Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_27.98243.186ON58558528730.0
KLTH0E15884g3.186ON58659416630.0
SAKL0C07964g3.186ON62354710651e-137
AER213C3.186ON5575859961e-128
ZYRO0A04994g3.186ON6085599581e-121
Suva_4.2363.186ON6304829151e-115
Smik_4.2213.186ON6194809131e-114
NDAI0A065103.186ON7125539041e-112
Skud_4.2403.186ON6194788921e-111
YDL013W (SLX5)3.186ON6194788911e-111
NCAS0I019103.186ON6135468601e-107
KAFR0A012203.186ON6475488471e-104
TBLA0F007203.186ON6495337809e-95
KLLA0C04411g3.186ON6075557649e-93
Kpol_1036.523.186ON5915536694e-79
TDEL0D043503.186ON5565316333e-74
KNAG0J012703.186ON5473585321e-59
CAGL0K01881g3.186ON5062414801e-52
TPHA0A043703.186ON6642484493e-47
SAKL0H07502g8.637ON86082820.24
Suva_11.2491.286ON551133761.4
AEL006W3.211ON249196742.5
TPHA0I010201.286ON54167723.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_27.9824
         (585 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_27.9824 s27 (74597..76354) [1758 bp, 585 aa] {ON} YDL013W (...  1111   0.0  
KLTH0E15884g Chr5 complement(1408264..1410024) [1761 bp, 586 aa]...   645   0.0  
SAKL0C07964g Chr3 (740340..742211) [1872 bp, 623 aa] {ON} simila...   414   e-137
AER213C Chr5 complement(1028170..1029843) [1674 bp, 557 aa] {ON}...   388   e-128
ZYRO0A04994g Chr1 complement(400896..402722) [1827 bp, 608 aa] {...   373   e-121
Suva_4.236 Chr4 (422236..424128) [1893 bp, 630 aa] {ON} YDL013W ...   357   e-115
Smik_4.221 Chr4 (411040..412899) [1860 bp, 619 aa] {ON} YDL013W ...   356   e-114
NDAI0A06510 Chr1 complement(1479651..1481789) [2139 bp, 712 aa] ...   352   e-112
Skud_4.240 Chr4 (423826..425685) [1860 bp, 619 aa] {ON} YDL013W ...   348   e-111
YDL013W Chr4 (429067..430926) [1860 bp, 619 aa] {ON}  SLX5Subuni...   347   e-111
NCAS0I01910 Chr9 complement(350296..352137) [1842 bp, 613 aa] {O...   335   e-107
KAFR0A01220 Chr1 complement(238371..240314) [1944 bp, 647 aa] {O...   330   e-104
TBLA0F00720 Chr6 (182887..184836) [1950 bp, 649 aa] {ON} Anc_3.1...   305   9e-95
KLLA0C04411g Chr3 (403257..405080) [1824 bp, 607 aa] {ON} simila...   298   9e-93
Kpol_1036.52 s1036 complement(140685..142460) [1776 bp, 591 aa] ...   262   4e-79
TDEL0D04350 Chr4 complement(793070..794740) [1671 bp, 556 aa] {O...   248   3e-74
KNAG0J01270 Chr10 (226858..228501) [1644 bp, 547 aa] {ON} Anc_3....   209   1e-59
CAGL0K01881g Chr11 (167939..169459) [1521 bp, 506 aa] {ON} weakl...   189   1e-52
TPHA0A04370 Chr1 (980168..982162) [1995 bp, 664 aa] {ON} Anc_3.1...   177   3e-47
SAKL0H07502g Chr8 complement(650824..653406) [2583 bp, 860 aa] {...    36   0.24 
Suva_11.249 Chr11 complement(455625..457280) [1656 bp, 551 aa] {...    34   1.4  
AEL006W Chr5 (621384..628859) [7476 bp, 2491 aa] {ON} Syntenic h...    33   2.5  
TPHA0I01020 Chr9 (234445..236070) [1626 bp, 541 aa] {ON} Anc_1.2...    32   3.5  

>Kwal_27.9824 s27 (74597..76354) [1758 bp, 585 aa] {ON} YDL013W
           (HEX3) - involved in hexose metabolism [contig 43] FULL
          Length = 585

 Score = 1111 bits (2873), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 543/585 (92%), Positives = 543/585 (92%)

Query: 1   MRPFEPPTDANSTESGQADIIEIESGVEDNQQMLSHQDGVPDTLEVPRTSESDPSLRNEN 60
           MRPFEPPTDANSTESGQADIIEIESGVEDNQQMLSHQDGVPDTLEVPRTSESDPSLRNEN
Sbjct: 1   MRPFEPPTDANSTESGQADIIEIESGVEDNQQMLSHQDGVPDTLEVPRTSESDPSLRNEN 60

Query: 61  VETLCNTDDDDDELQVVGESILSERQTSYPETEYVDLDRSGEGSLGQRRPQAASSEEDLV 120
           VETLCNTDDDDDELQVVGESILSERQTSYPETEYVDLDRSGEGSLGQRRPQAASSEEDLV
Sbjct: 61  VETLCNTDDDDDELQVVGESILSERQTSYPETEYVDLDRSGEGSLGQRRPQAASSEEDLV 120

Query: 121 ILEERTSSPSFVLNLPGGEYLRINGSPLDQPVRRSFQAQAPRQFDSXXXXXXXXXXXXXX 180
           ILEERTSSPSFVLNLPGGEYLRINGSPLDQPVRRSFQAQAPRQFDS              
Sbjct: 121 ILEERTSSPSFVLNLPGGEYLRINGSPLDQPVRRSFQAQAPRQFDSAGARRRLARRTART 180

Query: 181 XSNLFMQPSDDEQEESVEGNTYQLPSTVMARRQRNALLMXXXXXXXXXXXXXGFGMIQSP 240
            SNLFMQPSDDEQEESVEGNTYQLPSTVMARRQRNALLM             GFGMIQSP
Sbjct: 181 ASNLFMQPSDDEQEESVEGNTYQLPSTVMARRQRNALLMQRRPQPSRRQPVRGFGMIQSP 240

Query: 241 ELSALEAQINRLPPNVRSAFDHAQSVHEFRSILQSIDWQNYHQRQDDLTSLFSEYRANLL 300
           ELSALEAQINRLPPNVRSAFDHAQSVHEFRSILQSIDWQNYHQRQDDLTSLFSEYRANLL
Sbjct: 241 ELSALEAQINRLPPNVRSAFDHAQSVHEFRSILQSIDWQNYHQRQDDLTSLFSEYRANLL 300

Query: 301 RSRSNQRIRRPGERSRLDSRMAGQDPSAQNLPYSPSLVGIMAQTFNPVLGRMHMGYDART 360
           RSRSNQRIRRPGERSRLDSRMAGQDPSAQNLPYSPSLVGIMAQTFNPVLGRMHMGYDART
Sbjct: 301 RSRSNQRIRRPGERSRLDSRMAGQDPSAQNLPYSPSLVGIMAQTFNPVLGRMHMGYDART 360

Query: 361 HGGIMGYGEVDEEQQTQNXXXXXXXXXXXXXXARKRKYMEDTKSKQLGYLEKAVKLPEGY 420
           HGGIMGYGEVDEEQQTQN              ARKRKYMEDTKSKQLGYLEKAVKLPEGY
Sbjct: 361 HGGIMGYGEVDEEQQTQNIIQMIQEREEQEYEARKRKYMEDTKSKQLGYLEKAVKLPEGY 420

Query: 421 SSSFDTTPKMNITIKKNGKEEELTVTDDQAAAFYMDLPSCSLCGVELGVGIPDEFQGLST 480
           SSSFDTTPKMNITIKKNGKEEELTVTDDQAAAFYMDLPSCSLCGVELGVGIPDEFQGLST
Sbjct: 421 SSSFDTTPKMNITIKKNGKEEELTVTDDQAAAFYMDLPSCSLCGVELGVGIPDEFQGLST 480

Query: 481 QDRGVSFEALKAKYEFHCPYQALSKPSLVDRDLSRRTYVAACGHSFCGRCFARIDNARSF 540
           QDRGVSFEALKAKYEFHCPYQALSKPSLVDRDLSRRTYVAACGHSFCGRCFARIDNARSF
Sbjct: 481 QDRGVSFEALKAKYEFHCPYQALSKPSLVDRDLSRRTYVAACGHSFCGRCFARIDNARSF 540

Query: 541 NRASKQKLKDLKGASHPDNYGPKKCPAKDCNNQLRNRGKMREVYF 585
           NRASKQKLKDLKGASHPDNYGPKKCPAKDCNNQLRNRGKMREVYF
Sbjct: 541 NRASKQKLKDLKGASHPDNYGPKKCPAKDCNNQLRNRGKMREVYF 585

>KLTH0E15884g Chr5 complement(1408264..1410024) [1761 bp, 586 aa]
           {ON} similar to uniprot|P32828 Saccharomyces cerevisiae
           YDL013W HEX3 Ring finger protein involved in the DNA
           damage response with possible recombination role
           genetically identified by synthetic lethality with SGS1
           (DNA helicase) and TOP3 (DNA topoisomerase) sporulation
           role interacts with Slx8p and Lin1p
          Length = 586

 Score =  645 bits (1663), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 337/594 (56%), Positives = 409/594 (68%), Gaps = 17/594 (2%)

Query: 1   MRPFEPPTDANSTESGQADIIEIESGVEDNQQMLSHQDGVPDTLEVPRTSESDPSL---- 56
           M P +   D    E  Q D+IEIES  ED  Q+L      P TLE P   +   SL    
Sbjct: 1   MNPEDTNMDGTPPECSQNDVIEIESDTEDETQVL------PGTLEAPDIGQMHGSLVDDL 54

Query: 57  --RNENVETLCNTDDDDDELQVVGESILSERQTSYPETEYVDLDRSGEGSLGQRRPQ--A 112
             +N   E  CNT+DDD E+Q++GE++L     + P     +++R+    + Q RP   +
Sbjct: 55  PSQNNASEVFCNTEDDD-EIQLLGETVLDGNNAAAPRLGNPNINRAESVGVAQIRPHQPS 113

Query: 113 ASSEEDLVILEERTSSPSFVLNLPGGEYLRINGSPLDQPVRRSFQAQAPRQFDSXXXXXX 172
           A+ EEDLVILEER +SPSFVLNLPGGE+L+I+GSPLDQPVRRSFQ Q  R  +S      
Sbjct: 114 AAGEEDLVILEERNNSPSFVLNLPGGEHLQISGSPLDQPVRRSFQTQGNRHTNSANGRRR 173

Query: 173 XXXXXXXXXSNLFMQPSDDEQEESVEGNTYQLPSTVMARRQRNALLMXXXXXXXXXXXXX 232
                    S+LF+ PSD+E E     NT  LP+ V  RRQRN+++              
Sbjct: 174 LLRRTARRASSLFLHPSDEEDEGFAYENTDLLPTGVRLRRQRNSMMQRRPNPPRRQLLGT 233

Query: 233 GFGMIQSPELSALEAQINRLPPNVRSAFDHAQSVHEFRSILQSIDWQNYHQRQDDLTSLF 292
           G   +  PEL +LEAQIN  P  VRSAFDHAQS+HEFRSILQS+D Q+Y QRQD+LT LF
Sbjct: 234 G-DDVDDPELLSLEAQINSFPFEVRSAFDHAQSIHEFRSILQSVDRQSYEQRQDELTHLF 292

Query: 293 SEYRANLLRSRSNQRIRRPGER-SRLDSRMAGQDPSAQNLPYSPSLVGIMAQTFNPVLGR 351
           + YR +++RS +N R+RR  +  S +++R   +   A NL YSP+L GI+A+TFNP+LG 
Sbjct: 293 TVYRGHVMRSWANDRLRRARDAASGMNTRTTDRTSQAHNLRYSPTLAGIIARTFNPILGH 352

Query: 352 MHMGYDARTHGGIMGYGEVDEEQQTQNXXXXXXXXXXXXXXARKRKYMEDTKSKQLGYLE 411
           MHM Y+     G+  Y + DEE+QTQN              +RKRKYMEDTK KQ GYL+
Sbjct: 353 MHMAYEPGLGTGMAAYNDADEERQTQNIIQMIQEREEREFESRKRKYMEDTKPKQSGYLQ 412

Query: 412 KAVKLPEGYSSSFDTTPKMNITIKKNGKEEELTVTDDQAAAFYMDLPSCSLCGVELGVGI 471
           KA KLP+GYS+SFDTTP+MNI+I KNG+ EELTV DD A A YMD+P+C LCGVELGVGI
Sbjct: 413 KAAKLPDGYSASFDTTPRMNISIMKNGQNEELTVVDDHADALYMDIPACCLCGVELGVGI 472

Query: 472 PDEFQGLSTQDRGVSFEALKAKYEFHCPYQALSKPSLVDRDLSRRTYVAACGHSFCGRCF 531
           PD FQGL  +DRGVSFEALKAKY FHCPYQ LSKPS+ DRDLSRRTYVA CGHSFCGRCF
Sbjct: 473 PDGFQGLYEEDRGVSFEALKAKYNFHCPYQTLSKPSVADRDLSRRTYVAQCGHSFCGRCF 532

Query: 532 ARIDNARSFNRASKQKLKDLKGASHPDNYGPKKCPAKDCNNQLRNRGKMREVYF 585
           ARIDNARSFNRASK+KL +LKGAS+PDNYGPK CPAKDCNN+LR+RGKMREVYF
Sbjct: 533 ARIDNARSFNRASKKKLSELKGASNPDNYGPKNCPAKDCNNRLRSRGKMREVYF 586

>SAKL0C07964g Chr3 (740340..742211) [1872 bp, 623 aa] {ON} similar
           to uniprot|P32828 Saccharomyces cerevisiae YDL013W HEX3
           Ring finger protein involved in the DNA damage response
           with possible recombination role genetically identified
           by synthetic lethality with SGS1 (DNA helicase) and TOP3
           (DNA topoisomerase) sporulation role interacts with
           Slx8p and Lin1p
          Length = 623

 Score =  414 bits (1065), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 231/547 (42%), Positives = 328/547 (59%), Gaps = 50/547 (9%)

Query: 74  LQVVGESILSERQTSYPETEYVDL---------------DRSG---EGSLGQRRPQAASS 115
           LQVVGE++L        + ++VDL               +R+G     ++ +    A  S
Sbjct: 92  LQVVGETMLDRHGPIGEDADFVDLSSFGGGDTGSGGSGDNRNGVPTRTAIIRHSTGANGS 151

Query: 116 E--EDLVILEERTSSPSFVLNLPGGEYLRINGSPLDQPVRRSFQAQAPRQFDSXXXXXXX 173
           +  +D+ ILEERT++P+FVLNLPGGE LRI+G+  DQPVRRSFQ Q P +  +       
Sbjct: 152 DRGDDIEILEERTTAPNFVLNLPGGESLRISGTTADQPVRRSFQNQQPSRTRAVSAAAAA 211

Query: 174 X----XXXXXXXSNLFMQPSDDEQEE-SVEGNTYQLPSTVMARRQRNALLMXXXXXXXXX 228
                       +NLF       Q+  S E +   +P+ V   RQ+NA+           
Sbjct: 212 RRRLLNRTARSATNLFFSSGQGPQDGYSEENDPDYIPAGVRQLRQQNAMRDRQASLEQRR 271

Query: 229 XXXXGFGMI--QSPELSALEAQINRLPPNVRSAFDHAQSVHEFRSILQSIDWQNYHQRQD 286
                 GM    + EL+AL ++IN  P +++SAFDHAQS++EF  I+QS++ +    R+ 
Sbjct: 272 EQQRLNGMDPGANAELTALRSRINGYPLDIQSAFDHAQSLYEFEGIIQSVEPRMNENRKQ 331

Query: 287 DLTSLFSEYRANLLRSRSNQRIRRPGERSRLDSRMAGQDPSAQNLPYSPSLVG------- 339
           +L  L+S YR +++ S +  R R   E++    +   ++   +       +         
Sbjct: 332 ELRELYSRYRGHVMHSWAQNRRRTYREQAARAQQTRAREQEQRQRELENQVFHNRHSLTE 391

Query: 340 -IMAQTFNPVLGRMHMGYDARTHGGIMGYGEVDEEQQTQNXXXXXXXXXXXXXXARKRKY 398
            ++A+ F P     H G             + DEE +TQN               RK++Y
Sbjct: 392 FLIARAFGP----FHWGGQ-----------QADEEIETQNIIEMIQAREEREQDTRKKRY 436

Query: 399 MEDTKSKQLGYLEKAVKLPEGYSSSFDTTPKMNITIKKNGKEEELTVTDDQAAAFYMDLP 458
           MEDTK +Q G+L +A  +PEGYS+SFDT PKM I + +NG+EEE+TVTDD AA  Y D+P
Sbjct: 437 MEDTKFQQQGFLRRAEGVPEGYSASFDTAPKMKIAMTRNGREEEVTVTDDHAAKQYEDVP 496

Query: 459 SCSLCGVELGVGIPDEFQGLSTQDRGVSFEALKAKYEFHCPYQALSKPSLVDRDLSRRTY 518
           +C LCG+ELGVGIPDEF G++ +DRGVSFE+L AKY FHCPYQ+L++PS+ DRDLS+RTY
Sbjct: 497 ACCLCGIELGVGIPDEFSGITKEDRGVSFESLVAKYGFHCPYQSLARPSVADRDLSKRTY 556

Query: 519 VAACGHSFCGRCFARIDNARSFNRASKQKLKDLKGASHPDNYGPKKCPAKDCNNQLRNRG 578
           VA+CGH+FCGRCFAR+DNAR+++RASK+KL  L+GASHPDNYGPK CPA+ C+ QLR++G
Sbjct: 557 VASCGHTFCGRCFARVDNARAYSRASKKKLAGLQGASHPDNYGPKTCPAEGCSMQLRSKG 616

Query: 579 KMREVYF 585
           +M+EV+F
Sbjct: 617 RMKEVFF 623

>AER213C Chr5 complement(1028170..1029843) [1674 bp, 557 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL013W
           (HEX3)
          Length = 557

 Score =  388 bits (996), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 230/585 (39%), Positives = 329/585 (56%), Gaps = 36/585 (6%)

Query: 8   TDANSTESGQADIIEIESGVEDNQQMLSHQDG---VPDT-LEVPRTSESDPSLRNENV-- 61
           TD N+  +    +IEIES  E++Q++++       VPD  L  PR    D + R  +V  
Sbjct: 2   TDPNAARNA---VIEIESDPEEDQRIINQYRQTRLVPDRRLNRPR----DAANRFVSVSG 54

Query: 62  ETLCNTDDDDDELQVVGESILSERQTSYPETEYVDLDRSGEGSLGQRRPQAASSEEDLVI 121
                  + DDE+++V E  L +        ++VDLD     S           ++D+ I
Sbjct: 55  RVAAAAGEGDDEVEIVNEVYLDDEGPIDSTADFVDLDEQQGPSSSMVINHDGGGDDDVAI 114

Query: 122 LEERTSSPSFVLNLPGGEYLRINGSPLDQPVRRSFQAQAPRQFDSXXXXXXXXXXXXXXX 181
           +EERT+ P+F+LNLP G+ LRI+GS  D+P+RRSF+ Q                      
Sbjct: 115 IEERTTHPTFLLNLPNGQTLRISGSVHDRPLRRSFETQ-------RTARANMLRRAARSA 167

Query: 182 SNLFMQPSDDEQEESVEGNTYQLPSTVMARRQRNALLMXXXXXXXXXXXXXGFGMIQSPE 241
             LFM  +D E  E    +   LP +V+  RQR   LM                 I  P 
Sbjct: 168 QRLFMNENDGEPSEREASDREYLPQSVL--RQRQQALMQERLQRQREHARQ-HEHIADP- 223

Query: 242 LSALEAQINRLPPNVRSAFDHAQSVHEFRSILQSIDWQNYHQRQDDLTSLFSEYRANLLR 301
                 Q++ L P +RS F HA+++HE R++L +           DL  L+ ++R+  + 
Sbjct: 224 ------QVDALAPELRSIFYHAETLHEVRTMLNASGLGTSAAAMQDLLQLYMQFRSRQIN 277

Query: 302 SRSNQRIRRPGERSRLDSRMAGQDPSAQNLPYSPSLVGIMAQTFNP-VLGRMHMGYDART 360
           + + QR +     S  ++  A  D +++    +P+L      +F   VL R   G+    
Sbjct: 278 NWARQRAQEFRHGSAREADHAQDDSASRARLRNPALNAQRRNSFTSYVLARSLGGFGVWP 337

Query: 361 HGGIMGYGEVDEEQQTQNXXXXXXXXXXXXXXARKRKYMEDTKSKQLGYLEKAVKLPEGY 420
           +    G    D+++ TQN              +RKRKYMEDTKS+Q  ++ +A +LPEGY
Sbjct: 338 ND-FFG----DDDEVTQNIIDIIQAREERDLDSRKRKYMEDTKSQQQAFVARAQRLPEGY 392

Query: 421 SSSFDTTPKMNITIKKNGKEEELTVTDDQAAAFYMDLPSCSLCGVELGVGIPDEFQGLST 480
            +SFD TPKM +T++KNGK EE+ V DD AA  Y+++P C LCGVELG+GIPD+F G+S 
Sbjct: 393 YASFDPTPKMKMTLEKNGKTEEVVVADDLAAKSYVEVPVCCLCGVELGLGIPDDFAGISA 452

Query: 481 QDRGVSFEALKAKYEFHCPYQALSKPSLVDRDLSRRTYVAACGHSFCGRCFARIDNARSF 540
            DRGVSFE+L +KY+FHCPYQAL+ PS+ DRDLSR+T+VA CGH+FCGRCFARI+NA+ F
Sbjct: 453 VDRGVSFESLVSKYDFHCPYQALAHPSIADRDLSRKTFVAHCGHTFCGRCFARINNAKRF 512

Query: 541 NRASKQKLKDLKGASHPDNYGPKKCPAKDCNNQLRNRGKMREVYF 585
           ++ SK++L +L G SHPDNYGP+ CPA+ C  QLR RGKMREV+F
Sbjct: 513 SKISKKRLAELHGPSHPDNYGPRVCPAEGCRGQLRTRGKMREVFF 557

>ZYRO0A04994g Chr1 complement(400896..402722) [1827 bp, 608 aa] {ON}
           similar to uniprot|P32828 Saccharomyces cerevisiae
           YDL013W HEX3 Ring finger protein involved in the DNA
           damage response with possible recombination role
           genetically identified by synthetic lethality with SGS1
           (DNA helicase) and TOP3 (DNA topoisomerase) sporulation
           role interacts with Slx8p and Lin1p
          Length = 608

 Score =  373 bits (958), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 220/559 (39%), Positives = 314/559 (56%), Gaps = 52/559 (9%)

Query: 60  NVETLCNTDD--DDDELQVVGESILSERQTSYP---ETEYVDLDRSG-----EGSLGQRR 109
           NV T  + D+   DDE+ +VGE   +      P   + EYVDLD        E +   R 
Sbjct: 69  NVATTRSQDNGGSDDEVAIVGEINNTRGNEEGPIGSDAEYVDLDADNGPQVIEVNDNNRN 128

Query: 110 PQAASSEEDLVILEERTSSPSFVLNLPGGEYLRINGSPLDQPVRRSFQAQAPRQFDSXXX 169
               S ++ LVI++ERT++P   LNLPGGE L+I+ SP D+P RRSF+ Q          
Sbjct: 129 NNENSDDDGLVIVQERTTAPRVTLNLPGGESLQIDASPTDRPYRRSFEWQ-----QQDRT 183

Query: 170 XXXXXXXXXXXXSNLFMQPSDDEQEESVEGNTY--QLPSTVMARRQRNALLMXXXXXXXX 227
                       S L    SDD+ ++S  G     +LP +V+  R++             
Sbjct: 184 RRQAMERSARRASRLLFHTSDDDDDDSGNGTVENGRLPPSVLQLRRQEEERSRLRNITRR 243

Query: 228 XXXXXGFGMIQSPELSALEAQINRLPPNVRSAFDHAQSVHEFRSILQSIDWQNYHQRQDD 287
                   M  +P L  L  +I+  PP+VRSAF HAQS++EFRSILQS+      +  ++
Sbjct: 244 RDQMRSDAMQGNPVLMRLRERIDSFPPDVRSAFVHAQSLYEFRSILQSVAPLTLQECDNE 303

Query: 288 LTSLFSEYRANLLRSRSNQRIRRPGERSRLDSRMAGQDPSAQNLPYSPSLVGIMAQTFNP 347
           L  LF+EYR+ ++++ +  R++   + SR   R+  ++   Q   +            N 
Sbjct: 304 LVPLFTEYRSRMVQNWATNRVQSNQQESR---RLNEENHERQRRLW-----------HNR 349

Query: 348 VLGRMHMGYDARTHGGIMGY---------------------GEVDEEQQTQNXXXXXXXX 386
              R+HMG        +  Y                     G++DEE+ TQ+        
Sbjct: 350 RHFRIHMGVGGGFGESLANYILMNANGMGSNDAAWLYNGYVGDMDEEESTQSIVSMIQER 409

Query: 387 XXXXXXARKRKYMEDTKSKQLGYLEKAVKLPEGYSSSFDTTPKMNITIKKNGKEEELTVT 446
                 +R +KYME T+ +Q  Y+++A++LP+GYS+SFDT PK+ + I ++GKEE + V 
Sbjct: 410 EEREHDSRTKKYMEKTQDQQQSYVQRAMELPDGYSASFDTEPKIKLDIVRDGKEETVVVK 469

Query: 447 DDQAAAFYMDLPSCSLCGVELGVGIPDEFQGLSTQDRGVSFEALKAKYEFHCPYQALSKP 506
           DD  +  + ++P C+LCGVELGVGIPDEF+G++  DRGVSFE L  KY+FHCPYQ L++P
Sbjct: 470 DDSVSDQWQEVPVCTLCGVELGVGIPDEFEGITKMDRGVSFECLVYKYQFHCPYQTLARP 529

Query: 507 SLVDRDLSRRTYVAACGHSFCGRCFARIDNARSFNRASKQKLKDLKGASHPDNYGPKKCP 566
           S +DRDLSRRT+VA CGH++CGRCFARIDNAR  +R +K+KL  LKG++HPDNYGPK CP
Sbjct: 530 SQLDRDLSRRTFVAPCGHTYCGRCFARIDNARGKSRMAKRKLAQLKGSAHPDNYGPKICP 589

Query: 567 AKDCNNQLRNRGKMREVYF 585
           AK C + +R RGKMRE +F
Sbjct: 590 AKGCKSPIRTRGKMREAFF 608

>Suva_4.236 Chr4 (422236..424128) [1893 bp, 630 aa] {ON} YDL013W
           (REAL)
          Length = 630

 Score =  357 bits (915), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 202/482 (41%), Positives = 283/482 (58%), Gaps = 27/482 (5%)

Query: 119 LVILEERTSSPSFVLNLPGGEYLRINGSPLDQPVRRSFQAQAPRQFDSXXXXXXXXXXXX 178
           L I+EERT+ P   LNLPGGE L +N +P D P+RRSF+ Q     D             
Sbjct: 161 LTIVEERTARPRITLNLPGGERLEVNATPRDIPIRRSFEFQE----DLAASRRQLLRRSA 216

Query: 179 XXXSNLFMQPSDDEQEESVEG--NTYQLPSTVMARRQRNALLMXXXXX-------XXXXX 229
               NLF++ SD++ E   E   NT  LP T+   R+ + + M                 
Sbjct: 217 ARARNLFVERSDEDDENDEEWTENTNDLPETIQRARRESHMRMSRRVAERQHRIRAQQQR 276

Query: 230 XXXGFGMIQSPELSALEAQINRLPPNVRSAFDHAQSVHEFRSILQSIDWQNYHQRQDDLT 289
                 M  +  L ++  +I    P++RSAF HA+S+HEFRSILQ++      + + +L 
Sbjct: 277 MVSNENMGTAIRLQSIRERIQAYVPDIRSAFHHAESLHEFRSILQNVAPVTLQECEGELM 336

Query: 290 SLFSEYRANLLRSRSNQRIRRPGERSRLDSRMA--GQDPSA----QNLPYSPSLVGIMAQ 343
           +LF+E+R  LL++ +  R+R   E +    R A  GQ+  A     + PY  S+   +  
Sbjct: 337 ALFTEFRNQLLQNWAIDRVRNTQEEALRLHREALEGQERVAGGALHHGPYRESISSYL-- 394

Query: 344 TFNPVLGRMHMGYDARTHGGIMGYGEVDEEQQTQNXXXXXXXXXXXXXXARKRKYMEDTK 403
            FN        G+  R  GG +   E DEE+ TQN                 +  M  TK
Sbjct: 395 NFNG-----EDGFLTRLWGGPV-LNEADEERHTQNIIDMIQEREERERDVVMKNLMNKTK 448

Query: 404 SKQLGYLEKAVKLPEGYSSSFDTTPKMNITIKKNGKEEELTVTDDQAAAFYMDLPSCSLC 463
           ++Q  + E+A  LPEGYS+SFDTTPKM + I KNGKEE +TV DD  A    D+  C LC
Sbjct: 449 AQQDEFEERAANLPEGYSASFDTTPKMKLDIMKNGKEETITVLDDDLAKTLEDVSVCCLC 508

Query: 464 GVELGVGIPDEFQGLSTQDRGVSFEALKAKYEFHCPYQALSKPSLVDRDLSRRTYVAACG 523
           GVELGVGIPD+F G+S +DRG+SFE L ++Y+FHCPYQ L++PS++DRDLS+RT+VA+CG
Sbjct: 509 GVELGVGIPDDFVGMSQKDRGISFEGLVSRYKFHCPYQTLARPSVLDRDLSKRTFVASCG 568

Query: 524 HSFCGRCFARIDNARSFNRASKQKLKDLKGASHPDNYGPKKCPAKDCNNQLRNRGKMREV 583
           H++CGRC+ARIDNA+  +++ K+KL +LKG++HPDNYGPK CPA  C   +R+RG+++EV
Sbjct: 569 HTYCGRCYARIDNAKKKSKSPKKKLAELKGSAHPDNYGPKLCPADSCKKLIRSRGRLKEV 628

Query: 584 YF 585
           YF
Sbjct: 629 YF 630

>Smik_4.221 Chr4 (411040..412899) [1860 bp, 619 aa] {ON} YDL013W
           (REAL)
          Length = 619

 Score =  356 bits (913), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 196/480 (40%), Positives = 282/480 (58%), Gaps = 20/480 (4%)

Query: 115 SEEDLVILEERTSSPSFVLNLPGGEYLRINGSPLDQPVRRSFQAQAPRQFDSXXXXXXXX 174
           +++ L I+EERT+ P   LNLPGGE L +N +  D P+RRSF+ Q     D         
Sbjct: 151 NDDGLTIVEERTTRPRITLNLPGGERLEVNATTTDIPIRRSFEFQE----DLAASRRQLL 206

Query: 175 XXXXXXXSNLFMQPSDDEQEESVEGNTYQLPSTVM-ARRQR----NALLMXXXXXXXXXX 229
                   +LF+  SD+  E+  E +T+ LP T+  ARR+     N  +           
Sbjct: 207 RRSATRARSLFVDRSDENDEDWTE-HTHSLPETIQRARRESHMRMNRRIAERQLMAQQQR 265

Query: 230 XXXGFGMIQSPELSALEAQINRLPPNVRSAFDHAQSVHEFRSILQSIDWQNYHQRQDDLT 289
                    S  L ++  +I    P+VRSAF HA+S+HEFRSILQ++      + +++L 
Sbjct: 266 ISRDENTSTSFRLQSIRERIQSYTPDVRSAFHHAESLHEFRSILQNVAPVTLQECEEELM 325

Query: 290 SLFSEYRANLLRSRSNQRIRRPGERSRLDSRMAGQD---PSAQNLPYSPSLVGIMAQTFN 346
           +LF+E+R  LL++ + +R+R   E +    R A +     + +N        G+  ++  
Sbjct: 326 ALFTEFRNQLLQNWAIERVRNTQEEALRLHREALERQGRTTGRNFHR-----GVFRESIA 380

Query: 347 PVLG-RMHMGYDARTHGGIMGYGEVDEEQQTQNXXXXXXXXXXXXXXARKRKYMEDTKSK 405
             L      G+ +R   G +   + DEE+ TQN                 +  M  TK++
Sbjct: 381 NYLNFNGDDGFLSRLWSGSV-LNDADEERHTQNIIDMIQEREERERDVVMKNLMNKTKAQ 439

Query: 406 QLGYLEKAVKLPEGYSSSFDTTPKMNITIKKNGKEEELTVTDDQAAAFYMDLPSCSLCGV 465
           Q  +  +A  LPEGYS+SFDTTPKM + I KNGKEE + VTDD  A    D+P C LCG 
Sbjct: 440 QEEFEARAASLPEGYSASFDTTPKMKLDIMKNGKEETIIVTDDDLAKTLDDIPVCCLCGA 499

Query: 466 ELGVGIPDEFQGLSTQDRGVSFEALKAKYEFHCPYQALSKPSLVDRDLSRRTYVAACGHS 525
           ELGVGIPD+F G+S +DRG+SFE L +KY+FHCPYQ L++PS++DRDLS+RT++A+CGH+
Sbjct: 500 ELGVGIPDDFTGMSQRDRGISFEGLVSKYKFHCPYQTLARPSVLDRDLSKRTFIASCGHA 559

Query: 526 FCGRCFARIDNARSFNRASKQKLKDLKGASHPDNYGPKKCPAKDCNNQLRNRGKMREVYF 585
           +CGRCFARIDNA+  ++  K+KL  LKG++HPDNYGPK CPA+ C   +R+RGK++EVYF
Sbjct: 560 YCGRCFARIDNAKKKSKTPKKKLAQLKGSAHPDNYGPKLCPAESCKKLIRSRGKLKEVYF 619

>NDAI0A06510 Chr1 complement(1479651..1481789) [2139 bp, 712 aa]
           {ON} Anc_3.186 YDL013W
          Length = 712

 Score =  352 bits (904), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 211/553 (38%), Positives = 295/553 (53%), Gaps = 67/553 (12%)

Query: 90  PETEYVDLDRSGEGSLGQRRPQAASSEE--------------------DLVILEERTSSP 129
           P  EYVDLD   E  +   RP+                          +++ILEERTS+P
Sbjct: 170 PTAEYVDLDAEPE-YITNSRPRTIIINNNSSNNNIENSNGDANDDDDDEVMILEERTSTP 228

Query: 130 SFVLNLPGGEYLRINGSPLDQPVRRSFQAQAPRQFDSXXXXXXXXXXXXXXXSNLFMQPS 189
           +  LNLPGGE LRIN  P ++P R SF++                       ++LF   S
Sbjct: 229 TVTLNLPGGERLRINADPNERPTRSSFES-LNENIVPLSRRQLLRRATRRATNSLFFHGS 287

Query: 190 DDEQEESVEGNTYQLPSTVMARRQRNALLMXXXXXXXXXXXXXGFGMIQSP--------- 240
           D E E   + +   LP++++  RQR  ++              G     +          
Sbjct: 288 D-ENESDNDTDEVSLPASILGMRQRARMMAMQERQRQRQGQGQGHSAPDTSGNSVDNTST 346

Query: 241 --ELSALEAQINRLPPNVRSAFDHAQSVHEFRSILQSIDWQNYHQRQDDLTSLFSEYRAN 298
              L  L  +I+  PP+VR AFDHAQS+ EF SI+QS+    + +  DDL SLF++YR  
Sbjct: 347 NRNLINLRERIHTYPPDVRGAFDHAQSLQEFTSIVQSVAPTTFAECSDDLISLFTQYRGQ 406

Query: 299 LLRSRSNQRIR---RPGERSRLDSRMAGQDPS--AQNLPYSPSLVGIMAQTFNPVLGRMH 353
           ++   + +RIR   R  ER  L  R A    +  A N  +  +L          ++ ++ 
Sbjct: 407 VMADWTLRRIRQSQRDNER-LLRERHARVRSTIRANNRHFGSNLASFF------LMNQLG 459

Query: 354 MGY---------------------DARTHGGIMGYGEVDEEQQTQNXXXXXXXXXXXXXX 392
           +GY                     D     G  GY   D++  TQN              
Sbjct: 460 LGYGDVGAADDEDDGDYGIGEEDNDTGRAAGAYGYEYEDDDAHTQNIINMIQRREDAERD 519

Query: 393 ARKRKYMEDTKSKQLGYLEKAVKLPEGYSSSFDTTPKMNITIKKNGKEEELTVTDDQAAA 452
           +R + +M  TK +Q G+ ++A+ LPEGYSSSF T PK+ +T+KKNGK+E + + D   A 
Sbjct: 520 SRTKGFMSKTKPQQDGFKKRALALPEGYSSSFSTEPKVKMTVKKNGKDETVIMEDVDLAK 579

Query: 453 FYMDLPSCSLCGVELGVGIPDEFQGLSTQDRGVSFEALKAKYEFHCPYQALSKPSLVDRD 512
           ++MD+P+C LCGVELGVGIP +F G S +D GVSFE L +KY+FHCPYQ+LSKPS +DRD
Sbjct: 580 YWMDVPACILCGVELGVGIPKDFVGTSDKDHGVSFEFLVSKYDFHCPYQSLSKPSQLDRD 639

Query: 513 LSRRTYVAACGHSFCGRCFARIDNARSFNRASKQKLKDLKGASHPDNYGPKKCPAKDCNN 572
           LS++ YVA+CGH+FCGRC+ RIDNA+S ++  K+KL +LKG+SHPDNYGPK CP   C  
Sbjct: 640 LSQKVYVASCGHTFCGRCYVRIDNAKSKSKLPKKKLAELKGSSHPDNYGPKTCPGPSCKT 699

Query: 573 QLRNRGKMREVYF 585
            LR+RG+MRE+YF
Sbjct: 700 LLRSRGRMREIYF 712

>Skud_4.240 Chr4 (423826..425685) [1860 bp, 619 aa] {ON} YDL013W
           (REAL)
          Length = 619

 Score =  348 bits (892), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 191/478 (39%), Positives = 272/478 (56%), Gaps = 24/478 (5%)

Query: 119 LVILEERTSSPSFVLNLPGGEYLRINGSPLDQPVRRSFQAQAPRQFDSXXXXXXXXXXXX 178
           L I+EERT+ P   LNLPGGE L +N +  D P+RRSF+ Q     D             
Sbjct: 155 LTIVEERTTRPRVTLNLPGGERLEVNATTTDMPIRRSFEFQD----DLAVSRRQLLRRSA 210

Query: 179 XXXSNLFMQPSDDEQEESVEGNTYQLPSTVMARRQRNALLMXXXXX-----XXXXXXXXG 233
                LF+  SD+  EE  E +T  +P  +   R+ + + M                   
Sbjct: 211 ARARTLFVDRSDENDEEWTE-DTDNVPEAIQRARRESHMRMSRRIAERQLRAQQHRMASN 269

Query: 234 FGMIQSPELSALEAQINRLPPNVRSAFDHAQSVHEFRSILQSIDWQNYHQRQDDLTSLFS 293
             M  S    ++  +I    P++RSAF HA+S+HEFRSILQ++      + + +L +LF+
Sbjct: 270 ENMNTSIRFQSIRERIQAYAPDIRSAFYHAESLHEFRSILQNVAPVTLQECEGELMALFT 329

Query: 294 EYRANLLRSRSNQRIRRPGE------RSRLDSRMAGQDPSAQNLPYSPSLVGIMAQTFNP 347
           E+R  LL+  +  R+R   E      R  L+ +           P+  S+   +   F+ 
Sbjct: 330 EFRNQLLQDWAIDRVRNTQEEALRLHREALERQERATGRVFHRGPFRESITNYL--NFSG 387

Query: 348 VLGRMHMGYDARTHGGIMGYGEVDEEQQTQNXXXXXXXXXXXXXXARKRKYMEDTKSKQL 407
                  G+  R  G  +   + DEE+ TQN                 +  M  TK++Q 
Sbjct: 388 -----ENGFLTRLWGSPV-LNDADEERHTQNIIDMIQEREERERDVVMKNLMSKTKAQQE 441

Query: 408 GYLEKAVKLPEGYSSSFDTTPKMNITIKKNGKEEELTVTDDQAAAFYMDLPSCSLCGVEL 467
            + ++A +LPEGYS+SFDTTPKM + I KN KEE +TVTDD  A     +P C LCGVEL
Sbjct: 442 EFEDRAARLPEGYSASFDTTPKMKLDIMKNDKEETITVTDDDLARTLEVIPVCCLCGVEL 501

Query: 468 GVGIPDEFQGLSTQDRGVSFEALKAKYEFHCPYQALSKPSLVDRDLSRRTYVAACGHSFC 527
           GVGIPD+F G++ +DRG+SFE L +KY+FHCPYQ L++PS++DRDLSRRT++AACGH++C
Sbjct: 502 GVGIPDDFIGMNQKDRGISFEGLVSKYKFHCPYQTLARPSMLDRDLSRRTFIAACGHAYC 561

Query: 528 GRCFARIDNARSFNRASKQKLKDLKGASHPDNYGPKKCPAKDCNNQLRNRGKMREVYF 585
           GRCFARIDNA+  ++  K+KL  L+G++HPDNYGPK CPA+ C   +R+RG+++EVYF
Sbjct: 562 GRCFARIDNAKKKSKTPKKKLASLRGSAHPDNYGPKFCPAESCKKPIRSRGRLKEVYF 619

>YDL013W Chr4 (429067..430926) [1860 bp, 619 aa] {ON}  SLX5Subunit
           of the Slx5-Slx8 SUMO-targeted ubiquitin ligase (STUbL)
           complex, stimulated by SUMO-modified substrates;
           contains a RING domain and two SIMs (SUMO-interacting
           motifs); forms SUMO-dependent nuclear foci, including
           DNA repair centers
          Length = 619

 Score =  347 bits (891), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 192/478 (40%), Positives = 276/478 (57%), Gaps = 16/478 (3%)

Query: 115 SEEDLVILEERTSSPSFVLNLPGGEYLRINGSPLDQPVRRSFQAQAPRQFDSXXXXXXXX 174
           S++ L I+EERT+ P   LNLPGGE L +  +  D P+RRSF+ Q     D         
Sbjct: 151 SDDGLTIVEERTTRPRVTLNLPGGERLEVTATTTDIPIRRSFEFQE----DLGASRRQLL 206

Query: 175 XXXXXXXSNLFMQPSDDEQEESVEGNTYQLPSTVM-----ARRQRNALLMXXXXXXXXXX 229
                   NLF+  SD E +E    +T+ LP  +      +R + +  +           
Sbjct: 207 RRSATRARNLFVDRSD-ENDEDWTDDTHNLPEAIQRARRESRMRMSRRIAERQRRVQQQR 265

Query: 230 XXXGFGMIQSPELSALEAQINRLPPNVRSAFDHAQSVHEFRSILQSIDWQNYHQRQDDLT 289
                 +  S  L ++  +I    P++RSAF  A+S+HEFRSILQ++      + +++L 
Sbjct: 266 VSSDENISTSIRLQSIRERIQSYTPDIRSAFHRAESLHEFRSILQNVAPITLQECEEELM 325

Query: 290 SLFSEYRANLLRSRSNQRIRRPGERSRLDSRMA--GQDPSAQNLPYSPSLVGIMAQTFNP 347
           +LF+E+R  LL++ +  R+R   E +    R A   Q+ +A  + +  +L   +    N 
Sbjct: 326 ALFTEFRNQLLQNWAIDRVRNTQEEALRLHREALERQERTAGRVFHRGTLRESITNYLN- 384

Query: 348 VLGRMHMGYDARTHGGIMGYGEVDEEQQTQNXXXXXXXXXXXXXXARKRKYMEDTKSKQL 407
                  G+ +R   G     + DEE+ TQN                 +  M  T+++Q 
Sbjct: 385 --FNGEDGFLSRLWSG-PALSDADEERHTQNIIDMIQEREERERDVVMKNLMNKTRAQQE 441

Query: 408 GYLEKAVKLPEGYSSSFDTTPKMNITIKKNGKEEELTVTDDQAAAFYMDLPSCSLCGVEL 467
            +  +A  LPEGYS+SFDTTPKM + I KNGKEE + VTDD  A    D+P C LCG EL
Sbjct: 442 EFEARAASLPEGYSASFDTTPKMKLDITKNGKEETIIVTDDDLAKTLEDIPVCCLCGAEL 501

Query: 468 GVGIPDEFQGLSTQDRGVSFEALKAKYEFHCPYQALSKPSLVDRDLSRRTYVAACGHSFC 527
           GVGIPD+F G+S +DRGVSFE L +KY+FHCPYQ L++PS++DRDLS+RT++A+CGH+FC
Sbjct: 502 GVGIPDDFTGISQKDRGVSFEGLVSKYKFHCPYQTLARPSMLDRDLSKRTFIASCGHAFC 561

Query: 528 GRCFARIDNARSFNRASKQKLKDLKGASHPDNYGPKKCPAKDCNNQLRNRGKMREVYF 585
           GRCFARIDNA+  ++  K+KL  LKG++HPDNYGPK CPA  C   +R+RG+++EVYF
Sbjct: 562 GRCFARIDNAKKKSKMPKKKLAQLKGSAHPDNYGPKLCPADSCKKLIRSRGRLKEVYF 619

>NCAS0I01910 Chr9 complement(350296..352137) [1842 bp, 613 aa] {ON}
           Anc_3.186 YDL013W
          Length = 613

 Score =  335 bits (860), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 195/546 (35%), Positives = 301/546 (55%), Gaps = 57/546 (10%)

Query: 75  QVVGESILSERQTSYPETEYVDLDRS---GEGSLGQRR--------PQAASSEEDLVILE 123
           ++V  ++  +     P+ E++DLD+       ++ + R        P     ++DLVI +
Sbjct: 90  EIVNPNVARDDAPINPDAEFIDLDQEVPYANATIPRPRTIQIITPSPPQQQQDDDLVITQ 149

Query: 124 ERTSSPSFVLNLPGGEYLRINGSPLDQPVRRSFQAQ-----APRQFDSXXXXXXXXXXXX 178
           ERT  P+  LNLPGG+ L+++ +P DQ  R SF+ Q     A RQ               
Sbjct: 150 ERTMRPTVTLNLPGGQTLQVDATPTDQLARSSFEWQENIPLARRQL---------LRRST 200

Query: 179 XXXSNLFMQPSDDEQEESVEGNTYQLPSTVMARRQRNALLMXXXXXXXXXXXXXGFGMIQ 238
              ++LF     D+ E   +  +  LP  V+  RQR                        
Sbjct: 201 NRANSLFFH---DDHESDNDNGSVPLPPNVIRLRQRQQQQNREEPPPPPPPQDDA----- 252

Query: 239 SPELSALEAQINRLPPNVRSAFDHAQSVHEFRSILQSIDWQNYHQRQDDLTSLFSEYRAN 298
           +P ++ L  +IN   P+++SAF+HA S+HEF SILQ++      +  D+L SLF++YR+ 
Sbjct: 253 NPIMTRLRTRINTYSPDIQSAFNHAHSLHEFTSILQNVAPLTLQECGDELLSLFTQYRSQ 312

Query: 299 LLRSRSNQRIRRPGERSRLDSRMAGQDPSAQN---LPYSPSLVGIMAQTFNPVLGRMHMG 355
           L+ + + +R+R   + +   +       + +    L  +P+  G     FN  L R+ + 
Sbjct: 313 LMVNWATRRVRSSQQNTSSSNHRQRNLRNLRRNGALRVTPNANG-----FNVNLARLFLM 367

Query: 356 YDARTHGG-------IMGY---------GEVDEEQQTQNXXXXXXXXXXXXXXARKRKYM 399
                + G          Y         G+ +++ QTQN               R + +M
Sbjct: 368 NQLGINNGNDEDQYFTGAYNSEDDADHNGDDEDDTQTQNIINMIQRREEQEHDTRTKSFM 427

Query: 400 EDTKSKQLGYLEKAVKLPEGYSSSFDTTPKMNITIKKNGKEEELTVTDDQAAAFYMDLPS 459
             TK +Q  + ++A +LPE YS++F+T P M + IKKNGKEE + V D+ AA  Y+++P+
Sbjct: 428 ARTKPQQDAFKKRANELPENYSANFNTEPTMKLDIKKNGKEETIIVEDNDAAKNYIEVPA 487

Query: 460 CSLCGVELGVGIPDEFQGLSTQDRGVSFEALKAKYEFHCPYQALSKPSLVDRDLSRRTYV 519
           C+LCGVELGVGIP +FQG++  DRG SFE+L +KY+FHCPYQ+L+KPS +D+DLS+R ++
Sbjct: 488 CTLCGVELGVGIPKDFQGINDTDRGGSFESLVSKYKFHCPYQSLAKPSQLDKDLSQRVFM 547

Query: 520 AACGHSFCGRCFARIDNARSFNRASKQKLKDLKGASHPDNYGPKKCPAKDCNNQLRNRGK 579
           A+CGH+FCGRC+ARIDNA+S ++  K+ LK LKG+SHPDNYGP+ CPA  C + LR + K
Sbjct: 548 ASCGHTFCGRCYARIDNAKSKSKLPKKTLKQLKGSSHPDNYGPRVCPADSCRSLLRVKTK 607

Query: 580 MREVYF 585
           MREV+F
Sbjct: 608 MREVFF 613

>KAFR0A01220 Chr1 complement(238371..240314) [1944 bp, 647 aa] {ON}
           Anc_3.186 YDL013W
          Length = 647

 Score =  330 bits (847), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 204/548 (37%), Positives = 290/548 (52%), Gaps = 60/548 (10%)

Query: 90  PETEYVDLD---RSGEGSLGQRRPQA---------ASSEED-LVILEERTSSPSFVLNLP 136
           P  EY+DLD   +   G  G   P+           ++E+D L I+EERT+ P+  LNLP
Sbjct: 108 PGAEYIDLDTEDQYASGHHGFNTPRIVVINGDSNNGNNEDDGLEIIEERTTRPTVTLNLP 167

Query: 137 GGEYLRINGSPLDQPVRRSFQAQAPRQFDSXXXXXXXXXXXXXXXSNLFMQPSDDEQEES 196
           GGE L+IN S  D+P  RSF+ Q                       +LF+  SDDE  ++
Sbjct: 168 GGESLQINASDSDRPAHRSFEWQDA----LPEPRRRLLRRSAGRIRSLFLNNSDDENNDT 223

Query: 197 VEG--NTYQLPSTVMARRQRNALLMXXXXXXXXXXXXXGFGMIQ-SPELSALEAQINRLP 253
             G  N   LPS +   RQ     M                MI  +P    +  +IN   
Sbjct: 224 AAGRQNNRYLPSNIRRLRQEEQAQMRQLAQRRRRMNEQRPEMISGNPRFDEIRNRINAYS 283

Query: 254 PNVRSAFDHAQSVHEFRSILQSIDWQNYHQRQDDLTSLFSEYRANLLRSRSNQRIRRPGE 313
           P++RSAFDHAQ++HEF+SIL++I          +L SL++EYR+ LL++ + +R++    
Sbjct: 284 PDIRSAFDHAQTIHEFKSILENIAPVTLQDCGAELISLYTEYRSYLLQNWATRRVQNSAA 343

Query: 314 ------------------------RSRLDSRMAGQDPSAQNLPYSPSLVGIMAQTFNPVL 349
                                   R R D        +A NL    + + +    F  V 
Sbjct: 344 PATAGRARTDGRDRRRRTRNQRLARLRFDMESNEGGLTANNL----ARIFLANNGFQNVF 399

Query: 350 --GRMHMGYDARTHG---------GIMGYGEVDEEQQTQNXXXXXXXXXXXXXXARKRKY 398
             G +    D   +G         G  G  E +E Q+TQN              +R + +
Sbjct: 400 DGGDIRDDEDGDYYGYMNEYDDYMGEHGENEDEEAQRTQNIINMIQEREEREHDSRTKGF 459

Query: 399 MEDTKSKQLGYLEKAVKLPEGYSSSFDTTPKMNITIKKNGKEEELTVTDDQAA-AFYMDL 457
           M +TKS++    +KA  LP+GYS++FD+TPK  +   KNGKEEE+ V DD A     M++
Sbjct: 460 MANTKSQREANHKKARNLPDGYSANFDSTPKTVVKAMKNGKEEEIIVDDDVAVRNNLMEV 519

Query: 458 PSCSLCGVELGVGIPDEFQGLSTQDRGVSFEALKAKYEFHCPYQALSKPSLVDRDLSRRT 517
           P C+LCG ELG+GIPD+F+G+  +DRG+SF+ L +KY+ +CPYQ+L+KPS +DR LS+RT
Sbjct: 520 PICTLCGAELGIGIPDDFKGIGEEDRGLSFQFLVSKYKSYCPYQSLAKPSEIDRHLSKRT 579

Query: 518 YVAACGHSFCGRCFARIDNARSFNRASKQKLKDLKGASHPDNYGPKKCPAKDCNNQLRNR 577
           +VA CGH +CGRC ARI NA+  +R  K++L  L G+SHP+NYGPKKCPA +C   LR+R
Sbjct: 580 FVAKCGHLYCGRCVARISNAKENSRKPKKELAKLIGSSHPENYGPKKCPADNCKGLLRSR 639

Query: 578 GKMREVYF 585
           GK+ EVYF
Sbjct: 640 GKLSEVYF 647

>TBLA0F00720 Chr6 (182887..184836) [1950 bp, 649 aa] {ON} Anc_3.186
           YDL013W
          Length = 649

 Score =  305 bits (780), Expect = 9e-95,   Method: Compositional matrix adjust.
 Identities = 198/533 (37%), Positives = 271/533 (50%), Gaps = 71/533 (13%)

Query: 90  PETEYVDLDRSGEGS----LGQRRPQAASSE-------------EDLVILEERTSSPSFV 132
           P TEYVDLD   E S     G  R      +             +DLVI++ERTS+P+  
Sbjct: 151 PSTEYVDLDNEAEYSSNNNYGHSRTLIVDGDNDNADVIDDGNGADDLVIVQERTSAPTVT 210

Query: 133 LNLPGGEYLRINGSPLDQPVRRSFQAQA----------PRQFDSXXXXXXXXXXXXXXXS 182
           L LPG   ++IN +P D+PVR SF  Q            R+++S                
Sbjct: 211 LTLPGNRSIQINAAPTDRPVRSSFGWQGGVPDSRRGMLARRYNSVRQ------------- 257

Query: 183 NLFMQPSDDEQEESVEGNTYQLPSTV-----MARRQRNALLMXXXXXXXXXXXXXGF-GM 236
            LF    +D      + ++Y    T      +  R+RNA+                    
Sbjct: 258 -LFFNSDEDASRNGSDSDSYDDDYTPARLQRIQNRERNAVRQRMMQQRRQQQILRQEQSR 316

Query: 237 IQSPELSALEAQINRLPPNVRSAFDHAQSVHEFRSILQSIDWQNYHQRQDDLTSLFSEYR 296
            +SP ++ L  +IN  PP+VRS FDHA +++EF +++QS         + DL  +F+ YR
Sbjct: 317 NESPIMAELRRRINAYPPDVRSIFDHATTLNEFLALMQSTAPITLEDNRTDLIDIFTLYR 376

Query: 297 ANLLRSRSNQRIRRPGERSRLDSRMAGQDPSAQNLPYSPSLVGIMAQTFNPVLGRMH--M 354
            NL +   N  I R        +R A   P  +N+P     V           G +H  M
Sbjct: 377 GNLTQ---NWMINRMNSSRDNSARTASSTP-MRNMPAHTRFVQ----------GFLHSIM 422

Query: 355 GYDARTHGGIMGYG--EVDEEQQTQNXXXXXXXXXXXXXXARKRKYMEDTKSKQLGYLEK 412
           G      GG   YG  E DEE  TQN              ++ ++ M+ TK +Q  +  K
Sbjct: 423 GL-----GGDFPYGGTESDEEATTQNIIRMIEEREANERDSKVKQLMKKTKKQQEDFENK 477

Query: 413 AVKLPEGYSSSFDTTPKMNITIKKNGKEEELTVTDDQAAAFYMDLPSCSLCGVELGVGIP 472
           A  LP+G+S+SF   PK  I+I  +  + E+ VTD+  A  Y +LP C LCGVELGVGIP
Sbjct: 478 AKYLPKGFSASFSLVPKKIISIDGDDSKREI-VTDEFLAEEYEELPVCCLCGVELGVGIP 536

Query: 473 DEFQGLSTQDRGVSFEALKAKYEFHCPYQALSKPSLVDRDLSRRTYVAACGHSFCGRCFA 532
           D F+G++ ++  VSF++L  KY   CPY ALS P  +DRDLSRRTYVA+CGHSFCGRC  
Sbjct: 537 DSFRGITPEESKVSFDSLVKKYNIPCPYNALSAPGDIDRDLSRRTYVASCGHSFCGRCVR 596

Query: 533 RIDNARSFNRASKQKLKDLKGASHPDNYGPKKCPAKDCNNQLRNRGKMREVYF 585
           RI++A+   + SKQKLK+L G  +PD YGPK CPA DC  +LR +G+MREVYF
Sbjct: 597 RINHAKESGKISKQKLKELVGPENPDIYGPKTCPATDCTGKLRRKGQMREVYF 649

>KLLA0C04411g Chr3 (403257..405080) [1824 bp, 607 aa] {ON} similar
           to uniprot|P32828 Saccharomyces cerevisiae YDL013W HEX3
           Ring finger protein involved in the DNA damage response
           with possible recombination role genetically identified
           by synthetic lethality with SGS1 (DNA helicase) and TOP3
           (DNA topoisomerase) sporulation role interacts with
           Slx8p and Lin1p
          Length = 607

 Score =  298 bits (764), Expect = 9e-93,   Method: Compositional matrix adjust.
 Identities = 194/555 (34%), Positives = 282/555 (50%), Gaps = 54/555 (9%)

Query: 70  DDDELQVVGESILSERQTSYPETEYVDLDRSGEGSLGQRRPQAASSEEDLVILEERT--S 127
           D ++L++  E  L        + EY++LD     + G         ++DL+++EER   S
Sbjct: 68  DGEDLEITAEVSLRPDGPINDDAEYINLDNYRASNNGTVVVDHREGDDDLMLVEERIQES 127

Query: 128 SPSFVLNLPGGEYLRINGSPLDQPVRRSFQAQAPRQFDSXXXXXXXXXXXXXXXSNLFMQ 187
               +L LP G+ L+++ S  + PV RSFQ Q  R  +                   + Q
Sbjct: 128 GRPVLLQLPAGQTLQVDASWNELPVGRSFQNQVYRNPNQLRRLRRHIDHATAMFMGGYNQ 187

Query: 188 PSDDEQEESVEGNTYQLPSTVMARRQRNALLMXXXXXXXXXXXXXGFGMIQSPELSALEA 247
               + + S     Y  P  V    +RN   M                 +Q  + +A E 
Sbjct: 188 SGTGDSDFSDNDADYIPPDIV---NERNQYTMQTRMREQRERQ----NQMQRLQRAADET 240

Query: 248 QINRLPPNVRSAFDHAQSVHEFRSILQSIDWQNYHQRQDDLTSLFSEYRANLLRS----- 302
            I+ L P++RS F  +QS+ +FR  L   ++     R + L   + ++RA  ++S     
Sbjct: 241 -IDSLDPDLRSLFFESQSLSQFREGLARFNFP--PARLEQLLGQYRDFRARAMQSWAEGR 297

Query: 303 ---------RSNQRIRRPGERSRLDSRMAGQDPSAQNLPYSPSLVG-------------- 339
                    R++ R +R    ++ +        S  N  Y   L G              
Sbjct: 298 RTRSMSYQNRNSLRPQRTRSGTQQNHSRGSNGDSRDNALYQQMLFGMPDDDENMDGNNFT 357

Query: 340 --------IMAQTFNPVLGRMHMGYDARTHGGIMG-YGEVDEEQQTQNXXXXXXXXXXXX 390
                   I++ T N   G +  G      G   G Y + D+   T+             
Sbjct: 358 GTTQSLQRIISNTMNRRFGNLPFGV-----GPEFGFYEDGDDAANTELIIRMIQEREERD 412

Query: 391 XXARKRKYMEDTKSKQLGYLEKAVKLPEGYSSSFDTTPKMNITIKKNGKEEELTVTDDQA 450
              R +K  E TKS+Q  Y++KA  LPEGYS+SF+T P M++T++  G+EE + VTDD A
Sbjct: 413 ASTRTKKLNEVTKSQQQKYIDKANSLPEGYSASFNTAPLMSMTMENEGREETVMVTDDVA 472

Query: 451 AAFYMDLPSCSLCGVELGVGIPDEFQGLSTQDRGVSFEALKAKYEFHCPYQALSKPSLVD 510
           A  Y+D+P C LCGVELGVGIPD+++G+S +D+GVSFEAL++ Y+FHCPYQ L++P+LVD
Sbjct: 473 AKTYIDVPVCVLCGVELGVGIPDDWKGVSEEDKGVSFEALQSHYKFHCPYQTLARPTLVD 532

Query: 511 RDLSRRTYVAACGHSFCGRCFARIDNARSFNRASKQKLKDLKGASHPDNYGPKKCPAKDC 570
           RDLSRRTYV++CGH+FCGRC  RI NAR  +   K KLK+ +G SHPDNYGPKKCPA+ C
Sbjct: 533 RDLSRRTYVSSCGHTFCGRCQVRIKNARDISAKEKNKLKNSQGPSHPDNYGPKKCPAEGC 592

Query: 571 NNQLRNRGKMREVYF 585
           N+ LR +G MREVYF
Sbjct: 593 NSNLRKKGIMREVYF 607

>Kpol_1036.52 s1036 complement(140685..142460) [1776 bp, 591 aa]
           {ON} complement(140685..142460) [1776 nt, 592 aa]
          Length = 591

 Score =  262 bits (669), Expect = 4e-79,   Method: Compositional matrix adjust.
 Identities = 187/553 (33%), Positives = 263/553 (47%), Gaps = 87/553 (15%)

Query: 66  NTDDDDDELQVVGESILSERQTSYPE--TEYVDLDRSGE---------------GSLGQR 108
           N   ++D++ +V E   S R+    E  TEYVDLD   E               GS    
Sbjct: 93  NDSANNDDITIVREINRSPRRERRNESVTEYVDLDHEPEDVEPIGTSNLDGRSSGSNVND 152

Query: 109 RPQAASSEEDLVILEERTSSPS---FVLNLPGGEYLRINGSPLDQPVRRSFQAQAPRQFD 165
           R +  S+ +DL+I+ E+   PS     L +PG + + +  +  D P R SF+ Q  R+  
Sbjct: 153 RDRNNSNIDDLIIISEQHPQPSANSIFLTIPGRQLMELQVASTDIPTRSSFEYQNDRR-- 210

Query: 166 SXXXXXXXXXXXXXXXSNLFMQPSDDEQEESVEGNTYQLPSTVMARRQRNALLMXXXXXX 225
                           +  +MQ S       + G        ++  RQ N          
Sbjct: 211 ----PVRLGNSGRPRINRQYMQNSFSRVRRQLLG--------ILRVRQSN---------- 248

Query: 226 XXXXXXXGFGMIQSPELSALEAQINRLPPNVRSAFDHAQSVHEFRSILQSIDWQNYHQRQ 285
                         PE+  +  +I+    N+RSAF HA S +EF +I++           
Sbjct: 249 --------------PEIDEIAREISLYHTNIRSAFIHANSFNEFMAIIEVAPRLGI---T 291

Query: 286 DDLTSLFSEYRANLLRSRSNQ----------RIRRPGERSRLDSRMAGQDPSAQNLPYSP 335
           DDL  L+   R   LR+R++Q           I    E +R D    G +P        P
Sbjct: 292 DDLVDLY--LRLEDLRNRTHQANSLFVPDIDNISSNSETTRYDE---GWNPVTH-----P 341

Query: 336 SLVGIMAQTFN-PVLGRMHMGYDARTHGGIMGYGEVDEEQQTQNXXXXXXXXXXXXXXAR 394
                +  +F+ P++ R+   Y  R H     Y + DEE +TQ+               R
Sbjct: 342 VTNRFIEDSFHSPMIRRIFGNYGGRHH---QDYDDDDEEGRTQSIITMIQEREEVEKDLR 398

Query: 395 KRKYMEDTKSKQLGYLEKAVKLPEGYSSSFDTTPKMNITIKKNGKEEELTVTDDQAAAFY 454
            +KY E TK KQ  +  +A +LP+GYSSSF+T PK  + + KNG    ++V DD  A  +
Sbjct: 399 TKKYSESTKEKQDEFERRATELPDGYSSSFNTEPKAKVDMTKNGVNGSVSVVDDTMAEDW 458

Query: 455 MDLPSCSLCGVELGVGIPDEFQGLSTQDRGVSFEALKAKYEFHCPYQALSKPSLVDRDLS 514
            ++P C LCGV L  GIPDEFQG+S +DR + FE LK KY+  CPYQ L +PS  DRD S
Sbjct: 459 EEIPICCLCGVTLSEGIPDEFQGMSNEDRFLPFEELKEKYDSFCPYQCLIRPSQSDRDFS 518

Query: 515 RRTYVAACGHSFCGRCFARIDNARSFNRASKQKLKDLKGASHPDNYGPKKCPAKDCNNQL 574
           +R YVA CGH++CGRC+ RI N++  ++  K +L  LKGA HPDNYGPKKCP   CN  L
Sbjct: 519 KRVYVANCGHTYCGRCYRRIQNSKEKSKLPKSQLAKLKGACHPDNYGPKKCPVTSCNRLL 578

Query: 575 R-NRG-KMREVYF 585
           R +RG   RE YF
Sbjct: 579 RISRGVAFREAYF 591

>TDEL0D04350 Chr4 complement(793070..794740) [1671 bp, 556 aa] {ON}
           Anc_3.186 YDL013W
          Length = 556

 Score =  248 bits (633), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 173/531 (32%), Positives = 263/531 (49%), Gaps = 91/531 (17%)

Query: 93  EYVDLDRSGEGSLGQ--------RRPQAASSEED-LVILEERTSSPSFVLNLPGGEYLRI 143
           EY+DL+    G+  Q        R      +E+D L+ ++E+T   +  LNLPG   +RI
Sbjct: 79  EYIDLEMEPAGNEEQDDMIVYDERLSTPRDAEDDELIFVQEQTRPSTIQLNLPGRNPMRI 138

Query: 144 NGSPLDQPVRRSFQAQAPRQFDSXXXXXXXXXXXXXXXSNLFMQPSDDEQEESVEGNTYQ 203
             +  D+P RRSF                                   EQ+ S     +Q
Sbjct: 139 TATEYDRPARRSF-----------------------------------EQQASNRQLRHQ 163

Query: 204 LPSTVMARRQ--RNALLMXXXXXXXXXXXXXGFG-----MIQSPELSALEAQINRLPPNV 256
              T +ARRQ  R A                G       +   PE +A++ +++  P ++
Sbjct: 164 ---TRVARRQPMRRAARRANHSMNGYESDDGGLTSNRNQINYDPEFAAIQRRLDSYPLDI 220

Query: 257 RSAFDHAQSVHEFRSILQSIDWQNYHQRQDDLTSLFSEYRANLLRSRSNQRIRRPGERSR 316
           RSAF HAQ+++EF SI++++D   +   + DL  LF +YR  + R  +      PG RS 
Sbjct: 221 RSAFLHAQNMNEFSSIIENVDPLTWQDCRYDLERLFMDYRRMMARRAAQIGQNMPGYRSP 280

Query: 317 LDSRMAGQDPSAQNLPYSPSLVGIMAQTFNPVLGRMHMGY---DARTH----GGIMGYGE 369
            +      D               + +   P+  R+ +G    ++ TH     GI GYG 
Sbjct: 281 PNRTQGNAD---------------LLRRLGPLGVRIGIGTGMGESLTHYILEPGIFGYGS 325

Query: 370 -------------VDEEQQTQNXXXXXXXXXXXXXXARKRKYMEDTKSKQLGYLEKAVKL 416
                        ++EE +TQ+              A+ +  ME T+S++  ++EK   L
Sbjct: 326 FRMIGNPGGFDDGMEEEARTQSILNAIQEREEQERDAQTKSNMEKTRSQEENFIEKCKNL 385

Query: 417 PEGYSSSFDTTPK-MNITIKKNGKEEELTVTDDQAAAFYMDLPSCSLCGVELGVGIPDEF 475
           PEGYS+SFDTTP  + +    +G ++ + V D+ A A + ++  C LCGVELGVG+PD+F
Sbjct: 386 PEGYSASFDTTPTTVRLEPLNDGNKQAIVVEDESAIAEWEEIAVCCLCGVELGVGLPDDF 445

Query: 476 QGLSTQDRGVSFEALKAKYEFHCPYQALSKPSLVDRDLSRRTYVAACGHSFCGRCFARID 535
            G+S  DR +SF+ L  KY  HCPYQ+L+  +  +R LS +T+VA+CGH+FCGRC  RI+
Sbjct: 446 TGISADDRHLSFDELVTKYCSHCPYQSLTSANGTERALSMKTFVASCGHTFCGRCVVRIE 505

Query: 536 NARSFNRASKQKLKDLKGASHPDNYGPKKCPAKDCNNQLR-NRGKMREVYF 585
           NAR+ +++SK++L   KG  HPDNYGP+ CPA  C   +R  R KMRE +F
Sbjct: 506 NARTHSKSSKKELSKFKGPLHPDNYGPRLCPATGCKQNIRLGRTKMREAFF 556

>KNAG0J01270 Chr10 (226858..228501) [1644 bp, 547 aa] {ON} Anc_3.186
           YDL013W
          Length = 547

 Score =  209 bits (532), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 127/358 (35%), Positives = 192/358 (53%), Gaps = 26/358 (7%)

Query: 238 QSPELSALEAQINRLPPNVRSAFDHAQSVHEFRSILQSIDWQNYHQRQDDLTSLFSEYRA 297
           + P+   + A+IN  PPN++S F +AQS+ EF  I+Q+ D   + + +DDLT+LFS+Y++
Sbjct: 206 EDPQRRRIRARINSYPPNIQSTFHYAQSLPEFTYIVQNTDPITFAECRDDLTNLFSQYQS 265

Query: 298 NLLRSRSNQRIRRPGERSRLDSRMAGQDPSAQNLPYSPSLVGIMAQTFN----------P 347
                + + R+R  G++    S        +Q    S S        FN           
Sbjct: 266 ----MQHDDRMRNVGQQGSRQSEPRHGTNYSQRSAVSHSNNRYFYPEFNQYESDEARAQS 321

Query: 348 VLGRMHMGYDARTHGGIMGYGEVDEEQQTQNXXXXXXXXXXXXXXARKRKYMEDTKSKQL 407
           +L R+H     R    +MGY   DEE  TQN               R + + + +K    
Sbjct: 322 LLPRIHDFLQMR----LMGYPNDDEETTTQNIISMIQEREDTERDTRVKNFTDKSKPLLK 377

Query: 408 GYLEKAVKLPEGYSSSFDTTPKMNITIKKNGKEEELTVTDDQAAAFYMDLPSCSLCGVEL 467
             L++A  LP  YS+SF      +      G   E   +++ +         C LCG EL
Sbjct: 378 SILKEAKSLPSNYSASFHYPSSPSKPQIPGGSTSETAESEEVSC--------CVLCGSEL 429

Query: 468 GVGIPDEFQGLSTQDRGVSFEALKAKYEFHCPYQALSKPSLVDRDLSRRTYVAACGHSFC 527
           GVGIPD F G S +DR + F +L +KY F CPYQ+L +P+ +DRDLS+RT+++ CGH +C
Sbjct: 430 GVGIPDSFIGRSAEDRDLDFSSLISKYSFPCPYQSLIRPNQLDRDLSKRTFMSKCGHVYC 489

Query: 528 GRCFARIDNARSFNRASKQKLKDLKGASHPDNYGPKKCPAKDCNNQLRNRGKMREVYF 585
           GRCFARIDNA++ ++ SK++L  LKG S+P+ YGP+ C A  C   +R + ++RE+YF
Sbjct: 490 GRCFARIDNAKAKSKISKKELASLKGCSNPNIYGPRICVADGCTAVIRAKARLRELYF 547

>CAGL0K01881g Chr11 (167939..169459) [1521 bp, 506 aa] {ON} weakly
           similar to uniprot|P32828 Saccharomyces cerevisiae
           YDL013w Hexose metabolism-related protein
          Length = 506

 Score =  189 bits (480), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 107/241 (44%), Positives = 146/241 (60%), Gaps = 12/241 (4%)

Query: 347 PVLGRMHMGY-DARTHGGIMGYGEVDEEQQTQNXXXXXXXXXXXXXXARKRKYMEDTKSK 405
           PVL +    Y     +G  +   E DEE QTQ+               R ++Y   ++S+
Sbjct: 276 PVLPQSMASYMHNHVYGTPITGSEDDEEAQTQSIIDIIQQREESERDKRVKEYTRKSESQ 335

Query: 406 QLGYLEKAVKLPEGYSSSFDTTPKMNITIKKNGKEEELTVTDDQAAAFYMDLPSCSLCGV 465
           +  + E+A +LP GYS+SF  TP++   I++N  E+     DD+          C+LCGV
Sbjct: 336 KKKFYEEAKQLPPGYSASF-ATPEV---IRENDDEDNSNNDDDEDMIV------CNLCGV 385

Query: 466 ELGVGIPDEFQGLSTQDRGVSFEALKAKYEFHCPYQALSKPSLVDRDLSRRTYVAACGHS 525
           ELG+GIP+EF G+S +D  +SF  L  KY   CPYQ+L KPS +DRDLS+RTYV+ CGH 
Sbjct: 386 ELGIGIPEEFTGISKEDFALSFAELMDKYGSRCPYQSLGKPSELDRDLSKRTYVSNCGHL 445

Query: 526 FCGRCFARIDNARSFNRASKQKLKDLK-GASHPDNYGPKKCPAKDCNNQLRNRGKMREVY 584
           FCGRC+ R  NARS  +    K  ++K GASHPDN+ PK CPA +C  Q+R++GKMREVY
Sbjct: 446 FCGRCWRRYLNARSLMKTKAGKSLNVKLGASHPDNFAPKVCPADNCKYQIRSKGKMREVY 505

Query: 585 F 585
           F
Sbjct: 506 F 506

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 39/109 (35%), Positives = 55/109 (50%), Gaps = 15/109 (13%)

Query: 63  TLCNTDD--DDDELQVVGESILS--ERQTSYPETEYVDLDRSG---------EGSLGQRR 109
           T  N D+  DDDEL ++ +S +    RQ S P   Y++LD            E   G   
Sbjct: 49  TSVNADEGGDDDELTLLRQSNIRVPRRQISTP-VAYINLDDEAAHHDASDDIEFLGGNLV 107

Query: 110 PQAASSEEDLV-ILEERTSSPSFVLNLPGGEYLRINGSPLDQPVRRSFQ 157
           P A  ++ED V +LEER +     LNLPGG  + +N +  + PVR SF+
Sbjct: 108 PNAGDNDEDAVTLLEERLADGLVPLNLPGGRRIIVNAANGEAPVRSSFE 156

>TPHA0A04370 Chr1 (980168..982162) [1995 bp, 664 aa] {ON} Anc_3.186
           YDL013W
          Length = 664

 Score =  177 bits (449), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 98/248 (39%), Positives = 136/248 (54%), Gaps = 28/248 (11%)

Query: 365 MGYGEVDEEQQTQNXXXXXXXXXXXXXXARKRKYMEDTKSKQLGYLEKAVKLPEGYSSSF 424
            GY +  E Q+TQ+               R RK+ +  +  Q    EKA  +PEGYSSSF
Sbjct: 418 FGYAQAGE-QETQDLIAMIQEREEREHDIRTRKFTKKNEKLQQLIREKAKTIPEGYSSSF 476

Query: 425 DTTPKMNITIK--KNGK-----EEELTVTDDQAA----AFYMDLPSCSLCGVELGVGIPD 473
            T   + +  K  KNG      EE+    DD+         +++P C LCGVELG+GIP+
Sbjct: 477 STEVPVKLIDKQDKNGNNVIMLEEQQVEVDDEFGNKKNESVIEVPVCCLCGVELGIGIPE 536

Query: 474 EFQGLSTQDRGV-SFEALKAKYEFHCPYQALSKPSLVDRDLSRRTYVAACGHSFCGRCFA 532
            F G+S +D+ +  F+ +  KY F CPYQ + +P+ +DRDLSRRT+++ CGH+FCGRC+ 
Sbjct: 537 TFAGISAEDKKLECFKDIATKYGFSCPYQTMVRPTELDRDLSRRTFISNCGHAFCGRCYN 596

Query: 533 RIDNARSFNRASK-----QKLKDLK----------GASHPDNYGPKKCPAKDCNNQLRNR 577
           RI  A++  + +       KL  L           G+ +PDNYGPK CP  DC  Q+R R
Sbjct: 597 RIHLAKAETKKNNGRDITNKLTRLSQSNRISPVILGSLNPDNYGPKICPGSDCKYQIRAR 656

Query: 578 GKMREVYF 585
            KMRE YF
Sbjct: 657 TKMREAYF 664

 Score = 38.9 bits (89), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 28/91 (30%), Positives = 46/91 (50%), Gaps = 17/91 (18%)

Query: 68  DDDDDELQVVGESILSERQTSYPETEYVDLDRSGEGSLGQRRPQAASSEEDLVIL-EERT 126
           +D+ D+L V+ E             E VDLDR  E +         ++++DL+I+ E+  
Sbjct: 80  NDNMDDLSVINER------------EVVDLDREPEIT----SVANNTNDDDLMIVGEQVI 123

Query: 127 SSPSFVLNLPGGEYLRINGSPLDQPVRRSFQ 157
            +P  +LNLPGG    ++ +  D P R SF+
Sbjct: 124 ENPHILLNLPGGRTFELSTTTNDLPFRSSFE 154

>SAKL0H07502g Chr8 complement(650824..653406) [2583 bp, 860 aa] {ON}
           similar to uniprot|P38630 Saccharomyces cerevisiae
           YOR217W RFC1 Subunit of heteropentameric Replication
           factor C (RF-C) which is a DNA binding protein and
           ATPase that acts as a clamp loader of the proliferating
           cell nuclear antigen (PCNA) processivity factor for DNA
           polymerases delta and epsilon
          Length = 860

 Score = 36.2 bits (82), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 41/82 (50%), Gaps = 9/82 (10%)

Query: 429 KMNITIKKNGKEEELTVTDDQAAAFYMDLPSCSLCGVELGVGIPDEFQG-LSTQDRGVSF 487
           K NI+   N K++E+ VTD  ++ F    P+C L       G+   F G L T +RG++ 
Sbjct: 130 KENISFNFNNKQQEVDVTDSDSSVFPEGKPNCLL-------GLTIVFTGVLPTLERGIA- 181

Query: 488 EALKAKYEFHCPYQALSKPSLV 509
           E++  KY         SK SLV
Sbjct: 182 ESIAKKYGARVTKSISSKTSLV 203

>Suva_11.249 Chr11 complement(455625..457280) [1656 bp, 551 aa] {ON}
           YKR017C (REAL)
          Length = 551

 Score = 33.9 bits (76), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 32/133 (24%), Positives = 47/133 (35%), Gaps = 40/133 (30%)

Query: 477 GLST-----QDRGVSFEALKAKY--EFHCPYQALSKPSLVDRDLSRRTYVAACGHSFCGR 529
           GLST     +D+G S  + K ++  +F C     SK +         T+   CGH +C  
Sbjct: 151 GLSTVASVKEDKGYSLHSRKVEFKDDFACVICCESKNT--------ETFALECGHEYCIN 202

Query: 530 CF-----------------------ARIDNARSFNRASKQKLKD--LKGASHPDNYGPKK 564
           C+                         +D  +    AS  KL D  +K      N   K 
Sbjct: 203 CYRHYIQDKLHEGNIITCMDCSLALKNVDIDKVMGHASSSKLMDSSIKSFVQKHNRNYKW 262

Query: 565 CPAKDCNNQLRNR 577
           CP  DC + +  R
Sbjct: 263 CPFADCKSIIHLR 275

>AEL006W Chr5 (621384..628859) [7476 bp, 2491 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBL004W (UTP20)
          Length = 2491

 Score = 33.1 bits (74), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 28/96 (29%), Positives = 45/96 (46%), Gaps = 6/96 (6%)

Query: 398 YMEDTKSKQLGYLEKAVKLPEGYSSSFDTTPKMNITIKKNGKEEELTVTDDQAAAFYMDL 457
           YME+  S  L +++  + + +G  SSF+ +  +   IK + KE +      + A   +DL
Sbjct: 387 YMENYPSFFLEFVKTVIDMDKGRFSSFNCSRFIGQFIKSHWKEHQ-----KKIALLLLDL 441

Query: 458 PSCSLCGVELGVGIPDEFQGLSTQDRGVSFEALKAK 493
            S       L   IP+EF    T D   S +AL A+
Sbjct: 442 ESKPELSSTLNFTIPEEFVTSLTSDLQ-SLDALAAE 476

>TPHA0I01020 Chr9 (234445..236070) [1626 bp, 541 aa] {ON} Anc_1.286
           YKR017C
          Length = 541

 Score = 32.3 bits (72), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 28/67 (41%), Gaps = 13/67 (19%)

Query: 465 VELGVGIPDEFQGLSTQDRGVSFEALKAKYEFHCPYQALSKPSLVDRDLSRRTYVAACGH 524
           +E G+ I +E + L    RG+S         F CP        +   D  + TY   CGH
Sbjct: 141 IEAGIHINNEQKELPKSQRGISNRDF-----FTCP--------ICCEDQIKETYSLECGH 187

Query: 525 SFCGRCF 531
            +C  C+
Sbjct: 188 EYCISCY 194

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.131    0.375 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 59,878,140
Number of extensions: 2532423
Number of successful extensions: 7563
Number of sequences better than 10.0: 63
Number of HSP's gapped: 7830
Number of HSP's successfully gapped: 70
Length of query: 585
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 470
Effective length of database: 40,294,809
Effective search space: 18938560230
Effective search space used: 18938560230
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 69 (31.2 bits)