Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_27.9830na 1ON36936916760.0
KLTH0E15862gna 1ON36836911371e-155
SAKL0C07986gna 1ON3813838521e-112
KLLA0C04433gna 1ON3673757283e-93
Ecym_5262na 1ON3543466691e-84
Kpol_1060.256.274ON28339677.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_27.9830
         (369 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_27.9830 s27 (76603..77712) [1110 bp, 369 aa] {ON} [contig 4...   650   0.0  
KLTH0E15862g Chr5 complement(1406851..1407957) [1107 bp, 368 aa]...   442   e-155
SAKL0C07986g Chr3 (742551..743696) [1146 bp, 381 aa] {ON} conser...   332   e-112
KLLA0C04433g Chr3 (405523..406626) [1104 bp, 367 aa] {ON} conser...   285   3e-93
Ecym_5262 Chr5 (544088..545152) [1065 bp, 354 aa] {ON} similar t...   262   1e-84
Kpol_1060.25 s1060 complement(63581..64432) [852 bp, 283 aa] {ON...    30   7.2  

>Kwal_27.9830 s27 (76603..77712) [1110 bp, 369 aa] {ON} [contig 43]
           FULL
          Length = 369

 Score =  650 bits (1676), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/369 (87%), Positives = 322/369 (87%)

Query: 1   MSRLYIASICVGVIVFGCVNSLATKYQDNQCVRDCDGDNPIYFNQPVLQTLQMFIGEMAM 60
           MSRLYIASICVGVIVFGCVNSLATKYQDNQCVRDCDGDNPIYFNQPVLQTLQMFIGEMAM
Sbjct: 1   MSRLYIASICVGVIVFGCVNSLATKYQDNQCVRDCDGDNPIYFNQPVLQTLQMFIGEMAM 60

Query: 61  LAFLRGQQRSKLPLEQGFRGKPAISLQGYLLLALPAVCDIIATTLMNWALVMIPVSIYQM 120
           LAFLRGQQRSKLPLEQGFRGKPAISLQGYLLLALPAVCDIIATTLMNWALVMIPVSIYQM
Sbjct: 61  LAFLRGQQRSKLPLEQGFRGKPAISLQGYLLLALPAVCDIIATTLMNWALVMIPVSIYQM 120

Query: 121 TRGAIXXXXXXXXXXXXHRRVTRFEWASLXXXXXXXXXXXYSGQEDEVLSEEVISTSSVF 180
           TRGAI            HRRVTRFEWASL           YSGQEDEVLSEEVISTSSVF
Sbjct: 121 TRGAIVFFVALFSVVFLHRRVTRFEWASLAIIVAGVAVVGYSGQEDEVLSEEVISTSSVF 180

Query: 181 GISLILVALFFMATQFIVEEHILSRWEINPVGLVGFEGFFGTSITLAFLLVGNVAGGNRN 240
           GISLILVALFFMATQFIVEEHILSRWEINPVGLVGFEGFFGTSITLAFLLVGNVAGGNRN
Sbjct: 181 GISLILVALFFMATQFIVEEHILSRWEINPVGLVGFEGFFGTSITLAFLLVGNVAGGNRN 240

Query: 241 KNSSFNMKQAFMDMYEHSAVLXXXXXXXXXXALFNFTGVSITKHVSATSRSTVDTCRTLL 300
           KNSSFNMKQAFMDMYEHSAVL          ALFNFTGVSITKHVSATSRSTVDTCRTLL
Sbjct: 241 KNSSFNMKQAFMDMYEHSAVLISSIIIMISIALFNFTGVSITKHVSATSRSTVDTCRTLL 300

Query: 301 VWCVSLILGWESFKFMQXXXXXXXXXXXXXXNGAIEIPPKYLPRYFKEDSSEGERQRLID 360
           VWCVSLILGWESFKFMQ              NGAIEIPPKYLPRYFKEDSSEGERQRLID
Sbjct: 301 VWCVSLILGWESFKFMQLCGFVLLVLGTLLFNGAIEIPPKYLPRYFKEDSSEGERQRLID 360

Query: 361 TIDEEVERF 369
           TIDEEVERF
Sbjct: 361 TIDEEVERF 369

>KLTH0E15862g Chr5 complement(1406851..1407957) [1107 bp, 368 aa]
           {ON} conserved hypothetical protein
          Length = 368

 Score =  442 bits (1137), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 227/369 (61%), Positives = 258/369 (69%), Gaps = 1/369 (0%)

Query: 1   MSRLYIASICVGVIVFGCVNSLATKYQDNQCVRDCDGDNPIYFNQPVLQTLQMFIGEMAM 60
           M +L+I  IC+GV+V G VNSL TKYQDNQCVRDC G +P+YFNQPVLQTLQMFIGEM+M
Sbjct: 1   MGQLFIPVICIGVVVCGGVNSLMTKYQDNQCVRDCQGASPVYFNQPVLQTLQMFIGEMSM 60

Query: 61  LAFLRGQQRSKLPLEQGFRGKPAISLQGYLLLALPAVCDIIATTLMNWALVMIPVSIYQM 120
           LA    Q R     +  F  KP I  + Y+LLALPA+CDIIATTLMN ALVMIPVSIYQM
Sbjct: 61  LALWWFQLRGTGRQQHEFDNKPLIKGRSYVLLALPAICDIIATTLMNLALVMIPVSIYQM 120

Query: 121 TRGAIXXXXXXXXXXXXHRRVTRFEWASLXXXXXXXXXXXYSGQEDEVLSEEVISTSSVF 180
            RGAI             R+V R EWA L           YSGQ  + +SE+  S+S + 
Sbjct: 121 VRGAIVFFVALFSVLFLGRQVCRLEWAYLATIVAGVAVVGYSGQSADTVSEQSFSSSLLV 180

Query: 181 GISLILVALFFMATQFIVEEHILSRWEINPVGLVGFEGFFGTSITLAFLLVGNVAGGNRN 240
           G+ LIL AL FMATQFIVEEH++SRW ++PVGL+G EG FG+SIT+A L+VGN  GG R+
Sbjct: 181 GVLLILFALLFMATQFIVEEHVMSRWAVSPVGLIGHEGLFGSSITVALLVVGNYMGGYRD 240

Query: 241 KNSSFNMKQAFMDMYEHSAVLXXXXXXXXXXALFNFTGVSITKHVSATSRSTVDTCRTLL 300
            NS+FNMKQAF DM+   AVL          ALFNF GVSITK+VSATSRSTVDTCRTLL
Sbjct: 241 VNSTFNMKQAFSDMFARPAVLNSSFVIMVSIALFNFFGVSITKNVSATSRSTVDTCRTLL 300

Query: 301 VWCVSLILGWESFKFMQXXXXXXXXXXXXXXNGAIEIPPKYLPRYFKEDSSEGERQRLID 360
           VWCVSL LGWESFKF Q              N AIEIP KYLP YF ED S GE QRLI+
Sbjct: 301 VWCVSLSLGWESFKFTQLCGFALLVIGTLLFNNAIEIPDKYLPSYFLEDKS-GESQRLIN 359

Query: 361 TIDEEVERF 369
           TIDEEVERF
Sbjct: 360 TIDEEVERF 368

>SAKL0C07986g Chr3 (742551..743696) [1146 bp, 381 aa] {ON} conserved
           hypothetical protein
          Length = 381

 Score =  332 bits (852), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 180/383 (46%), Positives = 232/383 (60%), Gaps = 16/383 (4%)

Query: 1   MSRLYIASICVGVIVFGCVNSLATKYQDNQCVRDCDGDNPIYFNQPVLQTLQMFIGEMAM 60
           M +  + ++  G+IV GC+NS+A+KYQDNQCVRDCDG  P+ F QPVLQTLQMFIGE ++
Sbjct: 1   MKQSLVIALSAGLIVTGCINSIASKYQDNQCVRDCDGPRPVLFEQPVLQTLQMFIGESSV 60

Query: 61  LA--FLRGQQRSKLPLEQGFRGKPAISLQGYLLLALPAVCDIIATTLMNWALVMIPVSIY 118
                LR       P  +    KP +     LLLALPAVCDI ATTLMN AL MIPVS+Y
Sbjct: 61  FVVLLLRVIAGGGSPRPRSVE-KPPLPGNRVLLLALPAVCDICATTLMNVALTMIPVSVY 119

Query: 119 QMTRGAIXXXXXXXXXXXXHRRVTRFEWASLXXXXXXXXXXXYSGQEDEV---------- 168
           QMTRGA+              R++R EW SL            +G               
Sbjct: 120 QMTRGALIIFVAMFSIVFLGHRISRLEWCSLFVVVLGVTIVGCNGGSGSDGGSGGNNSLL 179

Query: 169 --LSEEVISTSSVFGISLILVALFFMATQFIVEEHILSRWEINPVGLVGFEGFFGTSITL 226
             ++   +S+S   G+ LIL+A  FMA+QF++EEHI+SRW + PV LVGFEG FG SITL
Sbjct: 180 SSVATARLSSSLFAGVFLILIAQLFMASQFVIEEHIMSRWTMMPVKLVGFEGVFGGSITL 239

Query: 227 AFLLVGNVAGGNRNKNSSFNMKQAFMDMYEHSAVLXXXXXXXXXXALFNFTGVSITKHVS 286
           A +L+G++   + N +S FN+ QAF DM+    VL          A FNF G+SIT  V+
Sbjct: 240 AVMLLGHLTFASGNPHSPFNVVQAFTDMFASPRVLYSSVAIMFSIACFNFFGISITNSVN 299

Query: 287 ATSRSTVDTCRTLLVWCVSLILGWESFKFMQXXXXXXXXXXXXXXNGAIEIPPKYLPRYF 346
           AT+RST+DTCRTL+VWCVSL +GWESFKF Q              NGAI++  + LPR+ 
Sbjct: 300 ATARSTIDTCRTLMVWCVSLSIGWESFKFGQLFGFVLLILGTLVFNGAIKLRRESLPRFL 359

Query: 347 KEDSSEGERQRLIDTIDEEVERF 369
            ED  + + +RLID +DEEV+RF
Sbjct: 360 AEDYPQ-DYERLIDVVDEEVDRF 381

>KLLA0C04433g Chr3 (405523..406626) [1104 bp, 367 aa] {ON} conserved
           hypothetical protein
          Length = 367

 Score =  285 bits (728), Expect = 3e-93,   Method: Compositional matrix adjust.
 Identities = 166/375 (44%), Positives = 217/375 (57%), Gaps = 14/375 (3%)

Query: 1   MSRLYIASICVGVIVFGCVNSLATKYQDNQCVRDCDGDNPIYFNQPVLQTLQMFIGEMAM 60
           M +  +    + +IV GC+NS+ATKYQDNQCVRDCD  +P+ F QPVLQTLQMFIGE+++
Sbjct: 1   MRKELVIVTALSLIVTGCINSIATKYQDNQCVRDCDSISPVLFEQPVLQTLQMFIGEISL 60

Query: 61  LAFLRGQQRSK------LPLEQGFRGKPAISLQGYLLLALPAVCDIIATTLMNWALVMIP 114
           +  +  Q+ +       +P  +        S Q Y L ALPA+CDI  TTLMN AL MIP
Sbjct: 61  MFVMFWQKYNSRNGYEAVPSAESLNKTKLPSRQSYAL-ALPAICDICGTTLMNLALTMIP 119

Query: 115 VSIYQMTRGAIXXXXXXXXXXXXHRRVTRFEWASLXXXXXXXXXXXYSGQEDEVLSEEVI 174
           VSIYQMTRG +              +++RFEW SL           YSG          +
Sbjct: 120 VSIYQMTRGVLILFVALFSVFFLKHKISRFEWLSLFIVVFGVFLVGYSGNVGVT-----V 174

Query: 175 STSSVFGISLILVALFFMATQFIVEEHILSRWEINPVGLVGFEGFFGTSITLAFLLVGNV 234
             S V G+ LI++A    ATQF++EEHI+S+W I P  LV FEG +G SITL  +L+ +V
Sbjct: 175 DVSLVTGVLLIVLAQVCTATQFVLEEHIMSKWIIPPSTLVAFEGIYGASITLLTMLIASV 234

Query: 235 AGGNRNKNSSFNMKQAFMDMYEHSAVLXXXXXXXXXXALFNFTGVSITKHVSATSRSTVD 294
                 +NSSFN+  +  DM+ +  VL          A FNF G+++T  ++AT RST+D
Sbjct: 235 TFAQNKQNSSFNIVYSLQDMFVNPRVLYSSIIIMISIACFNFFGITLTNSMNATVRSTID 294

Query: 295 TCRTLLVWCVSLILGWESFKFMQXXXXXXXXXXXXXXNGAIEIPPKYLPRYFKEDSSEGE 354
           TCRTLLVW VSL LGWESFK  Q              NGAI I  K LP++  +D    +
Sbjct: 295 TCRTLLVWLVSLSLGWESFKLTQFNGFVLLVLGTLLFNGAITIDKKRLPQWLTKDYPGDD 354

Query: 355 RQRLIDTIDEEVERF 369
             R+I+ IDEEVERF
Sbjct: 355 --RIINVIDEEVERF 367

>Ecym_5262 Chr5 (544088..545152) [1065 bp, 354 aa] {ON} similar to
           KLLA0C04433g - Kluyveromyces lactis
          Length = 354

 Score =  262 bits (669), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 140/346 (40%), Positives = 206/346 (59%), Gaps = 10/346 (2%)

Query: 1   MSRLYIASICVGVIVFGCVNSLATKYQDNQCVRDCDGDNPIYFNQPVLQTLQMFIGEM-A 59
           M + ++  +C+G+I+ GC+NS+ATKYQD QCVR+C  D+P    QPVLQT+QMF+GE  A
Sbjct: 1   MRQSFVILLCLGMIITGCINSIATKYQDKQCVRNCLTDSPELLQQPVLQTVQMFLGEASA 60

Query: 60  MLAF-LRGQQRSKLPLEQGFRGKPAISLQGYLLLALPAVCDIIATTLMNWALVMIPVSIY 118
           + AF L G + S    +   + K  +      LL++PAVCDI  TT+M+ AL ++PVSIY
Sbjct: 61  LFAFYLLGARPSTSVTKFLLQNKNTV------LLSIPAVCDICGTTMMHLALTLVPVSIY 114

Query: 119 QMTRGAIXXXXXXXXXXXXHRRVTRFEWASLXXXXXXXXXXXYSGQEDEVLSEEVISTSS 178
           QM RG++            ++++TR EW SL            +G +D   + +  + ++
Sbjct: 115 QMVRGSLVIVVATFSVVFLNKKLTRGEWLSLYTVMFGIGIVGLTGFDD--WNSDKPAANT 172

Query: 179 VFGISLILVALFFMATQFIVEEHILSRWEINPVGLVGFEGFFGTSITLAFLLVGNVAGGN 238
           + GI+LILVA  FMA Q+++EEH++SR+  + + +VGFEG FG +ITL FLL+G      
Sbjct: 173 LLGITLILVAQLFMAAQYVIEEHLISRYPFDSLEVVGFEGLFGGAITLFFLLLGTFTIAW 232

Query: 239 RNKNSSFNMKQAFMDMYEHSAVLXXXXXXXXXXALFNFTGVSITKHVSATSRSTVDTCRT 298
           ++ +S  N+ Q   D+     ++          A +NF G++IT H++ATSRST+DT RT
Sbjct: 233 KDPSSPLNLFQGLKDVSYSGNLMVSSFTIMISIAFYNFFGIAITNHMNATSRSTIDTSRT 292

Query: 299 LLVWCVSLILGWESFKFMQXXXXXXXXXXXXXXNGAIEIPPKYLPR 344
           LLVW VSLILGWE F F+Q              NGAI      +P+
Sbjct: 293 LLVWLVSLILGWERFSFLQLIGFALSVVGTLIFNGAISFANYQVPQ 338

>Kpol_1060.25 s1060 complement(63581..64432) [852 bp, 283 aa] {ON}
           complement(63581..64432) [852 nt, 284 aa]
          Length = 283

 Score = 30.4 bits (67), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 23/39 (58%)

Query: 87  QGYLLLALPAVCDIIATTLMNWALVMIPVSIYQMTRGAI 125
           Q Y LL  P V   +A  L N   +MIP++I++MT G +
Sbjct: 56  QCYRLLTYPLVHLSLAHLLFNSMAMMIPLNIFEMTHGTL 94

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.325    0.138    0.415 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 31,296,851
Number of extensions: 1102514
Number of successful extensions: 2752
Number of sequences better than 10.0: 7
Number of HSP's gapped: 2790
Number of HSP's successfully gapped: 7
Length of query: 369
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 258
Effective length of database: 40,753,473
Effective search space: 10514396034
Effective search space used: 10514396034
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 66 (30.0 bits)