Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_33.130051.5ON97097045600.0
KLTH0F00484g1.5ON9934778761e-101
KAFR0D001401.5ON10416665867e-62
SAKL0C00462g1.5ON11773985603e-58
Smik_3.141.5ON11135125372e-55
YCL061C (MRC1)1.5ON10965345263e-54
Ecym_10081.5ON11184625175e-53
KLLA0C00484g1.5ON9254344976e-51
AFR745W1.5ON10184624739e-48
NCAS0B091101.5ON10204834659e-47
Skud_3.31.5ON11524514605e-46
TDEL0C069701.5ON9414404576e-46
CAGL0B00330g1.5ON11363644571e-45
Suva_3.1521.5ON11405314562e-45
NDAI0A001401.5ON10915094515e-45
TPHA0E040101.5ON9654914434e-44
KNAG0C002201.5ON11614464401e-43
Kpol_2002.81.5ON9853894292e-42
ZYRO0F18480g1.5ON9604413934e-38
TBLA0A075701.5ON12523573901e-37
TPHA0H008402.56ON81593790.96
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_33.13005
         (970 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_33.13005 s33 complement(36797..39709) [2913 bp, 970 aa] {ON...  1761   0.0  
KLTH0F00484g Chr6 complement(37017..39998) [2982 bp, 993 aa] {ON...   342   e-101
KAFR0D00140 Chr4 complement(13233..16358) [3126 bp, 1041 aa] {ON...   230   7e-62
SAKL0C00462g Chr3 complement(41257..44790) [3534 bp, 1177 aa] {O...   220   3e-58
Smik_3.14 Chr3 complement(20226..23567) [3342 bp, 1113 aa] {ON} ...   211   2e-55
YCL061C Chr3 complement(18816..22106) [3291 bp, 1096 aa] {ON}  M...   207   3e-54
Ecym_1008 Chr1 complement(13340..16696) [3357 bp, 1118 aa] {ON} ...   203   5e-53
KLLA0C00484g Chr3 complement(35397..38174) [2778 bp, 925 aa] {ON...   196   6e-51
AFR745W Chr6 (1803046..1806102) [3057 bp, 1018 aa] {ON} Syntenic...   186   9e-48
NCAS0B09110 Chr2 (1746358..1749420) [3063 bp, 1020 aa] {ON} Anc_...   183   9e-47
Skud_3.3 Chr3 complement(6855..10313) [3459 bp, 1152 aa] {ON} YC...   181   5e-46
TDEL0C06970 Chr3 (1264155..1266980) [2826 bp, 941 aa] {ON} Anc_1...   180   6e-46
CAGL0B00330g Chr2 complement(18031..21441) [3411 bp, 1136 aa] {O...   180   1e-45
Suva_3.152 Chr3 complement(228665..232087) [3423 bp, 1140 aa] {O...   180   2e-45
NDAI0A00140 Chr1 complement(8373..11648) [3276 bp, 1091 aa] {ON}...   178   5e-45
TPHA0E04010 Chr5 (839903..842800) [2898 bp, 965 aa] {ON} Anc_1.5...   175   4e-44
KNAG0C00220 Chr3 complement(33011..36496) [3486 bp, 1161 aa] {ON...   174   1e-43
Kpol_2002.8 s2002 complement(11914..14871) [2958 bp, 985 aa] {ON...   169   2e-42
ZYRO0F18480g Chr6 (1524051..1526933) [2883 bp, 960 aa] {ON} weak...   155   4e-38
TBLA0A07570 Chr1 (1874419..1878177) [3759 bp, 1252 aa] {ON} Anc_...   154   1e-37
TPHA0H00840 Chr8 (170246..172693) [2448 bp, 815 aa] {ON} Anc_2.5...    35   0.96 

>Kwal_33.13005 s33 complement(36797..39709) [2913 bp, 970 aa] {ON}
           YCL061C (MRC1) - protein involved in replication
           checkpoint [contig 123] FULL
          Length = 970

 Score = 1761 bits (4560), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 879/970 (90%), Positives = 879/970 (90%)

Query: 1   MDLIDQLSNPRTKRSGFVKKLHLFDDESCPTVGGTGFLFENSIFNQVKKRIKATDDNEIN 60
           MDLIDQLSNPRTKRSGFVKKLHLFDDESCPTVGGTGFLFENSIFNQVKKRIKATDDNEIN
Sbjct: 1   MDLIDQLSNPRTKRSGFVKKLHLFDDESCPTVGGTGFLFENSIFNQVKKRIKATDDNEIN 60

Query: 61  HNAPTTASTEILKDTCETQAIERPYDGEELETDFVLAKAPSEPKDNEVRASQSSSRLKFQ 120
           HNAPTTASTEILKDTCETQAIERPYDGEELETDFVLAKAPSEPKDNEVRASQSSSRLKFQ
Sbjct: 61  HNAPTTASTEILKDTCETQAIERPYDGEELETDFVLAKAPSEPKDNEVRASQSSSRLKFQ 120

Query: 121 AQQEFTASGETRLDNHKEADIANTQLIGDSISSTSICDEDLETQKTSSNDMITSLTTQKI 180
           AQQEFTASGETRLDNHKEADIANTQLIGDSISSTSICDEDLETQKTSSNDMITSLTTQKI
Sbjct: 121 AQQEFTASGETRLDNHKEADIANTQLIGDSISSTSICDEDLETQKTSSNDMITSLTTQKI 180

Query: 181 DLSHSPIKGTLQATSRDDNLEPPTVDDREKSEGIMHTNEAHIEIEDDHSNIIXXXXXXXP 240
           DLSHSPIKGTLQATSRDDNLEPPTVDDREKSEGIMHTNEAHIEIEDDHSNII       P
Sbjct: 181 DLSHSPIKGTLQATSRDDNLEPPTVDDREKSEGIMHTNEAHIEIEDDHSNIISKSSKSKP 240

Query: 241 MVLDEKYGAQKXXXXXXXXXXXXXXXKEASNPEAEKSNLRETSERRNLSLNVLPSISEGF 300
           MVLDEKYGAQK               KEASNPEAEKSNLRETSERRNLSLNVLPSISEGF
Sbjct: 241 MVLDEKYGAQKFVDEFDEDSDVSECEKEASNPEAEKSNLRETSERRNLSLNVLPSISEGF 300

Query: 301 APLQLYHTILKQRLTDANXXXXXXXXXXXXXXXXXLSSKAAILDLKARMSKKKQSLAVTS 360
           APLQLYHTILKQRLTDAN                 LSSKAAILDLKARMSKKKQSLAVTS
Sbjct: 301 APLQLYHTILKQRLTDANSVEFSSSDDEKSSEARSLSSKAAILDLKARMSKKKQSLAVTS 360

Query: 361 SKETMPSASLRHLFSSLRKANRDQLVEHRNGLLLLRGVDLAEIAKEKESVESLLERELAR 420
           SKETMPSASLRHLFSSLRKANRDQLVEHRNGLLLLRGVDLAEIAKEKESVESLLERELAR
Sbjct: 361 SKETMPSASLRHLFSSLRKANRDQLVEHRNGLLLLRGVDLAEIAKEKESVESLLERELAR 420

Query: 421 NKKVKQEEIQKGEXXXXXXXXXXXXXXXXXXXXXXXXXXXDSNGYDDYNQXXXXXXXXXX 480
           NKKVKQEEIQKGE                           DSNGYDDYNQ          
Sbjct: 421 NKKVKQEEIQKGEDSSSDSSSDEFCNDSSTSLGSHSDSADDSNGYDDYNQEVDESVDTEV 480

Query: 481 XXLGPLKSKHELSVKTTNLTIVRAESDEEDDPLNVTKKKKVRRWNLIDSDDEALSNDEQK 540
             LGPLKSKHELSVKTTNLTIVRAESDEEDDPLNVTKKKKVRRWNLIDSDDEALSNDEQK
Sbjct: 481 VDLGPLKSKHELSVKTTNLTIVRAESDEEDDPLNVTKKKKVRRWNLIDSDDEALSNDEQK 540

Query: 541 TVIDLGAYGENILGTERIDEGAGAQVVGTSSSMCEAKLERNTTKSPVRILNRPCEEKIDQ 600
           TVIDLGAYGENILGTERIDEGAGAQVVGTSSSMCEAKLERNTTKSPVRILNRPCEEKIDQ
Sbjct: 541 TVIDLGAYGENILGTERIDEGAGAQVVGTSSSMCEAKLERNTTKSPVRILNRPCEEKIDQ 600

Query: 601 DEETRNPIIKNLIEKRKLKEALREAKMKELNRSKANGMIDFEAEESDDEWFGVGGADGEN 660
           DEETRNPIIKNLIEKRKLKEALREAKMKELNRSKANGMIDFEAEESDDEWFGVGGADGEN
Sbjct: 601 DEETRNPIIKNLIEKRKLKEALREAKMKELNRSKANGMIDFEAEESDDEWFGVGGADGEN 660

Query: 661 SDGYDSELDRMIDDYSNTKSDPEFLRKKLMEEEKLHDKDMVDRILHDIENGGFRKRGRYA 720
           SDGYDSELDRMIDDYSNTKSDPEFLRKKLMEEEKLHDKDMVDRILHDIENGGFRKRGRYA
Sbjct: 661 SDGYDSELDRMIDDYSNTKSDPEFLRKKLMEEEKLHDKDMVDRILHDIENGGFRKRGRYA 720

Query: 721 MXXXXXXXXXXXXXRYHARRKELLNERKSGNQEISVLATNPKSKAFFDSIFEDDLKGGIA 780
           M             RYHARRKELLNERKSGNQEISVLATNPKSKAFFDSIFEDDLKGGIA
Sbjct: 721 MDLTLSDDEDDDLLRYHARRKELLNERKSGNQEISVLATNPKSKAFFDSIFEDDLKGGIA 780

Query: 781 NLKEYQSHASPLKAAKDEISGKRETRISEQFVQKTLSFLKSKEDEQGDAEFVSVADTQES 840
           NLKEYQSHASPLKAAKDEISGKRETRISEQFVQKTLSFLKSKEDEQGDAEFVSVADTQES
Sbjct: 781 NLKEYQSHASPLKAAKDEISGKRETRISEQFVQKTLSFLKSKEDEQGDAEFVSVADTQES 840

Query: 841 SSGDFAEATDFYRLKQLSGIKSFSAPLRSSIRLQVRNKDGVLSGKANTTLVERFVRSVDT 900
           SSGDFAEATDFYRLKQLSGIKSFSAPLRSSIRLQVRNKDGVLSGKANTTLVERFVRSVDT
Sbjct: 841 SSGDFAEATDFYRLKQLSGIKSFSAPLRSSIRLQVRNKDGVLSGKANTTLVERFVRSVDT 900

Query: 901 NEKFEEGRKTVKSLNSYKIAGSSRASITFLGKARSLKARKRGPHARSAPHGQKIMTSHQF 960
           NEKFEEGRKTVKSLNSYKIAGSSRASITFLGKARSLKARKRGPHARSAPHGQKIMTSHQF
Sbjct: 901 NEKFEEGRKTVKSLNSYKIAGSSRASITFLGKARSLKARKRGPHARSAPHGQKIMTSHQF 960

Query: 961 FASDGQSFEN 970
           FASDGQSFEN
Sbjct: 961 FASDGQSFEN 970

>KLTH0F00484g Chr6 complement(37017..39998) [2982 bp, 993 aa] {ON}
           weakly similar to uniprot|P25588 Saccharomyces
           cerevisiae YCL061C MRC1 S-phase checkpoint protein found
           at replication forks required for DNA replication also
           required for Rad53p activation during DNA replication
           stress where it forms a replication-pausing complex with
           Tof1p and is phosphorylated by Mec1p protein involved in
           replication checkpoint
          Length = 993

 Score =  342 bits (876), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 209/477 (43%), Positives = 292/477 (61%), Gaps = 21/477 (4%)

Query: 507 DEEDDPLNVTKKKKVRRWNLIDSDDEALSNDEQKTVIDLGAYGENI-----LGTERIDEG 561
           +EE+D +  +  +K +++ LID+D+E  S      +IDLGAYG NI     +  E++ E 
Sbjct: 523 NEEEDAIRKSGLRKHKKFCLIDTDEEDGSVLNSGNIIDLGAYGSNIGNLNQIEQEQVGEH 582

Query: 562 AGAQVVGTSSSMCEAKLERNTTKSPVRILNRPCEEKIDQDEETRNP-IIKNLIEKRKLKE 620
            GA +    + +      +N  K   R  +   E   D   E  NP +I+ LIEK K KE
Sbjct: 583 VGAHI---ENDLTTTGRNKNLIKPSSRSSSFQVE---DNSHEDMNPGVIRELIEKHKRKE 636

Query: 621 ALREAKMKELNRSKANGMIDFEAEESDDEWFGVGGADGENSDGYDSELDRMIDDYSNTKS 680
            LREAK+++L++SKA+ +ID+EAEESDDEW G+GG DGE  D +DS+L++MIDDYSN++ 
Sbjct: 637 LLREAKLEKLHQSKASRIIDYEAEESDDEWHGIGGVDGERFDDHDSDLEKMIDDYSNSRF 696

Query: 681 DPEFLRKKLMEEEKLHDKDMVDRILHDIENGGFRKRGRYAMXXXXXXXXXXXXXRYHARR 740
           D   +RK+ +EEE   DK MV++ILHDIE GGFRKRGR A+             +YH+RR
Sbjct: 697 DSSEVRKRQIEEEISEDKSMVNKILHDIETGGFRKRGRNALDLELSDDDDEELLKYHSRR 756

Query: 741 KELLNERKSGNQEISVLATNPKSKAFFDSIFED-DLKGGIAN-----LKEYQSHASPLKA 794
           KELL ++ S   E  +LA NPKSKAFF++I ED   KG + +     ++ + S  +P + 
Sbjct: 757 KELLRQKVSAQGEAKLLAENPKSKAFFETIVEDIRSKGALEDEGPPPVRGFSSVNAPEEK 816

Query: 795 AKDEISGKRETRISEQFVQKTLSFLKSKE--DEQGDAEFVSVADTQESSSGDFAEATDFY 852
             D     ++T +SE FVQ+TLSFL S E  +E+G    +    T    S +  E  D +
Sbjct: 817 NSDSDKKGKKTVLSEAFVQQTLSFLTSGEVGEEKGPENNLGSLPTH-VPSFNTEETQDIF 875

Query: 853 RLKQLSGIKSFSAPLRSSIRLQVRNKDGVLSGKANTTLVERFVRSVDTNEKFEEGRKTVK 912
            LKQ S IKS SAP R+S  + + +++ +LS K   +   RF + VD NEKFEEG+KTV+
Sbjct: 876 ALKQNSSIKSLSAPTRNSSNMLIDDQEDLLSRKRACSFFARFTKRVDANEKFEEGKKTVR 935

Query: 913 SLNSYKIAGSSRASITFLGKARSLKARKRGPHARSAPHGQKIMTSHQFFASDGQSFE 969
           SLNSYK+AGSS+ASIT+LGKAR L A K+  H +S   G K       FAS+ +SFE
Sbjct: 936 SLNSYKVAGSSKASITYLGKARKLNAPKKVAHQQSRKRGHKPAAGFGIFASNSESFE 992

 Score = 95.9 bits (237), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 52/95 (54%), Positives = 71/95 (74%)

Query: 337 SSKAAILDLKARMSKKKQSLAVTSSKETMPSASLRHLFSSLRKANRDQLVEHRNGLLLLR 396
           S KAAILDLKAR+SKK QSL +  SK T   +S + LF+SLRKAN+ Q++++R      +
Sbjct: 358 SFKAAILDLKARLSKKSQSLLIPRSKVTSNFSSHQILFASLRKANKSQILDYRKEKYQSK 417

Query: 397 GVDLAEIAKEKESVESLLERELARNKKVKQEEIQK 431
           G+D  +I +EK S+ESLLERELARNKK++  EI++
Sbjct: 418 GIDYDKITEEKNSIESLLERELARNKKIRLREIEQ 452

 Score = 72.8 bits (177), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 74/218 (33%), Positives = 104/218 (47%), Gaps = 35/218 (16%)

Query: 1   MDLIDQLSNPRTKRSGFVKKLHLFDDESCPTVGGTGFLFENSIFNQVKKRIKATDDNEIN 60
           MDLID L   R + SG  KK+     +S P V GTGFLF NS+  +VK R+    D+E N
Sbjct: 1   MDLIDNL-RARNRGSGTAKKVKERGCDSLPLVTGTGFLFGNSVLRRVKSRL---GDDE-N 55

Query: 61  HNAPTTASTEILKDTC---ETQAIERPYDGEELETDFVLAKA-------------PSEPK 104
           H A +T S  I    C   +TQ +   YDGE+LE DF  + A             P+ PK
Sbjct: 56  HEADSTKSP-IDNGCCDLSQTQVVGLAYDGEDLEQDFADSTARIEGKSWAGPTNKPNYPK 114

Query: 105 DNEVRASQSSS--RLKFQAQQEFTASGETRLDNH--KEADIANTQLIGDSISSTSICDED 160
           D    +S +S+  R   +++ E T      +  H  KE D   TQL+        + D D
Sbjct: 115 DKRRVSSNNSTVERRIPRSELESTEVNTQLISPHQVKEIDELETQLL--------LPDVD 166

Query: 161 LE-TQKTSSNDMITSLTTQKIDLSHSPIKGTLQATSRD 197
           L  T ++S+N ++    TQ      +     +QATS+D
Sbjct: 167 LHPTNQSSNNTILDGTITQISGFGETCHDNAIQATSKD 204

>KAFR0D00140 Chr4 complement(13233..16358) [3126 bp, 1041 aa] {ON}
            Anc_1.5 YCL061C
          Length = 1041

 Score =  230 bits (586), Expect = 7e-62,   Method: Compositional matrix adjust.
 Identities = 206/666 (30%), Positives = 331/666 (49%), Gaps = 94/666 (14%)

Query: 338  SKAAILDLKARMSKKKQSLAVTSSKETMPSASLRHLFSSLRKANRDQLVEHRNGLLLLRG 397
            SKA + D+KAR+SKK+  + +++  +T    +L  LF+ L+KA+R Q++EH+  ++  +G
Sbjct: 435  SKATVFDIKARLSKKRPIVKISNDSKT----TLHTLFNKLQKASRQQIIEHQKEVIEKKG 490

Query: 398  VDLAEIAKEKESVESLLERELARNKKVK------QEEIQKGEXXXXXXXXXXXXXXXXXX 451
            ++L +I KEK+ VE+LLE+E+ RNKK++      ++++   +                  
Sbjct: 491  LNLEDIEKEKKIVENLLEQEINRNKKIRQREKEREKQLADAQDDENDLDFDHSANELDES 550

Query: 452  XXXXXXXXXDS-NGYDDYNQXXXXXXXXXXXXLGPLKSKHELSVKTTNLTIVRAESDEED 510
                     DS N YDD++                         K +   ++  +SD E 
Sbjct: 551  ELSGEESAIDSDNDYDDFSLEK---------------------TKRSKKKVIVEDSDTEI 589

Query: 511  DPLNVTKKKKVRRWNLIDSDDEALSNDEQKTVIDLGAYGENILGTERIDEGAGAQVVGTS 570
            +   ++   ++R     + DD    N   +  I+LG YG+N+         A  ++    
Sbjct: 590  EDEKMSHNAQIRE----EKDDSLFQN---RNAINLGPYGDNL-------SLAPIRITTEK 635

Query: 571  SSMCEAKLERNTTKSPVRILNRPCEEKIDQDEETRNPIIKNLIEKRKLKEALREAK-MKE 629
             S    K+ R              E   ++DEE        LIE++K  E  R+ K MK+
Sbjct: 636  QSGKNFKVSR--------------ESGDERDEEIPEKDRIRLIEEKKQHELERQRKQMKK 681

Query: 630  LNRSKANGMIDF---EAEESDDEWFGVGGADGENSDGYDSELDRMIDDYSNTKSDPEFLR 686
                KA G+ +F   EAEES+DEW G+GG DGE SD YDSE+++MIDDYS    +P+ +R
Sbjct: 682  RKEMKAKGITNFLEEEAEESEDEWHGIGGIDGEMSDEYDSEVEKMIDDYSKANFNPDEIR 741

Query: 687  KKLMEEEKLHDKDMVDRILHDIENGGFRKRGRYAMXXXXXXXXXXXXXRYHARRKELLNE 746
            + L +E K  D  MV++IL+DI+NGGFRKR + AM             +Y  +R+EL+ +
Sbjct: 742  QMLADENKETDIKMVEKILYDIKNGGFRKRRKGAMDLELSDEEDDELKQYRLKRRELMRQ 801

Query: 747  RKSGNQEISVLATNPKSKAFFDS-------------IFEDDLKGGIANLKEYQSHASPLK 793
            ++    E   L  NPKSKAFF+S             +FE    G I      Q +A+  +
Sbjct: 802  KRLEVGEAETLVKNPKSKAFFESMVDDIVEVKNPFAVFEPQRSGTITTDDGTQENANSNE 861

Query: 794  AAKDEISGKRETRISEQFVQKTLSFLKSKEDEQGDAEFVSVADTQESSSGDFAEATDFYR 853
             A  +   K+   +SE+FVQ+TLSFL S +D     +F      +  ++ +  E  D   
Sbjct: 862  GAASQNPSKK-VMLSEEFVQRTLSFLNSSKDMD---QFAPARSMRAEANDELIE--DLTA 915

Query: 854  LKQLSGIKSFSAPLRSSIRLQVRN--------KDGVLSGKANT-TLVERFVRSVDTNEKF 904
            LK+ S IKSF    R+S+  +  +         D +L+ +  T ++++ F  +VD N+KF
Sbjct: 916  LKKQSSIKSFKT-TRASVSQEPTDFDKENDDSFDDLLNSRVGTSSIMKTFSATVDINDKF 974

Query: 905  EEGRKTVKSLNSYKIAGSSRASITFLGKARSLKA-RKRGPHARSAPHGQKIMTSHQFFAS 963
            +EG KTVK   +YK   SS+ASIT++GK R L A +K+  +  S+        + + F+ 
Sbjct: 975  QEGVKTVKVSKAYKSVSSSKASITYMGKMRKLVAPQKKVANLSSSDIKNTNSRTSKLFSR 1034

Query: 964  DGQSFE 969
              +SFE
Sbjct: 1035 QDESFE 1040

 Score = 32.7 bits (73), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 17/60 (28%), Positives = 28/60 (46%), Gaps = 10/60 (16%)

Query: 30 PTVGGTGFLFENSIFNQVKKRIKATDDNEINHNAPTTASTEILKDTCETQAIERPYDGEE 89
          P + G GFLF+N   N++KKR+   + + + +            +  +TQ I   Y G E
Sbjct: 38 PALTGEGFLFDNPTLNRIKKRLDGEEKDVVQYTM----------NFSQTQLISNLYGGGE 87

>SAKL0C00462g Chr3 complement(41257..44790) [3534 bp, 1177 aa] {ON}
            some similarities with uniprot|P25588 Saccharomyces
            cerevisiae YCL061C MRC1 S-phase checkpoint protein found
            at replication forks required for DNA replication also
            required for Rad53p activation during DNA replication
            stress where it forms a replication-pausing complex with
            Tof1p and is phosphorylated by Mec1p protein involved in
            replication checkpoint
          Length = 1177

 Score =  220 bits (560), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 156/398 (39%), Positives = 221/398 (55%), Gaps = 28/398 (7%)

Query: 599  DQDEETRNPIIKNLIEKRKLKEALREAKMKELNRSKANGMIDFEAEESDDEWFGVGGADG 658
            D  EE    + + L  KR+ +  +R+ K KE+ R   + M + EAEES+DEW GVGGADG
Sbjct: 780  DDKEEYEKAMRQVLARKREQEHKIRQ-KRKEMKRKGVSKMFEMEAEESEDEWHGVGGADG 838

Query: 659  ENSDGYDSELDRMIDDYSNTKSDPEFLRKKLMEEEKLHDKDMVDRILHDIENGGFRKRGR 718
            E SD YDSEL++M+DDY+ T  DP  +R+ L  E+K +D+ +V++ILHDI+NGGFR+RG+
Sbjct: 839  ELSDEYDSELEKMVDDYTKTTFDPAEIRQMLAAEDKEYDEKIVNKILHDIKNGGFRRRGK 898

Query: 719  YAMXXXXXXXXXXXXXRYHARRKELLNERKSGNQEISVLATNPKSKAFFDSIFEDDLK-- 776
             A+             RYHA+R+ELL ++   N E S L +NPKS AFF+S+ ED ++  
Sbjct: 899  GALDIELSDDEDDELQRYHAKRRELLRQKVLENGEASKLVSNPKSHAFFESMVEDLVESK 958

Query: 777  -------------GGIA---NLKEYQSHASPLKAAKDEISGKRE-TRISEQFVQKTLSFL 819
                         G I+    +     H +   A    +  +R+  +IS++FVQ++LSFL
Sbjct: 959  NPFSIGETADPDSGAISENDKVDNASEHGTQPDAGGQPVRTERKRIKISQEFVQRSLSFL 1018

Query: 820  KSKEDEQGDAEF-VSVADTQESSSG-DFAEATDFYRLKQLSGIKSFSAPLRSSIRLQVRN 877
             SK++   + E    +A  Q S+ G D  +  D + LKQ S IK+   P R+S R     
Sbjct: 1019 NSKDELDNEFELDRRLAKHQHSTLGDDNDDLEDLFTLKQNSCIKTLHTPARTSSRTVDLE 1078

Query: 878  KDG--VLSGKANTTLVERFVRSVDTNEKFEEGRKTVKSLNSYKIAGSSRASITFLGKARS 935
             DG    +G    +++  F   +D NEKF+EG KTVK   SYK  G SRASIT+LGK R 
Sbjct: 1079 VDGNSPANGFKLPSVISSFSSRIDINEKFKEGTKTVKVSKSYKTIGGSRASITYLGKVRK 1138

Query: 936  LKARKRGPHARSAPHGQKIMTSHQ----FFASDGQSFE 969
            L A KR    R    G +   +       FA +  SFE
Sbjct: 1139 LNAPKRKESGRKPVFGHRHPEAAPKRAGLFADNDDSFE 1176

 Score = 84.7 bits (208), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 54/136 (39%), Positives = 82/136 (60%), Gaps = 5/136 (3%)

Query: 299 GFAPLQLYHTILKQRLTDANXXXXXXXXXXXXXXXXXLS--SKAAILDLKARMSKKKQSL 356
           G+ PL  Y   LK RL D+                   S  SKAA+L++KAR S K+Q +
Sbjct: 408 GWVPLNSYKNQLKARL-DSKEHIDLDSSSDEDENSVPASKMSKAAVLEIKARTS-KRQGI 465

Query: 357 AVTSSKETMPSA-SLRHLFSSLRKANRDQLVEHRNGLLLLRGVDLAEIAKEKESVESLLE 415
             T  + + P A SL+ LFSSL+KAN+ Q+++HR  +   RG++L +I +EK+ VE+LLE
Sbjct: 466 KKTRQQPSTPRAPSLKELFSSLKKANKKQILDHRREITEKRGLNLEDIEREKKEVENLLE 525

Query: 416 RELARNKKVKQEEIQK 431
           +E+ RN+K++  E Q+
Sbjct: 526 QEIERNRKIRLREKQR 541

 Score = 47.0 bits (110), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 34/115 (29%), Positives = 57/115 (49%), Gaps = 22/115 (19%)

Query: 1   MDLIDQLSN---PRTKRSGFVKKLHLF-------DDESCPTVGGTGFLFENS-IFNQVKK 49
           MD +D L +   P+ K++ +VK + ++       +++  P +    FLF NS I ++VK 
Sbjct: 1   MDFLDALGDLKHPKKKKTTYVKDIEVYATQEENDEEKKQPQLSSASFLFGNSTIVDKVKS 60

Query: 50  RIKATDDNEINHNAPTTASTEILKDTCETQAIERPYDGEELETDFVLAKAPSEPK 104
           R+    + E +         E      +TQ I   YDGE+LE DFV   +P +P+
Sbjct: 61  RLNGVSNEETD--------GERGDALPQTQVIPNYYDGEDLEQDFV---SPPKPR 104

>Smik_3.14 Chr3 complement(20226..23567) [3342 bp, 1113 aa] {ON}
            YCL061C (REAL)
          Length = 1113

 Score =  211 bits (537), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 170/512 (33%), Positives = 261/512 (50%), Gaps = 63/512 (12%)

Query: 515  VTKKKKV----RRWNLIDSDDEALSNDE------QKTVIDLGAYGENILGTERIDEGAGA 564
            V KKKK     R  +  DS++EA+  ++      ++  I+LG YG+NI   E +++    
Sbjct: 607  VPKKKKAHHVKRMIDESDSENEAVPKEKVDASVPKRIAINLGHYGDNI--EEEVNKFQET 664

Query: 565  QVVGTSSSMCEAKLERNTTKSPVRILNRPCEEKIDQDEETRNPIIKNLIEKRKL----KE 620
              + T  +  +  +ERN  ++   + +    ++ + +EE    I + LI+K KL    KE
Sbjct: 665  NDMNTQQT-DKITMERNIVENKAILEDTAVVDEDNINEEADEAIRRELIDKEKLQLRQKE 723

Query: 621  ALREAKMKELNRSKANGMIDFEAEESDDEWFGVGGADGENSDGYDSELDRMIDDYSNTKS 680
              +  K+KEL         + EAEESDDEW G+GGADGE SD YDS++++MIDDYS    
Sbjct: 724  LEKAIKLKELKHKGVTNFFEMEAEESDDEWHGIGGADGEGSDEYDSDVEKMIDDYSKNNF 783

Query: 681  DPEFLRKKLMEEEKLHDKDMVDRILHDIENGGFR-KRGRYAMXXXXXXXXXXXXXRYHAR 739
            +   +R+ L  E K  D  M+++IL+DI+NGGFR KR + ++             +Y  +
Sbjct: 784  NSHEIREMLAAENKEMDVKMINKILYDIKNGGFRNKRAKNSLELELSDDEDDVLQQYRLK 843

Query: 740  RKELLNERKSGNQEISVLATNPKSKAFFDSIFEDDLKGGIANLKEYQSHASPLKAAKD-- 797
            R+EL+ +R+    + + L  NPKSKAFF+S+ ED ++       E +S+      A D  
Sbjct: 844  RRELMRKRRLEIGDGTKLVKNPKSKAFFESMVEDIMEYKNPFRAEEESNQDITSTATDLD 903

Query: 798  -----EISGKRETR---------------ISEQFVQKTLSFLKSKEDEQGDAEFVSVADT 837
                  ++ +  TR               ISE FVQK+LSFLKS    + + +   +A  
Sbjct: 904  TLDNNSLNVRDSTRNNEKGPVDDKSKKIIISEDFVQKSLSFLKSNNYNEFEMD-KELAKM 962

Query: 838  QESSSGDFAEATDFYRLKQLSGIKSF---------SAPLRSSIRLQVRNKD--------- 879
            Q  +  +  E  D + LKQ S IKSF         S  + + I L+ R +D         
Sbjct: 963  QHGNDDEPIE--DLFTLKQHSSIKSFTNSQTDSFTSRTVTTMIDLEKRTEDEDEMENGDS 1020

Query: 880  GVLSGKANTTLVERFVRSVDTNEKFEEGRKTVKSLNSYKIAGSSRASITFLGKARSLKA- 938
             ++SG  + ++V+ F    D N+KF+EG KTVK   SYK+ GSS+ASIT++GK R L A 
Sbjct: 1021 SLVSGFKHPSIVKSFASRTDINDKFKEGNKTVKISKSYKMVGSSKASITYMGKTRKLMAP 1080

Query: 939  -RKRGPHARSAPHGQKIMTSHQFFASDGQSFE 969
             RK G       H +    + + F S   SF+
Sbjct: 1081 KRKAGTDQNHHRHKKTKTKTSKLFESGQNSFD 1112

 Score = 73.9 bits (180), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 42/93 (45%), Positives = 66/93 (70%), Gaps = 4/93 (4%)

Query: 338 SKAAILDLKARMSKKKQSLAVTSSKETMPSASLRH--LFSSLRKANRDQLVEHRNGLLLL 395
           SKA IL+LKAR+SK+ Q ++    +     A L H  LF++LRKA+R Q+++H+  ++  
Sbjct: 453 SKATILNLKARLSKQNQDISQRPLEGR--DARLDHNKLFNTLRKASRKQILDHQREVIET 510

Query: 396 RGVDLAEIAKEKESVESLLERELARNKKVKQEE 428
           +G  L ++ KEKE VE+LLE+E+ RNKK++Q+E
Sbjct: 511 KGFKLEDMVKEKELVENLLEQEIIRNKKIRQKE 543

 Score = 35.8 bits (81), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 55/205 (26%), Positives = 86/205 (41%), Gaps = 37/205 (18%)

Query: 21  LHLFDDESCPTVGGTGFLFENSIFNQVKKRIKATDDNEINHNAPTTASTEILKDTCETQA 80
           L+  D  + P + G GFLF N+  N+VK R++     E  H+          +D   +Q 
Sbjct: 38  LYTNDIVAPPALTGNGFLFANATLNRVKNRLEGGKAPEQEHDNKDDED----EDVSSSQL 93

Query: 81  IERPYD-GEELETDFVLAKAPSEPKDNEVRASQSSSRLKFQAQQEFTASGE----TRLDN 135
           I   Y+ GE+LE          E K NE   +  +    F   Q    S +      +  
Sbjct: 94  IANLYEGGEDLE----------ETKSNENDCTGKNCMPTFTQTQRIPVSIQQDKVVDVPI 143

Query: 136 HKEADIANTQLIGD-----------SISSTSICDEDLETQKTSSNDMIT-SLTTQKIDLS 183
           H   +   TQ+I D            +S+T+I  + + TQ+  S+D+IT S     I   
Sbjct: 144 HSVNEEKPTQIIKDDCFVNKIPQAQKLSTTTI--KPVATQRIDSDDIITQSQQALPIKPI 201

Query: 184 HSPIKGTLQATSRDDNLE---PPTV 205
            SP +G   ATS D +++   PP +
Sbjct: 202 ESPSQGKT-ATSNDLDVQSSKPPVL 225

>YCL061C Chr3 complement(18816..22106) [3291 bp, 1096 aa] {ON}
            MRC1S-phase checkpoint protein required for DNA
            replication; interacts with and stabilizes Pol2p at
            stalled replication forks during stress, where it forms a
            pausing complex with Tof1p and is phosphorylated by
            Mec1p; protects uncapped telomeres
          Length = 1096

 Score =  207 bits (526), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 189/534 (35%), Positives = 269/534 (50%), Gaps = 83/534 (15%)

Query: 504  AESDEEDDPLNVTKKKKVRRWNLI---DSDDEALSNDEQKT--------VIDLGAYGENI 552
            ++S++EDD + + +KK     ++I   DSD E  +  ++K          I+LG YG+NI
Sbjct: 579  SDSEKEDDEIILKQKKSHHVKHIINESDSDTEVEAKPKEKADESLPKRIAINLGHYGDNI 638

Query: 553  LGTERIDEGAGAQVVGTSSSMCEAKLERNTTKSPVRILNRPCEEKIDQDEETRNPIIKNL 612
               E  D+     V+ T + + E   ERNT ++ V+       + +  +EE    I + L
Sbjct: 639  --GEDTDKFQETNVLDTQN-IEEVMAERNTIENEVK-------DDVYVNEEADEAIRRQL 688

Query: 613  IEKRKL----KEALREAKMKELNRSKANGMIDFEAEESDDEWFGVGGADGENSDGYDSEL 668
            I+K KL    KE   EAK+KEL +       + EAEES+DEW G+GGADGE SD YDS+L
Sbjct: 689  IDKEKLQLKQKEKEHEAKIKELKKRGVTNFFEMEAEESEDEWHGIGGADGEGSDDYDSDL 748

Query: 669  DRMIDDYSNTKSDPEFLRKKLMEEEKLHDKDMVDRILHDIENGGFR-KRGR-YAMXXXXX 726
            ++MIDDYS    +P  +R+ L  E K  D  M+++IL+DI+NGGFR KR +         
Sbjct: 749  EKMIDDYSKNNFNPHEIREMLAAENKEMDIKMINKILYDIKNGGFRNKRAKNSLELELSD 808

Query: 727  XXXXXXXXRYHARRKELLNERKSGNQEISVLATNPKSKAFFDSIFED--DLKGGIANLKE 784
                    +Y  +R+EL+ +R+    + + L  NPKS AFF+S+ ED  + K      +E
Sbjct: 809  DDEDDVLQQYRLKRRELMRKRRLEIGDDAKLVKNPKSSAFFESMVEDIIEYKNPFGAEEE 868

Query: 785  YQ----SHASPLKAAKDEI-----SGKRETR----------ISEQFVQKTLSFLKSK--E 823
            Y     S A+ L    + I     +G  E +          ISE FVQK+LSFLKS   E
Sbjct: 869  YNLDITSTATDLDTQDNSINVGDNTGNNEQKPVDQKNKKVIISEDFVQKSLSFLKSNNYE 928

Query: 824  DEQGDAEFVSVADTQESSSGDFAEATDFYRLKQLSGIKSF---------SAPLRSSIRL- 873
            D + D E   +        G+     D Y LKQ S IKSF         S  + + I L 
Sbjct: 929  DFETDKELSRI------QHGNDEAIEDLYTLKQNSSIKSFTNSQTDSTTSKTVNTIIDLE 982

Query: 874  -------QVRNKDGVLSGK-ANTTLVERFVRSVDTNEKFEEGRKTVKSLNSYKIAGSSRA 925
                   +V N D  L G   + ++++ F    D N+KF+EG KTVK L SYK  GSS+A
Sbjct: 983  KRPEDEDEVENGDTSLVGVFKHPSIIKSFASRTDINDKFKEGNKTVKILKSYKTVGSSKA 1042

Query: 926  SITFLGKARSLKARKR---GPHARSAPH------GQKIMTSHQFFASDGQSFEN 970
            SIT++GK R L A KR   G H     H       +    S++ F S   SF+N
Sbjct: 1043 SITYMGKTRKLIAPKRKTEGSHRYHHDHHNKKMKMKTKTKSNKLFESGQDSFDN 1096

 Score = 81.3 bits (199), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 41/91 (45%), Positives = 66/91 (72%)

Query: 338 SKAAILDLKARMSKKKQSLAVTSSKETMPSASLRHLFSSLRKANRDQLVEHRNGLLLLRG 397
           SKA IL+LKAR+SK+ Q L+   +K   P      L ++LRKA+R Q+++H+  ++  +G
Sbjct: 437 SKATILNLKARLSKQNQKLSQRPNKSKDPKVDHNVLLNTLRKASRKQILDHQKEVIETKG 496

Query: 398 VDLAEIAKEKESVESLLERELARNKKVKQEE 428
           + L ++AKEKE VE+LLE+E+ RNK+++Q+E
Sbjct: 497 LKLEDMAKEKEIVENLLEQEILRNKRIRQKE 527

 Score = 42.7 bits (99), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 34/92 (36%), Positives = 44/92 (47%), Gaps = 13/92 (14%)

Query: 25  DDESCPTVGGTGFLFENSIFNQVKKRIKATDDNEINHNAPTTASTEILKDTCETQAIERP 84
           D ++ P + G GFLF N+  N+VK R++     E NHN     S    +++  TQ I   
Sbjct: 41  DIDNPPELTGNGFLFANATLNRVKNRLEGKKAPEQNHNNGKDRS----ENSLPTQLISNL 96

Query: 85  YD-GEELETDFVLAKAPSEPKDNEVRASQSSS 115
           YD GEELE         SE KDN       SS
Sbjct: 97  YDGGEELEK--------SEVKDNSYSEKNVSS 120

>Ecym_1008 Chr1 complement(13340..16696) [3357 bp, 1118 aa] {ON}
            similar to Ashbya gossypii AFR745W
          Length = 1118

 Score =  203 bits (517), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 156/462 (33%), Positives = 236/462 (51%), Gaps = 37/462 (8%)

Query: 540  KTVIDLGAYGENI-LG-----------TERIDEGAGAQVVGTSSSMCEAKLERNTTKSPV 587
            K  IDLGAYG+N+ LG           T RI +  G     ++++  + K +     S +
Sbjct: 661  KNTIDLGAYGDNLNLGNAGLPNNDEYLTYRIKKFEGLSPSKSATTELDVKSDLAAESSIL 720

Query: 588  RIL--------------NRPCEEKIDQDEETRNPIIKNLIEKRKLKEALREAKMKELNRS 633
              +                  EE  ++ EE +  I+K L+ K +L+E ++  K KE+ + 
Sbjct: 721  ETIKDGNWRLKKSGEIETGEEEEPKEEGEEEKRKIVKELMLKLRLQEKIKRQKQKEMRKL 780

Query: 634  KANGMIDFEAEESDDEWFGVGGADGENSDGYDSELDRMIDDYSNTKSDPEFLRKKLMEEE 693
              N M++ EA+ES+DEW GVGG D E SD YDS+LD+MIDDY+  + DP  +RK L  E+
Sbjct: 781  GVNKMVELEADESEDEWHGVGGVDYEASDEYDSDLDKMIDDYNKNEFDPVEIRKILASED 840

Query: 694  KLHDKDMVDRILHDIENGGFRKRGRYAMXXXXXXXXXXXXXRYHARRKELLNERKSGNQE 753
              HDK+MV++ILHDI+ GGFRKRGR  +              Y A+R     ++   ++ 
Sbjct: 841  LQHDKNMVNKILHDIKTGGFRKRGRGELDLELSEDEDGILQSYRAKRWNEQKQKMLDSEH 900

Query: 754  ISVLATNPKSKAFFDSIFEDDLKGGIANLKEYQSHASPLKAAKDEISGKRETR----ISE 809
             + + +NPKS  FF+S+ ++     I   +   +  SP   + + +  K+ T+    ISE
Sbjct: 901  NTSVKSNPKSLPFFESMVDE---FTIPVERALGTPDSPPAQSTNVLELKQNTKQKIVISE 957

Query: 810  QFVQKTLSFLKSKEDEQGDAEFVSVADTQESSSGDFAEATDFYRLKQLSGIKSFSAPLRS 869
             FV++TLSFL S E+       ++V      +    +E  D Y LK+ S IK  +    S
Sbjct: 958  HFVKQTLSFLTSDENMTNMRSEINVEKPNNDNDIYSSEVEDLYTLKETSTIKVLNT--YS 1015

Query: 870  SIRLQVRNKDGVLSGKANTTLVERFVRSVDTNEKFEEGRKTVKSLNSYKIAGSSRASITF 929
               +   ++DG   G    ++++ F    D N+KF++G K+VK  N YK  GSSRA+ITF
Sbjct: 1016 GKPIVNEDEDGAEFGFKAPSVMQTFGSRNDVNDKFKDGFKSVKISNKYKTLGSSRAAITF 1075

Query: 930  LGKARSLKARKRGPHAR--SAPHGQKIMTSHQFFASDGQSFE 969
            LGK R L   KR   +   SA    K    HQ F  +  +FE
Sbjct: 1076 LGKKRKLIIPKRSSKSPRDSAHRSIKNRLKHQAFLENTDTFE 1117

 Score = 67.8 bits (164), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 34/93 (36%), Positives = 66/93 (70%), Gaps = 2/93 (2%)

Query: 339 KAAILDLKARMSKKKQSLAVTSSKETMPSASLRHLFSSLRKANRDQLVEHRNGLLLLRGV 398
           KAA+L++KA++SK        ++++++ S +L+ LF SL+KAN+ Q+++HR  +   RG+
Sbjct: 443 KAALLNIKAKISKNMN--LSKNAEQSINSPTLKQLFISLKKANKKQILDHRREITEKRGI 500

Query: 399 DLAEIAKEKESVESLLERELARNKKVKQEEIQK 431
            L ++ +E+E VE LLE+++ RN++++  E +K
Sbjct: 501 SLEQLEQEREKVEDLLEQKIKRNRRIRLREKKK 533

>KLLA0C00484g Chr3 complement(35397..38174) [2778 bp, 925 aa] {ON}
           weakly similar to uniprot|P25588 Saccharomyces
           cerevisiae YCL061C MRC1 S-phase checkpoint protein found
           at replication forks required for DNA replication also
           required for Rad53p activation during DNA replication
           stress where it forms a replication-pausing complex with
           Tof1p and is phosphorylated by Mec1p protein involved in
           replication checkpoint
          Length = 925

 Score =  196 bits (497), Expect = 6e-51,   Method: Compositional matrix adjust.
 Identities = 155/434 (35%), Positives = 231/434 (53%), Gaps = 34/434 (7%)

Query: 543 IDLGAYGENILGTERIDEGAGAQVVGTSSSMCEAKLER-NTTKSPVRILNRPCEEKIDQ- 600
           I+LG YG+N+  +   +     Q      S  E K+ R ++ K  V  L+       D  
Sbjct: 517 INLGHYGDNLTSSNVTENDGADQSDRNVPSNSELKMNRSHSAKLLVGELSSDSSVDSDSS 576

Query: 601 ----DEETRNPIIKNLIEKRKLKEALREAKMKELNRSKANGMIDFEAEESDDEWFGVGGA 656
               DE  RN + +    +R+++    + + + L  +  N +++ EAEES+DEW GVGGA
Sbjct: 577 EDELDEVERNRLQERAKMRRRMEIEAAKKRKQVLKSTGLNKILEMEAEESEDEWHGVGGA 636

Query: 657 DGENSDGYDSELDRMIDDYSNTKSDPEFLRKKLMEEEKLHDKDMVDRILHDIENGGFRKR 716
           DGENSD YDS+LD MIDD+S +K D   +R++L  E K  D+ M+++ILHDI  GGFRKR
Sbjct: 637 DGENSDDYDSDLDTMIDDFSKSKFDTASIRERLALENKEMDERMINKILHDINTGGFRKR 696

Query: 717 GRYAMXXXXXXXXXXXXXRYHARRKELLNERKSGNQEISVLATNPKSKAFFDSIFEDDLK 776
           GR A+             ++  +R+E++ ++   N  +  +  N KSKAFFDS+ ED  +
Sbjct: 697 GRGALDLELSDDEDELLRQFREKRREIMKQKLLEN--VDGVVNNSKSKAFFDSMVEDITR 754

Query: 777 GGIANLKEYQSHASPLKAAKDEISGKRETRISEQFVQKTLSFLKSKEDEQGDAEFVSVAD 836
             I  +  + +        +DE+ GK++  ISE+FVQ +LSFL +K+D+  + E    A 
Sbjct: 755 KSIPAVTSFSN-------TRDEM-GKKKIVISEEFVQSSLSFLSAKDDDINEFEVTEAA- 805

Query: 837 TQESSSGDFAEAT-DFYRLKQLSGIKSFSAPLRSSIRLQVRNKDGVLSGKANTTLVERFV 895
                     +AT D   LKQ S IKS  +P R+       + DG        ++V+ F 
Sbjct: 806 ---------HDATEDLESLKQRSNIKSLDSPQRNRNSAFFDDVDGTSLDFKLPSIVKSFS 856

Query: 896 RSVDTNEKFEEGRKTVKSLNSYKIAGSSRASITFLGKARSLKARKRGPHAR-SAPHGQKI 954
            + D N+KF+ G KTV    SY++A  SR++ITFLGK R LKA    P  R S P  +K 
Sbjct: 857 SNSDVNDKFKTGIKTVTISKSYRVASGSRSAITFLGKKRKLKA----PQGRKSTPLVRKP 912

Query: 955 MTSHQFFASDGQSF 968
            +S   F S+  SF
Sbjct: 913 TSS--LFDSNSDSF 924

 Score = 64.3 bits (155), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 41/92 (44%), Positives = 58/92 (63%), Gaps = 2/92 (2%)

Query: 337 SSKAAILDLKARMSKKKQSLAVTSSKETMPSASLRHLFSSLRKANRDQLVEHRNGLLLLR 396
           SSKAA+L +KA+ S+ K + A      T+ S  L+ LF+SL+  NRDQ++E R  +   +
Sbjct: 338 SSKAALLLIKAKRSRNKATKAKNMHVSTVDS--LKELFTSLKTKNRDQILEFRREISGKK 395

Query: 397 GVDLAEIAKEKESVESLLERELARNKKVKQEE 428
           G+ L  I  EK  VE LLE+EL RN++VK  E
Sbjct: 396 GISLEAIEDEKIQVEKLLEQELERNRRVKLRE 427

>AFR745W Chr6 (1803046..1806102) [3057 bp, 1018 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YCL061C (MRC1)
          Length = 1018

 Score =  186 bits (473), Expect = 9e-48,   Method: Compositional matrix adjust.
 Identities = 143/462 (30%), Positives = 231/462 (50%), Gaps = 43/462 (9%)

Query: 508 EEDDPLNVTKKKKVRRWNLIDSDDEALSNDEQKTVIDLGAYGENILGTERIDEGAGAQVV 567
           EE D   VTK++   R  L+ SDDE     E +  I LG YG NI   +   E  G+ + 
Sbjct: 532 EESDHSVVTKRRS--RRILVQSDDEGTETTENRQAIHLGVYGNNIKPQDTGPEARGSYLT 589

Query: 568 GTSSSMCEAKLERNTTKSPVRI----------------LNRPCEEKIDQ----------- 600
                  +    + TT +P  +                LN   ++ + +           
Sbjct: 590 SRIKKYDDLSPVKTTTSTPKGLTDGRAELDHESPDGHSLNTNLQQGLSKSESSSTKVSED 649

Query: 601 --DEETRNPIIKNLIEKRKLKEALREAKMKELNRSKANGMIDFEAEESDDEWFGVGGADG 658
             D+ETR  I+ +L+ + + +    + + +E+ +     M++ EAEES+DEW G+GG+D 
Sbjct: 650 ELDQETRRKILSDLLARNRKRAERNKLRRREMKKKGITKMLEMEAEESEDEWHGIGGSDN 709

Query: 659 ENSDGYDSELDRMIDDYSNTKSDPEFLRKKLMEEEKLHDKDMVDRILHDIENGGFRKRGR 718
           E S+ YDSE+++MIDDYS   S+ + LR  L + E+ HD+++V++ILHDI  GGFR+RG+
Sbjct: 710 ELSEDYDSEVEKMIDDYSVHSSNADHLRAILAKNERQHDENIVNKILHDISTGGFRRRGK 769

Query: 719 YAMXXXXXXXXXXXXXRYHARRKELLNERKSGNQEISVLATNPKSKAFFDSIFEDDLKGG 778
            A+             ++  +R+ELL ++   N + S L +NPKS AFF ++ +D  +  
Sbjct: 770 GALDLEMSENEDQELQQFRQKRRELLKQKILENGDTSKLVSNPKSYAFFQTMVDDVTEAS 829

Query: 779 IANLKEYQSHASPLKAAKDEISGKRETRISEQFVQKTLSFLKSKEDEQGDAEFVSVADTQ 838
             N     +  + +    D  +  R+  ISEQFV++TLSFL SK    GD+E  +   + 
Sbjct: 830 FGN-----TFDANIDEKTDPSAAGRKIVISEQFVKETLSFLSSK---SGDSEIPAETKSI 881

Query: 839 ESSSGDFAEATDFYRLKQLSGIKSFSAPLRSSIRLQVRNK----DGVLSGKANTTLVERF 894
            SS+ +  E  D + LKQ S IK     L    ++   +     D   S     +  + F
Sbjct: 882 SSSTVEREEIQDLHTLKQNSNIKHLKGSLELPAQMAELSSGDEGDYGFSLDRFRSAAKSF 941

Query: 895 VRSVDTNEKFEEGRKTVKSLNSYKIAGSSRASITFLGKARSL 936
               + ++KF+ G K V+ L + K  G S+A+ITF+G+ R L
Sbjct: 942 NNGTNVDDKFKSGTKAVRILKANKTIGGSKAAITFIGRKRRL 983

 Score = 56.2 bits (134), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 37/83 (44%), Positives = 53/83 (63%), Gaps = 8/83 (9%)

Query: 338 SKAAILDLKARMSKKKQSLAVTSSK--ETMPSASLRHLFSSLRKANRDQLVEHRNGLLLL 395
           SKAA+L +KAR SK      +T  K  ET  S S   LF+ LRKANR+QL+E R   +  
Sbjct: 385 SKAAVLAIKARNSK-----FITPQKIDETKSSKS-NELFAKLRKANREQLLEQRRNAIER 438

Query: 396 RGVDLAEIAKEKESVESLLEREL 418
           RG+++  + +E+E + +LLE+EL
Sbjct: 439 RGINMQNLEQEREQLGNLLEQEL 461

>NCAS0B09110 Chr2 (1746358..1749420) [3063 bp, 1020 aa] {ON} Anc_1.5
            YCL061C
          Length = 1020

 Score =  183 bits (465), Expect = 9e-47,   Method: Compositional matrix adjust.
 Identities = 174/483 (36%), Positives = 255/483 (52%), Gaps = 49/483 (10%)

Query: 506  SDEEDDPL-NVTKKKKVRRWNLIDSDDEALSNDEQKTVIDLGAYGENILGTERIDEGAGA 564
            SDE++D +  +T+K+K     + +SDDE   N  +   IDLG YG N+     +      
Sbjct: 568  SDEDEDSIFQLTRKEKHPVRIIQESDDENEIN--KINTIDLGVYGGNLDNPNPL------ 619

Query: 565  QVVGTSSSMCEAKLERNTTKSPVRILNRPCEEKIDQDEETRNPIIKNLIEKRKLK--EAL 622
                  SS  E   +    KS          E  +  EE R+ +I  L EK++++  E  
Sbjct: 620  ------SSQTEPNEDDEDEKS--------TYENKEITEEERHALI--LAEKKRIQLIEKK 663

Query: 623  REAKMKELNRSKANGMIDFEAEESDDEWFGVGGADGENSDGYDSELDRMIDDYSNTKSDP 682
              A+ KE+ +   N + + EAEES+DEW G+GGADGE SD YDSE+++MIDDYS +  +P
Sbjct: 664  NAARTKEMKKKGVNKLFEMEAEESEDEWHGIGGADGEVSDEYDSEVEKMIDDYSKSNFNP 723

Query: 683  EFLRKKLMEEEKLHDKDMVDRILHDIENGGFRKRGRYAMXXXXXXXXXXXXX--RYHARR 740
            + +R+ L  E K  D +M+ +IL+DI+NGGFRKR R  +                YH R+
Sbjct: 724  DEIRQMLALENKEMDLNMITKILYDIKNGGFRKRRRGGLDLELSDDDEDDEELREYHKRK 783

Query: 741  KELLNERKSGNQEISVLATNPKSKAFFDSIFED--DLKGGIANLKEYQSHASPL----KA 794
            +EL+ +R     +   L  NPKSKAFF+S+ ED  D K    +++  +  ++ L    + 
Sbjct: 784  RELMKKRMLEIGDDKKLIKNPKSKAFFESMVEDIVDEKNAFGDIESIEKSSTELDTQEEK 843

Query: 795  AKDEISG--KRETRISEQFVQKTLSFLKSKEDEQGDAEFVSVADTQESSSGDFAEATDFY 852
             +D   G  K++  ISE+FVQKTLSFL+S  D +   EF    D  +   G+  E  D +
Sbjct: 844  EQDVTPGVDKKKNVISEEFVQKTLSFLRSGRDLE---EFNIEEDLAKEQHGENVE--DLF 898

Query: 853  RLKQLSGIKSFSAPLRSSIRLQVRNKDGV----LSGKANTTLVERFVRSVDTNEKFEEGR 908
             LKQ S IK F  P +++    + N + V    L G    ++++ F    D NEKF++G 
Sbjct: 899  SLKQRSTIKEFRNPSQTNTIDLINNVENVESSPLGGFKPPSVIKSFSSRTDINEKFKDGN 958

Query: 909  KTVKSLNSYKIAGSSRASITFLGKARSLKARKRGPHARSAPHGQKIM-TSHQFFASDGQS 967
            KTV     YK  GSS+ASIT+LGK+R L   K+  +      G KI  T    F+S  +S
Sbjct: 959  KTVTISKVYKTVGSSKASITYLGKSRKLMPPKKNKNREKI--GSKIKPTRSSLFSSHDES 1016

Query: 968  FEN 970
            FEN
Sbjct: 1017 FEN 1019

 Score = 76.6 bits (187), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 46/95 (48%), Positives = 67/95 (70%), Gaps = 5/95 (5%)

Query: 337 SSKAAILDLKARMSKKKQSLAVTSSKETMPSASLRHLFSSLRKANRDQLVEHRNGLLLLR 396
           +SKA +L+LKAR+SKKK    V S+K T  + SL  LF +L++A+R Q+++H+  L+  R
Sbjct: 400 TSKATLLNLKARLSKKK---PVKSNKST--NTSLDVLFQNLKQASRKQILDHQRELVENR 454

Query: 397 GVDLAEIAKEKESVESLLERELARNKKVKQEEIQK 431
           G  L +I KEKE VE+LLE E+ RNK+++  E QK
Sbjct: 455 GFKLEDIEKEKEIVENLLEEEIKRNKRIRMREKQK 489

 Score = 33.1 bits (74), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 19/81 (23%), Positives = 41/81 (50%), Gaps = 14/81 (17%)

Query: 3  LIDQLSNPRTKRSGFVKKLHL---FDDES--------CPTVGGTGFLFENSIFNQVKKRI 51
          + ++ S P+ +R    KK+H     D+E+         P V G GF+F N++ ++++ R+
Sbjct: 4  IFEEFSLPKKQRKTTYKKIHEEPNNDEEALTEAVDVMAPPVIGNGFIFGNALIDKIRNRL 63

Query: 52 KATDDNEINHNAPTTASTEIL 72
             ++ E   + P    T+++
Sbjct: 64 DGKENKE---DTPVPTQTQMI 81

>Skud_3.3 Chr3 complement(6855..10313) [3459 bp, 1152 aa] {ON} YCL061C
            (REAL)
          Length = 1152

 Score =  181 bits (460), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 160/451 (35%), Positives = 235/451 (52%), Gaps = 60/451 (13%)

Query: 539  QKTVIDLGAYGENILGTERIDEGAGAQVVGTSSSMCEAKLERNTTKSPVRILNRPCEEKI 598
            ++  IDLG YG+NI      DE A +     ++++   K++    K+         E + 
Sbjct: 682  KRNAIDLGHYGDNI------DEEA-SNSFEEATTLNTQKIDNIIIKTHTIENREEEEVEN 734

Query: 599  DQ-DEETRNPIIKNLIEKRKLKEALREAK-MKELNRSKANGMIDF---EAEESDDEWFGV 653
            D  DEE    I + LI+K+K +   +E K + EL   K+ G+ +F   EAEES+DEW GV
Sbjct: 735  DSIDEEVSEAIRRELIDKKKSQLRQKEKKHVAELKEFKSKGITNFFEMEAEESEDEWHGV 794

Query: 654  GGADGENSDGYDSELDRMIDDYSNTKSDPEFLRKKLMEEEKLHDKDMVDRILHDIENGGF 713
            GGADGE S+ YDSE+++MIDDYS    +   +R+ L  E K  D  M++RIL+DI+NGGF
Sbjct: 795  GGADGEGSEEYDSEVEKMIDDYSKNSFNSHEIREMLAAENKEMDVKMINRILYDIKNGGF 854

Query: 714  R-KRGRYAMXXXXXXXXXXXXXRYHARRKELLNERKSGNQEISVLATNPKSKAFFDSIFE 772
            R KR + ++             +Y  +R+EL+ +R+    + + L  NPKSKAFF+S+ E
Sbjct: 855  RNKRAKNSLELELSDDEDDVLQQYRLKRRELMRKRRLEIGDDTKLVKNPKSKAFFESMVE 914

Query: 773  DDLKGGIANLKEYQSHASPLKAAKD---------EISG-------------KRETRISEQ 810
            D ++       E +SH      A D         +I                ++T ISE 
Sbjct: 915  DIMEFKNPFKAEEESHQDLTSTATDLDTQDNDSIQIGDSTRNNEHRRVDDRSKKTIISED 974

Query: 811  FVQKTLSFLKSKE-DE-QGDAEFVSVADTQESSSGDFAEATDFYRLKQLSGIKSF----- 863
            FVQK+LSFL+S   DE + D E   +    +   GD     D + LKQ S IKSF     
Sbjct: 975  FVQKSLSFLRSNNYDEFEMDKERARI----QHDIGDEG-VEDLFTLKQHSSIKSFTNSPT 1029

Query: 864  ----SAPLRSSIRL--------QVRNKD-GVLSGKANTTLVERFVRSVDTNEKFEEGRKT 910
                S  + S I L        +V N+D  ++ G  + ++++ F    D N+KF+EG KT
Sbjct: 1030 DSLSSKRVNSMIDLEQPTEDNNEVENEDPSLIGGFKHPSIIKSFASRTDINDKFKEGNKT 1089

Query: 911  VKSLNSYKIAGSSRASITFLGKARSLKARKR 941
            VK   +YK  GSS+ASIT++GK R L A K+
Sbjct: 1090 VKISKTYKTVGSSKASITYMGKTRKLMAPKK 1120

 Score = 77.8 bits (190), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 40/89 (44%), Positives = 63/89 (70%)

Query: 338 SKAAILDLKARMSKKKQSLAVTSSKETMPSASLRHLFSSLRKANRDQLVEHRNGLLLLRG 397
           SKAAIL+LKAR+SK+ Q+L    +K          LF+ LRKA+R Q+++H+  ++  +G
Sbjct: 495 SKAAILNLKARLSKQSQNLTQMPNKNKGAKVDHNKLFNILRKASRKQILDHQREVIETKG 554

Query: 398 VDLAEIAKEKESVESLLERELARNKKVKQ 426
             L ++AKEKE VE+LLE+E+ RN++++Q
Sbjct: 555 FKLEDMAKEKEIVENLLEQEILRNRRIRQ 583

 Score = 37.7 bits (86), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 33/67 (49%), Gaps = 13/67 (19%)

Query: 30  PTVGGTGFLFENSIFNQVKKRIKAT----DDNEINHNAPTTASTEILKDTCETQAIERPY 85
           P + G GFLF N+  N+VK R++      DD +I  N          +D   TQ I   Y
Sbjct: 102 PALTGNGFLFGNATLNRVKNRLEGIDVPEDDRQIKDNEN--------EDAVSTQLIANLY 153

Query: 86  D-GEELE 91
           D GE+LE
Sbjct: 154 DGGEDLE 160

>TDEL0C06970 Chr3 (1264155..1266980) [2826 bp, 941 aa] {ON} Anc_1.5
           YCL061C
          Length = 941

 Score =  180 bits (457), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 151/440 (34%), Positives = 224/440 (50%), Gaps = 49/440 (11%)

Query: 541 TVIDLGAYGENILGTERIDEGAGAQVVGTSSSMCEAKLERNTTKSPVRILNRPCEEKIDQ 600
           + I+LGAYG+N++ T + DE        TS+     +L    ++S  R + +        
Sbjct: 541 SAINLGAYGDNLITTTK-DEA------HTSAEEHTTQLVNEISESQYRTMEK-------- 585

Query: 601 DEETRNPIIKNLIEKRKLKEALREAKMKELNRSKANGMIDFEAEESDDEWFGVGGADGEN 660
                        EK K++    + ++K++  S    M D EAEESDDEW GVGG DGE 
Sbjct: 586 -------------EKSKIRAQEEKQRLKQMKESGVTNMFDMEAEESDDEWRGVGGVDGET 632

Query: 661 SDGYDSELDRMIDDYSNTKSDPEFLRKKLMEEEKLHDKDMVDRILHDIENGGFRKRGRYA 720
            D YDS+L++MIDD+SNT S+ + +R+ LM E K  D   V++ILHDI+NGGFRKR +  
Sbjct: 633 IDDYDSDLEKMIDDFSNTTSNADQIRQLLMAENKETDLKTVNKILHDIKNGGFRKRRQNN 692

Query: 721 MXXXXXXXXXXXXXRYHARRKELLNERK-SGNQEISVLATNPKSKAFFDSIFED--DLKG 777
           +              Y  R+ EL+ +R+     +   L  N +SKAFF+S+ ED  DLK 
Sbjct: 693 LQLELSDDEDDELLNYKKRKLELMRKRRLQFGADDKKLLKNSRSKAFFESMVEDIIDLKD 752

Query: 778 GIANLKEYQSHASPLKAAKDEISGKRETRISEQFVQKTLSFLKSKEDEQGDAEFVSVADT 837
             +N  E        +   D  S K++  IS +FVQ++LSFL S  D    +EF     +
Sbjct: 753 PFSNQAETSEKDKKSEGLVD-ASNKQKDTISHEFVQQSLSFLSSSRDF---SEFEVARVS 808

Query: 838 QESSSGDFAEATDFYRLKQLSGIKSFSAPLRSSIRLQVRNKD------GVLSGKAN-TTL 890
           QE         TD   LKQ S +K+  AP  S+I  +    D       VL  +++ +++
Sbjct: 809 QEGERN-----TDLNSLKQDSTVKTLYAP--SNIISESERADHEEFDNSVLPVESSYSSV 861

Query: 891 VERFVRSVDTNEKFEEGRKTVKSLNSYKIAGSSRASITFLGKARSLKARKRGPHARSAPH 950
           V+ F   ++ N+K +EGRKTV    SY+  G ++ASIT+LGK R L A K+         
Sbjct: 862 VKSFGFDLNANDKLKEGRKTVTVSKSYRTVGGNKASITYLGKMRKLVAPKKSNAEVRTTS 921

Query: 951 GQKIMTSHQFFASDGQSFEN 970
               + + + F +   SFEN
Sbjct: 922 KLSTLGNSKIFRNFESSFEN 941

 Score = 59.7 bits (143), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 34/96 (35%), Positives = 61/96 (63%), Gaps = 5/96 (5%)

Query: 338 SKAAILDLKARMSKKKQSLAVTSSKETMPSASLRHLFSSLRKANRDQLVEHRNGLLLLRG 397
           +KA +L LKAR+SK++  +     K     ASL  L  +LR + + Q+++ +   +  +G
Sbjct: 356 AKATVLKLKARLSKRRPPVESQHGK-----ASLSALMKNLRNSTKRQILDRQKEGIERQG 410

Query: 398 VDLAEIAKEKESVESLLERELARNKKVKQEEIQKGE 433
           +   ++ KEKE VE+LLE+E+ARNK+++ +E +K +
Sbjct: 411 LKFEDVEKEKEIVENLLEQEIARNKRIRMKEKEKAQ 446

 Score = 32.7 bits (73), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 41/87 (47%), Gaps = 18/87 (20%)

Query: 11 RTKRSGFVKKLHLFDDESC------PTVGGTGFLFENSIFNQVKKRIKATDDNEINHNAP 64
          + +R+ + K +   DDE        P V G GFLF +S  ++VK R+    D E    A 
Sbjct: 13 KKRRATYQKAVQNEDDEYTEDPLVPPAVLGNGFLFNSSTLDKVKNRLNK--DQEQGTQAI 70

Query: 65 TTASTEILKDTCETQAIERPYDGEELE 91
           T  T++L +  E        DGE+LE
Sbjct: 71 DT--TQVLSNLYE--------DGEDLE 87

>CAGL0B00330g Chr2 complement(18031..21441) [3411 bp, 1136 aa] {ON}
            similar to uniprot|P25588 Saccharomyces cerevisiae
            YCL061c
          Length = 1136

 Score =  180 bits (457), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 138/364 (37%), Positives = 198/364 (54%), Gaps = 24/364 (6%)

Query: 596  EKIDQDEETRNPIIKNLIEKRKLKEALREAKMKELNRSKANGMIDFEAEESDDEWFGVGG 655
            E ID ++E R   IK  +++++ +E     K++EL     N   + EAEESDDEW G+GG
Sbjct: 765  EDIDTEQE-RIAAIKQQVKRQQEREVKERKKLQELANKGVNQYFEEEAEESDDEWRGIGG 823

Query: 656  ADGENSDGYDSELDRMIDDYSNTKSDPEFLRKKLMEEEKLHDKDMVDRILHDIENGGFRK 715
             DG++   YDSE+++MIDDYS T+ D   LR+K+M+E K  D  +V++IL+DI+NGGFRK
Sbjct: 824  VDGDDFGEYDSEVEKMIDDYSKTEVDLTSLRQKIMDENKEMDLKLVNKILYDIKNGGFRK 883

Query: 716  RGRYAMXXXXXXXXXXXXXRYHARRKELLNERKSGNQEISVLATNPKSKAFFDSIFE--- 772
            RGR  M              +  +R+EL+ +R   N++   L  NPKSKAFF+S+     
Sbjct: 884  RGRNDMELEFSDDEDAELQEFRRKRRELMKQRMLENEDTDKLTKNPKSKAFFESMIVDLV 943

Query: 773  ------DDLKGGIANLKEYQSHASPLKAAKDEISGKR-ETRISEQFVQKTLSFLKSKEDE 825
                  DDL   I   +E  +     K   +  S KR + RISE FVQKTLSFL + E  
Sbjct: 944  EDKNNFDDLSDQIELKEENITQEDNEKEYNEAKSNKRGKIRISEDFVQKTLSFLHNDEST 1003

Query: 826  QGDAEF-VSVADTQESSSGDFAEATDFYRLKQLSGIKSFSAPLRSSIRLQVRNKDGV--L 882
            Q   EF  S   ++E   GD         LK  S + SF + L +S ++    +D +   
Sbjct: 1004 Q---EFQPSFIMSKEKGIGDMN------ALKSNSSL-SFCSKLSTSRKIINDEEDVIEEF 1053

Query: 883  SGKANTTLVERFVRSVDTNEKFEEGRKTVKSLNSYKIAGSSRASITFLGKARSLKARKRG 942
                  ++++ F      ++KF++G K+VK   SYK  G S+ASIT+LGK R L   K G
Sbjct: 1054 ESFKRPSIIQSFSSKFTIDDKFKDGNKSVKVSTSYKTVGGSKASITYLGKTRKLVPPKNG 1113

Query: 943  PHAR 946
            P  R
Sbjct: 1114 PTVR 1117

 Score = 67.0 bits (162), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 61/94 (64%), Gaps = 5/94 (5%)

Query: 338 SKAAILDLKARMSKKKQSLAVTSSKETMPSASLRHLFSSLRKANRDQLVEHRNGLLLLRG 397
           SKA +L+LK R+SKKK    V + K+     S   LF++LRKA + Q++ HR  L+  RG
Sbjct: 536 SKATLLNLKVRLSKKKPVKKVHNEKD-----STNLLFNNLRKATKQQIMLHRKELMESRG 590

Query: 398 VDLAEIAKEKESVESLLERELARNKKVKQEEIQK 431
           ++  ++ K+K  VE LLE+E+ RN K+++ E +K
Sbjct: 591 LNFEDLEKQKVMVEDLLEKEIERNLKIREREKRK 624

>Suva_3.152 Chr3 complement(228665..232087) [3423 bp, 1140 aa] {ON}
            YCL061C (REAL)
          Length = 1140

 Score =  180 bits (456), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 177/531 (33%), Positives = 252/531 (47%), Gaps = 83/531 (15%)

Query: 514  NVTKKKKVRRWNLIDSDDEALSNDEQK-------------TVIDLGAYGENI-------- 552
            N+T KKK  R   I  + ++   DEQK               IDLG YG NI        
Sbjct: 617  NITNKKKPYRTKHILDESDSEVEDEQKMEVEKNVENVPKRNAIDLGHYGNNIDVDGSNSF 676

Query: 553  -----LGTERIDEGAGAQVVGTSSSMCEAKLERNTTKSPVRILNRPCEEKIDQDEETRNP 607
                 L T+++ E                + +  T  +     N   +   +  E  R  
Sbjct: 677  QAAIVLDTQQVGEITTQTKTTEHEDDEGEEEKEETDDNDDDDDNDDDDNDDEVSEAIRRE 736

Query: 608  IIKNLIEKRKLKEALREAKMKELNRSKANGMIDF---EAEESDDEWFGVGGADGENSDGY 664
            +I     +R+ KE  +  K+KEL   K+ G+ +F   EAEES+DEW GVGGADGE SD Y
Sbjct: 737  LIDREKSERRQKEKEQATKLKEL---KSKGVTNFFEMEAEESEDEWHGVGGADGEGSDEY 793

Query: 665  DSELDRMIDDYSNTKSDPEFLRKKLMEEEKLHDKDMVDRILHDIENGGFR-KRGRYAMXX 723
            DSE+++MIDDYS  K +   +R+ L  E K  D  M+++IL+DI+NGGFR KR + ++  
Sbjct: 794  DSEVEKMIDDYSKNKFNSHEIREMLAAENKEMDVKMINKILYDIKNGGFRNKRAKNSLEL 853

Query: 724  XXXXXXXXXXXRYHARRKELLNERKSGNQEISVLATNPKSKAFFDSIFED--DLKGGIAN 781
                       +Y  +R+EL+ +R+    + + L  NPKSKAFF+S+ ED  + K     
Sbjct: 854  ELSDDEDDVLQQYRLKRRELMRKRRLEIGDDTKLVKNPKSKAFFESMVEDIMEFKNPFGA 913

Query: 782  LKE----YQSHASPLKA-------AKDEISGKRETR----------ISEQFVQKTLSFLK 820
             KE      S A+ L           D  S     +          ISE FVQK+LSFLK
Sbjct: 914  EKESDQDVTSTATDLDTQDNDNTKPGDNTSNNEHNKHVGDKSKKLIISEDFVQKSLSFLK 973

Query: 821  SKE-DE-QGDAEFVSVADTQESSSGDFAEATDFYRLKQLSGIKSF---------SAPLRS 869
            S   DE + D E   +    +  +G+  +  D + LKQ S IKSF         S  + +
Sbjct: 974  SNNYDEFEMDRELARI----QHGNGE-GDVVDLFTLKQHSSIKSFTNSQTNSLSSRTMNT 1028

Query: 870  SIRLQVR---NKDG------VLSGKANTTLVERFVRSVDTNEKFEEGRKTVKSLNSYKIA 920
             I L+     N +G      ++ G  + ++++ F    D N+KF+EG KTVK   SYK  
Sbjct: 1029 VINLEEHTEGNDEGENGDQSLIGGFKHPSVIKSFASRTDINDKFKEGNKTVKISKSYKTV 1088

Query: 921  GSSRASITFLGKARSLKARKRGPHARSAP-HGQKIMTSHQFFASDGQ-SFE 969
            GSS+ASIT++GK R L A KR       P H +K  T       +GQ SF+
Sbjct: 1089 GSSKASITYMGKTRKLMAPKRKTEENHHPNHIKKSKTQKSKLFENGQDSFD 1139

 Score = 68.9 bits (167), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 56/84 (66%)

Query: 338 SKAAILDLKARMSKKKQSLAVTSSKETMPSASLRHLFSSLRKANRDQLVEHRNGLLLLRG 397
           SKA I +LKAR+SK+ Q LA  S+K     +    L ++LRKA+R Q+++H+  ++  +G
Sbjct: 466 SKATIFNLKARLSKQNQKLAQGSNKNKDFKSDHNKLINTLRKASRKQILDHQREIVETKG 525

Query: 398 VDLAEIAKEKESVESLLERELARN 421
             L ++ KEKE VE LLE+E+ RN
Sbjct: 526 FKLEDMVKEKEIVEDLLEQEILRN 549

 Score = 37.4 bits (85), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 35/64 (54%), Gaps = 5/64 (7%)

Query: 30  PTVGGTGFLFENSIFNQVKKRIKATDDNEINHNAPTTASTEILKDTCETQAIERPYD-GE 88
           P + G GFLF N+  N+VK R++    NE+  +     + +  +D   TQ I   YD GE
Sbjct: 90  PALTGNGFLFGNATLNRVKNRLEGR--NELGQDGQDKENED--EDVFSTQLIANLYDGGE 145

Query: 89  ELET 92
           ELE+
Sbjct: 146 ELES 149

>NDAI0A00140 Chr1 complement(8373..11648) [3276 bp, 1091 aa] {ON}
            Anc_1.5 YCL061C
          Length = 1091

 Score =  178 bits (451), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 165/509 (32%), Positives = 247/509 (48%), Gaps = 87/509 (17%)

Query: 512  PLNVTKKKKVRRWNLIDSDDEALSNDEQKTV-----IDLGAYGENILGTERIDEGAGAQV 566
            PL ++K     R N + +   ++S D++ T+     IDLGAYG+N+         A  + 
Sbjct: 620  PLQLSK-----RSNGVTAKIISVSEDDEDTISKRNAIDLGAYGDNLTT-------ANVKS 667

Query: 567  VGTSSSMCEAKLERNTTKSPVRILNRPCEEKIDQDEETRNPIIKNLIEKRKLKEALREAK 626
                    +     N    P+ +     +E+ID            +IE  K K  +++ K
Sbjct: 668  QDDDDLEVDDDKNENLDTQPLELTE---QERID------------IIEAEKTKIKMQQEK 712

Query: 627  M----KELNRSKANGMIDFEAEESDDEWFGVGGADGENSDGYDSELDRMIDDYSNTKSDP 682
            M    KE+ +       + EAEES+DEW G+GG DGE SD YDS++++MIDDYS    DP
Sbjct: 713  MRHKEKEMMKKGVTKFFEMEAEESEDEWHGIGGIDGEMSDEYDSDVEKMIDDYSKANFDP 772

Query: 683  EFLRKKLMEEEKLHDKDMVDRILHDIENGGFRKRGRYAMXXXXXXXXXXXXXR-YHARRK 741
              +R+ L  E K  D +M+++IL+DI+NGGFRKR R  +             R YH +RK
Sbjct: 773  NEIREMLAAENKEMDLNMINKILYDIKNGGFRKRKRGGLELELSEDEDDDALREYHLKRK 832

Query: 742  ELLNERK--SGNQEISVLATNPKSKAFFDSIFED--DLKGGIANLKEYQSHASPLKAAKD 797
            EL+ +R+   G+ E   L  NPKSKAFF+S+ ED  D K    +    ++    +   +D
Sbjct: 833  ELMRKRRLELGDDE-KKLVKNPKSKAFFESMVEDITDDKNAFNDEPLGETSTQEINNTQD 891

Query: 798  EISGKRETRI----------------SEQFVQKTLSFLK-SKEDEQGDAEFVSVADTQES 840
            ++  +    +                SE+FVQ+TLSFLK S+EDE    EF    +  + 
Sbjct: 892  DMKEEDAAVVKENGDSKRIKKKKTIISEEFVQRTLSFLKSSREDE----EFAMNENLAKE 947

Query: 841  SSGDFAEATDFYRLKQLSGIKSFSAPLRSS---IRLQVRNKDGVLSGKANTTL------V 891
              G   E  +   LKQ S IK F +P  +S   I+L   N D      +   L      +
Sbjct: 948  QHGTKVE--NLLSLKQQSSIKVFQSPSNNSSKVIKLDDINNDDDDDEDSPIALFKVPSIL 1005

Query: 892  ERFVRSVDTNEKFEEGRKTVKSLNSYKIAGSSRASITFLGKARSLKARKRGPHARSAPHG 951
            + F    D NEKF++G KTV    SY+  GSS+ASIT+LGK+R L A     H++  P  
Sbjct: 1006 KSFGSKTDINEKFQDGNKTVTISKSYRTVGSSKASITYLGKSRKLMA---PTHSKMKPLR 1062

Query: 952  QKIMTSHQ----------FFASDGQSFEN 970
             ++  +++           F++   SFEN
Sbjct: 1063 SRVTDNNKITKGERNIGSLFSTGDDSFEN 1091

 Score = 68.9 bits (167), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 38/92 (41%), Positives = 64/92 (69%), Gaps = 2/92 (2%)

Query: 337 SSKAAILDLKARMSKKKQSLAVTSSKETMPSASLRHLFSSLRKANRDQLVEHRNGLLLLR 396
           +SKA IL +KAR+SK+K    V   K+   + +L  LF +L+K++R Q++E++  L+  +
Sbjct: 449 TSKATILTIKARLSKQKSKKNV--QKDGTVNTNLNKLFENLKKSSRKQILENQRELIENK 506

Query: 397 GVDLAEIAKEKESVESLLERELARNKKVKQEE 428
           G++  +I  EKE VE+LLE+E+ RN+K++Q E
Sbjct: 507 GLNFEDIEMEKELVENLLEQEIKRNQKIRQRE 538

 Score = 43.1 bits (100), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 27/68 (39%), Positives = 37/68 (54%), Gaps = 8/68 (11%)

Query: 29  CPTVGGTGFLFENSIFNQVKKRIKATDDNEINHNAPTTASTEILKDTCETQAIERPY-DG 87
            PT+ GTGFLF+NS  ++V+ R+     N I       AS+E      ETQ I   Y +G
Sbjct: 47  TPTILGTGFLFKNSTIDKVRARLSGK--NYIEQEKTPLASSE-----QETQIITNLYTNG 99

Query: 88  EELETDFV 95
           E+LE D +
Sbjct: 100 EDLEKDLI 107

>TPHA0E04010 Chr5 (839903..842800) [2898 bp, 965 aa] {ON} Anc_1.5
           YCL061C
          Length = 965

 Score =  175 bits (443), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 159/491 (32%), Positives = 238/491 (48%), Gaps = 66/491 (13%)

Query: 507 DEEDDPLNVTKKKKVRRWNLIDSDDE--ALSNDEQKTV----IDLGAYGENILGTERIDE 560
           DEED+   + K+K  +   + DSD E  A   D ++ +    IDLG YG+NI+   R   
Sbjct: 513 DEEDEGFAIGKRKHKKTEIVDDSDSEIEAQIVDSKEIITANTIDLGHYGDNIIQQSR--- 569

Query: 561 GAGAQVVGTSSSMCEAKLERNTTKSPVRILNRPCEEKIDQDEETRNPIIKNLIEKRKLKE 620
               + +  +    E   ER                         N II   I K+K  E
Sbjct: 570 ----ETLNETEESDEEDEER------------------------YNAIISEGIRKQKELE 601

Query: 621 ALREAKMKELNRSKANGMIDFEAEESDDEWFGVGGADGENSDGYDSELDRMIDDYSNTKS 680
                ++KE+  S  + M + EAEES+DEW G+GG D + SD YDSE+++MIDDYS    
Sbjct: 602 KREAKRLKEMKTSGVSKMFEVEAEESEDEWHGIGGVDSDFSDAYDSEVEKMIDDYSRQNF 661

Query: 681 DPEFLRKKLMEEEKLHDKDMVDRILHDIENGGFRKRGRYAMXXXXXXXXXXXXXRYHARR 740
           +P  +R+ L +E K  D  +V++IL+DI+NGGFR R R                 Y A+R
Sbjct: 662 NPSEIREMLAKENKETDLALVNKILYDIKNGGFRTRKRRDRDLEFSDDDDDDLKAYRAKR 721

Query: 741 KELLNERKSGNQEISVLATNPKSKAFFDSIFE---------DDLKGGIANLKEYQSHASP 791
           + L+ E++   +    +  NPKSKAFF+SI +         DD+   I  + E ++    
Sbjct: 722 RALMREKRLDIEGDKKIVKNPKSKAFFESIVDDIIETKNPFDDMNTSIEQIVEKETPTVD 781

Query: 792 L----KAAKDEISGKRETRISEQFVQKTLSFLKSKEDEQGDAEFVSVADTQESSSGDFAE 847
           +    K A +    K++  ISE+FVQ++LSFL S   EQ + E        + + G+ A 
Sbjct: 782 IDNDEKLATNVTKKKKKIVISEEFVQRSLSFLNSCR-EQDEFEI-----NNQHNGGEKAT 835

Query: 848 AT-DFYRLKQLSGIKSFSAPLRSSIRLQVRNKD--------GVLSGKANTTLVERFVRSV 898
           +T D Y LK+ S IK+  +   S       N +         + +    T+++  F   V
Sbjct: 836 STADLYTLKRYSSIKTLQSVTSSRSSSIASNLNEQPSQSSGSLFNDLRKTSVLNSFSSDV 895

Query: 899 DTNEKFEEGRKTVKSLNSYKIAGSSRASITFLGKARSLKARKRGPHARSAPHGQKIMTSH 958
           D N KF+EG K+VK  N+YK  GS+RASIT++G +R L A K+     S+    +   S 
Sbjct: 896 DINSKFKEGTKSVKVSNAYKTVGSARASITYMGTSRRLVAPKKSRLTTSSKANSRTTPSR 955

Query: 959 QFFASDGQSFE 969
            F   +G SFE
Sbjct: 956 LFDNQEG-SFE 965

 Score = 57.8 bits (138), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 37/95 (38%), Positives = 68/95 (71%), Gaps = 5/95 (5%)

Query: 337 SSKAAILDLKARMSKKKQSLAVTSSKETMPSASLRHLFSSLRKANRDQLVEHRNGLLLLR 396
           +SKA IL+++A  SK++  ++  S + T     L  L+++L++A+++Q+V ++  L+  +
Sbjct: 358 ASKAVILNIRANKSKQQPKVSQKSDQTT-----LLMLYNNLKRASKEQIVSYQKELMEKK 412

Query: 397 GVDLAEIAKEKESVESLLERELARNKKVKQEEIQK 431
           G++L E+ KE E VE+LLE+E+ARN+K++Q E QK
Sbjct: 413 GINLEELEKENEIVENLLEQEIARNQKIRQREKQK 447

>KNAG0C00220 Chr3 complement(33011..36496) [3486 bp, 1161 aa] {ON}
            Anc_1.5 YCL061C
          Length = 1161

 Score =  174 bits (440), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 146/446 (32%), Positives = 213/446 (47%), Gaps = 66/446 (14%)

Query: 542  VIDLGAYGENILGTERIDEGAGAQVVGTSSSMCEAKLERNTTKSPVRILNRPCEEKIDQD 601
             IDLG YG N+                      E + E N T+     L+  C   +D+ 
Sbjct: 747  AIDLGDYGNNL----------------------EIRAELNNTEK----LDTKC--MLDEK 778

Query: 602  EETRNPIIKNLIEKRKLKEALREAKM----KELNRSKANGMIDFEAEESDDEWFGVGGAD 657
            E  R       ++K +LK  ++E K+     EL     +   + EAEES+DEW G+GG D
Sbjct: 779  EHAR------AVDKERLKTIMKEKKLMLKRAELKEKGVSNFFEEEAEESEDEWHGIGGID 832

Query: 658  GENSDGYDSELDRMIDDYSNTKSDPEFLRKKLMEEEKLHDKDMVDRILHDIENGGFRKRG 717
            GE SD YDSE+++MIDDYS    DPE +RK L+ E K  D  MV++IL DI+NG FRKRG
Sbjct: 833  GEVSDEYDSEVEKMIDDYSRADMDPEEIRKLLVSENKEMDVKMVNKILFDIKNGNFRKRG 892

Query: 718  RYAMXXXXXXXXXXXXXRYHARRKELLNERKSGNQEISVLATNPKSKAFFDSIFED--DL 775
            R  +             +Y  +R EL+ +R     +   L  N K+KAFFDS+ ED  ++
Sbjct: 893  RDTLELELSDEEDDDLRQYRQKRNELMKQRLLDLGDDKKLVKNVKTKAFFDSLVEDIVEV 952

Query: 776  KGGIANLKE-----YQSHASPLKAAKDEISGKRE---------TRISEQFVQKTLSFLKS 821
            K     + +          +     ++ +S K E         T +SE+FVQ++LSFL S
Sbjct: 953  KNPFGVMSDNETQDTDETTTIDTQTRESVSNKEEKPTQEKGKKTVLSEEFVQRSLSFLNS 1012

Query: 822  KEDEQGDAEFVSVADTQESSSGDFAEATDFYRLKQLSGIKSFSAPLRSSIRLQVRNKDGV 881
              +     EF    D       D  + +D Y LK+ S +KSF +    +  + V   D  
Sbjct: 1013 NRNL---TEFEQNQDLARLQHDD--DVSDLYTLKKQSSVKSFKSVGSKNEIINVDANDNS 1067

Query: 882  LSGKANTT-----LVERFVRSVDTNEKFEEGRKTVKSLNSYKIAGSSRASITFLGKARSL 936
             +  A  T     +++ F   ++ ++KF  G+KTVK+  SYK  G S+ S+T++ K R L
Sbjct: 1068 GTAVATATFRPPSIIKSFNSKLNVDDKFRNGKKTVKTFKSYKAVGGSKTSVTYMNKVRKL 1127

Query: 937  KARKRGPHARSAPHGQKI--MTSHQF 960
             A K      S    +KI   TSH F
Sbjct: 1128 TAPKSLKKLHSTGGERKISAQTSHSF 1153

 Score = 51.6 bits (122), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 33/85 (38%), Positives = 57/85 (67%), Gaps = 4/85 (4%)

Query: 337 SSKAAILDLKARMSKKKQSLAVTSSKETMPSASLRHLFSSLRKANRDQLVEHRNGLLLLR 396
           +SKAA+L++KA+  KKK  +   ++ +T    +L  LFS L+K NR Q++ H+  ++  +
Sbjct: 551 ASKAAVLNIKAKALKKKAIVKAANTNKT----TLDSLFSDLKKKNRQQILSHQAEIIGTK 606

Query: 397 GVDLAEIAKEKESVESLLERELARN 421
           G++  ++ +EKE VE LLE+E+ RN
Sbjct: 607 GINHKDLEREKEIVEDLLEQEILRN 631

 Score = 37.7 bits (86), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 31/103 (30%), Positives = 55/103 (53%), Gaps = 16/103 (15%)

Query: 2   DLIDQLSNPRTKRSGFVKKLH-------LFDDESCPT-VGGTGFLFENSIFNQVKKRIKA 53
           DL+++ ++ + KR    KK+          DD+  PT + G GFLF N+  +++K R+  
Sbjct: 3   DLLERFNSVKVKRRTTYKKVQQNSTDEAAGDDDCVPTSLAGNGFLFGNATVDKIKNRL-- 60

Query: 54  TDDNEINHNAP---TTASTEILKDTCETQAIERPYD-GEELET 92
             +NE + N+    T +S+E      ++Q +   YD GE+LE+
Sbjct: 61  --NNEDHPNSSIDVTKSSSEDQIPVSQSQLLSTLYDGGEDLES 101

>Kpol_2002.8 s2002 complement(11914..14871) [2958 bp, 985 aa] {ON}
           complement(11914..14871) [2958 nt, 986 aa]
          Length = 985

 Score =  169 bits (429), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 139/389 (35%), Positives = 213/389 (54%), Gaps = 29/389 (7%)

Query: 600 QDEETRNPIIKNLIEKRKLKEALREAKMKELNRSKANGMIDFEAEESDDEWFGVGGADGE 659
           +DEE    ++K  I++R+ +E  +  K++EL       M + EAEES+DEW G+GG DGE
Sbjct: 606 EDEELYKEMVKKEIDRRRDQERKQRQKLRELKDKGITDMFEVEAEESEDEWHGIGGVDGE 665

Query: 660 NSDGYDSELDRMIDDYSNTKSDPEFLRKKLMEEEKLHDKDMVDRILHDIENGGFRKRGRY 719
            SD YDSE+++MIDDYS    +   +R+KL  E K  D  MV+RIL+DI+NGGFRKR R 
Sbjct: 666 LSDEYDSEVEKMIDDYSKENFNAGEIREKLAAENKDMDLKMVNRILNDIKNGGFRKR-RN 724

Query: 720 AMXXXXXXXXXXXXXRYHARRKELLNERKSGNQEISVLATNPKSKAFFDSIFED--DLKG 777
           A+              Y A+R++L+ E++        L TN KS AF +S+ +D  ++K 
Sbjct: 725 ALEIELSDDEDDDLKAYRAKRRQLMKEKRLETDHNKKLMTNKKSHAFLESMVDDIVEVKN 784

Query: 778 GIANLKEYQSHASPLKAAKDEISG------KRETRISEQFVQKTLSFLKSKEDEQGDAEF 831
                 +     +P   A+ +++       K++  +SE FVQK+LSFL S  + +     
Sbjct: 785 PFDERDDNIMDDTPETDAEGDVNSNELLNKKKKFILSEAFVQKSLSFLSSSRNLEEFEMN 844

Query: 832 VSVADTQESSSGDFAEATDFYRLKQLSGIKSFSAPLRS-----SIRLQVRNKDGV---LS 883
            ++A  Q S +     ATD + LK    IKS  +   S     S +L + +++ V    S
Sbjct: 845 NNLAKEQHSHA-----ATDMFALKSHCSIKSLESLPGSHNNSISSKLDLLHEEIVSTPFS 899

Query: 884 GKANTTLVERFVRSVDTNEKFEEGRKTVKSLNSYKIAGSSRASITFLGKARSL---KARK 940
           G   T++++ F  S+D + KF++G KTVK   SY+  GS++ASIT+LGKAR L   K ++
Sbjct: 900 GLKQTSVIKSFSSSIDIDSKFKDGNKTVKVSKSYRTVGSAKASITYLGKARKLVPPKKKE 959

Query: 941 RGPHARSAPHGQKIMTSHQFFASDGQSFE 969
             PH+    H  K  ++ + F     SFE
Sbjct: 960 HKPHS----HKSKTASASRLFDEQDNSFE 984

 Score = 54.7 bits (130), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 50/146 (34%), Positives = 79/146 (54%), Gaps = 8/146 (5%)

Query: 291 NVLPSISE--GFAPLQLYHTILKQRLTDANXXX-XXXXXXXXXXXXXXLSSKAAILDLKA 347
           N LP  S+   F  L  Y  ILK+ +   N                   +SKA IL +KA
Sbjct: 312 NSLPQFSKESKFIGLSNYENILKKDINKQNCIEFSDSEDETEVTSKVSRASKATILSIKA 371

Query: 348 RMSKKKQSLAVTSSKETMPSASLRHLFSSLRKANRDQLVEHRNGLLLLRGVDLAEIAKEK 407
            +S+ K + +  ++K      +L +LFS L+KA + Q+++H+  ++  +G  + EI KEK
Sbjct: 372 NLSRHKPAQSSINNKN-----ALGNLFSDLKKATKAQILDHKKEIMEQKGYKMEEIEKEK 426

Query: 408 ESVESLLERELARNKKVKQEEIQKGE 433
           E VE+LLE+E+ RN+K++  E QK E
Sbjct: 427 EIVENLLEQEIERNRKIRIREKQKEE 452

>ZYRO0F18480g Chr6 (1524051..1526933) [2883 bp, 960 aa] {ON} weakly
           similar to uniprot|P25588 Saccharomyces cerevisiae
           YCL061C MRC1 S-phase checkpoint protein found at
           replication forks required for DNA replication also
           required for Rad53p activation during DNA replication
           stress where it forms a replication-pausing complex with
           Tof1p and is phosphorylated by Mec1p protein involved in
           replication checkpoint
          Length = 960

 Score =  155 bits (393), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 133/441 (30%), Positives = 217/441 (49%), Gaps = 62/441 (14%)

Query: 540 KTVIDLGAYGENILGTERIDEGAGAQVVGTSSSMCEAKLERNTTKSPVRILNRPCEEKID 599
           + +IDLG YG N+      D                             + N P  +  +
Sbjct: 556 RNIIDLGPYGNNLQVNHEED-----------------------------MENLPLSDSAE 586

Query: 600 QD---EETRNPIIKNLIEKRKLKEALREAKMKELNRSKANGMIDFEAEESDDEWFGVGGA 656
            D   EE  N +I   I K ++++  +E ++K++     N M++ EAEES+DEW GVGG 
Sbjct: 587 IDAAEEEKTNELIMEKIRKIEMRKKKKEQRLKDMKAKGLNKMLEMEAEESEDEWKGVGGV 646

Query: 657 DGENSDGYDSELDRMIDDYSNTKSDPEFLRKKLMEEEKLHDKDMVDRILHDIENGGFRKR 716
           DG+ SD +DS+L+ MIDD++ +  + + +R+ L +E K  D+ MV++IL+DI+NGGFRKR
Sbjct: 647 DGDLSDEHDSDLEEMIDDFTKSNENFDDVRQLLAKENKELDEKMVNKILYDIKNGGFRKR 706

Query: 717 GRYAMXXXXXXXXXXXXXRYHARRKELLNERKSGNQEISVLATNPKSKAFFDSIFE--DD 774
           GR A+              Y  +R+EL+ + +   ++      N KSKAF +S+ +  D+
Sbjct: 707 GRNALDLELSDDEDEDLRNYRLKRRELMKKSRIEGKDKEKAFRNAKSKAFLESMVDDIDE 766

Query: 775 LKGGIANLK-EYQSHASPLKAAKDEISGKRETRISEQFVQKTLSFL----KSKEDEQGDA 829
            K    + + + + +        D    K +  +S++FVQ++LSFL     S+E E G  
Sbjct: 767 SKNPFGDPEMDVEDNTDVDTQENDYPKNKEKNTLSQEFVQRSLSFLSNNNSSREFELG-- 824

Query: 830 EFVSVADTQESSSGDFAEATDFYRLKQLSGIKSF---SAPLRSSIRLQVRNKDGV-LSGK 885
           E +++ D          E  D   LK+ S I +    S+P++  +  + +++D + L   
Sbjct: 825 EQITLGD----------EEQDVSSLKRNSSIHALHNSSSPIKEDLEKENQDEDFITLPNF 874

Query: 886 ANTTLVERFVRSVDTNEKFEEGRKTVKSLNSYKIAGSSRASITFLGKARSLKARK----- 940
              +L++      D N KF+ G+KTV    SY+  G SR+SIT+ GK R L   K     
Sbjct: 875 KPPSLIKSLAGGFDPNNKFQSGKKTVTVSKSYRAVGGSRSSITYFGKMRKLVGPKNRNST 934

Query: 941 --RGPHARSAPHGQKIMTSHQ 959
             +GP   S P   K+  S Q
Sbjct: 935 LSKGPRPASKPTMGKLWESQQ 955

 Score = 69.3 bits (168), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 39/91 (42%), Positives = 63/91 (69%), Gaps = 5/91 (5%)

Query: 338 SKAAILDLKARMSKKKQSLAVTSSKETMPSASLRHLFSSLRKANRDQLVEHRNGLLLLRG 397
           SKA +LD+KAR SK+ + L+    K+T    +L  L  +L+KA++ Q+ +H+N L+  RG
Sbjct: 365 SKATVLDIKARRSKQ-EPLSKIKQKKT----TLNDLICTLKKASKKQITDHQNELMKSRG 419

Query: 398 VDLAEIAKEKESVESLLERELARNKKVKQEE 428
             L +I K+KE +E+LLE+E+ARNK++ + E
Sbjct: 420 YKLEDIEKQKEEIENLLEQEIARNKRLARRE 450

 Score = 32.7 bits (73), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 11/27 (40%), Positives = 19/27 (70%)

Query: 30 PTVGGTGFLFENSIFNQVKKRIKATDD 56
          P + G GFLF+NS  ++V+ R++  +D
Sbjct: 40 PPILGNGFLFQNSTIDKVRNRLRNAED 66

>TBLA0A07570 Chr1 (1874419..1878177) [3759 bp, 1252 aa] {ON} Anc_1.5
            YCL061C
          Length = 1252

 Score =  154 bits (390), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 118/357 (33%), Positives = 170/357 (47%), Gaps = 57/357 (15%)

Query: 628  KELNRSKANGMIDFEAEESDDEWFGVGGADGENSDGYDSELDRMIDDYSNTKSDPEFLRK 687
            +EL +  A+ M D EAEES+DEWFG+GGADGE SD YDSE++++IDDYS    +P+ +R 
Sbjct: 866  RELKKVGASKMFDMEAEESEDEWFGIGGADGEVSDEYDSEVEKLIDDYSRQDFNPDEIRN 925

Query: 688  KLMEEEKLHDKDMVDRILHDIENGGFRKRGRYAMXXXXXXXXXXXXXRYHARRKELLNER 747
            KLM E K  D  MV+RIL+DI+NGGFRKR R  +              Y  +R+E++ ++
Sbjct: 926  KLMNENKEMDIKMVNRILYDIKNGGFRKRNRNNIDLELSDDEDDELREYRIKRREIMKKK 985

Query: 748  KSGNQEISVLATNPKSKAFFDSIFEDDLKGG--------------------IANLKEYQS 787
            +        +    KSKAFF S+ +D ++                      I+N     +
Sbjct: 986  RLEVTNTDKILKTSKSKAFFMSMVDDIVETSNPFMITQPSDDDSDDNNMDSISNKNHKDA 1045

Query: 788  HASPLKA--------AKDEISGKRETRISEQFVQKTLSFL-KSKEDEQGDAEFVSVADTQ 838
            + +            A+   S +++  +SE FV KTLSFL KSKE      EF  V +  
Sbjct: 1046 NNAKKDKKDKRTDDHARLSQSSRKKFVMSEDFVHKTLSFLTKSKEVN----EFQHVNEHY 1101

Query: 839  ESSSGDFAEATDFYRLKQLSGIKSFSAPLRSSIRLQVRNK-------------------- 878
            +S  G      D   LKQ S IK+       S    V                       
Sbjct: 1102 KSQIGTI---NDIQSLKQKSSIKTMHVLSMMSQDTNVDLDASDKDDDDMIHHAGSFDNSF 1158

Query: 879  -DGVLSGKANTTLVERFVRSVDTNEKFEEGRKTVKSLNSYKIAGSSRASITFLGKAR 934
             D + S     ++++ F  + D N+KF++G KTV   NSYK  G  + SIT  G+ +
Sbjct: 1159 DDPLSSVSKAPSIIKIFGSTHDINDKFKDGNKTVTISNSYKTVGGMKTSITSFGRRK 1215

 Score = 58.9 bits (141), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 34/92 (36%), Positives = 62/92 (67%), Gaps = 5/92 (5%)

Query: 337 SSKAAILDLKARMSKKKQSLAVTSSKETMPSASLRHLFSSLRKANRDQLVEHRNGLLLLR 396
           +SKA ILD++ ++SKKK  +   + +      +L  LF+ L+KA++ Q+ +H+   +  +
Sbjct: 616 ASKAQILDIRHKLSKKKPQVKKKTIQ-----TNLDQLFNKLKKASKKQIFDHQKNAIESK 670

Query: 397 GVDLAEIAKEKESVESLLERELARNKKVKQEE 428
           G+ L ++ KEKE VE+LLE+E+ RN+K++ +E
Sbjct: 671 GLKLEDLKKEKEIVENLLEQEIERNRKIRAKE 702

>TPHA0H00840 Chr8 (170246..172693) [2448 bp, 815 aa] {ON} Anc_2.56
           YDL220C
          Length = 815

 Score = 35.0 bits (79), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 27/93 (29%), Positives = 42/93 (45%), Gaps = 11/93 (11%)

Query: 823 EDEQGDAEFVSVADTQ-ESSSGDFAEATDFYRLKQLSGIKSFSAPLRSSIRLQVRNKDGV 881
           E++  + ++    DT  E  S  F E  DFY+L Q         PL  S R     K  +
Sbjct: 645 ENDANETDYTLFDDTSSEMLSSRFTEENDFYKLNQ--------VPL--SDRQIYTVKTEI 694

Query: 882 LSGKANTTLVERFVRSVDTNEKFEEGRKTVKSL 914
           ++   N    E F+RS D  + F + RKT+ ++
Sbjct: 695 VNVDCNKFYFEYFLRSQDNKDNFVDPRKTINAI 727

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.309    0.127    0.342 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 93,520,211
Number of extensions: 4086414
Number of successful extensions: 17560
Number of sequences better than 10.0: 252
Number of HSP's gapped: 18368
Number of HSP's successfully gapped: 313
Length of query: 970
Length of database: 53,481,399
Length adjustment: 119
Effective length of query: 851
Effective length of database: 39,836,145
Effective search space: 33900559395
Effective search space used: 33900559395
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 71 (32.0 bits)