Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_33.130231.10ON1931939981e-140
KLTH0F00572g1.10ON1951674607e-58
SAKL0C00572g1.10ON3381633604e-41
TDEL0C069301.10ON1841682972e-33
KLLA0C00594g1.10ON1941822886e-32
ZYRO0F18370g1.10ON2201592541e-26
NDAI0A001901.10ON1711552405e-25
KNAG0C002701.10ON1741622083e-20
TPHA0E039601.10ON1771802075e-20
KAFR0D001901.10ON1851632068e-20
NCAS0B090601.10ON1671661934e-18
TBLA0A049701.10ON181501403e-10
Kpol_2002.131.10ON164421008e-05
Ecym_10121.10ON177153937e-04
Smik_3.191.10ON14465700.60
TPHA0D027405.591ON84642711.0
SAKL0H11748g8.477ON44472682.2
KAFR0H015708.477ON39954673.0
YCL056C (PEX34)1.10ON144134644.1
ZYRO0E05610g1.373ON87782664.4
YPL060W (MFM1)8.522ON41376646.8
NOTE: 2 genes in the same pillar as Kwal_33.13023 were not hit in these BLAST results
LIST: Skud_3.8 Suva_3.157

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_33.13023
         (193 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_33.13023 s33 complement(43697..44278) [582 bp, 193 aa] {ON}...   389   e-140
KLTH0F00572g Chr6 complement(42946..43533) [588 bp, 195 aa] {ON}...   181   7e-58
SAKL0C00572g Chr3 complement(51031..52047) [1017 bp, 338 aa] {ON...   143   4e-41
TDEL0C06930 Chr3 (1260938..1261492) [555 bp, 184 aa] {ON} Anc_1....   119   2e-33
KLLA0C00594g Chr3 complement(44220..44804) [585 bp, 194 aa] {ON}...   115   6e-32
ZYRO0F18370g Chr6 (1518178..1518840) [663 bp, 220 aa] {ON} conse...   102   1e-26
NDAI0A00190 Chr1 complement(17031..17546) [516 bp, 171 aa] {ON} ...    97   5e-25
KNAG0C00270 Chr3 complement(41823..42347) [525 bp, 174 aa] {ON} ...    85   3e-20
TPHA0E03960 Chr5 (833382..833915) [534 bp, 177 aa] {ON} Anc_1.10...    84   5e-20
KAFR0D00190 Chr4 complement(21149..21706) [558 bp, 185 aa] {ON} ...    84   8e-20
NCAS0B09060 Chr2 (1741161..1741664) [504 bp, 167 aa] {ON} Anc_1....    79   4e-18
TBLA0A04970 Chr1 complement(1220824..1221369) [546 bp, 181 aa] {...    59   3e-10
Kpol_2002.13 s2002 complement(23954..24448) [495 bp, 164 aa] {ON...    43   8e-05
Ecym_1012 Chr1 complement(22226..22759) [534 bp, 177 aa] {ON} si...    40   7e-04
Smik_3.19 Chr3 complement(28371..28805) [435 bp, 144 aa] {ON} YC...    32   0.60 
TPHA0D02740 Chr4 (566279..568819) [2541 bp, 846 aa] {ON} Anc_5.5...    32   1.0  
SAKL0H11748g Chr8 complement(1002207..1003541) [1335 bp, 444 aa]...    31   2.2  
KAFR0H01570 Chr8 complement(290698..291897) [1200 bp, 399 aa] {O...    30   3.0  
YCL056C Chr3 complement(26925..27359) [435 bp, 144 aa] {ON}  PEX...    29   4.1  
ZYRO0E05610g Chr5 complement(431805..434438) [2634 bp, 877 aa] {...    30   4.4  
YPL060W Chr16 (434523..435764) [1242 bp, 413 aa] {ON}  MFM1Mitoc...    29   6.8  

>Kwal_33.13023 s33 complement(43697..44278) [582 bp, 193 aa] {ON}
           [contig 123] FULL
          Length = 193

 Score =  389 bits (998), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 193/193 (100%), Positives = 193/193 (100%)

Query: 1   MSASQDFLPHFLNARKLFDSLDVTKTNKGGEAIENFCISGMESVAGLFDDIHLLKSFGII 60
           MSASQDFLPHFLNARKLFDSLDVTKTNKGGEAIENFCISGMESVAGLFDDIHLLKSFGII
Sbjct: 1   MSASQDFLPHFLNARKLFDSLDVTKTNKGGEAIENFCISGMESVAGLFDDIHLLKSFGII 60

Query: 61  SESNYVYRKLNKSGFCSKVWLLSLVLSTRKCIRDLNNLWMSRSRLRKEEVHFTMHSSNSL 120
           SESNYVYRKLNKSGFCSKVWLLSLVLSTRKCIRDLNNLWMSRSRLRKEEVHFTMHSSNSL
Sbjct: 61  SESNYVYRKLNKSGFCSKVWLLSLVLSTRKCIRDLNNLWMSRSRLRKEEVHFTMHSSNSL 120

Query: 121 RRALSDKIALKIKDVNRRLILVALEIMQNIAYLIIVAADVFTLNLVERWKNLLEKCSSLL 180
           RRALSDKIALKIKDVNRRLILVALEIMQNIAYLIIVAADVFTLNLVERWKNLLEKCSSLL
Sbjct: 121 RRALSDKIALKIKDVNRRLILVALEIMQNIAYLIIVAADVFTLNLVERWKNLLEKCSSLL 180

Query: 181 TVLKFLFLSIYPV 193
           TVLKFLFLSIYPV
Sbjct: 181 TVLKFLFLSIYPV 193

>KLTH0F00572g Chr6 complement(42946..43533) [588 bp, 195 aa] {ON}
           conserved hypothetical protein
          Length = 195

 Score =  181 bits (460), Expect = 7e-58,   Method: Compositional matrix adjust.
 Identities = 84/167 (50%), Positives = 123/167 (73%), Gaps = 1/167 (0%)

Query: 22  DVTKTNKG-GEAIENFCISGMESVAGLFDDIHLLKSFGIISESNYVYRKLNKSGFCSKVW 80
           D   T +G G+ IE+  +SG+E++AG+FDD+ LL+SFG+I E+N  Y+KLNKSGFCSK W
Sbjct: 21  DKPSTLEGQGKNIESALVSGLETIAGIFDDLQLLRSFGVIGENNVFYQKLNKSGFCSKAW 80

Query: 81  LLSLVLSTRKCIRDLNNLWMSRSRLRKEEVHFTMHSSNSLRRALSDKIALKIKDVNRRLI 140
           L+SL LS+R+   D+ NL +SRSRL++E+  F     N +R+ L+ K+  +I+++N++LI
Sbjct: 81  LVSLTLSSRRNASDIINLAISRSRLKREQAEFMRRPVNPVRKVLNAKVTARIQEINQKLI 140

Query: 141 LVALEIMQNIAYLIIVAADVFTLNLVERWKNLLEKCSSLLTVLKFLF 187
           LVALE++QNI YL +VAADV    L E+WK LLE+ SS+  + + LF
Sbjct: 141 LVALELIQNIGYLTLVAADVLAFGLTEKWKRLLERVSSIFAIARLLF 187

>SAKL0C00572g Chr3 complement(51031..52047) [1017 bp, 338 aa] {ON}
           conserved hypothetical protein
          Length = 338

 Score =  143 bits (360), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 73/163 (44%), Positives = 106/163 (65%)

Query: 25  KTNKGGEAIENFCISGMESVAGLFDDIHLLKSFGIISESNYVYRKLNKSGFCSKVWLLSL 84
           K  +   + E+  I G+ES+  +FDD++LLK+FGII E+N+VYR LNK G  SK+WL +L
Sbjct: 168 KGKQQPASFEDILIGGLESLTNVFDDVYLLKNFGIIGETNFVYRHLNKGGLGSKLWLATL 227

Query: 85  VLSTRKCIRDLNNLWMSRSRLRKEEVHFTMHSSNSLRRALSDKIALKIKDVNRRLILVAL 144
           VLS RK +  L  L  +R  L+KE        S +  + ++DK   KI  ++R++  V L
Sbjct: 228 VLSLRKSLGQLFRLARARHMLQKERRSTPHKCSKTFAKIIADKFTQKIGQLDRQIKDVLL 287

Query: 145 EIMQNIAYLIIVAADVFTLNLVERWKNLLEKCSSLLTVLKFLF 187
           +++QN+AYL++VA DVF L L  RW+ LLE  SSL+TV +F F
Sbjct: 288 DVLQNLAYLLVVAVDVFKLKLPHRWRRLLEWVSSLVTVSRFFF 330

>TDEL0C06930 Chr3 (1260938..1261492) [555 bp, 184 aa] {ON} Anc_1.10
           YCL056C
          Length = 184

 Score =  119 bits (297), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 60/168 (35%), Positives = 101/168 (60%)

Query: 26  TNKGGEAIENFCISGMESVAGLFDDIHLLKSFGIISESNYVYRKLNKSGFCSKVWLLSLV 85
           T     + E+  I+G+ESV   FD+++  KS GII E+N++YR+LNK G+ SK+W ++L+
Sbjct: 15  TGGSKTSFEDNLIAGLESVCSFFDNVYFAKSLGIIGENNFLYRRLNKGGWGSKLWFVTLL 74

Query: 86  LSTRKCIRDLNNLWMSRSRLRKEEVHFTMHSSNSLRRALSDKIALKIKDVNRRLILVALE 145
           LS RKC+R +  +  +R RL+ E      +    +   L +KI L ++  N  +    L+
Sbjct: 75  LSVRKCLRQIFQIVRNRIRLKTEIKGMDKNGKGLMNDVLKEKILLMLQKSNAMMRETLLD 134

Query: 146 IMQNIAYLIIVAADVFTLNLVERWKNLLEKCSSLLTVLKFLFLSIYPV 193
           ++QN  YL+IV  DVF LN+ +R + +LE  S+ +T+++F  +    V
Sbjct: 135 LLQNSVYLMIVVIDVFKLNIPKRARQILEPLSNFVTIMRFFTMGFSSV 182

>KLLA0C00594g Chr3 complement(44220..44804) [585 bp, 194 aa] {ON}
           conserved hypothetical protein
          Length = 194

 Score =  115 bits (288), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 65/182 (35%), Positives = 113/182 (62%), Gaps = 1/182 (0%)

Query: 5   QDFLPHFLNARKLFDSLDVTKTNKGGEAIENFCISGMESVAGLFDDIHLLKSFGIISESN 64
           +D     L+A K   SL +   +    ++E+  I  + SV+  FDD++LL+SFGIIS++N
Sbjct: 6   EDDTEKLLDATKTIKSL-IANEDAPSNSLEDLLIDSLTSVSSFFDDLYLLRSFGIISDTN 64

Query: 65  YVYRKLNKSGFCSKVWLLSLVLSTRKCIRDLNNLWMSRSRLRKEEVHFTMHSSNSLRRAL 124
           ++Y+KLNK    SKVWL+SL+LS R+ +  L  L   + +LRKE ++     S   ++ +
Sbjct: 65  FLYQKLNKGDIGSKVWLVSLLLSIRRSLTRLYTLIRLKLKLRKECMNIASTYSPGFKKLV 124

Query: 125 SDKIALKIKDVNRRLILVALEIMQNIAYLIIVAADVFTLNLVERWKNLLEKCSSLLTVLK 184
            +KI  +   ++ ++  + ++++Q++ Y+IIV+ D+F +NL  ++K  LE  SS  TVLK
Sbjct: 125 KEKILAESNQLSLKIRSLCMDLLQDLLYMIIVSIDIFKINLSLKFKRALELISSAATVLK 184

Query: 185 FL 186
           F+
Sbjct: 185 FV 186

>ZYRO0F18370g Chr6 (1518178..1518840) [663 bp, 220 aa] {ON}
           conserved hypothetical protein
          Length = 220

 Score =  102 bits (254), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 57/159 (35%), Positives = 98/159 (61%), Gaps = 2/159 (1%)

Query: 34  ENFCISGMESVAGLFDDIHLLKSFGIISESNYVYRKLNKSGFCSKVWLLSLVLSTRKCIR 93
           E+  I+G+ES+ GLFD+++LLK+ GIISE N +YR+LNK  + SK+W ++L+LS RK   
Sbjct: 58  EDTLIAGLESICGLFDNVYLLKTLGIISEDNLLYRRLNKGEWGSKLWFVTLLLSARKSFS 117

Query: 94  DLNNLWMSRSRLRKEEVHFTMHSSNSL-RRALSDKIALKIKDVNRRLILVALEIMQNIAY 152
            L  +  ++S+L++E           L ++ L +K    +K  +  +  V LE++Q +AY
Sbjct: 118 RLLKIMKAKSKLKEEMKELRTEGDEDLVKQVLRNKFTDALKKCSIIIKDVVLELLQTLAY 177

Query: 153 LIIVAADVFTLNLVERWKNLLEKCSSLLTVLKFLFLSIY 191
           L IV  +VF +N+ ++   +LE  S  + V++ +F + Y
Sbjct: 178 LAIVVIEVFKINVSQKVIKILEPLSHFIAVIR-IFTTGY 215

>NDAI0A00190 Chr1 complement(17031..17546) [516 bp, 171 aa] {ON}
           Anc_1.10 YCL056C
          Length = 171

 Score = 97.1 bits (240), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 54/155 (34%), Positives = 94/155 (60%), Gaps = 2/155 (1%)

Query: 32  AIENFCISGMESVAGLFDDIHLLKSFGIISESNYVYRKLNKSGFCSKVWLLSLVLSTRKC 91
            +E+  I G+E +  +FD+++LLKS GIISE+N +YR LNK  F SK+W ++L+L+TRK 
Sbjct: 4   TMEDSIIGGLEYICNIFDNVYLLKSLGIISENNLLYRNLNKGNFGSKIWFVTLILTTRKL 63

Query: 92  IRDLNNLWMSRSRLRKEEVHF--TMHSSNSLRRALSDKIALKIKDVNRRLILVALEIMQN 149
           +  L     +R RL KE  +      + N +   L +K+ + IK  +  ++ + LE+ Q 
Sbjct: 64  VHQLIRAVKARIRLVKERKNSKRITRNENLVSSVLHEKLDIGIKKCSSMIMDLLLELFQT 123

Query: 150 IAYLIIVAADVFTLNLVERWKNLLEKCSSLLTVLK 184
           + YL +V+ ++F L   ++   +LE  S+LL +++
Sbjct: 124 LVYLFLVSINIFKLKFSDKMVYVLEHLSNLLVLIR 158

>KNAG0C00270 Chr3 complement(41823..42347) [525 bp, 174 aa] {ON}
           Anc_1.10 YCL056C
          Length = 174

 Score = 84.7 bits (208), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 56/162 (34%), Positives = 98/162 (60%), Gaps = 5/162 (3%)

Query: 34  ENFCISGMESVAGLFDDIHLLKSFGIISESNYVYRKLNKSGFCSKVWLLSLVLSTRKCIR 93
           E+  +  +ES+  +FD+I+LLKS GIIS+ N++YRKLNK    SKVW L+L+LS RK ++
Sbjct: 10  EDVLLGKLESICSIFDNIYLLKSLGIISKENFLYRKLNKGNVGSKVWFLTLILSIRKNLK 69

Query: 94  DLNNLWMSRSRL--RKEEVHFTMHSSNSL-RRALSDKIALKIKDVNRRLILVALEIMQNI 150
            L  L  +R +L    E++       +SL    + +K++  ++  +  +I   L++ Q +
Sbjct: 70  RLVRLVQTRFKLVFEIEQILRQKKLDDSLVNNVVLNKLSTNLRKCHFMIIDTFLDLAQLL 129

Query: 151 AYLIIVAADVFTLNL-VERWKNLLEKCSSLLTVLKFLFLSIY 191
            YL IV+ D F +    +++K  L   S+++T+L+ L +S+Y
Sbjct: 130 IYLFIVSGDCFNIPPRFKKFKKYLGPMSNVVTILRML-VSVY 170

>TPHA0E03960 Chr5 (833382..833915) [534 bp, 177 aa] {ON} Anc_1.10
           YCL056C
          Length = 177

 Score = 84.3 bits (207), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 58/180 (32%), Positives = 103/180 (57%), Gaps = 10/180 (5%)

Query: 19  DSLDV-TKTNKGGEAIENFCISGMESVAGLFDDIHLLKSFGIISESNYVYRKLNKSGFCS 77
           DS DV +  N   E  E+  ++ +ES+  +FD +  L+S G+I E+N+ YR LN+S   S
Sbjct: 2   DSSDVFSDENGNEEGFESTLLNYLESITNIFDLVFFLRSTGLIKENNFFYRNLNRSNIGS 61

Query: 78  KVWLLSLVLSTRKCIRDLNNLWMSRSRLRKEEVHFTMHSSNSLRRALSDKIALKIKDVN- 136
           K+W ++L+LS RK  +++       S L+ E     +  +N L    SD I  KI++ N 
Sbjct: 62  KIWFVTLILSIRKLYKNILKSTKLLSLLKTELTK--IEKNNDLT---SDIILQKIQNNNT 116

Query: 137 ---RRLILVALEIMQNIAYLIIVAADVFTLNLVERWKNLLEKCSSLLTVLKFLFLSIYPV 193
              +++    +E++Q+  YLIIV+ ++F +++ ++  + LE  S+ +++LKF  L I P 
Sbjct: 117 ILKKKIKNFIIELIQDFIYLIIVSLEIFKISISKKLNHRLEILSNSVSMLKFFTLEITPT 176

>KAFR0D00190 Chr4 complement(21149..21706) [558 bp, 185 aa] {ON}
           Anc_1.10 YCL056C
          Length = 185

 Score = 84.0 bits (206), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 56/163 (34%), Positives = 95/163 (58%), Gaps = 8/163 (4%)

Query: 32  AIENFCISGMESVAGLFDDIHLLKSFGIISESNYVYRKLNKSGFCSKVWLLSLVLSTRKC 91
            +E+  I  +E +  +FD+I+ LK+ G+I E N++Y+KLNK    SK+WL+SL+LS R+C
Sbjct: 18  TLEDILIDKLEGICTVFDNIYFLKNLGVIKEDNFIYKKLNKGNLGSKIWLVSLILSIRRC 77

Query: 92  IRDLNNLWMSRSRLRKE----EVHFTMHSSNSLRRA-LSDKIALKIKDVNRRLILVALEI 146
            ++L +++ +R +   E           S N L    L DK+   ++  N  +  + LE 
Sbjct: 78  FKNLTHMYRTRRKYVTELSIVSKKRNQSSENGLVNGILKDKLLQSLQKCNSIIRDLLLEF 137

Query: 147 MQNIAYLIIVAADVFTLNLVERW-KNL--LEKCSSLLTVLKFL 186
           +Q + YLIIV  +VF +  +ER+ K +  LE  S+L+TV + +
Sbjct: 138 LQVLLYLIIVIIEVFKVKSLERYVKGIRNLEILSNLITVTRII 180

>NCAS0B09060 Chr2 (1741161..1741664) [504 bp, 167 aa] {ON} Anc_1.10
           YCL056C
          Length = 167

 Score = 79.0 bits (193), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 56/166 (33%), Positives = 99/166 (59%), Gaps = 10/166 (6%)

Query: 32  AIENFCISGMESVAGLFDDIHLLKSFGIISESNYVYRKLNKSGFCSKVWLLSLVLSTRKC 91
            +E+  ++ +ES+  +FD+++  KS G++SE N +YR LNK  F SK+W L+L+LS++K 
Sbjct: 3   GLEDNVLNALESICNIFDNVYFFKSIGVLSEKNILYRTLNKGDFGSKLWFLTLLLSSKKL 62

Query: 92  IRDLNNLWMSRSRLRKE------EVHFTMHSSNSLRRALSDKIALKIKDVNRRLILVALE 145
           I  L      R++++KE      E        NSL R   +    K  D+ R  +   LE
Sbjct: 63  ITRLTKSLKIRAKIKKEIDESPKENDEDKSLVNSLLREKLELSLAKCMDIIRNNV---LE 119

Query: 146 IMQNIAYLIIVAADVFTLNLVERWKNLLEKCSSLLTVLKFLFLSIY 191
           ++Q + YL I   +VF + + ++WK+LLE+ S+++T+++ +F+S Y
Sbjct: 120 LLQTMMYLSIAFINVFKVKVPQKWKHLLEQLSNIITIIR-VFISGY 164

>TBLA0A04970 Chr1 complement(1220824..1221369) [546 bp, 181 aa]
          {ON} Anc_1.10 YCL056C
          Length = 181

 Score = 58.5 bits (140), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 39/50 (78%)

Query: 40 GMESVAGLFDDIHLLKSFGIISESNYVYRKLNKSGFCSKVWLLSLVLSTR 89
          G+ES+  +FD+I+ L+S G+IS++N  YR LN+S   SK+WL++LVL+ R
Sbjct: 16 GLESICSVFDNIYFLRSIGLISDTNLFYRLLNRSELGSKIWLITLVLNIR 65

>Kpol_2002.13 s2002 complement(23954..24448) [495 bp, 164 aa] {ON}
          complement(23954..24448) [495 nt, 165 aa]
          Length = 164

 Score = 43.1 bits (100), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 15/42 (35%), Positives = 30/42 (71%)

Query: 34 ENFCISGMESVAGLFDDIHLLKSFGIISESNYVYRKLNKSGF 75
          E+  + G+E +  LFD I+ +K+ GII++ +++YRK+ ++ F
Sbjct: 7  EDIVLDGLEGICSLFDSIYFIKTLGIITDKSFLYRKIIQNNF 48

>Ecym_1012 Chr1 complement(22226..22759) [534 bp, 177 aa] {ON}
           similar to XP_452220 - K. lactis - KLLA0C00594g
          Length = 177

 Score = 40.4 bits (93), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 35/153 (22%), Positives = 66/153 (43%), Gaps = 18/153 (11%)

Query: 24  TKTNKGGEAIENFCISGMESVAGLFDDIHLLKSFGIISESNYVYRKLNKSGFCSKVWLLS 83
           + TN      E+     + S    +D I+L +S GII + N +Y+ L      S   LL 
Sbjct: 24  SDTNGSPTTFEDQLTENLRSAVTFYDLIYLFQSIGIIKKDNVIYKALAVGKINSGSRLLF 83

Query: 84  LVLSTRKC---IRDLNNLWMS-RSRLRKEEVHFTMHSSNSLRRALSDKIALKIKDVNRRL 139
           L+L  RK    +  L  LW + ++ L    +    + + S               V R +
Sbjct: 84  LLLVARKTFLKLLRLVRLWYALKNVLPPASIKKKYNETKS--------------RVKRSI 129

Query: 140 ILVALEIMQNIAYLIIVAADVFTLNLVERWKNL 172
           + ++++++  + YLI+V  D+F   + +  + L
Sbjct: 130 LRLSVDLLDTLVYLIVVLIDLFKFKVSDSTRKL 162

>Smik_3.19 Chr3 complement(28371..28805) [435 bp, 144 aa] {ON}
          YCL056C (REAL)
          Length = 144

 Score = 31.6 bits (70), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 32/65 (49%), Gaps = 6/65 (9%)

Query: 34 ENFCISGMESVAGLFDDIHLLKSFGIISESNYVYRKLNKSGFCSKVWLLSLVLSTRKCIR 93
          +N  I+    V+ L D   +L++ G++ +  YV      SG   KVWL    +S  KC+ 
Sbjct: 13 KNLWINVWNGVSSLLDFFAVLENLGVVDDKLYV------SGVLRKVWLCYSWISVIKCVW 66

Query: 94 DLNNL 98
           L NL
Sbjct: 67 KLINL 71

>TPHA0D02740 Chr4 (566279..568819) [2541 bp, 846 aa] {ON} Anc_5.591
           YDR466W
          Length = 846

 Score = 32.0 bits (71), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 13/42 (30%), Positives = 25/42 (59%), Gaps = 3/42 (7%)

Query: 48  FDDIHLLKSFGIISESNYVYRKL---NKSGFCSKVWLLSLVL 86
           ++DIH+ ++   +  + YV  +L   N+ G+CS VW L  ++
Sbjct: 181 YNDIHVNRASSFVGTAEYVSPELLLYNQCGYCSDVWALGCMI 222

>SAKL0H11748g Chr8 complement(1002207..1003541) [1335 bp, 444 aa]
           {ON} similar to uniprot|Q12505 Saccharomyces cerevisiae
           YPL026C SKS1 multicopy suppressor of snf3 and grr1
           mutants serine/threonine protein kinase homologous to
           Ran1p
          Length = 444

 Score = 30.8 bits (68), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 32/72 (44%), Gaps = 12/72 (16%)

Query: 77  SKVWLLSLVLSTRKCIRDLNNLWMSRSRLRKEEVHFTMHSSNSLRRALSDKIALKIKDVN 136
           S +W L ++L    CIR   N W+   +L     H+              K+ LKI  V+
Sbjct: 243 SDIWSLGIILINLTCIR---NPWLKAHQLEDHTFHYFTQDP---------KVLLKILPVS 290

Query: 137 RRLILVALEIMQ 148
           + L  + L+++Q
Sbjct: 291 QDLFSILLDVLQ 302

>KAFR0H01570 Chr8 complement(290698..291897) [1200 bp, 399 aa] {ON}
           Anc_8.477 YDR247W
          Length = 399

 Score = 30.4 bits (67), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 16/54 (29%), Positives = 25/54 (46%), Gaps = 3/54 (5%)

Query: 77  SKVWLLSLVLSTRKCIRDLNNLWMSRSRLRKEEVHFTMHSSNSLRRALSDKIAL 130
           S +W L ++L    CIR   N W+   R+  +  H+ +     L+R L    AL
Sbjct: 231 SDIWSLGVILINLTCIR---NPWLKAHRVEDKTFHYFIEDPAVLKRILPISDAL 281

>YCL056C Chr3 complement(26925..27359) [435 bp, 144 aa] {ON}
           PEX34Peroxisomal integral membrane protein that
           regulates peroxisome populations; interacts with Pex11p,
           Pex25p, and Pex27p to control both constitutive
           peroxisome division and peroxisome morphology and
           abundance during peroxisome proliferation
          Length = 144

 Score = 29.3 bits (64), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 29/134 (21%), Positives = 58/134 (43%), Gaps = 13/134 (9%)

Query: 23  VTKTNKGGEAIENFCISGMESVAGLFDDIHLLKSFGIISESNYVYRKLNKSGFCSKVWLL 82
           V+K N    + ++   +    V+ L D   +L++ G++++  YV      SG   KVWL 
Sbjct: 2   VSKKNTAEISAKDIWENIWSGVSSLLDFFAVLENLGVVNDKLYV------SGLLRKVWLC 55

Query: 83  SLVLSTRKCIRDLNNLWMSRSRLRKEEVHFTMHSSNSLRRALSDKIALKIKDVNRRLILV 142
              +S  KC+  L        +L K +              + DK+    K  N  +  +
Sbjct: 56  YSCISVIKCVWKL-------IKLCKVKFKIDQRLDGEGNGLVKDKLINFKKKYNEHIRHI 108

Query: 143 ALEIMQNIAYLIIV 156
              ++Q+++YL+++
Sbjct: 109 TAALLQDLSYLMVL 122

>ZYRO0E05610g Chr5 complement(431805..434438) [2634 bp, 877 aa] {ON}
           similar to uniprot|P43596 Saccharomyces cerevisiae
           YFR013W IOC3 Member of a complex (Isw1a) with Isw1p that
           has nucleosome-stimulated ATPase activity and represses
           transcription initiation by specific positioning of a
           promoter proximal dinucleosome has homology to Esc8p
           which is involved in silencing
          Length = 877

 Score = 30.0 bits (66), Expect = 4.4,   Method: Composition-based stats.
 Identities = 24/82 (29%), Positives = 36/82 (43%), Gaps = 12/82 (14%)

Query: 93  RDLNNLWMSRSRLRKEEVHFTMHSSNSLRRALSDKIALKIKDVNRRLILVALEIMQNIAY 152
           R L ++  SR  +R ++ H     SN  +  LS  I LKI +          EI Q +  
Sbjct: 460 RKLCSIVQSRYEIRSKKKHVKKQLSNGKKEDLS--IKLKILE----------EIKQTLKD 507

Query: 153 LIIVAADVFTLNLVERWKNLLE 174
           +     D   +NL E+W+ L E
Sbjct: 508 MPKEEKDQTMINLYEKWEKLFE 529

>YPL060W Chr16 (434523..435764) [1242 bp, 413 aa] {ON}
           MFM1Mitochondrial inner membrane magnesium transporter,
           involved in maintenance of mitochondrial magnesium
           concentrations and membrane potential; indirectly
           affects splicing of group II introns; functionally and
           structurally related to Mrs2p
          Length = 413

 Score = 29.3 bits (64), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 34/76 (44%), Gaps = 10/76 (13%)

Query: 40  GMESVAG--LFDDIHLLKSFGIISESNYVYRKLNKSGFCSKVWLLSLVLSTRKCIRDLNN 97
           GM S+ G      I+ +     I ESNY Y  +   G  S VWL +      K IR L+ 
Sbjct: 339 GMLSLGGALFLGSIYGMNLESFIEESNYAYLTVTILGLISTVWLYA------KGIRHLHK 392

Query: 98  LWMSR--SRLRKEEVH 111
           L      S+++ + VH
Sbjct: 393 LQRMTLLSKIKTDSVH 408

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.325    0.138    0.398 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 18,606,837
Number of extensions: 713088
Number of successful extensions: 2869
Number of sequences better than 10.0: 31
Number of HSP's gapped: 2935
Number of HSP's successfully gapped: 31
Length of query: 193
Length of database: 53,481,399
Length adjustment: 104
Effective length of query: 89
Effective length of database: 41,556,135
Effective search space: 3698496015
Effective search space used: 3698496015
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 62 (28.5 bits)