Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_33.130031.4ON44944922570.0
KLTH0F00462g1.4ON4514577339e-92
SAKL0C00440g1.4ON4624684191e-45
KLLA0C00462g1.4ON4604782229e-19
Kpol_2002.71.4ON4744911972e-15
ZYRO0F18502g1.4ON4502801962e-15
Suva_3.1511.4ON4212481891e-14
Skud_3.21.4ON4262481774e-13
Smik_3.131.4ON4252441756e-13
YCL063W (VAC17)1.4ON4232441722e-12
TDEL0C069801.4ON4264661589e-11
NCAS0B091201.4ON4334281331e-07
NDAI0A001301.4ON4781491251e-06
KNAG0C001901.4ON4423541178e-06
CAGL0B00308g1.4ON4303041133e-05
TBLA0A075801.4ON5132991081e-04
TPHA0E040201.4ON540269980.002
KAFR0D001201.4ON399481970.003
KAFR0E043904.370ON143130713.8
NOTE: 2 genes in the same pillar as Kwal_33.13003 were not hit in these BLAST results
LIST: AFR746C Ecym_1007

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_33.13003
         (449 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_33.13003 s33 (35425..36774) [1350 bp, 449 aa] {ON} YCL063W ...   874   0.0  
KLTH0F00462g Chr6 (35640..36995) [1356 bp, 451 aa] {ON} weakly s...   286   9e-92
SAKL0C00440g Chr3 (39662..41050) [1389 bp, 462 aa] {ON} weakly s...   166   1e-45
KLLA0C00462g Chr3 (33948..35330) [1383 bp, 460 aa] {ON} weakly s...    90   9e-19
Kpol_2002.7 s2002 (10372..11796) [1425 bp, 474 aa] {ON} (10372.....    80   2e-15
ZYRO0F18502g Chr6 complement(1527109..1528461) [1353 bp, 450 aa]...    80   2e-15
Suva_3.151 Chr3 (227186..228451) [1266 bp, 421 aa] {ON} YCL063W ...    77   1e-14
Skud_3.2 Chr3 (5324..6604) [1281 bp, 426 aa] {ON} YCL063W (REAL)       73   4e-13
Smik_3.13 Chr3 (18714..19991) [1278 bp, 425 aa] {ON} YCL063W (REAL)    72   6e-13
YCL063W Chr3 (17290..18561) [1272 bp, 423 aa] {ON}  VAC17Phospho...    71   2e-12
TDEL0C06980 Chr3 complement(1267077..1268357) [1281 bp, 426 aa] ...    65   9e-11
NCAS0B09120 Chr2 complement(1749531..1750832) [1302 bp, 433 aa] ...    56   1e-07
NDAI0A00130 Chr1 (6694..8130) [1437 bp, 478 aa] {ON} Anc_1.4 YCL...    53   1e-06
KNAG0C00190 Chr3 (28746..30074) [1329 bp, 442 aa] {ON} Anc_1.4 Y...    50   8e-06
CAGL0B00308g Chr2 (16533..17825) [1293 bp, 430 aa] {ON} similar ...    48   3e-05
TBLA0A07580 Chr1 complement(1878594..1880135) [1542 bp, 513 aa] ...    46   1e-04
TPHA0E04020 Chr5 complement(842960..844582) [1623 bp, 540 aa] {O...    42   0.002
KAFR0D00120 Chr4 (9052..10251) [1200 bp, 399 aa] {ON} Anc_1.4 YC...    42   0.003
KAFR0E04390 Chr5 complement(879422..883717) [4296 bp, 1431 aa] {...    32   3.8  

>Kwal_33.13003 s33 (35425..36774) [1350 bp, 449 aa] {ON} YCL063W -
           Hypothetical ORF [contig 123] FULL
          Length = 449

 Score =  874 bits (2257), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 425/449 (94%), Positives = 425/449 (94%)

Query: 1   MEQLAKIAQCALERSEEALVRLEKCVGKQRRLYESERSDQCLSEESSSTIVQYYSYLGQL 60
           MEQLAKIAQCALERSEEALVRLEKCVGKQRRLYESERSDQCLSEESSSTIVQYYSYLGQL
Sbjct: 1   MEQLAKIAQCALERSEEALVRLEKCVGKQRRLYESERSDQCLSEESSSTIVQYYSYLGQL 60

Query: 61  NCLYIKAQSLKDMMGNRCGHLPNSTQEAIERLEHDYKALCNHANELGIREKNLEDXXXXX 120
           NCLYIKAQSLKDMMGNRCGHLPNSTQEAIERLEHDYKALCNHANELGIREKNLED     
Sbjct: 61  NCLYIKAQSLKDMMGNRCGHLPNSTQEAIERLEHDYKALCNHANELGIREKNLEDSPSCL 120

Query: 121 XXXXXXXFQPKPLKIIERRLAQTNTSPTKVCTATVMAKSFCRSGTDKNSDYIPDEIGKXX 180
                  FQPKPLKIIERRLAQTNTSPTKVCTATVMAKSFCRSGTDKNSDYIPDEIGK  
Sbjct: 121 SPASVSSFQPKPLKIIERRLAQTNTSPTKVCTATVMAKSFCRSGTDKNSDYIPDEIGKTN 180

Query: 181 XXXXXXXXXXEAKKEPKFIRVVKSCGTGLNKHSNPHENRLSFFRDRQRLSISFIEDDEYL 240
                     EAKKEPKFIRVVKSCGTGLNKHSNPHENRLSFFRDRQRLSISFIEDDEYL
Sbjct: 181 SCNTNSPCTNEAKKEPKFIRVVKSCGTGLNKHSNPHENRLSFFRDRQRLSISFIEDDEYL 240

Query: 241 SDEETITSGSPLNASFLLNDFAKVAKGRPNQTLASSRHVENNERGAQTAAVSPFVSLVPK 300
           SDEETITSGSPLNASFLLNDFAKVAKGRPNQTLASSRHVENNERGAQTAAVSPFVSLVPK
Sbjct: 241 SDEETITSGSPLNASFLLNDFAKVAKGRPNQTLASSRHVENNERGAQTAAVSPFVSLVPK 300

Query: 301 KTCTAQIGLTSIDIRPDFGPCFSPKKFETTESKEILSHFVIKEPRTKSHSWLKGCDKSVP 360
           KTCTAQIGLTSIDIRPDFGPCFSPKKFETTESKEILSHFVIKEPRTKSHSWLKGCDKSVP
Sbjct: 301 KTCTAQIGLTSIDIRPDFGPCFSPKKFETTESKEILSHFVIKEPRTKSHSWLKGCDKSVP 360

Query: 361 FLQTFKIFNNQVLVTSETGCRNVDRTTSTKLITPSRKHFAQRELSDRTCSILVHGSSGSR 420
           FLQTFKIFNNQVLVTSETGCRNVDRTTSTKLITPSRKHFAQRELSDRTCSILVHGSSGSR
Sbjct: 361 FLQTFKIFNNQVLVTSETGCRNVDRTTSTKLITPSRKHFAQRELSDRTCSILVHGSSGSR 420

Query: 421 FVNAPQQQELHFKVSYEALREALNTDLNN 449
           FVNAPQQQELHFKVSYEALREALNTDLNN
Sbjct: 421 FVNAPQQQELHFKVSYEALREALNTDLNN 449

>KLTH0F00462g Chr6 (35640..36995) [1356 bp, 451 aa] {ON} weakly
           similar to uniprot|P25591 Saccharomyces cerevisiae
           YCL063W VAC17 vacuole inheritance
          Length = 451

 Score =  286 bits (733), Expect = 9e-92,   Method: Compositional matrix adjust.
 Identities = 187/457 (40%), Positives = 262/457 (57%), Gaps = 17/457 (3%)

Query: 1   MEQLAKIAQCALERSEEALVRLEKCVGKQRRLYESERSDQCLSEESSSTIVQYYSYLGQL 60
           MEQL +IAQ +L  S+ AL RL+ C+ +QRRLYES   DQCLS++SS+ + QYY Y+GQL
Sbjct: 1   MEQLQEIAQESLALSQSALARLDSCLERQRRLYESGFPDQCLSDKSSTNMAQYYEYIGQL 60

Query: 61  NCLYIKAQSLKD-MMGNRCGHLPNSTQEAIERLEHDYKALCNHANELGIREKNLEDXXXX 119
             LY KAQ L D ++ +    L +  Q AIE L  +++ +    N+      ++ +    
Sbjct: 61  YSLYTKAQKLSDTVILSDSKSLSSVQQRAIENLIQEFQEIAK--NDENFISYSMRESPNS 118

Query: 120 XXXXXXXXFQPKPLKIIERRLAQTNTSPTKVCTATVMAKSFCRSGTDKN----SDYIPDE 175
                   FQPKPLKI++RR AQ   SPTK      M+    R G + N    SD   + 
Sbjct: 119 MSVQSICSFQPKPLKILQRRQAQLE-SPTKRSFRPSMSLLDNR-GDETNLATASDRSQER 176

Query: 176 IGKXXXXXXXXXXXXEAKKEPKFIRVVKSCGTGLNKHSNPHENRLSFFRDRQRLSISFIE 235
           +                  +  FIR  KSC  GLN+ SNPHENRL+FF+DRQRLSISFIE
Sbjct: 177 LLGSSPSSIHFFRPSHTNADTLFIRSAKSCDAGLNRRSNPHENRLNFFKDRQRLSISFIE 236

Query: 236 DDEYLSDEETITSGSPLNASFLLNDFAKVAKGRPNQTLASSRHVENNERG--AQTAAVSP 293
           D+E +SDE T+ S   L ++++   F    K  P ++    + +   + G  A       
Sbjct: 237 DEEDVSDEATVISAGSLQSAYI---FETDIKSSPFKSQIGEKEIRIPKAGYLAVGEKSKG 293

Query: 294 FVSLVPKKTCTAQIGLTSIDIRPDFGPCFSPK-KFETTESKEILSHFVIKEPRTKSHSWL 352
           F +L+       QIG+T +D +P+FG    P  + E ++SK++LS  V +  +TK  +W 
Sbjct: 294 FNNLLSATPSAPQIGITEVDYKPNFGFSHQPGVEREASQSKKMLSQLVSQGNKTKCKNWF 353

Query: 353 KGCDK-SVPFLQTFKIFNNQVLVTSETGCRNVDRTTSTKLITPSRKHFAQRELSDRTCSI 411
             CD    P   T ++ NN VLVTSETG R+V+ TTS KL+ P RK   +++ +  +CSI
Sbjct: 354 NECDGLGKPISNTLRLLNNLVLVTSETGLRSVNNTTSAKLLMPPRKR-KEKQAAHGSCSI 412

Query: 412 LVHGSSGSRFVNAPQQQELHFKVSYEALREALNTDLN 448
            +HGSS S+FV APQQ +LHFKVS+ AL+EALNTDL+
Sbjct: 413 FIHGSSRSKFVTAPQQTKLHFKVSHGALQEALNTDLD 449

>SAKL0C00440g Chr3 (39662..41050) [1389 bp, 462 aa] {ON} weakly
           similar to uniprot|P25591 Saccharomyces cerevisiae
           YCL063W VAC17 vacuole inheritance
          Length = 462

 Score =  166 bits (419), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 143/468 (30%), Positives = 224/468 (47%), Gaps = 29/468 (6%)

Query: 1   MEQLAKIAQCALERSEEALVRLEKCVGKQRRLYESERSDQCLSEESSSTIVQYYSYLGQL 60
           ME L +I+Q  L RS+EA+++L+  + +Q+RLYE E  DQ       + + +Y + L QL
Sbjct: 1   MEGLHEISQKLLVRSQEAILQLDLYIQRQQRLYEYETLDQP-DNGLLTKLQEYQTCLAQL 59

Query: 61  NCLYIKAQSLKDMMGNRCGHLPNSTQEAIERLEHDYKALCNHANELGIREKNLEDXXXXX 120
           N L+I+++ L+D + +   H  +   ++I  L  +++ +    NEL   +          
Sbjct: 60  NSLHIRSEHLRDRIAS-TDHRASQDGDSIGHLVTEFQKITTKLNELAATQDRAYQSPGSQ 118

Query: 121 XXXXXXXFQPKPLKIIERRLAQTNTSPTKVCTATVMAKSFCRSGTDKNSDYIPDEIGKXX 180
                  F+PKPLKI+ER   Q  TSPTK         +  R     +   +     K  
Sbjct: 119 STKSVSSFEPKPLKILERTKLQHPTSPTKRVATPPKKIAPLRKNPPFDKKVMFSGHSKST 178

Query: 181 XXXXXXXXXXEAK---KEPKFIRVVKSCGTGLNKHS---NPHENRLSFFRDRQRLSISFI 234
                      +    ++ +F R  KSC  GLNK        +NRL+FF++ QRLSISF 
Sbjct: 179 SLPGSPSMAASSPVSIQQERFPRHAKSCDAGLNKQQRRRQDSDNRLNFFKENQRLSISFF 238

Query: 235 EDD-EYLSDEETITSGSPLNASFLLNDFAKVAKGRPNQTLASSRHVENNER--GAQTAAV 291
           +D+ +Y SDE+T+ S SP   +     F    K  P +   S   V + +    A   A 
Sbjct: 239 DDEIDYSSDEDTVISVSPPETT----SFKGFPKAEPLRRYNSHESVLSRKEVLPAALPAR 294

Query: 292 SPFVSLVPKKTCTAQIGLTSIDIRPDFGPCFSPKKF-----ETTE-SKEILSHFVIKEPR 345
           + + SL   +    +    S+ I  +  P +S         +TTE SK++L+ FV   P+
Sbjct: 295 AGWFSLWAGRNNKPKPMAESVSI--NDKPVYSTAALLRSHSKTTETSKDLLAQFVSAAPK 352

Query: 346 TKSH--SWLKGCDKSV-PFLQTFKIFNNQVLVTSETGCRNVDRTTSTKLI---TPSRKHF 399
            K    SW    ++        +K+FNN VLVTSETG ++ +   S K I    P+++  
Sbjct: 353 QKKQTTSWFGPAEEPKRSIFSGWKLFNNSVLVTSETGLQDSNSKPSAKRIGAAAPAKRVP 412

Query: 400 AQRELSDRTCSILVHGSSGSRFVNAPQQQELHFKVSYEALREALNTDL 447
             R  +    S L+ G +GSRFV+ P +  L+ KVSY+AL EAL T+ 
Sbjct: 413 LGRRKTHLPSSSLIMGPNGSRFVSPPNEPVLNNKVSYDALHEALCTEF 460

>KLLA0C00462g Chr3 (33948..35330) [1383 bp, 460 aa] {ON} weakly
           similar to uniprot|P25591 Saccharomyces cerevisiae
           YCL063W VAC17 vacuole inheritance
          Length = 460

 Score = 90.1 bits (222), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 117/478 (24%), Positives = 215/478 (44%), Gaps = 49/478 (10%)

Query: 1   MEQLAKIAQCALERSEEALVRLEKCVGKQRRLYESERSD-QCLSEESSSTIVQYYSYLGQ 59
           ME +  +A+  + R  EA+++LE  +  QR++ E + ++  C  +     + +YYS+L +
Sbjct: 1   MEDMRYVAERLVIRCNEAVMQLELSI--QRKMCEFDPNNSHCFIQ-----VQEYYSFLAR 53

Query: 60  LNCLYIKAQSLKDMMGNRCGHLPNST---QEAIERLEHDYKALCNHANELGIREKNLEDX 116
           L+ L ++A+ +++ + ++    PN      E +E+L ++++ +    NE+    ++    
Sbjct: 54  LSSLKLRAEHVQESLRHQRKD-PNDVCIEYETLEKLIYEFQDITMSLNEVARAYQSPTKS 112

Query: 117 XXXXXXXXXXXFQPKPLKIIER-RLAQTNTSPTKVCTATVMAKSFCRS-GTDKNSDYIPD 174
                         K LKIIER R +   TSP K   + +  +   +S    +N  +  D
Sbjct: 113 ARSGSSKESSVIPLKTLKIIERNRDSLIGTSPMKKSLSQLKKEEHNQSLPAKRNVRFQED 172

Query: 175 EI-----------GKXXXXXXXXXXXXEAK---KEPKFIRVVKSCGTGLNKHSNPHENRL 220
           ++                         E++   +E K +R+ KS   GLN  +  + +  
Sbjct: 173 DLDILHHLHSVKRANSLPGSPMPDTLLESQMFSREHKTLRMAKSYDVGLNGRAKKNAD-W 231

Query: 221 SFFRDRQRLSISFIED-DEYLSDEETITSGSPLNASFLLNDFAKVAKGRPNQTLASSRHV 279
            FF+++ RLS+S  +D +   SDEET+ S SP N S+ L   ++     P++ +   R  
Sbjct: 232 EFFKNKNRLSLSVFDDVNTDASDEETVISVSPPNISYYL---SQNEDQYPSKQV---RRC 285

Query: 280 ENNERGAQTAAVSPF--VSLVPKKTCTAQIGLTSIDIRPDF-----GPCFSPKKFETTES 332
            ++E       +SP    +L+ + T  +     +I  +P           SP       S
Sbjct: 286 NSHESILSRKILSPSTPANLIMRPTYQSVWQKKAIVTKPTISCSTSNSTASPTIGSPHLS 345

Query: 333 KEILSHFVIKEPRTKSHSWLKGCDKSVPFLQTF--KIFNNQVLVTSETGCRNVDRTTSTK 390
           K++LS FV   P  K   W    + S PF  +   K FN+  LVT E G  +    +S +
Sbjct: 346 KDMLSQFVTAPPSKKYRGWFSSSN-STPFASSIFQKWFNSDSLVTKEIGNPDNSSPSSGR 404

Query: 391 LITPSRKHFAQRELSDRTCSILVHGSSGSRFVNAPQQQELHFKVSYEALREALNTDLN 448
            I  +R+   +   S+   + +V G +G++F+       +   VSY  L+EALNT+ N
Sbjct: 405 PIVENRQ---RHSSSNSYSTSIVIGPNGAKFIRGLNDPLVTCTVSYNELQEALNTEFN 459

>Kpol_2002.7 s2002 (10372..11796) [1425 bp, 474 aa] {ON}
           (10372..11796) [1425 nt, 475 aa]
          Length = 474

 Score = 80.5 bits (197), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 122/491 (24%), Positives = 210/491 (42%), Gaps = 70/491 (14%)

Query: 4   LAKIAQCALERSEEALVRLEKCVGKQRRLYESERS-DQCLSEESSSTIVQYYSYLGQLNC 62
           +  +++  L RS+EA+++L+  + +Q++  ES+ + D+   E+ + T   Y  Y+ QLN 
Sbjct: 6   IDDLSERLLVRSQEAILQLDLWIQRQQQWAESDDNHDENDLEKVTDT---YNLYMSQLNS 62

Query: 63  LYIKAQSLKDMMGNRCGHLPNST------------QEAIERLEHDYKALCNHANELGIRE 110
           LYI++Q+++D +  +     N+             Q  IE L  +++ +    N L    
Sbjct: 63  LYIRSQNVRDKLNTKKKSRTNTIKYVSPSKVNMNGQSDIEDLIFEFQDITRKLNVLASSR 122

Query: 111 KNLEDXXXXXXXXXXX-XFQPKPLKIIERRLAQTNTSPTKVCTATVMAKSFCRSGTDKNS 169
           +                 FQPKPLKI  +R         K  T  V         TD N 
Sbjct: 123 RRCSSSKSSSSRSSSIGSFQPKPLKISLKRNKSLKEQNKKTVTFDV------EEVTDLNI 176

Query: 170 DYIPDEIGKXXXXXXXXXXXXEAKKEP--KFIRVVKSCGTGLN--KHSNPHENRL----- 220
           + +    G             E    P    +R  KS  TGLN  +   P ++++     
Sbjct: 177 NSVISLPG--------SPLRNEQSSPPMNHHLRQAKSYDTGLNSKRSIKPKKSKIDSVYD 228

Query: 221 SFFRDRQRLSISFIEDDEY------LSDEETITSGSPLNASFLL-------NDFAKVAKG 267
           S F++ QRLSIS  + D        +SD+ET+ S S L     L       N+   + + 
Sbjct: 229 STFKNTQRLSISLFDIDTNENDITNISDQETVISSSSLTMDEPLEIIDDQKNNLKPLRRY 288

Query: 268 RPNQTLASS--RHVENNERGAQTAAVSPFVSLVPKKTCTAQIGLTS-IDIRPDFGPCFSP 324
             ++++ S+  R +  ++R      + PF S+    T T      S  D++ D    + P
Sbjct: 289 NSHESILSTKIRPISISKR----FQIGPFRSVSTTTTSTNYDTTASNTDVKAD--DFYKP 342

Query: 325 KKFETTESKEILSHFVIKEPRTKSH-----SWLKGCDKSVPFLQTFKIFNNQVLVTSETG 379
               +T SK+ILS + IK     S+     +  K  + S  F   + IFN  ++ +SE G
Sbjct: 343 NLSNSTTSKDILSMYSIKNDVQNSNRGNIINNKKESNSSTSFFNKWNIFNFPLIASSEVG 402

Query: 380 CRNVDRTTSTKLITPSRKHFAQRELSDRTCSILVHGSSGSRFVNAPQQQELHFK--VSYE 437
            +  + TT+    +  +K  +    +    S +  G +GS F  +P   E  F   VS++
Sbjct: 403 SKQENNTTAKHFGSQRKKQISSLSYNKANYSTMTIGPNGSMFC-SPTIYEPTFSNTVSFQ 461

Query: 438 ALREALNTDLN 448
            L +ALNT+L+
Sbjct: 462 ELHDALNTELD 472

>ZYRO0F18502g Chr6 complement(1527109..1528461) [1353 bp, 450 aa]
           {ON} similar to uniprot|P25591 Saccharomyces cerevisiae
           YCL063W VAC17 vacuole inheritance
          Length = 450

 Score = 80.1 bits (196), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 79/280 (28%), Positives = 126/280 (45%), Gaps = 44/280 (15%)

Query: 1   MEQLAKIAQCALERSEEALVRLEKCVGKQRRLYESERSDQCLSEESSSTIV-QYYSYLGQ 59
           M  L  I++    RS+EA+++LE  + +Q+ L E E       E +   I  QY  Y+ Q
Sbjct: 1   MPSLDDISERLFIRSQEAVLQLELWIRRQQHLSEIEH------EHARDKIADQYNLYMAQ 54

Query: 60  LNCLYIKAQSLKDMMG----NRCGHLPNSTQEAIERLEHDYKALCNHANELGIREKNLED 115
           LN L ++++ ++D +     NR   + N  Q  IE L ++++ +    NEL   +K    
Sbjct: 55  LNSLCVRSEYVRDKLNAGYQNRKPPIVNE-QNYIEDLVYEFQDITVKLNELAQNQKEQVT 113

Query: 116 XXXXXXXXXXXXFQPKPLKIIER---RLAQTNTSPTKVCTATVMAKSFCRSGTDKNSDYI 172
                       FQP+PLKI ER    +  T  SPT++            +G  KN +++
Sbjct: 114 PSSKHSNGSVNSFQPRPLKITERYRTDIGATRQSPTRI------------NGKLKNVNFV 161

Query: 173 PDEI------GKXXXXXXXXXXXXEAKKEP-KFIRVVKSCGTGLNKHSNP------HENR 219
            + +       K               + P + +RV KS  TGLN +S         E  
Sbjct: 162 EESLPELFCPSKCTSLPGSPLKMRSPDRLPDRPLRVAKSYDTGLNPNSRAKLKKQKEEEM 221

Query: 220 LSFFRDRQRLSISFIED----DEYLSDEETITSGSPLNAS 255
           LS F++ QRLSI+F +D     +  SD+ T+ S SP+  S
Sbjct: 222 LSVFKENQRLSITFCDDIDEGSDSASDQNTVISTSPIPPS 261

>Suva_3.151 Chr3 (227186..228451) [1266 bp, 421 aa] {ON} YCL063W
           (REAL)
          Length = 421

 Score = 77.4 bits (189), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 70/248 (28%), Positives = 115/248 (46%), Gaps = 36/248 (14%)

Query: 2   EQLAKIAQCALERSEEALVRLEKCVGKQRRLYESERSDQCLSEESSSTIVQYYSYLGQLN 61
           + L  I +  L RSEEA+++L+  + +Q+R    E SD+   ++ S    QY  Y+ QLN
Sbjct: 4   QALEDITERLLTRSEEAILQLDLWIQRQQRSSVCEPSDRDSLDKLSQ---QYNQYMSQLN 60

Query: 62  CLYIKAQSLKDMMGNRCGHLPNSTQ---EAIERLEHDYKALCNHANELG-IREKNLEDXX 117
            LY++++S++D +        N+ +   + IE L H+++ +    N+L  +  K   D  
Sbjct: 61  SLYVRSESVRDKLSKEQWRRLNTEENEHKRIEDLVHEFQDITVRLNDLATVPNKASNDSP 120

Query: 118 XXXXXXXX-XXFQPKPLKIIERR---LAQTNTSPTKVCTATVMAKSFCRSGTDKNSDYIP 173
                      FQP+PLKIIER+   +   +  P K      +    C S T+     +P
Sbjct: 121 QSQSTRSSLDSFQPRPLKIIERQRLCVVTPSKPPKKSVVFNPINDVECPSKTNS----LP 176

Query: 174 DEIGKXXXXXXXXXXXXEAKKEP---KFIRVVKSCGTGLNKHSNPHENRL--SFFRDRQR 228
                              KK+P     +R  KS  TGLNK   P       SFF+++QR
Sbjct: 177 ----------------CSPKKQPGKAHTLRAAKSHDTGLNKSKKPSSTDAYESFFKNKQR 220

Query: 229 LSISFIED 236
           LS++F ++
Sbjct: 221 LSLTFFDE 228

>Skud_3.2 Chr3 (5324..6604) [1281 bp, 426 aa] {ON} YCL063W (REAL)
          Length = 426

 Score = 72.8 bits (177), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 68/248 (27%), Positives = 114/248 (45%), Gaps = 36/248 (14%)

Query: 2   EQLAKIAQCALERSEEALVRLEKCVGKQRRLYESERSDQCLSEESSSTIVQYYSYLGQLN 61
           + L  I +  L RS+EA+++L+  + +Q+R    + SDQ   E       QY  Y+ QLN
Sbjct: 4   QALEDITERLLIRSQEAILQLDLWIQRQQRSSVCQTSDQ---ESLDKLSQQYNQYMSQLN 60

Query: 62  CLYIKAQSLKDMMG---NRCGHLPNSTQEAIERLEHDYKALCNHANELGIREKNLED--X 116
            LY++++S++D +     R     ++  + IE L H+++ + +  NEL      + +   
Sbjct: 61  SLYVRSESVRDKLSKEQQRRLITEDNEHQRIEDLVHEFQDITSRLNELATVPHGVSNDSP 120

Query: 117 XXXXXXXXXXXFQPKPLKIIERRLAQTNTSPTKVCTATVMAKSFCRSGTDKNSDYIPDEI 176
                      FQP+PLKIIER+         +VC  T            K+  + P  I
Sbjct: 121 QSQSTRSSSGSFQPRPLKIIERQ---------RVCMVT------PSKPPKKSVGFNP--I 163

Query: 177 GKXXXXXXXXXXXXEAKKEP---KFIRVVKSCGTGLNK-----HSNPHENRLSFFRDRQR 228
                           KK P   + +R  KS  TGLNK      ++ +E   SFF+++QR
Sbjct: 164 NDVDCPSKTNSLPCSPKKPPAKNRTLRAAKSHDTGLNKSKKMSSTDAYE---SFFKNKQR 220

Query: 229 LSISFIED 236
           LS++F ++
Sbjct: 221 LSLTFFDE 228

>Smik_3.13 Chr3 (18714..19991) [1278 bp, 425 aa] {ON} YCL063W (REAL)
          Length = 425

 Score = 72.0 bits (175), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 70/244 (28%), Positives = 112/244 (45%), Gaps = 36/244 (14%)

Query: 2   EQLAKIAQCALERSEEALVRLEKCVGKQRRLYESERSDQCLSEESSSTIVQYYSYLGQLN 61
           + L  I +  L RS+EA+++L+  + +Q+R    + +DQ L ++ S    QY  Y+ QLN
Sbjct: 4   QALEDITERLLIRSQEAILQLDLWIQRQQRSSVCQTTDQELLDKVSK---QYNQYMSQLN 60

Query: 62  CLYIKAQSLKDMMG---NRCGHLPNSTQEAIERLEHDYKALCNHANELGIREKNL--EDX 116
            LY++++S++D +     R     ++  + IE L  +++ +    NEL      +  +  
Sbjct: 61  SLYVRSESVRDKLSKEQQRRLITEDNEHQRIEDLVREFQDITLRLNELATAPNEVANDSP 120

Query: 117 XXXXXXXXXXXFQPKPLKIIER-RLAQTNTS--PTKVCTATVMAKSFCRSGTDKNSDYIP 173
                      FQP+PLKIIER RL     S  P K      +    C S T+     +P
Sbjct: 121 QSQSTRSSLESFQPRPLKIIERQRLCMVTPSKPPKKSVGFNPINDVDCPSKTNS----LP 176

Query: 174 DEIGKXXXXXXXXXXXXEAKKEPK---FIRVVKSCGTGLNKHSNPH--ENRLSFFRDRQR 228
                              KK+P     +R  KS  TGLNK   P   +   SFF++RQR
Sbjct: 177 ----------------CSPKKQPAKNHTLRAAKSHDTGLNKSKKPSSADAYESFFKNRQR 220

Query: 229 LSIS 232
           LS++
Sbjct: 221 LSLT 224

>YCL063W Chr3 (17290..18561) [1272 bp, 423 aa] {ON}
           VAC17Phosphoprotein involved in vacuole inheritance;
           degraded in late M phase of the cell cycle; acts as a
           vacuole-specific receptor for myosin Myo2p
          Length = 423

 Score = 70.9 bits (172), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 70/244 (28%), Positives = 111/244 (45%), Gaps = 36/244 (14%)

Query: 2   EQLAKIAQCALERSEEALVRLEKCVGKQRRLYESERSDQCLSEESSSTIVQYYSYLGQLN 61
           + L  I +  L RS+EA+++L+  + +Q+R    + +DQ   E       QY  Y+ QLN
Sbjct: 4   QALEDITERLLIRSQEAILQLDLWIQRQQRSSICQTTDQ---ESLDKLSQQYNQYMSQLN 60

Query: 62  CLYIKAQSLKDMMG---NRCGHLPNSTQEAIERLEHDYKALCNHANELGI--REKNLEDX 116
            LY++++S++D +     R     ++  + IE L  +++ +    NEL     E   +  
Sbjct: 61  SLYVRSESVRDKLSKEQQRRLITEDNEHQRIEDLVREFQDITLRLNELATVPNEAPNDSP 120

Query: 117 XXXXXXXXXXXFQPKPLKIIER-RLAQTNTS--PTKVCTATVMAKSFCRSGTDKNSDYIP 173
                      FQP+PLKIIER RL     S  P K      + +  C S T+     +P
Sbjct: 121 QSQSTRSSLGSFQPRPLKIIERQRLCMVTPSKPPKKSVGFNPINEVDCPSKTNS----LP 176

Query: 174 DEIGKXXXXXXXXXXXXEAKKEP---KFIRVVKSCGTGLNKHSNPHENRL--SFFRDRQR 228
                              KK+P   + +R  KS  TGLNK   P  +    SFF++RQR
Sbjct: 177 ----------------CSPKKQPARNRTLRAAKSHDTGLNKSKKPSSSDTYESFFKNRQR 220

Query: 229 LSIS 232
           LS++
Sbjct: 221 LSLT 224

>TDEL0C06980 Chr3 complement(1267077..1268357) [1281 bp, 426 aa]
           {ON} Anc_1.4 YCL063W
          Length = 426

 Score = 65.5 bits (158), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 110/466 (23%), Positives = 188/466 (40%), Gaps = 68/466 (14%)

Query: 3   QLAKIAQCALERSEEALVRLEKCVGKQRRLYESERSDQCLSEESSSTIVQYYSYLGQLNC 62
           +L  +++  L RS+EA+++LE  + +Q+ L E E  D  + +  +    QY  Y+ QLN 
Sbjct: 2   ELEDLSERLLTRSQEAILQLELWIQRQQHLRELE--DSSIDKLGN----QYNVYIAQLNS 55

Query: 63  LYIKAQSLKDMMGN---RCGHLPNSTQEAIERLEHDYKALCNHANELGIREKNLEDXXXX 119
           L ++++ ++D +     R   + N  ++ IE L  +++ +    NEL   +         
Sbjct: 56  LCVRSEYVRDKLNKERERRMSIIND-RKYIEDLVFEFQDITVKLNELAQSQSIDSTPSSK 114

Query: 120 XXXXXXXXFQPKPLKIIERRLAQTNTSPTKVCTATVMAKSFCRSGTDKNSDYIPDEIGKX 179
                   FQP+PLK+ ER                 + KS   SG     D   + + K 
Sbjct: 115 STRSSLGSFQPRPLKLTERHGPNVKALRESPLKNKSVIKSVKFSGLH---DSKEEAVSKC 171

Query: 180 XXXXXXXXXXXEAKKEPKFIRVVKSCGTGLNKHSNPHE------NRLSFFRDRQRLSIS- 232
                         +    IR+ KS  TGLN  +          +  S FR+ QRLSI+ 
Sbjct: 172 LSLPGSPVRVTGPTRS---IRMAKSYDTGLNSKNTKKSKGSRDYDVPSIFRENQRLSITV 228

Query: 233 ---FIEDDEYLSDEETITSGSPLNASFLLNDFAKVAKGRPNQTLASSRHVENNERGAQTA 289
              F ED +  SD++T+ S  P          A   KG P +   S   + + +   Q  
Sbjct: 229 FDDFDEDADSTSDQDTVISLVP----------ADDGKGLPLRRFNSHESILSTK--VQPI 276

Query: 290 AVSPFVS--LVPKKTCTAQIGLTSIDIRPDFGPCFSPKKFETTESKEILSHFVIKEPRTK 347
           +  P  S  L+P     +        +R    P FS K      S+++LS FV +  +  
Sbjct: 277 SSLPLFSSFLLPSSNRPSMKS-----VRVSSAPVFS-KTSAPASSRDLLSTFVTRPGKAS 330

Query: 348 SHSWLKGCDKSVPFLQTFKIF------NNQVLVTSETGCRNVDRTTSTKLITPSRKHFAQ 401
           + + +K  +K + F   +  F      ++ +  T +    +   + S    + + +  A 
Sbjct: 331 NATGIKQENK-LGFFANWNFFKGPSSASHDIRATKQKASASRPESNSADCRSKTLEKMAP 389

Query: 402 RELSDRTCSILVHGSSGSRFVNAPQQQELHFKVSYEALREALNTDL 447
           R  S R+             V AP    L   +SYE LREAL+T++
Sbjct: 390 RRFSPRSP------------VKAPVFDSL---ISYEDLREALSTEI 420

>NCAS0B09120 Chr2 complement(1749531..1750832) [1302 bp, 433 aa]
           {ON} Anc_1.4 YCL063W
          Length = 433

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 96/428 (22%), Positives = 168/428 (39%), Gaps = 78/428 (18%)

Query: 1   MEQLAKIAQCALERSEEALVRLEKCVGKQRRLYESERSDQCLSEESSST----------- 49
           M  L  I++  L RS+EA+++L+  + +QRRL E    ++   +   +            
Sbjct: 1   MSLLQDISERLLVRSQEAILQLDVWIQRQRRLQELMEGEEEQEQGGDTNTNMDIRGTLPQ 60

Query: 50  -IVQYYSYLGQLNCLYIKAQSLKDMMGN------RCGHLPNST----QEAIERLEHDYKA 98
            + QY +Y+ QLN L ++ + ++D + N      R   L ++     Q+ I+ L H+++ 
Sbjct: 61  FLEQYNTYMAQLNSLQVRVEFIRDTLVNKKNTGIRNQQLESNNSVDEQKYIQDLVHEFQD 120

Query: 99  LCNHANELG-IREKNLEDXXXXXXXXXXXXFQPKPLKIIERRLAQTNTSPTKVCTATVMA 157
           +    +EL  +R  +               F+PKPL+II R              +   +
Sbjct: 121 ITQKLSELSTVRNPSTASSRSTSTKSSIESFKPKPLRIISR--------------SNTHS 166

Query: 158 KSFCRSGTDKNSDYIPDEIGKXXXXXXXXXXXXEAKKEPKFIRVVKSCGTGLNKHSNPHE 217
               ++  DK   +  DE               E  K    +R  KS           H 
Sbjct: 167 HLHQQTSLDKKVSFNEDESNSSISHSRSMESLHENSKS---LRNTKSMDVLKRSTFKNHS 223

Query: 218 NRLSFFRDRQRLSISFIEDD--------EYL-----SDEETITS-GSPLNASFLLNDFAK 263
           +       RQRLSI+  +DD        E+      SD+ T+ S G+P+  +    D   
Sbjct: 224 DFSKLLNSRQRLSINIFDDDLIANEDGNEFYNQYSDSDQATVISHGTPIRGA----DTPL 279

Query: 264 VAKGRPNQTLASSRHVENNERGAQTAAVSPFVSLVPKKTCTAQIGLTSIDIRPDFGPCFS 323
           + +   ++++ S R      +  Q   + P+ S+  ++     + + S        P FS
Sbjct: 280 LRRYNSHESILSFRKP---TQSRQPNQILPYSSV--RQPSMQSVAVNS-------NPIFS 327

Query: 324 PKKFETTESKEILSHFVIKEPRTKSHSWLKGCDKSVPFLQTFKIFNNQVLVTSETGCRNV 383
             +   T SK++LS F+ K    + H   K    S      +  FN    VTSE G    
Sbjct: 328 RMRPNAT-SKDLLSSFINKPQPNRLHQQ-KPKPNSNSLFGKWNFFNKFNSVTSEIG---- 381

Query: 384 DRTTSTKL 391
             TT+T+L
Sbjct: 382 --TTTTQL 387

>NDAI0A00130 Chr1 (6694..8130) [1437 bp, 478 aa] {ON} Anc_1.4
           YCL063W
          Length = 478

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 41/149 (27%), Positives = 69/149 (46%), Gaps = 21/149 (14%)

Query: 4   LAKIAQCALERSEEALVRLEKCVGKQRRLYESERSDQCLSEESSSTIV--------QYYS 55
           L  I +  L RS+EA+++L+  + +       E+  Q LS  ++S  +        QY  
Sbjct: 5   LQDITERLLIRSQEAILQLDLWIQR-------EKKQQELSTLNNSNNITYDHVDNQQYNV 57

Query: 56  YLGQLNCLYIKAQSLKDMMGNRCGHLPNST--QEAIERLEHDYKALCNHANELGIREKNL 113
           YL QLN L ++ Q ++D   +    L ++   Q+ IE L +++K +    N+L  + K  
Sbjct: 58  YLAQLNSLIVRVQYIRDKFLHNINQLDSTQDEQKYIENLVYEFKQITLKLNDLSKKNKTT 117

Query: 114 EDXXX----XXXXXXXXXFQPKPLKIIER 138
                             F+PKPLKII+R
Sbjct: 118 SSSENSSKTASSKSSMESFEPKPLKIIKR 146

>KNAG0C00190 Chr3 (28746..30074) [1329 bp, 442 aa] {ON} Anc_1.4
           YCL063W
          Length = 442

 Score = 49.7 bits (117), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 81/354 (22%), Positives = 144/354 (40%), Gaps = 33/354 (9%)

Query: 1   MEQLAKIAQCALERSEEALVRLEKCVGKQRRLYESERSDQCLSEESSSTIVQYYS-YLGQ 59
           M+ L  +    L RS++A+++LE  V +Q +L  ++ +   +  +    I Q  + +L Q
Sbjct: 1   MDCLEDVTDRLLIRSQDAILQLELWVQQQEKLLLTDHA--SVDRKKFEAIAQQRNLHLSQ 58

Query: 60  LNCLYIKAQSLKDMMG---NRCGHLPNSTQEAIERLEHDYKALCNHANELGIREKNLEDX 116
           LN L ++++ +K+ +    N C  +    +  IE L ++++ +    NEL    +     
Sbjct: 59  LNSLCLRSRYIKEKLASERNICS-IRKGRRSYIENLVYEFQDIAMSLNELSETNRKNGSP 117

Query: 117 XXXXXXXXXXXFQPKPLKIIERRLAQTNTSPTKVCTATVMAKSFCRSGTDKNSDYIPDEI 176
                      F+PKPL+I+ER+      SPTK  +  +         T+K SD+  + +
Sbjct: 118 VSQATTNSSDSFEPKPLRILERQRTCNAKSPTKRNSNHIKIPR----ETEK-SDFT-ENV 171

Query: 177 GKXXXXXXXXXXXXEAKKEPKFIRVVKSCGTGLN-KHSNPHENRLSFFRDRQRLSISFIE 235
                          +    + IR+ KS    LN +    H   ++ F  + RLS+   +
Sbjct: 172 ADCLHSSLPSSPLRGSNGSQQTIRLTKSYHESLNGQKPTSHSPLMNPFNAKNRLSLYLFD 231

Query: 236 D---------DEYLSDEETITSGSPL---NASF-------LLNDFAKVAKGRPNQTLASS 276
           +         D+  SD+ET+   SP+    A+F              VAK  P  + A  
Sbjct: 232 NIDEKELTPCDDDNSDQETVMYNSPVVSKGAAFEPLRRYNSHESILSVAKKAPIHSSAQK 291

Query: 277 RHVENNERGAQTAAVSPFVSLVPKKTCTAQIGLTSIDIRPDFGPCFSPKKFETT 330
                +     T+A S FVS  P  T    +   S D+        + K  +TT
Sbjct: 292 LQFYPSATNGTTSAQSVFVSSKPVYTKPLSVQSRSKDLLSSIAHAEASKDTKTT 345

>CAGL0B00308g Chr2 (16533..17825) [1293 bp, 430 aa] {ON} similar to
           uniprot|P25591 Saccharomyces cerevisiae YCL063w
          Length = 430

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 75/304 (24%), Positives = 126/304 (41%), Gaps = 63/304 (20%)

Query: 1   MEQLAKIAQCALERSEEALVRLEKCV---GKQRRLYESERSDQCLSEESSSTIVQYYSYL 57
           M  L +I +  LERS EA+ +L++ +    K R + E++     +         +Y  +L
Sbjct: 1   MASLEEITERLLERSNEAIEQLDEWILLQNKNRHISENKSGLDSIERLDD----KYTEFL 56

Query: 58  GQLNCLYIKAQSLKDMM--------GNRCGHLPNSTQEAIERLEHDYKALCNHANELGIR 109
            +LN LYI++Q +KD +          R   L  S    I+ L  ++K +    NE+  +
Sbjct: 57  EKLNSLYIRSQYIKDKIRTEKNAKATKRKSELNTS---RIQELMLEFKEITLSLNEIAQQ 113

Query: 110 EKNLEDX----XXXXXXXXXXXFQPKPLKIIERR---LAQTNTSPTKVCTATVMAKSFC- 161
           +                     F PKPLKI+ R     +  N+ P K         SFC 
Sbjct: 114 DDETNSKQLSPASTSTKSSLESFTPKPLKILNRASMIRSPINSPPKKRNI------SFCP 167

Query: 162 ----RSGTDKNSDYIPDEIGKXXXXXXXXXXXXEAKKEPKFIRVVKSCGTGL--NKHSNP 215
                S T+  S  +P    +              +++ + +   +S  TGL   K   P
Sbjct: 168 IHENLSVTEYES--LPSSPNRSNL----------LEEQEQVLHPARSFQTGLRTEKARKP 215

Query: 216 HENRLS-FFRDRQRLSISFI-----EDDEYL-----SDEETI--TSGSPLNASFLLNDFA 262
            +N+L  +F+D+QRLS++       +D E L     SDEET+  TS S +    + +D  
Sbjct: 216 DKNQLDKYFKDKQRLSLTLFGSADADDGESLNNNDYSDEETVIFTSSSNIETDAITDDMK 275

Query: 263 KVAK 266
            + +
Sbjct: 276 PIRR 279

>TBLA0A07580 Chr1 complement(1878594..1880135) [1542 bp, 513 aa]
           {ON} Anc_1.4 YCL063W
          Length = 513

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 70/299 (23%), Positives = 119/299 (39%), Gaps = 69/299 (23%)

Query: 12  LERSEEALVRLEKCVGKQRRLYESERSDQCLSEESSSTIVQYYSYLGQLNCLYIKAQSLK 71
           L +++EA+++L+  +  Q+     +      SE        Y  Y+ QLN LY++AQ ++
Sbjct: 12  LTKAQEAVLQLDLWIKDQQGFQNRDGLRASTSESLEQAERDYNRYMFQLNSLYLRAQYIR 71

Query: 72  DMM----------GNRCGHLPNSTQEAIERLEHDYKALCNHANELGIREKNLEDXXXXXX 121
           D +           +  G+  NS    +++L  ++ +L    NEL   ++N+ +      
Sbjct: 72  DKIEKQNAYNLADSDVAGNDTNS-HAYVQQLVTEFYSLSIKMNELSAIQENVTNGSSPLS 130

Query: 122 XXXXXX----------FQPKPLKIIERRLAQTNT---------SPTKVCTATVMAKSFC- 161
                           FQP+PLKI++R+    N          SP K+   +   K    
Sbjct: 131 NKSSHSNDSLSKITDGFQPRPLKILQRQKHNNNQNTHPQPDLESPLKLKHRSSYNKLLSS 190

Query: 162 -----------RSGTDKNSDYIPDEIGKXXXXXXXXXXXXEAKKEPKFIRVVKSCGTGLN 210
                       S   KN++ + D                ++ +EP F     S     N
Sbjct: 191 NKKESKPYKNFNSKKSKNNELLSD----------ISPVKIQSFEEPTF-----SVANTRN 235

Query: 211 KHS-NPHENRLSFFRDRQRLSISFIE----DDEY-----LSDEETITSGSPLNASFLLN 259
           K+S +P     S F+   RLSI F +    DDEY     +SD++TI   +P  AS + N
Sbjct: 236 KNSMDPL--HYSLFKTNNRLSIQFPDGYDNDDEYDDPTCISDQDTIFVSTPKIASSIKN 292

>TPHA0E04020 Chr5 complement(842960..844582) [1623 bp, 540 aa] {ON}
           Anc_1.4 YCL063W
          Length = 540

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 61/269 (22%), Positives = 111/269 (41%), Gaps = 51/269 (18%)

Query: 4   LAKIAQCALERSEEALVRLEKCVGKQRRLYESER-------------SDQCLSEESSSTI 50
           L ++++  L RS+EA+++L+  + +Q++ +   R             S++ L+   S+  
Sbjct: 8   LEELSEKLLIRSQEAILQLDLWILRQQQQHNDHRFGTATDTGNKTKDSNEALNALRST-- 65

Query: 51  VQYYSYLGQLNCLYIKAQSLKDMMGNRCGHLP--NSTQEAIERLEHDYKALCNHANELGI 108
             Y  Y+ QLN LY++++ ++D + +   ++   N     IE L  +++ +    N+L  
Sbjct: 66  --YDLYMSQLNSLYVRSEFIRDKLNSEKNNVNKFNLDHRNIEELVFEFQNIREKLNQLAA 123

Query: 109 REKNLEDXXXXXXXXXXXXFQP---KPLKII---ERRLAQTNTSPTKVCTATVMAK---S 159
             K L+              +    KPLK++   E+R+++      K  + T   +   S
Sbjct: 124 SSK-LDKHSPPKTSTRSSSMESMNLKPLKVVAKHEKRMSKELELKNKEKSVTFGKETRIS 182

Query: 160 FCRSGTDKNSDYIPDEIGKXXXXXXXXXXXXEAKKEPKFIRVVKSCGTGLN--KHSNPHE 217
              +G            GK               K+ K +R   S  TGLN    SN   
Sbjct: 183 LTTNGIG----------GKLMIKDDSDASPQLIDKKYKVLRNAISYDTGLNSKSKSNKRS 232

Query: 218 NRL----------SFFRDRQRLSISFIED 236
           NR           S F+++QR SIS  ED
Sbjct: 233 NREYRKKNDAAYDSLFKNKQRFSISLFED 261

>KAFR0D00120 Chr4 (9052..10251) [1200 bp, 399 aa] {ON} Anc_1.4
           YCL063W
          Length = 399

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 109/481 (22%), Positives = 184/481 (38%), Gaps = 128/481 (26%)

Query: 7   IAQCALERSEEALVRLEKCVGKQRRLYESERSDQCLSEESSSTIVQYYSYLGQLNCLYIK 66
           ++   L+RSEEA+ +LE  + +Q +L++              T  +Y     QLN L  K
Sbjct: 5   VSDTLLQRSEEAVSQLESWLKQQEQLHQ--------------TTAEY----KQLNSLCAK 46

Query: 67  AQSLKDMMGNRCGHLPNSTQEAIER------LEHDYKALCNHANELGIREKNLEDXXXXX 120
           ++ + +++ +    +P+   E  ER      L H++  +    NE+              
Sbjct: 47  SKYISNLLKDDSSSIPHDLMEQKERSFIVESLIHEFNEISTKLNEI---------VTHTS 97

Query: 121 XXXXXXXFQPKPLKIIERRLAQTNTSPTKVCTAT-------VMAKSFCRSGTDKNSDYIP 173
                  F+PKPL ++  R  +   SPT+    T       +    F    T K  + +P
Sbjct: 98  PQSTIDSFEPKPLNLL--RKNKILESPTRSSPVTRGRLERKISINLFPMHTTTK-CNSVP 154

Query: 174 DEIGKXXXXXXXXXXXXEAKKEPKFIRVVKSCGTGLN-KHSNPHENRLSFFRDRQRLSIS 232
                             +    + +R +KS   GLN  + NP       F++  RLSIS
Sbjct: 155 ----------TSPKCKSTSTLNQRTLRNIKSYHYGLNGDYINP-------FKENNRLSIS 197

Query: 233 FIEDDEYLSDEE-----------TITSGSPLNASFLLNDFAKVAKGRPNQTLASSRHVEN 281
           F   D   +D             T+   SP    FL N   K+ +        S   V  
Sbjct: 198 FFNGDNTFNDNNSDSESDIDDDDTVLVTSP----FLTNPKQKLKRSN------SQDSVFW 247

Query: 282 NERGAQTAAVSPFVSLVPKKTC--TAQIGLTSIDIRPDFGPCFSPKKFETTESKEILSHF 339
           NE   +  +    ++L P      TA++  T + ++ + G   S        SK +L+ F
Sbjct: 248 NENYLRKPSFQKQLNLFPSTLTKPTAELSSTQVFLK-NTGRLGS-------SSKALLTSF 299

Query: 340 VI----KEPRTKSHSWLKGCDKSVPFLQTFKIFNNQVLVTSETGCRNVDRTTSTKLITPS 395
           V     ++ RT + S                IFN+   VTSE G   +D+   +++I   
Sbjct: 300 VKDNLQQQQRTHNASSFNN------------IFNS---VTSEIGKSKLDK---SQII--- 338

Query: 396 RKHFAQRELSDRTCSI-LVHGSSGSRF--------VNAPQQQELHFKVSYEALREALNTD 446
             H  +R LSD +  I  +  S  SRF        ++  ++  ++  V Y  L +ALNT+
Sbjct: 339 --HTERRVLSDNSIVISTLITSKKSRFNRFSSVDNISPTKKPIINNDVQYSDLNDALNTE 396

Query: 447 L 447
            
Sbjct: 397 F 397

>KAFR0E04390 Chr5 complement(879422..883717) [4296 bp, 1431 aa] {ON}
            Anc_4.370 YJR137C
          Length = 1431

 Score = 32.0 bits (71), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 12/30 (40%), Positives = 19/30 (63%)

Query: 299  PKKTCTAQIGLTSIDIRPDFGPCFSPKKFE 328
            P+K  T   G T +D+ P +GP + P+KF+
Sbjct: 1036 PRKKKTLVGGNTLVDVEPIYGPAYLPRKFK 1065

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.130    0.374 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 44,325,430
Number of extensions: 1805202
Number of successful extensions: 4894
Number of sequences better than 10.0: 24
Number of HSP's gapped: 4977
Number of HSP's successfully gapped: 29
Length of query: 449
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 336
Effective length of database: 40,524,141
Effective search space: 13616111376
Effective search space used: 13616111376
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 67 (30.4 bits)