Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_33.13025na 1ON42342322840.0
KLTH0F00594gna 1ON43340613730.0
SAKL0H24838gna 1ON41040611771e-160
Ecym_1013na 1ON41141410331e-138
AFR741Wna 1ON4074069981e-132
ZYRO0D05434gna 1ON4284048151e-105
TDEL0H03670na 1ON4264307705e-98
YDR440W (DOT1)5.556ON58280820.17
AER326C5.556ON57584760.92
NDAI0H023802.441ON685111731.9
TPHA0M008003.131ON476115713.1
Suva_2.6165.556ON58980713.2
Smik_4.7165.556ON58480713.6
Suva_15.653.92ON1080115713.9
Skud_4.7165.556ON58680703.9
AFR443CsingletonON57650704.9
TPHA0D011908.665ON425128686.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_33.13025
         (423 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_33.13025 s33 complement(44353..45624) [1272 bp, 423 aa] {ON...   884   0.0  
KLTH0F00594g Chr6 complement(43649..44950) [1302 bp, 433 aa] {ON...   533   0.0  
SAKL0H24838g Chr8 (2160460..2161692) [1233 bp, 410 aa] {ON} cons...   457   e-160
Ecym_1013 Chr1 complement(22905..24140) [1236 bp, 411 aa] {ON} s...   402   e-138
AFR741W Chr6 (1798195..1799418) [1224 bp, 407 aa] {ON} NOHBY667;...   389   e-132
ZYRO0D05434g Chr4 complement(469258..470544) [1287 bp, 428 aa] {...   318   e-105
TDEL0H03670 Chr8 (607134..608414) [1281 bp, 426 aa] {ON}              301   5e-98
YDR440W Chr4 (1342493..1344241) [1749 bp, 582 aa] {ON}  DOT1Nucl...    36   0.17 
AER326C Chr5 complement(1238287..1240014) [1728 bp, 575 aa] {ON}...    34   0.92 
NDAI0H02380 Chr8 (578157..580214) [2058 bp, 685 aa] {ON} Anc_2.441     33   1.9  
TPHA0M00800 Chr13 (159632..161062) [1431 bp, 476 aa] {ON} Anc_3....    32   3.1  
Suva_2.616 Chr2 (1094368..1096137) [1770 bp, 589 aa] {ON} YDR440...    32   3.2  
Smik_4.716 Chr4 (1263375..1265129) [1755 bp, 584 aa] {ON} YDR440...    32   3.6  
Suva_15.65 Chr15 (102271..105513) [3243 bp, 1080 aa] {ON} YOL100...    32   3.9  
Skud_4.716 Chr4 (1262890..1264650) [1761 bp, 586 aa] {ON} YDR440...    32   3.9  
AFR443C Chr6 complement(1236336..1238066) [1731 bp, 576 aa] {ON}...    32   4.9  
TPHA0D01190 Chr4 (250654..251931) [1278 bp, 425 aa] {ON} Anc_8.6...    31   6.5  

>Kwal_33.13025 s33 complement(44353..45624) [1272 bp, 423 aa] {ON}
           [contig 123] FULL
          Length = 423

 Score =  884 bits (2284), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 423/423 (100%), Positives = 423/423 (100%)

Query: 1   MAQSTDEKLLHLKELFPKYDTDGLLDVLVSCDGSLKRSADFLGGSVSQTDTPDLHPKRLK 60
           MAQSTDEKLLHLKELFPKYDTDGLLDVLVSCDGSLKRSADFLGGSVSQTDTPDLHPKRLK
Sbjct: 1   MAQSTDEKLLHLKELFPKYDTDGLLDVLVSCDGSLKRSADFLGGSVSQTDTPDLHPKRLK 60

Query: 61  TKSQQSLSRYLEVNALHPIPNKVPASKSKPRPLELHGKEQIEANIPYCTYHTDVLPSEVA 120
           TKSQQSLSRYLEVNALHPIPNKVPASKSKPRPLELHGKEQIEANIPYCTYHTDVLPSEVA
Sbjct: 61  TKSQQSLSRYLEVNALHPIPNKVPASKSKPRPLELHGKEQIEANIPYCTYHTDVLPSEVA 120

Query: 121 DKLLQQLLEDRNHKPNKFYLFGNLCTSNCASRLFVPEAREKPFFYNGKEVKNPGNYTDEM 180
           DKLLQQLLEDRNHKPNKFYLFGNLCTSNCASRLFVPEAREKPFFYNGKEVKNPGNYTDEM
Sbjct: 121 DKLLQQLLEDRNHKPNKFYLFGNLCTSNCASRLFVPEAREKPFFYNGKEVKNPGNYTDEM 180

Query: 181 MLAQVVIENVVNEAISKRPPLPFQVKANEWEAQAVLSNVYKKDSNLDWHSDRLTNIGPQA 240
           MLAQVVIENVVNEAISKRPPLPFQVKANEWEAQAVLSNVYKKDSNLDWHSDRLTNIGPQA
Sbjct: 181 MLAQVVIENVVNEAISKRPPLPFQVKANEWEAQAVLSNVYKKDSNLDWHSDRLTNIGPQA 240

Query: 241 IIASLSLGFSREFRVRKSYPSNSQVFSLLPQHNSLIIMHAGFQEEYKHCVPKLGKGSRIP 300
           IIASLSLGFSREFRVRKSYPSNSQVFSLLPQHNSLIIMHAGFQEEYKHCVPKLGKGSRIP
Sbjct: 241 IIASLSLGFSREFRVRKSYPSNSQVFSLLPQHNSLIIMHAGFQEEYKHCVPKLGKGSRIP 300

Query: 301 KEDLHPISGTTRVNLTYRNYVMTENVFCKLCGCPMELRRTFKEPRKRGSYIYQCSRSYTA 360
           KEDLHPISGTTRVNLTYRNYVMTENVFCKLCGCPMELRRTFKEPRKRGSYIYQCSRSYTA
Sbjct: 301 KEDLHPISGTTRVNLTYRNYVMTENVFCKLCGCPMELRRTFKEPRKRGSYIYQCSRSYTA 360

Query: 361 ANGFHENQECKGFAFANFCKTPPLVSVDSEGSHWLAEDDTEARELQSKDRGPSSTSASLN 420
           ANGFHENQECKGFAFANFCKTPPLVSVDSEGSHWLAEDDTEARELQSKDRGPSSTSASLN
Sbjct: 361 ANGFHENQECKGFAFANFCKTPPLVSVDSEGSHWLAEDDTEARELQSKDRGPSSTSASLN 420

Query: 421 HVI 423
           HVI
Sbjct: 421 HVI 423

>KLTH0F00594g Chr6 complement(43649..44950) [1302 bp, 433 aa] {ON}
           conserved hypothetical protein
          Length = 433

 Score =  533 bits (1373), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 249/406 (61%), Positives = 312/406 (76%), Gaps = 5/406 (1%)

Query: 1   MAQSTDEKLLHLKELFPKYDTDGLLDVLVSCDGSLKRSADFLGGSVSQTDTPDLHPKRLK 60
           MA+ST+EK+  L+ L+P Y  DGLLDVLVSC GSLKRSA  LG     T TP+   KR K
Sbjct: 29  MARSTEEKIAELQNLYPDYGVDGLLDVLVSCGGSLKRSAQLLG----DTTTPESSSKRFK 84

Query: 61  TKSQQSLSRYLEVNALHPIPNKVPASKSKPRPLELHGKEQIEANIPYCTYHTDVLPSEVA 120
           ++ QQ+L+R+L+V  L     K   SK+  RP+ELH KE +E+ + YCTYH +VLP E+A
Sbjct: 85  SRQQQTLNRFLDVRLLPKAAIKTNGSKAS-RPIELHSKEDVESTLKYCTYHPNVLPLELA 143

Query: 121 DKLLQQLLEDRNHKPNKFYLFGNLCTSNCASRLFVPEAREKPFFYNGKEVKNPGNYTDEM 180
           +KLL+ L +D + KPN+FYLFGN C SNC SR+F+PE R +PF+YNGK V++   Y+DE+
Sbjct: 144 NKLLEALSKDTSFKPNEFYLFGNKCISNCKSRIFLPENRIEPFYYNGKRVESYSTYSDEI 203

Query: 181 MLAQVVIENVVNEAISKRPPLPFQVKANEWEAQAVLSNVYKKDSNLDWHSDRLTNIGPQA 240
           M+AQ+++E +VN+ +S+R  LPFQV+A +WE QAVLSN Y +DSNLDWHSDRLTNIGP A
Sbjct: 204 MMAQILVEELVNDVLSQRTALPFQVEAGKWEVQAVLSNSYSRDSNLDWHSDRLTNIGPHA 263

Query: 241 IIASLSLGFSREFRVRKSYPSNSQVFSLLPQHNSLIIMHAGFQEEYKHCVPKLGKGSRIP 300
           IIASLSLGF+REFRVR+ +PSNS  +SL PQHNSLIIMHAGFQEEYKHCVP L K   IP
Sbjct: 264 IIASLSLGFTREFRVRRVHPSNSSTYSLRPQHNSLIIMHAGFQEEYKHCVPFLPKNCNIP 323

Query: 301 KEDLHPISGTTRVNLTYRNYVMTENVFCKLCGCPMELRRTFKEPRKRGSYIYQCSRSYTA 360
            ED+HPIS   RVNLT+RNY +T  VFCKLCG PM+LRR+FK+P KRG YI+QCS+SYT 
Sbjct: 324 AEDVHPISNDVRVNLTFRNYALTTKVFCKLCGFPMDLRRSFKDPSKRGLYIFQCSKSYTE 383

Query: 361 ANGFHENQECKGFAFANFCKTPPLVSVDSEGSHWLAEDDTEARELQ 406
            N F E +ECKGFAFA F K PP    +++GS W+A+DD EA++ Q
Sbjct: 384 ENSFKEGRECKGFAFACFKKKPPFTEFETDGSRWIADDDLEAKQAQ 429

>SAKL0H24838g Chr8 (2160460..2161692) [1233 bp, 410 aa] {ON}
           conserved hypothetical protein
          Length = 410

 Score =  457 bits (1177), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 215/406 (52%), Positives = 287/406 (70%), Gaps = 2/406 (0%)

Query: 1   MAQSTDEKLLHLKELFPKYDTDGLLDVLVSCDGSLKRSADFLGGSVSQTDTPDLHPKRLK 60
           M  +T+EK+  L ELFP  D + LL+VL SC GS++++   +  SVSQ        KRLK
Sbjct: 6   MESTTEEKIKKLNELFPDADDEFLLEVLTSCSGSIRQAVSLIDASVSQKYDQLYSTKRLK 65

Query: 61  TKSQQSLSRYLEVNALHPIPNKVPASKSKPRPLELHGKEQIEANIPYCTYHTDVLPSEVA 120
            K+Q +L++ L  +   P  ++ P  +    P+ LH K+++E+ + YCTYH D+LPSEVA
Sbjct: 66  AKTQSTLTKLLSDSLTKPGISRGP--QKTRTPIALHTKDEVESTLAYCTYHKDILPSEVA 123

Query: 121 DKLLQQLLEDRNHKPNKFYLFGNLCTSNCASRLFVPEAREKPFFYNGKEVKNPGNYTDEM 180
           +K+L+ ++ D++ + N+FYLFGN CTSN  +R++      K   YNG+ + + G YTDEM
Sbjct: 124 NKILELVMNDKSARSNEFYLFGNKCTSNHKTRIYSCAEHRKALTYNGRVIDDVGEYTDEM 183

Query: 181 MLAQVVIENVVNEAISKRPPLPFQVKANEWEAQAVLSNVYKKDSNLDWHSDRLTNIGPQA 240
           M+A ++IE+ VNE +  R  LP+QVK  EW +Q  ++NVYK DSNL WHSDRLTNIGPQA
Sbjct: 184 MVAHLLIEDFVNEVLQSRGTLPYQVKPGEWTSQMAVANVYKLDSNLQWHSDRLTNIGPQA 243

Query: 241 IIASLSLGFSREFRVRKSYPSNSQVFSLLPQHNSLIIMHAGFQEEYKHCVPKLGKGSRIP 300
           I+ASLSLGFSREFRVR  YPS+SQV+S+ P+HNSL+IMHAGFQEEYKHCVP + K SR+P
Sbjct: 244 IVASLSLGFSREFRVRNIYPSDSQVYSIKPEHNSLLIMHAGFQEEYKHCVPPVPKCSRVP 303

Query: 301 KEDLHPISGTTRVNLTYRNYVMTENVFCKLCGCPMELRRTFKEPRKRGSYIYQCSRSYTA 360
           K++ HPISGTTRVN+TYRN +M +   C  CG PMELRRTFK+P  RG Y++QCS+SYT 
Sbjct: 304 KDEFHPISGTTRVNMTYRNRIMKKTPSCIKCGYPMELRRTFKKPDNRGMYMWQCSKSYTE 363

Query: 361 ANGFHENQECKGFAFANFCKTPPLVSVDSEGSHWLAEDDTEARELQ 406
            N F   +ECKG  +ANF     +   +S  S WLA+DD +ARE Q
Sbjct: 364 ENDFKAGKECKGMRYANFNNDSVVTDDESNCSRWLADDDIQAREAQ 409

>Ecym_1013 Chr1 complement(22905..24140) [1236 bp, 411 aa] {ON}
           similar to Ashbya gossypii AFR741W
          Length = 411

 Score =  402 bits (1033), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 198/414 (47%), Positives = 285/414 (68%), Gaps = 17/414 (4%)

Query: 4   STDEKLLHLKELFPKYDTDGLLDVLVSCDGSLKRSADFL-----GGSVSQTDTPDLHPKR 58
           +TDEKL +L+ LFP  + + LLD+LVSC+GS++ +   L     G  + +  +P   P++
Sbjct: 6   TTDEKLAYLQNLFPSANAEVLLDLLVSCNGSVRDATLLLDLSEEGTQLEEQRSP---PRK 62

Query: 59  L-KTKSQQSLSRYLEVNALHPIPNKVPASKSKPRPLELHGKEQIEANIPYCTYHTDVLPS 117
           + K K QQSLS +L + +L+   N+   S+   +P+ L+GK+ IE  + YCTYHTDVLP 
Sbjct: 63  VAKVKGQQSLSSFLPLQSLY---NR--QSRPSGKPIILYGKKDIELELKYCTYHTDVLPE 117

Query: 118 EVADKLLQQLLEDRNHKPNKFYLFGNLCTSNCASRLFVP-EAREKPFFYNGKEVKNPGNY 176
           E+A++LL+  + ++N KPN+FYLFGN C SNC S ++    A E  ++YNG  V+    +
Sbjct: 118 ELANRLLKFTMNEQNSKPNEFYLFGNKCVSNCRSAIYSNLSAEEDDYYYNGMRVQTVNRF 177

Query: 177 TDEMMLAQVVIENVVNEAISKRPPLPFQVKANEWEAQAVLSNVYKKDSNLDWHSDRLTNI 236
            D+M++ + +IE +VNE + KR  LPFQ K  +W++  V+SN+Y KDS+L WHSDR+T I
Sbjct: 178 NDDMVITRSIIEKLVNEQLQKRLTLPFQTKPGDWKSPVVISNIYAKDSDLQWHSDRMTYI 237

Query: 237 GPQAIIASLSLGFSREFRVRKSYPSNSQVFSLLPQHNSLIIMHAGFQEEYKHCVPKLGKG 296
           GP ++IA+LSLGFSR  R R+ YPSNSQ+++++P+HNS++IMHAG QEE+KHCVP L K 
Sbjct: 238 GPHSVIATLSLGFSRGVRFRRVYPSNSQIYTVMPEHNSVLIMHAGCQEEFKHCVPPLPKN 297

Query: 297 SRIPKEDLHPISGTTRVNLTYRNYVMT--ENVFCKLCGCPMELRRTFKEPRKRGSYIYQC 354
            +I K  ++PIS TTRV+LT+R+Y +   E V C  CG PM+LRR +K P KRG YI+ C
Sbjct: 298 HQISKSAINPISQTTRVSLTFRDYKVNTYEPVHCDKCGYPMDLRRIYKTPEKRGHYIWLC 357

Query: 355 SRSYTAANGFHENQECKGFAFANFCKTPPLVSVDSEGSHWLAEDDTEARELQSK 408
           ++SYTA NG +  QEC G  FA F    P  + +SEGS W+A+DD EA +  +K
Sbjct: 358 TKSYTAGNGLNNKQECGGLKFARFNHPLPTTTTESEGSFWVADDDFEALKFCTK 411

>AFR741W Chr6 (1798195..1799418) [1224 bp, 407 aa] {ON} NOHBY667; No
           homolog in Saccharomyces cerevisiae
          Length = 407

 Score =  389 bits (998), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 189/406 (46%), Positives = 268/406 (66%), Gaps = 13/406 (3%)

Query: 2   AQSTDEKLLHLKELFPKYDTDGLLDVLVSCDGSLKRSADFLGGSVSQTDTPDLHP-KRLK 60
           +++TDEKL  LK + P  DT+ LLDVLV C G+L+ +A  L   +   D  D  P K+ +
Sbjct: 4   SETTDEKLAKLKAIIPSADTEALLDVLVCCGGNLEEAAALLRNGIDPADEKDARPLKKPR 63

Query: 61  TKSQQSLSRYLEVNALHPIPNKVPASKSKPRPLELHGKEQIEANIPYCTYHTDVLPSEVA 120
            ++QQSLSRY  +        K P      RP+ LHGK  IE  + YCTYHT+VLP+ +A
Sbjct: 64  LQTQQSLSRYFGLK-------KSPVPALGGRPIVLHGKRDIEGALRYCTYHTNVLPAALA 116

Query: 121 DKLLQQLLEDRNHKPNKFYLFGNLCTSNCASRLF--VPEAREKPFFYNGKEVKNPGNYTD 178
           ++LL+ ++ D   KPN+FYLFG+ C +NC + L+  +  A     FYNG+ +    +Y  
Sbjct: 117 ERLLEVVMTDERAKPNEFYLFGSRCVTNCRTLLYGNLDPADAGRVFYNGR-ISTLTSYNA 175

Query: 179 EMMLAQVVIENVVNEAISKRPPLPFQVKANEWEAQAVLSNVYKKDSNLDWHSDRLTNIGP 238
           ++  AQ ++E++VN  ++KR  LPFQV A  W     ++N+Y+KDS+L WHSDRLT IGP
Sbjct: 176 DLCEAQRIVEHLVNAELAKRAKLPFQVPAGSWRCPVAVANIYEKDSDLQWHSDRLTYIGP 235

Query: 239 QAIIASLSLGFSREFRVRKSYPSNSQVFSLLPQHNSLIIMHAGFQEEYKHCVPKLGKGSR 298
            AI+ASL+LGF REFR+R+ YP++SQ++S+   HNS++IMHAG QEE+KHCVP LGK  +
Sbjct: 236 HAIVASLTLGFEREFRLRRVYPADSQIYSIPLAHNSVLIMHAGCQEEFKHCVPPLGKRKK 295

Query: 299 IPKEDLHPISGTTRVNLTYRNYVMT--ENVFCKLCGCPMELRRTFKEPRKRGSYIYQCSR 356
           +   +LHPISG+ RV+LT+R+Y +    +  C  CG PM+LRRT+K P KRG YI+ CSR
Sbjct: 296 VSAAELHPISGSVRVSLTFRHYKVDFPRDALCPECGYPMDLRRTYKTPSKRGHYIWICSR 355

Query: 357 SYTAANGFHENQECKGFAFANFCKTPPLVSVDSEGSHWLAEDDTEA 402
            Y++ N       CKG  +A    +PP+  ++SEG+ WLA+DD EA
Sbjct: 356 GYSSGNDKSVESFCKGIKYACVDASPPVTDIESEGNVWLADDDFEA 401

>ZYRO0D05434g Chr4 complement(469258..470544) [1287 bp, 428 aa] {ON}
           conserved hypothetical protein
          Length = 428

 Score =  318 bits (815), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 178/404 (44%), Positives = 249/404 (61%), Gaps = 33/404 (8%)

Query: 25  LDVLVSCDGSLKRSADFLGGS--VSQTDTPDLHPKRLK---------TKSQQSLSRYLEV 73
           L++LVSC+G+L+ + + +  S  V +T   D+   + K          K Q+SL+ +++ 
Sbjct: 33  LEILVSCEGNLEAAVELINDSLGVQRTSETDILCAKGKHEDEAVSPAPKVQKSLNSFIKD 92

Query: 74  --NALHPIPNKVPASKSKPRPLELHGKEQIEANIPYCTYHTDVLPSEVADKLLQQLLEDR 131
             N +  + ++    K   R +EL  KE IE NI Y + H +VLP  +A+ LL++L +D 
Sbjct: 93  PNNKIKSV-SEGSLGKISNRAIELFTKEDIETNIKYVSVHKNVLPELLANSLLKKLSQDN 151

Query: 132 NH-KPNKFYLFGNLCTSNCASRLFVPE----AREKPFFYNGKEVKNPGNYTDEMMLAQVV 186
           +   PN+FYLFG  CTSN  +++F       A     +YN   +     Y D++ +AQ++
Sbjct: 152 DSFTPNQFYLFGKKCTSNHLTKMFSSSEEISAGNIRIYYNSYSLSRIAQYDDDLKMAQLL 211

Query: 187 IENVVNEAISKRPPLPFQVKANEWEAQAVLSNVYKKDSNLDWHSDRLTNIGPQAIIASLS 246
           IE++VN+ I++R  LP+Q+++  W+   VL N Y K+SNLDWHSD++T+IGPQ IIASLS
Sbjct: 212 IEDLVNDCIAQRDLLPYQIRSPNWKGDVVLVNRYYKESNLDWHSDKMTSIGPQPIIASLS 271

Query: 247 LGFSREFRVRKSYPSNSQVFSLLPQHNSLIIMHAGFQEEYKHCVPKLGKGSRIPKEDLHP 306
           LG SREFRVRK+YPSNSQ++ + P HN+L+IMHAGFQEEY+HCV    K S +     HP
Sbjct: 272 LGCSREFRVRKNYPSNSQIYIIRPPHNTLVIMHAGFQEEYRHCVHGHSKNSPLKP---HP 328

Query: 307 ISGTTRVNLTYRNYV---MTENVFCKLCGCPMELRRTFKEPRKRGSYIYQCSRSYTAANG 363
           ISG  R+NLTYR Y+   +     CK CG PM+LRR FK+P+ RG YI+QCS+SYT    
Sbjct: 329 ISGHVRINLTYRCYLRKFLDRCPKCKKCGSPMDLRRAFKDPKTRGQYIWQCSKSYTG--- 385

Query: 364 FHENQECKGFAFANFCKTPPLV-SVDSEGSHWLAEDDTEARELQ 406
               QEC G   A F      V + D EGS WLA DD EA   Q
Sbjct: 386 ----QECGGVIRAKFDNDSLTVQNFDEEGSRWLAPDDQEAHSAQ 425

>TDEL0H03670 Chr8 (607134..608414) [1281 bp, 426 aa] {ON} 
          Length = 426

 Score =  301 bits (770), Expect = 5e-98,   Method: Compositional matrix adjust.
 Identities = 179/430 (41%), Positives = 251/430 (58%), Gaps = 41/430 (9%)

Query: 5   TDEKLLHLKELF----PK-YDTDG-LLDVLVSCDGSLKRSADFLGGSVSQTDTPDLHPKR 58
           T+EK+  L  L+    PK  DT+  LL++L +CDGS+K ++  L  S+      D +  +
Sbjct: 2   TEEKIATLISLYEDVIPKSRDTESFLLEILTACDGSVKNASLMLNESLGVARKVDCNIGK 61

Query: 59  LKT----------KSQQSLSRYLEVNA--LHPIPNKVPASKSKPRPLELHGKEQIEANIP 106
            K           K Q+SL++++E +A    PI +   A K+  R +EL  KE +E+ I 
Sbjct: 62  RKRDTGNSDNRCYKVQKSLNQFIEDDAKKFRPISSDRRA-KTSNRAIELFSKEDVESTIG 120

Query: 107 YCTYHTDVLPSEVADKLLQQLLED-RNHKPNKFYLFGNLCTSNCASRLF-----VPEARE 160
           Y T H   LP E A+ LL+QL++D     P +F+LFGN C+SN  S+ +     + + R+
Sbjct: 121 YVTMHEKALPEEFANSLLRQLMDDLEGFAPYEFHLFGNKCSSNHTSKKYSSDPAILDGRD 180

Query: 161 KPFFYNGKEVKNPGNYTDEMMLAQVVIENVVNEAISKRPPLPFQVKANEWEAQAVLSNVY 220
           K ++ N +       Y D +   Q++IE++VNE I K  PLPFQ+ +  W+   VL N Y
Sbjct: 181 KIYYNNRRGT--VYEYNDLLKATQLLIEDIVNETIKKFKPLPFQISSPNWKGDVVLVNKY 238

Query: 221 KKDSNLDWHSDRLTNIGPQAIIASLSLGFSREFRVRKSYPSNSQVFSLLPQHNSLIIMHA 280
            K  +L WHSDRLT+IGPQ I+ASLSLG  REFR+R+ YPS+SQ++ + P HNSLIIMHA
Sbjct: 239 GKSDHLMWHSDRLTSIGPQPIVASLSLGCVREFRIRRCYPSDSQIYVVRPPHNSLIIMHA 298

Query: 281 GFQEEYKHCVPKLGKGSRIPKEDLHPISGTTRVNLTYRNYV---MTENVFCKLCGCPMEL 337
           GFQEEY+H V +          +LHPIS   R NLTYR+Y+   +     C  C  PM+L
Sbjct: 299 GFQEEYRHSVHQQTNNR---ATNLHPISKDVRFNLTYRDYLKKYINNAPRCPKCDNPMDL 355

Query: 338 RRTFKEPRKRGSYIYQCSRSYTAANGFHENQECKGFAFANF-CKTPPLVSVDSEGSHWLA 396
           RR FK+P +RG YI+QCS  Y+         EC G   A+F C +  +     EGS WLA
Sbjct: 356 RRAFKDPERRGQYIWQCSSHYSGV-------ECGGVRLADFNCNSLVVEKNAGEGSRWLA 408

Query: 397 EDDTEARELQ 406
           +DD EA+E Q
Sbjct: 409 DDDWEAKEAQ 418

>YDR440W Chr4 (1342493..1344241) [1749 bp, 582 aa] {ON}
           DOT1Nucleosomal histone H3-Lys79 methylase; methylation
           is required for telomeric silencing, meiotic checkpoint
           control, and DNA damage response
          Length = 582

 Score = 36.2 bits (82), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 46/80 (57%), Gaps = 4/80 (5%)

Query: 252 EFRVRKSYPSNSQVFSLLPQHNSLIIMHAGFQEEYKHCVPKLGKGSRIPKEDLHPISGTT 311
           EF ++KS+  N++V  L+PQ + +++ +  F E+    V K+ + +++       IS  +
Sbjct: 453 EFSLKKSFVDNNRVAELIPQCDVILVNNFLFDEDLNKKVEKILQTAKV---GCKIISLKS 509

Query: 312 RVNLTYR-NYVMTENVFCKL 330
             +LTY+ N+   EN+F +L
Sbjct: 510 LRSLTYQINFYNVENIFNRL 529

>AER326C Chr5 complement(1238287..1240014) [1728 bp, 575 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR440W
           (DOT1)
          Length = 575

 Score = 33.9 bits (76), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 42/84 (50%), Gaps = 12/84 (14%)

Query: 252 EFRVRKSYPSNSQVFSLLPQHNSLIIMHAGFQEEYKHCVPKLGKGSR-----IPKEDLHP 306
           EF +RKS+  N +V  LLPQ + L+I +  F  +    V KL +G +     I  ++L P
Sbjct: 445 EFSLRKSFIDNERVNELLPQCDVLLINNFIFDTKLNQAVEKLIQGLKPGCKIITLKNLRP 504

Query: 307 ISGTTRVNLTYRNYVMTENVFCKL 330
            SG T       N+   EN+  +L
Sbjct: 505 -SGYT------INFDDVENILNRL 521

>NDAI0H02380 Chr8 (578157..580214) [2058 bp, 685 aa] {ON} Anc_2.441
          Length = 685

 Score = 32.7 bits (73), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 34/111 (30%), Positives = 51/111 (45%), Gaps = 11/111 (9%)

Query: 141 FGNLCTSNCASRLFVPEAREKPFFYNGKEVK---NPGNYTDEMMLAQVVIENVVNEAISK 197
           F +  T N A   F PEAR       G  +    +P N  ++++ AQV +E      +SK
Sbjct: 375 FDDRVTGNIAK--FAPEARRAALEERGGIIHFEISPKN-INKVVEAQVAVEGDAASNVSK 431

Query: 198 RPPLPFQVKA-NEWEAQAVLSNVYKKDSNLDWHSDRL-TNIGPQAIIASLS 246
             PL F VK   +W  Q    N +KK+    +  +   + I PQ +I+ LS
Sbjct: 432 LLPLVFPVKERKDWFKQI---NQWKKEYPYSYMKETAESKIKPQTVISKLS 479

>TPHA0M00800 Chr13 (159632..161062) [1431 bp, 476 aa] {ON} Anc_3.131
           YBR138C
          Length = 476

 Score = 32.0 bits (71), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 29/115 (25%), Positives = 45/115 (39%), Gaps = 10/115 (8%)

Query: 265 VFSLLPQHNSLIIMHAGFQEEYKHCVPKLGKGSR--------IPKEDLHPISGTTRVNLT 316
            FSL P H +   +     E+Y    P+  + S         + KE +HP++G T     
Sbjct: 256 TFSLAPNHANASSIMTDISEQYNTFEPEPNENSNASSDEINGVLKELIHPVTGVTEDQYI 315

Query: 317 YRNYVMTENVFCKLCGCPM-ELRRTFKEPRKRGSYI-YQCSRSYTAANGFHENQE 369
            R    ++ V C +C   + EL     E  K    +   C+  Y AA    E+ E
Sbjct: 316 SRISKKSQLVSCVVCDKVLYELSSILPENNKFKEIVCGNCAEKYEAAAKLFEDYE 370

>Suva_2.616 Chr2 (1094368..1096137) [1770 bp, 589 aa] {ON} YDR440W
           (REAL)
          Length = 589

 Score = 32.0 bits (71), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 21/80 (26%), Positives = 44/80 (55%), Gaps = 4/80 (5%)

Query: 252 EFRVRKSYPSNSQVFSLLPQHNSLIIMHAGFQEEYKHCVPKLGKGSRIPKEDLHPISGTT 311
           EF ++KS+  N +V  ++P+ + +++ +  F EE    V K+ + +++       IS   
Sbjct: 460 EFSLKKSFVDNERVNEIIPRCDVILVNNFLFDEELNKEVEKILQAAKV---GCKIISLKN 516

Query: 312 RVNLTYR-NYVMTENVFCKL 330
             +LTY+ ++   EN+F +L
Sbjct: 517 LRSLTYQIDFYNVENIFNRL 536

>Smik_4.716 Chr4 (1263375..1265129) [1755 bp, 584 aa] {ON} YDR440W
           (REAL)
          Length = 584

 Score = 32.0 bits (71), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 21/80 (26%), Positives = 43/80 (53%), Gaps = 4/80 (5%)

Query: 252 EFRVRKSYPSNSQVFSLLPQHNSLIIMHAGFQEEYKHCVPKLGKGSRIPKEDLHPISGTT 311
           EF +++S+  N +V  L+PQ + +++ +  F EE    V K+ + +++       IS   
Sbjct: 455 EFSLKESFVGNKRVIELIPQCDVILVNNFLFDEELNKEVEKILQTAKV---GCKIISLKN 511

Query: 312 RVNLTYR-NYVMTENVFCKL 330
             +L Y+ ++   EN+F +L
Sbjct: 512 LRSLAYQIDFYNVENIFNRL 531

>Suva_15.65 Chr15 (102271..105513) [3243 bp, 1080 aa] {ON} YOL100W
           (REAL)
          Length = 1080

 Score = 32.0 bits (71), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 28/115 (24%), Positives = 53/115 (46%), Gaps = 14/115 (12%)

Query: 37  RSADFLGGSVSQTDTPDLHPKRLKTKSQQSLSRYLE-VNALHPIPNKVPASKSKPRP--- 92
           +  +F  GS+  +  PD+ P ++  KS Q++    +   A  PI   V   ++  RP   
Sbjct: 448 KEINFKDGSIWSSTPPDIKPYKINAKSMQTMPGIGDKKQAKKPINALVKTHQTTSRPASN 507

Query: 93  --LELHGKEQIEANIPYCTYHTDV-LPSEVADKLLQQLLED-------RNHKPNK 137
             LE+ G   + ++  + +  +D+ +     D+   Q+LE+       R H+PNK
Sbjct: 508 SSLEVTGNSTVYSSNSHDSTESDIFVKKRPTDERTAQILENARKGINSRKHQPNK 562

>Skud_4.716 Chr4 (1262890..1264650) [1761 bp, 586 aa] {ON} YDR440W
           (REAL)
          Length = 586

 Score = 31.6 bits (70), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 21/80 (26%), Positives = 44/80 (55%), Gaps = 4/80 (5%)

Query: 252 EFRVRKSYPSNSQVFSLLPQHNSLIIMHAGFQEEYKHCVPKLGKGSRIPKEDLHPISGTT 311
           EF +++S+  N +V  L+PQ + +++ +  F E+    V K+ + +++       IS   
Sbjct: 457 EFSLKRSFVDNERVSELIPQCDVILVNNFLFDEKLNKRVEKILQTAKV---GCKVISLKN 513

Query: 312 RVNLTYR-NYVMTENVFCKL 330
             +LTY+ ++   EN+F +L
Sbjct: 514 LRSLTYQIDFYHVENIFNRL 533

>AFR443C Chr6 complement(1236336..1238066) [1731 bp, 576 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR284W
           (YKU70)
          Length = 576

 Score = 31.6 bits (70), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 27/50 (54%), Gaps = 3/50 (6%)

Query: 97  GKEQIEANIPYCTYH---TDVLPSEVADKLLQQLLEDRNHKPNKFYLFGN 143
           GK  +E  +PY   H    DV+ + + D+ LQ++ E R +   K +LF +
Sbjct: 123 GKRSLEEELPYDGRHPTSLDVVFTSIQDQFLQEVPEQRLYNNKKIFLFTD 172

>TPHA0D01190 Chr4 (250654..251931) [1278 bp, 425 aa] {ON} Anc_8.665
           YOR239W
          Length = 425

 Score = 30.8 bits (68), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 27/128 (21%), Positives = 59/128 (46%), Gaps = 6/128 (4%)

Query: 72  EVNALHPIPNKVPASK-SKPRPLELHGKEQIEANIPYCTYHTDVLPSEVADKLLQQLLED 130
           E+N  +   ++VP +  S+    +L G E +E +    T   + +  ++ +++L  +  D
Sbjct: 48  EINTFNCDVDEVPTNNISEDLGADLKGAEVVENDNKLTTEEQNAMAQDIKEEILNAVAHD 107

Query: 131 RNHKPNKFYLFGNLCTSNCASRLFVPEAREKPFFYNGKEVKNPGNYTDEMMLAQVVI-EN 189
            ++  +KF     + T+   SR+     R++PF +  +++    +  D      V   E+
Sbjct: 108 SSNVADKFENENEIVTNENNSRI----GRDEPFEFGKRQLTESSDVWDHNAWDNVEWGED 163

Query: 190 VVNEAISK 197
            V EA +K
Sbjct: 164 QVKEAQAK 171

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.133    0.397 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 47,103,204
Number of extensions: 2077411
Number of successful extensions: 5306
Number of sequences better than 10.0: 22
Number of HSP's gapped: 5432
Number of HSP's successfully gapped: 22
Length of query: 423
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 311
Effective length of database: 40,638,807
Effective search space: 12638668977
Effective search space used: 12638668977
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 67 (30.4 bits)