Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_27.123173.454ON43543523430.0
KLTH0E13948g3.454ON43843414760.0
SAKL0B06116g3.454ON43142412881e-176
Ecym_24653.454ON43838912761e-174
ZYRO0C06270g3.454ON43041912731e-174
YGR110W (CLD1)3.454ON44539512191e-165
Suva_7.3953.454ON45139512091e-164
Kpol_1035.93.454ON42742612011e-163
KNAG0B009503.454ON41842712001e-163
TDEL0F033903.454ON42439011961e-162
ABL019W3.454ON43138811951e-162
Smik_6.2003.454ON44539511921e-161
Skud_7.4153.454ON45239511841e-160
NCAS0E008603.454ON44039111201e-150
KAFR0I019703.454ON41139611031e-148
TPHA0O013103.454ON43843511051e-148
NDAI0G010903.454ON45638710781e-144
CAGL0L04686g3.454ON45144410431e-138
KLLA0B12914g3.454ON42638510011e-132
TBLA0F034603.454ON4414048931e-116
KLTH0C01254gna 1ON4344084982e-57
Kwal_14.985na 1ON4354084712e-53
SAKL0G19074gna 1ON4324134572e-51
Ecym_5577singletonON4334164152e-45
Skud_12.1678.284ON3943471844e-14
KNAG0G021408.284ON4083651835e-14
Kpol_543.498.284ON4293391836e-14
Suva_10.1838.284ON3943461792e-13
YLR099C (ICT1)8.284ON3943361792e-13
Smik_12.1588.284ON3943321721e-12
KLTH0G13178g8.284ON4153621712e-12
Kwal_56.237028.284ON4163371668e-12
TDEL0F041008.284ON4343801651e-11
YDR125C (ECM18)8.284ON4533811641e-11
AGR062C8.284ON3843241604e-11
TPHA0A016908.284ON4054101595e-11
KAFR0B028308.284ON3913491596e-11
Smik_4.3718.284ON4353571588e-11
KLLA0F19624g8.284ON4093331561e-10
CAGL0B01969g8.284ON4233291542e-10
Suva_2.2888.284ON4353291533e-10
CAGL0M11462g8.284ON3863641515e-10
SAKL0H16500g8.284ON4193261499e-10
Skud_4.3868.284ON4463391481e-09
NDAI0J01200singletonON4273421427e-09
ZYRO0D06666g8.284ON3803911382e-08
KNAG0H031208.284ON4343401373e-08
KAFR0B053808.284ON4113371355e-08
Ecym_42858.284ON4053341302e-07
NCAS0B051208.284ON3963361284e-07
NDAI0J012108.284ON4163421213e-06
TBLA0H014008.284ON4211721204e-06
NCAS0B037108.284ON4301701178e-06
NDAI0C054308.524ON3621141043e-04
TPHA0L016008.524ON372115970.002
KLTH0E12188g8.524ON336143940.004
CAGL0M05467g8.524ON354115900.015
ZYRO0F09064g8.524ON349143890.022
KNAG0A037708.524ON356128860.045
Kwal_27.119758.524ON336115860.049
SAKL0H10450g8.524ON392115800.28
Kwal_23.6592singletonON164119731.1
YPR147C3.488ON304142741.1
Suva_16.4763.488ON304142722.1
Suva_8.135singletonON33046722.3
KLLA0A10395gna 2ON29450677.6
SAKL0E02596g2.487ON31862687.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_27.12317
         (435 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_27.12317 s27 complement(1173365..1174672) [1308 bp, 435 aa]...   907   0.0  
KLTH0E13948g Chr5 complement(1231122..1232438) [1317 bp, 438 aa]...   573   0.0  
SAKL0B06116g Chr2 complement(519929..521224) [1296 bp, 431 aa] {...   500   e-176
Ecym_2465 Chr2 complement(908173..909489) [1317 bp, 438 aa] {ON}...   496   e-174
ZYRO0C06270g Chr3 (475283..476575) [1293 bp, 430 aa] {ON} simila...   494   e-174
YGR110W Chr7 (713709..715046) [1338 bp, 445 aa] {ON}  CLD1Mitoch...   474   e-165
Suva_7.395 Chr7 (684763..686118) [1356 bp, 451 aa] {ON} YGR110W ...   470   e-164
Kpol_1035.9 s1035 complement(19721..21004) [1284 bp, 427 aa] {ON...   467   e-163
KNAG0B00950 Chr2 (173167..174423) [1257 bp, 418 aa] {ON} Anc_3.4...   466   e-163
TDEL0F03390 Chr6 (624579..625853) [1275 bp, 424 aa] {ON} Anc_3.4...   465   e-162
ABL019W Chr2 (361560..362855) [1296 bp, 431 aa] {ON} Non-synteni...   464   e-162
Smik_6.200 Chr6 (329969..331306) [1338 bp, 445 aa] {ON} YGR110W ...   463   e-161
Skud_7.415 Chr7 (692655..694013) [1359 bp, 452 aa] {ON} YGR110W ...   460   e-160
NCAS0E00860 Chr5 (157521..158843) [1323 bp, 440 aa] {ON} Anc_3.454    436   e-150
KAFR0I01970 Chr9 (401907..403142) [1236 bp, 411 aa] {ON}              429   e-148
TPHA0O01310 Chr15 complement(258745..260061) [1317 bp, 438 aa] {...   430   e-148
NDAI0G01090 Chr7 (230932..232302) [1371 bp, 456 aa] {ON} Anc_3.454    419   e-144
CAGL0L04686g Chr12 (539203..540558) [1356 bp, 451 aa] {ON} simil...   406   e-138
KLLA0B12914g Chr2 (1126975..1128255) [1281 bp, 426 aa] {ON} simi...   390   e-132
TBLA0F03460 Chr6 (853280..854605) [1326 bp, 441 aa] {ON}              348   e-116
KLTH0C01254g Chr3 complement(113435..114739) [1305 bp, 434 aa] {...   196   2e-57
Kwal_14.985 s14 complement(142781..144088) [1308 bp, 435 aa] {ON...   186   2e-53
SAKL0G19074g Chr7 (1646858..1648156) [1299 bp, 432 aa] {ON} cons...   180   2e-51
Ecym_5577 Chr5 (1185997..1187298) [1302 bp, 433 aa] {ON} similar...   164   2e-45
Skud_12.167 Chr12 complement(322870..324054) [1185 bp, 394 aa] {...    75   4e-14
KNAG0G02140 Chr7 complement(484440..485666) [1227 bp, 408 aa] {O...    75   5e-14
Kpol_543.49 s543 complement(108945..110234) [1290 bp, 429 aa] {O...    75   6e-14
Suva_10.183 Chr10 complement(344549..345733) [1185 bp, 394 aa] {...    74   2e-13
YLR099C Chr12 complement(339744..340928) [1185 bp, 394 aa] {ON} ...    74   2e-13
Smik_12.158 Chr12 complement(319660..320844) [1185 bp, 394 aa] {...    71   1e-12
KLTH0G13178g Chr7 (1131579..1132826) [1248 bp, 415 aa] {ON} simi...    70   2e-12
Kwal_56.23702 s56 complement(668862..670112) [1251 bp, 416 aa] {...    69   8e-12
TDEL0F04100 Chr6 complement(756762..758066) [1305 bp, 434 aa] {O...    68   1e-11
YDR125C Chr4 complement(701397..702758) [1362 bp, 453 aa] {ON}  ...    68   1e-11
AGR062C Chr7 complement(833212..834366) [1155 bp, 384 aa] {ON} S...    66   4e-11
TPHA0A01690 Chr1 (344521..345738) [1218 bp, 405 aa] {ON} Anc_8.2...    66   5e-11
KAFR0B02830 Chr2 complement(578530..579705) [1176 bp, 391 aa] {O...    66   6e-11
Smik_4.371 Chr4 complement(662692..663999) [1308 bp, 435 aa] {ON...    65   8e-11
KLLA0F19624g Chr6 complement(1817206..1818435) [1230 bp, 409 aa]...    65   1e-10
CAGL0B01969g Chr2 complement(181406..182677) [1272 bp, 423 aa] {...    64   2e-10
Suva_2.288 Chr2 complement(496577..497884) [1308 bp, 435 aa] {ON...    64   3e-10
CAGL0M11462g Chr13 complement(1129244..1130404) [1161 bp, 386 aa...    63   5e-10
SAKL0H16500g Chr8 (1450828..1452087) [1260 bp, 419 aa] {ON} simi...    62   9e-10
Skud_4.386 Chr4 complement(673125..674465) [1341 bp, 446 aa] {ON...    62   1e-09
NDAI0J01200 Chr10 (280820..282103) [1284 bp, 427 aa] {ON}              59   7e-09
ZYRO0D06666g Chr4 (576172..577314) [1143 bp, 380 aa] {ON} simila...    58   2e-08
KNAG0H03120 Chr8 (586146..587450) [1305 bp, 434 aa] {ON} Anc_8.2...    57   3e-08
KAFR0B05380 Chr2 (1107049..1108284) [1236 bp, 411 aa] {ON} Anc_8...    57   5e-08
Ecym_4285 Chr4 (612053..613270) [1218 bp, 405 aa] {ON} similar t...    55   2e-07
NCAS0B05120 Chr2 complement(953798..954988) [1191 bp, 396 aa] {O...    54   4e-07
NDAI0J01210 Chr10 (282384..283634) [1251 bp, 416 aa] {ON} Anc_8....    51   3e-06
TBLA0H01400 Chr8 (312727..313992) [1266 bp, 421 aa] {ON} Anc_8.2...    51   4e-06
NCAS0B03710 Chr2 (664097..665389) [1293 bp, 430 aa] {ON} Anc_8.284     50   8e-06
NDAI0C05430 Chr3 (1259106..1260194) [1089 bp, 362 aa] {ON} Anc_8...    45   3e-04
TPHA0L01600 Chr12 (338450..339568) [1119 bp, 372 aa] {ON} Anc_8....    42   0.002
KLTH0E12188g Chr5 (1082142..1083152) [1011 bp, 336 aa] {ON} simi...    41   0.004
CAGL0M05467g Chr13 complement(583722..584786) [1065 bp, 354 aa] ...    39   0.015
ZYRO0F09064g Chr6 (735162..736211) [1050 bp, 349 aa] {ON} simila...    39   0.022
KNAG0A03770 Chr1 complement(494021..495091) [1071 bp, 356 aa] {O...    38   0.045
Kwal_27.11975 s27 (1028242..1029252) [1011 bp, 336 aa] {ON} YBR2...    38   0.049
SAKL0H10450g Chr8 complement(897598..898776) [1179 bp, 392 aa] {...    35   0.28 
Kwal_23.6592 s23 (1658078..1658572) [495 bp, 164 aa] {ON} [conti...    33   1.1  
YPR147C Chr16 complement(825645..826559) [915 bp, 304 aa] {ON} P...    33   1.1  
Suva_16.476 Chr16 complement(822104..823018) [915 bp, 304 aa] {O...    32   2.1  
Suva_8.135 Chr8 (238005..238235,238328..238489,238523..239122) [...    32   2.3  
KLLA0A10395g Chr1 complement(908097..908981) [885 bp, 294 aa] {O...    30   7.6  
SAKL0E02596g Chr5 complement(208748..209704) [957 bp, 318 aa] {O...    31   7.6  

>Kwal_27.12317 s27 complement(1173365..1174672) [1308 bp, 435 aa]
           {ON} YGR110W - Hypothetical ORF [contig 20] FULL
          Length = 435

 Score =  907 bits (2343), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 435/435 (100%), Positives = 435/435 (100%)

Query: 1   MPTFGDLQSSRVIAVIRSAADQLSNLQLRRLRIRPLEIKNQVPNTSYHPKPSSPSAIPLN 60
           MPTFGDLQSSRVIAVIRSAADQLSNLQLRRLRIRPLEIKNQVPNTSYHPKPSSPSAIPLN
Sbjct: 1   MPTFGDLQSSRVIAVIRSAADQLSNLQLRRLRIRPLEIKNQVPNTSYHPKPSSPSAIPLN 60

Query: 61  EIILKLPNLFPRSLEQSARDFKDFKLNAGALQSELLATLPFFPAGDSRRTAEIIRTTVDA 120
           EIILKLPNLFPRSLEQSARDFKDFKLNAGALQSELLATLPFFPAGDSRRTAEIIRTTVDA
Sbjct: 61  EIILKLPNLFPRSLEQSARDFKDFKLNAGALQSELLATLPFFPAGDSRRTAEIIRTTVDA 120

Query: 121 QGNYINEFNIRPTAVDTSKTMKHLILVHGYGAGLGFFLKTFENLNLINENWMIHAIDLPG 180
           QGNYINEFNIRPTAVDTSKTMKHLILVHGYGAGLGFFLKTFENLNLINENWMIHAIDLPG
Sbjct: 121 QGNYINEFNIRPTAVDTSKTMKHLILVHGYGAGLGFFLKTFENLNLINENWMIHAIDLPG 180

Query: 181 YGFSSRPPFPFKVGDSTPAQVEQWFHSRFHRWMERRGLLETPENNMVVAHSMGAYLTALY 240
           YGFSSRPPFPFKVGDSTPAQVEQWFHSRFHRWMERRGLLETPENNMVVAHSMGAYLTALY
Sbjct: 181 YGFSSRPPFPFKVGDSTPAQVEQWFHSRFHRWMERRGLLETPENNMVVAHSMGAYLTALY 240

Query: 241 ANKHPGHFKKLVMCSPAGVCHSAPEMRKRPPPWWFAKLWDKNISPFSLVRNANVLGSKLT 300
           ANKHPGHFKKLVMCSPAGVCHSAPEMRKRPPPWWFAKLWDKNISPFSLVRNANVLGSKLT
Sbjct: 241 ANKHPGHFKKLVMCSPAGVCHSAPEMRKRPPPWWFAKLWDKNISPFSLVRNANVLGSKLT 300

Query: 301 SGWSYRRLGQLLKDKVLNARQHEALHRYAYAIFNRKGSGEYLLSFALQCGGEPRVPLERR 360
           SGWSYRRLGQLLKDKVLNARQHEALHRYAYAIFNRKGSGEYLLSFALQCGGEPRVPLERR
Sbjct: 301 SGWSYRRLGQLLKDKVLNARQHEALHRYAYAIFNRKGSGEYLLSFALQCGGEPRVPLERR 360

Query: 361 LFHNRGQQFKANCEWLWLYGDQDWIDRRGGERVSQFLTAEMGHESCVKIVKNSGHHLYLD 420
           LFHNRGQQFKANCEWLWLYGDQDWIDRRGGERVSQFLTAEMGHESCVKIVKNSGHHLYLD
Sbjct: 361 LFHNRGQQFKANCEWLWLYGDQDWIDRRGGERVSQFLTAEMGHESCVKIVKNSGHHLYLD 420

Query: 421 NHRMFNKILEDEMRW 435
           NHRMFNKILEDEMRW
Sbjct: 421 NHRMFNKILEDEMRW 435

>KLTH0E13948g Chr5 complement(1231122..1232438) [1317 bp, 438 aa]
           {ON} similar to uniprot|P53264 Saccharomyces cerevisiae
           YGR110W Hypothetical ORF
          Length = 438

 Score =  573 bits (1476), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 268/434 (61%), Positives = 327/434 (75%)

Query: 1   MPTFGDLQSSRVIAVIRSAADQLSNLQLRRLRIRPLEIKNQVPNTSYHPKPSSPSAIPLN 60
           MPT  DLQ  +  ++ RSA  Q+  +Q +  +           N S   +PSSPSAIPL 
Sbjct: 1   MPTISDLQIYKAASLFRSAFSQVVGIQPKVRKPAFPCNSESASNPSITCRPSSPSAIPLR 60

Query: 61  EIILKLPNLFPRSLEQSARDFKDFKLNAGALQSELLATLPFFPAGDSRRTAEIIRTTVDA 120
           E+++ LP LFPRS+++S RD+  F+ +AG LQ +LL+TLPFFP     + AE+++T VD 
Sbjct: 61  ELVINLPRLFPRSMKESVRDYFAFRKDAGTLQHQLLSTLPFFPVAGDDKVAEVVQTPVDE 120

Query: 121 QGNYINEFNIRPTAVDTSKTMKHLILVHGYGAGLGFFLKTFENLNLINENWMIHAIDLPG 180
           Q NYINEF +RP     S T++HLI+VHGYGAGLGFFLK  E LNLI+  W+IHAIDLPG
Sbjct: 121 QANYINEFCVRPAMPHPSGTLRHLIIVHGYGAGLGFFLKNLEKLNLIDNRWVIHAIDLPG 180

Query: 181 YGFSSRPPFPFKVGDSTPAQVEQWFHSRFHRWMERRGLLETPENNMVVAHSMGAYLTALY 240
           YGFSSRP FP+K      AQVE WFH+RF  W+E+RGLL+ PE NM+VAHSMGAYL ALY
Sbjct: 181 YGFSSRPKFPYKYKSDPAAQVEHWFHARFKTWLEKRGLLQHPEQNMLVAHSMGAYLAALY 240

Query: 241 ANKHPGHFKKLVMCSPAGVCHSAPEMRKRPPPWWFAKLWDKNISPFSLVRNANVLGSKLT 300
           ANK+P HFKKLVMCSPAG+C++    ++R PPWWFAKLWD+NISPFSLVRN+ +LGSKLT
Sbjct: 241 ANKYPNHFKKLVMCSPAGICNTPSNKQRRLPPWWFAKLWDRNISPFSLVRNSRLLGSKLT 300

Query: 301 SGWSYRRLGQLLKDKVLNARQHEALHRYAYAIFNRKGSGEYLLSFALQCGGEPRVPLERR 360
           SGWSYRR GQLL +    A+Q EA+H+YAYAIFN  GSGEYLLSFAL+CGG+PR  LERR
Sbjct: 301 SGWSYRRFGQLLSEGYRGAQQFEAIHKYAYAIFNSPGSGEYLLSFALKCGGDPRDALERR 360

Query: 361 LFHNRGQQFKANCEWLWLYGDQDWIDRRGGERVSQFLTAEMGHESCVKIVKNSGHHLYLD 420
           LFHN+  QFKA CEWLWLYGDQDW+D  GG RVS FL   MG +S V++V +SGHHLY D
Sbjct: 361 LFHNKMNQFKAKCEWLWLYGDQDWMDVGGGRRVSHFLNTAMGKKSKVEVVHDSGHHLYFD 420

Query: 421 NHRMFNKILEDEMR 434
           N+  FN+ILE EM+
Sbjct: 421 NYEQFNRILEKEMK 434

>SAKL0B06116g Chr2 complement(519929..521224) [1296 bp, 431 aa] {ON}
           similar to uniprot|P53264 Saccharomyces cerevisiae
           YGR110W Hypothetical ORF
          Length = 431

 Score =  500 bits (1288), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 240/424 (56%), Positives = 315/424 (74%), Gaps = 9/424 (2%)

Query: 12  VIAVIRSAADQLSNLQL-RRLRIRPLEIKNQVPNTSYHPKPSSPSAIPLNEIILKLPNLF 70
           ++  +++A + +S   L  R ++R       + N     K + P+A+PL +I  +LPNLF
Sbjct: 12  LLTALKAAVNSISITNLISRAKVRTSAETTAIINQ----KSTPPTAMPLIQIATQLPNLF 67

Query: 71  PRSLEQSARDFKDFKLNAGALQSELLATLPFFPAGDSRRTAEIIRTTVDAQGNYINEFNI 130
           P S E S RD+  F+ NA + QS+LL+TLPF+P+  + R++EI++T VD +GNYINEF I
Sbjct: 68  PLSFEASIRDYSMFQENAESFQSQLLSTLPFYPSPANGRSSEILKTPVDDEGNYINEFTI 127

Query: 131 RPTAVDTSKTMKHLILVHGYGAGLGFFLKTFENLNLINENWMIHAIDLPGYGFSSRPPFP 190
           +P    +S +MKHLI VHGYGAGLGFFLK FEN+ L+N NW IHAIDLPGYGFSSRP FP
Sbjct: 128 KPMNPSSSSSMKHLIFVHGYGAGLGFFLKNFENIPLLNNNWCIHAIDLPGYGFSSRPKFP 187

Query: 191 FKVGDSTPAQVEQWFHSRFHRWMERRGLLETPENNMVVAHSMGAYLTALYANKHPGHFKK 250
           F   +  P  VE WFH R   W+ +RGLL  P+NN++VAHS+GAY++ALYANK P HF K
Sbjct: 188 FNYPEHNPIMVEDWFHQRIKGWLHKRGLLANPKNNLLVAHSLGAYISALYANKFPNHFSK 247

Query: 251 LVMCSPAGVCHSAPEMRKRPPPWWFAKLWDKNISPFSLVRNANVLGSKLTSGWSYRRLGQ 310
           L+MCSPAG+C S P++ + PP  WF KLWD+NISPFSLVRN+  LGSKLTSGW+YRR  Q
Sbjct: 248 LIMCSPAGICPS-PKLGQAPPQ-WFVKLWDRNISPFSLVRNSFHLGSKLTSGWTYRRFRQ 305

Query: 311 LLKDKVLNARQHEALHRYAYAIFNRKGSGEYLLSFALQCGGEPRVPLERRLFHNRGQQFK 370
            L++      QH+A+H+Y YAIFN+ GSGEYLLSFAL+CGG+PR+PLE+RLF N    FK
Sbjct: 306 FLREGQRGYEQHKAMHKYTYAIFNKPGSGEYLLSFALKCGGDPRLPLEKRLFDNT-SSFK 364

Query: 371 ANCEWLWLYGDQDWIDRRGGERVSQFLTAEMGHESCVKIVKNSGHHLYLDNHRMFNKILE 430
           ANC+WLWLYGD+DW+D RGG+R S+FL  ++G +S VK+V ++GHHLYLDN++ FN ++ 
Sbjct: 365 ANCDWLWLYGDEDWMDLRGGQRASEFLK-KIGMKSDVKVVPSAGHHLYLDNYKHFNNVVI 423

Query: 431 DEMR 434
            EM 
Sbjct: 424 KEME 427

>Ecym_2465 Chr2 complement(908173..909489) [1317 bp, 438 aa] {ON}
           similar to Ashbya gossypii ABL019W
          Length = 438

 Score =  496 bits (1276), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 227/389 (58%), Positives = 290/389 (74%), Gaps = 6/389 (1%)

Query: 49  PKPSSPSAIPLNEIILKLPNLFPRSLEQSARDFKDFKLNAGALQSELLATLPFFPAGDSR 108
           PKP+ P+AIPL EI+L +P+LFP  L++S +D+K F  +    Q+ LL+TLPFFP+    
Sbjct: 41  PKPTPPTAIPLMEILLNIPSLFPMPLKESWKDYKIFHDDVDKFQTGLLSTLPFFPSAADG 100

Query: 109 RTAEIIRTTVDAQGNYINEFNIRPTAVDTS---KTMKHLILVHGYGAGLGFFLKTFENLN 165
           +  EIIRT VD +GNYINEF IRP +   +     M HLI VHGYGAGLGFFLK FEN+ 
Sbjct: 101 KIGEIIRTPVDEEGNYINEFCIRPNSPPVNPKDSKMHHLIFVHGYGAGLGFFLKNFENIK 160

Query: 166 LINENWMIHAIDLPGYGFSSRPPFPFKVGDSTPAQVEQWFHSRFHRWMERRGLLETPENN 225
           L+N +W IHAID PGYGFSSRP FPF +  +T ++VE WFH RF  W+++RGLLE  E N
Sbjct: 161 LLNNSWTIHAIDFPGYGFSSRPKFPFSINKNTASEVENWFHDRFEIWLQKRGLLEDQERN 220

Query: 226 MVVAHSMGAYLTALYANKHPGHFKKLVMCSPAGVCHSAPEMRKRPPPWWFAKLWDKNISP 285
           +V+AHS+GAYL ALYA   P H KKL+MCSPAG+C S   +++  PPWWF KLWD+N+SP
Sbjct: 221 LVLAHSLGAYLIALYAQSRPKHLKKLIMCSPAGICPSNKVIKQ--PPWWFVKLWDRNLSP 278

Query: 286 FSLVRNANVLGSKLTSGWSYRRLGQLLKDKVLNARQHEALHRYAYAIFNRKGSGEYLLSF 345
           FSLVRN+ + GSKLTSGWS+RR  Q L +  +   Q +ALHRYAYAIFN+ GSGEYLLSF
Sbjct: 279 FSLVRNSGIFGSKLTSGWSFRRFKQFLNEGTMGESQFQALHRYAYAIFNKPGSGEYLLSF 338

Query: 346 ALQCGGEPRVPLERRLFHNR-GQQFKANCEWLWLYGDQDWIDRRGGERVSQFLTAEMGHE 404
            L+CGG+PR PL  RLF+++    FKA C+WLW+YGDQDW+D +GGE+ S F+   +G E
Sbjct: 339 VLKCGGDPRSPLLSRLFNSQAADSFKAQCDWLWMYGDQDWMDCKGGEQASDFIVRHIGKE 398

Query: 405 SCVKIVKNSGHHLYLDNHRMFNKILEDEM 433
           S V ++  SGHHLYLDN+ +FN++L+ EM
Sbjct: 399 SNVHVIPQSGHHLYLDNYSVFNELLQAEM 427

>ZYRO0C06270g Chr3 (475283..476575) [1293 bp, 430 aa] {ON} similar
           to uniprot|P53264 Saccharomyces cerevisiae YGR110W
           Hypothetical ORF
          Length = 430

 Score =  494 bits (1273), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 235/419 (56%), Positives = 300/419 (71%), Gaps = 7/419 (1%)

Query: 23  LSNLQLRRLRIRPLEIKNQVPNTSYHPKPSSPSAIPLNEIILKLPNLFPRSLEQSARDFK 82
           L ++    L  + + IK ++  T     P++P+AIPL++II++LP LFPRS++ S RD+K
Sbjct: 10  LKSIAASILSRKNVGIKKKLHGTLGTRVPAAPTAIPLHKIIMRLPKLFPRSVDASTRDYK 69

Query: 83  DFKLNAGALQSELLATLPFFPAGDSRRTAEIIRTTVDAQGNYINEFNIRPTAVDT-SKTM 141
           DF  + G LQ ELL TLPF+P     + AE+++TTVD QGNYINEF I P      S  M
Sbjct: 70  DFCYHTGQLQEELLRTLPFYPYCAESKKAEVVKTTVDDQGNYINEFCITPVKPSVPSHKM 129

Query: 142 KHLILVHGYGAGLGFFLKTFENLNLINENWMIHAIDLPGYGFSSRPPFPFKVGDSTPAQV 201
           KHLI +HGYGAGLGFFLK  E + L++ +W+IHAIDLPGYGFSSRP FPFK    + +QV
Sbjct: 130 KHLICIHGYGAGLGFFLKNLEGIPLLDNSWVIHAIDLPGYGFSSRPKFPFKYPKDSLSQV 189

Query: 202 EQWFHSRFHRWMERRGLLETPENNMVVAHSMGAYLTALYANKHPGHFKKLVMCSPAGVCH 261
             WFH R H W ++RGLL   +NN+V+AHS+GAYL ALY  K+  HFKKLVMCSPAGVC 
Sbjct: 190 HSWFHDRIHTWFKKRGLLVNSQNNLVMAHSLGAYLMALYTTKYTTHFKKLVMCSPAGVCK 249

Query: 262 S--APEMRKRPPPWWFAKLWDKNISPFSLVRNANVLGSKLTSGWSYRRLGQLLKDKV--- 316
           S  A  +    PPWW+ KLWD NISPF LVRNA  LGS +TSGWSYRR  +LL+      
Sbjct: 250 STTAKNIGNTTPPWWYTKLWDLNISPFCLVRNAAALGSMVTSGWSYRRFNKLLQSNSNTN 309

Query: 317 LNARQHEALHRYAYAIFNRKGSGEYLLSFALQCGGEPRVPLERRLFHNRGQQ-FKANCEW 375
           L+  Q EALHRYAYAIFNR+GSGEYLLSFAL CGG+PR+PLE  +F ++    F++NCEW
Sbjct: 310 LDRLQFEALHRYAYAIFNRRGSGEYLLSFALSCGGDPRLPLEDTIFKDKTSGIFRSNCEW 369

Query: 376 LWLYGDQDWIDRRGGERVSQFLTAEMGHESCVKIVKNSGHHLYLDNHRMFNKILEDEMR 434
           +W+YG++DW+D  GGERVS+F+  + G +S V +  NSGHHLY DNH+ FN  +  +M+
Sbjct: 370 IWIYGERDWMDVNGGERVSRFIENQGGRKSQVHVAPNSGHHLYFDNHKFFNSFIVKQMK 428

>YGR110W Chr7 (713709..715046) [1338 bp, 445 aa] {ON}
           CLD1Mitochondrial cardiolipin-specific phospholipase;
           functions upstream of Taz1p to generate
           monolyso-cardiolipin; transcription increases upon
           genotoxic stress; involved in restricting Ty1
           transposition; has homology to mammalian CGI-58
          Length = 445

 Score =  474 bits (1219), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 225/395 (56%), Positives = 286/395 (72%), Gaps = 11/395 (2%)

Query: 51  PSSPSAIPLNEIILKLPNLFPRSLEQSARDFKDFKLNAGALQSELLATLPFFPAGDSRRT 110
           PS+P+AIPL EII ++P+LFPR LE S +DF+DF  N  A Q+ELL TLPF+P     +T
Sbjct: 49  PSAPTAIPLREIIYRVPSLFPRPLEDSVKDFRDFIKNEDAFQTELLKTLPFYPTPSESKT 108

Query: 111 AEIIRTTVDAQGNYINEFNIRPTAVDTSKT-MKHLILVHGYGAGLGFFLKTFENLNLINE 169
           A +IRT VD +GNYINEF IRP      +  +KHL+ +HGYGAGLGFF+K FE++ L++ 
Sbjct: 109 ARLIRTVVDDEGNYINEFCIRPRKTSVPEADLKHLVFIHGYGAGLGFFIKNFEDIPLLDN 168

Query: 170 NWMIHAIDLPGYGFSSRPPFPFKVGDSTPAQVEQWFHSRFHRWMERRGLLETPENNMVVA 229
            W IHAIDLPGYGFSSRP FPF+        V+ WFH R H W  +R LL  PE N+V+A
Sbjct: 169 EWCIHAIDLPGYGFSSRPKFPFEYPRDNIHSVQDWFHERIHTWFSKRNLLNRPEKNIVMA 228

Query: 230 HSMGAYLTALYANKHPGH--FKKLVMCSPAGVCH-----SAPEMRK-RPPPWWFAKLWDK 281
           HS+G+YL ALY  K+     FKKL++CSPAGV +     +A E+ K +PPPWW+ KLWD+
Sbjct: 229 HSLGSYLMALYLQKYKESPSFKKLILCSPAGVSYRDFNNTASEVEKWKPPPWWYVKLWDR 288

Query: 282 NISPFSLVRNANVLGSKLTSGWSYRRLGQLLKDKVLNARQHEALHRYAYAIFNRKGSGEY 341
           NISPF+LVRN   LGSK+TSGWSYRR   +L      +++ EALHRYAYAIFN++GSGEY
Sbjct: 289 NISPFTLVRNFRQLGSKITSGWSYRRFKHILNGDPEQSKRFEALHRYAYAIFNKRGSGEY 348

Query: 342 LLSFALQCGGEPRVPLERRLFHNRGQQF--KANCEWLWLYGDQDWIDRRGGERVSQFLTA 399
           LLSFAL+CGGEPR+ LE++LF  +       +NC+WLWLYGD DW+D  GG RVS+FL  
Sbjct: 349 LLSFALKCGGEPRLSLEQQLFDGKKSDILKNSNCDWLWLYGDDDWMDVNGGLRVSRFLKE 408

Query: 400 EMGHESCVKIVKNSGHHLYLDNHRMFNKILEDEMR 434
           ++  +S V IV +SGHHLYLDN++ FN IL  EM+
Sbjct: 409 KLKQKSNVIIVPHSGHHLYLDNYKFFNNILTKEMQ 443

>Suva_7.395 Chr7 (684763..686118) [1356 bp, 451 aa] {ON} YGR110W
           (REAL)
          Length = 451

 Score =  470 bits (1209), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 220/395 (55%), Positives = 283/395 (71%), Gaps = 11/395 (2%)

Query: 51  PSSPSAIPLNEIILKLPNLFPRSLEQSARDFKDFKLNAGALQSELLATLPFFPAGDSRRT 110
           PS+P+AIPL EII K+P LFPR LE S +DF+DF  N  + Q+ELLATLPF+P   + + 
Sbjct: 55  PSAPTAIPLREIIYKVPGLFPRPLEDSVKDFRDFIKNEDSFQTELLATLPFYPNPSTTKK 114

Query: 111 AEIIRTTVDAQGNYINEFNIRPTAVDTSKT-MKHLILVHGYGAGLGFFLKTFENLNLINE 169
           +++I+T VD  GNYINEF I P      +  +KHL+ +HGYGAGLGFF+K FE++ L+N 
Sbjct: 115 SKLIKTIVDDDGNYINEFCIYPQVPSVPEADLKHLVFIHGYGAGLGFFIKNFEDIPLLNN 174

Query: 170 NWMIHAIDLPGYGFSSRPPFPFKVGDSTPAQVEQWFHSRFHRWMERRGLLETPENNMVVA 229
            W +HAIDLPGYGFSSRP FPFK        V+ WFH R H W E+R LL  PE N+V+A
Sbjct: 175 EWCVHAIDLPGYGFSSRPKFPFKYPRDDIHSVQDWFHERIHTWFEKRNLLNKPEKNIVMA 234

Query: 230 HSMGAYLTALYANKHPGH--FKKLVMCSPAGVCH------SAPEMRKRPPPWWFAKLWDK 281
           HS+G+YL ALY  K+ G   FKKL++CSPAGV H      ++   + +PPPWW+ KLWDK
Sbjct: 235 HSLGSYLMALYLQKYEGSPSFKKLILCSPAGVSHRDFDSGNSDVEKWKPPPWWYVKLWDK 294

Query: 282 NISPFSLVRNANVLGSKLTSGWSYRRLGQLLKDKVLNARQHEALHRYAYAIFNRKGSGEY 341
           NISPF+LVRN+   GSK+TSGWSYRR   +L      +++ EALHRYAY+IFN++GSGEY
Sbjct: 295 NISPFTLVRNSRQFGSKITSGWSYRRFKHILNGDPDQSKRFEALHRYAYSIFNKRGSGEY 354

Query: 342 LLSFALQCGGEPRVPLERRLFHNRGQQFKANC--EWLWLYGDQDWIDRRGGERVSQFLTA 399
           LLSFAL+CGGEPR+PLE +LF+ +      N   EW+WLYGD DW+D  GG RVS+ L  
Sbjct: 355 LLSFALKCGGEPRLPLEEQLFNGKNANVLKNAKYEWVWLYGDDDWMDVNGGLRVSKLLND 414

Query: 400 EMGHESCVKIVKNSGHHLYLDNHRMFNKILEDEMR 434
           ++  +S V  V N+GHHLYLDNH+ FN I+ +EM+
Sbjct: 415 KLKQKSSVITVPNAGHHLYLDNHKFFNTIIMNEMQ 449

>Kpol_1035.9 s1035 complement(19721..21004) [1284 bp, 427 aa] {ON}
           complement(19721..21004) [1284 nt, 428 aa]
          Length = 427

 Score =  467 bits (1201), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 225/426 (52%), Positives = 298/426 (69%), Gaps = 12/426 (2%)

Query: 15  VIRSAADQLSN-LQLRRLRIRPLEIKNQVPNTSYHPKPSSPSAIPLNEIILKLPNLFPRS 73
           +IR++   +SN    RR+    +  +++   T     P++P+AIPL EIILKLPNLFPR+
Sbjct: 6   LIRTSKSFISNNFNFRRVATSGVPSRDEKLPTV----PAAPAAIPLYEIILKLPNLFPRT 61

Query: 74  LEQSARDFKDFKLNAGALQSELLATLPFFPAGDSRRTAEIIRTTVDAQGNYINEFNIRPT 133
           L++S  D+ DF  +    Q+ELL+TLP++P  +  + AE+I T VD +GNYINEF I P 
Sbjct: 62  LKESLNDYHDFHKDIDKFQTELLSTLPYYPMANDGKKAELITTKVDDEGNYINEFCISPI 121

Query: 134 AVDTS-KTMKHLILVHGYGAGLGFFLKTFENLNLINENWMIHAIDLPGYGFSSRPPFPFK 192
             +   + +KHLI +HGYGAGLGFFLK FE+L L++  W IHAIDLPGYG+S R  FPFK
Sbjct: 122 GAEADQRDLKHLIFIHGYGAGLGFFLKNFEHLPLLDNKWCIHAIDLPGYGYSKRCEFPFK 181

Query: 193 VGDSTPAQVEQWFHSRFHRWMERRGLLETPENNMVVAHSMGAYLTALYANKHPGHFKKLV 252
             +   + V+ WFH R   W + R LL TPENNM++AHS+GAYL ALY +K P  FKK+V
Sbjct: 182 YPEHDISDVQDWFHKRIRTWFKARSLLTTPENNMIMAHSLGAYLMALYIDKFPNDFKKIV 241

Query: 253 MCSPAGVCHSAP--EMRKRPPPWWFAKLWDKNISPFSLVRNANVLGSKLTSGWSYRRLGQ 310
           MCSPAG+C S+   E+     PWWF KLWD+N+SPF+LVRN   LGSKLTSGWSYRR  Q
Sbjct: 242 MCSPAGICQSSTSEEIGNIKTPWWFNKLWDQNVSPFTLVRNTYYLGSKLTSGWSYRRFKQ 301

Query: 311 LLKDKVLNARQHEALHRYAYAIFNRKGSGEYLLSFALQCGGEPRVPLERRLFHNRGQQF- 369
           L +   L   Q E LHRYAY+IFN+KGSGEY+L FAL+CGG+PR+PLE  LF +   +  
Sbjct: 302 LKQSGHL--MQFEKLHRYAYSIFNQKGSGEYILGFALKCGGDPRIPLEDNLFKSPKTEGI 359

Query: 370 -KANCEWLWLYGDQDWIDRRGGERVSQFLTAEMGHESCVKIVKNSGHHLYLDNHRMFNKI 428
            K++CEWLW+YG++DW+D  GG+RV+  L    G +S   +V +SGHHLY DN++ FN++
Sbjct: 360 PKSDCEWLWVYGEKDWMDIGGGKRVTDELVTRFGKKSSTTVVPDSGHHLYFDNYKFFNEL 419

Query: 429 LEDEMR 434
           L  EM+
Sbjct: 420 LVKEMK 425

>KNAG0B00950 Chr2 (173167..174423) [1257 bp, 418 aa] {ON} Anc_3.454
           YGR110W
          Length = 418

 Score =  466 bits (1200), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 226/427 (52%), Positives = 295/427 (69%), Gaps = 12/427 (2%)

Query: 7   LQSSRVIAVIRSAADQLSNLQLRRLRIRPLEIKNQVPNTSYHPKPSSPSAIPLNEIILKL 66
           + S  +   +++  ++L    L+ +R R      Q  +  Y   P++P+AIPL EII+KL
Sbjct: 1   MASKALRGSLQAVLNRLKVFDLKNVRFR-----KQSDSRVYVKTPTAPTAIPLTEIIVKL 55

Query: 67  PNLFPRSLEQSARDFKDFKLNAGALQSELLATLPFFPAGDSRRTAEIIRTTVDAQGNYIN 126
           P LFPR + QS  D+K F  NA  +Q +LL+TLPFFP     + AEI+RT +D   N+IN
Sbjct: 56  PYLFPRGVAQSLEDYKVFSNNADKIQYDLLSTLPFFPEAKDGKRAEIVRTKIDEDDNFIN 115

Query: 127 EFNIRPTAVDTSKTMKHLILVHGYGAGLGFFLKTFENLNLINENWMIHAIDLPGYGFSSR 186
           EF I+P  V     +KHLI +HGYGAGLGFFLK FEN+ L + +W IHAIDLPG+GFSSR
Sbjct: 116 EFFIQPANVTEPSKLKHLIFIHGYGAGLGFFLKNFENIQLKDNSWCIHAIDLPGFGFSSR 175

Query: 187 PPFPFKVGDSTPAQVEQWFHSRFHRWMERRGLLETPENNMVVAHSMGAYLTALYANKHPG 246
             FPFK  +   ++V+ WFH R   W E+R LL+ P NNMVVAHS+GAYL ALY   +P 
Sbjct: 176 TKFPFKYPEDDVSKVQTWFHERLKIWFEKRDLLKNPGNNMVVAHSLGAYLMALYKRNNPL 235

Query: 247 HFKKLVMCSPAGVCHSAPEMRKRPPPWWFAKLWDKNISPFSLVRNANVLGSKLTSGWSYR 306
           HFKKL+MCSPAG+C+S   + K+ PPWW+A LWD N+SPFSLVRN+  LGSKLTSGWSYR
Sbjct: 236 HFKKLIMCSPAGMCNST--VVKKQPPWWYAALWDMNLSPFSLVRNSGWLGSKLTSGWSYR 293

Query: 307 RLGQLLKDKVLNARQHEALHRYAYAIFNRKGSGEYLLSFALQCGGEPRVPLERRLFHNRG 366
           R  + L  K+    Q E LH Y+YAIFNR G GEYLL+FAL+CGG+PRV LE  LF++  
Sbjct: 294 RF-RSLHSKI----QFENLHLYSYAIFNRPGCGEYLLAFALRCGGDPRVSLEATLFNDVV 348

Query: 367 QQFKANCEWLWLYGDQDWIDRRGGERVSQFLTAEMGHESCVKIVKNSGHHLYLDNHRMFN 426
            ++ ++ EW+WLYGD+DW+D +GG R+SQ +      +S V+++ N+GHHLY DN   FN
Sbjct: 349 NKWDSDSEWVWLYGDRDWMDVKGGRRISQKINEIFPGKSSVEVIPNAGHHLYFDNISCFN 408

Query: 427 KILEDEM 433
            ILE EM
Sbjct: 409 AILEKEM 415

>TDEL0F03390 Chr6 (624579..625853) [1275 bp, 424 aa] {ON} Anc_3.454
           YGR110W
          Length = 424

 Score =  465 bits (1196), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 226/390 (57%), Positives = 282/390 (72%), Gaps = 7/390 (1%)

Query: 51  PSSPSAIPLNEIILKLPNLFPRSLEQSARDFKDF-KLNAGALQSELLATLPFFPAGDSRR 109
           P++P+AIPL EII+KLP+LFPRS   S RD++D  +      Q +LLATLPF+  GD  R
Sbjct: 34  PAAPTAIPLREIIVKLPSLFPRSFGDSVRDYRDLCRHTDEKFQRDLLATLPFYGEGDLHR 93

Query: 110 TAEIIRTTVDAQGNYINEFNIRPTAVDTSKT-MKHLILVHGYGAGLGFFLKTFENLNLIN 168
            +E+IRT VD +GNYINEF I P      +  +KHL+ +HGYGAGLGFFLK FEN+ L+N
Sbjct: 94  RSEVIRTKVDDEGNYINEFYIMPKNASVPRDRLKHLVFIHGYGAGLGFFLKNFENIPLLN 153

Query: 169 ENWMIHAIDLPGYGFSSRPPFPFKVGDSTPAQVEQWFHSRFHRWMERRGLLETPENNMVV 228
             W IHAIDLPGYGFSSR  FPF+    T   V +WFH R +RW   R LL  PENN+V+
Sbjct: 154 NEWCIHAIDLPGYGFSSRCKFPFQYPKDTVTDVHEWFHKRLNRWFAERNLLRNPENNIVM 213

Query: 229 AHSMGAYLTALYANKHPGHFKKLVMCSPAGVCHSAPE--MRKRPPPWWFAKLWDKNISPF 286
           AHS+GAYL ALYA+K+  HFKKLVMCSPAG+C S     +  R PPWW++KLWD+NISPF
Sbjct: 214 AHSLGAYLMALYASKNSSHFKKLVMCSPAGICESTTTKAIGNRKPPWWYSKLWDRNISPF 273

Query: 287 SLVRNANVLGSKLTSGWSYRRLGQLLKDKVLNARQH-EALHRYAYAIFNRKGSGEYLLSF 345
           SLVR ++ LGSKLTSGWSY+R G+LL+ K   + Q  EALH+Y Y+IFN+ G GEYLLSF
Sbjct: 274 SLVRVSSRLGSKLTSGWSYKRFGKLLRSKSRKSEQQFEALHKYCYSIFNKPGCGEYLLSF 333

Query: 346 ALQCGGEPRVPLERRLFH-NRGQQFKANCEWLWLYGDQDWIDRRGGERVSQFLTAEMGHE 404
           AL+CGG+PR+PLE  LF  N       N EWLWLYG++DW+D  GG+RVS+ L  + G +
Sbjct: 334 ALRCGGDPRIPLEDMLFKTNDSGIMNGNLEWLWLYGERDWMDFNGGKRVSEHL-KKSGQK 392

Query: 405 SCVKIVKNSGHHLYLDNHRMFNKILEDEMR 434
           S V IV N+GHHLY DN+  FN ++  EM+
Sbjct: 393 SEVCIVPNAGHHLYFDNYDYFNSLIIREMK 422

>ABL019W Chr2 (361560..362855) [1296 bp, 431 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YGR110W
          Length = 431

 Score =  464 bits (1195), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 223/388 (57%), Positives = 278/388 (71%), Gaps = 5/388 (1%)

Query: 50  KPSSPSAIPLNEIILKLPNLFPRSLEQSARDFKDFKLNAGALQSELLATLPFFPAGDSRR 109
           KP+ P+A+PL EII  LPNLFP    QS  D+K FK +  A Q  LL+TLPFF      +
Sbjct: 41  KPTPPTAVPLYEIIRNLPNLFPLPTSQSWEDYKAFKSDREAFQVGLLSTLPFFERAREGK 100

Query: 110 TAEIIRTTVDAQGNYINEFNIRPTAVDTS--KTMKHLILVHGYGAGLGFFLKTFENLNLI 167
             +IIRT VD +GNYINEF IRP +++ +      HLI +HGYGAGLGFF+K FE+L L+
Sbjct: 101 IGKIIRTPVDDEGNYINEFCIRPASMEENHGAATNHLIFIHGYGAGLGFFIKNFEHLPLL 160

Query: 168 NENWMIHAIDLPGYGFSSRPPFPFKVGDSTPAQVEQWFHSRFHRWMERRGLLETPENNMV 227
           ++ W+IHAIDLPGYG+S+R  FPF V   +  +VE WFH R   W+ +RGLL+ P  NMV
Sbjct: 161 DDQWVIHAIDLPGYGYSTRCQFPFDVNTHSVREVEAWFHERLETWLSKRGLLQAPHRNMV 220

Query: 228 VAHSMGAYLTALYANKHPGHFKKLVMCSPAGVCHSAPEMRKRPPPWWFAKLWDKNISPFS 287
           +AHSMGAYLTA YA     HFKKL+MCSPAG+  S  +  K+ PPWWF KLWD+N+SPFS
Sbjct: 221 MAHSMGAYLTAHYAQSRQNHFKKLIMCSPAGI--SPSKSMKKQPPWWFIKLWDRNVSPFS 278

Query: 288 LVRNANVLGSKLTSGWSYRRLGQLLKDKVLNARQHEALHRYAYAIFNRKGSGEYLLSFAL 347
           LVRN+  LGSKLTSGWS+RR   LL +  +  RQ EALH+Y+YAIFN  GSGEYLLSF L
Sbjct: 279 LVRNSGPLGSKLTSGWSFRRFRHLLNEGEIGMRQFEALHKYSYAIFNMPGSGEYLLSFVL 338

Query: 348 QCGGEPRVPLERRLFH-NRGQQFKANCEWLWLYGDQDWIDRRGGERVSQFLTAEMGHESC 406
           +CGG+PR+PL   +F   +   FKA CEWLWLYGD  W+D+ GG+R S ++T  +G +S 
Sbjct: 339 KCGGDPRIPLLGSMFSPEKEHGFKAQCEWLWLYGDHVWMDKEGGQRASSYITDRIGGKSR 398

Query: 407 VKIVKNSGHHLYLDNHRMFNKILEDEMR 434
           V+IV NSGHHLY DN+  FNKIL  EM+
Sbjct: 399 VEIVPNSGHHLYFDNYSYFNKILLREMQ 426

>Smik_6.200 Chr6 (329969..331306) [1338 bp, 445 aa] {ON} YGR110W
           (REAL)
          Length = 445

 Score =  463 bits (1192), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 221/395 (55%), Positives = 280/395 (70%), Gaps = 11/395 (2%)

Query: 51  PSSPSAIPLNEIILKLPNLFPRSLEQSARDFKDFKLNAGALQSELLATLPFFPAGDSRRT 110
           PS+P+AIPL EII K+P LFPR +  S +DF+DF  +    Q+ELL TLPF+P     + 
Sbjct: 49  PSAPTAIPLREIIYKVPGLFPRPVGDSVKDFRDFIKSEDVFQTELLKTLPFYPNPSKLKK 108

Query: 111 AEIIRTTVDAQGNYINEFNIRPTAVDTSKT-MKHLILVHGYGAGLGFFLKTFENLNLINE 169
           + +IRT VD  GNYINEF IRP      +T +KHLI +HGYGAGLGFF+K FE++ L+N 
Sbjct: 109 SRVIRTVVDDDGNYINEFCIRPINPSVPETELKHLIFIHGYGAGLGFFIKNFEDIPLLNN 168

Query: 170 NWMIHAIDLPGYGFSSRPPFPFKVGDSTPAQVEQWFHSRFHRWMERRGLLETPENNMVVA 229
            W +HAIDLPGYGFSSRP FPF+        V+ WFH R H W  +R LL  P+ N+V+A
Sbjct: 169 EWCVHAIDLPGYGFSSRPKFPFEYPRDNLHDVQDWFHKRLHTWFNKRNLLNKPDKNVVMA 228

Query: 230 HSMGAYLTALYANKHPGH--FKKLVMCSPAGVCH-----SAPEMRK-RPPPWWFAKLWDK 281
           HS+G+YL ALY  K+     FKKL++CSPAGV H     +  E  K +PPPWW+ KLWD+
Sbjct: 229 HSLGSYLMALYVQKYKERPSFKKLILCSPAGVSHRDSNNTTSEAEKWKPPPWWYVKLWDR 288

Query: 282 NISPFSLVRNANVLGSKLTSGWSYRRLGQLLKDKVLNARQHEALHRYAYAIFNRKGSGEY 341
           NISPF+LVRN+   GSK+TSGWSYRR   +L   +  + + EALHRYAY+IFN++GSGEY
Sbjct: 289 NISPFTLVRNSRQFGSKITSGWSYRRFKHILNGDLKQSSRFEALHRYAYSIFNKRGSGEY 348

Query: 342 LLSFALQCGGEPRVPLERRLFHNRGQQF--KANCEWLWLYGDQDWIDRRGGERVSQFLTA 399
           LLSFAL+CGGEPR+PLE +LF++R       +N EWLWLYGD DW+D  GG RVS+FL  
Sbjct: 349 LLSFALKCGGEPRLPLEEQLFNDRNLNILRSSNYEWLWLYGDDDWMDVNGGIRVSKFLNE 408

Query: 400 EMGHESCVKIVKNSGHHLYLDNHRMFNKILEDEMR 434
           ++  +S V IV ++GHHLYLDN + FN IL  EMR
Sbjct: 409 KLRQKSNVIIVPHAGHHLYLDNSKFFNDILVKEMR 443

>Skud_7.415 Chr7 (692655..694013) [1359 bp, 452 aa] {ON} YGR110W
           (REAL)
          Length = 452

 Score =  460 bits (1184), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 220/395 (55%), Positives = 282/395 (71%), Gaps = 11/395 (2%)

Query: 51  PSSPSAIPLNEIILKLPNLFPRSLEQSARDFKDFKLNAGALQSELLATLPFFPAGDSRRT 110
           PS+P+AIPL EII K+P LFPR LE S +DF+DF  N    Q+ELL TLPF+P     + 
Sbjct: 55  PSAPTAIPLREIIYKVPGLFPRPLEDSVKDFRDFTKNEDVFQTELLETLPFYPNPSKYKK 114

Query: 111 AEIIRTTVDAQGNYINEFNIRPTAVDTSKT-MKHLILVHGYGAGLGFFLKTFENLNLINE 169
           +++I+T VD  GNYINEF I P      +T +KHL+ +HGYGAGLGFF+K  E++ L++ 
Sbjct: 115 SKLIKTVVDDDGNYINEFCIYPQKPSVPETELKHLVFIHGYGAGLGFFIKNLEDIPLLDN 174

Query: 170 NWMIHAIDLPGYGFSSRPPFPFKVGDSTPAQVEQWFHSRFHRWMERRGLLETPENNMVVA 229
            W IHAIDLPGYGFSSRP FPF+        V+ WFH R H W  +R LL  P+ N+VVA
Sbjct: 175 EWCIHAIDLPGYGFSSRPKFPFEYPKDNLHTVQDWFHERIHTWFNKRNLLHKPDKNIVVA 234

Query: 230 HSMGAYLTALYANKHPGH--FKKLVMCSPAGVCH------SAPEMRKRPPPWWFAKLWDK 281
           HS+G+YL ALY  K+     FKKLV+CSPAGV +      +A   + +PPPWW+ KLWD+
Sbjct: 235 HSLGSYLMALYLQKYKESPSFKKLVLCSPAGVSNRDFDNTTAEVGKWKPPPWWYVKLWDR 294

Query: 282 NISPFSLVRNANVLGSKLTSGWSYRRLGQLLKDKVLNARQHEALHRYAYAIFNRKGSGEY 341
           NISPF+LVRNA  LGSK+TSGWSYRR   +L      +R+ EALHRYAY+IFN++GSGEY
Sbjct: 295 NISPFTLVRNARQLGSKITSGWSYRRFKHILNGDPGQSRRFEALHRYAYSIFNKRGSGEY 354

Query: 342 LLSFALQCGGEPRVPLERRLFHNRGQQF--KANCEWLWLYGDQDWIDRRGGERVSQFLTA 399
           LLSFAL+CGGEPR+PLE +LF+    +    +N EW+WLYG+ DW+D  GG RVS++L  
Sbjct: 355 LLSFALRCGGEPRLPLEEQLFNGENSKVLKNSNYEWVWLYGNDDWMDVDGGLRVSKYLNE 414

Query: 400 EMGHESCVKIVKNSGHHLYLDNHRMFNKILEDEMR 434
           ++G +S V IV ++GHHLYLDN+  FNKIL  EM+
Sbjct: 415 KLGQKSNVFIVPHAGHHLYLDNYTFFNKILVKEMQ 449

>NCAS0E00860 Chr5 (157521..158843) [1323 bp, 440 aa] {ON} Anc_3.454
          Length = 440

 Score =  436 bits (1120), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 209/391 (53%), Positives = 270/391 (69%), Gaps = 8/391 (2%)

Query: 49  PKPSSPS-AIPLNEIILKLPNLFPRSLEQSARDFKDFKLNAGALQSELLATLPFFPAGDS 107
           P+PS+P  AIP+ +II  LP+LFPRSL  S RD+  F  +  +LQ  LL TLPFFP G S
Sbjct: 48  PQPSTPPVAIPITDIITSLPSLFPRSLHDSRRDYNTFTTDIDSLQLNLLKTLPFFPMGSS 107

Query: 108 RRTAEIIRTTVDAQGNYINEFNIRPTAVD---TSKTMKHLILVHGYGAGLGFFLKTFENL 164
           ++ A++IRT +D +GNYINEF I P   D   +S  +KHLI +HGYGAGLGFFLK  EN+
Sbjct: 108 QKVAKLIRTPIDDEGNYINEFCIMPAVKDGDYSSPDLKHLIFIHGYGAGLGFFLKNLENI 167

Query: 165 NLINENWMIHAIDLPGYGFSSRPPFPFKVGDSTPAQVEQWFHSRFHRWMERRGLLETPEN 224
            L++  W IHAIDLPGYGFSSR  FPF   + +  +V++WFH R +RW   R LL+ P+N
Sbjct: 168 PLLDNKWCIHAIDLPGYGFSSRFKFPFHYPNDSQTKVQKWFHDRIYRWFRERNLLQNPQN 227

Query: 225 NMVVAHSMGAYLTALYANKHPGHFKKLVMCSPAGVCHSAPEMRKRPPPWWFAKLWDKNIS 284
           N+V+AHS+GAYL A YA     HFKK++MCSPAGV   A   + + PPWW+ KLWD N S
Sbjct: 228 NLVMAHSLGAYLMAHYAFHFSNHFKKIIMCSPAGVSQFAVGKQNKQPPWWYNKLWDLNYS 287

Query: 285 PFSLVRNANVLGSKLTSGWSYRRLGQLLKDKVLNARQHEALHRYAYAIFNRKGSGEYLLS 344
           PFSLVRN+ + GSK+TSGWSYRR  +      LN  Q EALH+Y Y IFN+ GSGEYLLS
Sbjct: 288 PFSLVRNSGIYGSKITSGWSYRRF-KPTSFNGLNESQFEALHKYTYGIFNKNGSGEYLLS 346

Query: 345 FALQCGGEPRVPLERRLFHNRGQQFKANCEWLWLYGDQDWIDRRGGERVSQFLTAEMGH- 403
           F L CGG+PR  LE  LF       +  C+W+W+YGD+DW+D  G  R+S+ L  + G  
Sbjct: 347 FILSCGGDPRFALEDNLFKEENPP-EDLCDWVWVYGDRDWMDINGAHRISRRLVKKAGDT 405

Query: 404 -ESCVKIVKNSGHHLYLDNHRMFNKILEDEM 433
            +S V ++ ++GHHLYLDN++ FN ++  EM
Sbjct: 406 SKSKVHVIPSAGHHLYLDNYKAFNNLIIKEM 436

>KAFR0I01970 Chr9 (401907..403142) [1236 bp, 411 aa] {ON} 
          Length = 411

 Score =  429 bits (1103), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 210/396 (53%), Positives = 270/396 (68%), Gaps = 9/396 (2%)

Query: 39  KNQVPNTSYHPKPSSPSAIPLNEIILKLPNLFPRSLEQSARDFKDFKLNAGALQSELLAT 98
           K+QVP  S     S+P AIPL +II +LP LFPRS+++S +D++ +K     +Q +LL+T
Sbjct: 21  KSQVPVHS--NISSAPVAIPLVKIIAQLPRLFPRSIDESFKDYRVYKEGPERMQEDLLST 78

Query: 99  LPFFPAGDSRRTAEIIRTTVDAQGNYINEFNIRPTAVDTSKTMKHLILVHGYGAGLGFFL 158
           LPF+P     + A II+T VD +GNYINEF I P     S+ +KHLI +HGYGAG GFFL
Sbjct: 79  LPFYPNVSKDKVARIIKTVVDEEGNYINEFCITPKNTVNSQKLKHLIFIHGYGAGFGFFL 138

Query: 159 KTFENLNLINENWMIHAIDLPGYGFSSRPPFPFKVGDSTPAQVEQWFHSRFHRWMERRGL 218
           K  E++ L++ NW IHAIDLPG+GFSSR  FPFK   S  ++V  WFH R  RW+E R L
Sbjct: 139 KNLESIPLLDNNWCIHAIDLPGFGFSSRKNFPFKYPTSNTSEVTAWFHERIRRWLEERTL 198

Query: 219 LETPENNMVVAHSMGAYLTALYANKHPGHFKKLVMCSPAGVCHSAPEMRK-RPPPWWFAK 277
           L+ P+NN++VAHS+GAYL ALY   +P H +KL+MCSPAGV  S    +    PPWW+AK
Sbjct: 199 LDNPKNNVIVAHSLGAYLMALYTQVYPAHLRKLIMCSPAGVSKSQNNSKAVLQPPWWYAK 258

Query: 278 LWDKNISPFSLVRNANVLGSKLTSGWSYRRLGQLLKDKVLNARQHEALHRYAYAIFNRKG 337
           LWD N+SPF+LVR +  LGSKLTSGWSYRR  +L+++++    Q E LHRY+YAIFN+ G
Sbjct: 259 LWDMNLSPFTLVRLSKHLGSKLTSGWSYRRF-KLIENRM----QFEMLHRYSYAIFNQPG 313

Query: 338 SGEYLLSFALQCGGEPRVPLERRLFHNRGQQFKANCEWLWLYGDQDWIDRRGGERVSQFL 397
           SGEYLL F L+CGG PR  LE  LF N      +  EW W+YG+ DW+D  GG RV   L
Sbjct: 314 SGEYLLGFILECGGNPRCSLEDTLFSN-NFNVSSKVEWAWIYGENDWMDIEGGRRVHNLL 372

Query: 398 TAEMGHESCVKIVKNSGHHLYLDNHRMFNKILEDEM 433
             +   +S   +V N+GHHLYLDN R FN I+   M
Sbjct: 373 LEKFNRDSKFYMVPNAGHHLYLDNIRYFNNIIVQHM 408

>TPHA0O01310 Chr15 complement(258745..260061) [1317 bp, 438 aa] {ON}
           
          Length = 438

 Score =  430 bits (1105), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 212/435 (48%), Positives = 288/435 (66%), Gaps = 21/435 (4%)

Query: 17  RSAADQLSNLQLRRLRIRPLEIKNQVPNTSYHP-KPSSPS---------------AIPLN 60
           R   + L NL+  +LR + ++      N    P + +SPS               A+ L 
Sbjct: 3   RYLKELLDNLRTIKLREKVIDFSGSNLNLIEKPSRLTSPSIPNAAAAPTASTAPTALSLF 62

Query: 61  EIILKLPNLFPRSLEQSARDFKDFKLNAGALQSELLATLPFFPAGDSRRTAEIIRTTVDA 120
           E+I + P LFPRS  +S +D+K F  +    Q  LL TLP+FP   +   ++I  T VD 
Sbjct: 63  ELIKQFPRLFPRSFMKSFQDYKQFHSDVENFQVRLLETLPYFPDPSNGIYSKITNTIVDD 122

Query: 121 QGNYINEFNIRPTAVDT-SKTMKHLILVHGYGAGLGFFLKTFENLNLINENWMIHAIDLP 179
           +G+ INEF + P+ +   S+ +KHLI VHGYGAGLGFFLK  EN+ L+N+ W +HAIDLP
Sbjct: 123 EGSSINEFVVYPSNISVPSEKLKHLIFVHGYGAGLGFFLKNLENIKLLNDEWCVHAIDLP 182

Query: 180 GYGFSSRPPFPFKVGDSTPAQVEQWFHSRFHRWMERRGLLETPENNMVVAHSMGAYLTAL 239
           GYGFS+R  FPF+VG     QV +WFHSR   WM +R LL+  +NN ++AHS+GAYL AL
Sbjct: 183 GYGFSTRAKFPFQVGKHRHDQVNEWFHSRIRNWMHQRNLLQHSQNNFLIAHSLGAYLMAL 242

Query: 240 YANKHPGHFKKLVMCSPAGVCHSAPEMRKRPPPWWFAKLWDKNISPFSLVRNANVLGSKL 299
           Y +KHP   +K++MCSPAG+  S   ++K+ P WWF KLW++NISPF+LVR+++ +GSKL
Sbjct: 243 YVDKHPNDLQKILMCSPAGIGDSM-NLKKKTPAWWFEKLWERNISPFTLVRSSSYIGSKL 301

Query: 300 TSGWSYRRLGQLLKDKVLNARQHEALHRYAYAIFNRKGSGEYLLSFALQCGGEPRVPLER 359
           TSGW+YRR   LL     N +Q EALH+Y Y+IFN++GSGEYLL+FAL+CGG PR PLE+
Sbjct: 302 TSGWTYRRFSSLLSQN--NLKQFEALHKYTYSIFNQRGSGEYLLNFALKCGGGPRYPLEK 359

Query: 360 RLFHNRGQQF-KANCEWLWLYGDQDWIDRRGGERVSQFLTAEMGHESCVKIVKNSGHHLY 418
            LF N  +   K++ EW+W YGD DW+D+ GG RVS+ LT ++   S V IV  +GHHLY
Sbjct: 360 TLFMNNDKGISKSSTEWIWAYGDNDWMDKNGGIRVSEILTKQLKKRSEVYIVPRAGHHLY 419

Query: 419 LDNHRMFNKILEDEM 433
            DNH+ FN ++  EM
Sbjct: 420 FDNHQFFNDLILKEM 434

>NDAI0G01090 Chr7 (230932..232302) [1371 bp, 456 aa] {ON} Anc_3.454
          Length = 456

 Score =  419 bits (1078), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 204/387 (52%), Positives = 266/387 (68%), Gaps = 9/387 (2%)

Query: 51  PSSPSAIPLNEIILKLPNLFPRSLEQSARDFKDFKLNAGALQSELLATLPFFPAGDSRRT 110
           P+ P+AIPL  II  LP LFPRS++QS +D+K F+ +   LQ +LL TLPFF  G   +T
Sbjct: 69  PTPPTAIPLLRIITSLPKLFPRSIKQSIQDYKIFQKDPERLQIDLLKTLPFFSNGAKFKT 128

Query: 111 AEIIRTTV-DAQGNYINEFNIRP-TAVD-TSKTMKHLILVHGYGAGLGFFLKTFENLNLI 167
            +I++T + D    YINEF I P T ++  S  +KHLI +HGYGAGLGFF+K  EN+ L+
Sbjct: 129 GKILKTQIEDNDDYYINEFCITPDTNININSADVKHLIFIHGYGAGLGFFIKNLENIPLL 188

Query: 168 NENWMIHAIDLPGYGFSSR-PPFPFKVGDSTPAQVEQWFHSRFHRWMERRGLLETPENNM 226
           N  W IHAIDLPGYG+S+R   FPFK    +  +V+ WFH + H W+++R LL  P+NN+
Sbjct: 189 NNRWCIHAIDLPGYGYSTRNKKFPFKYPRDSQLKVQNWFHDKIHIWLQKRNLLNYPKNNL 248

Query: 227 VVAHSMGAYLTALYANKHPGHFKKLVMCSPAGVCHSAPEMRKRPPPWWFAKLWDKNISPF 286
           +VAHS+GAYL A YA K P HF+KL+MCSPAGV  S+ +     PPWW+ KLWD N SPF
Sbjct: 249 IVAHSLGAYLMAQYAFKFPSHFQKLIMCSPAGVTKSSIKKLNNSPPWWYEKLWDLNFSPF 308

Query: 287 SLVRNANVLGSKLTSGWSYRRLGQLLKDKVLNARQHEALHRYAYAIFNRKGSGEYLLSFA 346
           S+VRN+ + GSK+TS WSYRR   L     L+ +Q EALHRYAY+IFNR G GEYLLSF 
Sbjct: 309 SIVRNSGIYGSKITSAWSYRRFKPL----DLDHKQFEALHRYAYSIFNRPGCGEYLLSFI 364

Query: 347 LQCGGEPRVPLERRLFHNRGQQFKANCEWLWLYGDQDWIDRRGGERVSQFLTAEMGHESC 406
           L CGG PR  LE  LF       +  C+W W+YGD DW+D  G +RVS+ +  +   +S 
Sbjct: 365 LSCGGNPRFSLEDTLFQRENLSTEL-CDWGWIYGDNDWMDINGAKRVSRLINEQQKGKSD 423

Query: 407 VKIVKNSGHHLYLDNHRMFNKILEDEM 433
           V ++ ++GHHLYLDN++ FNK+L  EM
Sbjct: 424 VHVIPSAGHHLYLDNYKDFNKLLIKEM 450

>CAGL0L04686g Chr12 (539203..540558) [1356 bp, 451 aa] {ON} similar
           to uniprot|P53264 Saccharomyces cerevisiae YGR110w
          Length = 451

 Score =  406 bits (1043), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 210/444 (47%), Positives = 274/444 (61%), Gaps = 31/444 (6%)

Query: 16  IRSAADQLSNLQLRRLRIRPLEIKNQVPNTSYHPKPSSPSAIPLNEIILKLPNLFPRSLE 75
            R+ A +L  L+L  L  +  E+  +  +   H   ++P+A PL EI+  LP LFPRSL 
Sbjct: 11  FRNVASKL--LRLSSLGEKSSEVVGKDGSAIIHA--TAPTAKPLYEIVRDLPRLFPRSLA 66

Query: 76  QSARDFKDFKLNAGALQSELLATLPFFPAGDSRRTAEIIRTTVDAQGNYINEFNIRPTAV 135
           +S RD+  F  N   +Q ELL TLPFF      + A + +T +D+ GNYINE  I P  V
Sbjct: 67  ESKRDYATFHSNVDLMQLELLRTLPFFERTGYNKRAYLRKTEIDSDGNYINELVIEPANV 126

Query: 136 DTSKTMKHLILVHGYGAGLGFFLKTFENLNLINENWMIHAIDLPGYGFSSRPPFPFKVGD 195
           D +K  K LI VHGYGAGLGF+LK +E+L L++++W IHAIDLPGYGFSSR  FPF+   
Sbjct: 127 DPNKKRKRLIFVHGYGAGLGFYLKNYEHLPLLDDSWSIHAIDLPGYGFSSRMDFPFQFPR 186

Query: 196 STPAQVEQWFHSRFHRWMERRGLLETPENNMVVAHSMGAYLTALYANKHPGHFKKLVMCS 255
              + V  WF SR     E+RG  ++  +N+V+AHSMGAYL A Y NK+P   KK+VMCS
Sbjct: 187 DDTSVVCDWFISRLRTLFEKRGFDKS--DNIVMAHSMGAYLMAFYLNKYPDSVKKMVMCS 244

Query: 256 PAGVCHSAPEMRKRPP-----------------PWWFAKLWDKNISPFSLVRNANVLGSK 298
           PAG+  S   +                      PWW+ KLWD+NISPF LVR   +LGSK
Sbjct: 245 PAGISRSQYSINNNITEDISSGKEEIKLKIKKVPWWYTKLWDRNISPFVLVRKTGILGSK 304

Query: 299 LTSGWSYRRLGQLLKDKVLNARQHEALHRYAYAIFNRKGSGEYLLSFALQCGGEPRVPLE 358
           +TSGW+YRR   +L +K  N  Q E LHRY++AIFN KGSGEYLLSF L+CGG+PR PLE
Sbjct: 305 ITSGWTYRRFKPILLNKENNYEQFEKLHRYSFAIFNMKGSGEYLLSFVLECGGDPRSPLE 364

Query: 359 RRLFHNRGQQF--------KANCEWLWLYGDQDWIDRRGGERVSQFLTAEMGHESCVKIV 410
             LF +   +F         ++CEW+W+YG  DW+D  G ERV++        +S V  +
Sbjct: 365 NSLFSSDANKFGIDNAGIKNSSCEWVWVYGANDWMDIHGAERVTKDFLMNNRKKSRVVTI 424

Query: 411 KNSGHHLYLDNHRMFNKILEDEMR 434
             SGHHLY DN+ MFN +L DEM+
Sbjct: 425 PESGHHLYFDNYPMFNSLLIDEMK 448

>KLLA0B12914g Chr2 (1126975..1128255) [1281 bp, 426 aa] {ON} similar
           to uniprot|P53264 Saccharomyces cerevisiae YGR110W
          Length = 426

 Score =  390 bits (1001), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 194/385 (50%), Positives = 258/385 (67%), Gaps = 16/385 (4%)

Query: 50  KPSSPSAIPLNEIILKLPNLFPRSLEQSARDFKDFKLNAGALQSELLATLPFFPAGDSRR 109
           K ++P  +PL +I+  L  LFP S  +S +D+K + +N    Q +LL+ LP++P   +R 
Sbjct: 56  KSTAPIGLPLLQIVTNLHKLFPLSFAESLKDYKQYNINKEQFQEDLLSVLPYYPEPSARF 115

Query: 110 TAEIIRTTVDAQGNYINEFNIRPTAVDTS-KTMKHLILVHGYGAGLGFFLKTFENLNLIN 168
           +++II+T +DA GNYINEF I P   ++  K +KH+ILVHGYGAGLGF+LK F  L  ++
Sbjct: 116 SSKIIKTPIDAAGNYINEFQITPIRPESDGKPLKHIILVHGYGAGLGFYLKNFNAL--LS 173

Query: 169 ENWMIHAIDLPGYGFSSRPPFPFKVGDSTPAQVEQWFHSRFHRWMERRGLLETPENNMVV 228
           EN ++HAIDLPGYGFSSRP FPF     +   VE +FH   H+W +++GL+   ENN V+
Sbjct: 174 ENVVVHAIDLPGYGFSSRPMFPFHYPKDSYLAVEDYFHDALHKWFDKKGLISCWENNYVI 233

Query: 229 AHSMGAYLTALYANKHPGHFKKLVMCSPAGVCHSAPEMRKRPPPWWFAKLWDKNISPFSL 288
           AHSMGAY+ +LYANK+  HFKKL MCSP G+  +       PPPWWF KLWD+NISPFSL
Sbjct: 234 AHSMGAYIFSLYANKYK-HFKKLFMCSPGGISRNK---DMPPPPWWFLKLWDQNISPFSL 289

Query: 289 VRNANVLGSKLTSGWSYRRLGQLLKDKVLNARQHEALHRYAYAIFNRKGSGEYLLSFALQ 348
           VRNA  +GSKL SGW+ RR G       L+    + LH Y Y IFN+ GSGEY+LSF L 
Sbjct: 290 VRNAGHVGSKLVSGWTARRFG-------LHHPNFDKLHHYTYGIFNQPGSGEYMLSFMLG 342

Query: 349 CGGEPRVPLERRLFHNRGQQFKANCEWLWLYGDQDWIDRRGGERVSQFLTAEMGHESCVK 408
           CGG PRVPLE RLF        ++ +W+WLYGD DW+D  G  R++ FL  +  + + ++
Sbjct: 343 CGGWPRVPLETRLFTEENFN-SSHLDWVWLYGDSDWMDINGARRINDFLRKKCIN-TKLE 400

Query: 409 IVKNSGHHLYLDNHRMFNKILEDEM 433
           IV N+GHHLY DN   FN +L  E+
Sbjct: 401 IVPNAGHHLYWDNDSFFNNVLRKEL 425

>TBLA0F03460 Chr6 (853280..854605) [1326 bp, 441 aa] {ON} 
          Length = 441

 Score =  348 bits (893), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 187/404 (46%), Positives = 245/404 (60%), Gaps = 29/404 (7%)

Query: 50  KPSS-PSAIPLNEIILKLPNLFPRSLEQSARDFKDFKLNAGALQSELLATLPFFPA---- 104
           KPS+ P A  L +I+  LP LFPRS+  S RD+  FK N    Q  LL+ L F+P+    
Sbjct: 43  KPSTAPKAASLPQILRNLPRLFPRSMTDSIRDYSQFKTNPEFFQDRLLSQLSFYPSLYNN 102

Query: 105 -------GDSRRTAEIIRTTVDAQGNYINEFNIRPTAVDTSKTMKHLILVHGYGAGLGFF 157
                   D  R  +II+T V+ +  YINEF I P        +KHLIL+HGYGAGLGF+
Sbjct: 103 NSNDTSGNDDPRQGQIIKTYVN-ENEYINEFQILPNTSTPYDRLKHLILIHGYGAGLGFY 161

Query: 158 LKTFENLNLINENWMIHAIDLPGYGFSSRPPFPFKVGDS---TPAQVEQWFHSRFHRWME 214
           + T ++L++  +NW IHA+DLPGYGFSSR  FP+   +    +   V  WF  R   W  
Sbjct: 162 INTLQHLSM--DNWCIHAVDLPGYGFSSRLKFPYGTINPRIYSKKDVLDWFQKRLKTWFH 219

Query: 215 RRGLLETPENNMVVAHSMGAYLTALYANKHPGHFKKLVMCSPAGVCHSAPEMRKRPPPWW 274
           ++GLL  PENN+V AHSMGAY+   Y N HP  F+K++MCSPAG   ++  +     P W
Sbjct: 220 KKGLLAHPENNLVTAHSMGAYIMCHYLNNHPSDFRKIIMCSPAGFYPASNPLTNI--PLW 277

Query: 275 FAKLWDKNISPFSLVRNANVLGSKLTSGWSYRRLGQLLKDKVLNARQHEALHRYAYAIFN 334
           +  LWD+N SPFSLVR +  LGSKLTSGWSY R      ++ ++     ALH YAY+IFN
Sbjct: 278 YTYLWDRNYSPFSLVRISGPLGSKLTSGWSYSRF--FHSNQTISNELSLALHTYAYSIFN 335

Query: 335 RKGSGEYLLSFALQCGGEPRVPLERRLF-----HNRGQQFKANCEWLWLYGDQDWIDRRG 389
             GSGEY LS  L+ GG+PR PL+   F      N G + ++N E+ WLYG  DWI++ G
Sbjct: 336 LPGSGEYSLSHILKAGGDPRTPLQEEFFTCQSTTNNGIR-RSNVEYSWLYGQSDWINKTG 394

Query: 390 GERVSQFLTAEMGHESCVKIVKNSGHHLYLDNHRMFNKILEDEM 433
           G ++SQFL + +  +S V I  NSGHHLY DN+  FN  L  EM
Sbjct: 395 GFKISQFLNS-LNKKSNVFIAPNSGHHLYFDNYMWFNSYLAKEM 437

>KLTH0C01254g Chr3 complement(113435..114739) [1305 bp, 434 aa] {ON}
           conserved hypothetical protein
          Length = 434

 Score =  196 bits (498), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 133/408 (32%), Positives = 192/408 (47%), Gaps = 80/408 (19%)

Query: 85  KLNAGALQSELLATLPFFPAGDSRRTAEIIRTTVDAQGNYINEFNIRPTAVDTSKTMKHL 144
           + +A   + +LL+TL FFP GDS R  E++   +     +I+EF+I+     +    K L
Sbjct: 36  RADAKENEKKLLSTLEFFPGGDSIRNCELLDVDI-GNKQHIHEFSIQNIESCSRDYCKDL 94

Query: 145 ILVHGYGAGLGFFLKTFENLNLINENWMIHAIDLPGYGFSSRPPFP--------FKVGDS 196
           ++VHGYGA LG F++ F+ L+ I     +HA+D+ G G SSRP FP         K G  
Sbjct: 95  VMVHGYGAALGLFVRNFDGLSRI-PGINLHALDMLGCGLSSRPRFPGTGLISSVIKRGRV 153

Query: 197 TPAQV---EQWFHSRFHRWMERRGLLETPENNMVVAHSMGAYLTALYANKHPGHFKKLVM 253
           T  +V   E +F     +W ++R L    +  ++V HS+G YL+  YA K P   +KLV+
Sbjct: 154 TKEEVYEAENFFIDSLEKWRQQRKL----DKFVLVGHSLGGYLSCCYALKFPERVEKLVL 209

Query: 254 CSPAGVCHS------------------APEMRK-------RPP----------------- 271
            SP GV  S                   P++ K       RP                  
Sbjct: 210 VSPVGVEKSVFDLTKEHTPSHNNASELGPDLSKEVTNSSGRPTTDDPVKTSSSFHVPDEA 269

Query: 272 ---------PWWFAKLWDKNISPFSLVRNANVLGSKLTSGWSYRRLGQLLKDKVLNARQH 322
                    PW F+ +W  NISPF L+R+A   G  L+S WS+RR          N  Q 
Sbjct: 270 GNVERVPNMPWIFSSMWTYNISPFGLLRSAGPAGPLLSSRWSFRRFSF-----AENTEQL 324

Query: 323 EALHRYAYAIFNRKGSGEYLLSFALQCGGEPRVPLERRLFHNRGQQFKANCEWLWLYGDQ 382
              H Y Y+IF+  GSGEY L+  L  G   RVPL  R+  N        C+  W+YG  
Sbjct: 325 LTFHEYCYSIFSGSGSGEYALTRILAPGVLARVPLLSRVPEN------LKCDSFWMYGSH 378

Query: 383 DWIDRRGGERVSQFLTAEMGH-ESCVKIVKNSGHHLYLDNHRMFNKIL 429
           DW+ +  G  + + +    G  ++   +V ++GHHLYLDN   FN+ L
Sbjct: 379 DWMSKEAGSVIVRQINKTKGSVKADYSVVSDAGHHLYLDNPEEFNQKL 426

>Kwal_14.985 s14 complement(142781..144088) [1308 bp, 435 aa] {ON}
           YDR125C (ECM18) - (putative) involved in cell wall
           biogenesis [contig 244] FULL
          Length = 435

 Score =  186 bits (471), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 129/408 (31%), Positives = 187/408 (45%), Gaps = 80/408 (19%)

Query: 85  KLNAGALQSELLATLPFFPAGDSRRTAEIIRTTVDAQGNYINEFNIRPTAVDTSKTMKHL 144
           K NA   + +LL+TL FFP GDS R  +I+   +      I+E  I      +      L
Sbjct: 37  KSNARENEKQLLSTLEFFPQGDSTRKCKILDVDI-GDKQTIHELEIENLKTSSRSYANDL 95

Query: 145 ILVHGYGAGLGFFLKTFENLNLINENWMIHAIDLPGYGFSSRPPFP--------FKVGDS 196
           +LVHGYGA LG F++ F+ L+ +     +HAID+ G G SSRP FP         K G+ 
Sbjct: 96  VLVHGYGAALGLFVRNFDGLSSV-PGIKLHAIDMLGCGLSSRPKFPGTGLISSLIKRGNV 154

Query: 197 TPAQV---EQWFHSRFHRWMERRGLLETPENNMVVAHSMGAYLTALYANKHPGHFKKLVM 253
           T  +V   E +F     +W ++R +    E  ++V HS+G YL++ YA K+P   +KLV+
Sbjct: 155 TKEEVYEAEDFFVDSMEKWRKKRQV----EKFVLVGHSLGGYLSSCYALKYPERVEKLVL 210

Query: 254 CSPAGVCHS----------------------APEMRKRPP-------------------- 271
            SP GV  S                      A E+   P                     
Sbjct: 211 VSPVGVEKSIFDLTHEHTESHKGAAELGPDVAKEITNNPDKPTTDNPVKNSSSFHVPDEH 270

Query: 272 ---------PWWFAKLWDKNISPFSLVRNANVLGSKLTSGWSYRRLGQLLKDKVLNARQH 322
                       F+ +W  NISPF ++R    +G  ++S WS+RR      D   + +Q 
Sbjct: 271 GMVERVPNMSRIFSYMWTYNISPFGILRTLGPVGPLISSNWSFRRFS--FTD---DPKQL 325

Query: 323 EALHRYAYAIFNRKGSGEYLLSFALQCGGEPRVPLERRLFHNRGQQFKANCEWLWLYGDQ 382
              H Y Y +F+  GSGEY L+  L  G   R+PL  R+  N        C+  W+YG Q
Sbjct: 326 LTFHEYCYGVFSGAGSGEYALTRILAPGVLARLPLLSRMPGN------LKCDSFWMYGSQ 379

Query: 383 DWIDRRGGERVSQFLTAEMG-HESCVKIVKNSGHHLYLDNHRMFNKIL 429
           DW+ +  G  + + L    G  ++   IV ++GHHLYLDN   FN+ L
Sbjct: 380 DWMSKEAGSVMVKKLNESPGLGKADFSIVSDAGHHLYLDNPEEFNRKL 427

>SAKL0G19074g Chr7 (1646858..1648156) [1299 bp, 432 aa] {ON}
           conserved hypothetical protein
          Length = 432

 Score =  180 bits (457), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 131/413 (31%), Positives = 186/413 (45%), Gaps = 82/413 (19%)

Query: 81  FKDFKLNAGALQSE--LLATLPFFPAGDSRRTAEIIRTTVDAQGNYINEFNIRPTAVDTS 138
           FK +K  +   +SE  +L+ L F+P GD  R  E +   +   GN I+EF I  T     
Sbjct: 32  FKTWKHASSLRESEENILSMLDFYPEGDESRRCETMDVDI-GTGNSIHEFCIENTKESDR 90

Query: 139 KTMKHLILVHGYGAGLGFFLKTFENLNLINENWMIHAIDLPGYGFSSRPPFP-------- 190
              + ++LVHGYGA LG F++ F+ L+ I     +HAID+ GYG SSRP FP        
Sbjct: 91  DYCRDMVLVHGYGAALGLFIRNFDGLSQI-PGIRLHAIDMLGYGLSSRPKFPDTGFLTSF 149

Query: 191 FKVGDSTPAQV---EQWFHSRFHRWMERRGLLETPENNMVVAHSMGAYLTALYANKHPGH 247
           +K  + T   V   E +F      W  +R L    +  ++V HS+G YL+  YA K+P  
Sbjct: 150 WKKREVTKEDVLLAEDFFIDSIETWRHKRHL----DKFVLVGHSLGGYLSCRYALKYPER 205

Query: 248 FKKLVMCSPAGVCHS----------------------APEMRKRPP-------------- 271
            +KL++ SP GV  S                      A E++  P               
Sbjct: 206 VEKLILVSPVGVETSIFDLTKEHTATHEHAAELGPDIAQELKVVPENSTTDKPVQPSSSF 265

Query: 272 ---------------PWWFAKLWDKNISPFSLVRNANVLGSKLTSGWSYRRLGQLLKDKV 316
                          P     +W+ NISPF ++R+    G  L S WS+RR         
Sbjct: 266 HVPNESGHVERIPNLPKIVRIIWENNISPFGILRSLGPWGPLLCSRWSFRRFSH-----C 320

Query: 317 LNARQHEALHRYAYAIFNRKGSGEYLLSFALQCGGEPRVPLERRLFHNRGQQFKANCEWL 376
            +  Q    H YAY  FN +GSGEY L+  L  G   R+PL      N        CE L
Sbjct: 321 GDKEQVMKFHDYAYNTFNARGSGEYALTRILAPGVLARIPLLSCAPKN------LKCESL 374

Query: 377 WLYGDQDWIDRRGGERVSQFLTAEMGHESCVKIVKNSGHHLYLDNHRMFNKIL 429
           W+YG  DW+ +  G  + + L  + G+ +   +V ++GHHLYLDN   FN+ L
Sbjct: 375 WMYGSHDWMSKEAGSVIVKELN-KAGNTADYSVVSDAGHHLYLDNPHEFNQKL 426

>Ecym_5577 Chr5 (1185997..1187298) [1302 bp, 433 aa] {ON} similar to
           Saccharomyces cerevisiae YGR110W
          Length = 433

 Score =  164 bits (415), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 133/416 (31%), Positives = 192/416 (46%), Gaps = 81/416 (19%)

Query: 81  FKDFKLNAGALQSE--LLATLPFFPAGDSRRTAEIIRTTVDAQGNYINEFNIRPTAVDTS 138
           FK +K +A   ++E  +L  L F+P GDS RT E++   +   G+Y++EF I      T 
Sbjct: 28  FKTWKSSARLHEAEDNVLRMLSFYPDGDSERTCEVLHVDIGG-GDYMHEFCIENKLPMTR 86

Query: 139 KTMKHLILVHGYGAGLGFFLKTFENLNLINENWMIHAIDLPGYGFSSRPPFP-------- 190
            T K ++LVHGYG  LG F++ F+ L+ I     +HAID+ GYG SSRP FP        
Sbjct: 87  DTCKDIVLVHGYGTALGVFIRNFDELSQI-PGVRLHAIDMLGYGLSSRPRFPRSGFWDYY 145

Query: 191 FKVGDSTPAQVEQ---WFHSRFHRWMERRGL-------------------LETPE--NNM 226
            K    T  QVE+   +F      W E+R +                   L  PE  + +
Sbjct: 146 VKGKVVTKEQVEEALAFFVDSLEAWREKRNVDSFVLVGHSLGGYLSSFYALRHPERIDKL 205

Query: 227 VVAHSMGAYLTALY--------ANKHPGHFKKLVMC------------------SPAGVC 260
           V+   +G   T++Y         ++H G     V                    SP    
Sbjct: 206 VLVSPVGVE-TSIYDLTAEHTPEHQHAGQLGPEVASEFKEDATEHTTDLSIDSNSPQSSS 264

Query: 261 HSAPEMR---KRPP--PWWFAKLWDKNISPFSLVRNANVLGSKLTSGWSYRRLGQLLK-D 314
              P  +   +  P  PW    LW+ N+SPFSL+R    LG K+ + WS+RR G     +
Sbjct: 265 LHIPNEKGFVEHVPNIPWLVKMLWNTNVSPFSLLRLLGPLGPKICANWSFRRFGACKDTN 324

Query: 315 KVLNARQHEALHRYAYAIFNRKGSGEYLLSFALQCGGEPRVPLERRLFHNRGQQFKANCE 374
           +++N       H+YAY  F  KGSGEY +   L  G   RVPL  +L           C+
Sbjct: 325 ELMN------FHQYAYNNFKAKGSGEYAMMKILAPGALARVPLLSQL------PGALKCD 372

Query: 375 WLWLYGDQDWIDRRGGERVSQFLTAEMGHESCVKIVKNSGHHLYLDNHRMFNKILE 430
            LW+YG  DW+ +  G  + + L  +  + +  KIV N+GHHLYLDN   FN+ L+
Sbjct: 373 SLWMYGSNDWMSKEAGCIIVEELQEKSDYRAEYKIVNNAGHHLYLDNPEEFNRELK 428

>Skud_12.167 Chr12 complement(322870..324054) [1185 bp, 394 aa] {ON}
           YLR099C (REAL)
          Length = 394

 Score = 75.5 bits (184), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 90/347 (25%), Positives = 140/347 (40%), Gaps = 80/347 (23%)

Query: 138 SKTMKHLILVHGYGAGLGFFLKTFENLNLINENWMIHAIDLPGYGFSSRP---------- 187
           SK     +L+HGY A    F +TFE+L+   ++  ++AIDLP  G S  P          
Sbjct: 67  SKVCTPTVLIHGYAASSMAFYRTFESLSDNIKD--LYAIDLPANGASQAPALQVDKTKKI 124

Query: 188 -PFPFK---------VGDSTP---------AQVEQWFHSRFHRWMERRGLLETPENNMVV 228
            P  FK         V D  P          Q E +F  R  +W +   L        VV
Sbjct: 125 KPLRFKHIEDDVVVPVLDKHPPAEDIKSHLEQYENYFVDRIEQWRKDNKLRRI----NVV 180

Query: 229 AHSMGAYLTALYANKHPGHFKKLVMCSPAGVCHSAPEMRKRPPP--------------WW 274
            HS G Y++  YA K+P    KL + SP GV +S   +  +  P              ++
Sbjct: 181 GHSFGGYISFKYALKYPNSIDKLCLISPLGVENSIHAIAHKWEPNTTYPLTFTDPSSRYY 240

Query: 275 FAKLWDKNISPFSLVRNANVL------GSKLTSGW---SYRRL-GQLLKDKVLNA--RQH 322
             KL   N+  F      NVL      GSKL S +   +Y ++  QL KD +L++   ++
Sbjct: 241 TRKL---NVPQFIFENQLNVLKWMGPIGSKLCSNYISTAYVKVPDQLYKDYLLHSFVGKN 297

Query: 323 EALHRYAYAIFNRKGSGEYLLSFALQCGGEPRVPLERRLFHNRGQQFKANCEWLWLYGDQ 382
           + +      +F       +L           R  + R    N           +++YG+ 
Sbjct: 298 QTVQPQTIKVFT------HLFE---------RNLIARDPIINNVGLLNPATHVMFMYGEH 342

Query: 383 DWIDRRGGERVSQFLTAEMGHESCVKIVKNSGHHLYLDNHRMFNKIL 429
           DW+D+  G   ++ +       S V+ V ++GH+L+LDN   F   L
Sbjct: 343 DWMDKYAGYLTTESMLKNKAKASYVE-VPDAGHNLFLDNPHHFTSSL 388

>KNAG0G02140 Chr7 complement(484440..485666) [1227 bp, 408 aa] {ON} 
          Length = 408

 Score = 75.1 bits (183), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 91/365 (24%), Positives = 142/365 (38%), Gaps = 75/365 (20%)

Query: 125 INEFNIRPTAVDTSKTMKHL--ILVHGYGAG-LGFFLKTFENLNLINENWMIHAIDLPGY 181
           INE+ ++ +  D  +   H   +L+HGY A  + F L      N  ++   +  +DLP  
Sbjct: 63  INEWRLQNSG-DADRIAVHTPTVLIHGYAASSMAFHLNVAGLSNAFSD---LCVVDLPAN 118

Query: 182 GFSSRPPF----------------------------PFKVGDS----TPAQVEQWFHSRF 209
           G S  PP                             P K+  S     P   E +F  R 
Sbjct: 119 GLSREPPMLGPKVKGQPVHWKELDKKTGSLTVVCEPPSKMSSSGVLDDPGVYEDYFVDRI 178

Query: 210 HRWMERRGLLETPENNMVVAHSMGAYLTALYANKHPGHFKKLVMCSPAGVCHSAPEMRKR 269
            +W    G     +N  VV HS G Y++  YA K+  H  KLV+ SP GV  +   +  +
Sbjct: 179 EKWRLAHGF----DNINVVGHSFGGYMSFKYAIKYSKHVDKLVLLSPLGVERNIDSVSNK 234

Query: 270 PPPWWFAKLWD----KNISPFSLVRNANVLGSKLTSGWSYRR----LGQLLKDKVLNAR- 320
              W   K +D       SP    R   V G    +  +  R    LG  +  + + +R 
Sbjct: 235 ---WDVGKTYDLTDIDATSPL-YYRPFTVPGYLFNNQLNVLRKMGPLGNHMAKRAIASRY 290

Query: 321 -------QHEALHRYAYA--IFNRKGSGEYLLSFALQCGGEPRVPLERRLFHNRGQQFKA 371
                   H  LH   Y    F       +   F  Q        L R    +  Q+ K 
Sbjct: 291 SNVPGTAYHAYLHHVFYGAHTFPSANITAFTHLFTRQL-------LARDPLLDNIQRLKV 343

Query: 372 NCEWLWLYGDQDWIDRRGGERVSQFLTAE--MGHESCVKIVKNSGHHLYLDNHRMFNKIL 429
           N + + +YGD DW+++  G  + Q +  E  +  ++    + ++GH+L+LDN   FNK+L
Sbjct: 344 N-KLMMVYGDHDWMNKEAGYGMVQEINKERYVPAKAVYAELPSAGHNLFLDNPSGFNKLL 402

Query: 430 EDEMR 434
            D +R
Sbjct: 403 IDFLR 407

>Kpol_543.49 s543 complement(108945..110234) [1290 bp, 429 aa] {ON}
           complement(108945..110234) [1290 nt, 430 aa]
          Length = 429

 Score = 75.1 bits (183), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 86/339 (25%), Positives = 136/339 (40%), Gaps = 79/339 (23%)

Query: 145 ILVHGYGAGLGFFLKTFENLNLINENWMIHAIDLPGYGFSSRPPFPFK------------ 192
           +L+HGY A    + +TF  L+   +N  ++AIDLP +G S+ PP  FK            
Sbjct: 103 LLIHGYAASSLAYFRTFSGLSDKIKN--LYAIDLPSFGLSNAPPLDFKEKVSDIKIKLSD 160

Query: 193 ------VGDST----------PAQVEQWFHSRFHRWMERRGLLETPENNMVVAHSMGAYL 236
                 + DS             + E ++  +   W +   L    E   +V HS G Y+
Sbjct: 161 DNTKFKISDSNRVDSLDLKKLIGKYEDYYVEKIEDWRKANKL----EKINLVGHSFGGYI 216

Query: 237 TALYANKHPGHFKKLVMCSPAGV---CHSA----------PEMRKRPPPWWFAKLWDKNI 283
           +  YA K+P    +L + SP G+    HS           P   + P   ++AK  ++ I
Sbjct: 217 SFKYAIKYPDAINRLCLVSPLGMESNIHSVNNNFETKKEYPLDLEDPSSRFYAK--ERRI 274

Query: 284 SPFSLVRNANVL------GSKLTSGW---SYRRLGQLLKDKVLNARQHEALHRYAYAIFN 334
             F      NVL      GSKL   +   SYRR+   L               Y + +  
Sbjct: 275 PNFLFKNQLNVLRWMGPIGSKLCWNYINASYRRVPNPL------------FKEYLFELLY 322

Query: 335 RKGSGEYLLSFALQCGGEPRVPLERRLFHNRGQQFKANCEWLWLYGDQDWIDRRGGERVS 394
            KG G   ++  +      R  L R    +   + KA  + L LYG+ DW++   G  + 
Sbjct: 323 GKG-GMPSVTIDIFTNLFTRSLLARDPIMDSISKLKAE-KVLLLYGEHDWMNNLAGYNMV 380

Query: 395 QFLTAEMGHESCVKI-------VKNSGHHLYLDNHRMFN 426
           + L     + +   I       V ++GH+L+LDN + FN
Sbjct: 381 ESLNQLKPNNNISTIDYANYVEVPDAGHNLFLDNPQFFN 419

>Suva_10.183 Chr10 complement(344549..345733) [1185 bp, 394 aa] {ON}
           YLR099C (REAL)
          Length = 394

 Score = 73.6 bits (179), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 84/346 (24%), Positives = 137/346 (39%), Gaps = 78/346 (22%)

Query: 138 SKTMKHLILVHGYGAGLGFFLKTFENLNLINENWMIHAIDLPGYGFSSRPPFPFK----- 192
           SK     +L+HGY A    F +TF+NL+   ++  ++AIDLP  G S  P    +     
Sbjct: 67  SKVSTPTVLIHGYAASSMAFYRTFKNLSDNIKD--LYAIDLPANGASEAPALQVEGVKKI 124

Query: 193 ---------------VGDSTP---------AQVEQWFHSRFHRWMERRGLLETPENNMVV 228
                          V D  P          Q E +F  R  +W +   L +      VV
Sbjct: 125 KSLRFKHVEDDMVTPVLDKRPPAEEIKSHLEQYESYFVDRIEQWRKDNNLRKIN----VV 180

Query: 229 AHSMGAYLTALYANKHPGHFKKLVMCSPAGVCHSA-------------PEMRKRPPPWWF 275
            HS G Y++  YA K+P    KL + SP GV +S              P     P   ++
Sbjct: 181 GHSFGGYISFKYALKYPNSIDKLCLISPLGVENSIHAINHKWEANTTYPVTFTDPSSRYY 240

Query: 276 AKLWDKNISPFSLVRNANVL------GSKLTSGW---SYRRL-GQLLKDKVLNA--RQHE 323
            +    N+  F      NVL      GSKL S +   +Y ++  QL KD +L++   +++
Sbjct: 241 TR--KLNVPQFIFENQLNVLKWMGPIGSKLCSSYISTAYVKVPDQLYKDYLLHSFVGKNQ 298

Query: 324 ALHRYAYAIFNRKGSGEYLLSFALQCGGEPRVPLERRLFHNRGQQFKANCEWLWLYGDQD 383
           ++      +F +                  R  + R    N           +++YG+ D
Sbjct: 299 SVQPQTIKVFTQLFE---------------RNLIARDPIINNVGLLNPATHVMFMYGEHD 343

Query: 384 WIDRRGGERVSQFLTAEMGHESCVKIVKNSGHHLYLDNHRMFNKIL 429
           W+D+  G   ++ +       S ++ V ++GH+L+LDN   F   L
Sbjct: 344 WMDKYAGYLTTESMLKNKAKASYME-VPDAGHNLFLDNPNHFTSSL 388

>YLR099C Chr12 complement(339744..340928) [1185 bp, 394 aa] {ON}
           ICT1Lysophosphatidic acid acyltransferase, responsible
           for enhanced phospholipid synthesis during organic
           solvent stress; null displays increased sensitivity to
           Calcofluor white; highly expressed during organic
           solvent stress
          Length = 394

 Score = 73.6 bits (179), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 83/336 (24%), Positives = 138/336 (41%), Gaps = 80/336 (23%)

Query: 145 ILVHGYGAGLGFFLKTFENLNLINENWMIHAIDLPGYGFSSRPPF--------------- 189
           +L+HGY A    F +TFENL+   ++  ++AIDLP  G S  P                 
Sbjct: 74  VLIHGYAASSMAFYRTFENLSDNIKD--LYAIDLPANGASEAPALQVNKTKKIKSLRFKH 131

Query: 190 --------------PFKVGDSTPAQVEQWFHSRFHRWMERRGLLETPENNMVVAHSMGAY 235
                         P +   S   Q E +F  R  +W +   L +      VV HS G Y
Sbjct: 132 IEDDVVIPVIEKRPPAEDIKSHLEQYESYFVDRIEQWRKDNKLRKI----NVVGHSFGGY 187

Query: 236 LTALYANKHPGHFKKLVMCSPAGVCHSAPEMRKRPPP--------------WWFAKLWDK 281
           ++  YA K+P   +KL + SP GV +S   +  +  P              ++  KL   
Sbjct: 188 ISFKYALKYPDSIEKLCLISPLGVENSIHAITHKWEPNTTYPLTFTDPSSRYYTRKL--- 244

Query: 282 NISPFSLVRNANVL------GSKLTSGW---SYRRL-GQLLKDKVLNA--RQHEALHRYA 329
           N+  F      NVL      GSKL S +   +Y ++  Q+ KD +L++   +++ +    
Sbjct: 245 NVPRFIFENQLNVLKWMGPIGSKLCSNYISTAYVKVPDQIYKDYLLHSFVGKNQTVQPQT 304

Query: 330 YAIFNRKGSGEYLLSFALQCGGEPRVPLERRLFHNRGQQFKANCEWLWLYGDQDWIDRRG 389
             +F       +L           R  + R    N  +        +++YG+ DW+D+  
Sbjct: 305 IKVFT------HLFE---------RNLIARDPIINNVRFLNPATPVMFMYGEHDWMDKYA 349

Query: 390 GERVSQFLTAEMGHESCVKIVKNSGHHLYLDNHRMF 425
           G   ++ +       S V+ V ++GH+L+LDN + F
Sbjct: 350 GYLTTESMLKNKAKASYVE-VPDAGHNLFLDNPQHF 384

>Smik_12.158 Chr12 complement(319660..320844) [1185 bp, 394 aa] {ON}
           YLR099C (REAL)
          Length = 394

 Score = 70.9 bits (172), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 84/332 (25%), Positives = 135/332 (40%), Gaps = 80/332 (24%)

Query: 145 ILVHGYGAGLGFFLKTFENLNLINENWMIHAIDLPGYGFSSRPPFP-----------FK- 192
           +L+HGY A    F +TFE+L+  N    ++AIDLP  G S  P              FK 
Sbjct: 74  VLIHGYAASSMAFYRTFESLS--NNIKDLYAIDLPANGASEAPVLQVDKTKKVKSLRFKH 131

Query: 193 --------VGDSTP---------AQVEQWFHSRFHRWMERRGLLETPENNMVVAHSMGAY 235
                   V D  P          Q E +F  R  +W +   L +      VV HS G Y
Sbjct: 132 IEDDVVIPVLDRRPPAEDIKSHLEQYENYFVDRIEQWRKDNKLRKIN----VVGHSFGGY 187

Query: 236 LTALYANKHPGHFKKLVMCSPAGVCHSAPEMRKRPPP--------------WWFAKLWDK 281
           ++  YA K+P    KL + SP GV +S   +  +  P              ++  KL   
Sbjct: 188 ISFKYALKYPNSIDKLCLISPLGVENSIHAITHKWEPNTTYPLTFTDPSSRYYTRKL--- 244

Query: 282 NISPFSLVRNANVL------GSKLTSGW---SYRRL-GQLLKDKVLNA--RQHEALHRYA 329
           N+  F      NVL      GSKL S +   +Y ++  Q+ KD +L++   +++ +    
Sbjct: 245 NVPRFIFENQLNVLKWMGPIGSKLCSNYISTAYVKVPDQIYKDYLLHSFVGKNQTVQPQT 304

Query: 330 YAIFNRKGSGEYLLSFALQCGGEPRVPLERRLFHNRGQQFKANCEWLWLYGDQDWIDRRG 389
             +F       +L    L         + R    N           +++YG+ DW+D+  
Sbjct: 305 IKVFT------HLFERNL---------IARDPIINNVGLLNPTMHVMFMYGEHDWMDKYA 349

Query: 390 GERVSQFLTAEMGHESCVKIVKNSGHHLYLDN 421
           G   ++ +       S ++ V ++GH+L+LDN
Sbjct: 350 GYLTTESMLKNKAKASYIE-VPDAGHNLFLDN 380

>KLTH0G13178g Chr7 (1131579..1132826) [1248 bp, 415 aa] {ON} similar
           to uniprot|Q04623 Saccharomyces cerevisiae YDR125C
          Length = 415

 Score = 70.5 bits (171), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 89/362 (24%), Positives = 149/362 (41%), Gaps = 82/362 (22%)

Query: 125 INEFNIRPTAVDTSKTMKHLILVHGYGAGLGFFLKTFENLNLINENWMIHAIDLPGYGFS 184
           +N+F+ + +  +        +L+HGY A    F + FE L+    +  ++AIDLP  G S
Sbjct: 83  VNQFHFQNSLAEIKTPT---LLLHGYAASSMAFHRNFEGLSKCIRD--LYAIDLPANGLS 137

Query: 185 SRPPFPFKVGDSTPAQVE---------------------QWFHSRFHRWMERRGLLETPE 223
              P   +  +  P ++E                     Q F   +   +E+  L     
Sbjct: 138 PPQPLEIRCTEPQPLKIEISNDTFKLPYTINSLHHKSAIQNFEDYYLDALEQWRLDNKLG 197

Query: 224 NNMVVAHSMGAYLTALYANKHPGHFKKLVMCSPAGVCH---------------------- 261
              +VAHS G Y++  YA K+P   K+L + SP GV                        
Sbjct: 198 PINIVAHSFGGYISFRYAVKYPHAVKRLCLLSPLGVERNIFSVNNNWRSNTQYKLDFENP 257

Query: 262 -SAPEMRKRP--PPWWFAKLWDKNISPFSLVRNANVLGSKLTSGW---SYRRLGQLLKDK 315
            S   +RK P  PP  F +L  K      ++R    LG++L   +   +Y R+  L   +
Sbjct: 258 ASKFYIRKGPAIPPAIF-ELQTK------VLRGLGPLGARLCWNYITAAYARVPSLKYKQ 310

Query: 316 VLNARQH--EALHRYAYAIFNRKGSGEYLLSFALQCGGEPRVPLERRLFHNRGQQFKANC 373
            +    +   AL + +  IF    +   L           R PL   L H R ++     
Sbjct: 311 YIFEMFYGKNALTQTSKDIFTGLFTNRLL----------ARDPLLDSLCHVRSKKL---- 356

Query: 374 EWLWLYGDQDWIDRRGG-ERVSQFLTAEMGHESCVKIVKNSGHHLYLDNHRMFNKILEDE 432
             L +YGD DW++R+ G E V++    ++G ++    V +SGH+L+LDN    N+++   
Sbjct: 357 --LLMYGDHDWMNRKAGLEMVTE--AKKLGIDAQYGEVSSSGHNLFLDNPEESNELIVSF 412

Query: 433 MR 434
           +R
Sbjct: 413 LR 414

>Kwal_56.23702 s56 complement(668862..670112) [1251 bp, 416 aa] {ON}
           YDR125C (ECM18) - (putative) involved in cell wall
           biogenesis [contig 174] FULL
          Length = 416

 Score = 68.6 bits (166), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 86/337 (25%), Positives = 138/337 (40%), Gaps = 78/337 (23%)

Query: 145 ILVHGYGAGLGFFLKTFENLNLINENWMIHAIDLPGYGFSSRPPFPFKVGDSTPAQV--- 201
           +LVHGY A    F + F  L+   ++  ++AIDLP  G S  P  P ++  + P  +   
Sbjct: 100 LLVHGYAASSMGFHRNFPGLSQSIKD--LYAIDLPASGLS--PALPLEMRCTQPLDLKIN 155

Query: 202 ------------------------EQWFHSRFHRWMERRGLLETPENNMVVAHSMGAYLT 237
                                   E ++     +W     L   P N  +VAHS G YL+
Sbjct: 156 MSKDTFSLPYTINYLHHKSLIQNYEDYYLDAIEQWRHDNKL--GPIN--IVAHSFGGYLS 211

Query: 238 ALYANKHPGHFKKLVMCSPAGVCHSAPEMRKR-------------PPPWWFAK------- 277
             YA K P   +KL + SP GV  +   +  +             P   ++ K       
Sbjct: 212 FKYAVKFPHAVEKLCLVSPLGVERNIFSVNNQWRSNTSYNLDFENPASKFYIKKGPAIPR 271

Query: 278 -LWDKNISPFSLVRNANVLGSKLTSGW---SYRRLGQLLKDKVLNARQHEALHRYAYAIF 333
            ++++      L+RN   LG+KL+  +   +Y R+  L               +Y + + 
Sbjct: 272 LVFEQQTQ---LLRNLGPLGAKLSWNYINAAYSRVPSL------------DYKKYVFELL 316

Query: 334 NRKGSGEYLLSFALQCGGEPRVPLERRLFHNRGQQFKANCEWLWLYGDQDWIDRRGG-ER 392
             K +G    S  L  G      L R    +  Q F  + + + +YGD DW++RR G E 
Sbjct: 317 YGK-NGLNQTSKDLFIGLFNNRVLARDPLLDSIQFFGKSAKLMCIYGDHDWMNRRAGMEM 375

Query: 393 VSQFLTAEMGHESCVKIVKNSGHHLYLDNHRMFNKIL 429
           V++    ++G E+    V +SGH+L+LDN   FN  L
Sbjct: 376 VNE--ANQLGIEAKYNEVSSSGHNLFLDNPEEFNDKL 410

>TDEL0F04100 Chr6 complement(756762..758066) [1305 bp, 434 aa] {ON}
           Anc_8.284 YDR125C
          Length = 434

 Score = 68.2 bits (165), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 92/380 (24%), Positives = 143/380 (37%), Gaps = 87/380 (22%)

Query: 112 EIIRTTVDAQGNYINEF-----------NIRPTAVDTSKTMKHLILVHGYGAGLGFFLKT 160
           ++I   VD  G   N+            N   TA+ T       +L+HGY A    + + 
Sbjct: 77  DLIMVNVDVAGTKDNQIVAHGINQWHFNNPAATAITTPT-----LLIHGYAASSMAYYRN 131

Query: 161 FENLNLINENWMIHAIDLPGYGFSSRPPFPFK----------------------VGDSTP 198
           F  L+    +  ++AIDLP  G S+  PF                         + +S  
Sbjct: 132 FTGLSQTVTD--LYAIDLPANGLSAEQPFKLNGDKPRSLKVKYLDNDKFSVQHVIDESGT 189

Query: 199 AQVEQWFHSRFHRWMERRGLLETPENNMVVAHSMGAYLTALYANKHPGHFKKLVMCSPAG 258
            Q+ Q   S +   +E    +   E   +V HS G YL+  YA K+P   +KL + SP G
Sbjct: 190 KQMIQQCESYYLDKIEEWRKVNKLEKINLVGHSFGGYLSFKYALKYPNSIEKLCLVSPLG 249

Query: 259 VCHSAPEMRKRPPPWWFAKLWDKNISPFSLVRNANVLGSKLTSGWSYRRLGQLLKDKVLN 318
           V  S   +  +          +KN       + A  L    ++ ++ RR       K + 
Sbjct: 250 VETSIYSVNNK---------LEKN------TKYALDLEDPTSNFYTRRR----EIPKFIF 290

Query: 319 ARQHEALH-----------RYAYAIFNRKGSGEYL-LSFALQCGGEPRVPLERRLFHNRG 366
             Q E L             Y  + ++R    EY    F L  G     P  R++F N  
Sbjct: 291 KNQSEILRWMGPLGAKMCWNYILSAYSRIPEMEYKSYIFELLYGKGGIAPTARQIFTNLF 350

Query: 367 Q--------------QFKANCEWLWLYGDQDWIDRRGGERVSQFLTAEMGHESCVKI-VK 411
                          Q +A  + L +YGD DW+++  G ++ + L     + S   I V 
Sbjct: 351 TRNLLAKDPIMDSLGQLQAK-KVLLVYGDHDWMNKYAGYKLVERLNTIRNNTSAQYIEVP 409

Query: 412 NSGHHLYLDNHRMFNKILED 431
            SGH+L+LDN   FN  L +
Sbjct: 410 ESGHNLFLDNPTFFNASLTE 429

>YDR125C Chr4 complement(701397..702758) [1362 bp, 453 aa] {ON}
           ECM18Protein of unknown function, similar to Rlp24p
          Length = 453

 Score = 67.8 bits (164), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 94/381 (24%), Positives = 153/381 (40%), Gaps = 100/381 (26%)

Query: 119 DAQGNYINEFNIRPTAVDTSKTMKHLILVHGYGAGLGFFLKTFENLNLINENWMIHAIDL 178
           D   N IN+++ +     T +T    +L+HGY A    F + +  L+    N  +++ID+
Sbjct: 106 DKLFNEINQWHFQNENTSTVRT--PTLLIHGYAASSMSFFRNYPGLSKHIRN--LYSIDM 161

Query: 179 PGYGFSSRPPFPFKVGDSTPAQVEQWF---------------HSRFHRWMERRGLLETPE 223
           P  G SS P    ++  +TP  ++  F               H++F   M     L+  E
Sbjct: 162 PASGLSSVPSL--EINTTTPLPLDIKFIGENKFKVPYTINANHNKFVIQMYEDFYLDRIE 219

Query: 224 -----NNM----VVAHSMGAYLTALYANKHPGHFKKLVMCSPAGV----------CHSAP 264
                N +    VV HS G YL+  YA K+P    KL + SP GV           HS  
Sbjct: 220 QWRIDNKLGKMNVVGHSFGGYLSFKYAVKYPNSVNKLCLVSPLGVERNIWSVNNNFHSNT 279

Query: 265 EMR---KRPPPWWFAKLWDKNISP-------FSLVRNANVLGSKLTSGWSYRRLGQLLKD 314
                 K P   +++K   +N+ P       F ++R    LG+KL   W+Y         
Sbjct: 280 LYTIDFKNPNSKFYSK---RNMIPKYLFEQQFHILRMMGPLGAKLC--WNYIMA------ 328

Query: 315 KVLNARQHEALHRYAYAIFNRKGSGEYLLSFALQCGGEPRVPLE--RRLFHN-------- 364
                         AY+        EY+       GG P V  +  + LF          
Sbjct: 329 --------------AYSRVPSLAYKEYIFELFYGKGGIPEVTTDIFKALFSRCILAKDPL 374

Query: 365 -RGQQFKANCEWLWLYGDQDWIDRRGGERVSQFLTAEMGH-ESCVK-----IVKNSGHHL 417
               Q+    + L +YG  DW++++ G     F+  E+ + ++C++      + +SGH+L
Sbjct: 375 MDSLQYLNVKKLLIVYGQYDWMNKKAG----MFMVKELNNLKNCLEGASYLEIPSSGHNL 430

Query: 418 YLDNHRMFNK----ILEDEMR 434
           +LDN   FN+     L DE +
Sbjct: 431 FLDNPESFNQSIVSFLSDETK 451

>AGR062C Chr7 complement(833212..834366) [1155 bp, 384 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR099C
           (ICT1) and YDR125C (ECM18)
          Length = 384

 Score = 66.2 bits (160), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 82/324 (25%), Positives = 119/324 (36%), Gaps = 60/324 (18%)

Query: 145 ILVHGYGAGLGFFLKTFENLNLINENWMIHAIDLPGYGFSSRPPF-PFKVGDSTPA---- 199
           +L+HGY +    F +    L    E   ++A+DLPG G S   P  P             
Sbjct: 86  VLLHGYASSAVSFHRNLAALGAQVEQ--LYALDLPGNGMSQELPLGPAAARALARRCGAR 143

Query: 200 ----QVEQWFHSRFHRWMERRGLLETPENNMVVAHSMGAYLTALYANKHPGHFKKLVMCS 255
                +  ++     RW    GL    E      HS G YL   YA +HP   ++L + S
Sbjct: 144 ADIRALADYYLDALERWRAANGL----ETLNAAGHSFGGYLAFKYALRHPARVQRLCLVS 199

Query: 256 PAGVCHSAPEMRKRP------------------------PPWWFAKLWDKNISPFSLVRN 291
           P GV  +    R+ P                        PP  F +          ++R 
Sbjct: 200 PLGV-EAQTAGRRMPGRATRRRTRPPTPASPHYTRAAALPPLLFEQ-------QLRVLRW 251

Query: 292 ANVLGSKLTSGWSYRRLGQLLKDKVLNARQHEALHRYAYAIFNRKGSGEYLLSFALQCGG 351
              LG+ L   W Y        +   +       HRY +A+ +R       L   L  G 
Sbjct: 252 LGPLGAHLL--WQY-------VNASFSRVPGREFHRYTFALLHRLALRP--LPRKLFTGL 300

Query: 352 EPRVPLERRLFHNRGQQFKANCEWLWLYGDQDWIDRRGGERVSQFLTAEMGH-ESCVKIV 410
                L R    +   + K     L LYGD DW+D R G  +   L A  G  ++ + IV
Sbjct: 301 FTNALLARDPLLDSLAELKVPNVQL-LYGDHDWMDARAGRALVAELNALRGRPDASLAIV 359

Query: 411 KNSGHHLYLDNHRMFNKILEDEMR 434
             +GH+L+LDN   F+  L D +R
Sbjct: 360 PAAGHNLFLDNPEDFHSWLLDFLR 383

>TPHA0A01690 Chr1 (344521..345738) [1218 bp, 405 aa] {ON} Anc_8.284
           YDR125C
          Length = 405

 Score = 65.9 bits (159), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 99/410 (24%), Positives = 158/410 (38%), Gaps = 99/410 (24%)

Query: 90  ALQSELLATLPFFPAGDSRRTAEIIRTTVDAQGNYINEFNIRPTAVDTSKTMKHLILVHG 149
            LQ E+++ + F   GD       + TT     + IN+++    AV+        +LVHG
Sbjct: 19  TLQDEIVSNIEF--HGD-------VTTTNTMLFDEINQWHFHNNAVNGDLIETPTLLVHG 69

Query: 150 YGAGLGFFLKTFENLNLINENWMIHAIDLPGYGFSSRPPFP-------FKVGDST----- 197
           Y      + + F  L+   ++  +++IDLP +G S  P  P        KV  S      
Sbjct: 70  YATSSLAYYRNFAGLSSYIKD--LYSIDLPTFGLSKTPELPTRKVTKNLKVTLSNSNDKS 127

Query: 198 --PAQVEQWFHSRFH------RWMERRGLLETPENNMV-----------------VAHSM 232
             P ++  +  S+         + E +  LE  EN  +                 V HS 
Sbjct: 128 DDPKKITSFQLSKDDIKHNEKYYNETKKELEINENYYIDRIEKWRIENKLDKINLVGHSF 187

Query: 233 GAYLTALYANKHPGHFKKLVMCSPAGVCHSAPEMRKR-------------PPPWWFAKLW 279
           G YL+  YA K+P   +KL + SP G+  +   +  +             P   +F    
Sbjct: 188 GGYLSYKYATKYPDSIEKLCLVSPLGMESNIYSINNKFENDKIYEIEEEDPSSIFFTNT- 246

Query: 280 DKNISPFSLVRNANVL------GSKLTSGW---SYRRLGQ-LLKDKVLNARQHEALHRYA 329
            + I  F      NVL      GS LT  +   SYRR+   L KD +     HE      
Sbjct: 247 -RTIPKFLFNNQLNVLRWLGPVGSTLTWKYIKASYRRVDDALYKDYI-----HE------ 294

Query: 330 YAIFNRKGSGEYLLSFALQCGGEPRVPLERRLFHNRGQQFKANCEWLWLYGDQDWIDRRG 389
             I+ + G  E  +             L +    +   + KA    L LYG +DW++   
Sbjct: 295 -LIYGKGGMEETTIKTFTNLFTTKL--LAKDPITDTVDKLKAK-NVLLLYGQEDWMNNYA 350

Query: 390 GERVSQFLTAEMGHESCVKI----------VKNSGHHLYLDNHRMFNKIL 429
           G ++++ L    G+ +  K+          V  +GH+L+LDN   FNK L
Sbjct: 351 GYQMTKKLNELKGYNTS-KVGELNYATYMEVPEAGHNLFLDNPSFFNKAL 399

>KAFR0B02830 Chr2 complement(578530..579705) [1176 bp, 391 aa] {ON}
           Anc_8.284 YDR125C
          Length = 391

 Score = 65.9 bits (159), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 82/349 (23%), Positives = 138/349 (39%), Gaps = 71/349 (20%)

Query: 122 GNYINEFNI-RPTAVDTSKTMKHLILVHGYGAGLGFFLKTFENLNLINENWMIHAIDLPG 180
            N INE++   P A   SK     +L+HGY A    F +TF  L+   ++  ++AIDLPG
Sbjct: 51  NNEINEWHFHNPNA---SKIKTPTLLIHGYAASSMAFHRTFNRLSTDIKD--LYAIDLPG 105

Query: 181 YGFSSRPPFP--------------------------FKVGDSTPAQVEQWFHSRFHRWME 214
            G SS P                              ++  +  A+ E ++ SR   W +
Sbjct: 106 NGLSSAPELSDVIKMKDLKITLNKSKDGFTLKKAIDLEIEKANLAKYENYYLSRIDEWRK 165

Query: 215 RRGLLETPENNMVVAHSMGAYLTALYANKHPGHFKKLVMCSPAGV---CHSAP---EMRK 268
             G+    E   V+ HS G +++  YA  HP     L++ SP G+    HS     E+  
Sbjct: 166 FHGI----EKLNVIGHSFGGFISFKYAITHPNQVNDLILVSPLGMEKNIHSLNNNFELET 221

Query: 269 R-------PPPWWFAKLWDKNISPFSLVRNANVLGSKLTSGWSYRRLGQLLKDKVLNARQ 321
           +       P   ++A+ +  N+         N+L      G    R+ +   D       
Sbjct: 222 KYTLDFENPASLYYARSF--NVPSILFNNQLNILRWMGPLGG---RMARQYIDMAYKKVP 276

Query: 322 HEALHRYAYAIFNRKGS------GEYLLSFALQCGGEPRVPLERRLFHNRGQQFKANCEW 375
             A   Y Y +F    S        +   F+       R P+   L   R ++       
Sbjct: 277 DVAYKNYLYYVFYDGKSFPKVTINNFTNMFSKNLLA--RDPIMDNLLKLRAKKV------ 328

Query: 376 LWLYGDQDWIDRRGGERVSQFLT-AEMGHESCVKIVK--NSGHHLYLDN 421
           + +YG+ DW+D+  G  + + L+ +    +  V  V+  ++GH+L+LDN
Sbjct: 329 MLVYGEHDWMDKYAGYNMVELLSKSNYKLKDTVHYVEIPDAGHNLFLDN 377

>Smik_4.371 Chr4 complement(662692..663999) [1308 bp, 435 aa] {ON}
           YDR125C (REAL)
          Length = 435

 Score = 65.5 bits (158), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 84/357 (23%), Positives = 147/357 (41%), Gaps = 70/357 (19%)

Query: 119 DAQGNYINEFNIRPTAVDTSKTMKHLILVHGYGAGLGFFLKTFENLNLINENWMIHAIDL 178
           D   + IN+++ R     T   +   +L+HGY A    F + +  L+   +N  +++IDL
Sbjct: 88  DKLFDEINQWHFRNEKAST--VLTPTLLIHGYAASSMSFFRNYPGLSKHIQN--LYSIDL 143

Query: 179 PGYGFSSRPPFPFKVGDSTPAQVE-------------QWFHSRFHRWMERRGLLETPE-- 223
           P  G SS PP         P  +E                H +F   M     L+  E  
Sbjct: 144 PASGLSSIPPLEINATTPLPLDIEFTGKNKFKIPYTINLNHHKFVIQMYEDFYLDKIEQW 203

Query: 224 ---NNM----VVAHSMGAYLTALYANKHPGHFKKLVMCSPAGVCHSAPEMR--------- 267
              N +    +V HS G YL+  YA K+P   +KL + SP GV  +   +          
Sbjct: 204 RIDNKLGKVNIVGHSFGGYLSFKYAAKYPNSVEKLCLVSPLGVERNIWSINNNFRSNTLY 263

Query: 268 ----KRPPPWWFAKLWDKNISP-------FSLVRNANVLGSKLTSGW---SYRRLGQLLK 313
               + P   +++K   +N+ P       F L+R    +G+KL   +   +Y R+  L  
Sbjct: 264 TIGFEDPSSKFYSK---RNMIPKYLFERQFQLLRMMGPVGAKLCWNYIMAAYSRVPSL-- 318

Query: 314 DKVLNARQHEALHRYAYAIFNRKGSGEYLLSFALQCGGEPRVPLERRLFHNRGQQFKANC 373
                     A   Y + +F  KG G   ++  +  G   R  L +    +         
Sbjct: 319 ----------AYKEYIFELFYGKG-GIPEVTTEIFKGLFSRCILAKDPLMDSLHYLNVR- 366

Query: 374 EWLWLYGDQDWIDRRGGERVSQFLTAEMGH---ESCVKIVKNSGHHLYLDNHRMFNK 427
           + + +YG  DW++++ G  + + L + +G+   ++    + +SGH+L+LDN   FN+
Sbjct: 367 KLMVVYGQYDWMNKKAGMLMVENLNS-LGNCLEKASYLEIPSSGHNLFLDNPLSFNQ 422

>KLLA0F19624g Chr6 complement(1817206..1818435) [1230 bp, 409 aa]
           {ON} similar to uniprot|Q04623 Saccharomyces cerevisiae
           YDR125C ECM18 Protein of unknown function, similar to
           Rlp24p
          Length = 409

 Score = 64.7 bits (156), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 76/333 (22%), Positives = 131/333 (39%), Gaps = 57/333 (17%)

Query: 145 ILVHGYGAGLGFFLKTFENLNLINENWMIHAIDLPGYGFSSRPPFP-------------- 190
           +++HGY A    F + FE L+L  ++  ++A+DLPG G S   P                
Sbjct: 90  LMIHGYAASSMTFFRNFEQLSLSLKD--VYAVDLPGNGLSKELPLSVDSMQKPDRVEFNE 147

Query: 191 ------FKVGDSTP--------AQVEQWFHSRFHRWMERRGLLETPENNMVVAHSMGAYL 236
                 F++ +           A  E ++     +W +   L +      +V HS G YL
Sbjct: 148 TVKGQYFRLQNPVDEEKYKKHLAHYEDYYVDALEKWRKENKLSKIN----LVGHSYGGYL 203

Query: 237 TALYANKHPGHFKKLVMCSPAGVCHSAPEMRKRPPPWWFAKLWDKNISPFSLVRNANVLG 296
           T  Y+ K+P +  KL + SP GV  S   +     P    ++  ++ S  +     N+  
Sbjct: 204 TFKYSLKYPDNVHKLCLVSPLGVERSIFSIHNHLEPERDYEIQSEDPSKSNYSNKRNI-- 261

Query: 297 SKLTSGWSYRRLGQLLKDKVLNARQHEALHRYAYAIFNRKGS---GEYLLSFALQCG--G 351
            KL   +  + L      + +     +A   Y  + + R  S    EY+       G   
Sbjct: 262 PKLILQYQNKAL------RWMGPLGAKACWGYVNSSYGRVPSVPYREYVFQLVFGKGIMT 315

Query: 352 EPRVPLERRLFHNRGQQF--------KANCEWLWL-YGDQDWIDRRGGE-RVSQFLTAEM 401
           +  + +  +LF      +        K     L L YG+ DW+++  G   + +F +   
Sbjct: 316 DTSIRIFNQLFSRSLLAYDPIMDSLDKVKVSKLMLVYGEHDWMNKVAGRLAIEEFNSIRK 375

Query: 402 GHESCVKIVKNSGHHLYLDNHRMFNKILEDEMR 434
            ++    IV  +GH+L LDN   FN  L D +R
Sbjct: 376 SYDGTFDIVSRAGHNLVLDNPSEFNSKLVDFLR 408

>CAGL0B01969g Chr2 complement(181406..182677) [1272 bp, 423 aa] {ON}
           similar to uniprot|Q04623 Saccharomyces cerevisiae
           YDR125c ECM18 or uniprot|Q12385 Saccharomyces cerevisiae
           YLR099c ICT1
          Length = 423

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 84/329 (25%), Positives = 133/329 (40%), Gaps = 81/329 (24%)

Query: 145 ILVHGYGAGLGFFLKTFENLNLINENWMIHAIDLPGYGFSSRP--------PFPFKV--- 193
           +L+HGY A    F ++   LN   ++  ++ IDLPG G S  P        P P K+   
Sbjct: 110 VLIHGYAATSTAFFRSIPYLNRDIKD--LYTIDLPGNGLSFTPSLDLEVSKPLPLKIENI 167

Query: 194 GDSTPAQVEQWFHSRFHRWMERRGLLETPENNM-------------VVAHSMGAYLTALY 240
            D    Q+     S  HR++ ++ LL+   + +             VVAHS G YL+  Y
Sbjct: 168 DDGNEFQLPYVIDSAHHRYVLQK-LLDYYVDRIEQWRLDNKLGKINVVAHSYGGYLSFNY 226

Query: 241 ANKHPGHFKKLVMCSPAGV-----------------------CHSAPEMRKRPPPWWFAK 277
           A K+P +   L + SP GV                       C+S    RK     +   
Sbjct: 227 ALKYPANINTLGLISPLGVERNIYSINNEFHSRTIYKREWNDCNSMFYDRKFKLNDY--- 283

Query: 278 LWDKNISPFSLVRNANVLGSKLTSGWSYRRLGQLLKDKVLNARQHEALHR-YAYAIFNRK 336
           L+ K + P   +R    +G+KL   W+Y R           AR     ++ Y +  F  +
Sbjct: 284 LFQKQLKP---LRWLGPIGAKLC--WNYIRSAY--------ARVPSIDYKDYTFETFYGR 330

Query: 337 G----SGEYLLSFALQCGGEPRVPLERRLFHNRGQQFKANCEWLWLYGDQDWIDRRGGER 392
           G        + +  L      R PL   L H    Q     + + +YG  DW+++ GG+ 
Sbjct: 331 GGLPEQTSQIFTSLLTSSLLARDPL---LDHVSQLQVP---KLIMMYGQYDWMNKNGGKL 384

Query: 393 VSQFLTAEMGHESCVKIVKNSGHHLYLDN 421
           ++Q    E  +      + N+GH+L+LDN
Sbjct: 385 MTQIFNGETKYID----IPNAGHNLFLDN 409

>Suva_2.288 Chr2 complement(496577..497884) [1308 bp, 435 aa] {ON}
           YDR125C (REAL)
          Length = 435

 Score = 63.5 bits (153), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 82/329 (24%), Positives = 136/329 (41%), Gaps = 64/329 (19%)

Query: 145 ILVHGYGAGLGFFLKTFENLNLINENWMIHAIDLPGYGFSSRPPF--------------- 189
           +L+HGY A    + + +  L+   +N  +++IDLP  G SS PP                
Sbjct: 112 LLIHGYAASSMSYFRNYSGLSKHFQN--LYSIDLPASGLSSIPPLEVNTTTPLPLDIKFI 169

Query: 190 -------PFKVGDSTPAQVEQWFHSRFHRWMERRGLLETPENNMVVAHSMGAYLTALYAN 242
                  P+ +  S    V Q F   +   +E+  +    +   +V HS G YL+  YA 
Sbjct: 170 GKNKFKIPYTINASHHKFVIQMFEDFYIDRIEQWRIDNKLDKMNIVGHSFGGYLSFKYAV 229

Query: 243 KHPGHFKKLVMCSPAGVCHSAPEMR-------------KRPPPWWFAK--LWDKNI--SP 285
           K+P   +KL + SP GV  +   +              K P   +++K  L  K +    
Sbjct: 230 KYPNSVEKLCLVSPLGVERNIWSVNNNLSSNTLYTTDFKDPSSKFYSKGHLIPKYLFEEQ 289

Query: 286 FSLVRNANVLGSKLTSGW---SYRRLGQLLKDKVLNARQHEALHRYAYAIFNRKGSGEYL 342
           F L+R    LG+K+   +   +Y R+  L            A   Y + +F  KG G   
Sbjct: 290 FKLLRLMGPLGAKVCWNYIMAAYSRVTSL------------AFKEYIFELFYGKG-GIPE 336

Query: 343 LSFALQCGGEPRVPLERRLFHNRGQQFKANCEWLWLYGDQDWIDRRGG----ERVSQFLT 398
           ++  +  G   R  L R    +         + L +YG  DW+++  G    E V++ L 
Sbjct: 337 VTTDIFKGLFSRSILARDPILDSLNYLNVK-KLLVVYGQYDWMNKNAGMLLVENVNK-LG 394

Query: 399 AEMGHESCVKIVKNSGHHLYLDNHRMFNK 427
             +   S ++ V +SGH+L+LDN   FN+
Sbjct: 395 NGLERASYLE-VPSSGHNLFLDNPESFNQ 422

>CAGL0M11462g Chr13 complement(1129244..1130404) [1161 bp, 386 aa]
           {ON} similar to uniprot|Q12385 Saccharomyces cerevisiae
           YLR099c ICT1
          Length = 386

 Score = 62.8 bits (151), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 94/364 (25%), Positives = 143/364 (39%), Gaps = 110/364 (30%)

Query: 145 ILVHGYGAGLGFFLKTFENLNLINENWMIHAIDLPGYGFSSRPPF---------PFKVGD 195
           +LVHGYGA    + + F  L+    +  ++AIDLP  G S  PP           FK+ +
Sbjct: 48  LLVHGYGASSMAYHRCFAPLSRHIRD--LYAIDLPANGLSEAPPLVAEGEAPKAKFKIEE 105

Query: 196 S---------------TPAQVEQWFHSRFHRWMERRGLLET-------------PENNM- 226
           +               T AQV+Q    R HR  E+R  L+               ENN+ 
Sbjct: 106 NKFTVVQGARRAAEPVTDAQVDQELMLRTHR--EKRRYLQQYEDYYVESIEQWRKENNLD 163

Query: 227 ---VVAHSMGAYLTALYANKHPGHFKKLVMCSPAGV---CHS---------APEMRKRPP 271
              +V HS G YL+  YA K+P    KL + SP G+    HS           E+++  P
Sbjct: 164 KFNLVGHSFGGYLSYKYALKYPESVNKLCLLSPLGMERNIHSINNTFEENVVYELQESDP 223

Query: 272 PWWFAKLWDKNISP-------FSLVRNANVLGSKLTSGW---SYRRL-GQLLKDKVLN-- 318
             +      K  +P       FS++R    +G KL   +   SY ++  Q  KD +    
Sbjct: 224 SSYLYT--RKRKAPKFLFENQFSVLRWMGPIGDKLCLSFINSSYAKVPSQAYKDYLFESF 281

Query: 319 ------ARQ--HEALHRYAYAIFNRKGSGEYLLSFALQCGGEPRVPLERRLFHNRGQQFK 370
                 A+Q  H   H +  ++  R    + +    +     P V +             
Sbjct: 282 LGKKHFAKQNVHALKHLFTRSLLARDPIMDTIDKLKV-----PDVSV------------- 323

Query: 371 ANCEWLWLYGDQDWIDRRGG----ERVSQFLTAEMGHESCVKI-VKNSGHHLYLDNHRMF 425
                   YGD DW++   G    ER+ +F  A     S   + V ++GH+L+LDN   F
Sbjct: 324 -------FYGDHDWMNSYAGYLMVERLKKFRVASTSGGSASYLEVPDAGHNLFLDNPDYF 376

Query: 426 NKIL 429
           +K L
Sbjct: 377 SKKL 380

>SAKL0H16500g Chr8 (1450828..1452087) [1260 bp, 419 aa] {ON} similar
           to uniprot|Q04623 Saccharomyces cerevisiae YDR125C
          Length = 419

 Score = 62.0 bits (149), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 77/326 (23%), Positives = 131/326 (40%), Gaps = 56/326 (17%)

Query: 145 ILVHGYGAGLGFFLKTFENLNLINENWMIHAIDLPGYGFS--SRPPFPFKVGDSTPAQVE 202
           +L+HGY A    F + F  L+   +N  ++AIDLP  G S  S  P     G+  P + E
Sbjct: 100 LLLHGYAAASMGFHRNFAGLSSRIQN--LYAIDLPANGLSPGSSQPLVVSCGEPLPMKAE 157

Query: 203 QWFHSRFH-----RWMERRGLLETPENNM-----------------VVAHSMGAYLTALY 240
            + + RF       ++ ++  ++  E+                   +VAHS G YL+  Y
Sbjct: 158 -FSNDRFKIPYTLEYLHQKSFIQQLEDYYLNSIEQWRIDNKLNKINIVAHSFGGYLSTKY 216

Query: 241 ANKHPGHFKKLVMCSPAGVCHSAPEMRKRPPPWWFAKLW-DKNI----SPFSLVRNANVL 295
           A K+P   ++L + SP GV  +   +       W +  W D N     S + + R   + 
Sbjct: 217 AIKYPHAVERLCLVSPLGVERNIHSVNNH----WCSNTWYDLNYEDPGSKYYMRRMRGIP 272

Query: 296 GSKLTSGWSYRR----LGQLLKDKVLNAR----QHEALHRYAYAIFNRKGSGEYLLSFAL 347
            +   S     R    LG  L    +NA     ++E    Y + +F  K  G    +  +
Sbjct: 273 STVFQSQVKLLRLLGPLGAKLCWNYINAAYSRVKNEKYKEYVFELFYGK-EGVTQTAMDI 331

Query: 348 QCGGEPRVPLERRLFHNRGQQFKANCEWLWLYGDQDWIDRRGGERVSQFLTAEMGH---- 403
                 R  L +    +  Q        +  YG+ DW+++  G      +T E  H    
Sbjct: 332 FTNLFTRQLLAKDPLMDSLQHLHVG-RLMLAYGEHDWMNKYAG----VLMTKEFNHLRGK 386

Query: 404 --ESCVKIVKNSGHHLYLDNHRMFNK 427
              +   ++ +SGH+++LDN   FN+
Sbjct: 387 SDAATYTVISSSGHNMFLDNPDEFNE 412

>Skud_4.386 Chr4 complement(673125..674465) [1341 bp, 446 aa] {ON}
           YDR125C (REAL)
          Length = 446

 Score = 61.6 bits (148), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 84/339 (24%), Positives = 135/339 (39%), Gaps = 68/339 (20%)

Query: 137 TSKTMKHLILVHGYGAGLGFFLKTFENLNLINENWMIHAIDLPGYGFSSRP--------P 188
            S  +   +L+HGY A    + + +  L+    +  +++IDLP  G SS P        P
Sbjct: 115 ASTVLTPTLLIHGYAASSMSYFRNYPGLSKHIRD--LYSIDLPASGLSSIPSLEINATTP 172

Query: 189 FP----------FKVGDSTPAQ--------VEQWFHSRFHRWMERRGLLETPENNMVVAH 230
            P          FK+  +  A          E ++  R  +W     L +      +V H
Sbjct: 173 LPLDIKFIGKNKFKIPYTINANHHKFVIQMFEDFYLDRIEQWRIDNKLGKMN----IVGH 228

Query: 231 SMGAYLTALYANKHPGHFKKLVMCSPAGV---CHSAPEMRKRPPPWWF------AKLWDK 281
           S GAYL+  YA K+P   +KL + SP GV     S     +   P+        +K + K
Sbjct: 229 SFGAYLSFKYAVKYPNSVEKLCLVSPLGVERNIWSVNNNFRSNSPYTIDFENPSSKFYSK 288

Query: 282 -NISP-------FSLVRNANVLGSKLTSGW---SYRRLGQLLKDKVLNARQHEALHRYAY 330
            NI P       F ++R    LG+KL   +   +Y R+  L            A   Y +
Sbjct: 289 RNIIPRYLFQQQFQILRMMGPLGAKLCWNYILAAYSRVPSL------------AYKEYIF 336

Query: 331 AIFNRKGSGEYLLSFALQCGGEPRVPLERRLFHNRGQQFKANCEWLWLYGDQDWIDRRGG 390
            +F  KG G   ++  +  G   R  L R    +         + L +YG  DW+++  G
Sbjct: 337 ELFYGKG-GIPAVTTEIFEGLFSRSILARDPLMDSLNSLNVR-KLLVVYGQYDWMNKNAG 394

Query: 391 ERVSQFLTAEMGH--ESCVKIVKNSGHHLYLDNHRMFNK 427
             + + L     H  ++    +  SGH+L+LDN   FN+
Sbjct: 395 MLMVKELNNLGDHFEKATYTEIPFSGHNLFLDNPESFNQ 433

>NDAI0J01200 Chr10 (280820..282103) [1284 bp, 427 aa] {ON} 
          Length = 427

 Score = 59.3 bits (142), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 83/342 (24%), Positives = 134/342 (39%), Gaps = 74/342 (21%)

Query: 136 DTSKTMKHLILVHGYGAGLGFFLKTFENLNLINENWMIHAIDLPGYGFSSRPPF------ 189
           +TS+     +L+HGY      F +TF  L+    +  ++AID P  G S  PP       
Sbjct: 98  NTSQITTPTLLLHGYATSSIAFFRTFGPLSKQIRD--LYAIDFPANGLSKAPPLNVNHLK 155

Query: 190 ---PFKV---GDSTPAQV----------------EQWFHSRFHRWMERRGLLETPENNMV 227
              P+KV    D+T  Q+                E ++     +W     L    E   +
Sbjct: 156 KHTPYKVKFKDDNTKFQISHTVDVQLQKETIEHYENYYLDAVRKWQ----LTNKIEKFNL 211

Query: 228 VAHSMGAYLTALYANKHPGHFKKLVMCSPAGV------CHSAPEMRK-------RPPPWW 274
           V HS G Y    YA ++P    KL + SP GV       ++  E +K        P   +
Sbjct: 212 VGHSFGGYFAYKYALRYPDSVDKLCLVSPLGVERNIYSVNNNFEDKKVYNLELEDPTSKY 271

Query: 275 FAKLWD--KNI--SPFSLVRNANVLGSKLTSGW---SYRRLGQLLKDKVLNARQHEALHR 327
           + + +   K +    F ++R    LG + T  +   SYRR+  +                
Sbjct: 272 YGRTFQIPKCLFEGQFDILRKFGPLGPRFTWNYINSSYRRVPSM------------EFKE 319

Query: 328 YAYAIF--NRKGSGEYLLSFALQCGGEPRVPLERRLFHNRGQQFKANCEWLWLYGDQDWI 385
           Y + +   NRK S      F+       R  L R    +   + KA+   L +YG +DW+
Sbjct: 320 YIFELLYGNRKTSPILTEVFSNIVS---RNLLARDPILDSIDELKASNVML-MYGQEDWM 375

Query: 386 DRRGGERVSQFLTA--EMGHESCVKIVKNSGHHLYLDNHRMF 425
           + + G  + + L    E  + +    V N+GH+L+LDN   F
Sbjct: 376 NSQAGYLMVKELNEIRENPNAASYVEVPNAGHNLFLDNPDFF 417

>ZYRO0D06666g Chr4 (576172..577314) [1143 bp, 380 aa] {ON} similar
           to uniprot|Q04623 Saccharomyces cerevisiae YDR125C
          Length = 380

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 89/391 (22%), Positives = 144/391 (36%), Gaps = 94/391 (24%)

Query: 103 PAGDSRRTAEIIRTTVDAQGNY--------INEFNIRPTAVDTSKTMKHLILVHGYGAGL 154
           P  D +   + I   V   GN         +N+++   +  + S+     +L+HGY A  
Sbjct: 14  PVADLKHFQDKIMNLVKVGGNMENTMVNGQVNQWHFHNS--NASEVTTPTLLIHGYAASS 71

Query: 155 GFFLKTFENL-NLINENWMIHAIDLPGYGFSSRPPF--------PFKV------------ 193
             + +TF+ L + I++   ++ IDLP  G S   P         P KV            
Sbjct: 72  MAYYRTFQGLTDKISD---LYTIDLPSNGLSKELPLILDGQTPPPLKVEIHKDGSKFKII 128

Query: 194 -------GDSTPAQVEQWFHSRFHRWMERRGLLETPENNMVVAHSMGAYLTALYANKHPG 246
                    S   Q E ++      W +  G+        +V HS G Y+   YA K+P 
Sbjct: 129 ERVDAEHCRSVVKQYEDYYLDSIELWRKHNGIGRFN----LVGHSFGGYIAFKYAVKYPK 184

Query: 247 HFKKLVMCSPAGVCHSAPEMRKRPPPWWFAKLWD-KNISPFSLVRNANVLGSKLTSGWSY 305
             ++L + SP GV  +   +      W    +++ ++  P S +   N         W  
Sbjct: 185 AVEQLGLISPLGVESNIYSVNN---DWKLDTVYEMESTDPASRMYGKN---------WEI 232

Query: 306 RRLGQLLKDKVLNARQHEALH-----------RYAYAIFNRKGSGE---YLLSFALQCGG 351
                    KVL  RQ E L             Y  A +N+  + E   Y+       GG
Sbjct: 233 --------PKVLFERQTELLRWMGPIGAKLCWNYITAAYNKLPTMEYKDYVFELLYGNGG 284

Query: 352 EPRVP------------LERRLFHNRGQQFKANCEWLWLYGDQDWIDRRGGERVSQFLTA 399
            P+              L R    +   +  A  + L LYGD DW++   G R+ + L  
Sbjct: 285 IPKTARKVFGGLFTRSLLARDPIMDSMDKLGAR-KVLLLYGDSDWMNNYAGYRMVELLNQ 343

Query: 400 EMGH-ESCVKIVKNSGHHLYLDNHRMFNKIL 429
           + G   +    V ++ H+L+LDN   FN  L
Sbjct: 344 KRGKGYATYDEVPDARHNLFLDNPDSFNDKL 374

>KNAG0H03120 Chr8 (586146..587450) [1305 bp, 434 aa] {ON} Anc_8.284
           YDR125C
          Length = 434

 Score = 57.4 bits (137), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 75/340 (22%), Positives = 131/340 (38%), Gaps = 57/340 (16%)

Query: 132 PTAVDTSKTMKH-LILVHGYGAGLGFFLKTFENLNLINENWMIHAIDLPGYGFSSR---- 186
           P+ V +   +K  ++L+HGY +    + + F  L+   ++  ++AIDLP  G S      
Sbjct: 98  PSLVGSEAAVKPPVLLIHGYASSSMSYFRNFRGLSSQCKD--VYAIDLPANGLSREISLS 155

Query: 187 --------PPFPFKV-GDSTPAQV------------------EQWFHSRFHRWMERRGLL 219
                     +  +V G  +P QV                  E ++     RW     + 
Sbjct: 156 EDADLKDLVKYSLQVKGLDSPGQVKVTKPYNNKLCATQLRILEDYYVDEIERWRVENQI- 214

Query: 220 ETPENNMVVAHSMGAYLTALYANKHPGHFKKLVMCSPAGVCHSAPEMRKRPPPWWFAKLW 279
              +   +V HS G Y++  YA K+P +  KL + SP GV  +   +    P     +  
Sbjct: 215 ---DQLHLVGHSFGGYISYKYALKYPQNVMKLALISPLGVERNLYSVNNHLPQDSIVQGT 271

Query: 280 DKNISPFSLVRNANVLGSKLTSGWSYRRLGQLLKDKVLNARQHEALHRYAYAIFNRKGSG 339
            ++ S  S +R   V      +     R G       + AR        AYA    +   
Sbjct: 272 FEDPSSPSYLRKLEVPRYIFENQLKILRWG-----GPMGARLCWNYITSAYAKVPSREFK 326

Query: 340 EYLLSFALQCGGEPRVPLE------------RRLFHNRGQQFKANCEWLWLYGDQDWIDR 387
           EYL       GG  +  L             R    +   + K   + ++ YG  DW+++
Sbjct: 327 EYLFELFYGDGGITKTALTTFILLFTRNLLARDPIMDSIAELKVK-DVMFQYGQYDWMNK 385

Query: 388 RGGERVSQFLTAEMGHESCVKI-VKNSGHHLYLDNHRMFN 426
             G R ++ L  +  + S + + +  SGH+L+LD+ + FN
Sbjct: 386 NAGARAAELLRKQPYNNSALYLEIPESGHNLFLDSPQSFN 425

>KAFR0B05380 Chr2 (1107049..1108284) [1236 bp, 411 aa] {ON}
           Anc_8.284 YDR125C
          Length = 411

 Score = 56.6 bits (135), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 80/337 (23%), Positives = 125/337 (37%), Gaps = 70/337 (20%)

Query: 145 ILVHGYGAGLGFFLKTFENLNLINENWMIHAIDLPGYGFSS-----------RPPFPFKV 193
           +L+HG+ +    F + F  L+   +   ++AIDLP  G S            +    F +
Sbjct: 91  LLLHGFASSSMSFFRNFTGLS--QDIMDLYAIDLPANGLSRSLSTKFYRVSPKETRKFDM 148

Query: 194 GDSTPAQV----------------EQWFHSRFHRWMERRGLLETPENNMVVAHSMGAYLT 237
            D    Q+                E ++     RW     L +      +VAHS G YL+
Sbjct: 149 LDDIHFQLLSHGNYHAEKELIQKCEDYYIDTIERWRRSNELHKIN----IVAHSFGGYLS 204

Query: 238 ALYANKHPGHFKKLVMCSPAGVCHSAPEMR-----------KRPPPWWFAKLWDKNI--- 283
             YA K+P    KL + SP GV  +   +             R  P     + +  I   
Sbjct: 205 FKYALKYPESINKLCLVSPLGVEANIYSINNNFNVGETYTVNRLDPSSCCYINENEIPKY 264

Query: 284 ---SPFSLVRNANVLGSKLTSGW---SYRRLGQLLKDKVLNARQHEALHRYAYAIFNRKG 337
              + F ++R +  +G+KL   +   SY R+  L               RY + +   KG
Sbjct: 265 VFDNLFKILRLSGPIGAKLCWNYVLSSYSRISSL------------DFKRYVFELLYGKG 312

Query: 338 SGEYLLSFALQCGGEPRVPLERRLFHNRGQQFKANCEWLWLYGDQDWIDRRGGERVSQFL 397
            G    +  L         L R    +       N   L LYG+ DW+ +  G+ +    
Sbjct: 313 -GMTATAINLFTQLFTTRLLARDPLMDSAHSLSCN-GILLLYGEYDWMAKNAGKSLLTNC 370

Query: 398 TAE-MGHESCVKI--VKNSGHHLYLDNHRMFNKILED 431
            A+  G  S  K   V  SGH+L+LDN   FNK + +
Sbjct: 371 KADNKGSASKTKYLEVPKSGHNLFLDNPAFFNKSIAE 407

>Ecym_4285 Chr4 (612053..613270) [1218 bp, 405 aa] {ON} similar to
           Ashbya gossypii AGR062C
          Length = 405

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 74/334 (22%), Positives = 127/334 (38%), Gaps = 60/334 (17%)

Query: 145 ILVHGYGAGLGFFLKTFENLNLINENWMIHAIDLPGYGFSSRPPFPFKVGDSTPAQVE-Q 203
           +L+HGY      + +    L+   ++  ++ IDLP  G S   P    +      + E  
Sbjct: 87  LLLHGYATSSMCYHRNMPQLSEGIKH--LYTIDLPANGLSKELPLELDIAKPIVFKPEFN 144

Query: 204 WFHSRFH-----RWMERRGLLETPENNMV-----------------VAHSMGAYLTALYA 241
              S FH       +  R  ++  E+  +                 V HS G Y++  Y+
Sbjct: 145 SVKSEFHIPYTIDGLHHRCAIQKLEDYYIDSIELWRRKNSLGAINLVGHSFGGYISFKYS 204

Query: 242 NKHPGHFKKLVMCSPAGVCHSAPEMR-------------KRPPPWWFAKLWDKNISP--- 285
            K+P + KKL + SP GV  +   +              + P    FA   +K + P   
Sbjct: 205 IKYPQNVKKLCLISPIGVERNIYSVHNNWRSNCPYSIDYEDPSSKHFA---NKTMIPEFV 261

Query: 286 ----FSLVRNANVLGSKLTSGWSYRRLGQLLKDKVLNARQHEALHRYAYAIFNRKGSGEY 341
                 L+R    LG+KL  GW Y      +  KV N    E +    Y       +   
Sbjct: 262 FNEQTKLLRLMGPLGAKL--GWKYI---NAVYSKVPNFLYLEFIFTLIYGKNVMTDTSRN 316

Query: 342 LLSFALQCGGEPRVPLERRLFHNRGQQFKANCEWLWLYGDQDWIDRRGGERVSQFLTAEM 401
           + ++        R P+   L H    +       L LYG+ DW+  + G+ + +    + 
Sbjct: 317 IFTYLFTNSLLARDPMLDSLEHLHVDKL------LMLYGEHDWVRSQPGKMMVEEFNKQR 370

Query: 402 GHES-CVKIVKNSGHHLYLDNHRMFNKILEDEMR 434
            H S  + +V ++ H+L+LDN   FN  L + ++
Sbjct: 371 SHPSGTLTVVPDASHNLFLDNPVFFNVALLNFLK 404

>NCAS0B05120 Chr2 complement(953798..954988) [1191 bp, 396 aa] {ON} 
          Length = 396

 Score = 53.9 bits (128), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 73/336 (21%), Positives = 129/336 (38%), Gaps = 73/336 (21%)

Query: 145 ILVHGYGAGLGFFLKTFENLNLINENWMIHAIDLPGYGFSSRPP---------------- 188
           +L+HGY A    + +T   L+   ++  ++ IDLP    SS PP                
Sbjct: 70  VLIHGYAASSMAYYRTLATLSKNVKD--VYVIDLPANSLSSVPPHSDISHLKINKIKVVQ 127

Query: 189 ---------FPFKVG----------DSTPAQVEQWFHSRFHRWMERRGLLETPENNMVVA 229
                    + FKV                ++E ++     +W  RR      + N+V  
Sbjct: 128 VSKDKENEKYVFKVAPPHAYDAQREKQVIDKLENYYLDVIEKW--RRANYGLDKFNLV-G 184

Query: 230 HSMGAYLTALYANKHPGHFKKLVMCSPAGVCHSAPEMRKRPPPWWFAKLWDKNI-SPFSL 288
           HS G YL+  YA K+P    KL + SP GV   A  +R     +   K +  ++ +P S+
Sbjct: 185 HSFGGYLSFKYAIKYPEVVDKLCLVSPLGV---ASNIRSVNNVFDTKKEYVMDLQNPGSM 241

Query: 289 VRNAN------VLGSKLTSGWSYRRLGQLLKDKVLNARQHEALHRYAYAIFNRKGSGEYL 342
           + N        +  ++L        +G  L  K +N+         AY         +YL
Sbjct: 242 LYNRQRMIPNFLFNNQLNVLKWMGPVGSKLTRKYINS---------AYVKVPTMDYKDYL 292

Query: 343 LSFALQCGGEPRVPLERRLFH----------NRGQQFKANCEWLWLYGDQDWIDRRGGER 392
             +      +  V +  +LF           +   + K+   ++ +YGD DW+D+  G  
Sbjct: 293 YEYFQMGVPQVNVDIFTKLFSRNLMARDPIMDNMNRLKS-TRFMMMYGDNDWMDKFSGYT 351

Query: 393 VSQFLTA---EMGHESCVKIVKNSGHHLYLDNHRMF 425
           + Q +         ++    + ++GH+L+LDN   F
Sbjct: 352 LVQNINKIKNNFDRKATYVEIPDAGHNLFLDNPEDF 387

>NDAI0J01210 Chr10 (282384..283634) [1251 bp, 416 aa] {ON} Anc_8.284
          Length = 416

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 82/342 (23%), Positives = 125/342 (36%), Gaps = 68/342 (19%)

Query: 136 DTSKTMKHLILVHGYGAGLGFFLKTFENLNLINENWMIHAIDLPGYGFSSRPP------- 188
           +TS      +L+HGY A    F +TF  L+  N    ++AIDLP  G S   P       
Sbjct: 89  NTSTVTIPTLLLHGYAASSMSFYRTFAPLS--NNFKNLYAIDLPANGLSVAIPLKITKQR 146

Query: 189 -----------------FPFKVGDSTP--AQVEQWFHSRFHRWMERRGLLETPENNMVVA 229
                            +P  + +  P   Q E ++      W     +    E   +V 
Sbjct: 147 KRLYEVKYKENNKFSISYPVPIEEQKPLIEQYENYYLDAMRSWQVANNI----EKFNLVG 202

Query: 230 HSMGAYLTALYANKHPGHFKKLVMCSPAGVCHSAPEMRKRPPPWWFAKLWDKNI----SP 285
           HS G Y +  YA + P    KL + SP G+  +   +  +   +   K+++ N+    SP
Sbjct: 203 HSFGGYFSFKYALRFPDSINKLCLVSPLGMESNIFSIHNK---FEENKIYNVNLTDPTSP 259

Query: 286 FSLVRNANVLGSKLTSGWSYRRLGQLLKDKVLNARQHEALHRYAYAIFNRKGSGEYL-LS 344
           F         G K     +Y    QL   + L          Y  + + R  S EY    
Sbjct: 260 F--------YGKKFQIP-NYLFENQLDVIRKLGPFGARLCWNYILSAYKRVPSMEYKEYL 310

Query: 345 FALQCGGEPRVPLERRLFHNR---------------GQQFKANCEWLWLYGDQDWIDRRG 389
           F L  G     P+   LF N                 Q   +N   L +YG+ DW++R  
Sbjct: 311 FELFYGNRQVSPILCELFTNLLTRNLLARDPILDSIDQLQLSNV--LVMYGEHDWMNRYA 368

Query: 390 GE-RVSQFLTAEMGHESCVKI-VKNSGHHLYLDNHRMFNKIL 429
           G   VS+         +   + V  +GH+L+LDN   F+  L
Sbjct: 369 GYCMVSRLNNIRRTPNTAQYLQVPAAGHNLFLDNPEYFSSAL 410

>TBLA0H01400 Chr8 (312727..313992) [1266 bp, 421 aa] {ON} Anc_8.284
           YDR125C
          Length = 421

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 45/172 (26%), Positives = 73/172 (42%), Gaps = 39/172 (22%)

Query: 123 NYINEFNIRPTAVDTSKTMKHLILVHGYGAGLGFFLKTFENLNLINENWMIHAIDLPGYG 182
           N IN+++       T KT    +L+HGY A    + KTF  L    ++  ++ IDLPG+G
Sbjct: 34  NEINQWHFHNANASTIKT--PTVLIHGYAASSMAYYKTFRYLTGSIKD--LYTIDLPGFG 89

Query: 183 FSSRPP------------FPFKVGDSTPAQVEQWFHSRFHRWMERRGLLETPE------- 223
            S+ P             F  K+ DS  +   ++  S+ +  +   G +E          
Sbjct: 90  LSASPKIIINDHNRKKSQFDIKLIDSKDSNNNKFSISKKNLKLLENGNIEDKAFISAFDD 149

Query: 224 ------------NNM----VVAHSMGAYLTALYANKHPGHFKKLVMCSPAGV 259
                       NN+    V+ HS G Y++  YA K+P   + L + SP G+
Sbjct: 150 YYIDRIEKWRKFNNLGKINVIGHSFGGYISFKYAIKYPDSIENLCLVSPFGM 201

 Score = 36.2 bits (82), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 32/58 (55%), Gaps = 2/58 (3%)

Query: 376 LWLYGDQDWIDRRGGERVSQFLTAEMGHESCVKIVK--NSGHHLYLDNHRMFNKILED 431
           L  YG+ DW+++  G  +++ L    G       ++  NSGH+L LD+ + F+K L D
Sbjct: 360 LLFYGENDWMNKEAGFLMAEKLNILKGDSKYANWIEVPNSGHNLILDDPKFFSKNLID 417

>NCAS0B03710 Chr2 (664097..665389) [1293 bp, 430 aa] {ON} Anc_8.284
          Length = 430

 Score = 49.7 bits (117), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 49/170 (28%), Positives = 68/170 (40%), Gaps = 37/170 (21%)

Query: 116 TTVDAQGNYINEFNIRPTAVDTSKTMKHLILVHGYGAGLGFFLKTFENLNLINENWMIHA 175
           T +D   N  +  N   TAV T       +L+HGY A    F +TF  L+   +N  ++A
Sbjct: 88  TMIDGVLNQWSFHNSSATAVTTPT-----LLLHGYAASSLCFFRTFVPLSRSIKN--LYA 140

Query: 176 IDLPGYGFSSRPPF--------------------PFKVGDSTPAQV------EQWFHSRF 209
            DLPG G S    F                      K  +S   Q       E ++    
Sbjct: 141 TDLPGNGLSKNKSFFSVMYGNEYMKVKYEENNKFSIKYLNSLKDQTNSIKHSEDYYIDAI 200

Query: 210 HRWMERRGLLETPENNMVVAHSMGAYLTALYANKHPGHFKKLVMCSPAGV 259
             W     L   P+ N+V  HS G YL+  YA ++P +  KL + SP GV
Sbjct: 201 REWQLSNNL---PKINLV-GHSFGGYLSFKYALRYPDNVNKLCLVSPLGV 246

>NDAI0C05430 Chr3 (1259106..1260194) [1089 bp, 362 aa] {ON}
           Anc_8.524 YBR204C
          Length = 362

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 38/114 (33%), Positives = 52/114 (45%), Gaps = 14/114 (12%)

Query: 145 ILVHGYGAGLGFFLKTFENLNLINENWMIHAIDLPGYGFSSRPPFPFKVGDSTPAQVEQW 204
           + +HG G  L  F      L+L NEN  + A+DLPG+G S       +  D     V   
Sbjct: 93  LFIHGLGGVLEQFEPLLRLLDL-NENKFL-ALDLPGFGKSD------EYEDYNMFDVISI 144

Query: 205 FHSRFHRWMERRGLLETPENNMVVAHSMGAYLT--ALYANKHPGHFKKLVMCSP 256
            H+   R +  R    T  N ++V HSMG Y++    Y +     FKKLV  SP
Sbjct: 145 IHTIVDRLIPER----TTSNIVLVGHSMGCYISLHLFYKSYTRFSFKKLVFLSP 194

>TPHA0L01600 Chr12 (338450..339568) [1119 bp, 372 aa] {ON} Anc_8.524
           YBR204C
          Length = 372

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 30/115 (26%), Positives = 58/115 (50%), Gaps = 12/115 (10%)

Query: 145 ILVHGYGAGLGFFLKTFENLNLINENWMIHAIDLPGYGFSSRPPFPFKVGDSTPAQVEQW 204
           I +HG G  L  FL   +  +L N++++  A+DLPG+G  S     + + + + + +  +
Sbjct: 93  IFIHGLGGSLEQFLPLLKLTDLSNKSFI--AVDLPGFG-QSEFNDEYNIANYSMSSIIGF 149

Query: 205 FHSR-FHRWMERRGLLETPENNMVVAHSMGAYLTALYANKHPGHF--KKLVMCSP 256
             S+ F R+      L T    ++  HSMG YL   +  ++   +  +K+V+ +P
Sbjct: 150 LKSQVFSRY------LTTNTKIILTGHSMGCYLALHFYQQYKTEYQIQKIVLLAP 198

>KLTH0E12188g Chr5 (1082142..1083152) [1011 bp, 336 aa] {ON} similar
           to uniprot|P38139 Saccharomyces cerevisiae YBR204C
           Hypothetical ORF
          Length = 336

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 35/143 (24%), Positives = 60/143 (41%), Gaps = 26/143 (18%)

Query: 110 TAEIIRTTVDAQGNYINE----FNIRPTAVDTSKTMKH-------LILVHGYGAGLGFFL 158
           +  I++  +D + +++ E      +  T + TS  +KH        +  HG G  L  F 
Sbjct: 36  STAILKEPLDFENSFLAEHERFLQVGTTRLRTSHNIKHQHGEGPIYLFFHGLGGNLTQFE 95

Query: 159 KTFENLNLINENWMIHAIDLPGYGFSSRPPFPFKVGDSTPAQVEQWFHSRFHRWMERRGL 218
                L  +NE ++  A+DLPG+G S               QV Q  H  F +  + + +
Sbjct: 96  PLLRLLGELNEGFV--AMDLPGFGLSEEQ------DGYQMLQVTQVIHDAFLQITDHKKI 147

Query: 219 LETPENNMVVAHSMGAYLTALYA 241
           +       +V HSMG +L   +A
Sbjct: 148 I-------LVGHSMGCHLVLHFA 163

>CAGL0M05467g Chr13 complement(583722..584786) [1065 bp, 354 aa]
           {ON} weakly similar to uniprot|P38139 Saccharomyces
           cerevisiae YBR204c peroxisomal serine-active lipase
          Length = 354

 Score = 39.3 bits (90), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 30/115 (26%), Positives = 51/115 (44%), Gaps = 13/115 (11%)

Query: 144 LILVHGYGAGLGFFLKTFENLNLINENWMIHAIDLPGYGFSSRPPFPFKVGDSTPAQVEQ 203
            +L+HG G  +  F    + L L+   + + A+DLPG+G S         G ST      
Sbjct: 78  FLLIHGLGGSMDQFQPLMKLLTLLK--YRVIALDLPGFGQS---------GSSTNGYDML 126

Query: 204 WFHSRFHRWMERRGLLETPENNMVVAHSMGAYLTALYANKHPGHF--KKLVMCSP 256
           +  S   + ++     +T  +  VV HSMG Y+ + +   +   +   KLV+  P
Sbjct: 127 YVTSVVKKVVDNNIENKTDIDFKVVGHSMGCYIASHFVQMYHEEYNIDKLVLTCP 181

>ZYRO0F09064g Chr6 (735162..736211) [1050 bp, 349 aa] {ON} similar
           to uniprot|P38139 Saccharomyces cerevisiae YBR204C
           Hypothetical ORF
          Length = 349

 Score = 38.9 bits (89), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 35/143 (24%), Positives = 62/143 (43%), Gaps = 23/143 (16%)

Query: 117 TVDAQGNYINEFNIRPTAVDTSKTMKHLILVHGYGAGLGFFLKTFENLNLINENWMIHAI 176
            VD +G  I    +     D+S+  +  + +HG G  L  F      ++ +++ ++  A+
Sbjct: 62  CVDVRGKKIR---VCHNCQDSSQVHELFLFIHGLGGELEQFEPLLRLVDAMDQRFL--AL 116

Query: 177 DLPGYGFSSR-PPFPFKVGDSTPAQVEQWFHSRFHRWMERRGLLETPENNMVVAHSMGAY 235
           DLPG+G S     +P      T  ++   F++                  ++V HSMG Y
Sbjct: 117 DLPGFGKSDEWDEYPMLKVVETIEEIAAKFNA---------------AKIVLVGHSMGCY 161

Query: 236 LTA-LYANKHPGH-FKKLVMCSP 256
           LT+  Y   H  H   ++V+ SP
Sbjct: 162 LTSHFYEAYHKVHSINRIVLLSP 184

>KNAG0A03770 Chr1 complement(494021..495091) [1071 bp, 356 aa] {ON}
           Anc_8.524 YBR204C
          Length = 356

 Score = 37.7 bits (86), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 38/128 (29%), Positives = 59/128 (46%), Gaps = 25/128 (19%)

Query: 145 ILVHGYGAGLGFFLKTFENLNLINENWMIHAIDLPGYGFSSR-PPFP-FKVGDSTPAQVE 202
           I +HG G  L  F    + L+L +E + + AIDLPG+G S     +P  +V     A + 
Sbjct: 86  IFIHGLGGSLDQFFPLLKLLDL-SEKYFV-AIDLPGFGKSDEHTDYPMIQVVKHIDAVIS 143

Query: 203 QWFHSRFHRWMERRGLLETPENNMVVAHSMGAYLT----ALYANKHPGHFKKLVMCSPAG 258
           +  +       E R   +T     ++ HSMG YLT     L++ K+     K+V+ +P  
Sbjct: 144 ELLN-------EARLAFDTVR---LIGHSMGCYLTLHFMTLFSKKY--RIGKVVLLAPP- 190

Query: 259 VCHSAPEM 266
                PEM
Sbjct: 191 ----KPEM 194

>Kwal_27.11975 s27 (1028242..1029252) [1011 bp, 336 aa] {ON} YBR204C
           - Hypothetical ORF [contig 26] FULL
          Length = 336

 Score = 37.7 bits (86), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 30/115 (26%), Positives = 52/115 (45%), Gaps = 21/115 (18%)

Query: 145 ILVHGYGAGLGFFLKTFENLNLINENWMIHAIDLPGYGFSSRPPFPFKVGDSTPAQVEQW 204
           + +HG G  L  F      L+++NE ++   IDLPG+G S               +++ +
Sbjct: 82  VFIHGLGGTLTQFEPLLRVLDVLNEGFL--TIDLPGFGHSD--------------ELDSY 125

Query: 205 FHSRFHRWMERRGLLETPENN--MVVAHSMGAYLTALYANKHPGHF--KKLVMCS 255
                 + + R  L+ET +N   +VV HSMG ++   +   +   F  K +V  S
Sbjct: 126 SMLDIAKII-REVLVETTKNKKVIVVGHSMGCHIALHFGQLYNAEFAIKDMVFLS 179

>SAKL0H10450g Chr8 complement(897598..898776) [1179 bp, 392 aa] {ON}
           similar to uniprot|P38139 Saccharomyces cerevisiae
           YBR204C Hypothetical ORF
          Length = 392

 Score = 35.4 bits (80), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 30/115 (26%), Positives = 54/115 (46%), Gaps = 19/115 (16%)

Query: 145 ILVHGYGAGLGFFLKTFENLNLINENWMIHAIDLPGYGFSSRPPFPFKVGDSTPAQVEQW 204
           + +HG G  L  F    + L+L+N+ +   ++DLPG+G S               +VE +
Sbjct: 133 VFIHGLGGTLAQFEPLLKLLSLLNKGFF--SMDLPGFGSSD--------------EVESY 176

Query: 205 FHSRFHRWMERRGLLETPENNMV-VAHSMGAYLTALYAN--KHPGHFKKLVMCSP 256
                   +++     TP  N+V + HSMG YL   + +  +    F++LV+ +P
Sbjct: 177 GMLEIVAIVQKTFAKLTPSRNLVLIGHSMGCYLAIHFCSAFQEQYSFQELVLLAP 231

>Kwal_23.6592 s23 (1658078..1658572) [495 bp, 164 aa] {ON} [contig
           358] FULL
          Length = 164

 Score = 32.7 bits (73), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 27/119 (22%), Positives = 51/119 (42%), Gaps = 21/119 (17%)

Query: 156 FFLKTFEN--------LNLINENWMIHAIDLPGYGFSSRPPFPFKVGDSTPAQVEQWFHS 207
           F+L++F          + L+ E++ + A+DLPG G S +P      GD    Q      +
Sbjct: 18  FYLRSFPESWYAWRNVIPLLAESYWVIAVDLPGQGDSDKP------GDGYDTQT---LAN 68

Query: 208 RFHRWMERRGLLETPENNMVVAHSMGAYLTALYANKHPGHFKKLVMCSPAGVCHSAPEM 266
           + H  ++  GL        + AH +GA++   Y+       +++ +        + PEM
Sbjct: 69  KLHILIQSLGL----SRYFLAAHDVGAWVAFPYSLLFGEEIERMALLDAGIPGVTLPEM 123

>YPR147C Chr16 complement(825645..826559) [915 bp, 304 aa] {ON}
           Putative protein of unknown function; green fluorescent
           protein (GFP)-fusion protein localizes to the cytoplasm
           and is induced in response to the DNA-damaging agent MMS
          Length = 304

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 33/142 (23%), Positives = 62/142 (43%), Gaps = 14/142 (9%)

Query: 128 FNIRPTAVDTSKTMKHLILVHGYGAGLGFFLKTFENLNLINENWMIHAIDLPGYGFSSRP 187
            NI+PT   + +    L+ + G    L ++ +   +L+L + +W I  I   G   ++  
Sbjct: 16  LNIKPTVTKSGEDAPLLVWIPGNPGLLYYYQEMLHHLHLKHPDWEILGISHAGMTLNAHS 75

Query: 188 PFP-FKVGDSTPAQVEQWFHSRFHRWMERRGLLETPENNMVVAHSMGAYLT--ALYANKH 244
             P F + D    QVE    + F    + R ++       ++ HS+GAY+      +NK 
Sbjct: 76  NTPIFSLQDQVDHQVEVI--NNFS--CKNRKII-------IMGHSVGAYIVQKVCLSNKL 124

Query: 245 PGHFKKLVMCSPAGVCHSAPEM 266
            G  +K+ + +P  +     EM
Sbjct: 125 VGSVQKVGLVTPTVMDIHTSEM 146

>Suva_16.476 Chr16 complement(822104..823018) [915 bp, 304 aa] {ON}
           YPR147C (REAL)
          Length = 304

 Score = 32.3 bits (72), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 33/142 (23%), Positives = 63/142 (44%), Gaps = 14/142 (9%)

Query: 128 FNIRPTAVDTSKTMKHLILVHGYGAGLGFFLKTFENLNLINENWMIHAIDLPGYGFSSRP 187
            NI+PT    ++    L+ + G    L ++ +   +L+L + +W I  I   G   ++R 
Sbjct: 16  LNIKPTVTTDNEDAPLLVWIPGNPGLLHYYQEMIHHLHLKHPDWEILGISHAGMSSNARS 75

Query: 188 PFP-FKVGDSTPAQVEQWFHSRFHRWMERRGLLETPENNMVVAHSMGAYLT--ALYANKH 244
             P F + D    QV+    + F    + R ++       ++ HS+GAY+      +N+ 
Sbjct: 76  NTPIFSLQDQVDHQVKVI--NNFSH--DNRKII-------IMGHSVGAYIVQKVCLSNEL 124

Query: 245 PGHFKKLVMCSPAGVCHSAPEM 266
            G   K+ + +P  +   A EM
Sbjct: 125 VGSVTKVGLITPTVMDIHASEM 146

>Suva_8.135 Chr8 (238005..238235,238328..238489,238523..239122) [993
           bp, 330 aa] {ON} YOR084W (REAL)
          Length = 330

 Score = 32.3 bits (72), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 21/46 (45%)

Query: 222 PENNMVVAHSMGAYLTALYANKHPGHFKKLVMCSPAGVCHSAPEMR 267
           P  N+V+ HSMG +   +     P  F  L++  P  V   AP  R
Sbjct: 89  PALNVVIGHSMGGFQALVCDVLQPNLFHLLILIEPVVVARQAPAAR 134

>KLLA0A10395g Chr1 complement(908097..908981) [885 bp, 294 aa] {ON}
           similar to uniprot|P53750 Saccharomyces cerevisiae
           YNR064C
          Length = 294

 Score = 30.4 bits (67), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 27/50 (54%), Gaps = 3/50 (6%)

Query: 138 SKTMKHLILVHGYGAGLGFFLKTFENLNLINENWMIHAIDLPGYGFSSRP 187
            K+   ++L+HGY      F      + LI++ + + A DLPG+GF+  P
Sbjct: 27  DKSNPSIVLLHGYPTSSTMFRHL---IPLISDKFHVIAPDLPGFGFTEVP 73

>SAKL0E02596g Chr5 complement(208748..209704) [957 bp, 318 aa] {ON}
           similar to uniprot|P28321 Saccharomyces cerevisiae
           YKL094W YJU3 Protein of unknown function localizes to
           lipid particles
          Length = 318

 Score = 30.8 bits (68), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 31/62 (50%), Gaps = 5/62 (8%)

Query: 376 LWLYGDQDWIDRRGGER--VSQFLTAEMGHESCVKIVKNSGHHLYLDNHRMFNKILEDEM 433
           L L+G+ D I+   G +   ++  T E   E  +K+   + H L L+  R+F  + ED  
Sbjct: 252 LILHGEDDTINDPHGSKKFFNEMCTFE---EKQLKLYPKARHSLCLETDRIFQTVFEDMT 308

Query: 434 RW 435
           RW
Sbjct: 309 RW 310

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.322    0.137    0.434 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 49,247,698
Number of extensions: 2202113
Number of successful extensions: 5144
Number of sequences better than 10.0: 69
Number of HSP's gapped: 5109
Number of HSP's successfully gapped: 106
Length of query: 435
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 322
Effective length of database: 40,524,141
Effective search space: 13048773402
Effective search space used: 13048773402
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 67 (30.4 bits)