Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_33.130161.8ON82824022e-52
KLTH0F00550g1.8ON82823736e-48
SAKL0C00528g1.8ON110823443e-43
AFR743W1.8ON82823284e-41
Ecym_10101.8ON82823215e-40
ZYRO0F18414g1.8ON87753051e-37
CAGL0B00396g1.8ON88743033e-37
NCAS0B090801.8ON93802992e-36
Kpol_2002.111.8ON86822982e-36
TBLA0A049601.8ON96712955e-36
TPHA0E039801.8ON86702922e-35
KLLA0C00550g1.8ON82822808e-34
Skud_3.61.8ON97962714e-32
YCL057C-A (MOS1)1.8ON97792695e-32
Smik_3.171.8ON97792671e-31
Suva_3.1551.8ON97692628e-31
TDEL0C069401.8ON86792573e-30
KNAG0C002501.8ON94742513e-29
NDAI0A001701.8ON96782402e-27
KAFR0D001701.8ON90892322e-26
TDEL0C00150singletonON52630640.80
KLTH0G19404gsingletonON51370578.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_33.13016
         (82 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_33.13016 s33 complement(41816..42064) [249 bp, 82 aa] {ON} ...   159   2e-52
KLTH0F00550g Chr6 complement(42092..42340) [249 bp, 82 aa] {ON} ...   148   6e-48
SAKL0C00528g Chr3 complement(47403..47735) [333 bp, 110 aa] {ON}...   137   3e-43
AFR743W Chr6 (1800868..1801116) [249 bp, 82 aa] {ON} Syntenic ho...   130   4e-41
Ecym_1010 Chr1 complement(19126..19374) [249 bp, 82 aa] {ON} sim...   128   5e-40
ZYRO0F18414g Chr6 (1521776..1522039) [264 bp, 87 aa] {ON} simila...   122   1e-37
CAGL0B00396g Chr2 complement(24498..24764) [267 bp, 88 aa] {ON} ...   121   3e-37
NCAS0B09080 Chr2 (1744147..1744428) [282 bp, 93 aa] {ON} Anc_1.8...   119   2e-36
Kpol_2002.11 s2002 complement(19864..20124) [261 bp, 86 aa] {ON}...   119   2e-36
TBLA0A04960 Chr1 complement(1220183..1220473) [291 bp, 96 aa] {O...   118   5e-36
TPHA0E03980 Chr5 (837161..837421) [261 bp, 86 aa] {ON} Anc_1.8 Y...   117   2e-35
KLLA0C00550g Chr3 complement(40901..41149) [249 bp, 82 aa] {ON} ...   112   8e-34
Skud_3.6 Chr3 complement(12034..12324) [291 bp, 97 aa] {ON} YCL0...   108   4e-32
YCL057C-A Chr3 complement(24032..24325) [294 bp, 97 aa] {ON}  MO...   108   5e-32
Smik_3.17 Chr3 complement(25487..25777) [291 bp, 97 aa] {ON} YCL...   107   1e-31
Suva_3.155 Chr3 complement(233792..234085) [294 bp, 97 aa] {ON} ...   105   8e-31
TDEL0C06940 Chr3 (1261913..1262173) [261 bp, 86 aa] {ON} Anc_1.8...   103   3e-30
KNAG0C00250 Chr3 complement(38677..38961) [285 bp, 94 aa] {ON} A...   101   3e-29
NDAI0A00170 Chr1 complement(13975..14265) [291 bp, 96 aa] {ON} A...    97   2e-27
KAFR0D00170 Chr4 complement(18220..18492) [273 bp, 90 aa] {ON} A...    94   2e-26
TDEL0C00150 Chr3 (14725..16305) [1581 bp, 526 aa] {ON}                 29   0.80 
KLTH0G19404g Chr7 (1672150..1673691) [1542 bp, 513 aa] {ON} weak...    27   8.0  

>Kwal_33.13016 s33 complement(41816..42064) [249 bp, 82 aa] {ON}
          YCL057C-A - Hypothetical ORF, has similarity to
          proteins in S. pombe, C. elegans, D. melanogaster.
          [contig 123] FULL
          Length = 82

 Score =  159 bits (402), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 82/82 (100%), Positives = 82/82 (100%)

Query: 1  MSDQAKIAPVSRSLLNDKWDVVLSNLVVKVGLGFGAGVVASVLLFKRRAAPVWIGVGFGL 60
          MSDQAKIAPVSRSLLNDKWDVVLSNLVVKVGLGFGAGVVASVLLFKRRAAPVWIGVGFGL
Sbjct: 1  MSDQAKIAPVSRSLLNDKWDVVLSNLVVKVGLGFGAGVVASVLLFKRRAAPVWIGVGFGL 60

Query: 61 GRGYSEGDAIFRSSAGLRTVKA 82
          GRGYSEGDAIFRSSAGLRTVKA
Sbjct: 61 GRGYSEGDAIFRSSAGLRTVKA 82

>KLTH0F00550g Chr6 complement(42092..42340) [249 bp, 82 aa] {ON}
          similar to uniprot|Q96VH5 Saccharomyces cerevisiae
          YCL057C-A
          Length = 82

 Score =  148 bits (373), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 74/82 (90%), Positives = 78/82 (95%)

Query: 1  MSDQAKIAPVSRSLLNDKWDVVLSNLVVKVGLGFGAGVVASVLLFKRRAAPVWIGVGFGL 60
          MS+Q K++P SRSLLNDKWDVVLSNLVVK GLGFGAGVVASVLLFKRRA PVWIGVGFGL
Sbjct: 1  MSEQLKVSPTSRSLLNDKWDVVLSNLVVKTGLGFGAGVVASVLLFKRRAFPVWIGVGFGL 60

Query: 61 GRGYSEGDAIFRSSAGLRTVKA 82
          GRGY+EGDAIFRSSAGLRTVKA
Sbjct: 61 GRGYAEGDAIFRSSAGLRTVKA 82

>SAKL0C00528g Chr3 complement(47403..47735) [333 bp, 110 aa] {ON}
           similar to uniprot|Q96VH5 Saccharomyces cerevisiae
           YCL057C-A
          Length = 110

 Score =  137 bits (344), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 65/82 (79%), Positives = 76/82 (92%)

Query: 1   MSDQAKIAPVSRSLLNDKWDVVLSNLVVKVGLGFGAGVVASVLLFKRRAAPVWIGVGFGL 60
           MS+Q +++  ++S+LNDKWDVVLSN+VVK GLGFGAG+VASVLLFKRRA PVW+GVGFGL
Sbjct: 29  MSEQLQVSKPNKSILNDKWDVVLSNVVVKTGLGFGAGIVASVLLFKRRAFPVWLGVGFGL 88

Query: 61  GRGYSEGDAIFRSSAGLRTVKA 82
           GRGY+EGDAIFRSSAGLRTV A
Sbjct: 89  GRGYAEGDAIFRSSAGLRTVNA 110

>AFR743W Chr6 (1800868..1801116) [249 bp, 82 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YCL057C-A
          Length = 82

 Score =  130 bits (328), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 65/82 (79%), Positives = 72/82 (87%)

Query: 1  MSDQAKIAPVSRSLLNDKWDVVLSNLVVKVGLGFGAGVVASVLLFKRRAAPVWIGVGFGL 60
          MS Q +++  SRS+LNDKWDVVLSNLVVK GLGFGAGV ASVL FKRRA PVW+GVGFGL
Sbjct: 1  MSGQLEVSAPSRSILNDKWDVVLSNLVVKTGLGFGAGVFASVLFFKRRAFPVWLGVGFGL 60

Query: 61 GRGYSEGDAIFRSSAGLRTVKA 82
          GRGY+EGDAIFRS AGLR V+A
Sbjct: 61 GRGYAEGDAIFRSHAGLRAVRA 82

>Ecym_1010 Chr1 complement(19126..19374) [249 bp, 82 aa] {ON}
          similar to Ashbya gossypii AFR743W
          Length = 82

 Score =  128 bits (321), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 62/82 (75%), Positives = 72/82 (87%)

Query: 1  MSDQAKIAPVSRSLLNDKWDVVLSNLVVKVGLGFGAGVVASVLLFKRRAAPVWIGVGFGL 60
          M ++ ++A  SRS+LNDKWDVVLSNLVVK GLGF  GV+ASVL FKRRA PVW+G+GFGL
Sbjct: 1  MGEKLEVAAPSRSILNDKWDVVLSNLVVKAGLGFSVGVLASVLFFKRRAFPVWLGIGFGL 60

Query: 61 GRGYSEGDAIFRSSAGLRTVKA 82
          GRGY+EGDAIFRS AGLRT+KA
Sbjct: 61 GRGYAEGDAIFRSHAGLRTMKA 82

>ZYRO0F18414g Chr6 (1521776..1522039) [264 bp, 87 aa] {ON} similar
          to uniprot|Q96VH5 Saccharomyces cerevisiae YCL057C-A
          Length = 87

 Score =  122 bits (305), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 61/75 (81%), Positives = 70/75 (93%), Gaps = 1/75 (1%)

Query: 8  APVSRSLLNDKWDVVLSNLVVKVGLGFGAGVVASVLLFKRRAAPVWIGVGFGLGRGYSEG 67
          AP ++S+LNDKWDVVLSNL+VK GLGFG GVVASVL+FKRRA PVW+G+GFGLGRGY+EG
Sbjct: 14 AP-NKSILNDKWDVVLSNLLVKSGLGFGVGVVASVLIFKRRAFPVWLGIGFGLGRGYAEG 72

Query: 68 DAIFRSSAGLRTVKA 82
          DAIFRS+AGLRT KA
Sbjct: 73 DAIFRSAAGLRTSKA 87

>CAGL0B00396g Chr2 complement(24498..24764) [267 bp, 88 aa] {ON}
          highly similar to uniprot|Q96VH5 Saccharomyces
          cerevisiae YCL057ca
          Length = 88

 Score =  121 bits (303), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 59/74 (79%), Positives = 67/74 (90%), Gaps = 1/74 (1%)

Query: 8  APVSRSLLNDKWDVVLSNLVVKVGLGFGAGVVASVLLFKRRAAPVWIGVGFGLGRGYSEG 67
           PV RS+LNDKWDVVLSN++VK+GLGFG GVV SVL FKRR+ PVW+GVGFG GRGYSEG
Sbjct: 15 TPV-RSILNDKWDVVLSNMIVKMGLGFGVGVVTSVLFFKRRSFPVWLGVGFGAGRGYSEG 73

Query: 68 DAIFRSSAGLRTVK 81
          DAIFRS+AGLR+VK
Sbjct: 74 DAIFRSTAGLRSVK 87

>NCAS0B09080 Chr2 (1744147..1744428) [282 bp, 93 aa] {ON} Anc_1.8
          YCL057C-A
          Length = 93

 Score =  119 bits (299), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 56/80 (70%), Positives = 66/80 (82%)

Query: 2  SDQAKIAPVSRSLLNDKWDVVLSNLVVKVGLGFGAGVVASVLLFKRRAAPVWIGVGFGLG 61
          +  A    + RS+LNDKWDVVLSN++VKVGLGF  GVVASV+ FKRR  PVW+G+GFG+G
Sbjct: 13 TSTAVTPTIDRSILNDKWDVVLSNMLVKVGLGFSVGVVASVIFFKRRTFPVWLGIGFGVG 72

Query: 62 RGYSEGDAIFRSSAGLRTVK 81
          RGY+EGDAIFRS AGLRT K
Sbjct: 73 RGYAEGDAIFRSPAGLRTAK 92

>Kpol_2002.11 s2002 complement(19864..20124) [261 bp, 86 aa] {ON}
          complement(19864..20124) [261 nt, 87 aa]
          Length = 86

 Score =  119 bits (298), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 58/82 (70%), Positives = 70/82 (85%), Gaps = 4/82 (4%)

Query: 1  MSDQAKIAPVS----RSLLNDKWDVVLSNLVVKVGLGFGAGVVASVLLFKRRAAPVWIGV 56
          MS Q++   ++    RS+LNDKWDVVLSN +VK  LGFGAGV+ASV+LFKRRA PVW+G+
Sbjct: 1  MSQQSQELQITSAPTRSILNDKWDVVLSNFLVKTSLGFGAGVLASVILFKRRAFPVWLGI 60

Query: 57 GFGLGRGYSEGDAIFRSSAGLR 78
          GFG+GRGYSEGDAIFRS+AGLR
Sbjct: 61 GFGIGRGYSEGDAIFRSAAGLR 82

>TBLA0A04960 Chr1 complement(1220183..1220473) [291 bp, 96 aa]
          {ON} Anc_1.8 YCL057C-A
          Length = 96

 Score =  118 bits (295), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 53/71 (74%), Positives = 65/71 (91%)

Query: 11 SRSLLNDKWDVVLSNLVVKVGLGFGAGVVASVLLFKRRAAPVWIGVGFGLGRGYSEGDAI 70
          +RS+LNDKWD+V+SN++VK   GFGAGV+ASV+ FKRRA PVW+GVGFGLGRGYSEGDAI
Sbjct: 25 NRSILNDKWDIVISNMLVKTTFGFGAGVLASVIFFKRRAFPVWLGVGFGLGRGYSEGDAI 84

Query: 71 FRSSAGLRTVK 81
          FRS+AGLR+ +
Sbjct: 85 FRSTAGLRSFQ 95

>TPHA0E03980 Chr5 (837161..837421) [261 bp, 86 aa] {ON} Anc_1.8
          YCL057C-A
          Length = 86

 Score =  117 bits (292), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 53/70 (75%), Positives = 65/70 (92%)

Query: 12 RSLLNDKWDVVLSNLVVKVGLGFGAGVVASVLLFKRRAAPVWIGVGFGLGRGYSEGDAIF 71
          +S+LNDKWDVVLSN++VK GLGFG GVV S+LLFKRRA PVW+G+GFG+GRGYS+GDAIF
Sbjct: 16 KSILNDKWDVVLSNMLVKTGLGFGVGVVTSILLFKRRAFPVWLGIGFGVGRGYSDGDAIF 75

Query: 72 RSSAGLRTVK 81
          RS+AGLR+ +
Sbjct: 76 RSAAGLRSTR 85

>KLLA0C00550g Chr3 complement(40901..41149) [249 bp, 82 aa] {ON}
          similar to uniprot|Q96VH5 Saccharomyces cerevisiae
          YCL057C-A
          Length = 82

 Score =  112 bits (280), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 54/82 (65%), Positives = 65/82 (79%)

Query: 1  MSDQAKIAPVSRSLLNDKWDVVLSNLVVKVGLGFGAGVVASVLLFKRRAAPVWIGVGFGL 60
          MS+Q +      S+L+ +WDVVLSN+V K  LG G G+VASVL FKRRA PVW+GVGFGL
Sbjct: 1  MSEQVQTTKAVPSILDKRWDVVLSNVVAKTALGAGVGIVASVLFFKRRAFPVWVGVGFGL 60

Query: 61 GRGYSEGDAIFRSSAGLRTVKA 82
          GRGY+EGDAIFR++AGLR V A
Sbjct: 61 GRGYAEGDAIFRTNAGLRKVNA 82

>Skud_3.6 Chr3 complement(12034..12324) [291 bp, 97 aa] {ON}
          YCL057C-A (REAL)
          Length = 97

 Score =  108 bits (271), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 53/96 (55%), Positives = 69/96 (71%), Gaps = 15/96 (15%)

Query: 1  MSDQAKIAPVSRS---------------LLNDKWDVVLSNLVVKVGLGFGAGVVASVLLF 45
          MS+QAK+   ++S               +L+ KWD+V+SN++VK  +GFG GV  SVL F
Sbjct: 1  MSEQAKLQEPAKSTSSNDSIKNGSAVSTILDAKWDIVMSNMLVKTAMGFGVGVFTSVLFF 60

Query: 46 KRRAAPVWIGVGFGLGRGYSEGDAIFRSSAGLRTVK 81
          KRRA PVW+G+GFG+GRGY+EGDAIFRSSAGLR+ K
Sbjct: 61 KRRAFPVWLGIGFGVGRGYAEGDAIFRSSAGLRSSK 96

>YCL057C-A Chr3 complement(24032..24325) [294 bp, 97 aa] {ON}
          MOS1Mitochondrial protein essential for proper inner
          membrane organization; conserved component of the
          mitochondrial inner membrane organizing system (MICOS,
          MINOS, or MitOS), a scaffold-like structure on the
          intermembrane space side of the inner membrane which
          has a role in the maintenance of crista junctions and
          inner membrane architecture; ortholog of human MINOS1
          Length = 97

 Score =  108 bits (269), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 50/79 (63%), Positives = 62/79 (78%)

Query: 3  DQAKIAPVSRSLLNDKWDVVLSNLVVKVGLGFGAGVVASVLLFKRRAAPVWIGVGFGLGR 62
          D  K      ++L+ KWD+VLSN++VK  +GFG GV  SVL FKRRA PVW+G+GFG+GR
Sbjct: 18 DSNKNGSSVSTILDTKWDIVLSNMLVKTAMGFGVGVFTSVLFFKRRAFPVWLGIGFGVGR 77

Query: 63 GYSEGDAIFRSSAGLRTVK 81
          GY+EGDAIFRSSAGLR+ K
Sbjct: 78 GYAEGDAIFRSSAGLRSSK 96

>Smik_3.17 Chr3 complement(25487..25777) [291 bp, 97 aa] {ON}
          YCL057C-A (REAL)
          Length = 97

 Score =  107 bits (267), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 50/79 (63%), Positives = 63/79 (79%)

Query: 3  DQAKIAPVSRSLLNDKWDVVLSNLVVKVGLGFGAGVVASVLLFKRRAAPVWIGVGFGLGR 62
          D +K      ++L+ KWD+VLSN++VK  +GFG GV  SVL FKRRA PVW+G+GFG+GR
Sbjct: 18 DSSKNGSGVSTVLDTKWDIVLSNMLVKTAMGFGVGVFTSVLFFKRRAFPVWLGIGFGVGR 77

Query: 63 GYSEGDAIFRSSAGLRTVK 81
          GY+EGDAIFRSSAGLR+ K
Sbjct: 78 GYAEGDAIFRSSAGLRSSK 96

>Suva_3.155 Chr3 complement(233792..234085) [294 bp, 97 aa] {ON}
          YCL057C-A (REAL)
          Length = 97

 Score =  105 bits (262), Expect = 8e-31,   Method: Compositional matrix adjust.
 Identities = 47/69 (68%), Positives = 59/69 (85%)

Query: 13 SLLNDKWDVVLSNLVVKVGLGFGAGVVASVLLFKRRAAPVWIGVGFGLGRGYSEGDAIFR 72
          ++L+ KWD+VLSN++VK  +GFG GV  SVL FKRRA P W+G+GFG+GRGY+EGDAIFR
Sbjct: 28 TVLDAKWDIVLSNMLVKTAMGFGIGVFTSVLFFKRRAFPAWLGIGFGVGRGYAEGDAIFR 87

Query: 73 SSAGLRTVK 81
          SSAGLR+ K
Sbjct: 88 SSAGLRSSK 96

>TDEL0C06940 Chr3 (1261913..1262173) [261 bp, 86 aa] {ON} Anc_1.8
          YCL057C-A
          Length = 86

 Score =  103 bits (257), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 61/79 (77%), Positives = 71/79 (89%)

Query: 4  QAKIAPVSRSLLNDKWDVVLSNLVVKVGLGFGAGVVASVLLFKRRAAPVWIGVGFGLGRG 63
          Q ++A  SRS+LNDKWDVVLSN++VK GLGFG GVV SVL FKRRA PVW+G+GFGLGRG
Sbjct: 8  QLQVAAPSRSILNDKWDVVLSNMLVKTGLGFGVGVVGSVLFFKRRAFPVWLGIGFGLGRG 67

Query: 64 YSEGDAIFRSSAGLRTVKA 82
          Y+EGDAIFRS+AGLR+VKA
Sbjct: 68 YAEGDAIFRSAAGLRSVKA 86

>KNAG0C00250 Chr3 complement(38677..38961) [285 bp, 94 aa] {ON}
          Anc_1.8 YCL057C-A
          Length = 94

 Score =  101 bits (251), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 68/74 (91%)

Query: 8  APVSRSLLNDKWDVVLSNLVVKVGLGFGAGVVASVLLFKRRAAPVWIGVGFGLGRGYSEG 67
            + RSLLNDKWDVVLSN++VKVG+GFG GVV SVLLF+RRA PVW+G+GFG+GRGYSEG
Sbjct: 20 TKIDRSLLNDKWDVVLSNMLVKVGMGFGVGVVTSVLLFRRRAFPVWLGIGFGVGRGYSEG 79

Query: 68 DAIFRSSAGLRTVK 81
          DAIFRS++G+RTVK
Sbjct: 80 DAIFRSTSGIRTVK 93

>NDAI0A00170 Chr1 complement(13975..14265) [291 bp, 96 aa] {ON}
          Anc_1.8 YCL057C-A
          Length = 96

 Score = 97.1 bits (240), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 67/78 (85%)

Query: 4  QAKIAPVSRSLLNDKWDVVLSNLVVKVGLGFGAGVVASVLLFKRRAAPVWIGVGFGLGRG 63
          Q ++A + +S+LNDKWD+VLSN +VKVGLGFG GVV SV+ FKRR  PVW+G+GFG GRG
Sbjct: 18 QQQLATIDKSILNDKWDIVLSNTLVKVGLGFGVGVVTSVIFFKRRTFPVWLGIGFGAGRG 77

Query: 64 YSEGDAIFRSSAGLRTVK 81
          Y+EGDAIFRSSAG+R+V 
Sbjct: 78 YAEGDAIFRSSAGIRSVN 95

>KAFR0D00170 Chr4 complement(18220..18492) [273 bp, 90 aa] {ON}
          Anc_1.8 YCL057C-A
          Length = 90

 Score = 94.0 bits (232), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 56/89 (62%), Positives = 71/89 (79%), Gaps = 8/89 (8%)

Query: 1  MSDQAKIAP--------VSRSLLNDKWDVVLSNLVVKVGLGFGAGVVASVLLFKRRAAPV 52
          MS++ K+          + RS+LNDKWD+VLSN++VKVGLGFG GVV SV+ FKRRA PV
Sbjct: 1  MSEEDKVGKPAEYSNNSIDRSILNDKWDLVLSNMLVKVGLGFGVGVVTSVIFFKRRAFPV 60

Query: 53 WIGVGFGLGRGYSEGDAIFRSSAGLRTVK 81
          W+G+G+G GR YSEGDAIFRS+AGLR+V+
Sbjct: 61 WLGIGYGFGRAYSEGDAIFRSNAGLRSVQ 89

>TDEL0C00150 Chr3 (14725..16305) [1581 bp, 526 aa] {ON} 
          Length = 526

 Score = 29.3 bits (64), Expect = 0.80,   Method: Composition-based stats.
 Identities = 14/30 (46%), Positives = 22/30 (73%), Gaps = 1/30 (3%)

Query: 26  LVVKVGLGFGAGVVASVL-LFKRRAAPVWI 54
           +V +V  GFG GV++S++ L++  AAP WI
Sbjct: 121 IVGRVVAGFGVGVLSSIVPLYQSEAAPKWI 150

>KLTH0G19404g Chr7 (1672150..1673691) [1542 bp, 513 aa] {ON} weakly
           similar to uniprot|Q12300 Saccharomyces cerevisiae
           YDL138W RGT2 Plasma membrane glucose receptor
          Length = 513

 Score = 26.6 bits (57), Expect = 8.0,   Method: Composition-based stats.
 Identities = 17/70 (24%), Positives = 34/70 (48%), Gaps = 20/70 (28%)

Query: 5   AKIAPVSRSLLNDKWDVVLSNLVVKVGL-------------------GFGAGVVASVL-L 44
           A +AP++   L  +  +++S L+  VG+                   G G GV+++++ L
Sbjct: 81  AMLAPLASDTLGRRLGLIISTLIFAVGVILQVAATGQDLLIVGRVVAGAGVGVLSAIVPL 140

Query: 45  FKRRAAPVWI 54
           ++  A+P WI
Sbjct: 141 YQSEASPKWI 150

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.322    0.139    0.409 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 7,169,669
Number of extensions: 224670
Number of successful extensions: 621
Number of sequences better than 10.0: 22
Number of HSP's gapped: 621
Number of HSP's successfully gapped: 22
Length of query: 82
Length of database: 53,481,399
Length adjustment: 54
Effective length of query: 28
Effective length of database: 47,289,435
Effective search space: 1324104180
Effective search space used: 1324104180
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 59 (27.3 bits)