVASIKVLAIIGYLIYALVIVCGGS-SQGP 267

Query: 257 LGARYWHDPGAFRG---SDSIN--RFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSI 311
           +G RYW +PG +     S  +N  RF G V+ L+NAAF Y G E   +TA E  NP+KS+
Sbjct: 268 IGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSV 327

Query: 312 RSASKKLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSATHASPFVIAVASHGVRVVPH 371
             A  K+V+RI   YIM+   +G LVP+N D  L SG S   +SPFVI++ + G   +P 
Sbjct: 328 PRAINKVVFRIALFYIMSLFFIGLLVPYN-DHTLSSGDSYIASSPFVISIQNAGTYALPD 386

Query: 372 FXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVSCVFGLL 431
                                        + G AP+   YV + G P L ++V+   GLL
Sbjct: 387 IFNAVVMLTIISAANSNVYVGSRVLYALAQTGNAPKQFAYVTKHGVPWLGVIVTASLGLL 446

Query: 432 SFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYVAWTGV 491
           +F+  +    T F WL+ IS L+ L  WF I+LSH+R  +A+  +G S D+L + A    
Sbjct: 447 AFLVVNNNANTAFNWLINISTLAGLCAWFFIALSHIRFMQALKYRGISRDDLPFKAKLMP 506

Query: 492 WGAYYAMAMIVAILVGQFWVAISPVGSNKLDANNFFENYLAMPILIFLYLGYKIWTRDWR 551
           WGAYY+   +  I+  Q + A +P      D   FF +Y+++ +L+ +++G +++ R  R
Sbjct: 507 WGAYYSAFFVFVIIFIQGFEAFTP-----WDTTTFFTSYISLILLVVVFIGCQLYYRC-R 560

Query: 552 LLIPSSEVDLVAHRKIFDAEVLRHEQ 577
            L+   ++D+   R+  +A +   ++
Sbjct: 561 FLLKVEDIDIDTDRREIEAIIWEDDE 586

>Kpol_2000.64 s2000 complement(130912..132744) [1833 bp, 610 aa]
           {ON} complement(130912..132744) [1833 nt, 611 aa]
          Length = 610

 Score =  246 bits (629), Expect = 7e-73,   Method: Compositional matrix adjust.
 Identities = 152/510 (29%), Positives = 248/510 (48%), Gaps = 13/510 (2%)

Query: 73  ESASKHKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYC 132
           E+  +   +K+ ++ RH+ MI+L   IGTG+ VG    L N GP   +I Y  + S++Y 
Sbjct: 96  EAQYQDTRVKRALKQRHIGMIALGGTIGTGLFVGIATPLSNAGPVGSLIAYIFMGSVVYF 155

Query: 133 VIQSASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKY 192
           V QS  E+A  +  +      +    +  AFG +  ++Y   W     +E+      I+Y
Sbjct: 156 VTQSLGEMAT-FIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEISVIGQVIQY 214

Query: 193 WNQTINPDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGGAG 252
           W + +   A++ IF+V++  +N                 KVL             CGG+ 
Sbjct: 215 WTKAVPLAAWIGIFWVIVTLMNFFPVKVYGEFEFWIASIKVLAIMGYLIYALIIVCGGS- 273

Query: 253 NDGYLGARYWHDPGAFRG---SDSIN--RFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNP 307
           + G +G RYW +PG +     SD     RF G V+ L+NAAF Y G E   +TA E  NP
Sbjct: 274 HQGPIGFRYWRNPGPWGPGIISDKTGEARFLGWVSSLINAAFTYQGTELVGITAGEAANP 333

Query: 308 QKSIRSASKKLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSATHASPFVIAVASHGVR 367
           +KS+  A  K+V+RI   YIM+   +G LVP+N D L  +  +   +SPFVI++ + G R
Sbjct: 334 RKSVPRAINKVVFRIALFYIMSLFFIGLLVPFNDDRL-ANDSAVIASSPFVISIQNAGTR 392

Query: 368 VVPHFXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVSCV 427
            +P                                G AP+  +YV + G P + ++ +  
Sbjct: 393 ALPDIFNAVVLLTIISAANSNVYVGSRVLYALALTGNAPKIFSYVTKYGVPYMGVICTAA 452

Query: 428 FGLLSFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYVA 487
            GLL+F+  +    T F WL+ IS L+ L  W  ISLSH+R  +A+  +G S D+L + A
Sbjct: 453 LGLLAFLVVNNNANTAFNWLINISTLAGLCAWLFISLSHIRFMQALKYRGISRDDLPFKA 512

Query: 488 WTGVWGAYYAMAMIVAILVGQFWVAISPVGSNKLDANNFFENYLAMPILIFLYLGYKIWT 547
               WGAYYA   +  I+  Q + A +P    K D + FF +Y+++ +L  L+ G +++ 
Sbjct: 513 KLMPWGAYYASFFVTVIIFIQGFQAFTP----KFDVSTFFTSYISLILLAVLFSGCQLYY 568

Query: 548 RDWRLLIPSSEVDLVAHRKIFDAEVLRHEQ 577
           R  R +    ++D+ + R+  +A +   ++
Sbjct: 569 R-CRFIWKVEDIDIDSDRREIEAIIWEEDE 597

>ZYRO0F16632g Chr6 complement(1371112..1372935) [1824 bp, 607 aa]
           {ON} similar to uniprot|P32487 Saccharomyces cerevisiae
           YNL268W LYP1 Lysine permease one of three amino acid
           permeases (Alp1p Can1p Lyp1p) responsible for uptake of
           cationic amino acids
          Length = 607

 Score =  245 bits (625), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 159/511 (31%), Positives = 243/511 (47%), Gaps = 14/511 (2%)

Query: 71  PIESASKHKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSML 130
           P +       +K+ ++PRH+ MI+L   IGTG+ VG  + L   GP   +I Y  + S++
Sbjct: 92  PAKGKFHDTQVKRALKPRHLGMIALGGTIGTGLFVGISEPLSRSGPVGSLIAYIFMGSVV 151

Query: 131 YCVIQSASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTI 190
           Y V QS  E+A  +  +      +    +  A G S  ++Y   W      EL      I
Sbjct: 152 YFVTQSLGEMAT-FIPVTSSITVFTKRFLSPALGVSNGYMYWFNWAITFATELSVTGQII 210

Query: 191 KYWNQTINPDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGG 250
           +YW   +   A++ IF+V++  +N              +  KVL             CGG
Sbjct: 211 QYWTYKVPLAAWIPIFWVIVAVLNFFPVKIYGEIEFWVSSVKVLAIVGYLIYALVIVCGG 270

Query: 251 AGNDGYLGARYWHDPGAF-RGSDSIN----RFKGIVAVLVNAAFAYGGAEFSVLTAAEQQ 305
           +   G +G RYW    AF  G  S N    RF G V+ L+NAAF Y G E   ++A E  
Sbjct: 271 S-RQGPIGFRYWRHGYAFGDGYISKNKDEARFLGWVSSLINAAFTYQGTELVGISAGEAA 329

Query: 306 NPQKSIRSASKKLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSATHASPFVIAVASHG 365
           NP+K++  A  K+++RI   YI++   +G LVP+N D+ L  G +   +SPFVI++ + G
Sbjct: 330 NPRKTVPRAINKVIFRIALFYILSLFFIGLLVPYN-DKRLSDGSAIIASSPFVISMLNAG 388

Query: 366 VRVVPHFXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVS 425
              +P                               QG AP+   YV+R G P L + V+
Sbjct: 389 TSALPDIFNAVILITVLSAANSDVYIASRVLYALAGQGNAPKQFTYVNRYGVPYLGVFVT 448

Query: 426 CVFGLLSFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGY 485
           C+ G L+F+  S    T F WL+ IS L+ L  WF I  +H+R  +A+  +G S D+L +
Sbjct: 449 CLVGWLAFLVVSNNANTAFNWLINISTLAGLTAWFFICFAHIRFMQALKHKGISRDDLPF 508

Query: 486 VAWTGVWGAYYAMAMIVAILVGQFWVAISPVGSNKLDANNFFENYLAMPILIFLYLGYKI 545
            A    WGAYYA   +  I+  Q + A +P      D  +FF +Y+++ +   LYLG  I
Sbjct: 509 KARFMPWGAYYAAFFVGLIIFIQGYDAFTP-----WDTKSFFTSYISLILFGVLYLGCLI 563

Query: 546 WTRDWRLLIPSSEVDLVAHRKIFDAEVLRHE 576
           + R  RLLI   ++D+   RK  +A V   +
Sbjct: 564 YYRG-RLLIKIEDIDIDTDRKEVEAYVWEED 593

>Suva_16.40 Chr16 (56664..58484) [1821 bp, 606 aa] {ON} YPL265W
           (REAL)
          Length = 606

 Score =  244 bits (624), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 151/522 (28%), Positives = 257/522 (49%), Gaps = 19/522 (3%)

Query: 73  ESASKHKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYC 132
           +   +   L+++++ RH+ MI++   +GTG+L+G G +L  GGP S++I Y  V  +++ 
Sbjct: 72  DGKDETTRLRKDLKARHISMIAIGGSLGTGLLIGTGTALLTGGPVSMLIAYGFVGLLVFF 131

Query: 133 VIQSASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKY 192
            +    E+A  Y  L  GF +Y S  VD A GF++ + Y  ++  + P +L  A++ I+Y
Sbjct: 132 TMACLGEMAS-YIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQY 189

Query: 193 W--NQTINPDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGG 250
           W     +NP  ++TIF VV+VAIN              +  KV++             GG
Sbjct: 190 WVSRDRVNPGVWITIFLVVIVAINIVGVRFFGEFEFWLSSFKVMVMLGLILLLFIIMLGG 249

Query: 251 AGNDGYLGARYWHDPGAFRG-----SDSINRFKGIVAVLVNAAFAYGGAEFSVLTAAEQQ 305
             +   LG RYW DPGAF+      + S  +F    +V V + F+Y G E + +  +E +
Sbjct: 250 GPDHDRLGFRYWRDPGAFKEYSTAITGSKGKFVAFASVFVYSLFSYTGIELTGIVCSEAK 309

Query: 306 NPQKSIRSASKKLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSATH--ASPFVIAVAS 363
           NP+KS+  A K  VYRI+  Y+ T  LLG  V +N   LL + G A    ASPFV+A+ +
Sbjct: 310 NPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKAMSAAASPFVVAIQN 369

Query: 364 HGVRVVPHFXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLL 423
            G++V+PH                               G AP+      + G P   L+
Sbjct: 370 SGIKVLPHIFNGCVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYYALM 429

Query: 424 VSCVFGLLSFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADEL 483
           VS +F  L+++  S     +F + + +  +  + +W +I + ++   RA   QG    + 
Sbjct: 430 VSVLFCCLAYMNVSAGSAKIFNYFVNVVSMFGILSWITILIVYIYFDRACRAQGVDKSKF 489

Query: 484 GYVAWTGVWGAYYAMAMIVAI-LVGQFWVAISPVGSNKLDANNFFENYLAMPILIFLYLG 542
            YVA    +GAY+A+   + I L+  F V +     +  D   F   Y+ +PI +F ++G
Sbjct: 490 AYVAPGQRYGAYFALFFCILIALIKNFTVFL----GHTFDYKTFITGYIGLPIYVFSWVG 545

Query: 543 YKIWTRDWRLLIPSSEVDLVAHRKIFDAEVLRHE-QLEEKEQ 583
           YK+  +    ++  ++ DL   ++I+D E  + + Q +EKE+
Sbjct: 546 YKLIYK--TKVVKPADADLYTLKEIYDREEEQGKLQDQEKEE 585

>Ecym_1088 Chr1 (184038..185741) [1704 bp, 567 aa] {ON} similar to
           Ashbya gossypii AFR667C
          Length = 567

 Score =  243 bits (621), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 148/525 (28%), Positives = 254/525 (48%), Gaps = 16/525 (3%)

Query: 73  ESASKHKT-LKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLY 131
           +    H+T +K+ ++ RH+ MI+L   IGTG+ +     L   GP   +I Y  + +++Y
Sbjct: 51  QEGDYHETEVKRALKARHISMIALGGTIGTGLFIVIASPLRTAGPVGSLIAYIFMGTVVY 110

Query: 132 CVIQSASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIK 191
            + QS  E+A  +  +      +    +  AFG +  ++Y   W     +EL      I 
Sbjct: 111 SITQSLGEMAT-FIPVTSSVTVFSKRFLSPAFGVANGYMYWFNWAITFAVELSVVGQIIN 169

Query: 192 YWNQTINPDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGGA 251
           YW   +   A++TIF++++  +N                 KV+             CGG+
Sbjct: 170 YWTSVVPLGAWITIFWIIVTLLNFFPVRFYGEIEFWIASVKVITIVGYLIYAFIVVCGGS 229

Query: 252 GNDGYLGARYWHDPGAF-RGSDSIN----RFKGIVAVLVNAAFAYGGAEFSVLTAAEQQN 306
            + G +G R W +PG +  G  S N    RF G V+ L+ AAF Y G E   +TA E +N
Sbjct: 230 -SQGPIGFRNWRNPGPWGTGVISSNQTEARFLGWVSSLIKAAFTYQGTELVGITAGESKN 288

Query: 307 PQKSIRSASKKLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSATHASPFVIAVASHGV 366
           P+K++  A  K+ +RIL  YI++   +G LVP+N   +  +  +  +ASPFVI++ + G 
Sbjct: 289 PRKTVPKAINKVFFRILFFYILSLFFVGLLVPYNDPRMDNTSDTDVNASPFVISIRNAGT 348

Query: 367 RVVPHFXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVSC 426
           +++P                              + G AP+   YV+R G PVL ++V+ 
Sbjct: 349 KILPDIFNAVVLVTVVSAANSNVYIGSRVIYSLAQSGNAPKQFGYVNRHGVPVLGVMVTA 408

Query: 427 VFGLLSFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYV 486
           + GL++F+  +   +  F WL+ IS L+ L  W  ISL+H+R  + +  +G S D L + 
Sbjct: 409 LMGLMAFLVVNNNAKAAFNWLVNISTLAGLCAWLFISLAHIRFMQCLKQRGISRDALPFK 468

Query: 487 AWTGVWGAYYAMAMIVAILVGQFWVAISPVGSNKLDANNFFENYLAMPILIFLYLGYKIW 546
           A    W AYYA + +  I+  Q + A SP    K D   FF  Y+++ +++ +++G +I+
Sbjct: 469 AKFMPWAAYYAASFVFVIIFIQGYTAFSP----KFDVTQFFTAYISLMLMLVVFIGCQIY 524

Query: 547 TRDWRLLIPSSEVDLVAHRKIFDAEVLRHEQLEEKEQLRHAPWTT 591
            +  R L    ++D+  +R+  DA V      +E + L    W+T
Sbjct: 525 YKC-RFLWKLEDIDIDTNRREIDAIVWED---DEPKNLWDKFWST 565

>KNAG0C05920 Chr3 (1157993..1159792) [1800 bp, 599 aa] {ON} 
          Length = 599

 Score =  243 bits (621), Expect = 8e-72,   Method: Compositional matrix adjust.
 Identities = 152/514 (29%), Positives = 247/514 (48%), Gaps = 15/514 (2%)

Query: 73  ESASKHKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYC 132
           E   KH+++K+ ++PRH+ MI+L   IGTG+ +G  K L N GP   +I Y  V ++++ 
Sbjct: 85  EEHVKHRSVKRALKPRHIAMIALGGTIGTGLFMGIAKPLRNAGPVGALIAYIFVGTIIFS 144

Query: 133 VIQSASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKY 192
           V QS  E+ + +  +   F  +    +  AFG +  ++Y   W     +EL      I++
Sbjct: 145 VTQSLGEM-VTFIPVTSSFTVFSHRFLSPAFGAANGYMYWFSWAMTFAVELSVLGKVIQF 203

Query: 193 WNQTINPDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGGAG 252
           W   +   A++ IF+ +L   N                 KVL              G AG
Sbjct: 204 WTTAVPLAAWIVIFWFLLTLSNMFPVKYYGEIEFWIAFLKVLSLVGFLIFCLCITSG-AG 262

Query: 253 NDGYLGARYWHDPGAF-----RGSDSINRFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNP 307
             G  G RYW DPGA+         S  RF G V+ L+NAAF Y G E   +TA E  NP
Sbjct: 263 PHGPFGFRYWRDPGAWGPGIIAEDQSEARFLGWVSSLINAAFTYQGTELVGITAGEAANP 322

Query: 308 QKSIRSASKKLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSATHASPFVIAVASHGVR 367
           +K++  A KK++ RIL  Y+ +   +G LVP+N D  L S  S   +SPF+IA+ + GV 
Sbjct: 323 RKAVPKAIKKVILRILFFYVGSLFFIGMLVPFN-DPKLTSATSFVSSSPFIIAIQNSGVS 381

Query: 368 VVPHFXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVSCV 427
           ++P                                  AP+F     + G P + +L + +
Sbjct: 382 LLPSIFNGVILITIISAGNSNVYVGSRILFGLAHSNLAPQFFTRTTKTGVPFVAVLFTSL 441

Query: 428 FGLLSFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYVA 487
           FG L+F+  +   + VF WLL+I  ++  F W  ISLSH+R  +A+  +G S + L + A
Sbjct: 442 FGSLAFLELTTDGDKVFNWLLSIVAIAGFFAWLLISLSHIRFMKALEYRGISRNSLPFKA 501

Query: 488 WTGVWGAYYAMAMIVAILVGQFWVAISPVGSNKLDANNFFENYLAMPILIFLYLGYKIWT 547
               W AYYA A I+ I++ Q + A +P    + + ++F  +Y+++ + + ++  ++   
Sbjct: 502 IFMPWLAYYATAFIILIILIQGFTAFAP----RFNVSDFVASYISLLLFVIIWGVFQA-M 556

Query: 548 RDWRLLIPSSEVDLVAHRKIFDAEVLRHEQLEEK 581
           +  R+     ++DL + RK  D E +R E    K
Sbjct: 557 KKCRIFWKVEDIDLDSDRK--DIEDIRWEDDSPK 588

>CAGL0J08162g Chr10 complement(803679..805472) [1794 bp, 597 aa]
           {ON} highly similar to uniprot|P32487 Saccharomyces
           cerevisiae YNL268w LYP1 or uniprot|P04817 Saccharomyces
           cerevisiae YEL063c CAN1 or uniprot|P38971 Saccharomyces
           cerevisiae YNL270c ALP1
          Length = 597

 Score =  243 bits (619), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 156/507 (30%), Positives = 251/507 (49%), Gaps = 16/507 (3%)

Query: 78  HKT-LKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYCVIQS 136
           H T +K+ ++ RH+ MI+L   IGTG+ VG    L N GP   +I Y  + +++Y V QS
Sbjct: 87  HDTRVKRALKQRHIGMIALGGTIGTGLFVGISTPLSNSGPVGALIAYIFMGTIIYFVTQS 146

Query: 137 ASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKYWNQT 196
             E+A  +  +      +    +  AFG +  ++Y   W     +E+      I+YW   
Sbjct: 147 LGEMAT-FIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEVSVIGQVIQYWTFK 205

Query: 197 INPDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGGAGNDGY 256
           +   A++ IF+V++  +N                 KV+             CGG+ + G 
Sbjct: 206 VPLAAWIGIFWVLITLMNFFPVKIYGEFEFWVASIKVIAIVGYLIYALIIVCGGS-HQGP 264

Query: 257 LGARYWHDPGAFRGSDSIN------RFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNPQKS 310
           +G RYW +PGA  G+  I+      RF G V+ L+NAAF Y G E   +TA E  NP+KS
Sbjct: 265 IGFRYWRNPGAM-GAGIISSDLGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKS 323

Query: 311 IRSASKKLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSATHASPFVIAVASHGVRVVP 370
           +  A  K+V+RI+  YIM+   +G LVP+N D  L +  +   +SPFVI++ + G +V+P
Sbjct: 324 VPRAINKVVFRIVLFYIMSLFFVGLLVPYN-DPRLSASSAVIASSPFVISIQNAGTKVLP 382

Query: 371 HFXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVSCVFGL 430
                                         + G AP+   YV R G P L ++ + + GL
Sbjct: 383 DIFNAVVLVTVISAANSNVYVGSRVLYALAQSGNAPKQFAYVTRHGVPYLGVICTALLGL 442

Query: 431 LSFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYVAWTG 490
           L+F+  +    T F WL+ IS L+ L  W  ISL+H+R  +A+  +G S D+L + A   
Sbjct: 443 LAFLVVNHNANTAFNWLINISTLAGLCAWLFISLAHIRFMQALKFRGISRDDLPFKAKFM 502

Query: 491 VWGAYYAMAMIVAILVGQFWVAISPVGSNKLDANNFFENYLAMPILIFLYLGYKIWTRDW 550
            WGAYYA   +  I+  Q + A +P    K D + FF  Y+++ +L+ L+ G +++ R  
Sbjct: 503 PWGAYYASFFVTVIIFIQGFQAFAP----KFDVSEFFTAYISLILLVVLFAGCQLYYRC- 557

Query: 551 RLLIPSSEVDLVAHRKIFDAEVLRHEQ 577
           R L    ++D+ + R+  DA V   ++
Sbjct: 558 RFLWKLEDIDIDSDRREIDAIVWEDDE 584

>Ecym_1087 Chr1 complement(180832..182544) [1713 bp, 570 aa] {ON}
           similar to Ashbya gossypii AFR668W
          Length = 570

 Score =  241 bits (616), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 150/530 (28%), Positives = 254/530 (47%), Gaps = 16/530 (3%)

Query: 69  LTPIES--ASKHKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIV 126
           ++ +ES   +    +K++++PRH+ MISL   IGTG+ +G    +   GP   ++ Y  +
Sbjct: 48  MSEVESLYGNDDPDVKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFM 107

Query: 127 SSMLYCVIQSASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTA 186
            ++ +CV QS  E+A  +  +   F  Y    +  A G +  ++Y   W     LEL   
Sbjct: 108 GTIAFCVTQSLGEMAT-FIPVTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSII 166

Query: 187 SMTIKYWNQTINPDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXX 246
              I+YW   +    ++ +F+++L A N                 KVL            
Sbjct: 167 GQLIQYWTFAVPLSVWIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVM 226

Query: 247 NCGGAGNDGYLGARYWHDPGAF-RGSDSIN----RFKGIVAVLVNAAFAYGGAEFSVLTA 301
            CGG+ ++G LG RYW +PG +  G  S N    RF G V+ L+ AAF Y G E   +TA
Sbjct: 227 VCGGS-SEGALGFRYWKNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGITA 285

Query: 302 AEQQNPQKSIRSASKKLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSATHASPFVIAV 361
            E +NP+K++  A  K+ +RIL  YI++   +G LVP+    L  +  S  + SPFV+A+
Sbjct: 286 GESKNPRKTVPKAINKVFFRILFFYILSLFFVGLLVPYTDPRLSTTSDSDINTSPFVMAI 345

Query: 362 ASHGVRVVPHFXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLC 421
            + G +V+P                              + G AP      ++ G P   
Sbjct: 346 QNSGTKVLPSVFNGVILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYA 405

Query: 422 LLVSCVFGLLSFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSAD 481
           +L S +FG L+++  S   + VF WLL I+ ++  F W  ISLSH+R  + +  +G S +
Sbjct: 406 VLTSSIFGCLAYLNISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRN 465

Query: 482 ELGYVAWTGVWGAYYAMAMIVAILVGQFWVAISPVGSNKLDANNFFENYLAMPILIFLYL 541
           +L + A    WGAYYA   I  I++ Q + + +P    +   + F  +Y+++ + I  +L
Sbjct: 466 DLPFKAKFMPWGAYYAAFFITVIILIQGFDSFAP----EFVFSEFIADYISVFLFIVCWL 521

Query: 542 GYKIWTRDWRLLIPSSEVDLVAHRKIFDAEVLRHEQLEEKEQLRHAPWTT 591
           G+++  +  RL++   +VD+   R+  DA V   +  +E + L    W +
Sbjct: 522 GFQVLFKT-RLILRKEDVDIDTDRREIDALVWSDD--DEPKTLLQKLWQS 568

>NDAI0F04190 Chr6 complement(1012142..1013941) [1800 bp, 599 aa]
           {ON} 
          Length = 599

 Score =  242 bits (618), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 155/509 (30%), Positives = 249/509 (48%), Gaps = 20/509 (3%)

Query: 78  HKT-LKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYCVIQS 136
           H T +K+ ++ RH+ MI+L   IGTG+ +G    L N GP   +I Y  + S++Y + QS
Sbjct: 89  HDTQVKRALKQRHLGMIALGGTIGTGLFIGIATPLTNSGPVGSLIAYLFMGSIIYFITQS 148

Query: 137 ASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKYWNQT 196
             E+A  +  +      +    +  AFG +  ++Y   W     +E+      I+YW   
Sbjct: 149 LGEMAT-FIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITFAVEISVVGQVIEYWTDK 207

Query: 197 INPDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGGAGNDGY 256
           +   A++ IF+V++  +N                 KVL             CGG+ + G 
Sbjct: 208 VPLAAWIAIFWVLITLLNFFPVKVYGEIEFWIAFIKVLAIMGYLLYALIIVCGGS-SQGP 266

Query: 257 LGARYWHDPGAFRG---SDSIN--RFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSI 311
           +G RYW +PG +     S  +N  RF G V+ L+NAAF Y G E   +TA E  NP+K++
Sbjct: 267 IGFRYWRNPGPWGPGIISKDVNTGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTV 326

Query: 312 RSASKKLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSATHASPFVIAVASHGVRVVPH 371
             A  K+V+RI   YIM+   +G LVP+N DE L S  +   +SPFVI++ + G +V+P 
Sbjct: 327 PRAINKVVFRIALFYIMSLFFIGMLVPYN-DERLASTSAVIASSPFVISIQNAGTKVLPD 385

Query: 372 FXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVSCVFGLL 431
                                          G AP+   +V R G P L ++V+   GLL
Sbjct: 386 IFNAIVMITIISAANSNVYVGSRVLYALALSGNAPKQFAFVTRYGVPYLGVIVTSALGLL 445

Query: 432 SFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYVAWTGV 491
           +F+  +    T F WL+ IS L+ L  W  IS+SH+R  +A+  +G S D+L + A    
Sbjct: 446 AFLVVNNNANTAFNWLINISTLAGLCAWLFISISHIRFMQALKFRGISRDDLPFKAKLMP 505

Query: 492 WGAYYAMAMIVAILVGQFWVAISPVGSNKLDANNFFENYLAMPILIFLYLGYKIWTR--- 548
           +GAYYA   +  I+  Q + A SP      D   FF +Y+++ IL  L++G +I+ R   
Sbjct: 506 FGAYYATFFVTVIIFIQGFQAFSP----HWDTTAFFTSYISLIILAVLFIGCQIFYRCRF 561

Query: 549 DWRLLIPSSEVDLVAHRKIFDAEVLRHEQ 577
            WR+     ++D+ + R+  +A +   ++
Sbjct: 562 FWRV----EDIDIDSDRREIEAVIWEDDE 586

>CAGL0A01199g Chr1 (121067..122908) [1842 bp, 613 aa] {ON} similar
           to uniprot|P53388 Saccharomyces cerevisiae YPL265w DIP5
           dicarboxylic amino acid permease
          Length = 613

 Score =  242 bits (618), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 160/536 (29%), Positives = 260/536 (48%), Gaps = 31/536 (5%)

Query: 73  ESASKHKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYC 132
           +   +H  L+++++ RH+ MI++   IGTG+L+G G SL+  GP S+ I YA V  +++ 
Sbjct: 78  DGKDEHTRLRKDLKARHISMIAIGGSIGTGLLIGTGNSLYTAGPMSMFIAYAFVGVLVFF 137

Query: 133 VIQSASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKY 192
            + +  E+A  Y  L  GF +Y S   D A GF+V + Y  ++L + P +L  A++ I+Y
Sbjct: 138 TMAALGEMAS-YIPL-DGFTSYASRYCDPALGFAVGYAYLCKYLILPPNQLTAAALVIQY 195

Query: 193 W--NQTINPDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGG 250
           W   + +NP  ++TIF V++VA+N              +  KV++             GG
Sbjct: 196 WLDREQVNPGVWITIFLVIIVAMNFIGVKFFGEFEFWLSTFKVIVMIGLIILLFVIMLGG 255

Query: 251 AGNDGYLGARYWHDPGAFRG-SDSIN----RFKGIVAVLVNAAFAYGGAEFSVLTAAEQQ 305
                 LG R++  PGAF+  S SI+    +F   VAVLV A FAY G E + + AAE  
Sbjct: 256 GPTHDRLGFRFYDHPGAFKPYSKSIDGSKGKFVAFVAVLVYALFAYLGIELTGIVAAEAA 315

Query: 306 NPQKSIRSASKKLVYRILGIYIMTAILLGFLVPWNSDELL---GSGGSATHASPFVIAVA 362
           NP+KSI  A K  +YRI+  Y++T  LLG  V ++ D LL    + G+   ASP+V+A+ 
Sbjct: 316 NPRKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYD-DPLLKKAKTSGTGAAASPYVVAII 374

Query: 363 SHGVRVVPHFXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCL 422
           + G++ +PH                                 AP+     +R G P   L
Sbjct: 375 NSGIKALPHIFNACVLMFVFSACNSDLYVASRTLYGLAIDNKAPKIFAVTNRWGVPYYSL 434

Query: 423 LVSCVFGLLSFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADE 482
           L+S  F LL++++ S     +F + + +  +  L +W SI ++++   RA+  Q      
Sbjct: 435 LMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWISILITYLCFFRAVKAQNVDRSR 494

Query: 483 LGYVAWTGVWGAYYAMAMIVAI-LVGQFWVAISPVGSNKLDANNFFENYLAMPILIFLYL 541
             Y A    +G+Y+ +A  + I  +  F V +    ++  D  NF   Y+ +P+ +  Y 
Sbjct: 495 FAYRAPFQPYGSYFTLAFCILIAFIKNFTVFL----NHHFDYKNFITGYIGIPVFVISYF 550

Query: 542 GYKI--WTRDWRLLIPSSEVDLVAHRKIFDAEVLRHEQLEEKEQLRHAPWTTRLAN 595
           GYK    T+ W+      EVDL   +   D E       EE+ ++  A    RL N
Sbjct: 551 GYKFVKKTKIWK----PEEVDLYTFKAAIDEE-------EEQGKIADAERRERLKN 595

>Suva_5.4 Chr5 complement(7388..9160) [1773 bp, 590 aa] {ON} YEL063C
           (REAL)
          Length = 590

 Score =  241 bits (616), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 154/514 (29%), Positives = 252/514 (49%), Gaps = 15/514 (2%)

Query: 73  ESASKHKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYC 132
           E   ++  +K+ ++ RH+ MI+L   IGTG+ +G    L N GP   +I Y  + S+ Y 
Sbjct: 76  EGEVQNAEVKRELKQRHIGMIALGGTIGTGLFIGLSTPLTNAGPVGALISYLFMGSLAYS 135

Query: 133 VIQSASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKY 192
           V QS  E+A  +  +   F  +    +  AFG +  ++Y   W     LEL      I++
Sbjct: 136 VTQSLGEMAT-FIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAVTFALELSVVGQVIQF 194

Query: 193 WNQTINPDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGGAG 252
           W   +   A+++IF+V++ A+N                 KV+             CG AG
Sbjct: 195 WTYAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCG-AG 253

Query: 253 NDGYLGARYWHDPGAF-RGSDSIN----RFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNP 307
             G +G RYW +PGA+  G  S N    RF G V+ L+NAAF + G E   +TA E  NP
Sbjct: 254 VTGPVGFRYWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTFQGTELVGITAGEAANP 313

Query: 308 QKSIRSASKKLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSATHASPFVIAVASHGVR 367
           +K++  A KK+V+RIL  YI + + +G LVP+N D  L S  S    SPF+IA+ + G +
Sbjct: 314 RKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYN-DPKLTSATSYVSTSPFIIAIENSGTK 372

Query: 368 VVPHFXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVSCV 427
           V+PH                             +   AP+F +   + G P + +  + +
Sbjct: 373 VLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKGGVPYIAVFATSI 432

Query: 428 FGLLSFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYVA 487
           FG L+++  S     VF WLL I+G++  F W  IS+SH+R  +A+  +G S DEL + A
Sbjct: 433 FGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKYRGISRDELPFKA 492

Query: 488 WTGVWGAYYAMAMIVAILVGQFWVAISPVGSNKLDANNFFENYLAMPILIFLYLGYKIWT 547
                 AYYA   +V I++ Q + + +P      +  NF   Y+++ + + +++ +++  
Sbjct: 493 KLMPGLAYYATFFMVVIILIQGFTSFTPT----FNGVNFLAAYISVFLFLAIWILFELIF 548

Query: 548 RDWRLLIPSSEVDLVAHRKIFDAEVLRHEQLEEK 581
           R  R +    +VD+ + R+  D E +  E+ E K
Sbjct: 549 RC-RFVWKIEDVDIDSDRR--DIEAIVWEEPEPK 579

>TBLA0A05460 Chr1 (1348452..1350278) [1827 bp, 608 aa] {ON} Anc_1.84
           YNL268W
          Length = 608

 Score =  241 bits (616), Expect = 4e-71,   Method: Compositional matrix adjust.
 Identities = 155/510 (30%), Positives = 243/510 (47%), Gaps = 13/510 (2%)

Query: 73  ESASKHKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYC 132
           E+  K   +K+ ++PRH+ MI+L   IGTG+ +G    L   GP   +I Y  + +++Y 
Sbjct: 94  EAEFKDTKVKRALKPRHIGMIALGGTIGTGLFIGISDPLQKSGPVGSLIAYIFMGTVVYF 153

Query: 133 VIQSASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKY 192
           V Q+  E+A  +  +      + S  +  AFG S  ++Y   W     +E+      I++
Sbjct: 154 VTQALGEMAT-FIPVTSSITVFSSRFLSPAFGVSNGYLYWFNWAITYAVEISVVGQVIEF 212

Query: 193 WNQTINPDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGGAG 252
           W   +   A+++IF+V++ A+N                 KVL             CGG+ 
Sbjct: 213 WTTKVPLAAWISIFWVLVTALNFFPVSVYGEIEFWVASVKVLAIVGYLIYALVIVCGGS- 271

Query: 253 NDGYLGARYWHDPGAFRG---SDSIN--RFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNP 307
             G +G RYW    A  G   S   N  RF G VA L+NAAF Y G E   +TA E  NP
Sbjct: 272 KQGPIGFRYWRHGYAMGGGMISKDKNEARFLGWVASLINAAFTYQGTELVGITAGEAANP 331

Query: 308 QKSIRSASKKLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSATHASPFVIAVASHGVR 367
           +KS+  A  K+V+RI+  YI++   +G LVP+N D  L S  S   +SPFVI++ + G R
Sbjct: 332 RKSVPRAINKVVFRIVIFYILSLFFIGLLVPYN-DPKLNSATSYIASSPFVISIENAGTR 390

Query: 368 VVPHFXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVSCV 427
            +PH                               G AP+    V   G P L ++V+ +
Sbjct: 391 ALPHIFNAIIMITIISAANSNVYVSSRVLYSLALSGHAPKIFARVTPQGVPFLGVIVTAL 450

Query: 428 FGLLSFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYVA 487
            GLL+F+  +      F WL+ IS L+ L  W  IS+SH+R   A+  +G S D+L + A
Sbjct: 451 MGLLAFLVVNNNANEAFNWLINISTLAGLCAWLFISMSHLRFMEALKYRGISRDDLPFKA 510

Query: 488 WTGVWGAYYAMAMIVAILVGQFWVAISPVGSNKLDANNFFENYLAMPILIFLYLGYKIWT 547
               +G+YYA   I  I+  Q + A SP    K D  +FF  Y+++ +L  L++G +++ 
Sbjct: 511 RFMPYGSYYACFFITVIIFIQGFTAFSP----KFDVASFFTAYISLILLAVLFIGCQLYY 566

Query: 548 RDWRLLIPSSEVDLVAHRKIFDAEVLRHEQ 577
           R  R      ++D+   R+  D  V   ++
Sbjct: 567 R-CRFFWKVEDIDIDTDRREIDEIVWEDDE 595

>TDEL0C06180 Chr3 (1120158..1121909) [1752 bp, 583 aa] {ON} Anc_1.83
           YEL063C
          Length = 583

 Score =  240 bits (612), Expect = 8e-71,   Method: Compositional matrix adjust.
 Identities = 158/509 (31%), Positives = 244/509 (47%), Gaps = 13/509 (2%)

Query: 73  ESASKHKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYC 132
           E       +K+ ++ RH+ MI+L   IGTG+ +G    L N GP   +I Y  +++++Y 
Sbjct: 69  EGQVHEAEVKRALKQRHIGMIALGGTIGTGLFIGISTPLSNAGPVGGLIAYLFMATLVYS 128

Query: 133 VIQSASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKY 192
           V+QS  E+A  +  +   F  + S  +  AFG +  ++Y   W     LEL      I++
Sbjct: 129 VVQSLGEMAT-FIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEF 187

Query: 193 WNQTINPDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGGAG 252
           W   +   A++TIF+V+L   N                 KV+             CG AG
Sbjct: 188 WTTAVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCG-AG 246

Query: 253 NDGYLGARYWHDPGAF-----RGSDSINRFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNP 307
             G +G RYW +PGA+         +  RF G V+ L+NAAF Y G E   +TA E  NP
Sbjct: 247 ITGPVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANP 306

Query: 308 QKSIRSASKKLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSATHASPFVIAVASHGVR 367
           +KS+  A KK+V+RIL  Y   A+ +G LVP+N D  L S  S   +SPF+IA+ + G +
Sbjct: 307 RKSVPRAIKKVVFRILVFYYPIAVFIGLLVPYN-DPKLNSSDSYVSSSPFIIAIENSGTK 365

Query: 368 VVPHFXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVSCV 427
           V+PH                             +   AP F    +  G P   +  +  
Sbjct: 366 VLPHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSA 425

Query: 428 FGLLSFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYVA 487
           FG L+++  S    + F WLL I+G++  FTW  IS  H+R  +A+  +G S D+L + A
Sbjct: 426 FGALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKA 485

Query: 488 WTGVWGAYYAMAMIVAILVGQFWVAISPVGSNKLDANNFFENYLAMPILIFLYLGYKIWT 547
               W AYYA+  +V I++ Q + A +P  S      +F   Y+++ + I ++LG +IW 
Sbjct: 486 KFMPWLAYYALFFMVVIILIQGFTAFAPTFSGV----DFAAAYVSVFLFIAIWLGAQIWF 541

Query: 548 RDWRLLIPSSEVDLVAHRKIFDAEVLRHE 576
           R  R+     EVD+   R+  +A V   E
Sbjct: 542 RC-RIFHRLDEVDIDTDRRDIEAVVWDDE 569

>YEL063C Chr5 complement(31694..33466) [1773 bp, 590 aa] {ON}
           CAN1Plasma membrane arginine permease, requires
           phosphatidyl ethanolamine (PE) for localization,
           exclusively associated with lipid rafts; mutation
           confers canavanine resistance
          Length = 590

 Score =  240 bits (613), Expect = 9e-71,   Method: Compositional matrix adjust.
 Identities = 153/514 (29%), Positives = 248/514 (48%), Gaps = 15/514 (2%)

Query: 73  ESASKHKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYC 132
           E   ++  +K+ ++ RH+ MI+L   IGTG+ +G    L N GP   +I Y  + S+ Y 
Sbjct: 76  EGEVQNAEVKRELKQRHIGMIALGGTIGTGLFIGLSTPLTNAGPVGALISYLFMGSLAYS 135

Query: 133 VIQSASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKY 192
           V QS  E+A  +  +   F  +    +  AFG +  ++Y   W     LEL      I++
Sbjct: 136 VTQSLGEMAT-FIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQF 194

Query: 193 WNQTINPDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGGAG 252
           W   +   A+++IF+V++  +N                 KVL             CG AG
Sbjct: 195 WTYKVPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCG-AG 253

Query: 253 NDGYLGARYWHDPGAF-----RGSDSINRFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNP 307
             G +G RYW +PGA+         +  RF G V+ L+NAAF + G E   +TA E  NP
Sbjct: 254 VTGPVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANP 313

Query: 308 QKSIRSASKKLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSATHASPFVIAVASHGVR 367
           +KS+  A KK+V+RIL  YI + + +G LVP+N D  L    S    SPF+IA+ + G +
Sbjct: 314 RKSVPRAIKKVVFRILTFYIGSLLFIGLLVPYN-DPKLTQSTSYVSTSPFIIAIENSGTK 372

Query: 368 VVPHFXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVSCV 427
           V+PH                             +   AP+FL+   + G P + + V+  
Sbjct: 373 VLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAA 432

Query: 428 FGLLSFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYVA 487
           FG L+++  S   + VF WLL I+G++  F W  IS+SH+R  +A+  +G S DEL + A
Sbjct: 433 FGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKA 492

Query: 488 WTGVWGAYYAMAMIVAILVGQFWVAISPVGSNKLDANNFFENYLAMPILIFLYLGYKIWT 547
                 AYYA   +  I++ Q + A +P    K +  +F   Y+++ + + +++ ++   
Sbjct: 493 KLMPGLAYYAATFMTIIIIIQGFTAFAP----KFNGVSFAAAYISIFLFLAVWILFQCIF 548

Query: 548 RDWRLLIPSSEVDLVAHRKIFDAEVLRHEQLEEK 581
           R  R +    +VD+ + R+  D E +  E  E K
Sbjct: 549 RC-RFIWKIGDVDIDSDRR--DIEAIVWEDHEPK 579

>Kpol_358.3 s358 (7369..9096) [1728 bp, 575 aa] {ON} (7369..9096)
           [1728 nt, 576 aa]
          Length = 575

 Score =  239 bits (610), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 157/519 (30%), Positives = 255/519 (49%), Gaps = 21/519 (4%)

Query: 81  LKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYCVIQSASEL 140
           LK+ ++ RH+ MI++   +GTG+L+G G +L  GGPAS++I Y+ V  +++ V+    E+
Sbjct: 50  LKKELKARHISMIAIGGSLGTGLLIGTGTALRTGGPASILIAYSFVGILVFFVMACLGEM 109

Query: 141 AIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKYW--NQTIN 198
           A  Y  L  GF +Y +   D A GF+V + Y  ++  + P +L   ++ I+YW   +T+N
Sbjct: 110 AT-YIPL-DGFTSYATRYCDPALGFAVGYCYLFKYFIITPNQLTAGALVIQYWIDRETVN 167

Query: 199 PDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGGAGNDGYLG 258
           P  ++TIF VV+V IN              +  K+++             GG  N   LG
Sbjct: 168 PGVWITIFLVVIVIINTVGVRYFGEFEFWLSSFKIMVMFGVILFLFIIMLGGGPNHDRLG 227

Query: 259 ARYWHDPGAFRG-SDSIN----RFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRS 313
            RYW +PGAF+  S+SI     +F   VAV V A FAY G E + + AAE +NP+++I  
Sbjct: 228 FRYWKNPGAFKPYSESITGSKGKFVSFVAVFVYALFAYLGIELTGIVAAEAENPRRNIPR 287

Query: 314 ASKKLVYRILGIYIMTAILLGFLVPWNSDELL--GSGGSATHASPFVIAVASHGVRVVPH 371
           A K  +YRI+  YI+T  LLG  V +N   LL      ++  ASPFV+A+ + GVR +PH
Sbjct: 288 AIKLTMYRIILFYIVTIFLLGMCVAYNDPRLLAAAHASTSAAASPFVVAIQNSGVRALPH 347

Query: 372 FXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVSCVFGLL 431
                                          G AP+     +R G P   L    +F LL
Sbjct: 348 IFNVCVLIFVFSACNSDLYVGTRSLYSLAIDGKAPKLFAKTNRWGVPYNALFGCFLFCLL 407

Query: 432 SFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYVAWTGV 491
           +++  S     +F + + +  +  + +W SI ++++   RA   Q    +   Y A    
Sbjct: 408 AYMNVSSGSAQIFNYFVNVVSIFGILSWISILITYIFFYRACIAQNVDRNSFAYRAPFQP 467

Query: 492 WGAYYAMAMIVAI-LVGQFWVAISPVGSNKLDANNFFENYLAMPILIFLYLGYKIWTRDW 550
           +GAY  +   V I  +  F V I      + D  +F   Y+ +P+ +  Y GYKI  +  
Sbjct: 468 YGAYITLFFCVLIAFIKNFTVFI-----GEFDYKSFITGYIGLPLYVIFYFGYKIIYKT- 521

Query: 551 RLLIPSSEVDLVAHRKIFDAEVL--RHEQLEEKEQLRHA 587
             L+ + E DL + ++  D E    + ++ E KE+L+++
Sbjct: 522 -KLVKAEEADLYSFKEAIDREEAEGKIKEAEAKERLKNS 559

>NCAS0A00600 Chr1 complement(109246..110880) [1635 bp, 544 aa] {ON} 
          Length = 544

 Score =  238 bits (607), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 154/529 (29%), Positives = 257/529 (48%), Gaps = 18/529 (3%)

Query: 73  ESASKHKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYC 132
           +   K + +K+ ++ RH+ MI+L   IGTG+ +G  + L   GP   +I Y  + ++++ 
Sbjct: 27  DDQEKQQDVKRELKKRHISMIALGGTIGTGLFLGIARPLIIAGPIGALIAYLFMGTVVFS 86

Query: 133 VIQSASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKY 192
           V QS  E+   +  +   F  +    +  AFG +  ++Y   W     LEL      I++
Sbjct: 87  VTQSLGEMCT-FIPVTASFTVFAQRFLSPAFGAANGYMYWFSWAMTFALELSVVGQIIQF 145

Query: 193 WNQTINPDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGGAG 252
           W   +   A+++I +V+L   N                 KVL               GAG
Sbjct: 146 WTMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVL-AILGFIIYGICIICGAG 204

Query: 253 NDGYLGARYWHDPGAFRG---SDSIN--RFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNP 307
             G +G RYW +PG +     S ++N  RF G V+ L+NAAF + G E   +TA E Q P
Sbjct: 205 VTGPVGFRYWKNPGPWGMGIISSNVNEARFFGWVSSLINAAFTFQGTELVGITAGEVQEP 264

Query: 308 QKSIRSASKKLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSATHASPFVIAVASHGVR 367
           +K++  A KK+V+RIL  YI + +++G LVP+N D  L S  S   +SPF+I + + G +
Sbjct: 265 RKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYN-DPKLQSNDSYVSSSPFIITIQNAGTK 323

Query: 368 VVPHFXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVSCV 427
           ++PH                             +   AP+F     + G P + +L + +
Sbjct: 324 ILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTNTSKAGVPYVTVLFTSM 383

Query: 428 FGLLSFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYVA 487
           FG L+++  +   +  FTWLL I G++  F W  IS SH+R  +A+  +G S ++L Y A
Sbjct: 384 FGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKALKQRGISRNDLPYKA 443

Query: 488 WTGVWGAYYAMAMIVAILVGQFWVAISPVGSNKLDANNFFENYLAMPILIFLYLGYKIWT 547
               W AYYA+  +V I+V Q + + +P    K    NFF  Y+++ + I  ++ ++IW 
Sbjct: 444 MLMPWLAYYAVFFMVIIIVIQGFTSFAP----KFKVANFFAAYISVFLFIIFWVAFQIWF 499

Query: 548 RDWRLLIPSSEVDLVAHRKIFDAEVLRHEQLEEKEQLRHAPWTTRLANF 596
           +  RL+    +VDL   R+  + EV   + +E+K +     W  R  N+
Sbjct: 500 KC-RLVWKLQDVDLDTDRRDIEEEVW-SDDVEDKNK----NWWDRFWNY 542

>KAFR0D03940 Chr4 complement(767673..769466) [1794 bp, 597 aa] {ON}
           Anc_1.84 YNL268W
          Length = 597

 Score =  239 bits (609), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 153/570 (26%), Positives = 261/570 (45%), Gaps = 22/570 (3%)

Query: 19  SFDSVEVLKEESPRSDSRSDGLFRRFADSFRRHEAHNXXXXXXXXXXXXXLTPIESASKH 78
           S+D+ E++  E   +DS+ + + ++  +S      H                  E+  + 
Sbjct: 26  SYDNFEII--EIQHNDSKDNSIKKKIPNSELASLTHAYSRSRVEPEHDEDAE--EADYED 81

Query: 79  KTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYCVIQSAS 138
           K +K+ ++ RH+ MI+L   IGTG+ VG    L + GP   +I Y  + S++Y V Q+  
Sbjct: 82  KQVKRELKQRHIGMIALGGTIGTGLFVGIATPLADAGPVGALIAYIFMGSIVYFVTQALG 141

Query: 139 ELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKYWNQTIN 198
           E+A  +  +      +    +  AFG +  ++Y   W     +E+      I+YW   + 
Sbjct: 142 EMAT-FIPVTSSITVFSQRFLSPAFGVANGYMYWFNWAITFAVEISVVGQVIQYWTDAVP 200

Query: 199 PDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGGAGNDGYLG 258
             A++ IF+V++  +N                 KV+             CGG+   G +G
Sbjct: 201 LAAWIAIFWVLVTLMNFFPVKVYGEVEFWVAFMKVIAIVGYLLYALIIVCGGSKKQGPIG 260

Query: 259 ARYWHDPGAF-----------RGSDSINRFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNP 307
            RYW +PGA+             S    RF G VA L+NAAF Y G E   +TA E  NP
Sbjct: 261 FRYWRNPGAWGNGLTSDGEPIYSSKYEGRFLGWVASLINAAFTYQGTELVGITAGEAANP 320

Query: 308 QKSIRSASKKLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSATHASPFVIAVASHGVR 367
           +K++  A  K+V+RI+  YIM+   +G LVP+ +D  L    +   +SPFVI++ + G +
Sbjct: 321 RKTVPRAINKVVFRIVLFYIMSLFFIGLLVPF-TDSRLSDDTTVIASSPFVISIENAGTK 379

Query: 368 VVPHFXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVSCV 427
           ++P                                  AP+    V R G P + ++ + +
Sbjct: 380 ILPDIFNAIVMVTVLSAANSNVYVGSRVLYSLAHTKVAPKIFARVTRQGVPFMGVICTSL 439

Query: 428 FGLLSFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYVA 487
            GLL+F+       T F WL+ IS L+ L  W  ISL+HVR  + +  +G S D+L + A
Sbjct: 440 LGLLAFLVVDNNANTAFNWLVDISTLAGLCAWLFISLAHVRFMQVLKQRGISRDDLPFKA 499

Query: 488 WTGVWGAYYAMAMIVAILVGQFWVAISPVGSNKLDANNFFENYLAMPILIFLYLGYKIWT 547
               WG+YYA   +  I+  Q + A SP      D   FF +Y+++ +L  +++G +++ 
Sbjct: 500 KFMPWGSYYAAFWVFVIIFVQGFQAFSP----HFDVTTFFTDYISLILLAVVFIGAQLYY 555

Query: 548 RDWRLLIPSSEVDLVAHRKIFDAEVLRHEQ 577
           R  R L    +VD+ + R+  +  +   ++
Sbjct: 556 R-CRFLWKLEDVDIDSDRREIEDAIWEDDE 584

>NDAI0A00610 Chr1 complement(113913..115610) [1698 bp, 565 aa] {ON} 
          Length = 565

 Score =  238 bits (607), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 149/495 (30%), Positives = 245/495 (49%), Gaps = 13/495 (2%)

Query: 77  KHKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYCVIQS 136
           +   +K+ ++ RH+ MI+L   IGTG+ +G    L N GP   +I Y  + +++Y V QS
Sbjct: 55  REAEVKRELKQRHIGMIALGGTIGTGLFIGLSTPLTNAGPVGALIAYLFMGTLVYSVTQS 114

Query: 137 ASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKYWNQT 196
             E+A  +  +   F  +    +  +FG +  ++Y   W     LEL      I++W   
Sbjct: 115 LGEMAT-FIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFWTSA 173

Query: 197 INPDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGGAGNDGY 256
           +   A+++IF+V+LVA+N                 KVL             CG AG  G 
Sbjct: 174 VPIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCG-AGVTGP 232

Query: 257 LGARYWHDPGAFRG---SDSIN--RFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSI 311
           +G RYW +PG       + ++N  +F G V+ L+NAAF Y G E   +TA E  NP+KS+
Sbjct: 233 VGFRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSV 292

Query: 312 RSASKKLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSATHASPFVIAVASHGVRVVPH 371
             A KK+V+RIL  YI +   +G LVP+N D  L S  S   ASPF+I++ + G  ++PH
Sbjct: 293 PRAIKKVVFRILFFYIGSLFFIGLLVPYN-DPKLTSDDSYVAASPFIISIQNSGTPILPH 351

Query: 372 FXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVSCVFGLL 431
                                        +   APR L+  ++ G P + ++ + +FG L
Sbjct: 352 IFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFGAL 411

Query: 432 SFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYVAWTGV 491
           +++  S   E  F WLL I+G++  F+W  IS+SHVR  +A+  +G S D+L + A    
Sbjct: 412 AYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKFMP 471

Query: 492 WGAYYAMAMIVAILVGQFWVAISPVGSNKLDANNFFENYLAMPILIFLYLGYKIWTRDWR 551
             AYYA+  +  I++ Q + +  P      D  +F   Y++  + I +++ +++W R  R
Sbjct: 472 GLAYYAIFFMTLIIIIQGFTSFCP----SFDGIDFLAAYISCFLFIAIWIVFQLWFRC-R 526

Query: 552 LLIPSSEVDLVAHRK 566
           L+    +VD+   R+
Sbjct: 527 LIWKIEDVDIDTDRR 541

>KNAG0F00480 Chr6 (73545..75338) [1794 bp, 597 aa] {ON} 
          Length = 597

 Score =  239 bits (609), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 148/511 (28%), Positives = 247/511 (48%), Gaps = 14/511 (2%)

Query: 72  IESASKHKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLY 131
           +E+      +K+ ++ RH+ MI+L   IGTG+ VG    L   GP   +I Y  + +++Y
Sbjct: 83  LEAEVHETKVKRALKQRHIGMIALGGTIGTGLFVGISTPLSVAGPVGSLIAYIFMGTIIY 142

Query: 132 CVIQSASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIK 191
            V QS  E+A  +  +      +    +  AFG +  ++Y   W     +E+      I+
Sbjct: 143 FVTQSLGEMAT-FIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEISVIGQVIQ 201

Query: 192 YWNQTINPDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGGA 251
           YW + +   A++ IF+V++  +N                 KVL             CGG+
Sbjct: 202 YWTKAVPLAAWIAIFWVLVTLMNFFPVKVYGEVEFWIAFVKVLAIVGYLIYALVIVCGGS 261

Query: 252 GNDGYLGARYWHDPGAF-----RGSDSINRFKGIVAVLVNAAFAYGGAEFSVLTAAEQQN 306
            + G +G RYW  PGAF       + +  +F G VA L+NAAF Y G E   +TA E  N
Sbjct: 262 -HQGPIGFRYWRHPGAFGPGIISKNKNTGKFLGWVASLINAAFTYQGTELVGITAGEAAN 320

Query: 307 PQKSIRSASKKLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSATHASPFVIAVASHGV 366
           P+K++  A  K+V+RI+  YIM+   +G L+P+N D+ L +  +   +SPFVI++ +   
Sbjct: 321 PRKTVPRAINKVVFRIVLFYIMSLFFIGMLLPYN-DKRLSAQDAVIASSPFVISIKNAHT 379

Query: 367 RVVPHFXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVSC 426
           +V+P                                G AP+  +YV R G P L ++ + 
Sbjct: 380 KVLPDIFNAVVMVTVMSAANSNVYVGSRVLYALALTGNAPKQFSYVTRYGVPYLGVVCTA 439

Query: 427 VFGLLSFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYV 486
             GLL+F+  +    T F WL+ IS L+ L  W  ISL+H+R  +A+  +G S D+L + 
Sbjct: 440 SLGLLAFLVVNNNANTAFNWLINISTLAGLCAWLFISLAHIRFMQALKFRGISRDDLPFK 499

Query: 487 AWTGVWGAYYAMAMIVAILVGQFWVAISPVGSNKLDANNFFENYLAMPILIFLYLGYKIW 546
           A    WGAYYA   +  I+  Q + A  P      D + FF +Y+++ +L  L +G +++
Sbjct: 500 AKLMPWGAYYAAFFVTVIIFIQGYQAFCP-----WDVSTFFTSYISLILLAVLVVGCQLY 554

Query: 547 TRDWRLLIPSSEVDLVAHRKIFDAEVLRHEQ 577
            R  R L+   ++D+   R+  ++ V   ++
Sbjct: 555 YRG-RFLLKLEDIDIDTDRREIESIVWEDDE 584

>SAKL0C02684g Chr3 complement(251988..253754) [1767 bp, 588 aa] {ON}
           similar to uniprot|P04817 Saccharomyces cerevisiae
           YEL063C CAN1 Plasma membrane arginine permease requires
           phosphatidyl ethanolamine (PE) for localization
           exclusively associated with lipid rafts mutation confers
           canavanine resistance
          Length = 588

 Score =  238 bits (607), Expect = 6e-70,   Method: Compositional matrix adjust.
 Identities = 145/492 (29%), Positives = 240/492 (48%), Gaps = 13/492 (2%)

Query: 73  ESASKHKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYC 132
           E   +   +K+ ++PRH+ MI+L   IGTG+ +G    L + GP   +I Y  + ++ Y 
Sbjct: 74  EGNVQDAEVKRALKPRHISMIALGGTIGTGLFIGISSPLADAGPVGALIAYMFMGTIAYF 133

Query: 133 VIQSASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKY 192
           V QS  E+A  +  +   F  +    +  AFG +  ++Y   W     LEL      I++
Sbjct: 134 VTQSLGEMAT-FIPVTSSFTVFTQRFLSPAFGVANGYLYWFSWCITFALELSVVGQIIQF 192

Query: 193 WNQTINPDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGGAG 252
           W   +   A++ IF+V+L   N               C KVL             CG AG
Sbjct: 193 WTFAVPLGAWIAIFWVILTTSNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFIMVCG-AG 251

Query: 253 NDGYLGARYWHDPGAFRG---SDSIN--RFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNP 307
             G +G RYW +PG +     S  +N  RF G V+ L+NAAF Y G E   +TA E +NP
Sbjct: 252 KTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLINAAFTYQGTELVGITAGESKNP 311

Query: 308 QKSIRSASKKLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSATHASPFVIAVASHGVR 367
           ++++  A  K+ +RIL  YI++ + +G LVP+N D  L S  S   +SPFVIA+ + G +
Sbjct: 312 RRTVPRAINKVFFRILFFYILSLLFIGLLVPFN-DPKLKSEDSYISSSPFVIAIENSGTK 370

Query: 368 VVPHFXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVSCV 427
           V+PH                             +   AP+      + G P + +L +  
Sbjct: 371 VLPHIFNAVILSTIISAGNSNIYVGSRVLYGLAKNKLAPKVFARATKDGVPYISVLGTAA 430

Query: 428 FGLLSFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYVA 487
           FG L+++  S   + VF WLL I+ ++  F W  ISL+H+R  + +  +  S ++L + A
Sbjct: 431 FGFLAYLNLSNSAQKVFDWLLNITAIAGFFAWLFISLAHIRFMQVLKDRNMSRNDLPFKA 490

Query: 488 WTGVWGAYYAMAMIVAILVGQFWVAISPVGSNKLDANNFFENYLAMPILIFLYLGYKIWT 547
               WGAYY+   I  I++ Q + A +P    K + +NFF  Y+++ + + +++ ++I  
Sbjct: 491 KFMPWGAYYSAFFISLIIIIQGFTAFAP----KFNVSNFFAAYISVFLFLAIWVVFQIRF 546

Query: 548 RDWRLLIPSSEV 559
           R  R ++  ++V
Sbjct: 547 RT-RFILTKNDV 557

>SAKL0C02728g Chr3 (255022..256710) [1689 bp, 562 aa] {ON} similar
           to uniprot|P32487 Saccharomyces cerevisiae YNL268w LYP1
           lysine-specific high-affinity permease
          Length = 562

 Score =  236 bits (603), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 146/481 (30%), Positives = 235/481 (48%), Gaps = 12/481 (2%)

Query: 73  ESASKHKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYC 132
           E   +   +K+ ++PRH+ MI+L   IGTG+ VG    L   GP   +I Y  + S++Y 
Sbjct: 48  EGDCRETEVKRALKPRHISMIALGGTIGTGLFVGIASPLSESGPVGALIAYIFIGSIVYF 107

Query: 133 VIQSASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKY 192
           V QS  E+A  +  +      +    +  AFG +  ++Y   W     +E+      I+Y
Sbjct: 108 VTQSLGEMAT-FIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEIAVVGQVIQY 166

Query: 193 WNQTINPDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGGAG 252
           W   +   A++ IF+V++   N                 KV+             CGG+ 
Sbjct: 167 WTDAVPLAAWIAIFWVLVTLANFFPVKFYGEVEFWVASVKVIAIVGYLIYALVIVCGGS- 225

Query: 253 NDGYLGARYWHDPGAFRG---SDSIN--RFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNP 307
           + G +G RYW +PG +     S  +N  RF G V+ L+NAAF Y G E   +TA E  NP
Sbjct: 226 HQGPIGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANP 285

Query: 308 QKSIRSASKKLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSATHASPFVIAVASHGVR 367
           +K++  A  K+ +RIL  YI++   +G LVP++ D  L +  +   +SPFVI++ + G +
Sbjct: 286 RKTVPRAINKVFFRILFFYILSLFFIGLLVPYD-DLRLSNTTAVIASSPFVISIQNAGTK 344

Query: 368 VVPHFXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVSCV 427
           V+PH                               G AP+   YV + G P L ++V+ +
Sbjct: 345 VLPHIFNAIVMITIISAANSNVYVGSRVLYSLALSGNAPKQFGYVTKQGVPYLGVIVTAL 404

Query: 428 FGLLSFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYVA 487
            GLL+F+  +      F WL+ IS L+ L  W  ISLSHVR  + +  +G S ++L + A
Sbjct: 405 LGLLAFLVVNNNANEAFNWLVNISTLAGLCAWLFISLSHVRFMQCLKHRGISREDLPFKA 464

Query: 488 WTGVWGAYYAMAMIVAILVGQFWVAISPVGSNKLDANNFFENYLAMPILIFLYLGYKIWT 547
               WGAYYA   I  I++ Q + A +P    K   ++FF +Y+++ +L  L+LG +++ 
Sbjct: 465 KLMPWGAYYAAFFIGVIIIIQGFKAFTP----KFRVSDFFTSYISLILLAVLFLGCQLFY 520

Query: 548 R 548
           R
Sbjct: 521 R 521

>TBLA0A05450 Chr1 complement(1345808..1347628) [1821 bp, 606 aa]
           {ON} Anc_1.83 YEL063C
          Length = 606

 Score =  238 bits (606), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 148/484 (30%), Positives = 231/484 (47%), Gaps = 15/484 (3%)

Query: 77  KHKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYCVIQS 136
           +   +K+ ++PRH+ MI+L   IGTG+ +G    + N GP   +I Y  + ++++ V QS
Sbjct: 98  EEAQVKRELKPRHIGMIALGGTIGTGLFIGIATPIQNAGPVGSLIAYIFMGTLVFSVTQS 157

Query: 137 ASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKYWNQT 196
             E+A  +  +   F  + S  V   FG +  ++Y   W     LEL      I++W   
Sbjct: 158 LGEMAT-FIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQVIEFWTFK 216

Query: 197 INPDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGGAGNDGY 256
           +   A+++IF+V++V +N                 KV+             CG AG  G 
Sbjct: 217 VPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMVCG-AGITGP 275

Query: 257 LGARYWHDPGAF-----RGSDSINRFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSI 311
           +G RYW  PG +         +  RF G V+ L+NAAF Y G E   +TA E  NP+KS+
Sbjct: 276 VGFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSV 335

Query: 312 RSASKKLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSATHASPFVIAVASHGVRVVPH 371
             A KK+  RIL  YI++   +G LVP+N D  L S  S   ASPF+IA+ + G +V+PH
Sbjct: 336 PRAIKKVSVRILLFYILSLFFIGLLVPYN-DPKLSSTDSYVSASPFIIAIQNSGTKVLPH 394

Query: 372 FXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVSCVFGLL 431
                                            AP+F     R G P + +L +  FG L
Sbjct: 395 IFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQKT-RNGVPFIAVLFTAAFGAL 453

Query: 432 SFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYVAWTGV 491
           +++  S   +  F WLL I+G++  F W SIS+SH+R  + +  +G S D+L Y A    
Sbjct: 454 AYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPYKAALMP 513

Query: 492 WGAYYAMAMIVAILVGQFWVAISPVGSNKLDANNFFENYLAMPILIFLYLGYKIW--TRD 549
             AYY    +  I++ Q + A +P    K D+  F   Y++  + +F+Y+  + +  TR 
Sbjct: 514 GLAYYGAFFVTLIILIQGFTAFAP----KFDSTAFLTAYISCFLFLFIYIVAQCYFRTRL 569

Query: 550 WRLL 553
           WR L
Sbjct: 570 WRTL 573

>KAFR0B06430 Chr2 complement(1333415..1335196) [1782 bp, 593 aa]
           {ON} 
          Length = 593

 Score =  237 bits (605), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 159/530 (30%), Positives = 244/530 (46%), Gaps = 32/530 (6%)

Query: 81  LKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYCVIQSASEL 140
           LK+N++ RHV MI++   +GTG+L+G G SL   GP SL I Y+ V  +++  +    E+
Sbjct: 64  LKKNLKARHVSMIAIGGSLGTGLLIGTGTSLAAAGPGSLFITYSFVGVLVFFTMSCLGEM 123

Query: 141 AIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKYW--NQTIN 198
           A        GF +Y S  VD A GF+V + Y  ++L +   +L   +M ++YW    T+N
Sbjct: 124 AAFIP--LDGFTSYASRYVDPALGFAVGYSYLCKYLILPANQLTAGAMVVQYWVDRDTLN 181

Query: 199 PDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGGAGNDGYLG 258
           P  F+TIF +++V IN              +  KVL+             GG  N   LG
Sbjct: 182 PGVFITIFLILIVTINIFGVKIFGEFEFWLSSFKVLVMLGLILLMFIIMLGGGPNHDRLG 241

Query: 259 ARYWHDPGAFR--------GSDSINRFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNPQKS 310
            RYW DPG+F+         S S  +F    +  V A F Y G E + + AAE QNP+K+
Sbjct: 242 FRYWRDPGSFKPYSSSIISISGSTGKFVSFTSCFVYALFCYLGIELTGIVAAEAQNPRKN 301

Query: 311 IRSASKKLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSATH--ASPFVIAVASHGVRV 368
           I  A K  +YRI+  Y++T +LL   V +N   LL + G +T   ASPFV+A+ + G+ +
Sbjct: 302 IPKAIKLTMYRIIIFYVITILLLTMCVAYNDPLLLKATGQSTSAAASPFVVAIENSGINI 361

Query: 369 VPHFXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVSCVF 428
           +PH                                 AP+F    ++ G P   L  S  F
Sbjct: 362 LPHIFNVCVLAFVLSAANSDLYVASRSLYSLAIDNKAPKFFGKTNKWGIPYWSLAFSTAF 421

Query: 429 GLLSFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYVAW 488
             L+++  S     VF + +    +  + +W  I ++++   +A   QG       YVA 
Sbjct: 422 SCLAYMNVSSSASNVFNYFVNAVSIFGVISWICILVTYIHFDKACKAQGMDKSNFTYVAP 481

Query: 489 TGVWGAYYAMAMIVAI-LVGQFWVAISPVGSNKLDANNFFENYLAMPILIFLYLGYKI-- 545
              +GAY+A+     + LV  F V +      + D  NF   Y+ +P+    ++GYKI  
Sbjct: 482 WQPYGAYFALFFCCVLALVKNFTVFL----GGQFDYKNFITGYIGIPVFFICFVGYKIVY 537

Query: 546 WTRDWRLLIPSSEVDLVAHRKIFDAEVLRHEQLEEKEQLRHAPWTTRLAN 595
            T+  R      EVDLV  + + D E       EE  ++  A    RL N
Sbjct: 538 KTKTHR----PEEVDLVTLKALIDQE-------EEDGKIEDAEREERLKN 576

>NCAS0A00610 Chr1 (111522..113345) [1824 bp, 607 aa] {ON} 
          Length = 607

 Score =  236 bits (602), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 162/562 (28%), Positives = 255/562 (45%), Gaps = 20/562 (3%)

Query: 11  SPDNGVVESFDSVEVLKEESPRSDSRSDGLFRRFADSFRRHEAHNXXXXXXXXXXXXXLT 70
           SPD+       S+E++K E    D +      +F+                         
Sbjct: 36  SPDD------HSIEIIKNEILEKDKKKIAHTNQFSSDIHSITDSLARSRLPHLGDDDDEE 89

Query: 71  PIESASKHKT-LKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSM 129
             E A  H T +K+ ++ RH+ MI+L   IGTG+ VG    L N GP   +I Y  + S+
Sbjct: 90  DAEEAQYHDTEVKRALKQRHIGMIALGGTIGTGLFVGISVPLTNSGPVGSLIAYLFMGSI 149

Query: 130 LYCVIQSASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMT 189
           +Y + QS  E+A  +  +      +    +  AFG +  ++Y   W     +E+      
Sbjct: 150 IYSITQSLGEMAT-FIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEISVVGQV 208

Query: 190 IKYWNQTINPDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCG 249
           I+YW + +   A++ IF+V +  +N                 KVL             CG
Sbjct: 209 IEYWTKKVPLAAWIAIFWVFVTLMNFFPVKVYGEIEFWIAFMKVLAIAGYLLYALIIVCG 268

Query: 250 GAGNDGYLGARYWHDPGAF-----RGSDSINRFKGIVAVLVNAAFAYGGAEFSVLTAAEQ 304
           G+ + G +G RYW +PG +         + +RF G V+ L+NAAF Y G E   +TA E 
Sbjct: 269 GS-SQGPIGFRYWRNPGPWGAGIISKDKNTSRFLGWVSSLINAAFTYQGTELVGITAGEA 327

Query: 305 QNPQKSIRSASKKLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSATHASPFVIAVASH 364
            NP+KS+  A  K+V+RI   YIM+   +G LVP++ D  L S  +   +SPFVI++ + 
Sbjct: 328 ANPRKSVPRAINKVVFRIALFYIMSLFFIGLLVPYD-DPRLSSDSAVVASSPFVISIQNA 386

Query: 365 GVRVVPHFXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLV 424
           G +++P                              + G AP+   YV R G P L +L 
Sbjct: 387 GTKILPDIFNAIVMITVISAANSNVYVGSRVLYALAQTGNAPKQFAYVTRHGVPYLGVLC 446

Query: 425 SCVFGLLSFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELG 484
           +   GLL+F+  +    T F WL+ IS L+ L  W  IS+SH+R  +A+  +G S D+L 
Sbjct: 447 TAALGLLAFLVVNNNANTAFNWLINISTLAGLCAWLFISISHIRFMQALKFRGISRDDLP 506

Query: 485 YVAWTGVWGAYYAMAMIVAILVGQFWVAISPVGSNKLDANNFFENYLAMPILIFLYLGYK 544
           + A    W AYYA   +  I+  Q + A SP      D   FF  Y+++ IL  L++G +
Sbjct: 507 FKAKFMPWAAYYATFFVTVIIFIQGFQAFSP----HFDVTAFFTAYISLIILAVLFIGCQ 562

Query: 545 IWTRDWRLLIPSSEVDLVAHRK 566
           I+ R  R      ++D+   R+
Sbjct: 563 IYYRC-RFFWKLEDIDIDTDRR 583

>TPHA0M00130 Chr13 complement(25769..27604) [1836 bp, 611 aa] {ON} 
          Length = 611

 Score =  236 bits (602), Expect = 5e-69,   Method: Compositional matrix adjust.
 Identities = 153/522 (29%), Positives = 254/522 (48%), Gaps = 23/522 (4%)

Query: 81  LKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYCVIQSASEL 140
           LK++++ RH+ MI++   +GTG+L+G G +L   GPAS++I Y  V ++++  + +  E+
Sbjct: 82  LKKDLKARHISMIAIGGSLGTGLLIGTGTALRTAGPASILIAYTFVGTLVFFTMAALGEM 141

Query: 141 AIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKYW--NQTIN 198
           A  Y  L  GF +Y S   D A GF+V + Y  ++  + P +L  A++ I+YW    T+N
Sbjct: 142 AA-YIPL-DGFTSYASRYCDPALGFAVGYSYLFKYFIITPNQLTAAALVIQYWVDRDTVN 199

Query: 199 PDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGGAGNDGYLG 258
           P  ++TIF VV++AIN              +  K+++             GG  N   LG
Sbjct: 200 PGVWITIFLVVIIAINTIGVKYFGEFEFWLSSFKIMVMIGVMIFLFVIMLGGGPNHDRLG 259

Query: 259 ARYWHDPGAFRG--------SDSINRFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNPQKS 310
            RYW  PGAF+           S  +F   V V V A FAY G E + + AAE +NP+++
Sbjct: 260 FRYWKTPGAFKPYSSSVVNIEGSTGKFVAFVNVFVYALFAYLGIELTGIVAAEAENPRRN 319

Query: 311 IRSASKKLVYRILGIYIMTAILLGFLVPWNSDELL--GSGGSATHASPFVIAVASHGVRV 368
           I  A K  V+RIL  Y+ T  LLG  V ++   LL   +  ++  ASPFV+A+ + GV V
Sbjct: 320 IPRAIKLTVWRILFFYVATIFLLGMCVAYDDPLLLAAANAQTSAAASPFVVAIQNSGVDV 379

Query: 369 VPHFXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVSCVF 428
           +PH                               G AP+     +R G P   +    +F
Sbjct: 380 LPHIFNVCVLMFVFSACNSDLYVGTRSLYSLAVDGKAPKIFAKTNRWGVPYNAMGGCVLF 439

Query: 429 GLLSFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYVAW 488
            LL+++  S     +F + + +  +  + +W SI ++ +   RA+  QG       YVA 
Sbjct: 440 CLLAYMNVSSGSAEIFNYFVNVVSIFGVLSWSSILITFIYFDRAVRAQGIDRSTFAYVAP 499

Query: 489 TGVWGAYYAMAMIVAI-LVGQFWVAISPVGSNKLDANNFFENYLAMPILIFLYLGYKIWT 547
              +G+Y+A+   V + L+  F V +     N+ D   F   Y+ +P+  F ++GYK++ 
Sbjct: 500 FQPYGSYFALFFCVLLALIKNFSVFL----GNEFDYKTFITGYIGLPVYAFSFIGYKLYY 555

Query: 548 RDWRLLIPSSEVDLVAHRKIFDAEVL--RHEQLEEKEQLRHA 587
           +     +   E DL +++   D E    + ++ E KE+L+H 
Sbjct: 556 KTKT--VKPHEADLNSYKAAVDREEEEGKIKEAERKERLKHG 595

>CAGL0J08184g Chr10 (806631..808349) [1719 bp, 572 aa] {ON} similar
           to uniprot|P04817 Saccharomyces cerevisiae YEL063c CAN1
           or uniprot|P38971 Saccharomyces cerevisiae YNL270c ALP1
           or uniprot|P32487 Saccharomyces cerevisiae YNL268w LYP1
          Length = 572

 Score =  235 bits (599), Expect = 6e-69,   Method: Compositional matrix adjust.
 Identities = 153/505 (30%), Positives = 243/505 (48%), Gaps = 13/505 (2%)

Query: 77  KHKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYCVIQS 136
           +H  +K++++ RH+ MI+L   IGTG+ +G    L N GP   ++ Y  + ++++ V QS
Sbjct: 62  EHHDVKRSLKQRHIGMIALGGTIGTGLFIGIATPLANAGPVGALVAYLFMGTVVFSVTQS 121

Query: 137 ASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKYWNQT 196
             E+A  +  +   F+ +    +  A G +  ++Y L W     LEL      I++W   
Sbjct: 122 LGEMAT-FIPVTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALELSVVGQIIQFWTFK 180

Query: 197 INPDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGGAGNDGY 256
           +   A+++IF+V+L A N                 KVL             CG AG  G 
Sbjct: 181 VPLAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLCIVCG-AGKTGP 239

Query: 257 LGARYWHDPGAF-RGSDSIN----RFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSI 311
           +G RYW +PGA   G  S N    RF G V+ L+NAAF Y G E   +TA E  NP+K++
Sbjct: 240 IGFRYWRNPGAMGPGIISSNTGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAV 299

Query: 312 RSASKKLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSATHASPFVIAVASHGVRVVPH 371
             A +K++ RIL  YI +   +G  VP+N D  L S  S   +SPF+I + + G RV+PH
Sbjct: 300 PRAIRKVLIRILLFYIGSLFFIGLTVPYN-DPKLTSTDSYVSSSPFIITIQNAGTRVLPH 358

Query: 372 FXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVSCVFGLL 431
                                        + G AP+FL      G P L +L    FG L
Sbjct: 359 IFNAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVLAISAFGSL 418

Query: 432 SFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYVAWTGV 491
           S++  S      F WLL I+G++  F W  IS SHVR  +A+  +G S D+L Y A    
Sbjct: 419 SYMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDDLPYKALWMP 478

Query: 492 WGAYYAMAMIVAILVGQFWVAISPVGSNKLDANNFFENYLAMPILIFLYLGYKIWTRDWR 551
           W AYYA+  +V I++ Q + + +P         +F   Y+++ + +  +  ++I+ R  R
Sbjct: 479 WLAYYAIFFMVVIILIQGFTSFAP----HFSGRDFVAAYISVGLFLVFWGFFQIYFRC-R 533

Query: 552 LLIPSSEVDLVAHRKIFDAEVLRHE 576
           ++    +VD+   R+  ++ V   +
Sbjct: 534 IIWKLEDVDIDTDRREIESVVWEDD 558

>Skud_5.26 Chr5 complement(30850..32622) [1773 bp, 590 aa] {ON}
           YEL063C (REAL)
          Length = 590

 Score =  235 bits (599), Expect = 7e-69,   Method: Compositional matrix adjust.
 Identities = 149/514 (28%), Positives = 251/514 (48%), Gaps = 15/514 (2%)

Query: 73  ESASKHKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYC 132
           E   ++  +K+ ++ RH+ MI+L   IGTG+ +G    L N GP   +I Y  + S+ + 
Sbjct: 76  EGEVQNAEVKRELKQRHIGMIALGGTIGTGLFIGLSTPLANAGPVGALIAYLFMGSLAFS 135

Query: 133 VIQSASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKY 192
           V QS  E+A  +  +   F  +    +  AFG +  ++Y   W     LEL      I++
Sbjct: 136 VTQSLGEMAT-FIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQF 194

Query: 193 WNQTINPDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGGAG 252
           W   +   A+++IF+V++  +N                 KV+             CG AG
Sbjct: 195 WTHKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCG-AG 253

Query: 253 NDGYLGARYWHDPGAF-----RGSDSINRFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNP 307
             G +G RYW +PGA+       + +  RF G V+ L+NAAF + G E   +TA E  NP
Sbjct: 254 VTGPVGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANP 313

Query: 308 QKSIRSASKKLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSATHASPFVIAVASHGVR 367
           +K++  A KK+V+RIL  YI + + +G LVP+N D  L    S    SPF++A+ + G +
Sbjct: 314 RKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYN-DPKLTEATSYVSTSPFIVAIQNSGTK 372

Query: 368 VVPHFXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVSCV 427
           V+PH                             +   AP+FL+   + G P + +  + V
Sbjct: 373 VLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKGGVPYIAVFATAV 432

Query: 428 FGLLSFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYVA 487
           FG L+++  S   + VF WLL I+G++  F W  IS+SH+R  +A+  +G S DEL + A
Sbjct: 433 FGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKA 492

Query: 488 WTGVWGAYYAMAMIVAILVGQFWVAISPVGSNKLDANNFFENYLAMPILIFLYLGYKIWT 547
                 AYY+   ++ I++ Q + A +P    K + ++F   Y+++ + I +++ ++   
Sbjct: 493 KLMPGLAYYSSFFMIIIIIIQGFTAFAP----KFNGSSFLAAYISIFLFIAVWILFECIF 548

Query: 548 RDWRLLIPSSEVDLVAHRKIFDAEVLRHEQLEEK 581
           R  R +    +VD+ + R+  D E +  E  E K
Sbjct: 549 RC-RFIWKIEDVDIDSDRR--DIEAIVWEDHEPK 579

>NCAS0B08570 Chr2 (1644264..1645862) [1599 bp, 532 aa] {ON} 
          Length = 532

 Score =  233 bits (595), Expect = 7e-69,   Method: Compositional matrix adjust.
 Identities = 151/506 (29%), Positives = 247/506 (48%), Gaps = 14/506 (2%)

Query: 77  KHKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYCVIQS 136
           + +T+++ ++ RH+ MI+L   IGTG+ +G    L N GP   +I Y  ++++ Y V QS
Sbjct: 23  EAETVRRELKQRHMGMIALGGTIGTGLFIGVSTPLMNAGPVGALIAYLFMATLAYSVTQS 82

Query: 137 ASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKYWNQT 196
             E+A  +  +   F  +    V  AFG +  ++Y   W     LEL      I++W   
Sbjct: 83  LGEMAT-FIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALELSVVGQVIQFWTFA 141

Query: 197 INPDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGGAGNDGY 256
           +   A+++IF+V+L  +N                 KV+             CG AG  G 
Sbjct: 142 VPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIYCFCMVCG-AGVTGP 200

Query: 257 LGARYWHDPGAF-----RGSDSINRFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSI 311
           +G RYW  PGAF         +  RF G V+ L+NAAF + G E   +TA E  NP+K++
Sbjct: 201 VGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTV 260

Query: 312 RSASKKLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSATHASPFVIAVASHGVRVVPH 371
             A KK+V+RIL  YI++   +G LVP++ D  L S  S   ASPF+IA+ + G  V+PH
Sbjct: 261 PRAIKKVVFRILFFYILSLFFIGLLVPYD-DWKLTSTDSYVSASPFIIAIENSGTHVLPH 319

Query: 372 FXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVSCVFGLL 431
                                            AP  L+   + G P + +LV+ +FG L
Sbjct: 320 IFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQHGVPWVAVLVTSLFGAL 379

Query: 432 SFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYVAWTGV 491
           +++  S   +  F WLL I+G++  FTW  ISLSH+R  +A+ ++G S D+L + A    
Sbjct: 380 AYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMRGISRDDLPFKAKWMP 439

Query: 492 WGAYYAMAMIVAILVGQFWVAISPVGSNKLDANNFFENYLAMPILIFLYLGYKIWTRDWR 551
             AYY +  +  I++ Q + +  P   N +D   F   Y+++ + I +++ ++ W R  R
Sbjct: 440 GLAYYGVFFMTLIIIIQGFTSFCP--WNGID---FLTAYISVFMFIAIWIAFQAWFRC-R 493

Query: 552 LLIPSSEVDLVAHRKIFDAEVLRHEQ 577
           L+    +VD+   R+  +  V   ++
Sbjct: 494 LIWRVEDVDIDTDRRAVEEAVWIEQE 519

>KLLA0C02343g Chr3 complement(203552..205297) [1746 bp, 581 aa] {ON}
           similar to uniprot|P04817 Saccharomyces cerevisiae
           YEL063C CAN1 Plasma membrane arginine permease requires
           phosphatidyl ethanolamine (PE) for localization
           exclusively associated with lipid rafts mutation confers
           canavanine resistance
          Length = 581

 Score =  233 bits (594), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 149/522 (28%), Positives = 243/522 (46%), Gaps = 16/522 (3%)

Query: 21  DSVEVLKEESPRSDSRSDGLF---RRFADSFRRHEAHNXXXXXXXXXXXXXLTPIESASK 77
           + +E L     +S S   G+     +  D  R  + +N               P E +  
Sbjct: 11  EELEALHSNLSQSQSARSGMHVSNSKIDDPLRFSKDNNLTLEAIDDDSSRMFDP-EGSIG 69

Query: 78  HKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYCVIQSA 137
              +K+ ++PRHV MI+L   IGTG+ +     L N GP   +I + ++ ++ Y V QS 
Sbjct: 70  QAEVKRALKPRHVSMIALGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYSVTQSL 129

Query: 138 SELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKYWNQTI 197
            E+A  +  +   F  +    +  A G +  ++Y   W     LEL      I+YW   +
Sbjct: 130 GEMAT-FIPVTSSFTVFSQRFISPAVGAANGYMYWFSWAITFALELSIVGQIIQYWTDAV 188

Query: 198 NPDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGGAGNDGYL 257
             +A++ IF+V+LV+ N                 KV+             CG AG +G +
Sbjct: 189 PLEAWIAIFWVLLVSFNMFPVKWYGEFEFWVASIKVIAIIGFLIYSLCMVCG-AGPEGPI 247

Query: 258 GARYWHDPGAFRG---SDSIN--RFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIR 312
           G RYW  PG +     + ++N  RF G V+ L++AAF Y G E   +TA E +NP+K++ 
Sbjct: 248 GFRYWRKPGPWGNGIIAKNVNKARFLGWVSSLISAAFTYQGTELVGITAGETKNPRKAVP 307

Query: 313 SASKKLVYRILGIYIMTAILLGFLVPWNSDELLGS-GGSATHASPFVIAVASHGVRVVPH 371
            A  K+ +RIL  YI +   +G LVP+N  +L GS  GS    SPF+IA+ +    V+PH
Sbjct: 308 RAINKVFFRILIFYIGSLFFIGLLVPYNDPKLEGSDNGSYIAQSPFLIAILNCRTPVLPH 367

Query: 372 FXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVSCVFGLL 431
                                        +   AP+F +   + G P + +L++ VFG L
Sbjct: 368 IFNAVILTTIISAGNSNVYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAVLITAVFGFL 427

Query: 432 SFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYVAWTGV 491
           +++  S   + VF WLL I+ ++   TW  IS+SH+R  + +  +G S D+L Y A    
Sbjct: 428 AYLNVSNDAQEVFDWLLNITAIAGFITWLLISISHIRFMQTLKHRGISRDDLPYKAKFMP 487

Query: 492 WGAYYAMAMIVAILVGQFWVAISPVGSNKLDANNFFENYLAM 533
           + AYYA   I  I++ Q + A +P      + ++FF  Y+++
Sbjct: 488 YAAYYAAFFITVIIIIQGFTAFAP----HFNVSDFFAAYISV 525

>YNL268W Chr14 (138550..140385) [1836 bp, 611 aa] {ON}  LYP1Lysine
           permease; one of three amino acid permeases (Alp1p,
           Can1p, Lyp1p) responsible for uptake of cationic amino
           acids
          Length = 611

 Score =  233 bits (595), Expect = 5e-68,   Method: Compositional matrix adjust.
 Identities = 148/510 (29%), Positives = 245/510 (48%), Gaps = 14/510 (2%)

Query: 73  ESASKHKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYC 132
           E+  + K +K+ ++ RH+ MI+L   IGTG+ VG    L N GP   +I Y  + +++Y 
Sbjct: 98  EAHYEDKHVKRALKQRHIGMIALGGTIGTGLFVGISTPLSNAGPVGSLIAYIFMGTIVYF 157

Query: 133 VIQSASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKY 192
           V QS  E+A  +  +      +    +  AFG S  ++Y   W     +E+      I+Y
Sbjct: 158 VTQSLGEMAT-FIPVTSSITVFSKRFLSPAFGVSNGYMYWFNWAITYAVEVSVIGQVIEY 216

Query: 193 WNQTINPDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGGAG 252
           W   +   A++ IF+V++  +N                 KVL             CGG+ 
Sbjct: 217 WTDKVPLAAWIAIFWVIITLMNFFPVKVYGEFEFWVASVKVLAIMGYLIYALIIVCGGS- 275

Query: 253 NDGYLGARYWHDPGAF-----RGSDSINRFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNP 307
           + G +G RYW +PGA+         S  RF G V+ L+NAAF Y G E   +TA E  NP
Sbjct: 276 HQGPIGFRYWRNPGAWGPGIISSDKSEGRFLGWVSSLINAAFTYQGTELVGITAGEAANP 335

Query: 308 QKSIRSASKKLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSATHASPFVIAVASHGVR 367
           +K++  A  K+V+RI+  YIM+   +G LVP+N D  L +  +   +SPFVI++ + G  
Sbjct: 336 RKTVPRAINKVVFRIVLFYIMSLFFIGLLVPYN-DSRLSASSAVIASSPFVISIQNAGTY 394

Query: 368 VVPHFXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVSCV 427
            +P                                G AP+   YV R G P L ++ +  
Sbjct: 395 ALPDIFNAVVLITVVSAANSNVYVGSRVLYSLARTGNAPKQFGYVTRQGVPYLGVVCTAA 454

Query: 428 FGLLSFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYVA 487
            GLL+F+  +    T F WL+ IS L+ L  W  ISL+H+R  +A+  +G S D+L + A
Sbjct: 455 LGLLAFLVVNNNANTAFNWLINISTLAGLCAWLFISLAHIRFMQALKHRGISRDDLPFKA 514

Query: 488 WTGVWGAYYAMAMIVAILVGQFWVAISPVGSNKLDANNFFENYLAMPILIFLYLGYKIWT 547
               +GAYYA   +  I+  Q + A  P        + FF +Y+++ +L  +++G +I+ 
Sbjct: 515 KLMPYGAYYAAFFVTVIIFIQGFQAFCP-----FKVSEFFTSYISLILLAVVFIGCQIYY 569

Query: 548 RDWRLLIPSSEVDLVAHRKIFDAEVLRHEQ 577
           +  R +    ++D+ + R+  +A +   ++
Sbjct: 570 K-CRFIWKLEDIDIDSDRREIEAIIWEDDE 598

>SAKL0G14916g Chr7 complement(1277225..1278970) [1746 bp, 581 aa]
           {ON} uniprot|Q875Q9 Saccharomyces kluyveri DIP5
          Length = 581

 Score =  232 bits (592), Expect = 7e-68,   Method: Compositional matrix adjust.
 Identities = 158/520 (30%), Positives = 253/520 (48%), Gaps = 20/520 (3%)

Query: 81  LKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYCVIQSASEL 140
           LK+ +  RHV MI++   +GTG+L+G G SL   GP S++I Y+ V  ++Y V+    E+
Sbjct: 55  LKKELEARHVSMIAIGGSLGTGLLIGTGTSLSLAGPVSILIAYSFVGFLVYIVMTCLGEM 114

Query: 141 AIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKYW--NQTIN 198
           A  Y  L  GF +Y S   D A GF+V + Y  ++L + P +L  A++ ++YW   + +N
Sbjct: 115 AT-YIPL-DGFTSYASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVN 172

Query: 199 PDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGGAGNDGYLG 258
           P  ++TIF V++V IN              +  KVL+             GG  +   LG
Sbjct: 173 PGVWITIFLVIIVTINVVGVKFFGEFEFWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLG 232

Query: 259 ARYWHDPGAFRG-----SDSINRFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRS 313
            R++ DPGAFR      S S  +F   VAV V A FAY G E   + AAE +NP++++  
Sbjct: 233 FRFYKDPGAFRPYSEAISGSKGKFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPR 292

Query: 314 ASKKLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSATH--ASPFVIAVASHGVRVVPH 371
           A K  +YRI+  Y++T  LLG  V +N   LL +   +T   ASPFV+A+ + G+ V+PH
Sbjct: 293 AIKLTLYRIVVFYLVTIFLLGMTVAYNDPLLLQAKKKSTSAAASPFVVAIKNAGIPVLPH 352

Query: 372 FXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVSCVFGLL 431
                                            AP+     ++ G P   L++  +F LL
Sbjct: 353 IFNACVLMFVFSACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLL 412

Query: 432 SFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYVAWTGV 491
           +++  S     VF + + +  +  L +W +I ++++   RA+  QG     L Y A    
Sbjct: 413 AYMNVSSGSAQVFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLAS 472

Query: 492 WGAYYAMAMIVAI-LVGQFWVAISPVGSNKLDANNFFENYLAMPILIFLYLGYKIWTRDW 550
            GAY+A+     I L+  F V +     +K D  NF   Y+ +P+ I  + GYK + R  
Sbjct: 473 KGAYFALFFCCLIALIKNFTVFL----GHKFDYKNFITGYIGIPVFIICFFGYK-YIRGT 527

Query: 551 RLLIPSSEVDLVAHRKIFDAEVLRHE--QLEEKEQLRHAP 588
           + + P  E DL   +++ D E    +     +KE++  +P
Sbjct: 528 KFVKP-EEADLYTFKELIDLEEEEGKLWDAAQKEKMESSP 566

>NDAI0I02660 Chr9 complement(619959..621743) [1785 bp, 594 aa] {ON} 
          Length = 594

 Score =  233 bits (593), Expect = 7e-68,   Method: Compositional matrix adjust.
 Identities = 160/532 (30%), Positives = 259/532 (48%), Gaps = 25/532 (4%)

Query: 72  IESASKHKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLY 131
           I+  ++   LK+ ++ RHV MI++   +GTG+L+G G SL   GP S +I YA V  +++
Sbjct: 59  IDGKTEGTRLKKALKARHVSMIAIGGSLGTGLLIGTGTSLALAGPVSTLIAYAFVGLLVF 118

Query: 132 CVIQSASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIK 191
             +    E+A  Y  L  GF +Y S   D A GF+V + Y  ++  + P +L  A++ I+
Sbjct: 119 FTMACLGEMAT-YIPL-DGFTSYASRYCDPALGFAVGYAYLFKYFILPPNQLTAAALVIQ 176

Query: 192 YW--NQTINPDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCG 249
           YW   + +NP  +VTIF VV+V+IN              +  KVL+             G
Sbjct: 177 YWVDKEKVNPGVWVTIFLVVIVSINVFGVRFFGEFEFWLSSFKVLVMLGLMLLLFILMLG 236

Query: 250 GAGNDGYLGARYWHDPGAFRG-SDSIN----RFKGIVAVLVNAAFAYGGAEFSVLTAAEQ 304
           G  +   LG RYW  PG+F+  S++I     RF   V+V V A +AY G E + + AAE 
Sbjct: 237 GGPDHDRLGFRYWRHPGSFKEYSETITGDTGRFVAFVSVFVYATYAYLGIELTGIVAAEA 296

Query: 305 QNPQKSIRSASKKLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSATH--ASPFVIAVA 362
           QNP+KSI  A K  +YRI+  Y+++  LLG  V ++   L+ +  S+T   ASPFV+A+ 
Sbjct: 297 QNPRKSIPKAIKLTMYRIVIFYLISIFLLGMCVAYDDPLLIKAKNSSTSAAASPFVVAII 356

Query: 363 SHGVRVVPHFXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCL 422
           + G+  +PH                                 AP+     +R G P   L
Sbjct: 357 NSGINALPHIINACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPKIFAKTNRWGIPYYAL 416

Query: 423 LVSCVFGLLSFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADE 482
            VS +F LL+++  S     +F + + +  +  + +W SI ++++   RA+  QG     
Sbjct: 417 SVSVLFCLLAYMCVSSASAKIFNYFVNVVSIFGILSWISILITYICFDRAVRAQGVDKST 476

Query: 483 LGYVAWTGVWGAYYAMAMIVAI-LVGQFWVAISPVGSNKLDANNFFENYLAMPILIFLYL 541
             YVA    +GA++++     I L+  F V +    +++ D  NF   Y+ +P+  F Y 
Sbjct: 477 FAYVAPFQPYGAWFSLFFCCLIALIKNFTVFL----NHQFDYKNFITGYIGLPVFFFCYF 532

Query: 542 GYKIWTRDWRLLIPSSEVDLVAHRKIFDAEVLRHEQLEEKEQLRHAPWTTRL 593
           GYK +T   +++ P  +VDL   +   D E       EE  ++  A    R+
Sbjct: 533 GYK-FTYKTKVIDP-LKVDLYTFKAAIDQE-------EEDGKMADAEKAERI 575

>AFR668W Chr6 (1659910..1661580) [1671 bp, 556 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL063C (CAN1) and
           YNL270C (ALP1)
          Length = 556

 Score =  231 bits (589), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 143/474 (30%), Positives = 234/474 (49%), Gaps = 13/474 (2%)

Query: 77  KHKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYCVIQS 136
               +K+ ++PRHV MISL   IGTG+ +G    + N GP   ++ Y  V++M YCV QS
Sbjct: 45  NQSDVKRELKPRHVTMISLGGTIGTGLFIGIASPIRNAGPVGSLLAYIFVATMAYCVTQS 104

Query: 137 ASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKYWNQT 196
             E+A  +  +   F  + S  V  A G +  ++Y L W     LE+      I YW+  
Sbjct: 105 LGEMAT-FIPVTSSFTVFASRFVSPALGAANGYLYWLSWCITFALEISVIGRLILYWSDA 163

Query: 197 INPDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGGAGNDGY 256
           +   A++ IF+V+L AIN                 KV+             CGG+   G 
Sbjct: 164 VPITAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIAILCFLFYGLVVVCGGS-KLGR 222

Query: 257 LGARYWHDPGAFRG---SDSIN--RFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSI 311
           +G RYW DPG +     S  I+  +F G V+ L+ AAF + G E   +TA E +NP++++
Sbjct: 223 IGFRYWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAAFTFQGTELVGVTAGETKNPRRTV 282

Query: 312 RSASKKLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSAT-HASPFVIAVASHGVRVVP 370
             A   + +RIL  YI + +++G LV ++  +L+  G +   +ASPFV+A+ + G +V+P
Sbjct: 283 PKAINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDGSTTNANASPFVVAINAAGTKVLP 342

Query: 371 HFXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVSCVFGL 430
                                           G AP F++     G P + +L + +FG 
Sbjct: 343 DIMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISRTTSRGVPYVAVLATSMFGA 402

Query: 431 LSFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYVAWTG 490
           L ++  S K  +VF WLL+I+ +S  FTW  IS+SH+R  + +  +G S D+L + A   
Sbjct: 403 LGYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQCLKKRGISRDDLPFKAKFM 462

Query: 491 VWGAYYAMAMIVAILVGQFWVAISPVGSNKLDANNFFENYLAMPILIFLYLGYK 544
            +GAYYA   ++ I++ Q + A +P       A +F   Y++  I + ++L ++
Sbjct: 463 PYGAYYAAFFVIVIILVQGFTAFTP-----FSAVDFVAYYISAFIFVVIWLLFQ 511

>YNL270C Chr14 complement(135940..137661) [1722 bp, 573 aa] {ON}
           ALP1Arginine transporter; expression is normally very
           low and it is unclear what conditions would induce
           significant expression
          Length = 573

 Score =  231 bits (588), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 152/515 (29%), Positives = 252/515 (48%), Gaps = 12/515 (2%)

Query: 74  SASKHKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYCV 133
           S  + + +K+ ++ RH+ MI+L   IGTG+++G G  L + GP   +I Y  + +++Y V
Sbjct: 59  SPQERREVKRKLKQRHIGMIALGGTIGTGLIIGIGPPLAHAGPVGALISYLFMGTVIYSV 118

Query: 134 IQSASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKYW 193
            QS  E+ + +  +   F+ +    +  A G +  ++Y L W     LEL      I+YW
Sbjct: 119 TQSLGEM-VTFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALELSVLGKVIQYW 177

Query: 194 NQTINPDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGGAGN 253
            + +   A++ IF+ +L ++N                 KV+             CG   +
Sbjct: 178 TEAVPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVIALLGFIIFSFCVVCGAGQS 237

Query: 254 DGYLGARYWHDPGAF-----RGSDSINRFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNPQ 308
           DG +G RYW +PGA+         +  RF G V+ L+NAAF Y G E   +TA E  NP+
Sbjct: 238 DGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPR 297

Query: 309 KSIRSASKKLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSATHASPFVIAVASHGVRV 368
           K++  A KK+V RIL  YI++   +G LVP+N D  L S G    +SPF+I++ + G +V
Sbjct: 298 KALPRAIKKVVVRILVFYILSLFFIGLLVPYN-DPKLDSDGIFVSSSPFMISIENSGTKV 356

Query: 369 VPHFXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVSCVF 428
           +P                              +   APRFL+ V R G P   +L + VF
Sbjct: 357 LPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTRGGVPYFSVLSTSVF 416

Query: 429 GLLSFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYVAW 488
           G L+F+  S      F WLL I+G++  F W  IS SH+R  +A+  +G S D+L Y A 
Sbjct: 417 GFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIRKRGISRDDLPYKAQ 476

Query: 489 TGVWGAYYAMAMIVAILVGQFWVAISPVGSNKLDANNFFENYLAMPILIFLYLGYKIWTR 548
              + AYYA   I  I++ Q + A +P         +F   Y+++ + + ++L +++W +
Sbjct: 477 MMPFLAYYASFFIALIVLIQGFTAFAPT----FQPIDFVAAYISIFLFLAIWLSFQVWFK 532

Query: 549 DWRLLIPSSEVDLVAHRKIFDAEVLRHEQLEEKEQ 583
             RLL    ++D+ + R+  +  V    + + + Q
Sbjct: 533 C-RLLWKLQDIDIDSDRRQIEELVWIEPECKTRWQ 566

>Kwal_33.15545 s33 complement(1149997..1151727) [1731 bp, 576 aa]
           {ON} YPL265W (DIP5) - dicarboxylic amino acid permease
           [contig 290] FULL
          Length = 576

 Score =  229 bits (585), Expect = 6e-67,   Method: Compositional matrix adjust.
 Identities = 153/506 (30%), Positives = 239/506 (47%), Gaps = 20/506 (3%)

Query: 77  KHK--TLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYCVI 134
           KH+   LK+ +  RHV MI++   +GTG+L+G G SL + GP S++I Y+ V  ++Y V+
Sbjct: 44  KHEGIRLKKELEARHVSMIAIGGSLGTGLLIGTGSSLASAGPVSILISYSFVGLLVYTVM 103

Query: 135 QSASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKYW- 193
               E+A        GF +Y S  VD A GF+V + Y  ++  V P +L   +M +++W 
Sbjct: 104 SCLGEMAAFIP--LDGFTSYASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWV 161

Query: 194 -NQTINPDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGGAG 252
               +NP  ++TIF  ++V IN              +  KVL+             GG  
Sbjct: 162 SRDRVNPGVWITIFLALIVLINTVGVRFFGEFEFWLSSVKVLVMLGLILLLFIIMLGGGP 221

Query: 253 NDGYLGARYWHDPGAFRG-----SDSINRFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNP 307
           N    G R+W DPGAF+      S S  +F    +V   A FAY G E   + AAE +NP
Sbjct: 222 NHDRTGFRFWRDPGAFKPYSEAISGSKGKFVSFASVFALALFAYTGTELCGIVAAEAKNP 281

Query: 308 QKSIRSASKKLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSATH--ASPFVIAVASHG 365
           ++S+  A K  +YRI+  Y++T +LLG  V +N   LL +   AT   ASPFV+A+ +  
Sbjct: 282 RRSVPRAIKLTLYRIVVFYVITILLLGMTVAYNDPRLLKAKKMATSAAASPFVVAIENAS 341

Query: 366 VRVVPHFXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVS 425
           + V+PH                               G APR     ++ G P   L +S
Sbjct: 342 IPVLPHIFNVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLS 401

Query: 426 CVFGLLSFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGY 485
            +F LL+++  S     VF + + +  +  L +W +I ++++R  +A+ VQ      L Y
Sbjct: 402 VLFCLLAYMNVSSGSAQVFNYFVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLSY 461

Query: 486 VAWTGVWGAYYAMAMIVAI-LVGQFWVAISPVGSNKLDANNFFENYLAMPILIFLYLGYK 544
            A    W  Y A+     I L+  + V +     +K D   F   Y+ +P+ +  Y+GYK
Sbjct: 462 TAAFQPWSTYVALFFCCLIGLIKNYTVFL----GHKFDYKTFISGYIGIPVYLICYVGYK 517

Query: 545 IWTRDWRLLIPSSEVDLVAHRKIFDA 570
           +  R    LI   +VDL   +   DA
Sbjct: 518 VVYRT--KLIKPEDVDLYTFKDAIDA 541

>ZYRO0F16654g Chr6 (1374093..1375835) [1743 bp, 580 aa] {ON} similar
           to uniprot|P04817 Saccharomyces cerevisiae YEL063C CAN1
           Plasma membrane arginine permease requires phosphatidyl
           ethanolamine (PE) for localization exclusively
           associated with lipid rafts mutation confers canavanine
           resistance
          Length = 580

 Score =  229 bits (584), Expect = 9e-67,   Method: Compositional matrix adjust.
 Identities = 145/505 (28%), Positives = 244/505 (48%), Gaps = 13/505 (2%)

Query: 77  KHKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYCVIQS 136
           +   +K+ ++PRH+ MI+L   IGTG+ VG  + L N GP  ++I Y  ++++ + V+QS
Sbjct: 70  RSTEVKRALKPRHIGMIALGGTIGTGLFVGISEPLQNAGPVGMLIAYLFMATIAFSVMQS 129

Query: 137 ASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKYWNQT 196
             E+A  Y  +   F+ +    +  AFG +  ++Y   W     LEL      ++YW   
Sbjct: 130 LGEMAT-YIPVTSAFSVFSQRFLSPAFGAANGYMYWFSWSITFALELSVIGQIVQYWTFK 188

Query: 197 INPDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGGAGNDGY 256
           +   A+++IF+V++  +N                 KV+             CG AG  G 
Sbjct: 189 VPVAAWISIFWVLIAGLNFCPVKFYGEFEFWIAFIKVVAIVGFIIYCFIMVCG-AGKTGP 247

Query: 257 LGARYWHDPGAF-RGSDSIN----RFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSI 311
           +G RYW    AF  G  S N    RF G V+ L+NAAF Y G E   +TA E  NP+K++
Sbjct: 248 VGFRYWRHGYAFGDGIISKNKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTV 307

Query: 312 RSASKKLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSATHASPFVIAVASHGVRVVPH 371
             + K+ ++RIL  YI + + +G LVP+N D  L    S   +SPF++A+ + G + +P 
Sbjct: 308 PKSIKRTLWRILIFYIFSLLFVGLLVPFN-DHGLQDSRSYAASSPFILAIKNSGTKALPD 366

Query: 372 FXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVSCVFGLL 431
                                            AP  L    + G P   +L +   G L
Sbjct: 367 IFNAVILTTVISAANSDVYVGSRVMYSMARNRLAPPILAKASKGGVPYAAVLFTSAIGAL 426

Query: 432 SFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYVAWTGV 491
           +++  S     VF WL+ I+G++  F+W+ IS SH+R  +A+  +G S ++L + A    
Sbjct: 427 AYLETSSSGANVFNWLMNITGVAGFFSWWLISWSHLRFMKALKQRGISRNDLPFKASFMP 486

Query: 492 WGAYYAMAMIVAILVGQFWVAISPVGSNKLDANNFFENYLAMPILIFLYLGYKIWTRDWR 551
           W A Y+   +  I++ Q +   +P       A++F  +Y+++ +   ++  ++IW R   
Sbjct: 487 WIAIYSFFFMTLIILVQGFTCFTP----HFQASDFVASYISVGLFFVIWAVFQIWFRC-P 541

Query: 552 LLIPSSEVDLVAHRKIFDAEVLRHE 576
           LL+P +E+D+   R+  DAEV   E
Sbjct: 542 LLVPIAEIDIDTDRRDVDAEVWEDE 566

>Smik_14.68 Chr14 (117603..119438) [1836 bp, 611 aa] {ON} YEL063C
           (REAL)
          Length = 611

 Score =  229 bits (585), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 143/504 (28%), Positives = 243/504 (48%), Gaps = 14/504 (2%)

Query: 79  KTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYCVIQSAS 138
           K +K+ ++ RH+ MI+L   IGTG+ VG    L N GP   +I Y  + +++Y + QS  
Sbjct: 104 KHVKRALKQRHIGMIALGGTIGTGLFVGISTPLSNAGPVGSLIAYIFMGTVIYFITQSLG 163

Query: 139 ELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKYWNQTIN 198
           E+A  +  +      +    +  AFG S  ++Y   W     +E+      I+YW   + 
Sbjct: 164 EMAT-FIPVTSSITVFSKRFLSPAFGVSNGYMYWFNWAITYAVEVSVIGQVIQYWTDKVP 222

Query: 199 PDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGGAGNDGYLG 258
             A++ IF+V++  +N                 KVL             CGG+ + G +G
Sbjct: 223 LAAWIAIFWVLITLMNFFPVKVYGEFEFWVASVKVLAIVGYLIYALVIVCGGS-HQGPIG 281

Query: 259 ARYWHDPGAF-----RGSDSINRFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRS 313
            RYW +PGA+       + S  RF G V+ L+NAAF Y G E   +TA E  NP+K++  
Sbjct: 282 FRYWRNPGAWGPGIISKNKSEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPR 341

Query: 314 ASKKLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSATHASPFVIAVASHGVRVVPHFX 373
           A  K+V+RI+  YIM+   +G LVP+N   L  S  +   +SPFVI++ + G   +P   
Sbjct: 342 AINKVVFRIVIFYIMSLFFIGLLVPYNEPRLSPSS-AVIASSPFVISIQNAGTYALPDIF 400

Query: 374 XXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVSCVFGLLSF 433
                                      + G AP+   YV + G P + +L +   GLL+F
Sbjct: 401 NAVVLITVISAANSNVYVGSRVLYSLAQSGNAPKQFGYVTKQGVPYMGVLSTAALGLLAF 460

Query: 434 VAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYVAWTGVWG 493
           +  +    T F WL++IS L+ L  W  ISL+H+R  +A+  +G S D+L + A    +G
Sbjct: 461 LVVNNNANTAFNWLISISTLAGLCAWLFISLAHIRFMQALKQRGISRDDLPFKAKLMPYG 520

Query: 494 AYYAMAMIVAILVGQFWVAISPVGSNKLDANNFFENYLAMPILIFLYLGYKIWTRDWRLL 553
           AYYA   +  I+  Q + A  P        + FF +Y+++ +L  +++  +++ +  R +
Sbjct: 521 AYYASFFVTIIIFIQGFQAFCP-----FSVSEFFTSYISLILLAVVFISCQLYYKC-RFI 574

Query: 554 IPSSEVDLVAHRKIFDAEVLRHEQ 577
               ++D+ + R+  +A +   ++
Sbjct: 575 WKLEDIDIDSDRREIEAIIWEDDE 598

>NCAS0D02260 Chr4 (421966..423759) [1794 bp, 597 aa] {ON} 
          Length = 597

 Score =  229 bits (584), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 151/526 (28%), Positives = 250/526 (47%), Gaps = 20/526 (3%)

Query: 72  IESASKHKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLY 131
           ++  ++   LK+ +  R V M+++   +GTG+L+G G SL   GP S++I YA V  +++
Sbjct: 62  VDGKTEGTRLKKVLEGRVVSMVAIGGSLGTGLLIGTGNSLATAGPVSMLIAYAFVGLLVF 121

Query: 132 CVIQSASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIK 191
             + S  E+A  Y  L  GF +Y +   D A GF+V + Y  ++  + P +L  A++ I+
Sbjct: 122 FTMASLGEMAS-YIPL-DGFTSYATRYADPALGFAVGYCYLFKYFILPPNQLTAAALVIQ 179

Query: 192 YW--NQTINPDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCG 249
           YW   + +NP  ++TIF VV+VAIN              +  KVL+             G
Sbjct: 180 YWIPREKVNPGVWITIFLVVIVAINTLGVQFFGEFEFWLSSFKVLVMFALIILLFILMLG 239

Query: 250 GAGNDGYLGARYWHDPGAFRG-----SDSINRFKGIVAVLVNAAFAYGGAEFSVLTAAEQ 304
           G  N   LG R+W  PGAF       +    +F   V+V V A FAY G E   +   E 
Sbjct: 240 GGPNHDRLGFRHWKHPGAFNNYSPAITGDTGKFVAFVSVFVYATFAYLGTELVGIVVGEA 299

Query: 305 QNPQKSIRSASKKLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSATH--ASPFVIAVA 362
           +NP+KS+  A K  +YRI+  Y+++ +LLG  V ++   LL +   +T   ASPFV+A+ 
Sbjct: 300 RNPRKSVPKAIKLTMYRIIIFYLISILLLGMCVGYDDPLLLEAKTKSTSAAASPFVVAIV 359

Query: 363 SHGVRVVPHFXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCL 422
           + G++V+PH                                 AP+     +R G P   L
Sbjct: 360 NSGIKVLPHIFNACVLVFVFSACNSDLYVASRSLYSLAIDNKAPKIFARTNRWGIPYYSL 419

Query: 423 LVSCVFGLLSFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADE 482
            +S +F LL++++ S     +F + + +  +  L +W  I ++++   RA+  QG     
Sbjct: 420 GLSVLFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWICILVTYLAFDRAVRAQGIDKST 479

Query: 483 LGYVAWTGVWGAYYAMAMIVAI-LVGQFWVAISPVGSNKLDANNFFENYLAMPILIFLYL 541
             YVA    +GAY+A+     I L+  F V +     ++ D   F   Y+ +P+    Y 
Sbjct: 480 FSYVAPGQRYGAYFALFFCSLIALIKNFTVFL----GHQFDYKTFITGYIGIPVFFISYF 535

Query: 542 GYKIWTRDWRLLIPSSEVDLVAHRKIFDAEVL--RHEQLEEKEQLR 585
           GYK+  +    +I   EVDL   +   D E    + E +  KE+++
Sbjct: 536 GYKLIYK--TKIIDPLEVDLYTFKAAIDQEEEDGKLEDIARKERIK 579

>Kwal_33.13411 s33 (210461..212143) [1683 bp, 560 aa] {ON} YNL268W
           (LYP1) - lysine permease [contig 117] FULL
          Length = 560

 Score =  227 bits (578), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 145/510 (28%), Positives = 235/510 (46%), Gaps = 13/510 (2%)

Query: 73  ESASKHKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYC 132
           E   +   +K+ ++PRHV MI+L   IGTG+ VG    L + GP   +I Y  + S++Y 
Sbjct: 46  EGDLQEGQVKRALKPRHVSMIALGGTIGTGLFVGIASPLSSAGPVGALIAYIFMGSIVYF 105

Query: 133 VIQSASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKY 192
           V QS  E+A  +  +      + +  +  AFG +  ++Y   W     +E+      I+Y
Sbjct: 106 VTQSMGEMAT-FIPVTSSITVFSNRFLSPAFGVANGYMYWFNWAITYAVEISVIGQVIQY 164

Query: 193 WNQTINPDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGGAG 252
           W + +   A++ IF+V +   N                 KV+             CGG+ 
Sbjct: 165 WTKAVPLAAWIGIFWVAITLANFFPVRFYGEVEFWVASIKVIAIVGYLLYALIIVCGGS- 223

Query: 253 NDGYLGARYWHDPGAF-----RGSDSINRFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNP 307
             G +G RYW +PG +      G     RF G VA L+NA+F Y G E   +TA E  NP
Sbjct: 224 KQGPIGFRYWRNPGPWGDGIISGDKDKGRFLGWVASLINASFTYQGTELVGITAGEAANP 283

Query: 308 QKSIRSASKKLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSATHASPFVIAVASHGVR 367
           +K++  A  K+ +RIL  YI++   +G LVP+N   L     S   +SPFVI++ S G R
Sbjct: 284 RKTVPKAINKVFFRILFFYILSLFFVGLLVPYNHPGL-DKHTSVIASSPFVISIQSAGTR 342

Query: 368 VVPHFXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVSCV 427
           ++P                                G AP+  +YV   G P L ++ + +
Sbjct: 343 ILPDIFNAVVLVTIISAANSNVYVGSRILFSLAHTGIAPKQFSYVTNQGVPYLGVICTAL 402

Query: 428 FGLLSFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYVA 487
            GLL+F+         F WL+ IS L+ L  W  IS+SH+R  + +  +G S D+L + +
Sbjct: 403 LGLLAFLVVDDNANEGFNWLINISTLAGLCAWLFISISHIRFMQCLKQRGISRDDLPFKS 462

Query: 488 WTGVWGAYYAMAMIVAILVGQFWVAISPVGSNKLDANNFFENYLAMPILIFLYLGYKIWT 547
               +GAYYA   +  I+  Q + A  P    K     FF  Y+++ +L  ++   +++ 
Sbjct: 463 KLMPYGAYYAAFWVAVIIFVQGFQAFCP----KFKVAEFFTGYISLILLAVVFCLAQLYY 518

Query: 548 RDWRLLIPSSEVDLVAHRKIFDAEVLRHEQ 577
           R  R      ++D+ + R+  DA +   E+
Sbjct: 519 RC-RFFNRLEDIDIDSDRREIDALIWEEEE 547

>KNAG0C00790 Chr3 (138911..140650) [1740 bp, 579 aa] {ON} 
          Length = 579

 Score =  227 bits (578), Expect = 7e-66,   Method: Compositional matrix adjust.
 Identities = 150/507 (29%), Positives = 244/507 (48%), Gaps = 17/507 (3%)

Query: 81  LKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYCVIQSASEL 140
           +K+ ++ RH+ MI+L   IGTG+ +G    L   GP   +I Y  + +++Y V QS  E+
Sbjct: 73  VKRELKQRHIGMIALGATIGTGLFIGLSTPLKQAGPVGALISYIFMGTLVYSVTQSLGEM 132

Query: 141 AIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKYWNQTINPD 200
           A  +  +   F  +    +  + G +  ++Y   W     LEL      I+YW   +   
Sbjct: 133 AT-FIPVTSSFTVFAQRFLSPSIGAATGYMYWFSWAVTFALELSVIGQVIQYWTYAVPLA 191

Query: 201 AFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGGAGNDGYLGAR 260
           A+++IF+VV+ A N                 KV+             CG AG  G +G R
Sbjct: 192 AWISIFWVVITAGNMFPVKYYGEVEFWIAFIKVIAIVGFLLYCLCMVCG-AGVTGPVGFR 250

Query: 261 YWHDPGAFRGSDSIN------RFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSA 314
           YW +PG + G   I+      RF G V+ L+N AF Y G E   ++A E  NP+K++  A
Sbjct: 251 YWRNPGPW-GPGIISKDKNEARFLGWVSSLINGAFTYQGTELVGISAGEAANPRKAVPRA 309

Query: 315 SKKLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSATHASPFVIAVASHGVRVVPHFXX 374
            KK+V+RIL  YI +   +G LVP+N D+ L +  S   +SPF+IA+ + G  V+PH   
Sbjct: 310 IKKVVFRILFFYIGSLFFIGLLVPYN-DDALNNTDSYVASSPFIIAIKNSGTPVLPHIFN 368

Query: 375 XXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVSCVFGLLSFV 434
                                     +   AP+ L+   + G P + +LV+ V G L+++
Sbjct: 369 AVIACTIVSAGNSNVYVGSRILFGLSKNKLAPKILSRTTKGGVPWIAVLVTSVVGALAYM 428

Query: 435 AASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYVAWTGVWGA 494
             S   +  F WLL I+ ++  FTW  ISLSH+R  +A+  +G S D+L + A      A
Sbjct: 429 ETSTGGQNAFNWLLNITAVAGFFTWLFISLSHIRFMQALKYRGISRDDLPFKAALMPGLA 488

Query: 495 YYAMAMIVAILVGQFWVAISPVGSNKLDANNFFENYLAMPILIFLYLGYKIWTRDWRLLI 554
           YYA  ++  I++ Q + A +P    K   ++F   Y+++ + I ++  ++I  R  R + 
Sbjct: 489 YYASFLMFVIIIIQGFTAFAP----KFSGSDFAAAYISIFLFIGIWCLFQIIFRC-RFIH 543

Query: 555 PSSEVDLVAHRKIFDAEVLRHEQLEEK 581
              +VD+   R+  D E +  E  E K
Sbjct: 544 KVEDVDIDTDRR--DIEAVVWEDAEPK 568

>Skud_14.70 Chr14 complement(124390..126111) [1722 bp, 573 aa] {ON}
           YNL270C (REAL)
          Length = 573

 Score =  226 bits (575), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 150/515 (29%), Positives = 250/515 (48%), Gaps = 12/515 (2%)

Query: 74  SASKHKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYCV 133
           S      +++ ++ RH+ MI+L   IGTG+++G G  L + GP   +I Y  + +++Y V
Sbjct: 59  SPRSRGEVQRKLKERHIGMIALGGTIGTGLIIGIGPPLAHAGPVGALISYLFMGTVIYSV 118

Query: 134 IQSASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKYW 193
            QS  E+A  +  +   F+ +    +  A G +  ++Y L W     LEL      I+YW
Sbjct: 119 TQSLGEMAT-FIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALELSVLGQIIQYW 177

Query: 194 NQTINPDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGGAGN 253
              +   A++ IF+ +L  +N                 KV+             CG    
Sbjct: 178 THAVPLAAWIVIFWCLLTLMNMFPVKYYGEFEFCIASIKVITLLGFIIFSFCIVCGAGQP 237

Query: 254 DGYLGARYWHDPGAF-----RGSDSINRFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNPQ 308
           DG +G RYW +PGA+       + +  RF G V+ L+NAAF Y G E   +TA E  NP+
Sbjct: 238 DGPIGFRYWRNPGAWGPGIISSNKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPR 297

Query: 309 KSIRSASKKLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSATHASPFVIAVASHGVRV 368
           K++  A KK+V RIL  YI++   +G LVP+N D  L S G+   ASPF+I++ + G +V
Sbjct: 298 KAVPRAIKKVVIRILVFYILSLFFIGLLVPYN-DPKLDSDGTFVSASPFMISIENSGTKV 356

Query: 369 VPHFXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVSCVF 428
           +P                              +   AP+ L+ V R G P L +L++ +F
Sbjct: 357 LPDIFNAVVLITIFSAGNSNVYIGSRVLYSLSKNSLAPKCLSNVTRGGVPYLAVLLTSLF 416

Query: 429 GLLSFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYVAW 488
           G L+F+  S      F WLL I+G++  F W  IS SH+R  +A+  +G S D+L Y A 
Sbjct: 417 GFLAFLETSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIKKRGISRDDLPYKAR 476

Query: 489 TGVWGAYYAMAMIVAILVGQFWVAISPVGSNKLDANNFFENYLAMPILIFLYLGYKIWTR 548
              + AYYA   I  I++ Q + A +P         +F   Y+++ +   ++L +++W +
Sbjct: 477 MMPFLAYYASFFIALIVLIQGFTAFAPT----FQPVDFVAAYISVFLFAIIWLSFQLWFK 532

Query: 549 DWRLLIPSSEVDLVAHRKIFDAEVLRHEQLEEKEQ 583
             RL+    ++D+ + R+  + +V    + + + Q
Sbjct: 533 C-RLICKLQDIDIDSDRREIEEQVWIEPECKTRWQ 566

>KLTH0F02420g Chr6 (205827..207692) [1866 bp, 621 aa] {ON} similar
           to uniprot|P32487 Saccharomyces cerevisiae YNL268W LYP1
           Lysine permease one of three amino acid permeases (Alp1p
           Can1p Lyp1p) responsible for uptake of cationic amino
           acids
          Length = 621

 Score =  227 bits (578), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 144/511 (28%), Positives = 241/511 (47%), Gaps = 15/511 (2%)

Query: 73  ESASKHKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYC 132
           E   +   +K+ ++PRHV MI+L   IGTG+ VG    L   GP   +I Y  + +++Y 
Sbjct: 107 EGDMQEGKVKRALKPRHVSMIALGGTIGTGLFVGIASPLSYSGPVGALIAYIFMGTVVYF 166

Query: 133 VIQSASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKY 192
           V QS  E+A  +  +      + S  +  AFG +  ++Y   W     +EL      I+Y
Sbjct: 167 VTQSMGEMAT-FIPVTSSITVFSSRFLSPAFGVANGYMYWFNWAITFAVELSVTGQVIEY 225

Query: 193 WNQTINPDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGGAG 252
           W + +   A++ IF+V++   N                 KVL             CGG+ 
Sbjct: 226 WTEAVPRAAWIAIFWVLVTLANFFPVQFYGEVEFWVASIKVLAIVGYLIYALVIVCGGS- 284

Query: 253 NDGYLGARYWHDPGAFRGSDSIN------RFKGIVAVLVNAAFAYGGAEFSVLTAAEQQN 306
             G +G RYW +PG + G+  I+      RF G VA L+NA+F Y G E   +TA E  N
Sbjct: 285 KQGPIGFRYWRNPGPW-GAGIISKDKDEGRFLGWVASLINASFTYQGTELVGITAGEAAN 343

Query: 307 PQKSIRSASKKLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSATHASPFVIAVASHGV 366
           P++++  A  K+ +RIL  YI++   +G LVP+N   L     +   +SPFVI++ + G 
Sbjct: 344 PRRTVPRAINKVFFRILFFYILSLFFVGLLVPYNHSSL-DKTTTVIASSPFVISIQNAGT 402

Query: 367 RVVPHFXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVSC 426
           R +P                                G AP+  + V   G P + ++V+ 
Sbjct: 403 RALPDIFNAVVLVTIISAANSNVYVGSRVLFSLAHTGIAPKVFSSVTPQGVPFMGVIVTS 462

Query: 427 VFGLLSFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYV 486
           + GLL+F+  +      F WL+ IS L+ L  W  IS+SH+R  + +  +G S D+L + 
Sbjct: 463 LLGLLAFLVVNHNANEAFNWLINISTLAGLCAWLFISISHIRFMQCLKQRGISRDDLPFK 522

Query: 487 AWTGVWGAYYAMAMIVAILVGQFWVAISPVGSNKLDANNFFENYLAMPILIFLYLGYKIW 546
           +    +GAYYA   +  I+  Q + A SP          FF +Y+++ +L+ ++ G +++
Sbjct: 523 SKLMPYGAYYAAFWVTVIIFVQGFQAFSP----HFKVTEFFTSYISLMLLVVVFCGAQLF 578

Query: 547 TRDWRLLIPSSEVDLVAHRKIFDAEVLRHEQ 577
            R  R      ++D+ + R+  DA +   ++
Sbjct: 579 YR-CRFFNRLEDIDIDSDRREADALIWEDDE 608

>Smik_14.67 Chr14 complement(114969..116690) [1722 bp, 573 aa] {ON}
           YNL270C (REAL)
          Length = 573

 Score =  224 bits (572), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 152/515 (29%), Positives = 251/515 (48%), Gaps = 12/515 (2%)

Query: 74  SASKHKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYCV 133
           S  K   +K+ ++ RH+ MI+L   IGTG+++G G  L + GP   +I Y  + +++Y V
Sbjct: 59  SPRKGGEVKRKLKQRHIGMIALGGTIGTGLIIGIGPPLAHAGPVGALISYLFMGTVIYSV 118

Query: 134 IQSASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKYW 193
            QS  E+A  +  +   F+ +    +  A G +  ++Y L W     LEL      I+YW
Sbjct: 119 TQSLGEMAT-FIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALELSVLGQIIQYW 177

Query: 194 NQTINPDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGGAGN 253
              +   A++ IF+ +L  +N                 KV+             CG   +
Sbjct: 178 TDAVPLVAWIVIFWCLLTLMNMFPVKYYGEFEFCIASIKVIALLGFIFFSFCIVCGAGQS 237

Query: 254 DGYLGARYWHDPGAF-----RGSDSINRFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNPQ 308
            G +G RYW +PGA+       + +  RF G V+ L+NAAF Y G E   +TA E  NP+
Sbjct: 238 GGPIGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPR 297

Query: 309 KSIRSASKKLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSATHASPFVIAVASHGVRV 368
           +++  A KK+V RIL  YI++   +G LVP+N D  L S G+   +SPF+I++ + G +V
Sbjct: 298 RAVPRAIKKVVVRILVFYILSLFFIGLLVPYN-DPKLDSEGTFVSSSPFMISIENSGTKV 356

Query: 369 VPHFXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVSCVF 428
           +P                              +   APRFL+ V + G P   +L +  F
Sbjct: 357 LPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTKGGVPYFAVLSTSAF 416

Query: 429 GLLSFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYVAW 488
           G L+F+  S     VF WLL I+G++  F W  ISLSH+R  +A+  +G S D+L Y A 
Sbjct: 417 GFLAFLETSAGSGKVFNWLLNITGVAGFFAWLLISLSHIRFMQAIKKRGISRDDLPYRAR 476

Query: 489 TGVWGAYYAMAMIVAILVGQFWVAISPVGSNKLDANNFFENYLAMPILIFLYLGYKIWTR 548
              + AYYA   I  I++ Q + A +P         +F   Y+++ + I ++L +++W +
Sbjct: 477 MMPFLAYYASFFIALIVLIQGFTAFAPT----FQPIDFIAAYISVFLFIAIWLLFQVWFK 532

Query: 549 DWRLLIPSSEVDLVAHRKIFDAEVLRHEQLEEKEQ 583
             R +    +VD+ + R+  + +V    + + + Q
Sbjct: 533 C-RFVWKLQDVDIDSDRRDIEEQVWIEPECKTRWQ 566

>KLTH0B01166g Chr2 (102227..103960) [1734 bp, 577 aa] {ON} similar
           to uniprot|P53388 Saccharomyces cerevisiae YPL265W DIP5
           Dicarboxylic amino acid permease mediates high-affinity
           and high-capacity transport of L- glutamate and
           L-aspartate also a transporter for Gln Asn Ser Ala and
           Gly
          Length = 577

 Score =  224 bits (570), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 157/526 (29%), Positives = 249/526 (47%), Gaps = 22/526 (4%)

Query: 77  KHK--TLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYCVI 134
           KH+   LK+ +  RHV MI++   +GTG+L+G G SL + GPAS++I Y+ V  ++Y V+
Sbjct: 45  KHEGIRLKKALEARHVSMIAIGGSLGTGLLIGTGSSLASAGPASILISYSFVGLLVYTVM 104

Query: 135 QSASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKYW- 193
               E+A        GF +Y S  VD A GF+V + Y  ++  V P +L   +M ++YW 
Sbjct: 105 ACLGEMAAFIP--LDGFTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWV 162

Query: 194 -NQTINPDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGGAG 252
             + +NP  ++TIF V++V IN              +  KVL+             GG  
Sbjct: 163 SREKVNPGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKVLVMLGLILLLFIIMLGGGP 222

Query: 253 NDGYLGARYWHDPGAFRG-----SDSINRFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNP 307
           N    G RYW DPGAF+      S S  +F    +V   A FAY G E   + AAE +NP
Sbjct: 223 NHDRTGFRYWRDPGAFKPYSEAISGSKGKFVSFASVFALALFAYTGTELCGIVAAEAKNP 282

Query: 308 QKSIRSASKKLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSATH--ASPFVIAVASHG 365
           ++S+  A K  +YRI+  Y+++ +LLG  V +N   L+ +   +T   ASPFV+A+ + G
Sbjct: 283 RRSVPRAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIKAKKMSTSAAASPFVVAIKNAG 342

Query: 366 VRVVPHFXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVS 425
           + V+PH                                 AP+     +  G P   L VS
Sbjct: 343 IPVLPHIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVS 402

Query: 426 CVFGLLSFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGY 485
            +F LL+++  S     +F + + +  +  L +W SI ++++R  +A+  Q        Y
Sbjct: 403 VLFCLLAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSY 462

Query: 486 VAWTGVWGAYYAMAMIVAI-LVGQFWVAISPVGSNKLDANNFFENYLAMPILIFLYLGYK 544
            A    W  + ++     I L+  + V +     +  D   F   Y+ +P+    Y+GYK
Sbjct: 463 TAPFQPWSTWVSLFFCCLIGLIKNYTVFL----GHTFDYKTFISGYIGIPVYAICYVGYK 518

Query: 545 IWTRDWRLLIPSSEVDLVAHRKIFDA--EVLRHEQLEEKEQLRHAP 588
           +  R    LI   +VDL   +   DA  E  +  +LE KEQL+ +P
Sbjct: 519 LVHRS--KLIKPEDVDLYTFKAAIDAEEEEGKLLELERKEQLKSSP 562

>TPHA0B04480 Chr2 (1050173..1051984) [1812 bp, 603 aa] {ON} Anc_1.83
           YEL063C
          Length = 603

 Score =  223 bits (568), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 150/503 (29%), Positives = 243/503 (48%), Gaps = 13/503 (2%)

Query: 73  ESASKHKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYC 132
           E   K   +K+ ++ RH+ MI+L   IGTG+ +G    L N GP   +I Y  ++++++ 
Sbjct: 89  EGVVKEAEVKRQLKQRHIGMIALGGTIGTGLFIGIATPLGNAGPVGALIAYLFMATIVFS 148

Query: 133 VIQSASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKY 192
           V QS  E+A  +  +   F  + S  +  A G +  ++Y   W     LEL      I++
Sbjct: 149 VTQSLGEMAT-FIPVTSSFTVFSSRFLSPAIGAANGYMYWFSWAVTFALELSVVGQIIQF 207

Query: 193 WNQTINPDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGGAG 252
           W   +   A++ I++V+L  +N                 KVL             CG AG
Sbjct: 208 WTHAVPLSAWIVIWWVILTIMNLFPVKFYGEFEFWVASIKVLAIIGFLIYCLCMVCG-AG 266

Query: 253 NDGYLGARYWHDPGAFRG---SDSIN--RFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNP 307
             G +G RYW +PG +     S  +N  RF G V+ L+NAAF Y G E   +TA E  NP
Sbjct: 267 VTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANP 326

Query: 308 QKSIRSASKKLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSATHASPFVIAVASHGVR 367
           +K++  A KK+ +RIL  YI++   +G LVP++ DE L S  S   ASPF+IA+ + G +
Sbjct: 327 RKTVPRAIKKVTFRILIFYILSLFFIGLLVPYD-DEKLTSTDSYISASPFIIAIENSGTK 385

Query: 368 VVPHFXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVSCV 427
           ++PH                             +   AP++  Y  R G P   +  +  
Sbjct: 386 ILPHIFNAVILSTIISAGNSNVYVGSRILFGLAKTKLAPKWFGYTSRGGVPYYSVFFTSS 445

Query: 428 FGLLSFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYVA 487
           FG L+F+  S      F WLL I  ++  F W  IS++HVR  +A+  +G S D+L + A
Sbjct: 446 FGALAFLEVSSGGAKAFNWLLNIISVAGFFAWLLISIAHVRFMQALKHRGISRDDLPFKA 505

Query: 488 WTGVWGAYYAMAMIVAILVGQFWVAISPVGSNKLDANNFFENYLAMPILIFLYLGYKIWT 547
                 AYY++  +  I++ Q + A +P      + ++F   Y+++ +  FL+L ++++ 
Sbjct: 506 RFMPHLAYYSIFFMTIIIIIQGFTAFAPT----FNGSDFVAAYISIFLFFFLWLCFQLYF 561

Query: 548 RDWRLLIPSSEVDLVAHRKIFDA 570
           R  +LL    EVD+   R+  DA
Sbjct: 562 RS-KLLWTVEEVDIDTDRRDVDA 583

>KLLA0C02365g Chr3 (208462..210201) [1740 bp, 579 aa] {ON} similar
           to uniprot|P32487 Saccharomyces cerevisiae YNL268W LYP1
           Lysine permease one of three amino acid permeases (Alp1p
           Can1p Lyp1p) responsible for uptake of cationic amino
           acids
          Length = 579

 Score =  222 bits (566), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 156/507 (30%), Positives = 251/507 (49%), Gaps = 16/507 (3%)

Query: 78  HKT-LKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYCVIQS 136
           H+T +K+ ++PRHV MI+L   IGTG+ VG  K L   GP   +I Y  + S++Y V QS
Sbjct: 69  HETEVKRALKPRHVSMIALGGTIGTGLFVGIAKPLSLSGPVGSLIAYIFMGSVVYFVTQS 128

Query: 137 ASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKYWNQT 196
             E+A  +  +      +    +  AFG +  ++Y   W     +EL      I YW   
Sbjct: 129 LGEMAT-FIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVELSVLGQIINYWTDA 187

Query: 197 INPDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGGAGNDGY 256
           +   A++ IF+V+L A N                 KV+             CGG+ + G 
Sbjct: 188 VPLAAWIAIFWVLLTAANFFPVKWYGEFEFCVASIKVIAIVGYLLYALIIVCGGS-SQGP 246

Query: 257 LGARYWHDPGAFRGSDSIN------RFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNPQKS 310
           +G RYW +PG + G+ +I       RF G V  LVNA+F Y G E   +TA E  NP+K+
Sbjct: 247 IGFRYWRNPGPW-GTGTIAKNVNKARFLGWVGSLVNASFTYQGTELVGITAGEASNPRKT 305

Query: 311 IRSASKKLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSATHASPFVIAVASHGVRVVP 370
           +  A  K+ +RIL  YI +   +G LVP+NS +L  S  +   +SPFVI++ + G +V+P
Sbjct: 306 VPKAINKVFFRILVFYIGSLFFVGLLVPYNSPQL-ESNSAVIASSPFVISIQNAGTKVLP 364

Query: 371 HFXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVSCVFGL 430
                                           G AP+  +YV + G P L ++ + + GL
Sbjct: 365 DIFNAVVLVTILSAGNSNVYVGSRVLYSLALSGNAPKQFSYVTKQGVPYLGVICTALLGL 424

Query: 431 LSFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYVAWTG 490
           L+F+A +    T F WL+ IS L+ L  WF IS++H+R  + + ++G S D L + A   
Sbjct: 425 LAFLATNENANTAFNWLINISTLAGLCAWFFISVAHIRFMQCLKLRGISRDSLPFKAKLM 484

Query: 491 VWGAYYAMAMIVAILVGQFWVAISPVGSNKLDANNFFENYLAMPILIFLYLGYKIWTRDW 550
            WGAYYA   +  I+  Q + A +P    + D + FF  Y+++ +L+ L++  +++ R  
Sbjct: 485 PWGAYYAAFFVGLIVFIQGFTAFAP----RFDVSEFFTAYISLILLVVLFILCQLYYRC- 539

Query: 551 RLLIPSSEVDLVAHRKIFDAEVLRHEQ 577
           R L    ++D+ + R+  DA +   ++
Sbjct: 540 RFLTKIEDIDIDSDRREIDAIIWEDDE 566

>KAFR0D00700 Chr4 complement(120768..122492) [1725 bp, 574 aa] {ON} 
          Length = 574

 Score =  222 bits (565), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 150/525 (28%), Positives = 253/525 (48%), Gaps = 28/525 (5%)

Query: 72  IESASKHKT-LKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSML 130
           + S S H   +K+ ++ RH+ MI+L   IGTG+ +G    L + GP   +I Y  V ++ 
Sbjct: 52  LNSGSVHDAEVKRELKQRHIGMIALGGTIGTGLFIGISTPLEDSGPVGSLIAYIFVGTLT 111

Query: 131 YCVIQSASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTI 190
           Y V QS  E+A  +  +   F  + S  +  + G +V ++Y   W     LEL      +
Sbjct: 112 YAVTQSLGEMAT-FIPVTSSFTVFASRFLSPSIGAAVGYMYWFSWAVTFALELSVVGQIV 170

Query: 191 KYWNQTINPDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGG 250
            YW   +   A+++IF+V+L A+N                 KV+             CG 
Sbjct: 171 DYWTFAVPIAAWISIFWVILTALNMFPVKFYGEIEFWVAAVKVVAIVGFLIYCLCMVCG- 229

Query: 251 AGNDGYLGARYWHDPGAFRGSDSIN-----------RFKGIVAVLVNAAFAYGGAEFSVL 299
           AG  G +G RYW +PG +    + N           RF G    L+NAAF Y G E   +
Sbjct: 230 AGVTGPVGFRYWRNPGPWGDGLTSNGVEISKNKNTGRFLGWFNSLINAAFTYQGTELVGI 289

Query: 300 TAAEQQNPQKSIRSASKKLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSATHASPFVI 359
           TA E  NP+K++  A KK+V+RIL  YI +   +G LVP++ D  L S  S   +SPF+I
Sbjct: 290 TAGEAANPRKTVPRAIKKVVFRILLFYIGSLFFIGLLVPFD-DPKLSSDDSYVSSSPFII 348

Query: 360 AVASHGVRVVPHFXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPV 419
           A+ + G +++P                              + G AP+ L+   + G P 
Sbjct: 349 AIENSGTKILPDIFNAIILITIISAGNSNIYVGSRILFSLAKTGLAPKILSRTTKKGVPW 408

Query: 420 LCLLVSCVFGLLSFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRS 479
           + +L + VFG+L+++  +   +TVF WL+ I+ ++  + W  I +SH+R  + +  +G S
Sbjct: 409 VSVLATAVFGVLAYMETTQGGQTVFDWLVNITAIAGFWAWLFILISHIRFMQVLKFRGIS 468

Query: 480 ADELGYVAWTGVWGAYYAMAMIVAILVGQFWVAISPVGSNKLDANNFFENYLAMPILIFL 539
            D+L + A      AYYA+  +V I++ Q + A +P      D ++FF  Y+++ +   +
Sbjct: 469 RDDLPFKANLMPGLAYYAVFCMVIIIIFQGFTAFTPT----FDVSDFFAAYISVILFFLI 524

Query: 540 YLGYKIWTR---DWRLLIPSSEVDLVAHRKIFDAEVLRHEQLEEK 581
           +  +++W +    W+L     +VD+ ++R+  D E +  E  E K
Sbjct: 525 WGAFQLWFKCRWIWKL----EDVDIDSNRR--DVEKIIWEDPEPK 563

>Suva_14.75 Chr14 (133164..134999) [1836 bp, 611 aa] {ON} YEL063C
           (REAL)
          Length = 611

 Score =  223 bits (567), Expect = 5e-64,   Method: Compositional matrix adjust.
 Identities = 142/506 (28%), Positives = 241/506 (47%), Gaps = 14/506 (2%)

Query: 77  KHKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYCVIQS 136
           + K +++ ++ RH+ MI+L   IGTG+ VG    L N GP   +I Y  + +++Y V QS
Sbjct: 102 EDKHVRRALKQRHIGMIALGGTIGTGLFVGISTPLSNAGPVGSLIAYIFMGTVVYFVTQS 161

Query: 137 ASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKYWNQT 196
             E+A  +  +      +    +  AFG S  ++Y   W     +E+      I+YW   
Sbjct: 162 LGEMAT-FIPVTSSITVFSKRFLSPAFGVSNGYMYWFNWAITYAVEVSVIGQVIEYWTTK 220

Query: 197 INPDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGGAGNDGY 256
           +    ++ IF+V++  +N                 KVL             CGG+   G 
Sbjct: 221 VPLGVWIAIFWVLITLMNFFPVKVYGEFEFWVASVKVLAIMGYLIYALVIVCGGS-KQGP 279

Query: 257 LGARYWHDPGAF-----RGSDSINRFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSI 311
           +G RYW +PGA+         +  RF G V+ L+NAAF Y G E   +TA E  NP+K++
Sbjct: 280 IGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTV 339

Query: 312 RSASKKLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSATHASPFVIAVASHGVRVVPH 371
             A  K+V+RI+  YIM+   +G LVP+ +D  L +  +   +SPFVI++ + G   +P 
Sbjct: 340 PRAINKVVFRIVLFYIMSLFFIGLLVPY-TDPRLSASSAVIASSPFVISIQNAGTYALPD 398

Query: 372 FXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVSCVFGLL 431
                                        + G AP+   YV + G P L +L +   GLL
Sbjct: 399 IFNAIVLITVISAANSNVYVGSRVLYSLAQTGNAPKQFGYVTKQGVPYLGVLSTAALGLL 458

Query: 432 SFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYVAWTGV 491
           +F+  +    T F WL+ IS L+ L  W  ISLSH+R  +A+  +G S D+L + A    
Sbjct: 459 AFLVVNNNANTAFNWLINISTLAGLCAWLFISLSHIRFMQALNQRGISRDDLPFKAKFMP 518

Query: 492 WGAYYAMAMIVAILVGQFWVAISPVGSNKLDANNFFENYLAMPILIFLYLGYKIWTRDWR 551
           +GAYYA   +  I+  Q + +  P         +FF +Y+++ +L  ++ G +++ +  R
Sbjct: 519 YGAYYASFFVTVIIFIQGFQSFCP-----FRVADFFTSYISLILLAVVFTGCQLYYK-CR 572

Query: 552 LLIPSSEVDLVAHRKIFDAEVLRHEQ 577
            +    ++D+ + R+  +A +   ++
Sbjct: 573 FIWKLEDIDIDSDRREIEAIIWEDDE 598

>Suva_14.73 Chr14 complement(130474..131967) [1494 bp, 497 aa] {ON}
           YNL268W (REAL)
          Length = 497

 Score =  219 bits (557), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 142/487 (29%), Positives = 229/487 (47%), Gaps = 25/487 (5%)

Query: 111 LHNGGPASLVIGYAIVSSMLYCVIQSASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWV 170
           L + GP   +I Y  + +++Y V QS  E+A  +  +   F+ +    +  A G +  ++
Sbjct: 20  LAHAGPVGALISYIFMGTVIYSVTQSLGEMAT-FIPVTSSFSVFAQRFLSPALGATNGYM 78

Query: 171 YCLQWLCVLPLELVTASMTIKYWNQTINPDAFVTIFYVVLVAINXXXXXXXXXXXXXXNC 230
           Y L W     LEL      I+YW   +   A++ IF+ +L  +N                
Sbjct: 79  YWLSWCFTFALELSVLGQIIQYWTDAVPLSAWIVIFWCLLTLMNMFPVKYYGEFEFCIAS 138

Query: 231 CKVLMXXXXXXXXXXXNCGGAGNDGYLGARYWHDPGAF-----RGSDSINRFKGIVAVLV 285
            KV+             CG    DG +G RYW +PGA+         +  RF G V+ L+
Sbjct: 139 IKVIALLGFIIYSFCMVCGAGQPDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLI 198

Query: 286 NAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRILGIYIMTAILLGFLVPWNSDELL 345
           NAAF Y G E   +TA E  NP+K++  A KK+V RIL  YIM+   +G LVP+N D  L
Sbjct: 199 NAAFTYQGTELVGITAGEAANPRKAVPRAIKKVVVRILVFYIMSLFFIGLLVPYN-DPKL 257

Query: 346 GSGGSATHASPFVIAVASHGVRVVPHFXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFA 405
            S GS   ASPF+I++ + G +V+P                              +   A
Sbjct: 258 DSDGSFVSASPFMISIENSGTKVLPDIFNAVVLITIVSAGNSNVYIGSRVLYSLSKNDLA 317

Query: 406 PRFLNYVDRCGRPVLCLLVSCVFGLLSFVAASPKEETVFTWLLAISGLSELFTWFSISLS 465
           PRFL+ V + G P   +L + VFG L+F+  S      F WLL I+G++  F W  IS S
Sbjct: 318 PRFLSIVTKGGVPYFAVLATSVFGFLAFLETSAGSGKAFNWLLNITGVAGFFAWLLISFS 377

Query: 466 HVRLRRAMTVQGRSADELGYVAWTGVWGAYYAMAMIVAILVGQFWVAISPVGSNKLDANN 525
           H+R  +A++ +G S ++L Y A    + AYYA   I  I++ Q + A +P         +
Sbjct: 378 HIRFMQAISKRGISRNDLPYKARMMPYLAYYASFFIALIVLIQGFTAFAP----SFQPVD 433

Query: 526 FFENYLAMPILIFLYLGYKIWTRDWRLLIPSSEVDLVAHRKIFDAEVLRHEQLEEK---E 582
           F   Y+++ + + ++  +++W +   +++   +VD+ + R+          ++EE+   E
Sbjct: 434 FVAAYISVFLFVAIWFSFQLWFKC-PIILKLQDVDIDSDRR----------EIEEQVWIE 482

Query: 583 QLRHAPW 589
            LR   W
Sbjct: 483 PLRKTKW 489

>Skud_14.71 Chr14 (127310..129148) [1839 bp, 612 aa] {ON} YEL063C
           (REAL)
          Length = 612

 Score =  221 bits (563), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 141/506 (27%), Positives = 240/506 (47%), Gaps = 14/506 (2%)

Query: 77  KHKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYCVIQS 136
           + K +K+ ++ RH+ MI+L   IGTG+ VG    L   GP   +I Y  + +++Y + QS
Sbjct: 103 EDKHVKRALKQRHIGMIALGGTIGTGLFVGISTPLSKAGPVGSLISYIFMGTVVYFITQS 162

Query: 137 ASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKYWNQT 196
             E+A  +  +      +    +  AFG +  ++Y   W     +E+      I+YW   
Sbjct: 163 LGEMAT-FIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEVSVIGQVIQYWTDK 221

Query: 197 INPDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGGAGNDGY 256
           +    ++ IF+V++  +N                 KVL             CGG+ + G 
Sbjct: 222 VPLAVWIAIFWVLITLMNFFPVKVYGEFEFWVASVKVLAIMGYLIYALVIVCGGS-HQGP 280

Query: 257 LGARYWHDPGAF-----RGSDSINRFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSI 311
           +G RYW +PGA+         +  RF G V+ L+NAAF Y G E   +TA E  NP+K++
Sbjct: 281 IGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTV 340

Query: 312 RSASKKLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSATHASPFVIAVASHGVRVVPH 371
             A  K+V+RI+  YIM+   +G LVP+N   L  S  +   +SPFVI++ + G   +P 
Sbjct: 341 PRAINKVVFRIVLFYIMSLFFIGLLVPYNEPRLSASS-AVIASSPFVISIQNAGTYALPD 399

Query: 372 FXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVSCVFGLL 431
                                        + G AP+   YV + G P L +L +   GLL
Sbjct: 400 IFNAVVLITVISAANSNVYVGSRVLYSLAQTGNAPKQFGYVTKQGVPYLGVLSTAALGLL 459

Query: 432 SFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYVAWTGV 491
           +F+  +    T F WL+ IS L+ L  W  ISL+H+R  +A+  +G S D+L + A    
Sbjct: 460 AFLVVNNNANTAFNWLINISTLAGLCAWLFISLAHIRFMQALEQRGISRDDLPFKAKLMP 519

Query: 492 WGAYYAMAMIVAILVGQFWVAISPVGSNKLDANNFFENYLAMPILIFLYLGYKIWTRDWR 551
           +GAYYA   +  I+  Q + A  P        ++FF +Y+++ +L  ++ G +++ +  R
Sbjct: 520 YGAYYAAFFVTVIIFIQGFQAFCP-----FKVSDFFTSYISLILLAVVFTGCQLYYK-CR 573

Query: 552 LLIPSSEVDLVAHRKIFDAEVLRHEQ 577
            +    ++D+   R+  +A +   ++
Sbjct: 574 FIWKLEDIDIDTDRREIEAIIWEDDE 599

>NDAI0F04200 Chr6 (1016214..1017914) [1701 bp, 566 aa] {ON} 
          Length = 566

 Score =  218 bits (556), Expect = 9e-63,   Method: Compositional matrix adjust.
 Identities = 138/504 (27%), Positives = 241/504 (47%), Gaps = 19/504 (3%)

Query: 77  KHKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYCVIQS 136
           ++  +K+++  RH+ MI+L   IGTG+ +G    L   GP   +I Y  + +++Y V QS
Sbjct: 56  EYHEVKRDLSKRHIAMIALGGTIGTGLFLGIANPLMISGPVGSLIAYLFLGTVVYSVTQS 115

Query: 137 ASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKYWNQT 196
             E+A  +  +   F  +    +  A G +  ++Y   W     LEL      I++W   
Sbjct: 116 LGEMAT-FIPVTASFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSVVGQIIQFWTFA 174

Query: 197 INPDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGGAGNDGY 256
           +   A+++IF+V+L   N                 KV              CG AG  G 
Sbjct: 175 VPLPAWISIFWVILTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCIVCG-AGKTGP 233

Query: 257 LGARYWHDPGAF-RGSDSIN----RFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSI 311
           +G RYW +PG +  G  S N    RF G  + L+NAAF + G E   +TA E  NP++++
Sbjct: 234 VGFRYWRNPGPWGTGIISSNIAEARFLGWASSLINAAFTFQGTELVGITAGEAANPRQTV 293

Query: 312 RSASKKLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSATHASPFVIAVASHGVRVVPH 371
             A +K+V+RIL  YI++   +G LVP++ D  L S  S   +SPF+IA+ + G +++PH
Sbjct: 294 PKAIRKVVFRILVFYILSLFFIGLLVPYD-DVKLKSENSYVSSSPFIIAIENSGTKILPH 352

Query: 372 FXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVSCVFGLL 431
                                        + G  P+      + G PV  ++ + +FG L
Sbjct: 353 IFNGVILVTIISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGAL 412

Query: 432 SFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYVAWTGV 491
           +F+  S   +  F WLL + G++  F+W  IS +H+R  + +  +G S ++L + A    
Sbjct: 413 AFMETSTGGDEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLPFKAKFMP 472

Query: 492 WGAYYAMAMIVAILVGQFWVAISPVGSNKLDANNFFENYLAMPILIFLYLGYKIWTR--- 548
           + AYYA  +++ I+  Q + A +P    K D  NFF +Y+++ +    +  +++W +   
Sbjct: 473 YLAYYATIVMIIIIFFQGFTAFAP----KFDVLNFFASYISVFLFFIFWGSFQLWFKCRY 528

Query: 549 DWRLLIPSSEVDLVAHRKIFDAEV 572
            W+L+    ++D+   R+  +  V
Sbjct: 529 VWKLV----DIDIDKDRREIEDRV 548

>Ecym_2480 Chr2 complement(940315..942075) [1761 bp, 586 aa] {ON}
           similar to Ashbya gossypii ACL135W
          Length = 586

 Score =  218 bits (556), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 154/531 (29%), Positives = 256/531 (48%), Gaps = 26/531 (4%)

Query: 77  KHK--TLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYCVI 134
           KHK   LK++++ RHV MI++   +GTG+L+G G +L   GP +++I Y+I+  +++ V+
Sbjct: 52  KHKGIRLKKDLQARHVSMIAIGGSLGTGLLIGTGSALSQAGPIAILIAYSIMGWVVFTVM 111

Query: 135 QSASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKYW- 193
               E+A  Y  L  GF +Y +   D A GF+V + Y  ++L + P +L  A++ ++YW 
Sbjct: 112 SCLGEMAA-YIPL-DGFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWV 169

Query: 194 -NQTINPDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGGAG 252
               +NP  ++T+F  V++ IN              +  KVL+             GG  
Sbjct: 170 GRGKVNPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKVLVMLCVMTLLLVLVLGGGP 229

Query: 253 NDGYLGARYWHDPGAFR---GSDSI----NRFKGIVAVLVNAAFAYGGAEFSVLTAAEQQ 305
           +   LG RYW DPG F+   G+ SI     +F    +V V A FAY G E   + AAE +
Sbjct: 230 SHNRLGFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECK 289

Query: 306 NPQKSIRSASKKLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSATH--ASPFVIAVAS 363
           NP++++  A K  +YRI+  Y+ T  LLG  V +N   LL +  + T   ASP+V+A+ +
Sbjct: 290 NPRRNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQTKKAKTSAAASPYVVAIKN 349

Query: 364 HGVRVVPHFXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLL 423
            G+ V+PH                                 AP+     +  G P   L 
Sbjct: 350 AGIPVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLA 409

Query: 424 VSCVFGLLSFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADEL 483
           +  +F  L+++  S   ET+F++ + ++ +  L +W SI ++++   RA  VQG   + L
Sbjct: 410 LCTLFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTL 469

Query: 484 GYVAWTGVWGAYYAMAMIVAI-LVGQFWVAISPVGSNKLDANNFFENYLAMPILIFLYLG 542
            Y A      A+ A+   + + LV  F V +     +  D   F   Y+ +P+ I  ++ 
Sbjct: 470 SYQAPFQPVTAWIALGFCLMVALVKNFTVFL----GDTFDYKTFITGYIGIPVYILCFVC 525

Query: 543 YKIWTR-DWRLLIPSSEVDLVAHRKIFDAEVL--RHEQLEEKEQLRHAPWT 590
           YKI  +  W   I S+ VDL  ++   D E    + E +  KE+ +   WT
Sbjct: 526 YKIVHKTKW---IKSANVDLFTYKTAIDLEEEEGKLEMMRLKEERKQHGWT 573

>AFR667C Chr6 complement(1657505..1659196) [1692 bp, 563 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL268W
           (LYP1)
          Length = 563

 Score =  216 bits (551), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 139/516 (26%), Positives = 238/516 (46%), Gaps = 23/516 (4%)

Query: 73  ESASKHKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYC 132
           E   +   +K+ ++ RH+ MI+L   IGTG+ +     L   GP   ++ Y  + +++Y 
Sbjct: 47  EGDYQETEVKRALKARHISMIALGGTIGTGLFIVIASPLRTAGPVGSLLAYIFIGTVVYS 106

Query: 133 VIQSASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKY 192
           + QS  E+A  +  +      +    +  AFG +  ++Y   W     +EL      I+Y
Sbjct: 107 ITQSLGEMAT-FIPVTSSVTVFSKRFLSPAFGVANGYMYWFNWAITFAVELSVVGQIIQY 165

Query: 193 WNQTINPDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGGAG 252
           W   +   A++ IF+V++  +N                 KVL             CGG+ 
Sbjct: 166 WTDRVPIAAWIVIFWVLVTLVNFFPVRFYGEIEFWIASVKVLTIVGYLIYAFIIVCGGSK 225

Query: 253 N-------DGYLGARYWHDPGAFRGSDSINR----FKGIVAVLVNAAFAYGGAEFSVLTA 301
                    G + AR     GA R S    R    F G V+ L+ AAF Y G E   +TA
Sbjct: 226 QGPIGLPATGGIPAR-----GA-RASSRTTRKRHGFLGWVSSLIKAAFTYQGTELVGITA 279

Query: 302 AEQQNPQKSIRSASKKLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSATHASPFVIAV 361
            E  NP+K++  A  K+ +RIL  YI + + +G LVP++   L     +  +ASPFVI++
Sbjct: 280 GESTNPRKNVPKAINKVFFRILFFYIGSLLFVGLLVPYDDPRLNSESSTDVNASPFVISI 339

Query: 362 ASHGVRVVPHFXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLC 421
            + G +++P                                G AP+ L +V + G P   
Sbjct: 340 KNAGTKILPDIFNAVVLITVISAANSNVYIGSRVAYSLALAGNAPKQLAFVTKQGVPYFG 399

Query: 422 LLVSCVFGLLSFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSAD 481
           +L++ + GL+SF+  +    T F WL+ IS L+ L  W  ISL+H+R  + +  +G S D
Sbjct: 400 VLITSLMGLMSFLVLNHNASTAFDWLVNISTLAGLCAWLFISLAHIRFMQCLKHRGISRD 459

Query: 482 ELGYVAWTGVWGAYYAMAMIVAILVGQFWVAISPVGSNKLDANNFFENYLAMPILIFLYL 541
           +L + A    W AYYA   +  I+  Q + A +P    K D   FF +Y+++ +++ +++
Sbjct: 460 DLPFKAKFMPWAAYYATFFVTVIIFIQGYTAFTP----KFDVTTFFTSYISLFLMLLVFI 515

Query: 542 GYKIWTRDWRLLIPSSEVDLVAHRKIFDAEVLRHEQ 577
           G +I+ +  R L    ++D+ + R+  DA V   ++
Sbjct: 516 GCQIYYK-CRFLWAVEDIDIDSDRREIDAIVWEEDE 550

>Skud_7.4 Chr7 (9030..10079) [1050 bp, 349 aa] {ON} YKR039W (REAL)
          Length = 349

 Score =  210 bits (535), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 122/351 (34%), Positives = 194/351 (55%), Gaps = 24/351 (6%)

Query: 5   ELHNMKSPDNGVVESFDSVEVLKEESPRSDSRSD--------GL---FRRFADSFRRHEA 53
           E  N+     G+  +    E + +E P S   SD        GL   + RF +SF+R E 
Sbjct: 7   EKDNVNYDVKGIEPAITETESISQE-PFSTFSSDNNELTSEGGLNNTWTRFKNSFKRFEL 65

Query: 54  HNXXXXXXXXXXXXXLTPIESASKHKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHN 113
                             I  A+    LK  ++ RH+ MI++   IGTG+ VG+GK+L  
Sbjct: 66  EELDPNLTDA------EKIAIATARSPLKHTLKKRHLHMIAVGGAIGTGLFVGSGKALRT 119

Query: 114 GGPASLVIGYAIVSSMLYCVIQSASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCL 173
            GPA ++IG+ +  SM+YC++ +  ELA+I+  ++GGF  Y +  +D++FGF+V++ Y L
Sbjct: 120 AGPAGILIGWTVTGSMIYCMVMAVGELAVIF-PVSGGFTTYATRFIDESFGFAVNFNYML 178

Query: 174 QWLCVLPLELVTASMTIKYWNQTINP---DAFVTIFYVVLVAINXXXXXXXXXXXXXXNC 230
           QWL  LPLE+V AS+T+ YW   ++P   D FV +F+VV+V+IN                
Sbjct: 179 QWLVTLPLEIVAASITVNYWG--VDPKYRDGFVALFWVVIVSINLFGVKGYGEAEFIFAV 236

Query: 231 CKVLMXXXXXXXXXXXNCGGAGNDGYLGARYWHDPGAFRGSDSINRFKGIVAVLVNAAFA 290
            KV+             CGG    G++GA+YWH+PGAF G+    +FKG   V + A+F+
Sbjct: 237 IKVITIIGFIIMAVVLICGGGPQGGFIGAKYWHNPGAFVGATPGLKFKGFCTVFITASFS 296

Query: 291 YGGAEFSVLTAAEQQNPQKSIRSASKKLVYRILGIYIMTAILLGFLVPWNS 341
           +GG+E   +  +E +NP+KS+  A+K++ +RI+  Y++  +L+G LVP+N 
Sbjct: 297 FGGSEVVGIAGSEAENPRKSVPGAAKQVFWRIILFYVICLLLIGMLVPYND 347

>Skud_51.1 Chr51 (364..1407) [1044 bp, 348 aa] {ON} YKR039W (REAL)
          Length = 348

 Score =  210 bits (535), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 122/351 (34%), Positives = 194/351 (55%), Gaps = 24/351 (6%)

Query: 5   ELHNMKSPDNGVVESFDSVEVLKEESPRSDSRSD--------GL---FRRFADSFRRHEA 53
           E  N+     G+  +    E + +E P S   SD        GL   + RF +SF+R E 
Sbjct: 7   EKDNVNYDVKGIEPAITETESISQE-PFSTFSSDNNELTSEGGLNNTWTRFKNSFKRFEL 65

Query: 54  HNXXXXXXXXXXXXXLTPIESASKHKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHN 113
                             I  A+    LK  ++ RH+ MI++   IGTG+ VG+GK+L  
Sbjct: 66  EELDPNLTDAEK------IAIATARSPLKHTLKKRHLHMIAVGGAIGTGLFVGSGKALRT 119

Query: 114 GGPASLVIGYAIVSSMLYCVIQSASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCL 173
            GPA ++IG+ +  SM+YC++ +  ELA+I+  ++GGF  Y +  +D++FGF+V++ Y L
Sbjct: 120 AGPAGILIGWTVTGSMIYCMVMAVGELAVIF-PVSGGFTTYATRFIDESFGFAVNFNYML 178

Query: 174 QWLCVLPLELVTASMTIKYWNQTINP---DAFVTIFYVVLVAINXXXXXXXXXXXXXXNC 230
           QWL  LPLE+V AS+T+ YW   ++P   D FV +F+VV+V+IN                
Sbjct: 179 QWLVTLPLEIVAASITVNYWG--VDPKYRDGFVALFWVVIVSINLFGVKGYGEAEFIFAV 236

Query: 231 CKVLMXXXXXXXXXXXNCGGAGNDGYLGARYWHDPGAFRGSDSINRFKGIVAVLVNAAFA 290
            KV+             CGG    G++GA+YWH+PGAF G+    +FKG   V + A+F+
Sbjct: 237 IKVITIIGFIIMAVVLVCGGGPQGGFIGAKYWHNPGAFVGATPGLKFKGFCTVFITASFS 296

Query: 291 YGGAEFSVLTAAEQQNPQKSIRSASKKLVYRILGIYIMTAILLGFLVPWNS 341
           +GG+E   +  +E +NP+KS+  A+K++ +RI+  Y++  +L+G LVP+N 
Sbjct: 297 FGGSEVVGIAGSEAENPRKSVPGAAKQVFWRIILFYVICLLLIGMLVPYND 347

>Skud_47.1 Chr47 (1..987) [987 bp, 328 aa] {ON} YPL274W (REAL)
          Length = 328

 Score =  207 bits (526), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 116/326 (35%), Positives = 179/326 (54%), Gaps = 6/326 (1%)

Query: 277 FKGIVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRILGIYIMTAILLGFL 336
           FK +    V+AAF++GG+E  +LT+ E +N   +I  A+K   +RI   YI T +++G L
Sbjct: 5   FKNLCNTFVSAAFSFGGSELVLLTSTESKNIS-AISRAAKGTFWRIAIFYITTVVIIGCL 63

Query: 337 VPWNSDELL-GSGGSATHASPFVIAVASHGVR--VVPHFXXXXXXXXXXXXXXXXXXXXX 393
           VP+N   LL GS      ASPFVIA+++ G     V +F                     
Sbjct: 64  VPYNDSRLLNGSTSEDISASPFVIALSNTGSMGAKVSNFMNVVILVAVVSVCNSCVYASS 123

Query: 394 XXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVSCVFGLLSFVAASPKEETVFTWLLAISGL 453
                    G  P   +Y+DR GRP++ + +S VFGLL F+ AS KE+ VFTWL A+  +
Sbjct: 124 RLIQALGASGQLPSICSYMDRKGRPLVGIAISGVFGLLGFLVASNKEDEVFTWLFALCSI 183

Query: 454 SELFTWFSISLSHVRLRRAMTVQGRSADELGYVAWTGVWGAYYAMAMIVAILVGQFWVAI 513
           S  FTWF I +S +R R A+  QGRS DE+ Y +  GV+G      +   ++ G+ +V+ 
Sbjct: 184 SSFFTWFCICMSQIRFRMALKAQGRSKDEIAYKSMLGVYGGVLGCVLNALLIAGEIYVSA 243

Query: 514 SPVGSNKLDANNFFENYLAMPILIFLYLGYKIWTRDWR-LLIPSSEVDLVAHRKIFDAEV 572
           +PVGS    A  FFE  L++PI+I +Y+ ++I+ +DWR   I  S++DL     I + ++
Sbjct: 244 APVGSPS-SAKAFFEYCLSIPIMIVVYVAHRIYRKDWRNWYIKRSDIDLDTGCSIENLDL 302

Query: 573 LRHEQLEEKEQLRHAPWTTRLANFWC 598
            + ++  EKE +   P+  ++  FWC
Sbjct: 303 FKAQKEAEKELIASKPFYYKIYRFWC 328

>YOR348C Chr15 complement(986899..988782) [1884 bp, 627 aa] {ON}
           PUT4Proline permease, required for high-affinity
           transport of proline; also transports the toxic proline
           analog azetidine-2-carboxylate (AzC); PUT4 transcription
           is repressed in ammonia-grown cells
          Length = 627

 Score =  215 bits (547), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 152/590 (25%), Positives = 261/590 (44%), Gaps = 24/590 (4%)

Query: 13  DNGVVESFDSVEVLKEESPRSDSRSDGLFRRFADSFRRHEAHN-XXXXXXXXXXXXXLTP 71
           +  VV+  +S       + RSD+  D   R    S  +  + N               +P
Sbjct: 36  EEDVVQVTESPSSGSRNNHRSDNEKDDAIRMEKISKNQSASSNGTIREDLIMDVDLEKSP 95

Query: 72  -IESASKHKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSML 130
            ++  S+   LKQ ++ RHV +I+L   IGTG+LVG   +LH  GPA L I Y I+S+++
Sbjct: 96  SVDGDSEPHKLKQGLQSRHVQLIALGGAIGTGLLVGTSSTLHTCGPAGLFISYIIISAVI 155

Query: 131 YCVIQSASELAIIY----TSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTA 186
           Y ++ +  E+        +  AG      +  VD + GF+  W Y   ++ ++  E   A
Sbjct: 156 YPIMCALGEMVCFLPGDGSDSAGSTANLVTRYVDPSLGFATGWNYFYCYVILVAAECTAA 215

Query: 187 SMTIKYWNQTINPDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXX 246
           S  ++YW   +    ++TIF  V+V +N                 K+L            
Sbjct: 216 SGVVEYWTTAVPKGVWITIFLCVVVILNFSAVKVYGESEFWFASIKILCIVGLIILSFIL 275

Query: 247 NCGGAGNDGYLGARYWHDPGAFR---GSDSINRFKGIVAVLVNAAFAYG-GAEFSVLTAA 302
             GG  N   LG RYW  PGAF       S+  F  I   ++  AFA+  G E   +T+A
Sbjct: 276 FWGGGPNHDRLGFRYWQHPGAFAHHLTGGSLGNFTDIYTGIIKGAFAFILGPELVCMTSA 335

Query: 303 EQQNPQKSIRSASKKLVYRILGIYIMTAILLGFLVPWNSDEL---LGSGGSATHASPFVI 359
           E  + +++I  AS++ V+R++  Y++  + +  +VP+N   L   L  G     +SPFVI
Sbjct: 336 ECADQRRNIAKASRRFVWRLIFFYVLGTLAISVIVPYNDPTLVNALAQGKPGAGSSPFVI 395

Query: 360 AVASHGVRVVPHFXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPV 419
            + + G++V+PH                             + G AP+ L  +++ G P 
Sbjct: 396 GIQNAGIKVLPHIINGCILTSAWSAANAFMFASTRSLLTMAQTGQAPKCLGRINKWGVPY 455

Query: 420 LCLLVSCVFGLLSFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRS 479
           + + VS +   L+++  S     VF W   IS +S    W    ++++R R+A+   G  
Sbjct: 456 VAVGVSFLCSCLAYLNVSSSTADVFNWFSNISTISGFLGWMCGCIAYLRFRKAIFYNGL- 514

Query: 480 ADELGYVAWTGVWGAYYAMAMIVAILVGQFWVAISPVGSNKLDANNFFENYLAMPILIFL 539
            D L +  W   +  ++++ +I  I +   +    P         +F   Y+ +PI + L
Sbjct: 515 YDRLPFKTWGQPYTVWFSLIVIGIITITNGYAIFIP---KYWRVADFIAAYITLPIFLVL 571

Query: 540 YLGYKIWTRDWRL-LIPSSEVDLVAHRKIFDAEVLRHEQLEEKEQLRHAP 588
           + G+K++TR WR   +P SE+D+          V   E+  E E++R  P
Sbjct: 572 WFGHKLYTRTWRQWWLPVSEIDVTT------GLVEIEEKSREIEEMRLPP 615

>SAKL0B10956g Chr2 complement(949900..951618) [1719 bp, 572 aa] {ON}
           similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348C PUT4 proline-specific permease (also capable of
           transporting alanine and glycine) putative proline-
           specific permease
          Length = 572

 Score =  214 bits (544), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 141/530 (26%), Positives = 245/530 (46%), Gaps = 22/530 (4%)

Query: 73  ESASKHKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYC 132
           ++     TLK+ ++ RH+ +I+L   IGTG+ VG   +LH  GPA L   Y I+S ++Y 
Sbjct: 43  DAPQGDHTLKKGLKSRHIQLIALGGCIGTGLFVGTSSTLHACGPAGLFTSYCIISVIIYP 102

Query: 133 VIQSASELAIIYTSLAGGFNAYPSLL----VDKAFGFSVSWVYCLQWLCVLPLELVTASM 188
           V+ +  E+               S L    VD + GF+  W Y   ++ ++  E   AS 
Sbjct: 103 VMNALGEMVCYLPGDGSSSGGSISKLVTRYVDPSLGFATGWNYYYCYVILVAAECTAASG 162

Query: 189 TIKYWNQTINPDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNC 248
            ++YW   +   A++TIF  V+V +N                 K+L              
Sbjct: 163 VVQYWTTAVPKGAWITIFLGVVVLLNFCAVKFYGESEFWFASMKILCILGLLFVSFILFW 222

Query: 249 GGAGNDGYLGARYWHDPGAFR---GSDSINRFKGIVAVLVNAAFAY-GGAEFSVLTAAEQ 304
           GG  +   LG RYW  PGAF     S +  RF  I   ++   FA+  G E   LT+AE 
Sbjct: 223 GGGPHHDRLGFRYWQKPGAFAYHITSGNTGRFLDIWTGVIKGGFAFILGPELVALTSAEA 282

Query: 305 QNPQKSIRSASKKLVYRILGIYIMTAILLGFLVPWNSDEL---LGSGGSATHASPFVIAV 361
           Q+ +++I+ AS++ VYR++  Y+ +++ +G +V +N   L   L  G     +SPFVI +
Sbjct: 283 QDARRNIQKASRRFVYRLIFFYVSSSLAIGCIVAYNDKTLSTALDQGKPGAGSSPFVIGI 342

Query: 362 ASHGVRVVPHFXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLC 421
            + G++V+PH                             ++GFAP+ L  V+R G P   
Sbjct: 343 QNAGIKVLPHIINVCILSSAWSSGNSFMFAASRSLLSMSQEGFAPKILGRVNRFGVPYAA 402

Query: 422 LLVSCVFGLLSFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSAD 481
           + ++ +   ++++  S     VFTW   IS +S    W  I ++++R R+A+  Q    +
Sbjct: 403 VALTSLLSCIAYLNVSSSTADVFTWFSNISTISGFIGWICIGIAYLRFRKAIFFQNLY-E 461

Query: 482 ELGYVAWTGVWGAYYAMAMIVAILVGQFWVAISPVGSNKLDANNFFENYLAMPILIFLYL 541
            + +      +G ++ +  +  I +   +    P   N    ++F   Y+ +PI + L++
Sbjct: 462 RVPFKTPFQPYGTWFFIIAVSVICLTNGYAIFIPANWN---VSDFIAAYVTLPIFLVLWI 518

Query: 542 GYKIWTRDWRL-LIPSSEVDLVAHRKIFDAEVLRHEQLEEKEQLRHAPWT 590
           G+K+WTR W+   IP  E+D+    K  +      E+ +E ++ R  P T
Sbjct: 519 GHKLWTRTWKTWAIPVPEIDVTTGLKEIE------EESKECDEKRIVPTT 562

>Kpol_2000.65 s2000 (134897..136684) [1788 bp, 595 aa] {ON}
           (134897..136684) [1788 nt, 596 aa]
          Length = 595

 Score =  213 bits (543), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 137/482 (28%), Positives = 233/482 (48%), Gaps = 14/482 (2%)

Query: 73  ESASKHKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYC 132
           +   +   +K+ ++ RH+ MI+L   IGTG+ +G    L N GP   +I Y  ++++++ 
Sbjct: 81  QGVVQDAEVKRELKQRHIGMIALGGTIGTGLFIGISTPLKNAGPVGSLIAYLFMATIVFS 140

Query: 133 VIQSASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKY 192
           V QS  E+A  +  +   F  + S  +  + G +  ++Y   W     LEL      I++
Sbjct: 141 VTQSLGEMAT-FIPVTSSFTVFSSRFISPSIGAANGYMYWFSWAITFALELSVVGQIIQF 199

Query: 193 WNQTINPDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGGAG 252
           W   +   A++ I++ +L  +N                 KV+             CG AG
Sbjct: 200 WTDAVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCMVCG-AG 258

Query: 253 NDGYLGARYWHDPGAFRGSDSIN------RFKGIVAVLVNAAFAYGGAEFSVLTAAEQQN 306
             G +G RYW +PG + G   I+      RF G V+ L+NAAF Y G E   +TA E  N
Sbjct: 259 VTGPVGFRYWRNPGPW-GPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAGEAAN 317

Query: 307 PQKSIRSASKKLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSATHASPFVIAVASHGV 366
           P+K++  A KK+ +RIL  YI++   +G LVP++ D  L S  S   +SPF+IA+ + G 
Sbjct: 318 PRKTVPRAIKKVSFRILIFYILSLFFIGLLVPFD-DPKLSSDDSYVSSSPFIIAIQNSGT 376

Query: 367 RVVPHFXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVSC 426
           +V+PH                             +   APR+     + G P + +L + 
Sbjct: 377 KVLPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVLFTS 436

Query: 427 VFGLLSFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYV 486
            FG L+F+  S      F WLL I G++  F W  IS++HVR  + +  +G S D+L + 
Sbjct: 437 AFGALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDLPFK 496

Query: 487 AWTGVWGAYYAMAMIVAILVGQFWVAISPVGSNKLDANNFFENYLAMPILIFLYLGYKIW 546
           A    W AYYA+  ++ I++ Q + A +P      + ++F   Y+++ +  FL++ ++++
Sbjct: 497 AALMPWLAYYAIFFMIIIIIIQGFTAFAP----TFNGSDFVAAYISVFLFFFLWVSFQLY 552

Query: 547 TR 548
            R
Sbjct: 553 FR 554

>Smik_15.532 Chr15 complement(932437..934332) [1896 bp, 631 aa] {ON}
           YOR348C (REAL)
          Length = 631

 Score =  214 bits (545), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 156/603 (25%), Positives = 267/603 (44%), Gaps = 45/603 (7%)

Query: 10  KSPDNGVVESFDSVEV-LKEESPRSDSRSDGLFRRFADSFRRHEAHNXXXXXXXXXXXXX 68
           K  DN VV+  +S+   L+   P  + + D +  R     + H A +             
Sbjct: 38  KKEDN-VVQVTESLSSGLRRNHPYDNEKDDAI--RMEKISKNHSASSNGTIREDLIMDVD 94

Query: 69  LTP---IESASKHKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAI 125
           +     +E  ++   LKQ ++ RHV +I+L   IGTG+LVG   +LH  GPA L I Y I
Sbjct: 95  VEKSPSVEGDNEPHKLKQGLQSRHVQLIALGGAIGTGLLVGTSSTLHTCGPAGLFISYII 154

Query: 126 VSSMLYCVIQSASELAIIY----TSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPL 181
           +S+++Y ++ +  E+        +  AG      +  VD + GF+  W Y   ++ ++  
Sbjct: 155 ISAVIYPIMCALGEMVCFLPGDGSDSAGSTANLVTRYVDASLGFATGWNYFYCYVILVAA 214

Query: 182 ELVTASMTIKYWNQTINPDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXX 241
           E   AS  ++YW   +    ++TIF  V+V +N                 K+L       
Sbjct: 215 ECTAASGVVEYWTTAVPKGVWITIFLCVVVLLNLSAVKVYGESEFWFASIKILCIVGLII 274

Query: 242 XXXXXNCGGAGNDGYLGARYWHDPGAFR---GSDSINRFKGIVAVLVNAAFAY-GGAEFS 297
                  GG  N   LG RYW  PGAF       S+  F  I   ++  AFA+  G E  
Sbjct: 275 LSFILFWGGGPNHDRLGFRYWQHPGAFAHHLTGGSLGNFTDIYTGIIKGAFAFILGPELV 334

Query: 298 VLTAAEQQNPQKSIRSASKKLVYRILGIYIMTAILLGFLVPWNSDEL---LGSGGSATHA 354
            +T+AE  + +++I  AS++ V+R++  Y++  + +  +VP+N   L   L  G     +
Sbjct: 335 CMTSAECADQRRNISKASRRFVWRLIFFYVLGTLAISVIVPYNDPSLVNALAQGKPGAGS 394

Query: 355 SPFVIAVASHGVRVVPHFXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDR 414
           SPFVI + + G++V+PH                             + G AP+ L  ++R
Sbjct: 395 SPFVIGIQNAGIKVLPHIINGCILSSAWSAANAFMFASTRSLLTMAQTGQAPKCLGRINR 454

Query: 415 CGRPVLCLLVSCVFGLLSFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMT 474
            G P + + VS +   L+++  S     VF W   IS +S    W    ++++R R+A+ 
Sbjct: 455 WGVPYVAVGVSFLCSCLAYLNVSSSTADVFNWFSNISTISGFLGWMCGCIAYLRFRKAIF 514

Query: 475 VQGRSADELGYVAWT---GVWGAYYAMAMIV-----AILVGQFWVAISPVGSNKLDANNF 526
             G   D L +  W     VW +   + +I      AI + ++W              +F
Sbjct: 515 YNGL-FDRLPFKTWGQPYTVWASLIVVGIITLTNGYAIFIPKYW-----------KIADF 562

Query: 527 FENYLAMPILIFLYLGYKIWTRDW-RLLIPSSEVDLVAHRKIFDAEVLRHEQLEEKEQLR 585
              Y+ +PI + L+ G+K++TR W +  +P SE+D+     + + E    E+  E E++R
Sbjct: 563 IAAYITLPIFLVLWFGHKLYTRTWSQWWLPVSEIDVTT--GLIEIE----EKSREIEEMR 616

Query: 586 HAP 588
             P
Sbjct: 617 LPP 619

>KNAG0L02460 Chr12 (437963..439729) [1767 bp, 588 aa] {ON} 
          Length = 588

 Score =  209 bits (533), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 154/531 (29%), Positives = 252/531 (47%), Gaps = 25/531 (4%)

Query: 73  ESASKHKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYC 132
           +     + LK++++ RHV MI++   +GTG+L+G G SL   GP S++I Y+ V  +++ 
Sbjct: 54  DGKCSDQRLKKDLKARHVSMIAIGGSLGTGLLIGTGNSLAVAGPVSMLISYSFVGVLVFF 113

Query: 133 VIQSASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKY 192
           V+    E+A  Y  L  GF +Y S   D A GF+V + Y +++  + P +L  A++ I+Y
Sbjct: 114 VMSCIGEMA-AYIPL-DGFTSYASRYCDPALGFAVGYAYLVKYFILPPNQLTAAALVIQY 171

Query: 193 W--NQTINPDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGG 250
           W   + +NP  ++TI  VV+V IN              +  KV++             GG
Sbjct: 172 WIPREKVNPGVWITIVLVVIVVINTFGVKFFGEFEFWLSSFKVIVMLGLIILMFIIMLGG 231

Query: 251 AGNDGYLGARYWHDPGAFRGSD-----SINRFKGIVAVLVNAAFAYGGAEFSVLTAAEQQ 305
                 LG RYW  PGAF+         I RF   V+  V   F Y G E + + AAE +
Sbjct: 232 TPTHDRLGFRYWKHPGAFKEYSKSIHGDIGRFVSFVSCFVYGLFCYLGIELTGIVAAEAE 291

Query: 306 NPQKSIRSASKKLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSATH--ASPFVIAVAS 363
           NP+K+I  A K  ++RI+  YI+T  LLG  V  N   LL +   +T   ASPFV+A+ +
Sbjct: 292 NPRKNIPKAIKLTMWRIIIFYIITIFLLGMCVSSNDPLLLEAKTKSTSAAASPFVVAIVN 351

Query: 364 HGVRVVPHFXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLL 423
            G+  +PH                                 AP+     +R G P   L 
Sbjct: 352 SGIEALPHIFNACVLMFVFSACNSDLYVASRNLYSLAIDNKAPKIFAKTNRFGIPYNSLG 411

Query: 424 VSCVFGLLSFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADEL 483
           V+ +F LL++++ S     +F + + +  ++ + TW SI ++++   RA+  QG      
Sbjct: 412 VAVLFCLLAYMSVSSGSAKIFNYFVNVVSITGVLTWISILITYICFDRAVRAQGIDKSTF 471

Query: 484 GYVAWTGVWGAYYAMAMIVAI-LVGQFWVAISPVGSNKLDANNFFENYLAMPILIFLYLG 542
            YVA    +GAY+++     + L+  F V +    ++K D  NF   Y+ +P+    Y G
Sbjct: 472 AYVAPLQPYGAYFSLFFCCLLALIKNFTVFL----NHKFDYRNFITGYIGLPLFFICYFG 527

Query: 543 YKIWTRDWRLLIPSSEVDLVAHRKIFDAEVLRHEQLEEKEQLRHAPWTTRL 593
           YK + +  ++  P  EVDL + +   D E       EE  +++ A    R+
Sbjct: 528 YK-FVKKTKIRKP-EEVDLFSFKAAIDQE-------EEDGRIKDAATAERI 569

>ACL135W Chr3 (115359..117125) [1767 bp, 588 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YPL265W (DIP5)
          Length = 588

 Score =  209 bits (532), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 152/527 (28%), Positives = 250/527 (47%), Gaps = 29/527 (5%)

Query: 77  KHK--TLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYCVI 134
           KH+   LK++++ RHV MI++   +GTG+L+G G SL   GP S++I Y+I+  +++ V+
Sbjct: 53  KHEGIRLKKDLQARHVSMIAIGGSLGTGLLIGTGSSLMRAGPGSILIAYSIMGWVVFTVM 112

Query: 135 QSASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKYW- 193
               E+A  Y  L  GF +Y +   D A GF+V W Y  ++L + P +L   ++ I++W 
Sbjct: 113 SCLGEMA-AYIPL-DGFTSYATRYADPALGFAVGWAYLFKYLVLTPNQLTAGALVIQFWI 170

Query: 194 -NQTINPDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGGAG 252
               ++P  ++T+   V+V IN              +  KVL+             GG  
Sbjct: 171 PAARVSPGVWITVVLAVIVVINTVGVRFFGEFEFWLSSFKVLVMLCVMILLLVLALGGGP 230

Query: 253 NDGYLGARYWHDPGAFRG--------SDSINRFKGIVAVLVNAAFAYGGAEFSVLTAAEQ 304
               LG RYW DPGAF+            + +F   ++V V A FAY G E   + AAE 
Sbjct: 231 THDRLGFRYWSDPGAFKEYSKKDTHIKGGLGKFVAFLSVFVYALFAYLGTELCGIVAAEC 290

Query: 305 QNPQKSIRSASKKLVYRILGIYIMTAILLGFLVPWNSDELL--GSGGSATHASPFVIAVA 362
           ++P++++  A K  +YRI+  Y++T  LLG  V +N   L+   S   +  ASP+V+A+ 
Sbjct: 291 KDPRRNVPRAIKLTLYRIVVFYLVTIFLLGMCVAYNDPLLMQASSAEVSAAASPYVVAIE 350

Query: 363 SHGVRVVPHFXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCL 422
           +  + V+P+                               G AP+     ++ G P   L
Sbjct: 351 NAVIPVLPNLFNACVLTFVFSACNSDLYVGSRSLYGLAIDGKAPKLFARTNKWGVPYNAL 410

Query: 423 LVSCVFGLLSFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADE 482
               +F  L++++ S    T F + + ++ +  L +W SI ++++   RA   QG     
Sbjct: 411 ACCTLFCCLAYMSVSKSARTAFGYFVNVTSIFGLMSWVSILITYICFDRAFRAQGIPKST 470

Query: 483 LGYVAWTGVWGAYYAMAMIVAI-LVGQFWVAISPVGSNKLDANNFFENYLAMPILIFLYL 541
           L YVA    +  + A+   + + L+  F   I      ++D   F   Y+ +PI IF ++
Sbjct: 471 LSYVAPCQPYAGWVALIFCIFVALIKNFDAFI----GKEVDVPTFITGYIGLPIYIFCFI 526

Query: 542 GYKIWTR-DWRLLIPSSEVDLVAHRKIFD---AEVLRHEQLEEKEQL 584
           GYKI  +  W   IPS EVDL   ++  D    E +R   L  KEQL
Sbjct: 527 GYKIVHKTKW---IPSKEVDLFTFKEAIDLEEEECIRERAL-MKEQL 569

>Suva_8.402 Chr8 complement(722727..724778) [2052 bp, 683 aa] {ON}
           YOR348C (REAL)
          Length = 683

 Score =  211 bits (536), Expect = 4e-59,   Method: Compositional matrix adjust.
 Identities = 159/605 (26%), Positives = 262/605 (43%), Gaps = 33/605 (5%)

Query: 11  SPDNGVVESFDSVE-----VLKEESPRSDSRSDGLFRRFADSFRRHEAHNXXXXXXXXXX 65
           SP   VV   D+ +     V   ESP S SR+        D+ R  +             
Sbjct: 82  SPAQTVVTFTDAADKDPNVVQVTESPSSGSRTHHYEAEKDDAIRMEKISKNQSASSNGTV 141

Query: 66  XXXLTPIES------ASKHKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASL 119
              L   +S      A  H+ LKQ ++ RHV +I+L   IGTG+LVG   +LH  GPA L
Sbjct: 142 REELDLEKSPSADGDAGPHR-LKQGLQSRHVQLIALGGAIGTGLLVGTSSTLHTCGPAGL 200

Query: 120 VIGYAIVSSMLYCVIQSASELAIIY----TSLAGGFNAYPSLLVDKAFGFSVSWVYCLQW 175
            I Y I+S+++Y ++ +  E+        +  AG      +  VD + GF+  W Y   +
Sbjct: 201 FISYIIISAVIYPIMCALGEMVCFLPGDGSDSAGSSANLVTRYVDASLGFATGWNYYYCY 260

Query: 176 LCVLPLELVTASMTIKYWNQTINPDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLM 235
           + ++  E   AS  ++YW   +    ++TIF  V+V +N                 K+L 
Sbjct: 261 VILVAAECTAASGVVEYWTTAVPKGVWITIFLCVVVLLNFSAVKVYGESEFWFASIKILC 320

Query: 236 XXXXXXXXXXXNCGGAGNDGYLGARYWHDPGAFR---GSDSINRFKGIVAVLVNAAFAY- 291
                        GG      LG RYW  PG+F       S+  F  I   ++  AFA+ 
Sbjct: 321 IVGLIILSFILFWGGGPKHDRLGFRYWQHPGSFAHHLAGGSLGNFTDIYTGIIKGAFAFI 380

Query: 292 GGAEFSVLTAAEQQNPQKSIRSASKKLVYRILGIYIMTAILLGFLVPWNSDEL---LGSG 348
            G E   +T+AE  + +++I  AS++ V+R++  Y++  + +  +VP+N   L   L  G
Sbjct: 381 LGPELVCMTSAECADQRRNIAKASRRFVWRLIFFYVLGTLAITVIVPYNDPSLVNALAQG 440

Query: 349 GSATHASPFVIAVASHGVRVVPHFXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRF 408
                +SP+VI + + G++V+PH                             + G AP+ 
Sbjct: 441 KPGAGSSPYVIGIQNAGIKVLPHIINGCILTSAWSAANAFMFASTRSLLTMAQTGQAPKC 500

Query: 409 LNYVDRCGRPVLCLLVSCVFGLLSFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVR 468
           L  ++R G P + + VS +   L+++  S     VF W   IS +S    W    ++++R
Sbjct: 501 LGKINRFGVPYVAVGVSFLCSCLAYLNVSSSTADVFNWFSNISTISGFLGWICGCIAYLR 560

Query: 469 LRRAMTVQGRSADELGYVAWTGVWGAYYAMAMIVAILVGQFWVAISPVGSNKLDANNFFE 528
            R+A+   G   D L +  W   +  ++++ ++  I +   +    P   N  D   F  
Sbjct: 561 FRKAIFFNGLY-DRLPFKTWGQPYTVWFSLTVVSIITITNGYAIFIPKYWNVAD---FIA 616

Query: 529 NYLAMPILIFLYLGYKIWTRDWRLLIPS-SEVDLVA-----HRKIFDAEVLRHEQLEEKE 582
            Y+ +PI + L+LG+K++TR W     S SE+D+         K  D E LR      KE
Sbjct: 617 AYITLPIFLVLWLGHKLYTRTWNHWWHSVSEIDVTTGLVEIEEKSRDIEELRLPPATFKE 676

Query: 583 QLRHA 587
           +   A
Sbjct: 677 KFMDA 681

>ZYRO0D17908g Chr4 (1486514..1488070) [1557 bp, 518 aa] {ON} similar
           to uniprot|P53388 Saccharomyces cerevisiae YPL265W DIP5
           Dicarboxylic amino acid permease, mediates high-affinity
           and high-capacity transport of L-glutamate and
           L-aspartate; also a transporter for Gln, Asn, Ser, Ala,
           and Gly
          Length = 518

 Score =  206 bits (525), Expect = 7e-59,   Method: Compositional matrix adjust.
 Identities = 130/486 (26%), Positives = 228/486 (46%), Gaps = 8/486 (1%)

Query: 73  ESASKHKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYC 132
           E   K+  L + ++PR V +++L + +GTG+++G+G +L  GGP SL I Y    S+L  
Sbjct: 24  EIDEKNGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCV 83

Query: 133 VIQSASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKY 192
           VI S SE+A  +  +  GF+ Y +  VD AFGF+  W Y L++  VL   L    + I Y
Sbjct: 84  VIFSLSEMAS-FAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGY 142

Query: 193 WNQTINPDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGGAG 252
           W   +N   +VT+ YV +  +N                 K+L+            CGGA 
Sbjct: 143 WRPDVNVGVWVTVLYVTVFCVNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAP 202

Query: 253 NDGYLGARYWHDPGA--FRGSDSINRFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNPQKS 310
           N    G RYW + GA  +       +F G  A +V + F + G+E   +   E  NP+K+
Sbjct: 203 NHTTTGFRYWRESGALPYLVGGGTGKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKT 262

Query: 311 IRSASKKLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSATHASPFVIAVASHGVRVVP 370
           I  +S  + +RI  +Y+    +LG  +   + +L+ +  +  +ASPFVIA++S G++V+P
Sbjct: 263 IPKSSMNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDANASPFVIAISSSGIKVLP 322

Query: 371 HFXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVSCVFGL 430
           +F                            + G AP+    V+R   PV+  +   + G 
Sbjct: 323 NFVNAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGF 382

Query: 431 LSFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYVAWTG 490
           L+++       TVF+++ +   +  +  WF I ++++   RA+  +G S D++ +  W  
Sbjct: 383 LAYMNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFRMWFQ 442

Query: 491 VWGAYYAMAMIVAILVGQFWVAISPVGSNKLDANNFFENYLAMPILIFLYLGYKIWTRDW 550
            + AY  +  +  I     + A       K     F  +Y+ +   I + +GYK++ +  
Sbjct: 443 PYAAYVTLFFVTIITFFNGYNAFII----KFHYKTFITSYIGVFANILMVIGYKLYFKT- 497

Query: 551 RLLIPS 556
           + + PS
Sbjct: 498 KFVKPS 503

>KAFR0C05160 Chr3 (1025799..1027553) [1755 bp, 584 aa] {ON} Anc_7.44
           YOR348C
          Length = 584

 Score =  204 bits (520), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 143/541 (26%), Positives = 250/541 (46%), Gaps = 36/541 (6%)

Query: 72  IESASKH---KTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSS 128
           IES +K    + LK  ++ RH+ +I+L   IGTG+ VG   +L N GPA+LVI Y ++S+
Sbjct: 44  IESGAKESSSRNLKHGLQSRHIQLIALGGTIGTGLFVGTSSTLANCGPAALVISYIVIST 103

Query: 129 MLYCVIQSASELAIIYTSLAG--------GFNAY-PSLLVDKAFGFSVSWVYCLQWLCVL 179
           ++Y ++    E+      L G        G+ AY  S  VD++ GF+ SW Y   ++ ++
Sbjct: 104 IVYPIMNMFGEMV---CYLPGNDDDDESVGYCAYLVSKYVDESLGFATSWNYYYCFIVLV 160

Query: 180 PLELVTASMTIKYWNQTINPDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXX 239
             E   AS  ++YW   I     + +F  V+  +N                 K+      
Sbjct: 161 ATECTAASSIVEYWTSKIPKAVLIFLFLGVIFLLNFLPVKFYGEAEFWFAIIKIFCITGL 220

Query: 240 XXXXXXXNCGGAGN---DGYLGARYWHDPGAFRG---SDSINRFKGIVAVLVNAAFAY-G 292
                   CGGA N   + ++G  YW +P +FR    + S+  F  +   L+  AFA+  
Sbjct: 221 IIVAFVIFCGGAPNNEDNSFVGFHYWKNPSSFRDYVTNGSLGNFLDVYNALIKGAFAFIL 280

Query: 293 GAEFSVLTAAEQQNPQKSIRSASKKLVYRILGIYIMTAILLGFLVPWNSDELLGS---GG 349
           G E   LT++E  + +++I  AS++ VYR++  YI  A+ +  +VP+N   LL +     
Sbjct: 281 GPELVSLTSSECVDQRRNIAKASRRFVYRLMFFYIFGALSISVIVPYNDPTLLNALALNK 340

Query: 350 SATHASPFVIAVASHGVRVVPHFXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFL 409
               +SPFVI + + G+ ++PH                             + G APR  
Sbjct: 341 PGAGSSPFVIGIQNAGITILPHIINFCILTSAMSAGNAFLFASTRALLTMGKNGSAPRIF 400

Query: 410 NYVDRCGRPVLCLLVSCVFGLLSFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRL 469
           + ++R G P + L +S +   L+F+  S     VF W   IS +S    WF+  ++++R 
Sbjct: 401 SRINRHGVPYVALSLSIMIACLAFLNCSASSAKVFQWFSNISTISGFIGWFTGCIAYLRF 460

Query: 470 RRAMTVQGRSADELGYVAWTGVWGAYYAMAMIVAILVGQFWVAISPVGSNKLDANNFFEN 529
           RR +   G   D L +     V+  +Y+   +  +++   ++ I P   N  D   F   
Sbjct: 461 RRTIDYNGL-YDRLPFKTKGQVYLTWYSFVFVGILILTNGYMYIIPKFWNYQD---FIAA 516

Query: 530 YLAMPILIFLYLGYKIWTRDWRLL---IPSSEVDLVAHRKIFDAEVLRHEQLEEKEQLRH 586
           Y+ +P+ + LY G+ I++  WR      P  E+D+V   +    E+    ++ ++E+  H
Sbjct: 517 YITLPVFLVLYFGHIIYSGRWRQRKWWKPVDEIDVVTGLE----EIELKTKIADEERQGH 572

Query: 587 A 587
           +
Sbjct: 573 S 573

>TPHA0H02850 Chr8 complement(676524..678329) [1806 bp, 601 aa] {ON}
           Anc_7.44 YOR348C
          Length = 601

 Score =  201 bits (512), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 134/525 (25%), Positives = 236/525 (44%), Gaps = 18/525 (3%)

Query: 79  KTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYCVIQSAS 138
            TLKQ ++ RHV +I+L   IGTG+ VG   +LH  GPA L I Y I+SS++Y ++ +  
Sbjct: 73  NTLKQGLKSRHVQLIALGGCIGTGLFVGTSSTLHTCGPAGLFIAYCIISSVIYPIMNAVG 132

Query: 139 ELAIIYT----SLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKYWN 194
           E+           AG         VD++  F+  W Y   ++ ++  E   A+  ++YW 
Sbjct: 133 EMVCYLPGDGHDSAGSVTHLVKRYVDESLAFATGWNYFYCYVILVAAECTAAAGVVEYWT 192

Query: 195 QTINPDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGGAGND 254
             +   A++TIF  ++  +N                 K+L              GG  + 
Sbjct: 193 LAVPKAAWITIFLAIIFLLNMSSVKYFGETEFWFASIKILCIMGLIILSFILFWGGGPSH 252

Query: 255 GYLGARYWHDPGAFR---GSDSINRFKGIVAVLVNAAFAY-GGAEFSVLTAAEQQNPQKS 310
             LG RYW +PGAF       S+  F  I + ++  AFA+  G E   LT++E  + +++
Sbjct: 253 DRLGFRYWKNPGAFAHHVTDGSLGNFLDIYSGIIKGAFAFILGPELVALTSSECSDQRRN 312

Query: 311 IRSASKKLVYRILGIYIMTAILLGFLVPWNSDEL---LGSGGSATHASPFVIAVASHGVR 367
           I  ASK+ +YR++  YI+  + +G +V WN   L   L +      +SPFVI + + G+ 
Sbjct: 313 IAKASKRFIYRLMFFYILGTLAIGVIVAWNDPVLASALSNNTPGAGSSPFVIGIQNAGIE 372

Query: 368 VVPHFXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLVSCV 427
           V+PH                             + G AP+    +++ G P + +++S +
Sbjct: 373 VLPHIINACILTSAWSSGNAFMFASSRSLFTMAQNGTAPKIFGRINKYGVPYMAVILSTL 432

Query: 428 FGLLSFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYVA 487
              L+++ AS     VFTWL  IS +S    W    ++++R R+A+       D + +  
Sbjct: 433 ISCLAYLNASSSAARVFTWLSNISTISGFLGWICACIAYLRFRKAI-FYNNLYDRMPFKT 491

Query: 488 WTGVWGAYYAMAMIVAILVGQFWVAISPVGSNKLDANNFFENYLAMPILIFLYLGYKIWT 547
           W   +   +++ ++  I +   +    P   N  D   F   Y+ +PI + LY+G+K++ 
Sbjct: 492 WGQPYLILWSLTVVSIITITNGYQTFIPKFWNVSD---FIAAYITLPIFLALYVGHKVYN 548

Query: 548 ---RDWRLLIPSSEVDLVAHRKIFDAEVLRHEQLEEKEQLRHAPW 589
               D+ L+  +  V+ +      D    +  +L+E   L    W
Sbjct: 549 HFKNDYPLMKLAYSVEDIDVITGLDEIETKTCELDENRILPTNRW 593

>KNAG0E00390 Chr5 (61730..63529) [1800 bp, 599 aa] {ON} Anc_7.44
           YOR348C
          Length = 599

 Score =  201 bits (511), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 134/514 (26%), Positives = 229/514 (44%), Gaps = 24/514 (4%)

Query: 76  SKHKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYCVIQ 135
           +   +L+Q ++ RH+ MI+L   IGTG+ VG   +L   GPA L I Y I+SS++Y ++ 
Sbjct: 72  ANEGSLQQGLKSRHIQMIALGGAIGTGLFVGTSSTLALCGPAGLFISYIIISSVVYPIMC 131

Query: 136 SASELAIIY----TSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIK 191
              E+           +G      +  VDK+ GF+ +W Y   ++ ++  E   AS  ++
Sbjct: 132 GFGEMVCYLPGNGNDASGSAAHLVARYVDKSLGFATAWNYYYCYIILVAAECTAASGVVE 191

Query: 192 YWNQTINPDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGGA 251
           YW   +    ++ IF  ++V +N                 K+L              GG 
Sbjct: 192 YWTVAVPKGVWILIFLGIVVILNFGPVKYYGEAEFWFASIKILCIVGLIILSFILFWGGG 251

Query: 252 GNDGYLGARYWHDPGAFRG---SDSINRFKGIVAVLVNAAFAYG-GAEFSVLTAAEQQNP 307
            N   LG RYW  PGAF          RF  I + ++   FA+  G E   LT+AE ++ 
Sbjct: 252 PNHDRLGFRYWQRPGAFTEHIMKGGFGRFLDIYSGVIKGGFAFILGPELVCLTSAECEDQ 311

Query: 308 QKSIRSASKKLVYRILGIYIMTAILLGFLVPWNSDEL---LGSGGSATHASPFVIAVASH 364
           +++I  A+++ ++R++  Y++  + +  +V +N   L   L SG     +SPFVI + + 
Sbjct: 312 RRNIAKAARRFIWRLMFFYVLGTLAISVIVAYNDPSLVSALASGKPGAGSSPFVIGIQNA 371

Query: 365 GVRVVPHFXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLCLLV 424
           G+RV+PH                               G APR    ++R G P + + +
Sbjct: 372 GIRVLPHIINACILSSAWSAGNAFMFASTRSLLTMARNGDAPRVFGKINRFGVPYVAISL 431

Query: 425 SCVFGLLSFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELG 484
           S     L+F+  S     VF W   IS +S    W    ++++R R+A+   G   D L 
Sbjct: 432 SGGLSCLAFLNVSSSTADVFNWFSNISTISGFIGWICGCVAYIRFRKAIFFNGMY-DRLP 490

Query: 485 YVAWTGVWGAYYAMAMIVAILVGQFWVAISPVGSNKLDANNFFENYLAMPILIFLYLGYK 544
           +  W   +  YY++ +I  I +   +    P        ++F   Y+ +PI + L++G+K
Sbjct: 491 FKTWGQPYAVYYSLFVISLITLTNGYATFIP---KNWKGSDFVAAYITLPIFVVLWVGHK 547

Query: 545 IWTRD-----WRLL----IPSSEVDLVAHRKIFD 569
           +WTR      WR +    + +  VD+    KI D
Sbjct: 548 LWTRTFTKRWWRRVDQIDVTTGLVDIEERTKILD 581

>Skud_15.515 Chr15 complement(924662..926542) [1881 bp, 626 aa] {ON}
           YOR348C (REAL)
          Length = 626

 Score =  201 bits (511), Expect = 5e-56,   Method: Compositional matrix adjust.
 Identities = 138/528 (26%), Positives = 244/528 (46%), Gaps = 22/528 (4%)

Query: 73  ESASKHKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYC 132
           +  ++ + LKQ ++ RHV +I+L   IGTG+LVG   +LH  GP  L I Y I+S+++Y 
Sbjct: 97  DGDNEPRKLKQGLQSRHVQLIALGGAIGTGLLVGTSSTLHTCGPGGLFISYIIISAVIYP 156

Query: 133 VIQSASELAIIY----TSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASM 188
           ++ +  E+        +  AG      +  VD + GF+  W Y   ++ ++  E   AS 
Sbjct: 157 IMCALGEMVCFLPGDGSDSAGSTANLVTRYVDASLGFATGWNYFYCYVILVAAECTAASG 216

Query: 189 TIKYWNQTINPDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNC 248
            ++YW   +    ++T+F +V+V +N                 K+L              
Sbjct: 217 VVEYWTTAVPKGVWITVFLLVVVLLNFSAVKVYGESEFWFASIKILCIVGLIILSFILFW 276

Query: 249 GGAGNDGYLGARYWHDPGAFR---GSDSINRFKGIVAVLVNAAFAYG-GAEFSVLTAAEQ 304
           GG      LG RYW  PGAF       S+  F  I   ++  AFA+  G E   +T+AE 
Sbjct: 277 GGGPKHDRLGFRYWQHPGAFAHHLTGGSLGNFTDIYTGIIKGAFAFILGPELVCMTSAEC 336

Query: 305 QNPQKSIRSASKKLVYRILGIYIMTAILLGFLVPWNSDEL---LGSGGSATHASPFVIAV 361
            + +++I  AS++ V+R++  Y++  + +  +VP+N   L   L  G     +SPFVI +
Sbjct: 337 ADQRRNIAKASRRFVWRLIFFYVLGTLSISVIVPYNDPVLVNALAQGKPGAGSSPFVIGI 396

Query: 362 ASHGVRVVPHFXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRPVLC 421
            + G++V+PH                             + G AP+ L  ++R G P + 
Sbjct: 397 QNAGIKVLPHIINGCILTSAWSAANAFMFASTRSLLTMAQTGQAPKCLGKINRWGVPYVA 456

Query: 422 LLVSCVFGLLSFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSAD 481
           +  S +   L+++  S     VF W   IS +S    W    ++++R R+A+   G   D
Sbjct: 457 VAASFLCSCLAYLNVSSSTADVFNWFSNISTISGFLGWICGCIAYLRFRKAIFYNGL-YD 515

Query: 482 ELGYVAWTGVWGAYYAMAMIVAILVGQFWVAISPVGSNKLDANNFFENYLAMPILIFLYL 541
            L +  W   +  ++++ ++  I +   +    P         +F   Y+ +PI + L+L
Sbjct: 516 RLPFKTWGQPYTVWFSLIVVSIITITNGYAIFIP---KYWKVADFIAAYVTLPIFLVLWL 572

Query: 542 GYKIWTRDW-RLLIPSSEVDLVAHRKIFDAEVLRHEQLEEKEQLRHAP 588
           G+K++TR W +  +P SE+D+   R + + E    E+  E E+LR  P
Sbjct: 573 GHKLYTRTWHQWWLPVSEIDVT--RGLVEIE----EKSREIEELRLPP 614

>AFR156W Chr6 (717642..719318) [1677 bp, 558 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YOR348C (PUT4)
          Length = 558

 Score =  200 bits (508), Expect = 5e-56,   Method: Compositional matrix adjust.
 Identities = 135/502 (26%), Positives = 235/502 (46%), Gaps = 23/502 (4%)

Query: 73  ESASKHKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYC 132
            + S++ TL + ++ RH+ +I+L   IGTG+ VG   +LHN G A L++ + ++S+++Y 
Sbjct: 38  SAGSEYNTLHKGLQSRHIQLIALGGCIGTGLFVGTSWTLHNCGAAPLLLSFILISTIVYP 97

Query: 133 VIQSASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKY 192
           ++ S +E+ I Y    G      S  VD + GF+  W Y   +  ++  EL  A+  + Y
Sbjct: 98  IMCSLAEM-ICYLPQQGSVPELVSRYVDPSLGFATGWNYAYAYAILVAAELSAAASVVSY 156

Query: 193 WNQTINPDAFVTIFYVVLVAINXXXXXXXXXXXXXXNCCKVLMXXXXXXXXXXXNCGGAG 252
           W+  +   A++TIF VV+V +N                 K++              GGA 
Sbjct: 157 WDNPVPMAAWITIFLVVVVGLNFTAVKYYGEAEFWFASIKLICILGLLVVSVVIFFGGAP 216

Query: 253 NDGYLGARYWHDPGAFRGS---DSINRFKGIVAVLVNAAFAY-GGAEFSVLTAAEQQNPQ 308
           N    G RYW +PG F  S    S  RF  +   ++ +AFA+    E   +   E Q+ +
Sbjct: 217 NHDRTGFRYWKNPGPFAMSLAPGSTGRFLDVWRAVIKSAFAFILSPELIGIACVEAQDTR 276

Query: 309 KSIRSASKKLVYRILGIYIMTAILLGFLVPWNSDEL---LGSGGSATHASPFVIAVASHG 365
           ++   AS++ +YRI+  Y+  A+++G ++     +L   L +G     +SPFV  +A+ G
Sbjct: 277 RNTEKASRRFIYRIIFFYVSCALMIGVILSRTDPKLIEALETGAPGAASSPFVQGIANAG 336

Query: 366 VRVVPHFXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGFAPRFLNYVDRCGRP----VLC 421
           + V+ H                              +G AP+FL  ++R G P    ++C
Sbjct: 337 IPVLDHVINVAILSSAWSAGNSFMYASTRMVLALAREGNAPKFLTKINRYGVPYNAVIVC 396

Query: 422 LLVSCVFGLLSFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSAD 481
            LV+C    L+++        VF WL  I  +S    WF++ ++ +R RR +      + 
Sbjct: 397 TLVAC----LAYLNVKTTSANVFQWLSNICTISGFIGWFAMGIAFIRFRRGIVFNNLQS- 451

Query: 482 ELGYVAWTGVWGAYYAMAMIVAI-LVGQFWVAISPVGSNKLDANNFFENYLAMPILIFLY 540
            + Y      + AYY   M V + L   F V +      + +  +F   Y+ +PI + LY
Sbjct: 452 RIPYQGPLQPYIAYYFTFMTVVVCLTNGFHVFL----KGRWNVVDFVAAYVTLPIYLVLY 507

Query: 541 LGYKIWTRDWRLLIPSSEVDLV 562
           LG+K+W R  R  IP  ++D++
Sbjct: 508 LGHKLWFRT-RWYIPVEQIDVI 528

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.324    0.138    0.431 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 52,201,948
Number of extensions: 1904441
Number of successful extensions: 7774
Number of sequences better than 10.0: 381
Number of HSP's gapped: 6216
Number of HSP's successfully gapped: 400
Length of query: 598
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 483
Effective length of database: 40,294,809
Effective search space: 19462392747
Effective search space used: 19462392747
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 69 (31.2 bits)