Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_33.130111.6ON33433416690.0
KLTH0F00506g1.6ON33231514890.0
SAKL0C00484g1.6ON33931414590.0
CAGL0B00352g1.6ON33731414280.0
NDAI0A001501.6ON31731414150.0
NCAS0B091001.6ON32731414120.0
Kpol_2002.91.6ON33831414130.0
YCL059C (KRR1)1.6ON31631114080.0
Smik_3.151.6ON31631114070.0
Suva_3.1531.6ON31631114040.0
Skud_3.41.6ON31631113950.0
Ecym_10091.6ON33631113930.0
KNAG0C002301.6ON34931413830.0
TPHA0E040001.6ON31631413760.0
KLLA0C00506g1.6ON33031113760.0
TDEL0C069601.6ON35031413540.0
ZYRO0F18458g1.6ON31431113460.0
AFR744W1.6ON34331213420.0
TBLA0A049401.6ON31631412941e-180
KAFR0D001501.6ON34430912741e-177
SAKL0G03740g5.482ON266146940.002
ZYRO0D11440g5.482ON269146940.003
Kpol_543.135.482ON268146930.003
TDEL0A034605.482ON272146930.003
Suva_8.1975.482ON274148930.004
Kwal_47.188645.482ON271146930.004
Ecym_45525.482ON271146920.004
KLTH0G02574g5.482ON271146920.004
NCAS0A119605.482ON270146900.007
AAR002W1.420ON178171870.011
Skud_15.3105.482ON276148880.014
KLLA0C06446g5.482ON274146880.016
TPHA0J028205.482ON268146870.017
YOR145C (PNO1)5.482ON274148870.019
KAFR0E036005.482ON276146870.021
Smik_15.3265.482ON274148860.027
CAGL0K09460g5.482ON261146850.033
NDAI0A043105.482ON274146850.034
KNAG0C046105.482ON277146840.046
TBLA0D018905.482ON271146800.12
KAFR0B030308.309ON46756731.4
ZYRO0C02552g3.50ON54633721.8
AGL183C8.309ON50724721.8
TBLA0E020007.316ON301133712.2
Ecym_42428.309ON41624712.5
Kpol_1036.608.309ON49424693.6
KNAG0G023508.309ON49724693.8
KLTH0E14014g8.798ON48699694.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_33.13011
         (334 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_33.13011 s33 complement(39946..40950) [1005 bp, 334 aa] {ON...   647   0.0  
KLTH0F00506g Chr6 complement(40222..41220) [999 bp, 332 aa] {ON}...   578   0.0  
SAKL0C00484g Chr3 complement(45059..46078) [1020 bp, 339 aa] {ON...   566   0.0  
CAGL0B00352g Chr2 complement(22171..23184) [1014 bp, 337 aa] {ON...   554   0.0  
NDAI0A00150 Chr1 complement(12040..12993) [954 bp, 317 aa] {ON} ...   549   0.0  
NCAS0B09100 Chr2 (1745144..1746127) [984 bp, 327 aa] {ON} Anc_1....   548   0.0  
Kpol_2002.9 s2002 complement(17681..18697) [1017 bp, 338 aa] {ON...   548   0.0  
YCL059C Chr3 complement(22429..23379) [951 bp, 316 aa] {ON}  KRR...   546   0.0  
Smik_3.15 Chr3 complement(23880..24830) [951 bp, 316 aa] {ON} YC...   546   0.0  
Suva_3.153 Chr3 complement(232200..233150) [951 bp, 316 aa] {ON}...   545   0.0  
Skud_3.4 Chr3 complement(10422..11372) [951 bp, 316 aa] {ON} YCL...   541   0.0  
Ecym_1009 Chr1 complement(16963..17973) [1011 bp, 336 aa] {ON} s...   541   0.0  
KNAG0C00230 Chr3 complement(36795..37844) [1050 bp, 349 aa] {ON}...   537   0.0  
TPHA0E04000 Chr5 (838446..839396) [951 bp, 316 aa] {ON} Anc_1.6 ...   534   0.0  
KLLA0C00506g Chr3 complement(38584..39576) [993 bp, 330 aa] {ON}...   534   0.0  
TDEL0C06960 Chr3 (1262869..1263921) [1053 bp, 350 aa] {ON} Anc_1...   526   0.0  
ZYRO0F18458g Chr6 (1522841..1523785) [945 bp, 314 aa] {ON} highl...   523   0.0  
AFR744W Chr6 (1801815..1802846) [1032 bp, 343 aa] {ON} Syntenic ...   521   0.0  
TBLA0A04940 Chr1 complement(1218143..1219093) [951 bp, 316 aa] {...   503   e-180
KAFR0D00150 Chr4 complement(16573..17607) [1035 bp, 344 aa] {ON}...   495   e-177
SAKL0G03740g Chr7 complement(309922..310722) [801 bp, 266 aa] {O...    41   0.002
ZYRO0D11440g Chr4 complement(964606..965415) [810 bp, 269 aa] {O...    41   0.003
Kpol_543.13 s543 complement(30976..31782) [807 bp, 268 aa] {ON} ...    40   0.003
TDEL0A03460 Chr1 complement(617779..618597) [819 bp, 272 aa] {ON...    40   0.003
Suva_8.197 Chr8 complement(354586..355410) [825 bp, 274 aa] {ON}...    40   0.004
Kwal_47.18864 s47 (1004428..1005243) [816 bp, 271 aa] {ON} YOR14...    40   0.004
Ecym_4552 Chr4 (1087732..1088547) [816 bp, 271 aa] {ON} similar ...    40   0.004
KLTH0G02574g Chr7 complement(201390..202205) [816 bp, 271 aa] {O...    40   0.004
NCAS0A11960 Chr1 complement(2371549..2372361) [813 bp, 270 aa] {...    39   0.007
AAR002W Chr1 (341790..342326) [537 bp, 178 aa] {ON} Syntenic hom...    38   0.011
Skud_15.310 Chr15 complement(554002..554832) [831 bp, 276 aa] {O...    39   0.014
KLLA0C06446g Chr3 complement(566371..567195) [825 bp, 274 aa] {O...    39   0.016
TPHA0J02820 Chr10 complement(627383..628189) [807 bp, 268 aa] {O...    38   0.017
YOR145C Chr15 complement(605347..606171) [825 bp, 274 aa] {ON}  ...    38   0.019
KAFR0E03600 Chr5 (724338..725168) [831 bp, 276 aa] {ON} Anc_5.48...    38   0.021
Smik_15.326 Chr15 complement(561176..562000) [825 bp, 274 aa] {O...    38   0.027
CAGL0K09460g Chr11 complement(935326..936111) [786 bp, 261 aa] {...    37   0.033
NDAI0A04310 Chr1 (970952..971776) [825 bp, 274 aa] {ON} Anc_5.48...    37   0.034
KNAG0C04610 Chr3 (905301..906134) [834 bp, 277 aa] {ON} Anc_5.48...    37   0.046
TBLA0D01890 Chr4 (461527..462342) [816 bp, 271 aa] {ON} Anc_5.48...    35   0.12 
KAFR0B03030 Chr2 (632585..633988) [1404 bp, 467 aa] {ON} Anc_8.3...    33   1.4  
ZYRO0C02552g Chr3 (202013..203653) [1641 bp, 546 aa] {ON} simila...    32   1.8  
AGL183C Chr7 complement(352996..354519) [1524 bp, 507 aa] {ON} S...    32   1.8  
TBLA0E02000 Chr5 (487674..488579) [906 bp, 301 aa] {ON} Anc_7.31...    32   2.2  
Ecym_4242 Chr4 (504084..505334) [1251 bp, 416 aa] {ON} similar t...    32   2.5  
Kpol_1036.60 s1036 (169585..171069) [1485 bp, 494 aa] {ON} (1695...    31   3.6  
KNAG0G02350 Chr7 (542717..544210) [1494 bp, 497 aa] {ON} Anc_8.3...    31   3.8  
KLTH0E14014g Chr5 (1239444..1240904) [1461 bp, 486 aa] {ON} simi...    31   4.1  

>Kwal_33.13011 s33 complement(39946..40950) [1005 bp, 334 aa] {ON}
           YCL059C (KRR1) - involved in cell division and spore
           germination [contig 123] FULL
          Length = 334

 Score =  647 bits (1669), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/334 (95%), Positives = 318/334 (95%)

Query: 1   MPSTHNKDKPWDTPDIDKWKIEEFKPEDNTSGLPFSEESSFMTLFPKYREVYLKSVWKDV 60
           MPSTHNKDKPWDTPDIDKWKIEEFKPEDNTSGLPFSEESSFMTLFPKYREVYLKSVWKDV
Sbjct: 1   MPSTHNKDKPWDTPDIDKWKIEEFKPEDNTSGLPFSEESSFMTLFPKYREVYLKSVWKDV 60

Query: 61  TRALEKHSISCVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120
           TRALEKHSISCVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD
Sbjct: 61  TRALEKHSISCVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120

Query: 121 MACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLSKCYILVQGNTVSAMGPFKGL 180
           MACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLSKCYILVQGNTVSAMGPFKGL
Sbjct: 121 MACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLSKCYILVQGNTVSAMGPFKGL 180

Query: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKRPDLAEEDWSRFLPMFKKRNVARKKPKNI 240
           KEVRRVVEDCMKNVHPIYHIKELMIKRELAKRPDLAEEDWSRFLPMFKKRNVARKKPKNI
Sbjct: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKRPDLAEEDWSRFLPMFKKRNVARKKPKNI 240

Query: 241 KSKEAKVYTPFPPVQQPRKVDLQIESGEYFLSKKEKEAKKLDERKKEQAEKQIEKDKERA 300
           KSKEAKVYTPFPPVQQPRKVDLQIESGEYFLSKKEKEAKKLDERKKEQAEKQIEKDKERA
Sbjct: 241 KSKEAKVYTPFPPVQQPRKVDLQIESGEYFLSKKEKEAKKLDERKKEQAEKQIEKDKERA 300

Query: 301 KDYVAPSEKEYGSTAXXXXXXXXXXXXXXXXPRA 334
           KDYVAPSEKEYGSTA                PRA
Sbjct: 301 KDYVAPSEKEYGSTAKRRSSHTSSDSSIRKKPRA 334

>KLTH0F00506g Chr6 complement(40222..41220) [999 bp, 332 aa] {ON}
           highly similar to uniprot|P25586 Saccharomyces
           cerevisiae YCL059C KRR1 Essential nucleolar protein
           required for the synthesis of 18S rRNA and for the
           assembly of 40S ribosomal subunit
          Length = 332

 Score =  578 bits (1489), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/315 (91%), Positives = 304/315 (96%)

Query: 1   MPSTHNKDKPWDTPDIDKWKIEEFKPEDNTSGLPFSEESSFMTLFPKYREVYLKSVWKDV 60
           MPSTHNKDKPWDTPDIDKWKIEEFKPEDN SG+PF+EESSFMTLFPKYRE YLKSVW DV
Sbjct: 1   MPSTHNKDKPWDTPDIDKWKIEEFKPEDNVSGMPFAEESSFMTLFPKYREAYLKSVWNDV 60

Query: 61  TRALEKHSISCVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120
           TRAL+KH+I+CVLDLVEGSMTVKTTR+TYDPAIILKARDLIKLLARSVPFPQAVKILQDD
Sbjct: 61  TRALDKHNIACVLDLVEGSMTVKTTRRTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120

Query: 121 MACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLSKCYILVQGNTVSAMGPFKGL 180
            ACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELL+KCYILVQGNTVSAMGPFKGL
Sbjct: 121 TACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180

Query: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKRPDLAEEDWSRFLPMFKKRNVARKKPKNI 240
           KEVRRVVEDCM+N+HPIYHIKELMIKRELAKRPDLAEEDWSRFLPMFKKRNVARKKPKNI
Sbjct: 181 KEVRRVVEDCMRNIHPIYHIKELMIKRELAKRPDLAEEDWSRFLPMFKKRNVARKKPKNI 240

Query: 241 KSKEAKVYTPFPPVQQPRKVDLQIESGEYFLSKKEKEAKKLDERKKEQAEKQIEKDKERA 300
           K KE KVYTPFPP QQPRK+DLQIESGEYFL+KKEKEAKKL+ERK+EQAEKQ+EK+KERA
Sbjct: 241 KPKENKVYTPFPPAQQPRKIDLQIESGEYFLTKKEKEAKKLEERKREQAEKQVEKNKERA 300

Query: 301 KDYVAPSEKEYGSTA 315
           KDYVAP EK Y  ++
Sbjct: 301 KDYVAPIEKGYEGSS 315

>SAKL0C00484g Chr3 complement(45059..46078) [1020 bp, 339 aa] {ON}
           highly similar to uniprot|P25586 Saccharomyces
           cerevisiae YCL059C KRR1 Essential nucleolar protein
           required for the synthesis of 18S rRNA and for the
           assembly of 40S ribosomal subunit
          Length = 339

 Score =  566 bits (1459), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/314 (89%), Positives = 298/314 (94%)

Query: 1   MPSTHNKDKPWDTPDIDKWKIEEFKPEDNTSGLPFSEESSFMTLFPKYREVYLKSVWKDV 60
           MPSTHNKDKPWDTP+IDKWKIEEFKPEDN SGLPF+EESSFMTLFPKYRE YLKSVW DV
Sbjct: 1   MPSTHNKDKPWDTPEIDKWKIEEFKPEDNASGLPFAEESSFMTLFPKYREAYLKSVWNDV 60

Query: 61  TRALEKHSISCVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120
           TRAL+KH I+C LDLVEGSM+VKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKIL+DD
Sbjct: 61  TRALDKHHIACTLDLVEGSMSVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILEDD 120

Query: 121 MACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLSKCYILVQGNTVSAMGPFKGL 180
           +ACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELL+KCYILVQGNTVSAMGPFKGL
Sbjct: 121 VACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180

Query: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKRPDLAEEDWSRFLPMFKKRNVARKKPKNI 240
           KEVRRVVEDCMKNVHPIYHIKELMIKRELAKRP+LAEEDWSRFLPMFKKRNVARKKPK  
Sbjct: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKRPELAEEDWSRFLPMFKKRNVARKKPKKA 240

Query: 241 KSKEAKVYTPFPPVQQPRKVDLQIESGEYFLSKKEKEAKKLDERKKEQAEKQIEKDKERA 300
           K+KE KVYTPFPP Q PRKVDL+IESGEYFLSKKEKE KKL ER++EQAEKQ +K++ERA
Sbjct: 241 KAKEKKVYTPFPPAQLPRKVDLEIESGEYFLSKKEKEVKKLQERRQEQAEKQAQKEEERA 300

Query: 301 KDYVAPSEKEYGST 314
           KDYVAP E EY ST
Sbjct: 301 KDYVAPEEAEYKST 314

>CAGL0B00352g Chr2 complement(22171..23184) [1014 bp, 337 aa] {ON}
           highly similar to uniprot|P25586 Saccharomyces
           cerevisiae YCL059c KRR1
          Length = 337

 Score =  554 bits (1428), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 268/314 (85%), Positives = 289/314 (92%), Gaps = 1/314 (0%)

Query: 1   MPSTHNKDKPWDTPDIDKWKIEEFKPEDNTSGLPFSEESSFMTLFPKYREVYLKSVWKDV 60
           M ST+NKDKPWDT DIDKWKIEEFKPEDN SG PF+EESSFMTLFPKYRE YLKS+W DV
Sbjct: 1   MVSTYNKDKPWDTEDIDKWKIEEFKPEDNKSGQPFAEESSFMTLFPKYREAYLKSIWNDV 60

Query: 61  TRALEKHSISCVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120
           TRAL+KH I C LDLVEGSMTVKTTRKT+DPAIILKARDLIKLLARSVPFPQAVKILQDD
Sbjct: 61  TRALDKHHIGCTLDLVEGSMTVKTTRKTFDPAIILKARDLIKLLARSVPFPQAVKILQDD 120

Query: 121 MACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLSKCYILVQGNTVSAMGPFKGL 180
           +ACDVIKIGN V+NK+RFVKRRQRLVGPNGNTLKALELL+KCYILVQGNTVSAMGP+KGL
Sbjct: 121 IACDVIKIGNTVANKDRFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPYKGL 180

Query: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKRPDLAEEDWSRFLPMFKKRNVARKKPKNI 240
           KE+RRVV DCMKNVHPIYHIKELMIKRELAKRP+LA EDWSRFLPMFKKRNVARKKP  +
Sbjct: 181 KEIRRVVLDCMKNVHPIYHIKELMIKRELAKRPELANEDWSRFLPMFKKRNVARKKPSKV 240

Query: 241 KSKEAKVYTPFPPVQQPRKVDLQIESGEYFLSKKEKEAKKLDERKKEQAEKQIEKDKERA 300
           K+ E KVYTPFPP Q PRKVDLQIESGEYFLSKKEKE KKL E++++QAEKQI KD+ER 
Sbjct: 241 KA-EKKVYTPFPPAQLPRKVDLQIESGEYFLSKKEKEIKKLHEQREKQAEKQILKDEERR 299

Query: 301 KDYVAPSEKEYGST 314
           KDY+AP E EY S+
Sbjct: 300 KDYIAPKEDEYKSS 313

>NDAI0A00150 Chr1 complement(12040..12993) [954 bp, 317 aa] {ON}
           Anc_1.6 YCL059C
          Length = 317

 Score =  549 bits (1415), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 267/314 (85%), Positives = 290/314 (92%), Gaps = 1/314 (0%)

Query: 1   MPSTHNKDKPWDTPDIDKWKIEEFKPEDNTSGLPFSEESSFMTLFPKYREVYLKSVWKDV 60
           M STHN+DKPWDT +I+KWKIEEFKPEDN SGLPF+EESSFMTLFPKYRE YLKSVW DV
Sbjct: 1   MVSTHNRDKPWDTEEINKWKIEEFKPEDNASGLPFAEESSFMTLFPKYRETYLKSVWNDV 60

Query: 61  TRALEKHSISCVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120
           TRAL  H+++CVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKIL+DD
Sbjct: 61  TRALNTHNLACVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILEDD 120

Query: 121 MACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLSKCYILVQGNTVSAMGPFKGL 180
           MACDVIKIGNFV+NKERFVKRRQRLVGPNGNTLKALELL+KCYILVQGNTVS MGPFKGL
Sbjct: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPFKGL 180

Query: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKRPDLAEEDWSRFLPMFKKRNVARKKPKNI 240
           KEVRRVVEDCMKN+HPIYHIKELMIKRELAK+P+LA EDWSRFLPMFKKRNVARKK    
Sbjct: 181 KEVRRVVEDCMKNIHPIYHIKELMIKRELAKKPELANEDWSRFLPMFKKRNVARKK-PKK 239

Query: 241 KSKEAKVYTPFPPVQQPRKVDLQIESGEYFLSKKEKEAKKLDERKKEQAEKQIEKDKERA 300
             KE K+YTPFPP Q PRKVDL+IESGEYFLSK+EKE KKL+ER+++QAEKQ+EK+ ER 
Sbjct: 240 VKKEKKIYTPFPPAQLPRKVDLEIESGEYFLSKREKEMKKLNERREQQAEKQVEKETERN 299

Query: 301 KDYVAPSEKEYGST 314
           KDYVAPSE  Y S+
Sbjct: 300 KDYVAPSEPTYKSS 313

>NCAS0B09100 Chr2 (1745144..1746127) [984 bp, 327 aa] {ON} Anc_1.6
           YCL059C
          Length = 327

 Score =  548 bits (1412), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 266/314 (84%), Positives = 288/314 (91%), Gaps = 1/314 (0%)

Query: 1   MPSTHNKDKPWDTPDIDKWKIEEFKPEDNTSGLPFSEESSFMTLFPKYREVYLKSVWKDV 60
           M STHN+DKPWDTPD+DKW IEEFKPEDN SGLPF+EESSFMTLFPKYRE YLKSVW DV
Sbjct: 1   MVSTHNRDKPWDTPDVDKWHIEEFKPEDNASGLPFAEESSFMTLFPKYRETYLKSVWNDV 60

Query: 61  TRALEKHSISCVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120
           TRAL KH++ CVLDLVEGSMTVKTTRKT+DPAIILKARDLIKLLARSVPFPQAVKILQDD
Sbjct: 61  TRALNKHNLGCVLDLVEGSMTVKTTRKTFDPAIILKARDLIKLLARSVPFPQAVKILQDD 120

Query: 121 MACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLSKCYILVQGNTVSAMGPFKGL 180
           MACDVIKIGNFV+NKERFVKRRQRLVGPNGNTLKALELL+KCYILVQGNTVS MGPF+GL
Sbjct: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPFQGL 180

Query: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKRPDLAEEDWSRFLPMFKKRNVARKKPKNI 240
           KEVRRVVEDCMKNVHPIYHIKELMIKRELAK+P+LA EDWSRFLPMFKKRNVARKK    
Sbjct: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKKPELANEDWSRFLPMFKKRNVARKK-PKK 239

Query: 241 KSKEAKVYTPFPPVQQPRKVDLQIESGEYFLSKKEKEAKKLDERKKEQAEKQIEKDKERA 300
             KE K+YTPFPP Q PRKVDL+IESGEYFLSK+EKE KKL ER+++QAEKQ EK+ ER 
Sbjct: 240 VRKEKKIYTPFPPAQLPRKVDLEIESGEYFLSKREKEMKKLHERREQQAEKQAEKEVERN 299

Query: 301 KDYVAPSEKEYGST 314
           K+Y+AP E+ Y S+
Sbjct: 300 KNYIAPEEETYKSS 313

>Kpol_2002.9 s2002 complement(17681..18697) [1017 bp, 338 aa] {ON}
           complement(17681..18697) [1017 nt, 339 aa]
          Length = 338

 Score =  548 bits (1413), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 269/314 (85%), Positives = 292/314 (92%), Gaps = 1/314 (0%)

Query: 1   MPSTHNKDKPWDTPDIDKWKIEEFKPEDNTSGLPFSEESSFMTLFPKYREVYLKSVWKDV 60
           M STHNKDKPWDT DIDKWK+EEFKPEDN SGLPF+EESSFMTLFPKYRE+YLKSVW DV
Sbjct: 1   MVSTHNKDKPWDTEDIDKWKVEEFKPEDNASGLPFAEESSFMTLFPKYREIYLKSVWNDV 60

Query: 61  TRALEKHSISCVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120
           T+AL+K  I+C LDLVEGSMTVKTTRKT+DP  ILKARDLIKLLARSVPFPQA+KIL+DD
Sbjct: 61  TKALDKRHIACTLDLVEGSMTVKTTRKTFDPYAILKARDLIKLLARSVPFPQAIKILEDD 120

Query: 121 MACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLSKCYILVQGNTVSAMGPFKGL 180
           MACDVIKIGNFV+NKERFVKRRQRLVGPNGNTLKALELL+KCYILVQGNTVS MGPFKGL
Sbjct: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSCMGPFKGL 180

Query: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKRPDLAEEDWSRFLPMFKKRNVARKKPKNI 240
           KE+RRVVEDCMKNVHPIYHIKELMIKRELAKRP+LA+EDWSRFLPMFKKRNVARKK    
Sbjct: 181 KEIRRVVEDCMKNVHPIYHIKELMIKRELAKRPELADEDWSRFLPMFKKRNVARKK-AAK 239

Query: 241 KSKEAKVYTPFPPVQQPRKVDLQIESGEYFLSKKEKEAKKLDERKKEQAEKQIEKDKERA 300
             KE KVYTPFPP QQPRKVDL+IESGEYFLSKKEKE K+L ER++EQ++KQIEK+KER+
Sbjct: 240 PKKEKKVYTPFPPAQQPRKVDLEIESGEYFLSKKEKEVKRLQERREEQSQKQIEKEKERS 299

Query: 301 KDYVAPSEKEYGST 314
           KDYVAP E+EY ST
Sbjct: 300 KDYVAPMEEEYKST 313

>YCL059C Chr3 complement(22429..23379) [951 bp, 316 aa] {ON}
           KRR1Essential nucleolar protein required for the
           synthesis of 18S rRNA and for the assembly of 40S
           ribosomal subunit
          Length = 316

 Score =  546 bits (1408), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 266/311 (85%), Positives = 293/311 (94%)

Query: 1   MPSTHNKDKPWDTPDIDKWKIEEFKPEDNTSGLPFSEESSFMTLFPKYREVYLKSVWKDV 60
           M STHN+DKPWDT DIDKWKIEEFK EDN SG PF+EESSFMTLFPKYRE YLK++W DV
Sbjct: 1   MVSTHNRDKPWDTDDIDKWKIEEFKEEDNASGQPFAEESSFMTLFPKYRESYLKTIWNDV 60

Query: 61  TRALEKHSISCVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120
           TRAL+KH+I+CVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD
Sbjct: 61  TRALDKHNIACVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120

Query: 121 MACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLSKCYILVQGNTVSAMGPFKGL 180
           MACDVIKIGNFV+NKERFVKRRQRLVGPNGNTLKALELL+KCYILVQGNTVSAMGPFKGL
Sbjct: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180

Query: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKRPDLAEEDWSRFLPMFKKRNVARKKPKNI 240
           KEVRRVVEDCMKN+HPIYHIKELMIKRELAKRP+LA EDWSRFLPMFKKRNVARKKPK I
Sbjct: 181 KEVRRVVEDCMKNIHPIYHIKELMIKRELAKRPELANEDWSRFLPMFKKRNVARKKPKKI 240

Query: 241 KSKEAKVYTPFPPVQQPRKVDLQIESGEYFLSKKEKEAKKLDERKKEQAEKQIEKDKERA 300
           ++ E KVYTPFPP Q PRKVDL+IESGEYFLSK+EK+ KKL+E+K++Q E++IE+ +ERA
Sbjct: 241 RNVEKKVYTPFPPAQLPRKVDLEIESGEYFLSKREKQMKKLNEQKEKQMEREIERQEERA 300

Query: 301 KDYVAPSEKEY 311
           KD++AP E+ Y
Sbjct: 301 KDFIAPEEEAY 311

>Smik_3.15 Chr3 complement(23880..24830) [951 bp, 316 aa] {ON}
           YCL059C (REAL)
          Length = 316

 Score =  546 bits (1407), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 267/311 (85%), Positives = 292/311 (93%)

Query: 1   MPSTHNKDKPWDTPDIDKWKIEEFKPEDNTSGLPFSEESSFMTLFPKYREVYLKSVWKDV 60
           M STHN+DKPWDT DIDKWKIEEFK EDN SG PF+EESSFMTLFPKYRE YLK++W DV
Sbjct: 1   MVSTHNRDKPWDTDDIDKWKIEEFKEEDNASGQPFAEESSFMTLFPKYRESYLKTIWNDV 60

Query: 61  TRALEKHSISCVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120
           TRAL+KH+I+CVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD
Sbjct: 61  TRALDKHNIACVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120

Query: 121 MACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLSKCYILVQGNTVSAMGPFKGL 180
           MACDVIKIGNFV+NKERFVKRRQRLVGPNGNTLKALELL+KCYILVQGNTVSAMGPFKGL
Sbjct: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180

Query: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKRPDLAEEDWSRFLPMFKKRNVARKKPKNI 240
           KEVRRVVEDCMKNVHPIYHIKELMIKRELAKRP+LA EDWSRFLPMFKKRNVARKKPK I
Sbjct: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKRPELANEDWSRFLPMFKKRNVARKKPKKI 240

Query: 241 KSKEAKVYTPFPPVQQPRKVDLQIESGEYFLSKKEKEAKKLDERKKEQAEKQIEKDKERA 300
           ++ E KVYTPFPP Q PRKVDL+IESGEYFLSK+EK+ KKL E+K++Q E++IE+ +ERA
Sbjct: 241 RNIEKKVYTPFPPAQLPRKVDLEIESGEYFLSKREKQMKKLSEQKEKQMEREIERQEERA 300

Query: 301 KDYVAPSEKEY 311
           KD++AP E+ Y
Sbjct: 301 KDFIAPEEETY 311

>Suva_3.153 Chr3 complement(232200..233150) [951 bp, 316 aa] {ON}
           YCL059C (REAL)
          Length = 316

 Score =  545 bits (1404), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 265/311 (85%), Positives = 292/311 (93%)

Query: 1   MPSTHNKDKPWDTPDIDKWKIEEFKPEDNTSGLPFSEESSFMTLFPKYREVYLKSVWKDV 60
           M STHN+DKPWDT D+DKW IEEFK EDN SG PF+EESSFMTLFPKYRE YLK++W DV
Sbjct: 1   MVSTHNRDKPWDTDDVDKWTIEEFKEEDNASGQPFAEESSFMTLFPKYRENYLKTIWNDV 60

Query: 61  TRALEKHSISCVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120
           TRAL+KH+ISCVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD
Sbjct: 61  TRALDKHNISCVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120

Query: 121 MACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLSKCYILVQGNTVSAMGPFKGL 180
           MACDVIKIGNFV+NKERFVKRRQRLVGPNGNTLKALELL+KCYILVQGNTVSAMGPFKGL
Sbjct: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180

Query: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKRPDLAEEDWSRFLPMFKKRNVARKKPKNI 240
           KEVRRVVEDCMKNVHPIYHIKELMIKRELAKRP+LA EDWSRFLPMFKKRNVARKKPK I
Sbjct: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKRPELANEDWSRFLPMFKKRNVARKKPKKI 240

Query: 241 KSKEAKVYTPFPPVQQPRKVDLQIESGEYFLSKKEKEAKKLDERKKEQAEKQIEKDKERA 300
           ++ E KVYTPFPP Q PRKVDL+IESGEYFLSK+EK+ KKL+E+K++Q E+++E+ +ERA
Sbjct: 241 RNIEKKVYTPFPPAQLPRKVDLEIESGEYFLSKREKQMKKLNEQKEKQMEREVERQEERA 300

Query: 301 KDYVAPSEKEY 311
           K++VAP E+ Y
Sbjct: 301 KNFVAPQEEAY 311

>Skud_3.4 Chr3 complement(10422..11372) [951 bp, 316 aa] {ON}
           YCL059C (REAL)
          Length = 316

 Score =  541 bits (1395), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 263/311 (84%), Positives = 292/311 (93%)

Query: 1   MPSTHNKDKPWDTPDIDKWKIEEFKPEDNTSGLPFSEESSFMTLFPKYREVYLKSVWKDV 60
           M STHN++KPWDT DIDKWKIEEFK EDN SG PF+EESSFMTLFPKYRE YLK++W DV
Sbjct: 1   MVSTHNREKPWDTDDIDKWKIEEFKEEDNGSGQPFAEESSFMTLFPKYREGYLKTIWNDV 60

Query: 61  TRALEKHSISCVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120
           TRAL+KH+I+CVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD
Sbjct: 61  TRALDKHNIACVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120

Query: 121 MACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLSKCYILVQGNTVSAMGPFKGL 180
           MACDVIKIGNFV+NKERFVKRRQRLVGPNGNTLKALELL+KCYILVQGNTVSAMGPFKGL
Sbjct: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180

Query: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKRPDLAEEDWSRFLPMFKKRNVARKKPKNI 240
           KEVRRVVEDCMKN+HPIYHIKELMIKRELAKRP+LA EDWSRFLPMFKKRNVARKKPK I
Sbjct: 181 KEVRRVVEDCMKNIHPIYHIKELMIKRELAKRPELANEDWSRFLPMFKKRNVARKKPKKI 240

Query: 241 KSKEAKVYTPFPPVQQPRKVDLQIESGEYFLSKKEKEAKKLDERKKEQAEKQIEKDKERA 300
           ++ E KVYTPFPP Q PRKVDL+IESGEYFLSK++K+ KKL+E+K++Q E+++E+ +ERA
Sbjct: 241 RNVEKKVYTPFPPAQLPRKVDLEIESGEYFLSKRDKQVKKLNEQKEKQMERELERQEERA 300

Query: 301 KDYVAPSEKEY 311
           KD+ AP E+ Y
Sbjct: 301 KDFTAPEEESY 311

>Ecym_1009 Chr1 complement(16963..17973) [1011 bp, 336 aa] {ON}
           similar to Ashbya gossypii AFR744W
          Length = 336

 Score =  541 bits (1393), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 264/311 (84%), Positives = 287/311 (92%), Gaps = 2/311 (0%)

Query: 1   MPSTHNKDKPWDTPDIDKWKIEEFKPEDNTSGLPFSEESSFMTLFPKYREVYLKSVWKDV 60
           M STHNKDKPWDTPDIDKWKIEEFKPEDN SGLPF+EESSFMTLFPKYRE YLKS W DV
Sbjct: 1   MVSTHNKDKPWDTPDIDKWKIEEFKPEDNASGLPFAEESSFMTLFPKYREAYLKSTWNDV 60

Query: 61  TRALEKHSISCVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120
           TRAL+KH ++C L+LVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKIL+DD
Sbjct: 61  TRALDKHHLACELNLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILEDD 120

Query: 121 MACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLSKCYILVQGNTVSAMGPFKGL 180
           +ACDVIKIGNF SNK+RFVKRRQRLVGPNGNTLKALELL+KCYILVQGNTVSAMGP+KGL
Sbjct: 121 VACDVIKIGNFSSNKDRFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPYKGL 180

Query: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKRPDLAEEDWSRFLPMFKKRNVARKKPKNI 240
           KEVRRVVEDCMKNVHPIYHIKELMIKRELAK+P+LA++DWSRFLPMFKKRN+ARK  K  
Sbjct: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKKPELADQDWSRFLPMFKKRNIARK--KPK 238

Query: 241 KSKEAKVYTPFPPVQQPRKVDLQIESGEYFLSKKEKEAKKLDERKKEQAEKQIEKDKERA 300
           K KE KVYTPFPP Q PRKVDL+IE+GEYFLSK EK+ KKL+E +  Q EKQ+EK KERA
Sbjct: 239 KIKEKKVYTPFPPAQLPRKVDLEIETGEYFLSKNEKKMKKLEEHRNRQTEKQLEKAKERA 298

Query: 301 KDYVAPSEKEY 311
           +DY+AP EKEY
Sbjct: 299 EDYIAPDEKEY 309

>KNAG0C00230 Chr3 complement(36795..37844) [1050 bp, 349 aa] {ON}
           Anc_1.6 YCL059C
          Length = 349

 Score =  537 bits (1383), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 265/314 (84%), Positives = 284/314 (90%), Gaps = 1/314 (0%)

Query: 1   MPSTHNKDKPWDTPDIDKWKIEEFKPEDNTSGLPFSEESSFMTLFPKYREVYLKSVWKDV 60
           M STHNKDKPWDT DIDKW IEEFKPEDN SG PF+EESSFMTLFPKYRE YLKSVWKDV
Sbjct: 1   MVSTHNKDKPWDTDDIDKWHIEEFKPEDNASGQPFAEESSFMTLFPKYRETYLKSVWKDV 60

Query: 61  TRALEKHSISCVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120
           T+AL+ H I+C LDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQ+D
Sbjct: 61  TKALDSHHIACTLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQED 120

Query: 121 MACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLSKCYILVQGNTVSAMGPFKGL 180
            ACDVIKIGN V+NKERFVKRRQRLVGP+GNTLKALELL+KCYILVQGNTVSAMGP+KGL
Sbjct: 121 TACDVIKIGNIVTNKERFVKRRQRLVGPDGNTLKALELLTKCYILVQGNTVSAMGPYKGL 180

Query: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKRPDLAEEDWSRFLPMFKKRNVARKKPKNI 240
           KE+RRVVEDCM NVHPIYHIKELMIKRELAK+P+LA EDWSRFLPMFKKRNVARKK    
Sbjct: 181 KELRRVVEDCMHNVHPIYHIKELMIKRELAKKPELANEDWSRFLPMFKKRNVARKK-PKK 239

Query: 241 KSKEAKVYTPFPPVQQPRKVDLQIESGEYFLSKKEKEAKKLDERKKEQAEKQIEKDKERA 300
             KE KVYTPFPP Q PRKVDL+IESGEYFL+KKEK+ KKL+ERK+ QAEKQ  KD+ER 
Sbjct: 240 IKKEKKVYTPFPPAQLPRKVDLEIESGEYFLNKKEKQFKKLEERKEIQAEKQRVKDEERR 299

Query: 301 KDYVAPSEKEYGST 314
           KDY AP EK YG+T
Sbjct: 300 KDYTAPKEKAYGTT 313

>TPHA0E04000 Chr5 (838446..839396) [951 bp, 316 aa] {ON} Anc_1.6
           YCL059C
          Length = 316

 Score =  534 bits (1376), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 260/314 (82%), Positives = 287/314 (91%), Gaps = 1/314 (0%)

Query: 1   MPSTHNKDKPWDTPDIDKWKIEEFKPEDNTSGLPFSEESSFMTLFPKYREVYLKSVWKDV 60
           M STHNK+KPWDT DIDKWK+E+FKPEDN SG+PFSEESSFMTLFPKYREVYLKSVWKDV
Sbjct: 1   MVSTHNKEKPWDTEDIDKWKLEDFKPEDNASGMPFSEESSFMTLFPKYREVYLKSVWKDV 60

Query: 61  TRALEKHSISCVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120
           T+AL+KH ++C L+LV+GSMTV TTRKTYDP IILKARDLIKLLARSVPFPQAVKIL DD
Sbjct: 61  TKALDKHHVACTLNLVDGSMTVSTTRKTYDPYIILKARDLIKLLARSVPFPQAVKILDDD 120

Query: 121 MACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLSKCYILVQGNTVSAMGPFKGL 180
           MACDVIKIGNFV+NKERFVKRRQRLVGPNGNTLKALELL+KCYILVQGNTVS MGPFKGL
Sbjct: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPFKGL 180

Query: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKRPDLAEEDWSRFLPMFKKRNVARKKPKNI 240
           KE+RRVVED M+NVHPIYHIKELMIKRELAK+P+LA EDWSRFLPMFKKRNVARKK    
Sbjct: 181 KEIRRVVEDAMRNVHPIYHIKELMIKRELAKKPELANEDWSRFLPMFKKRNVARKK-SKK 239

Query: 241 KSKEAKVYTPFPPVQQPRKVDLQIESGEYFLSKKEKEAKKLDERKKEQAEKQIEKDKERA 300
             +E KVYTPFPP Q PRKVDL+IESGEYFLSKKEKE K+L ER+ +QAEKQ EKD ER+
Sbjct: 240 PKREKKVYTPFPPSQLPRKVDLEIESGEYFLSKKEKEVKRLHERRDQQAEKQAEKDIERS 299

Query: 301 KDYVAPSEKEYGST 314
           K+Y+AP E++Y S+
Sbjct: 300 KNYIAPKEEKYVSS 313

>KLLA0C00506g Chr3 complement(38584..39576) [993 bp, 330 aa] {ON}
           highly similar to uniprot|P25586 Saccharomyces
           cerevisiae YCL059C KRR1 Essential nucleolar protein
           required for the synthesis of 18S rRNA and for the
           assembly of 40S ribosomal subunit
          Length = 330

 Score =  534 bits (1376), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 262/311 (84%), Positives = 286/311 (91%), Gaps = 2/311 (0%)

Query: 1   MPSTHNKDKPWDTPDIDKWKIEEFKPEDNTSGLPFSEESSFMTLFPKYREVYLKSVWKDV 60
           M STHNKDKPWDT ++DKW IEEFKPEDN SGLPF+EESSFMTLFPKYRE YLKSVWKDV
Sbjct: 1   MVSTHNKDKPWDTDEVDKWNIEEFKPEDNKSGLPFAEESSFMTLFPKYREAYLKSVWKDV 60

Query: 61  TRALEKHSISCVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120
           TR+L+ H I+C L+LVEGSMTVKTTRKTYDPA+ILKARDLIKLLARSVPFPQAVKIL+DD
Sbjct: 61  TRSLDAHHIACELNLVEGSMTVKTTRKTYDPAVILKARDLIKLLARSVPFPQAVKILEDD 120

Query: 121 MACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLSKCYILVQGNTVSAMGPFKGL 180
           +ACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELL+KCYILVQGNTVS MGP+KGL
Sbjct: 121 VACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPYKGL 180

Query: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKRPDLAEEDWSRFLPMFKKRNVARKKPKNI 240
           KEVRRVVEDCMKNVHPIYHIKELMIKRELAK+P+LAEEDWSRFLPMFKKRNVARK  K  
Sbjct: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKKPELAEEDWSRFLPMFKKRNVARK--KPK 238

Query: 241 KSKEAKVYTPFPPVQQPRKVDLQIESGEYFLSKKEKEAKKLDERKKEQAEKQIEKDKERA 300
           K KE K+YTPFPP Q PRKVDL+IESGEYFLSK+EKE KKL ER+++QA K  EK+ ERA
Sbjct: 239 KIKEKKIYTPFPPAQLPRKVDLEIESGEYFLSKREKEVKKLHERREQQAAKHAEKESERA 298

Query: 301 KDYVAPSEKEY 311
           KD++AP E +Y
Sbjct: 299 KDFIAPKETDY 309

>TDEL0C06960 Chr3 (1262869..1263921) [1053 bp, 350 aa] {ON} Anc_1.6
           YCL059C
          Length = 350

 Score =  526 bits (1354), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 259/314 (82%), Positives = 288/314 (91%), Gaps = 1/314 (0%)

Query: 1   MPSTHNKDKPWDTPDIDKWKIEEFKPEDNTSGLPFSEESSFMTLFPKYREVYLKSVWKDV 60
           M STHN+DKPWDT DIDKW++EEFKPEDN SGLPF+EESSFMTLFPKYRE YLKS+W DV
Sbjct: 1   MVSTHNRDKPWDTEDIDKWQVEEFKPEDNASGLPFAEESSFMTLFPKYREPYLKSIWNDV 60

Query: 61  TRALEKHSISCVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120
           TRAL  H I+CVLDL+EGSMTVKTTRKT+DPAIIL+ARDLIKLLARSVPF QAVKIL++D
Sbjct: 61  TRALNAHHIACVLDLMEGSMTVKTTRKTFDPAIILRARDLIKLLARSVPFAQAVKILEED 120

Query: 121 MACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLSKCYILVQGNTVSAMGPFKGL 180
           +ACDVIKIGN V+NKERFVKRRQRLVGPNGNTLKALELL+KCYILVQGNTVS MGP+KGL
Sbjct: 121 VACDVIKIGNVVANKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPYKGL 180

Query: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKRPDLAEEDWSRFLPMFKKRNVARKKPKNI 240
           KEVRRVVED M+NVHPIY IKELMIKRELAKRP+LAEEDWSRFLPMFKKRNVARKKPK I
Sbjct: 181 KEVRRVVEDTMRNVHPIYQIKELMIKRELAKRPELAEEDWSRFLPMFKKRNVARKKPKKI 240

Query: 241 KSKEAKVYTPFPPVQQPRKVDLQIESGEYFLSKKEKEAKKLDERKKEQAEKQIEKDKERA 300
           ++ E KVYTPFPP QQPRK+DL+IESGEYFLSKKEKE  KL ER+++QAEKQ EK++ R+
Sbjct: 241 RA-EKKVYTPFPPAQQPRKIDLEIESGEYFLSKKEKEINKLKERREKQAEKQEEKEEARS 299

Query: 301 KDYVAPSEKEYGST 314
           KDY+AP E  Y S+
Sbjct: 300 KDYIAPKEDVYKSS 313

>ZYRO0F18458g Chr6 (1522841..1523785) [945 bp, 314 aa] {ON} highly
           similar to uniprot|P25586 Saccharomyces cerevisiae
           YCL059C KRR1 Essential nucleolar protein required for
           the synthesis of 18S rRNA and for the assembly of 40S
           ribosomal subunit
          Length = 314

 Score =  523 bits (1346), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 253/311 (81%), Positives = 282/311 (90%), Gaps = 1/311 (0%)

Query: 1   MPSTHNKDKPWDTPDIDKWKIEEFKPEDNTSGLPFSEESSFMTLFPKYREVYLKSVWKDV 60
           M STHNKDKPWDT +IDKW  +EFK EDN SGLPF+EESSFMTLFPKYRE YLKS+W DV
Sbjct: 1   MVSTHNKDKPWDTGEIDKWHQDEFKEEDNASGLPFAEESSFMTLFPKYREAYLKSIWNDV 60

Query: 61  TRALEKHSISCVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120
           T+AL K+ ++CVLDLVEGSMTVKTTRKT DPAIILKARDLIKLLARSVPFPQAVKIL+D+
Sbjct: 61  TKALNKYHVACVLDLVEGSMTVKTTRKTCDPAIILKARDLIKLLARSVPFPQAVKILEDN 120

Query: 121 MACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLSKCYILVQGNTVSAMGPFKGL 180
            ACDVIKIGN V+NKERF KRRQRLVGPNGNTLKALELL+KCYILVQGNTV+AMG +KGL
Sbjct: 121 TACDVIKIGNTVANKERFQKRRQRLVGPNGNTLKALELLTKCYILVQGNTVAAMGNYKGL 180

Query: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKRPDLAEEDWSRFLPMFKKRNVARKKPKNI 240
           KEVRRVVED MKN+HPIYHIKELMIKRELAKRP+LA EDWSRFLP FKKRNVARKKP  I
Sbjct: 181 KEVRRVVEDTMKNIHPIYHIKELMIKRELAKRPELANEDWSRFLPNFKKRNVARKKPMKI 240

Query: 241 KSKEAKVYTPFPPVQQPRKVDLQIESGEYFLSKKEKEAKKLDERKKEQAEKQIEKDKERA 300
           + KE KVYTPFPP Q PRKVDL+IESGEYFL+K+EKEAKKL+ER+++QAEKQ E+ KER 
Sbjct: 241 R-KEKKVYTPFPPAQTPRKVDLEIESGEYFLNKREKEAKKLEERREKQAEKQEERQKERR 299

Query: 301 KDYVAPSEKEY 311
           KD++ P E++Y
Sbjct: 300 KDFLPPKEEDY 310

>AFR744W Chr6 (1801815..1802846) [1032 bp, 343 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YCL059C (KRR1)
          Length = 343

 Score =  521 bits (1342), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 264/312 (84%), Positives = 289/312 (92%), Gaps = 2/312 (0%)

Query: 1   MPSTHNKDKPWDTPDIDKWKIEEFKPEDNTSGLPFSEESSFMTLFPKYREVYLKSVWKDV 60
           M ST NKDKPWDTPD+DKW IEEF PED+ SGLPF+EESSFMTLFPKYRE YLKS+WK+V
Sbjct: 1   MVSTPNKDKPWDTPDVDKWAIEEFNPEDSASGLPFAEESSFMTLFPKYRETYLKSIWKEV 60

Query: 61  TRALEKHSISCVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120
           TRALEKH I+C L+LVEGSM+VKTTRKTYDPAIILKARDLIKLLARSVP PQA+KILQDD
Sbjct: 61  TRALEKHHIACELNLVEGSMSVKTTRKTYDPAIILKARDLIKLLARSVPLPQAIKILQDD 120

Query: 121 MACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLSKCYILVQGNTVSAMGPFKGL 180
           +ACDVIKIGN V++KERFVKRRQRLVGPNGNTLKALELL+KCYILVQGNTVSAMGP+KGL
Sbjct: 121 IACDVIKIGNIVASKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPYKGL 180

Query: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKRPDLAEEDWSRFLPMFKKRNVARKKPKNI 240
           KEVRRVVEDCM+N+HPIYHIKELMIKRELAKRP+LAEEDWSRFLPMFKKRNVARK  K  
Sbjct: 181 KEVRRVVEDCMRNIHPIYHIKELMIKRELAKRPELAEEDWSRFLPMFKKRNVARK--KPK 238

Query: 241 KSKEAKVYTPFPPVQQPRKVDLQIESGEYFLSKKEKEAKKLDERKKEQAEKQIEKDKERA 300
           K KE KVYTPFPP Q PRKVDL+IE+GEYFLSKKEKEAKKL+ R+ +QAEKQ EK+KERA
Sbjct: 239 KIKEKKVYTPFPPAQLPRKVDLEIETGEYFLSKKEKEAKKLEARRAQQAEKQSEKEKERA 298

Query: 301 KDYVAPSEKEYG 312
           KDY+AP+E EY 
Sbjct: 299 KDYIAPAEPEYS 310

>TBLA0A04940 Chr1 complement(1218143..1219093) [951 bp, 316 aa] {ON}
           Anc_1.6 YCL059C
          Length = 316

 Score =  503 bits (1294), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 261/314 (83%), Positives = 291/314 (92%), Gaps = 1/314 (0%)

Query: 1   MPSTHNKDKPWDTPDIDKWKIEEFKPEDNTSGLPFSEESSFMTLFPKYREVYLKSVWKDV 60
           M STHN+DKPWDTPDI+KW+I+EFKPEDN SGLPF+EESSFMTLFPKYRE YL+ VW DV
Sbjct: 1   MVSTHNRDKPWDTPDINKWEIQEFKPEDNASGLPFTEESSFMTLFPKYRETYLREVWGDV 60

Query: 61  TRALEKHSISCVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120
           T++L+K+ ++C LDL+EGSMTVKTTRKTYDPAIILKARDLIKLLARSVP+PQA++ILQDD
Sbjct: 61  TKSLDKYHVACTLDLIEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPYPQAIRILQDD 120

Query: 121 MACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLSKCYILVQGNTVSAMGPFKGL 180
           +ACDVIKIGN V+NKERFVKRRQRLVGPNGNTLKALELL+KCYILVQGNTVSAMGPFKGL
Sbjct: 121 IACDVIKIGNVVNNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180

Query: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKRPDLAEEDWSRFLPMFKKRNVARKKPKNI 240
           KEVRRVVEDCMKNVHPIYHIKELMIKREL+KRP+LA EDWSRFLPMFKKRNVARKK    
Sbjct: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELSKRPELANEDWSRFLPMFKKRNVARKK-SKK 239

Query: 241 KSKEAKVYTPFPPVQQPRKVDLQIESGEYFLSKKEKEAKKLDERKKEQAEKQIEKDKERA 300
             KE KVYTPFPP Q PRKVDL+IESGEYFLSKKEKE KKL ER+++Q EKQ+EK+KER 
Sbjct: 240 PKKEKKVYTPFPPAQLPRKVDLEIESGEYFLSKKEKEIKKLKERREKQEEKQVEKEKERR 299

Query: 301 KDYVAPSEKEYGST 314
           KD++APSEKEY S+
Sbjct: 300 KDFIAPSEKEYKSS 313

>KAFR0D00150 Chr4 complement(16573..17607) [1035 bp, 344 aa] {ON}
           Anc_1.6 YCL059C
          Length = 344

 Score =  495 bits (1274), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 267/309 (86%), Positives = 288/309 (93%), Gaps = 1/309 (0%)

Query: 1   MPSTHNKDKPWDTPDIDKWKIEEFKPEDNTSGLPFSEESSFMTLFPKYREVYLKSVWKDV 60
           M ST+NK+KPWDT DIDKW+ EEFKPEDN SGLPF+EESSFMTLFPKYRE YLKSVWKDV
Sbjct: 1   MVSTYNKEKPWDTEDIDKWQTEEFKPEDNASGLPFAEESSFMTLFPKYRESYLKSVWKDV 60

Query: 61  TRALEKHSISCVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120
           T+ALEKH I+C+LDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQA+KIL+D+
Sbjct: 61  TKALEKHHIACILDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAIKILEDN 120

Query: 121 MACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLSKCYILVQGNTVSAMGPFKGL 180
           MACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELL+KCYILVQGNTVSAMGPFKGL
Sbjct: 121 MACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180

Query: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKRPDLAEEDWSRFLPMFKKRNVARKKPKNI 240
           KEVRRVVEDCM NVHPIYHIKELMIKRELAK+P+LA EDWSRFLPMFKKRNVARKK    
Sbjct: 181 KEVRRVVEDCMLNVHPIYHIKELMIKRELAKKPELANEDWSRFLPMFKKRNVARKK-PKK 239

Query: 241 KSKEAKVYTPFPPVQQPRKVDLQIESGEYFLSKKEKEAKKLDERKKEQAEKQIEKDKERA 300
             KE KVYTPFPP Q PRKVDL+IESGEYFLSKKEKE KKL+ERK+EQA+KQ EK+KER 
Sbjct: 240 IRKEKKVYTPFPPTQLPRKVDLEIESGEYFLSKKEKEVKKLEERKEEQAKKQEEKEKERK 299

Query: 301 KDYVAPSEK 309
           K+Y+AP E+
Sbjct: 300 KNYIAPKEE 308

>SAKL0G03740g Chr7 complement(309922..310722) [801 bp, 266 aa] {ON}
           similar to uniprot|Q7LHP7 Saccharomyces cerevisiae
           YOR145C PNO1 Partner of Nob1 Protein required for cell
           viability
          Length = 266

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 32/146 (21%), Positives = 67/146 (45%), Gaps = 4/146 (2%)

Query: 46  PKYREVYLKSVWKDVTRALEKH-SISCVLDLVEGSMTVKTT-RKTYDPAIILKARDLIKL 103
           P +R   L++ W  +   L  H  +   ++L   S+ ++T  + T DP  + K  D IK 
Sbjct: 94  PPHRMTPLRNNWTKIYPPLVDHLKLQVRMNLKTKSVELRTHPKHTTDPGALQKGADFIKA 153

Query: 104 LARSVPFPQAVKILQ-DDMACDVIKIGNFVS-NKERFVKRRQRLVGPNGNTLKALELLSK 161
            A       A+ +L+ DD+  +  ++ +  +   +   +   R+ G +G T  A+E  ++
Sbjct: 154 FALGFDLDDAIALLRLDDLYIETFEVKDVKTLTGDHLSRAIGRIAGKDGKTKFAIENATR 213

Query: 162 CYILVQGNTVSAMGPFKGLKEVRRVV 187
             I++  + +  +G F  ++  R  V
Sbjct: 214 TRIVLADSKIHILGGFTHIRMAREAV 239

>ZYRO0D11440g Chr4 complement(964606..965415) [810 bp, 269 aa] {ON}
           highly similar to uniprot|Q7LHP7 Saccharomyces
           cerevisiae YOR145C PNO1 Partner of Nob1 Protein required
           for cell viability
          Length = 269

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 31/146 (21%), Positives = 68/146 (46%), Gaps = 4/146 (2%)

Query: 46  PKYREVYLKSVWKDVTRALEKH-SISCVLDLVEGSMTVKTT-RKTYDPAIILKARDLIKL 103
           P +R   L++ W  +   L +H  +   ++L   S+ +++  R+T DP  + K  D IK 
Sbjct: 97  PPHRMTPLRNNWTKIYPPLVEHLKLQVRMNLKTKSVELRSHPRQTTDPGALQKGADFIKA 156

Query: 104 LARSVPFPQAVKILQ-DDMACDVIKIGNFVS-NKERFVKRRQRLVGPNGNTLKALELLSK 161
                    ++ +L+ DD+  +  ++ +  + N +   +   R+ G +G T  A+E  ++
Sbjct: 157 FTLGFDLDDSIALLRLDDLYIETFEVKDVKTLNGDHLSRAIGRIAGKDGKTKFAIENATR 216

Query: 162 CYILVQGNTVSAMGPFKGLKEVRRVV 187
             I++    +  +G F  ++  R  V
Sbjct: 217 TRIVLADAKIHILGGFTHIRMAREAV 242

>Kpol_543.13 s543 complement(30976..31782) [807 bp, 268 aa] {ON}
           complement(30976..31782) [807 nt, 269 aa]
          Length = 268

 Score = 40.4 bits (93), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 32/146 (21%), Positives = 67/146 (45%), Gaps = 4/146 (2%)

Query: 46  PKYREVYLKSVWKDVTRALEKH-SISCVLDLVEGSMTVKTT-RKTYDPAIILKARDLIKL 103
           P +R   L++ W  +   L  H  +   ++L   S+ ++T  + T DP  + K  D IK 
Sbjct: 96  PPHRMTPLRNNWTKIYPPLVDHLKLQVRMNLKTKSVELRTNPKHTTDPGALQKGADFIKA 155

Query: 104 LARSVPFPQAVKILQ-DDMACDVIKIGNFVS-NKERFVKRRQRLVGPNGNTLKALELLSK 161
                    ++ +L+ DD+  +  +I +  + N +   +   R+ G +G T  A+E  ++
Sbjct: 156 FTLGFDLDDSIALLRLDDLYIETFEIKDVKTLNGDHLSRAIGRIAGKDGKTKFAIENATR 215

Query: 162 CYILVQGNTVSAMGPFKGLKEVRRVV 187
             I++  + +  +G F  ++  R  V
Sbjct: 216 TRIVLADSKIHILGGFTHIRMAREAV 241

>TDEL0A03460 Chr1 complement(617779..618597) [819 bp, 272 aa] {ON}
           Anc_5.482 YOR145C
          Length = 272

 Score = 40.4 bits (93), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 32/146 (21%), Positives = 68/146 (46%), Gaps = 4/146 (2%)

Query: 46  PKYREVYLKSVWKDVTRALEKH-SISCVLDLVEGSMTVKTT-RKTYDPAIILKARDLIKL 103
           P +R   L++ W  +   L +H  +   ++L   S+ ++T  + T DP  + K  D IK 
Sbjct: 100 PPHRMTPLRNNWTKIYPPLVEHLKLQVRMNLKTKSVELRTNPKHTTDPGALQKGADFIKA 159

Query: 104 LARSVPFPQAVKILQ-DDMACDVIKIGNFVS-NKERFVKRRQRLVGPNGNTLKALELLSK 161
                    ++ +L+ DD+  +  +I +  + N +   +   R+ G +G T  A+E  ++
Sbjct: 160 FTLGFDLDDSIALLRLDDLYIETFEIKDVKTLNGDHLSRAIGRIAGKDGKTKFAIENATR 219

Query: 162 CYILVQGNTVSAMGPFKGLKEVRRVV 187
             I++  + +  +G F  ++  R  V
Sbjct: 220 TRIVLADSKIHILGGFTHIRMAREAV 245

>Suva_8.197 Chr8 complement(354586..355410) [825 bp, 274 aa] {ON}
           YOR145C (REAL)
          Length = 274

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 32/148 (21%), Positives = 69/148 (46%), Gaps = 4/148 (2%)

Query: 44  LFPKYREVYLKSVWKDVTRALEKH-SISCVLDLVEGSMTVKTTRK-TYDPAIILKARDLI 101
           + P +R   L++ W  +   L +H  +   ++L   S+ ++T  K T DP  + K  D I
Sbjct: 100 MVPPHRLTPLRNSWTKIYPPLVEHLKLQVRMNLKTKSVELRTNPKFTTDPGALQKGADFI 159

Query: 102 KLLARSVPFPQAVKILQ-DDMACDVIKIGNFVS-NKERFVKRRQRLVGPNGNTLKALELL 159
           K  A       ++ +L+ DD+  +  ++ +  +   +   +   R+ G +G T  A+E  
Sbjct: 160 KAFALGFDLDDSIALLRLDDLYIETFEVKDVKTLTGDHLSRAIGRIAGKDGKTKFAIENA 219

Query: 160 SKCYILVQGNTVSAMGPFKGLKEVRRVV 187
           ++  I++  + +  +G F  ++  R  V
Sbjct: 220 TRTRIVLADSKIHILGGFTHIRMAREFV 247

>Kwal_47.18864 s47 (1004428..1005243) [816 bp, 271 aa] {ON} YOR145C
           - Protein required for cell viability [contig 189] FULL
          Length = 271

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 32/146 (21%), Positives = 67/146 (45%), Gaps = 4/146 (2%)

Query: 46  PKYREVYLKSVWKDVTRALEKH-SISCVLDLVEGSMTVKTT-RKTYDPAIILKARDLIKL 103
           P +R   L++ W  +   L  H  +   ++L   ++ ++T  + T DP  + K  D IK 
Sbjct: 99  PPHRLTPLRNNWTKIYPPLVDHLKLQVRMNLKTKTVELRTHPKHTTDPGALQKGADFIKA 158

Query: 104 LARSVPFPQAVKILQ-DDMACDVIKIGNFVS-NKERFVKRRQRLVGPNGNTLKALELLSK 161
                    A+ +L+ DD+  +  +I +  + N +   +   R+ G +G T  A+E  ++
Sbjct: 159 FTLGFDLDDAIALLRLDDLYIETFEIKDVKTLNGDHLSRAIGRIAGKDGKTKFAIENATR 218

Query: 162 CYILVQGNTVSAMGPFKGLKEVRRVV 187
             I++  + +  +G F  ++  R  V
Sbjct: 219 TRIVLADSKIHILGGFTHIRMARESV 244

>Ecym_4552 Chr4 (1087732..1088547) [816 bp, 271 aa] {ON} similar to
           Ashbya gossypii AFR390C
          Length = 271

 Score = 40.0 bits (92), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 31/146 (21%), Positives = 67/146 (45%), Gaps = 4/146 (2%)

Query: 46  PKYREVYLKSVWKDVTRALEKH-SISCVLDLVEGSMTVKTT-RKTYDPAIILKARDLIKL 103
           P +R   L++ W  +   L  H  +   ++L   S+ ++T  + T DP  + K  D IK 
Sbjct: 99  PPHRMTPLRNNWTKIYPPLVDHLKLQVRMNLKTKSVELRTHPKHTVDPGALQKGADFIKT 158

Query: 104 LARSVPFPQAVKILQ-DDMACDVIKIGNFVS-NKERFVKRRQRLVGPNGNTLKALELLSK 161
                    ++ +L+ DD+  +  +I +  + N +   +   R+ G +G T  A+E  ++
Sbjct: 159 FTLGFDLDDSIALLRLDDLYIETFEIKDVKTLNGDHLSRAIGRIAGKDGKTKFAIENATR 218

Query: 162 CYILVQGNTVSAMGPFKGLKEVRRVV 187
             I++  + +  +G F  ++  R  +
Sbjct: 219 TRIVLADSKIHILGGFTHIRMARETI 244

>KLTH0G02574g Chr7 complement(201390..202205) [816 bp, 271 aa] {ON}
           similar to uniprot|Q7LHP7 Saccharomyces cerevisiae
           YOR145C PNO1 Partner of Nob1 Protein required for cell
           viability
          Length = 271

 Score = 40.0 bits (92), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 32/146 (21%), Positives = 67/146 (45%), Gaps = 4/146 (2%)

Query: 46  PKYREVYLKSVWKDVTRALEKH-SISCVLDLVEGSMTVKTT-RKTYDPAIILKARDLIKL 103
           P +R   L++ W  +   L  H  +   ++L   ++ ++T  + T DP  + K  D IK 
Sbjct: 99  PPHRMTPLRNNWTKIYPPLVDHLKLQVRMNLKTKTVELRTHPKHTTDPGALQKGADFIKA 158

Query: 104 LARSVPFPQAVKILQ-DDMACDVIKIGNFVS-NKERFVKRRQRLVGPNGNTLKALELLSK 161
                    A+ +L+ DD+  +  +I +  + N +   +   R+ G +G T  A+E  ++
Sbjct: 159 FTLGFDLDDAIALLRLDDLYIETFEIKDVKTLNGDHLSRAIGRIAGKDGKTKFAIENATR 218

Query: 162 CYILVQGNTVSAMGPFKGLKEVRRVV 187
             I++  + +  +G F  ++  R  V
Sbjct: 219 TRIVLADSKIHILGGFTHIRMARESV 244

>NCAS0A11960 Chr1 complement(2371549..2372361) [813 bp, 270 aa] {ON}
           Anc_5.482 YOR145C
          Length = 270

 Score = 39.3 bits (90), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 31/146 (21%), Positives = 65/146 (44%), Gaps = 4/146 (2%)

Query: 46  PKYREVYLKSVWKDVTRALEKH-SISCVLDLVEGSMTVKTT-RKTYDPAIILKARDLIKL 103
           P +R   L++ W  +   L  H  +   ++L   S+ ++T  + T DP  + K  D IK 
Sbjct: 98  PPHRMTPLRNSWTKIYPPLVDHLKLQVRMNLKTKSVELRTHPKHTTDPGALQKGADFIKA 157

Query: 104 LARSVPFPQAVKILQ-DDMACDVIKIGNFVS-NKERFVKRRQRLVGPNGNTLKALELLSK 161
                    ++ +L+ DD+  +  +I +  +   +   +   R+ G +G T  A+E  ++
Sbjct: 158 FTLGFDLDDSIALLRLDDLYIETFEIKDVKTLTGDHLSRAIGRIAGKDGKTKFAIENATR 217

Query: 162 CYILVQGNTVSAMGPFKGLKEVRRVV 187
             I++    +  +G F  ++  R  V
Sbjct: 218 TRIVLADTKIHILGGFTHIRMAREAV 243

>AAR002W Chr1 (341790..342326) [537 bp, 178 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YCR003W (MRPL32)
          Length = 178

 Score = 38.1 bits (87), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 47/171 (27%), Positives = 72/171 (42%), Gaps = 38/171 (22%)

Query: 54  KSVWKDVTRALEKHSISCVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQA 113
           ++VW +V RAL + + +    L  GS +V            +  R L++LL R+    QA
Sbjct: 4   QAVWGNVGRALSECTAALFPRLELGSGSV------------IAPRTLLELLRRAGGSQQA 51

Query: 114 --VKILQDDMACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLSKCYILVQGNTV 171
               +  D +   V K       K    KRRQ+L GP    L+ +  L KC         
Sbjct: 52  GTAAVGADGLVLAVPK------KKVSHQKRRQKLYGPGKKQLQMVHHLGKC--------- 96

Query: 172 SAMGPFKGLKEVRRVVEDCMKNVHPIYHIKELMIKRELAKRP---DLAEED 219
            + G +K L  +      CM  V  I HI ++  + + A+ P   DL+E D
Sbjct: 97  PSCGHYKRLNTL------CMYCVGEIRHIWKVYTQTKPAEPPQEQDLSELD 141

>Skud_15.310 Chr15 complement(554002..554832) [831 bp, 276 aa] {ON}
           YOR145C (REAL)
          Length = 276

 Score = 38.5 bits (88), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 31/148 (20%), Positives = 68/148 (45%), Gaps = 4/148 (2%)

Query: 44  LFPKYREVYLKSVWKDVTRALEKH-SISCVLDLVEGSMTVKTTRK-TYDPAIILKARDLI 101
           + P +R   L++ W  +   L +H  +   ++L   S+ ++T  K T DP  + K  D I
Sbjct: 102 MVPPHRMTPLRNSWTKIYPPLVEHLKLQVRMNLKTKSVELRTNPKFTTDPGALQKGADFI 161

Query: 102 KLLARSVPFPQAVKILQ-DDMACDVIKIGNFVS-NKERFVKRRQRLVGPNGNTLKALELL 159
           K          ++ +L+ DD+  +  ++ +  +   +   +   R+ G +G T  A+E  
Sbjct: 162 KAFTLGFDLDDSIALLRLDDLYIETFEVKDVKTLTGDHLSRAIGRIAGKDGKTKFAIENA 221

Query: 160 SKCYILVQGNTVSAMGPFKGLKEVRRVV 187
           ++  I++  + +  +G F  ++  R  V
Sbjct: 222 TRTRIVLADSKIHILGGFTHIRMARESV 249

>KLLA0C06446g Chr3 complement(566371..567195) [825 bp, 274 aa] {ON}
           highly similar to uniprot|Q7LHP7 Saccharomyces
           cerevisiae YOR145C PNO1 Partner of Nob1 Protein required
           for cell viability,
          Length = 274

 Score = 38.5 bits (88), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 33/146 (22%), Positives = 67/146 (45%), Gaps = 4/146 (2%)

Query: 46  PKYREVYLKSVWKDVTRALEKH-SISCVLDLVEGSMTVKTT-RKTYDPAIILKARDLIKL 103
           P +R   LK+ W  +   L  H  +   ++L   S+ ++T  + T DP  + K  D IK 
Sbjct: 102 PPHRMTPLKNNWSKIYPPLVDHLKLQVRMNLKTKSVELRTHPKHTTDPGALQKGADFIKA 161

Query: 104 LARSVPFPQAVKILQ-DDMACDVIKIGNFVSNKERFVKRR-QRLVGPNGNTLKALELLSK 161
                    ++ +L+ DD+  +  +I +  + +   + R   R+ G +G T  A+E  ++
Sbjct: 162 FTLGFDLDDSIALLRLDDLYIETFEIKDVKTLQGDHLSRAIGRIAGKDGKTKFAIENATR 221

Query: 162 CYILVQGNTVSAMGPFKGLKEVRRVV 187
             I++  + +  +G F  ++  R  V
Sbjct: 222 TRIVLADSKIHILGGFTHIRMARESV 247

>TPHA0J02820 Chr10 complement(627383..628189) [807 bp, 268 aa] {ON}
           Anc_5.482 YOR145C
          Length = 268

 Score = 38.1 bits (87), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 31/146 (21%), Positives = 66/146 (45%), Gaps = 4/146 (2%)

Query: 46  PKYREVYLKSVWKDVTRALEKH-SISCVLDLVEGSMTVKTT-RKTYDPAIILKARDLIKL 103
           P +R   L++ W  +   L  H  +   ++L   S+ ++T  + T DP  + K  D IK 
Sbjct: 96  PPHRMTPLRNSWSKIYPPLVDHLKLQVRMNLKSKSVELRTHPKHTTDPGALQKGADFIKA 155

Query: 104 LARSVPFPQAVKILQ-DDMACDVIKIGNFVS-NKERFVKRRQRLVGPNGNTLKALELLSK 161
                    ++ +L+ DD+  +  +I +  + + +   +   R+ G +G T  A+E  ++
Sbjct: 156 FTLGFDLDDSIALLRLDDLYIETFEIKDVKTLHGDHLSRAIGRIAGKDGKTKFAIENATR 215

Query: 162 CYILVQGNTVSAMGPFKGLKEVRRVV 187
             I++    +  +G F  ++  R  V
Sbjct: 216 TRIVLADTKIHILGGFTHIRMAREAV 241

>YOR145C Chr15 complement(605347..606171) [825 bp, 274 aa] {ON}
           PNO1Essential nucleolar protein required for pre-18S
           rRNA processing, interacts with Dim1p, an 18S rRNA
           dimethyltransferase, and also with Nob1p, which is
           involved in proteasome biogenesis; contains a KH domain
          Length = 274

 Score = 38.1 bits (87), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 31/148 (20%), Positives = 68/148 (45%), Gaps = 4/148 (2%)

Query: 44  LFPKYREVYLKSVWKDVTRALEKH-SISCVLDLVEGSMTVKTTRK-TYDPAIILKARDLI 101
           + P +R   L++ W  +   L +H  +   ++L   S+ ++T  K T DP  + K  D I
Sbjct: 100 MVPPHRMTPLRNSWTKIYPPLVEHLKLQVRMNLKTKSVELRTNPKFTTDPGALQKGADFI 159

Query: 102 KLLARSVPFPQAVKILQ-DDMACDVIKIGNFVS-NKERFVKRRQRLVGPNGNTLKALELL 159
           K          ++ +L+ DD+  +  ++ +  +   +   +   R+ G +G T  A+E  
Sbjct: 160 KAFTLGFDLDDSIALLRLDDLYIETFEVKDVKTLTGDHLSRAIGRIAGKDGKTKFAIENA 219

Query: 160 SKCYILVQGNTVSAMGPFKGLKEVRRVV 187
           ++  I++  + +  +G F  ++  R  V
Sbjct: 220 TRTRIVLADSKIHILGGFTHIRMARESV 247

>KAFR0E03600 Chr5 (724338..725168) [831 bp, 276 aa] {ON} Anc_5.482
           YOR145C
          Length = 276

 Score = 38.1 bits (87), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 30/146 (20%), Positives = 67/146 (45%), Gaps = 4/146 (2%)

Query: 46  PKYREVYLKSVWKDVTRALEKH-SISCVLDLVEGSMTVKTT-RKTYDPAIILKARDLIKL 103
           P +R   L++ W  +   L +H  +   ++L   S+ ++T  + T DP  + K  D IK 
Sbjct: 104 PPHRMTPLRNNWTKIYPPLVEHLKLQVRMNLKTKSVELRTHPKHTTDPGALQKGADFIKA 163

Query: 104 LARSVPFPQAVKILQ-DDMACDVIKIGNFVS-NKERFVKRRQRLVGPNGNTLKALELLSK 161
                    ++ +L+ DD+  +  ++ +  +   +   +   R+ G +G T  A+E  ++
Sbjct: 164 FTLGFDLDDSIALLRLDDLYIETFEVKDVKTLTGDHLSRAIGRIAGKDGKTKFAIENATR 223

Query: 162 CYILVQGNTVSAMGPFKGLKEVRRVV 187
             I++  + +  +G F  ++  R  V
Sbjct: 224 TRIVLADSKIHILGGFTHIRMAREAV 249

>Smik_15.326 Chr15 complement(561176..562000) [825 bp, 274 aa] {ON}
           YOR145C (REAL)
          Length = 274

 Score = 37.7 bits (86), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 31/148 (20%), Positives = 68/148 (45%), Gaps = 4/148 (2%)

Query: 44  LFPKYREVYLKSVWKDVTRALEKH-SISCVLDLVEGSMTVKTTRK-TYDPAIILKARDLI 101
           + P +R   L++ W  +   L +H  +   ++L   S+ ++T  K T DP  + K  D I
Sbjct: 100 MVPPHRMTPLRNSWTKIYPPLVEHLKLQVRMNLKTKSVELRTNPKFTTDPGALQKGADFI 159

Query: 102 KLLARSVPFPQAVKILQ-DDMACDVIKIGNFVS-NKERFVKRRQRLVGPNGNTLKALELL 159
           K          ++ +L+ DD+  +  ++ +  +   +   +   R+ G +G T  A+E  
Sbjct: 160 KAFTLGFDLDDSIALLRLDDLYIETFEVKDVKTLTGDHLSRAIGRIAGKDGKTKFAIENA 219

Query: 160 SKCYILVQGNTVSAMGPFKGLKEVRRVV 187
           ++  I++  + +  +G F  ++  R  V
Sbjct: 220 TRTRIVLADSKIHILGGFTHIRMARESV 247

>CAGL0K09460g Chr11 complement(935326..936111) [786 bp, 261 aa] {ON}
           highly similar to uniprot|Q99216 Saccharomyces
           cerevisiae YOR145c
          Length = 261

 Score = 37.4 bits (85), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 29/146 (19%), Positives = 66/146 (45%), Gaps = 4/146 (2%)

Query: 46  PKYREVYLKSVWKDVTRALEKH-SISCVLDLVEGSMTVKTT-RKTYDPAIILKARDLIKL 103
           P +R   L++ W  +   L  H  +   ++L   ++ ++T  + T DP  + K  D IK 
Sbjct: 89  PPHRMTPLRNSWNKIYPPLVDHLKLQVRMNLKTRTVELRTHPKHTTDPGALQKGADFIKA 148

Query: 104 LARSVPFPQAVKILQ-DDMACDVIKIGNFVS-NKERFVKRRQRLVGPNGNTLKALELLSK 161
                    ++ +L+ DD+  +  ++ +  +   +   +   R+ G +G T  A+E  ++
Sbjct: 149 FTLGFDLDDSIALLRLDDLYIETFEVKDVKTLTGDHLSRAIGRIAGKDGKTKFAIENATR 208

Query: 162 CYILVQGNTVSAMGPFKGLKEVRRVV 187
             I++  + +  +G F  ++  R  V
Sbjct: 209 TRIVLADSKIHILGGFTHIRMAREAV 234

>NDAI0A04310 Chr1 (970952..971776) [825 bp, 274 aa] {ON} Anc_5.482
           YOR145C
          Length = 274

 Score = 37.4 bits (85), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 31/146 (21%), Positives = 65/146 (44%), Gaps = 4/146 (2%)

Query: 46  PKYREVYLKSVWKDVTRALEKH-SISCVLDLVEGSMTVKTT-RKTYDPAIILKARDLIKL 103
           P +R   L++ W  +   L  H  +   ++L   S+ ++T  + T DP  + K  D IK 
Sbjct: 102 PPHRMTPLRNSWTKIYPPLVDHLKLQVRMNLKTKSVELRTHPKHTTDPGALQKGADFIKA 161

Query: 104 LARSVPFPQAVKILQ-DDMACDVIKIGNFVS-NKERFVKRRQRLVGPNGNTLKALELLSK 161
                    ++ +L+ DD+  +  +I +  +   +   +   R+ G +G T  A+E  ++
Sbjct: 162 FTLGFDLDDSIALLRLDDLYIETFEIKDVKTLTGDHLSRAIGRIAGKDGKTKFAIENATR 221

Query: 162 CYILVQGNTVSAMGPFKGLKEVRRVV 187
             I++    +  +G F  ++  R  V
Sbjct: 222 TRIVLADTKIHILGGFTHIRMARESV 247

>KNAG0C04610 Chr3 (905301..906134) [834 bp, 277 aa] {ON} Anc_5.482
           YOR145C
          Length = 277

 Score = 37.0 bits (84), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 30/146 (20%), Positives = 67/146 (45%), Gaps = 4/146 (2%)

Query: 46  PKYREVYLKSVWKDVTRALEKH-SISCVLDLVEGSMTVKTT-RKTYDPAIILKARDLIKL 103
           P +R   L++ W  +   L  H  +   ++L   S+ ++T  + T DP  + K  D IK 
Sbjct: 105 PPHRMTPLRNNWTKIYPPLVDHLKLQVRMNLKTKSVELRTHPKHTTDPGALQKGADFIKA 164

Query: 104 LARSVPFPQAVKILQ-DDMACDVIKIGNFVS-NKERFVKRRQRLVGPNGNTLKALELLSK 161
                    ++ +L+ DD+  +  ++ +  + + +   +   R+ G +G T  A+E  ++
Sbjct: 165 FTLGFDLDDSIALLRLDDLYIETFEVKDVKTLHGDHLSRAIGRIAGKDGKTKFAIENATR 224

Query: 162 CYILVQGNTVSAMGPFKGLKEVRRVV 187
             I++  + +  +G F  ++  R  V
Sbjct: 225 TRIVLADSKIHILGGFTHIRMARESV 250

>TBLA0D01890 Chr4 (461527..462342) [816 bp, 271 aa] {ON} Anc_5.482
           YOR145C
          Length = 271

 Score = 35.4 bits (80), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 29/146 (19%), Positives = 66/146 (45%), Gaps = 4/146 (2%)

Query: 46  PKYREVYLKSVWKDVTRALEKH-SISCVLDLVEGSMTVKTT-RKTYDPAIILKARDLIKL 103
           P +R   L++ W  +   L  H  +   ++L   S+ ++T  + T DP  + K  D IK 
Sbjct: 99  PPHRMTPLRNNWPKIYPPLVDHLKLQVRMNLRTKSVELRTHPKHTTDPGALQKGADFIKA 158

Query: 104 LARSVPFPQAVKILQ-DDMACDVIKIGNFVS-NKERFVKRRQRLVGPNGNTLKALELLSK 161
                    ++ +L+ DD+  +  ++ +  +   +   +   R+ G +G T  A+E  ++
Sbjct: 159 FTLGFDLDDSIALLRLDDLYIETFEVKDVKTLTGDHLSRAIGRIAGKDGKTKFAIENATR 218

Query: 162 CYILVQGNTVSAMGPFKGLKEVRRVV 187
             I++  + +  +G F  ++  R  +
Sbjct: 219 TRIVLADSKIHILGGFTHIRMARESI 244

>KAFR0B03030 Chr2 (632585..633988) [1404 bp, 467 aa] {ON} Anc_8.309
           YLR116W
          Length = 467

 Score = 32.7 bits (73), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 28/56 (50%), Gaps = 5/56 (8%)

Query: 145 LVGPNGNTLKALELLSKCYILVQGNTVSAMGPFKGLKEVRRVVEDCMKNVHPIYHI 200
           L+GP GNTL+ L+  SKC I ++G      G  K  K    + E  M    P++ +
Sbjct: 151 LLGPRGNTLRKLQEQSKCKIAIRG-----RGSVKEGKHANDLPEGAMNMEDPLHCL 201

>ZYRO0C02552g Chr3 (202013..203653) [1641 bp, 546 aa] {ON} similar
           to uniprot|P38925 Saccharomyces cerevisiae YOL122C SMF1
           Divalent metal ion transporter
          Length = 546

 Score = 32.3 bits (72), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 20/33 (60%)

Query: 256 QPRKVDLQIESGEYFLSKKEKEAKKLDERKKEQ 288
           QPR +D  +  G Y +++ E E KK DE  ++Q
Sbjct: 285 QPRLLDYDVTHGNYSVTESELEGKKTDEEVRDQ 317

>AGL183C Chr7 complement(352996..354519) [1524 bp, 507 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR116W
           (MSL5)
          Length = 507

 Score = 32.3 bits (72), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 13/24 (54%), Positives = 18/24 (75%)

Query: 145 LVGPNGNTLKALELLSKCYILVQG 168
           L+GP GNTLK L+  S C I+++G
Sbjct: 169 LLGPRGNTLKQLQQQSGCKIVIRG 192

>TBLA0E02000 Chr5 (487674..488579) [906 bp, 301 aa] {ON} Anc_7.316
           YDL142C
          Length = 301

 Score = 32.0 bits (71), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 34/133 (25%), Positives = 57/133 (42%), Gaps = 18/133 (13%)

Query: 56  VWKDVTRALEKHSISCVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARS-------- 107
           + + +  AL     SCV DL++G +  K   +T   +++  A D + +L  +        
Sbjct: 102 IHEQLVSALYLFCYSCVTDLLDGQLARKFNLQTPLGSVLDPAADKLLMLVTTIALTIPSG 161

Query: 108 ---VPFPQAVKILQDDMACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLSKCYI 164
              +P P A  IL  D+    +  GN  S   R+ K  QR      +T +  ++ S   I
Sbjct: 162 PCLIPLPIATVILGRDL----VLAGN--SFYHRY-KSMQRAYAGGFSTKQFFDIFSYPSI 214

Query: 165 LVQGNTVSAMGPF 177
           +VQ  T+S    F
Sbjct: 215 VVQPTTISKWNTF 227

>Ecym_4242 Chr4 (504084..505334) [1251 bp, 416 aa] {ON} similar to
           Ashbya gossypii AGL183C
          Length = 416

 Score = 32.0 bits (71), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 13/24 (54%), Positives = 17/24 (70%)

Query: 145 LVGPNGNTLKALELLSKCYILVQG 168
           L+GP GNTLK L+  S C I ++G
Sbjct: 149 LLGPRGNTLKQLQQQSGCKIAIRG 172

>Kpol_1036.60 s1036 (169585..171069) [1485 bp, 494 aa] {ON}
           (169585..171069) [1485 nt, 495 aa]
          Length = 494

 Score = 31.2 bits (69), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 13/24 (54%), Positives = 18/24 (75%)

Query: 145 LVGPNGNTLKALELLSKCYILVQG 168
           L+GP GNTLK L+  S+C I ++G
Sbjct: 152 LLGPRGNTLKKLQEDSQCKIAIRG 175

>KNAG0G02350 Chr7 (542717..544210) [1494 bp, 497 aa] {ON} Anc_8.309
           YLR116W
          Length = 497

 Score = 31.2 bits (69), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 13/24 (54%), Positives = 17/24 (70%)

Query: 145 LVGPNGNTLKALELLSKCYILVQG 168
           L+GP GNTLK L+  S C I ++G
Sbjct: 148 LLGPRGNTLKQLQKQSNCKIAIRG 171

>KLTH0E14014g Chr5 (1239444..1240904) [1461 bp, 486 aa] {ON} similar
           to uniprot|Q12096 Saccharomyces cerevisiae YOR320C GNT1
           N-acetylglucosaminyltransferase capable of modification
           of N-linked glycans in the Golgi apparatus
          Length = 486

 Score = 31.2 bits (69), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 26/99 (26%), Positives = 40/99 (40%), Gaps = 20/99 (20%)

Query: 137 RFV-KRRQRLVGPNGNTLKALELLSKCYILVQGNTVSAMGPFKGLKEVRRVVEDCMKNVH 195
           RF+ KRR RLVG  G  +  + L +KC +  Q N        + ++  R        N+H
Sbjct: 2   RFLFKRRLRLVGAIGAVVLLISLTAKCVVQFQLN--------REIEHYRTFFRKHKDNIH 53

Query: 196 PIYH-----------IKELMIKRELAKRPDLAEEDWSRF 223
            IY            I+ L   R+    P  +  DW ++
Sbjct: 54  DIYDPLNIKQIPYETIESLYQLRKTGDVPKKSPIDWGKY 92

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.133    0.384 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 35,478,169
Number of extensions: 1589553
Number of successful extensions: 16425
Number of sequences better than 10.0: 398
Number of HSP's gapped: 14964
Number of HSP's successfully gapped: 610
Length of query: 334
Length of database: 53,481,399
Length adjustment: 110
Effective length of query: 224
Effective length of database: 40,868,139
Effective search space: 9154463136
Effective search space used: 9154463136
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 66 (30.0 bits)