Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_27.115422.284ON79179139360.0
KLTH0G10318g2.284ON79080323590.0
SAKL0E07722g2.284ON79180918520.0
Suva_9.1042.284ON80584915690.0
Skud_9.782.284ON80972715640.0
YIL095W (PRK1)2.284ON81085015610.0
Smik_9.842.284ON80873015300.0
TDEL0G021502.284ON66148214150.0
ADL217W2.284ON75069413741e-179
Ecym_33232.284ON74850413701e-178
TPHA0C033802.284ON69750513361e-174
CAGL0G02607g2.284ON68837913261e-173
NCAS0G038102.284ON66131213231e-173
NDAI0G006402.284ON62131513091e-171
KAFR0J013702.284ON78031613201e-170
ZYRO0A01848g2.284ON70431513131e-170
NCAS0B062602.284ON72337313111e-170
KAFR0H033302.284ON36931312711e-169
NDAI0B035602.284ON75635113051e-169
Kpol_1003.352.284ON71331512751e-165
Skud_14.3092.284ON63930912641e-164
YNL020C (ARK1)2.284ON63831412611e-164
Suva_14.3272.284ON63230812581e-163
KNAG0H020202.284ON59231512421e-161
Smik_14.3112.284ON63730912451e-161
TBLA0B059302.284ON71731312511e-161
Kpol_1039.332.284ON70131511961e-153
TBLA0B069402.284ON144331512121e-148
CAGL0J03432g2.284ON62231111301e-144
KNAG0A054302.284ON78831711321e-142
TPHA0D015402.284ON70731511241e-142
Kwal_27.109453.273ON9353148444e-99
KLTH0C07260g3.273ON9013088401e-98
SAKL0D03234g3.273ON8583098352e-98
KNAG0J008203.273ON10913198473e-98
Kpol_251.43.273ON8383138263e-97
KAFR0A010403.273ON9123308252e-96
KNAG0H012203.273ON9133238216e-96
CAGL0H10208g3.273ON10273228242e-95
KAFR0C004303.273ON9493198192e-95
Kpol_1052.223.273ON11013098262e-95
KLLA0F18612g3.273ON8143198086e-95
Ecym_26503.273ON8943108101e-94
TBLA0E025903.273ON10613238191e-94
NCAS0A105903.273ON10953188159e-94
Smik_2.1913.273ON11083198151e-93
TPHA0A040303.273ON10543268121e-93
Suva_4.2973.273ON11073198141e-93
Skud_2.1793.273ON10903198131e-93
NDAI0A057003.273ON11573268142e-93
ZYRO0E06864g3.273ON11153168122e-93
TPHA0M011203.273ON7883137935e-93
YBR059C (AKL1)3.273ON11083198062e-92
AGR027C3.273ON9613107887e-91
CAGL0K11990g3.273ON9913147907e-91
TDEL0D035203.273ON10493167841e-89
TBLA0I019303.273ON13613137816e-88
Kwal_56.242746.262ON3463382451e-21
Skud_16.426.262ON3643332442e-21
TDEL0A067506.262ON3723122407e-21
YPL236C (ENV7)6.262ON3643292372e-20
KNAG0F001701.24ON5432762413e-20
Kpol_2002.241.24ON4872612332e-19
Ecym_21536.262ON3633522292e-19
KLTH0H03080g6.262ON3463382273e-19
Suva_16.706.262ON3643392274e-19
KAFR0A050906.31ON6682422325e-19
Kpol_1023.266.31ON7392732291e-18
Kpol_1037.206.31ON7042762281e-18
CAGL0J11638g6.31ON7462992281e-18
CAGL0K08514g2.479ON14892532302e-18
NCAS0C041008.141ON9053352282e-18
ZYRO0E07876g6.262ON3693342212e-18
Smik_6.4416.262ON3643332203e-18
TDEL0G043806.31ON7222762253e-18
NDAI0F045201.24ON4891942224e-18
KNAG0E008506.31ON7112762244e-18
NDAI0C026806.31ON7502762236e-18
SAKL0A03344g6.262ON3643522176e-18
TPHA0J004206.31ON7072762228e-18
YAR019C (CDC15)3.177ON9742802238e-18
TPHA0E038501.24ON4821942191e-17
Smik_1.793.177ON9742812211e-17
ABL034W2.479ON14253262212e-17
Suva_13.1636.31ON7052992192e-17
Skud_13.1546.31ON7052992192e-17
SAKL0H06754g8.668ON8842102192e-17
Smik_13.1596.31ON7052992182e-17
YMR001C (CDC5)6.31ON7052992182e-17
NCAS0D021006.31ON7262762173e-17
TBLA0A074601.24ON5162682153e-17
KNAG0D048107.86ON14401832183e-17
KLLA0C06138g6.31ON7082882164e-17
Kpol_1072.198.668ON8961982165e-17
Ecym_30356.31ON7402762155e-17
SAKL0C00946g1.24ON5642682146e-17
Skud_1.723.177ON9742882157e-17
KLTH0F16676g5.406ON8782532148e-17
Kpol_431.92.479ON15522032158e-17
KAFR0G012001.24ON5072342101e-16
KLTH0F00946g1.24ON5122482101e-16
ZYRO0D05500g7.86ON12621792131e-16
ACL006W6.31ON7082762111e-16
TPHA0G032002.479ON15342002132e-16
Kwal_26.87518.668ON8482072112e-16
Kwal_26.73551.271ON14462622112e-16
CAGL0M02299g8.668ON8932142102e-16
SAKL0H16632g8.279ON10622102102e-16
KAFR0G026906.31ON7132762093e-16
ZYRO0C07480g6.31ON7742762084e-16
Kwal_33.131121.24ON5052892064e-16
NCAS0A002801.24ON5352842065e-16
ZYRO0F18062g1.24ON4712682055e-16
TDEL0A061408.668ON8613022075e-16
TBLA0D022308.141ON11543102085e-16
TDEL0A025502.479ON13692212086e-16
Suva_16.1608.668ON9183142077e-16
KLLA0F11319g8.668ON8432072067e-16
Suva_1.863.177ON9742922069e-16
NDAI0K021002.496ON9092352059e-16
Kwal_55.215455.406ON8652172051e-15
KNAG0F029006.31ON6492612041e-15
SAKL0E01584g6.31ON6952762031e-15
NCAS0C016708.668ON8962092032e-15
TBLA0A071501.52ON13912962042e-15
TBLA0A047207.86ON12622502042e-15
KLTH0D05566g2.479ON11282032032e-15
Smik_4.3678.279ON10662112022e-15
TDEL0C067801.24ON4682821992e-15
Suva_11.1232.479ON15262342022e-15
KLLA0F13552g2.479ON12672012023e-15
Smik_7.938.140ON5632181993e-15
AGR058W8.279ON10711962013e-15
KLTH0D11044g8.668ON8492102003e-15
TPHA0F024306.31ON7982781995e-15
KNAG0D002106.371ON8331981995e-15
KAFR0D012207.86ON10551972005e-15
CAGL0M11396g8.279ON11922102005e-15
Kwal_56.224766.31ON6972761985e-15
TBLA0B004906.31ON7872991995e-15
Ecym_42918.279ON11451961995e-15
NCAS0B044906.222ON3492051935e-15
KLTH0C10912g6.31ON6972761985e-15
Skud_10.1191.271ON14812621996e-15
ACR133C8.668ON8512001987e-15
Ecym_10301.24ON4402791957e-15
TBLA0B082503.92ON13472161988e-15
KLTH0G13288g8.279ON11422131989e-15
KNAG0F002901.52ON11252521971e-14
Smik_10.1471.271ON14782711971e-14
SAKL0H07084g8.654ON9192051971e-14
Kpol_1044.37.86ON9321791971e-14
YJL095W (BCK1)1.271ON14782621971e-14
KLLA0C01650g1.52ON11123021971e-14
CAGL0B01925g8.279ON9442151961e-14
KLLA0F14190g1.271ON13382541971e-14
Skud_16.1328.668ON9243141961e-14
Skud_3.391.52ON10173001961e-14
TDEL0H036407.86ON12371841961e-14
KLTH0D03454g1.271ON14332611961e-14
KNAG0D008306.262ON3873031911e-14
Skud_3.1656.371ON7161971951e-14
YDR122W (KIN1)8.279ON10641981961e-14
Kwal_26.77882.479ON12672031961e-14
KLTH0G05214g5.591ON6532641941e-14
ZYRO0D06776g8.279ON12042101952e-14
Suva_3.1901.52ON10242371952e-14
TDEL0F040608.279ON11262001952e-14
NDAI0G034508.141ON9483231942e-14
Kwal_26.71547.86ON12132441942e-14
Smik_6.3478.668ON9173121942e-14
CAGL0F00913g7.86ON12062001942e-14
ZYRO0G03366g2.479ON16161991942e-14
KLLA0E21693g5.406ON10162251932e-14
Suva_2.2838.279ON10891981933e-14
YPL150W8.668ON9013141933e-14
Kwal_56.237178.279ON8582131923e-14
YDR523C (SPS1)1.24ON4902001903e-14
ZYRO0F07194g8.668ON9382101923e-14
TBLA0I011502.479ON17451991933e-14
SAKL0G01848g5.406ON8851971923e-14
CAGL0K02167g8.140ON11622771923e-14
TDEL0A027202.496ON9152361923e-14
TPHA0H026307.86ON13671831934e-14
CAGL0L03520g1.271ON14472841924e-14
KNAG0G021108.279ON11921971924e-14
Suva_7.838.140ON5692121904e-14
Suva_6.1691.271ON14842161924e-14
KAFR0D049505.406ON10082021914e-14
KAFR0B028008.279ON10952171924e-14
KNAG0A065402.479ON14321981925e-14
Skud_11.1262.479ON15182471925e-14
SAKL0C01716g1.52ON12152321915e-14
CAGL0I07513g3.92ON10762481915e-14
Skud_8.1635.406ON10761961915e-14
TDEL0F009308.140ON11302351915e-14
TPHA0E036401.52ON11371981915e-14
Skud_5.2498.140ON11472671915e-14
Skud_4.3838.279ON10652091915e-14
Kpol_1065.36.222ON3762741866e-14
Suva_15.2975.406ON10741961906e-14
AFL101C6.222ON3672771856e-14
ZYRO0B01166g2.496ON9632351907e-14
Kwal_47.172528.141ON8723101897e-14
Kpol_1031.105.406ON11271961907e-14
NDAI0B020708.279ON12581981907e-14
Suva_7.828.141ON9003131898e-14
KAFR0D032002.479ON14482001908e-14
AFR724C1.24ON4402781868e-14
Suva_2.6871.52ON11283011898e-14
Ecym_73922.479ON14342021899e-14
Ecym_26407.86ON13251811899e-14
NCAS0C041208.140ON9152631899e-14
Smik_4.7673.92ON7582551881e-13
NCAS0G012106.262ON3673441831e-13
NCAS0B050908.279ON12102111881e-13
YGL180W (ATG1)8.141ON8973141871e-13
Smik_7.928.141ON8973151871e-13
TBLA0C046008.279ON13151981871e-13
Ecym_12751.374ON4512911841e-13
TPHA0G016308.668ON8712031871e-13
ACL104C5.406ON9472011871e-13
Smik_8.1805.406ON10731961871e-13
KLTH0D10714g8.654ON8722081872e-13
KLLA0C00979g1.24ON4832931842e-13
KNAG0J016708.668ON10092001872e-13
NDAI0E012908.654ON7292391862e-13
Skud_4.7831.52ON11353011872e-13
CAGL0L11550g5.406ON10722041862e-13
KAFR0C014403.92ON10952431862e-13
YKL101W (HSL1)2.479ON15182351872e-13
Skud_7.918.141ON8973141862e-13
Smik_3.1896.371ON7191951852e-13
Kpol_463.81.271ON14472781862e-13
Sklu_YGOB_Anc_2.4962.496ON6192331852e-13
ACR281C7.86ON12591811862e-13
AFR696C1.52ON11422321862e-13
KLTH0D02486g7.86ON12231801862e-13
NDAI0J012508.279ON11761971862e-13
NCAS0A057702.479ON14611991862e-13
NCAS0B086001.52ON11172341852e-13
Kpol_1055.242.496ON9372681852e-13
Smik_4.7891.52ON11362011852e-13
Skud_4.7643.92ON7563031843e-13
CAGL0K05709g1.52ON11032371853e-13
NDAI0C017005.406ON10201941853e-13
KLLA0F19536g8.279ON11041951853e-13
TPHA0J008208.279ON12181971853e-13
SAKL0A04246g6.222ON4002151813e-13
NDAI0E023908.668ON8832101843e-13
NOTE: 1 genes in the same pillar as Kwal_27.11542 were not hit in these BLAST results
LIST: KLLA0E08405g

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_27.11542
         (791 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_27.11542 s27 complement(841389..843764) [2376 bp, 791 aa] {...  1520   0.0  
KLTH0G10318g Chr7 (872129..874501) [2373 bp, 790 aa] {ON} simila...   913   0.0  
SAKL0E07722g Chr5 complement(625066..627441) [2376 bp, 791 aa] {...   717   0.0  
Suva_9.104 Chr9 (178011..180428) [2418 bp, 805 aa] {ON} YIL095W ...   608   0.0  
Skud_9.78 Chr9 (160531..162960) [2430 bp, 809 aa] {ON} YIL095W (...   607   0.0  
YIL095W Chr9 (183937..186369) [2433 bp, 810 aa] {ON}  PRK1Protei...   605   0.0  
Smik_9.84 Chr9 (162983..165409) [2427 bp, 808 aa] {ON} YIL095W (...   593   0.0  
TDEL0G02150 Chr7 (422718..424703) [1986 bp, 661 aa] {ON} Anc_2.2...   549   0.0  
ADL217W Chr4 (321491..323743) [2253 bp, 750 aa] {ON} Syntenic ho...   533   e-179
Ecym_3323 Chr3 (618386..620632) [2247 bp, 748 aa] {ON} similar t...   532   e-178
TPHA0C03380 Chr3 (740939..743032) [2094 bp, 697 aa] {ON} Anc_2.2...   519   e-174
CAGL0G02607g Chr7 complement(240244..242310) [2067 bp, 688 aa] {...   515   e-173
NCAS0G03810 Chr7 complement(703842..705827) [1986 bp, 661 aa] {O...   514   e-173
NDAI0G00640 Chr7 (139655..141520) [1866 bp, 621 aa] {ON} Anc_2.284    508   e-171
KAFR0J01370 Chr10 complement(250424..252766) [2343 bp, 780 aa] {...   513   e-170
ZYRO0A01848g Chr1 (152134..154248) [2115 bp, 704 aa] {ON} simila...   510   e-170
NCAS0B06260 Chr2 complement(1180650..1182821) [2172 bp, 723 aa] ...   509   e-170
KAFR0H03330 Chr8 complement(635910..637019) [1110 bp, 369 aa] {O...   494   e-169
NDAI0B03560 Chr2 complement(892839..895109) [2271 bp, 756 aa] {O...   507   e-169
Kpol_1003.35 s1003 (89266..91407) [2142 bp, 713 aa] {ON} (89266....   495   e-165
Skud_14.309 Chr14 complement(566344..568263) [1920 bp, 639 aa] {...   491   e-164
YNL020C Chr14 complement(595623..597539) [1917 bp, 638 aa] {ON} ...   490   e-164
Suva_14.327 Chr14 complement(578572..580470) [1899 bp, 632 aa] {...   489   e-163
KNAG0H02020 Chr8 complement(357248..359026) [1779 bp, 592 aa] {O...   483   e-161
Smik_14.311 Chr14 complement(558013..559926) [1914 bp, 637 aa] {...   484   e-161
TBLA0B05930 Chr2 (1400163..1402316) [2154 bp, 717 aa] {ON} Anc_2...   486   e-161
Kpol_1039.33 s1039 complement(102096..104201) [2106 bp, 701 aa] ...   465   e-153
TBLA0B06940 Chr2 (1639189..1643520) [4332 bp, 1443 aa] {ON} Anc_...   471   e-148
CAGL0J03432g Chr10 (330031..331899) [1869 bp, 622 aa] {ON} simil...   439   e-144
KNAG0A05430 Chr1 complement(800787..803153) [2367 bp, 788 aa] {O...   440   e-142
TPHA0D01540 Chr4 complement(316471..318594) [2124 bp, 707 aa] {O...   437   e-142
Kwal_27.10945 s27 (565717..568524) [2808 bp, 935 aa] {ON} YBR059...   329   4e-99
KLTH0C07260g Chr3 (626334..629039) [2706 bp, 901 aa] {ON} simila...   328   1e-98
SAKL0D03234g Chr4 (262365..264941) [2577 bp, 858 aa] {ON} some s...   326   2e-98
KNAG0J00820 Chr10 complement(137927..141202) [3276 bp, 1091 aa] ...   330   3e-98
Kpol_251.4 s251 (5802..8318) [2517 bp, 838 aa] {ON} (5802..8318)...   322   3e-97
KAFR0A01040 Chr1 complement(197612..200350) [2739 bp, 912 aa] {O...   322   2e-96
KNAG0H01220 Chr8 (209884..212625) [2742 bp, 913 aa] {ON} Anc_3.2...   320   6e-96
CAGL0H10208g Chr8 complement(996853..999936) [3084 bp, 1027 aa] ...   322   2e-95
KAFR0C00430 Chr3 complement(88561..91410) [2850 bp, 949 aa] {ON}...   320   2e-95
Kpol_1052.22 s1052 (72364..75669) [3306 bp, 1101 aa] {ON} (72364...   322   2e-95
KLLA0F18612g Chr6 (1711131..1713575) [2445 bp, 814 aa] {ON} some...   315   6e-95
Ecym_2650 Chr2 complement(1257641..1260325) [2685 bp, 894 aa] {O...   316   1e-94
TBLA0E02590 Chr5 complement(651679..654864) [3186 bp, 1061 aa] {...   320   1e-94
NCAS0A10590 Chr1 complement(2108142..2111429) [3288 bp, 1095 aa]...   318   9e-94
Smik_2.191 Chr2 complement(338792..342118) [3327 bp, 1108 aa] {O...   318   1e-93
TPHA0A04030 Chr1 (901665..904829) [3165 bp, 1054 aa] {ON} Anc_3....   317   1e-93
Suva_4.297 Chr4 complement(523650..526973) [3324 bp, 1107 aa] {O...   318   1e-93
Skud_2.179 Chr2 complement(325193..328465) [3273 bp, 1090 aa] {O...   317   1e-93
NDAI0A05700 Chr1 (1288604..1292077) [3474 bp, 1157 aa] {ON} Anc_...   318   2e-93
ZYRO0E06864g Chr5 complement(516731..520078) [3348 bp, 1115 aa] ...   317   2e-93
TPHA0M01120 Chr13 complement(223548..225914) [2367 bp, 788 aa] {...   310   5e-93
YBR059C Chr2 complement(356861..360187) [3327 bp, 1108 aa] {ON} ...   315   2e-92
AGR027C Chr7 complement(763303..766188) [2886 bp, 961 aa] {ON} S...   308   7e-91
CAGL0K11990g Chr11 complement(1156224..1159199) [2976 bp, 991 aa...   308   7e-91
TDEL0D03520 Chr4 (647828..650977) [3150 bp, 1049 aa] {ON} Anc_3....   306   1e-89
TBLA0I01930 Chr9 complement(436511..440596) [4086 bp, 1361 aa] {...   305   6e-88
Kwal_56.24274 s56 (932404..933444) [1041 bp, 346 aa] {ON} YPL236...    99   1e-21
Skud_16.42 Chr16 complement(75193..76287) [1095 bp, 364 aa] {ON}...    99   2e-21
TDEL0A06750 Chr1 (1179818..1180936) [1119 bp, 372 aa] {ON} Anc_6...    97   7e-21
YPL236C Chr16 complement(101608..102702) [1095 bp, 364 aa] {ON} ...    96   2e-20
KNAG0F00170 Chr6 (13778..15409) [1632 bp, 543 aa] {ON} Anc_1.24 ...    97   3e-20
Kpol_2002.24 s2002 (48405..49868) [1464 bp, 487 aa] {ON} (48405....    94   2e-19
Ecym_2153 Chr2 complement(287697..288788) [1092 bp, 363 aa] {ON}...    93   2e-19
KLTH0H03080g Chr8 complement(274038..275078) [1041 bp, 346 aa] {...    92   3e-19
Suva_16.70 Chr16 complement(110631..111725) [1095 bp, 364 aa] {O...    92   4e-19
KAFR0A05090 Chr1 (1011918..1013924) [2007 bp, 668 aa] {ON}             94   5e-19
Kpol_1023.26 s1023 (51805..54024) [2220 bp, 739 aa] {ON} (51805....    93   1e-18
Kpol_1037.20 s1037 (41658..43772) [2115 bp, 704 aa] {ON} (41658....    92   1e-18
CAGL0J11638g Chr10 complement(1130744..1132984) [2241 bp, 746 aa...    92   1e-18
CAGL0K08514g Chr11 complement(854143..858612) [4470 bp, 1489 aa]...    93   2e-18
NCAS0C04100 Chr3 (834997..837714) [2718 bp, 905 aa] {ON} Anc_8.141     92   2e-18
ZYRO0E07876g Chr5 (616134..617243) [1110 bp, 369 aa] {ON} simila...    90   2e-18
Smik_6.441 Chr6 (721619..722713) [1095 bp, 364 aa] {ON} YPL236C ...    89   3e-18
TDEL0G04380 Chr7 (792278..794446) [2169 bp, 722 aa] {ON} Anc_6.3...    91   3e-18
NDAI0F04520 Chr6 complement(1098426..1099895) [1470 bp, 489 aa] ...    90   4e-18
KNAG0E00850 Chr5 complement(158992..161127) [2136 bp, 711 aa] {O...    91   4e-18
NDAI0C02680 Chr3 complement(621951..624203) [2253 bp, 750 aa] {O...    91   6e-18
SAKL0A03344g Chr1 complement(305149..306243) [1095 bp, 364 aa] {...    88   6e-18
TPHA0J00420 Chr10 complement(96445..98568) [2124 bp, 707 aa] {ON...    90   8e-18
YAR019C Chr1 complement(172211..175135) [2925 bp, 974 aa] {ON}  ...    91   8e-18
TPHA0E03850 Chr5 complement(810694..812142) [1449 bp, 482 aa] {O...    89   1e-17
Smik_1.79 Chr1 complement(149839..152763) [2925 bp, 974 aa] {ON}...    90   1e-17
ABL034W Chr2 (333432..337709) [4278 bp, 1425 aa] {ON} Syntenic h...    90   2e-17
Suva_13.163 Chr13 complement(259136..261253) [2118 bp, 705 aa] {...    89   2e-17
Skud_13.154 Chr13 complement(255263..257380) [2118 bp, 705 aa] {...    89   2e-17
SAKL0H06754g Chr8 (594995..597649) [2655 bp, 884 aa] {ON} simila...    89   2e-17
Smik_13.159 Chr13 complement(260249..262366) [2118 bp, 705 aa] {...    89   2e-17
YMR001C Chr13 complement(269019..271136) [2118 bp, 705 aa] {ON} ...    89   2e-17
NCAS0D02100 Chr4 (385878..388058) [2181 bp, 726 aa] {ON} Anc_6.31      88   3e-17
TBLA0A07460 Chr1 (1848207..1849757) [1551 bp, 516 aa] {ON} Anc_1...    87   3e-17
KNAG0D04810 Chr4 (867817..872139) [4323 bp, 1440 aa] {ON} Anc_7....    89   3e-17
KLLA0C06138g Chr3 (540409..542535) [2127 bp, 708 aa] {ON} simila...    88   4e-17
Kpol_1072.19 s1072 (44906..47596) [2691 bp, 896 aa] {ON} (44906....    88   5e-17
Ecym_3035 Chr3 complement(70391..72613) [2223 bp, 740 aa] {ON} s...    87   5e-17
SAKL0C00946g Chr3 (84995..86689) [1695 bp, 564 aa] {ON} similar ...    87   6e-17
Skud_1.72 Chr1 (141337..144261) [2925 bp, 974 aa] {ON} YAR019C (...    87   7e-17
KLTH0F16676g Chr6 complement(1351362..1353998) [2637 bp, 878 aa]...    87   8e-17
Kpol_431.9 s431 complement(22310..26968) [4659 bp, 1552 aa] {ON}...    87   8e-17
KAFR0G01200 Chr7 (273238..274761) [1524 bp, 507 aa] {ON} Anc_1.2...    86   1e-16
KLTH0F00946g Chr6 (73412..74950) [1539 bp, 512 aa] {ON} similar ...    86   1e-16
ZYRO0D05500g Chr4 (473262..477050) [3789 bp, 1262 aa] {ON} weakl...    87   1e-16
ACL006W Chr3 (344395..346521) [2127 bp, 708 aa] {ON} Syntenic ho...    86   1e-16
TPHA0G03200 Chr7 (683296..687900) [4605 bp, 1534 aa] {ON} Anc_2....    87   2e-16
Kwal_26.8751 s26 complement(928853..931399) [2547 bp, 848 aa] {O...    86   2e-16
Kwal_26.7355 s26 (326867..331207) [4341 bp, 1446 aa] {ON} YJL095...    86   2e-16
CAGL0M02299g Chr13 (273725..276406) [2682 bp, 893 aa] {ON} simil...    86   2e-16
SAKL0H16632g Chr8 complement(1461613..1464801) [3189 bp, 1062 aa...    86   2e-16
KAFR0G02690 Chr7 complement(555573..557714) [2142 bp, 713 aa] {O...    85   3e-16
ZYRO0C07480g Chr3 (565426..567750) [2325 bp, 774 aa] {ON} highly...    85   4e-16
Kwal_33.13112 s33 (76807..78324) [1518 bp, 505 aa] {ON} YDR523C ...    84   4e-16
NCAS0A00280 Chr1 (40406..42013) [1608 bp, 535 aa] {ON} Anc_1.24        84   5e-16
ZYRO0F18062g Chr6 complement(1494752..1496167) [1416 bp, 471 aa]...    84   5e-16
TDEL0A06140 Chr1 complement(1074016..1076601) [2586 bp, 861 aa] ...    84   5e-16
TBLA0D02230 Chr4 (557816..561280) [3465 bp, 1154 aa] {ON} Anc_8....    85   5e-16
TDEL0A02550 Chr1 (457841..461950) [4110 bp, 1369 aa] {ON} Anc_2....    85   6e-16
Suva_16.160 Chr16 (277393..280149) [2757 bp, 918 aa] {ON} YPL150...    84   7e-16
KLLA0F11319g Chr6 (1042436..1044967) [2532 bp, 843 aa] {ON} simi...    84   7e-16
Suva_1.86 Chr1 complement(150761..153685) [2925 bp, 974 aa] {ON}...    84   9e-16
NDAI0K02100 Chr11 complement(469575..472304) [2730 bp, 909 aa] {...    84   9e-16
Kwal_55.21545 s55 complement(882294..884891) [2598 bp, 865 aa] {...    84   1e-15
KNAG0F02900 Chr6 (549477..551426) [1950 bp, 649 aa] {ON}               83   1e-15
SAKL0E01584g Chr5 complement(121830..123917) [2088 bp, 695 aa] {...    83   1e-15
NCAS0C01670 Chr3 complement(306682..309372) [2691 bp, 896 aa] {O...    83   2e-15
TBLA0A07150 Chr1 (1776160..1780335) [4176 bp, 1391 aa] {ON} Anc_...    83   2e-15
TBLA0A04720 Chr1 (1168895..1172683) [3789 bp, 1262 aa] {ON} Anc_...    83   2e-15
KLTH0D05566g Chr4 (498055..501441) [3387 bp, 1128 aa] {ON} weakl...    83   2e-15
Smik_4.367 Chr4 (655941..659141) [3201 bp, 1066 aa] {ON} YDR122W...    82   2e-15
TDEL0C06780 Chr3 complement(1236767..1238173) [1407 bp, 468 aa] ...    81   2e-15
Suva_11.123 Chr11 (235064..239644) [4581 bp, 1526 aa] {ON} YKL10...    82   2e-15
KLLA0F13552g Chr6 complement(1252906..1256709) [3804 bp, 1267 aa...    82   3e-15
Smik_7.93 Chr7 complement(158441..160132) [1692 bp, 563 aa] {ON}...    81   3e-15
AGR058W Chr7 (823626..826841) [3216 bp, 1071 aa] {ON} Syntenic h...    82   3e-15
KLTH0D11044g Chr4 complement(901388..903937) [2550 bp, 849 aa] {...    82   3e-15
TPHA0F02430 Chr6 complement(535865..538261) [2397 bp, 798 aa] {O...    81   5e-15
KNAG0D00210 Chr4 complement(22721..25222) [2502 bp, 833 aa] {ON}...    81   5e-15
KAFR0D01220 Chr4 (246927..250094) [3168 bp, 1055 aa] {ON} Anc_7....    82   5e-15
CAGL0M11396g Chr13 (1122109..1125687) [3579 bp, 1192 aa] {ON} si...    82   5e-15
Kwal_56.22476 s56 complement(145039..147132) [2094 bp, 697 aa] {...    81   5e-15
TBLA0B00490 Chr2 complement(94755..97118) [2364 bp, 787 aa] {ON}...    81   5e-15
Ecym_4291 Chr4 complement(620549..623986) [3438 bp, 1145 aa] {ON...    81   5e-15
NCAS0B04490 Chr2 (814474..815523) [1050 bp, 349 aa] {ON} Anc_8.141     79   5e-15
KLTH0C10912g Chr3 (898372..900465) [2094 bp, 697 aa] {ON} highly...    81   5e-15
Skud_10.119 Chr10 (215299..219744) [4446 bp, 1481 aa] {ON} YJL09...    81   6e-15
ACR133C Chr3 complement(581468..584023) [2556 bp, 851 aa] {ON} S...    81   7e-15
Ecym_1030 Chr1 (56043..57365) [1323 bp, 440 aa] {ON} similar to ...    80   7e-15
TBLA0B08250 Chr2 complement(1968879..1972922) [4044 bp, 1347 aa]...    81   8e-15
KLTH0G13288g Chr7 complement(1139058..1142486) [3429 bp, 1142 aa...    81   9e-15
KNAG0F00290 Chr6 (31750..35127) [3378 bp, 1125 aa] {ON} Anc_1.52...    80   1e-14
Smik_10.147 Chr10 (239101..243537) [4437 bp, 1478 aa] {ON} YJL09...    80   1e-14
SAKL0H07084g Chr8 complement(619288..622047) [2760 bp, 919 aa] {...    80   1e-14
Kpol_1044.3 s1044 (4910..5845,5849..7711) [2799 bp, 932 aa] {ON}...    80   1e-14
YJL095W Chr10 (247255..251691) [4437 bp, 1478 aa] {ON}  BCK1Mito...    80   1e-14
KLLA0C01650g Chr3 (128119..131457) [3339 bp, 1112 aa] {ON} simil...    80   1e-14
CAGL0B01925g Chr2 (176316..179150) [2835 bp, 944 aa] {ON} simila...    80   1e-14
KLLA0F14190g Chr6 (1311121..1315137) [4017 bp, 1338 aa] {ON} uni...    80   1e-14
Skud_16.132 Chr16 (239797..242571) [2775 bp, 924 aa] {ON} YPL150...    80   1e-14
Skud_3.39 Chr3 (66201..69254) [3054 bp, 1017 aa] {ON} YCL024W (R...    80   1e-14
TDEL0H03640 Chr8 complement(600211..603924) [3714 bp, 1237 aa] {...    80   1e-14
KLTH0D03454g Chr4 (327039..331340) [4302 bp, 1433 aa] {ON} simil...    80   1e-14
KNAG0D00830 Chr4 complement(130823..131986) [1164 bp, 387 aa] {O...    78   1e-14
Skud_3.165 Chr3 (258916..261066) [2151 bp, 716 aa] {ON} YCR091W ...    80   1e-14
YDR122W Chr4 (694700..697894) [3195 bp, 1064 aa] {ON}  KIN1Serin...    80   1e-14
Kwal_26.7788 s26 (511530..515333) [3804 bp, 1267 aa] {ON} YKL101...    80   1e-14
KLTH0G05214g Chr7 (423793..425754) [1962 bp, 653 aa] {ON} weakly...    79   1e-14
ZYRO0D06776g Chr4 complement(583027..586641) [3615 bp, 1204 aa] ...    80   2e-14
Suva_3.190 Chr3 (288639..288813,288870..291766) [3072 bp, 1024 a...    80   2e-14
TDEL0F04060 Chr6 (749896..753276) [3381 bp, 1126 aa] {ON} Anc_8....    80   2e-14
NDAI0G03450 Chr7 (822716..825562) [2847 bp, 948 aa] {ON} Anc_8.141     79   2e-14
Kwal_26.7154 s26 (237387..241028) [3642 bp, 1213 aa] {ON} YOL045...    79   2e-14
Smik_6.347 Chr6 complement(553316..556069) [2754 bp, 917 aa] {ON...    79   2e-14
CAGL0F00913g Chr6 (97023..100643) [3621 bp, 1206 aa] {ON} simila...    79   2e-14
ZYRO0G03366g Chr7 (261014..265864) [4851 bp, 1616 aa] {ON} simil...    79   2e-14
KLLA0E21693g Chr5 complement(1936438..1939488) [3051 bp, 1016 aa...    79   2e-14
Suva_2.283 Chr2 (489490..492759) [3270 bp, 1089 aa] {ON} YDR122W...    79   3e-14
YPL150W Chr16 (268188..270893) [2706 bp, 901 aa] {ON} Protein ki...    79   3e-14
Kwal_56.23717 s56 complement(674222..676798) [2577 bp, 858 aa] {...    79   3e-14
YDR523C Chr4 complement(1485566..1487038) [1473 bp, 490 aa] {ON}...    78   3e-14
ZYRO0F07194g Chr6 complement(581438..584254) [2817 bp, 938 aa] {...    79   3e-14
TBLA0I01150 Chr9 complement(235187..240424) [5238 bp, 1745 aa] {...    79   3e-14
SAKL0G01848g Chr7 (154547..157204) [2658 bp, 885 aa] {ON} weakly...    79   3e-14
CAGL0K02167g Chr11 complement(192297..195785) [3489 bp, 1162 aa]...    79   3e-14
TDEL0A02720 Chr1 complement(491618..494365) [2748 bp, 915 aa] {O...    79   3e-14
TPHA0H02630 Chr8 complement(614048..618151) [4104 bp, 1367 aa] {...    79   4e-14
CAGL0L03520g Chr12 complement(403100..407443) [4344 bp, 1447 aa]...    79   4e-14
KNAG0G02110 Chr7 (477260..480838) [3579 bp, 1192 aa] {ON} Anc_8....    79   4e-14
Suva_7.83 Chr7 complement(159329..161038) [1710 bp, 569 aa] {ON}...    78   4e-14
Suva_6.169 Chr6 complement(300200..304654) [4455 bp, 1484 aa] {O...    79   4e-14
KAFR0D04950 Chr4 (971956..974982) [3027 bp, 1008 aa] {ON} Anc_5....    78   4e-14
KAFR0B02800 Chr2 (571295..574582) [3288 bp, 1095 aa] {ON} Anc_8....    79   4e-14
KNAG0A06540 Chr1 (1002435..1006733) [4299 bp, 1432 aa] {ON} Anc_...    79   5e-14
Skud_11.126 Chr11 (235011..239567) [4557 bp, 1518 aa] {ON} YKL10...    79   5e-14
SAKL0C01716g Chr3 (143880..147527) [3648 bp, 1215 aa] {ON} simil...    78   5e-14
CAGL0I07513g Chr9 (722045..725275) [3231 bp, 1076 aa] {ON} simil...    78   5e-14
Skud_8.163 Chr8 (290415..293645) [3231 bp, 1076 aa] {ON} YHR102W...    78   5e-14
TDEL0F00930 Chr6 complement(160181..163573) [3393 bp, 1130 aa] {...    78   5e-14
TPHA0E03640 Chr5 complement(769962..773375) [3414 bp, 1137 aa] {...    78   5e-14
Skud_5.249 Chr5 complement(400867..404310) [3444 bp, 1147 aa] {O...    78   5e-14
Skud_4.383 Chr4 (666354..669551) [3198 bp, 1065 aa] {ON} YDR122W...    78   5e-14
Kpol_1065.3 s1065 complement(4445..5575) [1131 bp, 376 aa] {ON} ...    76   6e-14
Suva_15.297 Chr15 (518854..520850,520945..522172) [3225 bp, 1074...    78   6e-14
AFL101C Chr6 complement(249144..250247) [1104 bp, 367 aa] {ON} S...    76   6e-14
ZYRO0B01166g Chr2 complement(97168..100059) [2892 bp, 963 aa] {O...    78   7e-14
Kwal_47.17252 s47 (318148..320766) [2619 bp, 872 aa] {ON} YGL180...    77   7e-14
Kpol_1031.10 s1031 (25064..28447) [3384 bp, 1127 aa] {ON} (25064...    78   7e-14
NDAI0B02070 Chr2 (514024..517800) [3777 bp, 1258 aa] {ON}              78   7e-14
Suva_7.82 Chr7 (156049..158751) [2703 bp, 900 aa] {ON} YGL180W (...    77   8e-14
KAFR0D03200 Chr4 (628993..633339) [4347 bp, 1448 aa] {ON} Anc_2....    78   8e-14
AFR724C Chr6 complement(1770338..1771660) [1323 bp, 440 aa] {ON}...    76   8e-14
Suva_2.687 Chr2 complement(1215095..1218481) [3387 bp, 1128 aa] ...    77   8e-14
Ecym_7392 Chr7 complement(803240..807544) [4305 bp, 1434 aa] {ON...    77   9e-14
Ecym_2640 Chr2 complement(1232617..1236594) [3978 bp, 1325 aa] {...    77   9e-14
NCAS0C04120 Chr3 complement(840008..842755) [2748 bp, 915 aa] {O...    77   9e-14
Smik_4.767 Chr4 complement(1353354..1355630) [2277 bp, 758 aa] {...    77   1e-13
NCAS0G01210 Chr7 complement(215860..216963) [1104 bp, 367 aa] {O...    75   1e-13
NCAS0B05090 Chr2 (946126..949758) [3633 bp, 1210 aa] {ON}              77   1e-13
YGL180W Chr7 (160065..162758) [2694 bp, 897 aa] {ON}  ATG1Protei...    77   1e-13
Smik_7.92 Chr7 (155049..157742) [2694 bp, 897 aa] {ON} YGL180W (...    77   1e-13
TBLA0C04600 Chr3 (1112043..1115990) [3948 bp, 1315 aa] {ON} Anc_...    77   1e-13
Ecym_1275 Chr1 complement(560481..561836) [1356 bp, 451 aa] {ON}...    75   1e-13
TPHA0G01630 Chr7 (336511..339126) [2616 bp, 871 aa] {ON} Anc_8.6...    77   1e-13
ACL104C Chr3 complement(157357..160200) [2844 bp, 947 aa] {ON} S...    77   1e-13
Smik_8.180 Chr8 (292993..296214) [3222 bp, 1073 aa] {ON} YHR102W...    77   1e-13
KLTH0D10714g Chr4 (880389..883007) [2619 bp, 872 aa] {ON} simila...    77   2e-13
KLLA0C00979g Chr3 (73295..74746) [1452 bp, 483 aa] {ON} similar ...    75   2e-13
KNAG0J01670 Chr10 complement(304021..307050) [3030 bp, 1009 aa] ...    77   2e-13
NDAI0E01290 Chr5 complement(255593..257782) [2190 bp, 729 aa] {O...    76   2e-13
Skud_4.783 Chr4 complement(1382552..1385959) [3408 bp, 1135 aa] ...    77   2e-13
CAGL0L11550g Chr12 (1232015..1235233) [3219 bp, 1072 aa] {ON} si...    76   2e-13
KAFR0C01440 Chr3 complement(295468..298755) [3288 bp, 1095 aa] {...    76   2e-13
YKL101W Chr11 (248920..253476) [4557 bp, 1518 aa] {ON}  HSL1Nim1...    77   2e-13
Skud_7.91 Chr7 (165681..168374) [2694 bp, 897 aa] {ON} YGL180W (...    76   2e-13
Smik_3.189 Chr3 (273885..276044) [2160 bp, 719 aa] {ON} YCR091W ...    76   2e-13
Kpol_463.8 s463 complement(18696..23039) [4344 bp, 1447 aa] {ON}...    76   2e-13
Sklu_YGOB_Anc_2.496 Chr5 (185447..187306) [1860 bp, 619 aa] {ON}...    76   2e-13
ACR281C Chr3 complement(864528..868307) [3780 bp, 1259 aa] {ON} ...    76   2e-13
AFR696C Chr6 complement(1722130..1725558) [3429 bp, 1142 aa] {ON...    76   2e-13
KLTH0D02486g Chr4 (247566..251237) [3672 bp, 1223 aa] {ON} simil...    76   2e-13
NDAI0J01250 Chr10 complement(291314..294844) [3531 bp, 1176 aa] ...    76   2e-13
NCAS0A05770 Chr1 (1132854..1137239) [4386 bp, 1461 aa] {ON} Anc_...    76   2e-13
NCAS0B08600 Chr2 (1649375..1652728) [3354 bp, 1117 aa] {ON} Anc_...    76   2e-13
Kpol_1055.24 s1055 complement(57430..60243) [2814 bp, 937 aa] {O...    76   2e-13
Smik_4.789 Chr4 complement(1385209..1388619) [3411 bp, 1136 aa] ...    76   2e-13
Skud_4.764 Chr4 complement(1351725..1353995) [2271 bp, 756 aa] {...    75   3e-13
CAGL0K05709g Chr11 complement(556732..560043) [3312 bp, 1103 aa]...    76   3e-13
NDAI0C01700 Chr3 complement(367077..370139) [3063 bp, 1020 aa] {...    76   3e-13
KLLA0F19536g Chr6 (1808263..1811577) [3315 bp, 1104 aa] {ON} sim...    76   3e-13
TPHA0J00820 Chr10 (193408..197064) [3657 bp, 1218 aa] {ON} Anc_8...    76   3e-13
SAKL0A04246g Chr1 complement(396019..397221) [1203 bp, 400 aa] {...    74   3e-13
NDAI0E02390 Chr5 complement(496256..498907) [2652 bp, 883 aa] {O...    75   3e-13
Smik_7.319 Chr7 complement(534132..535472) [1341 bp, 446 aa] {ON...    75   3e-13
KLLA0F07623g Chr6 (720246..723935) [3690 bp, 1229 aa] {ON} simil...    76   3e-13
KAFR0C03020 Chr3 complement(601565..603121) [1557 bp, 518 aa] {O...    75   3e-13
NCAS0A09470 Chr1 complement(1883183..1887730) [4548 bp, 1515 aa]...    75   4e-13
KLTH0C09548g Chr3 (792218..795199) [2982 bp, 993 aa] {ON} simila...    75   4e-13
Ecym_5505 Chr5 (1027605..1030616) [3012 bp, 1003 aa] {ON} simila...    75   4e-13
Kwal_26.7861 s26 complement(544126..546993) [2868 bp, 955 aa] {O...    75   4e-13
TBLA0E02290 Chr5 complement(563483..567385) [3903 bp, 1300 aa] {...    75   4e-13
Ecym_2434 Chr2 complement(843308..846676) [3369 bp, 1122 aa] {ON...    75   5e-13
YHR102W Chr8 (316572..319814) [3243 bp, 1080 aa] {ON}  KIC1Prote...    75   5e-13
Smik_4.803 Chr4 complement(1408345..1409817) [1473 bp, 490 aa] {...    74   5e-13
TDEL0A07860 Chr1 (1365985..1368498) [2514 bp, 837 aa] {ON} Anc_6...    75   5e-13
CAGL0K02673g Chr11 complement(241338..244085) [2748 bp, 915 aa] ...    75   5e-13
KLLA0B02332g Chr2 complement(206863..207948) [1086 bp, 361 aa] {...    73   5e-13
KAFR0K00700 Chr11 complement(153981..158126) [4146 bp, 1381 aa] ...    75   5e-13
KAFR0A03730 Chr1 (761946..764312) [2367 bp, 788 aa] {ON} Anc_8.6...    75   5e-13
Smik_16.296 Chr16 (542962..544128) [1167 bp, 388 aa] {ON} YPR054...    73   6e-13
NDAI0G05470 Chr7 (1340175..1344842) [4668 bp, 1555 aa] {ON} Anc_...    75   6e-13
Smik_11.139 Chr11 (235511..240115) [4605 bp, 1534 aa] {ON} YKL10...    75   6e-13
NCAS0B03740 Chr2 complement(668231..671380) [3150 bp, 1049 aa] {...    75   6e-13
Skud_16.340 Chr16 (631100..632266) [1167 bp, 388 aa] {ON} YPR054...    73   6e-13
TPHA0G03290 Chr7 (702953..705874) [2922 bp, 973 aa] {ON} Anc_2.4...    74   7e-13
Suva_2.666 Chr2 complement(1183839..1186133) [2295 bp, 764 aa] {...    74   7e-13
KNAG0B04320 Chr2 complement(821265..824348) [3084 bp, 1027 aa] {...    74   7e-13
TDEL0D05320 Chr4 complement(965082..968255) [3174 bp, 1057 aa] {...    74   7e-13
Suva_15.65 Chr15 (102271..105513) [3243 bp, 1080 aa] {ON} YOL100...    74   7e-13
NDAI0A00660 Chr1 (121773..124841) [3069 bp, 1022 aa] {ON} Anc_1.52     74   7e-13
CAGL0H06259g Chr8 (615045..619055) [4011 bp, 1336 aa] {ON} simil...    74   7e-13
YCR091W Chr3 (274404..276566) [2163 bp, 720 aa] {ON}  KIN82Putat...    74   7e-13
NDAI0H02470 Chr8 complement(597707..601942) [4236 bp, 1411 aa] {...    74   8e-13
YNR047W Chr14 (708523..711204) [2682 bp, 893 aa] {ON}  FPK1Ser/T...    74   8e-13
ZYRO0G15290g Chr7 complement(1237119..1241582) [4464 bp, 1487 aa...    74   8e-13
YDR490C Chr4 complement(1431968..1434268) [2301 bp, 766 aa] {ON}...    74   8e-13
ZYRO0G19052g Chr7 (1576638..1580033) [3396 bp, 1131 aa] {ON} sim...    74   8e-13
NCAS0H01940 Chr8 (374913..377960) [3048 bp, 1015 aa] {ON} Anc_5....    74   8e-13
CAGL0L06006g Chr12 complement(672704..675532) [2829 bp, 942 aa] ...    74   8e-13
NDAI0D02750 Chr4 (639802..644349) [4548 bp, 1515 aa] {ON} Anc_2....    74   8e-13
Ecym_1058 Chr1 (105835..109329) [3495 bp, 1164 aa] {ON} similar ...    74   8e-13
Skud_14.379 Chr14 (677081..679774) [2694 bp, 897 aa] {ON} YNR047...    74   9e-13
TPHA0I00920 Chr9 (204753..209057) [4305 bp, 1434 aa] {ON} Anc_1....    74   9e-13
TPHA0H01630 Chr8 (371333..374443) [3111 bp, 1036 aa] {ON} Anc_5....    74   9e-13
ZYRO0C06776g Chr3 complement(508813..511485) [2673 bp, 890 aa] {...    74   9e-13
Smik_14.377 Chr14 (666338..669025) [2688 bp, 895 aa] {ON} YNR047...    74   1e-12
SAKL0E02860g Chr5 complement(228726..232859) [4134 bp, 1377 aa] ...    74   1e-12
KLLA0C08525g Chr3 (744554..749209) [4656 bp, 1551 aa] {ON} simil...    74   1e-12
Kpol_1072.29 s1072 complement(61987..64668) [2682 bp, 893 aa] {O...    74   1e-12
ABR014W Chr2 (417708..420623) [2916 bp, 971 aa] {ON} Syntenic ho...    74   1e-12
NDAI0F01600 Chr6 complement(392424..393662) [1239 bp, 412 aa] {O...    72   1e-12
Suva_5.250 Chr5 (392904..396323) [3420 bp, 1139 aa] {ON} YER129W...    74   1e-12
NDAI0K02390 Chr11 (537260..539920) [2661 bp, 886 aa] {ON} Anc_6....    74   1e-12
Suva_14.402 Chr14 (690198..692915) [2718 bp, 905 aa] {ON} YNR047...    74   1e-12
Smik_4.532 Chr4 complement(956572..961554) [4983 bp, 1660 aa] {O...    74   1e-12
Skud_7.92 Chr7 complement(169006..170697) [1692 bp, 563 aa] {ON}...    73   1e-12
TBLA0A03570 Chr1 (892930..895857) [2928 bp, 975 aa] {ON} Anc_5.4...    74   1e-12
TPHA0D01140 Chr4 (238656..240524) [1869 bp, 622 aa] {ON} Anc_8.6...    73   1e-12
Kwal_56.22693 s56 complement(239982..242936) [2955 bp, 984 aa] {...    74   1e-12
KNAG0L00520 Chr12 (79786..80892) [1107 bp, 368 aa] {ON} Anc_7.86...    72   1e-12
NCAS0A05050 Chr1 complement(1002107..1004788) [2682 bp, 893 aa] ...    73   2e-12
TBLA0H01660 Chr8 complement(377521..380511) [2991 bp, 996 aa] {O...    73   2e-12
KNAG0B05350 Chr2 complement(1034166..1036676) [2511 bp, 836 aa] ...    73   2e-12
Kpol_1040.20 s1040 (57057..60950) [3894 bp, 1297 aa] {ON} (57057...    73   2e-12
NCAS0D04710 Chr4 complement(901442..903856) [2415 bp, 804 aa] {O...    73   2e-12
ZYRO0G16632g Chr7 (1360854..1365827) [4974 bp, 1657 aa] {ON} hig...    74   2e-12
Skud_4.797 Chr4 complement(1405618..1407075) [1458 bp, 485 aa] {...    72   2e-12
Ecym_2405 Chr2 (788655..791222) [2568 bp, 855 aa] {ON} similar t...    73   2e-12
Ecym_8339 Chr8 (684113..686875) [2763 bp, 920 aa] {ON} similar t...    73   2e-12
TPHA0E02820 Chr5 complement(589816..590970) [1155 bp, 384 aa] {O...    72   2e-12
Kwal_56.24091 s56 (845680..846825) [1146 bp, 381 aa] {ON} YPL209...    72   2e-12
Suva_2.703 Chr2 complement(1238496..1239953) [1458 bp, 485 aa] {...    72   2e-12
NCAS0F01580 Chr6 complement(313801..317949) [4149 bp, 1382 aa] {...    73   2e-12
YDR507C Chr4 complement(1462358..1465786) [3429 bp, 1142 aa] {ON...    73   2e-12
Smik_3.54 Chr3 (80309..83407) [3099 bp, 1032 aa] {ON} YCL024W (R...    73   2e-12
Skud_8.39 Chr8 complement(76730..79501) [2772 bp, 923 aa] {ON} Y...    73   2e-12
Smik_15.57 Chr15 (92331..95576) [3246 bp, 1081 aa] {ON} YOL100W ...    73   2e-12
KLLA0C18568g Chr3 (1639958..1642282) [2325 bp, 774 aa] {ON} simi...    72   2e-12
ZYRO0A06446g Chr1 complement(513126..515957) [2832 bp, 943 aa] {...    73   2e-12
Skud_15.54 Chr15 (88576..91824) [3249 bp, 1082 aa] {ON} YOL100W ...    73   2e-12
CAGL0F04741g Chr6 (478256..479584) [1329 bp, 442 aa] {ON} simila...    72   2e-12
KLTH0F01672g Chr6 (127277..130771) [3495 bp, 1164 aa] {ON} simil...    73   2e-12
AFR335C Chr6 complement(1046756..1049857) [3102 bp, 1033 aa] {ON...    73   2e-12
Ecym_3488 Chr3 complement(915087..916400) [1314 bp, 437 aa] {ON}...    72   3e-12
KLLA0C12485g Chr3 (1060167..1062944) [2778 bp, 925 aa] {ON} simi...    72   3e-12
Smik_15.122 Chr15 (209665..212970) [3306 bp, 1101 aa] {ON} YOL04...    72   3e-12
KNAG0G01240 Chr7 (277868..280597) [2730 bp, 909 aa] {ON} Anc_8.1...    72   3e-12
AFR092W Chr6 (595092..599363) [4272 bp, 1423 aa] {ON} Syntenic h...    73   3e-12
KNAG0I02670 Chr9 complement(524008..526734) [2727 bp, 908 aa] {O...    72   3e-12
NDAI0G04290 Chr7 complement(1030530..1033871) [3342 bp, 1113 aa]...    72   3e-12
Kwal_47.18307 s47 complement(776521..778386) [1866 bp, 621 aa] {...    72   3e-12
TPHA0O01120 Chr15 complement(217462..218751) [1290 bp, 429 aa] {...    71   3e-12
SAKL0D05522g Chr4 (437018..441442) [4425 bp, 1474 aa] {ON} simil...    72   3e-12
KAFR0A01420 Chr1 (276454..280650) [4197 bp, 1398 aa] {ON} Anc_1....    72   3e-12
TBLA0B01630 Chr2 (360963..364850) [3888 bp, 1295 aa] {ON} Anc_3....    72   3e-12
Kwal_26.8709 s26 (907885..910374) [2490 bp, 829 aa] {ON} YPL141C...    72   3e-12
YGL179C Chr7 complement(163409..165091) [1683 bp, 560 aa] {ON}  ...    72   3e-12
YDR283C Chr4 complement(1025070..1030049) [4980 bp, 1659 aa] {ON...    72   3e-12
TPHA0H00420 Chr8 complement(82575..85691) [3117 bp, 1038 aa] {ON...    72   3e-12
CAGL0G04609g Chr7 complement(437162..440059) [2898 bp, 965 aa] {...    72   4e-12
KNAG0B01780 Chr2 (326438..331180) [4743 bp, 1580 aa] {ON} Anc_1....    72   4e-12
Suva_8.47 Chr8 complement(91615..94557) [2943 bp, 980 aa] {ON} Y...    72   4e-12
CAGL0J03872g Chr10 (368472..370457) [1986 bp, 661 aa] {ON} simil...    72   4e-12
KAFR0B02140 Chr2 (417972..420662) [2691 bp, 896 aa] {ON} Anc_8.1...    72   4e-12
CAGL0E05720g Chr5 (569265..570341) [1077 bp, 358 aa] {ON} simila...    70   4e-12
TDEL0C06490 Chr3 complement(1191461..1194922) [3462 bp, 1153 aa]...    72   4e-12
YHL007C Chr8 complement(95118..97937) [2820 bp, 939 aa] {ON}  ST...    72   4e-12
KLLA0A07403g Chr1 (661261..663900) [2640 bp, 879 aa] {ON} simila...    72   4e-12
Smik_8.42 Chr8 complement(74075..76894) [2820 bp, 939 aa] {ON} Y...    72   4e-12
SAKL0B09856g Chr2 complement(830531..834355) [3825 bp, 1274 aa] ...    72   5e-12
CAGL0M02519g Chr13 complement(290723..292993) [2271 bp, 756 aa] ...    72   5e-12
CAGL0M10153g Chr13 complement(1010688..1013291) [2604 bp, 867 aa...    72   5e-12
YOL045W Chr15 (243497..246802) [3306 bp, 1101 aa] {ON}  PSK2One ...    72   5e-12
KAFR0C04780 Chr3 (948771..951131) [2361 bp, 786 aa] {ON} Anc_6.3...    72   5e-12
Skud_15.112 Chr15 (202308..205613) [3306 bp, 1101 aa] {ON} YOL04...    72   5e-12
KLTH0D06006g Chr4 complement(532589..535453) [2865 bp, 954 aa] {...    72   6e-12
KNAG0D02140 Chr4 complement(362745..365357) [2613 bp, 870 aa] {O...    71   6e-12
TBLA0C02940 Chr3 complement(706091..711022) [4932 bp, 1643 aa] {...    72   6e-12
YLR096W Chr12 (332590..336033) [3444 bp, 1147 aa] {ON}  KIN2Seri...    71   6e-12
Kpol_1066.46 s1066 (82874..86551) [3678 bp, 1225 aa] {ON} (82874...    72   6e-12
NDAI0I00250 Chr9 (42174..44867) [2694 bp, 897 aa] {ON} Anc_3.177...    71   6e-12
NDAI0A03870 Chr1 (867910..870597) [2688 bp, 895 aa] {ON} Anc_2.496     71   6e-12
TDEL0D01400 Chr4 (269367..273656) [4290 bp, 1429 aa] {ON} Anc_1....    72   6e-12
Suva_16.382 Chr16 (673009..674205) [1197 bp, 398 aa] {ON} YPR054...    70   7e-12
TDEL0A06000 Chr1 (1053427..1055799) [2373 bp, 790 aa] {ON} Anc_8...    71   7e-12
KAFR0I02010 Chr9 complement(411589..412887) [1299 bp, 432 aa] {O...    70   7e-12
YPR054W Chr16 (666280..667446) [1167 bp, 388 aa] {ON}  SMK1Middl...    70   7e-12
Ecym_6040 Chr6 complement(77854..80544) [2691 bp, 896 aa] {ON} s...    71   7e-12
TDEL0E02180 Chr5 complement(408232..411195) [2964 bp, 987 aa] {O...    71   7e-12
Suva_1.50 Chr1 (96474..100556) [4083 bp, 1360 aa] {ON} YAL017W (...    71   7e-12
YFR014C Chr6 complement(172537..173877) [1341 bp, 446 aa] {ON}  ...    70   7e-12
TPHA0D02840 Chr4 (591733..593637) [1905 bp, 634 aa] {ON}               71   8e-12
KAFR0D03390 Chr4 (667896..670292) [2397 bp, 798 aa] {ON} Anc_2.4...    71   8e-12
TDEL0B04700 Chr2 (834336..836996) [2661 bp, 886 aa] {ON} Anc_8.1...    71   8e-12
CAGL0C03509g Chr3 complement(350846..353533) [2688 bp, 895 aa] {...    71   8e-12
Kwal_27.10004 s27 complement(156153..158360) [2208 bp, 735 aa] {...    71   8e-12
TDEL0B06320 Chr2 (1118534..1119868) [1335 bp, 444 aa] {ON} Anc_1...    70   8e-12
YOR233W Chr15 (775846..778248) [2403 bp, 800 aa] {ON}  KIN4Serin...    71   8e-12
NCAS0A08080 Chr1 complement(1594221..1596092) [1872 bp, 623 aa] ...    70   9e-12
Kpol_2002.46 s2002 (95107..98478) [3372 bp, 1123 aa] {ON} (95107...    71   9e-12
KAFR0D04100 Chr4 complement(809681..813034) [3354 bp, 1117 aa] {...    71   9e-12
KLLA0B13607g Chr2 (1191592..1194561) [2970 bp, 989 aa] {ON} simi...    71   9e-12
ZYRO0G19074g Chr7 complement(1580648..1583413) [2766 bp, 921 aa]...    71   9e-12
ADR313W Chr4 (1255930..1257666) [1737 bp, 578 aa] {ON} Syntenic ...    70   9e-12
KNAG0K02370 Chr11 complement(475088..477739) [2652 bp, 883 aa] {...    70   1e-11
Skud_1.44 Chr1 (95573..99643) [4071 bp, 1356 aa] {ON} YAL017W (R...    71   1e-11
NCAS0C04940 Chr3 (1006185..1009535) [3351 bp, 1116 aa] {ON} Anc_...    71   1e-11
CAGL0H01639g Chr8 (158967..160532) [1566 bp, 521 aa] {ON} simila...    70   1e-11
YAL017W Chr1 (120225..124295) [4071 bp, 1356 aa] {ON}  PSK1One o...    71   1e-11
NCAS0A05570 Chr1 (1093653..1096409) [2757 bp, 918 aa] {ON} Anc_6...    70   1e-11
AEL230W Chr5 (198401..200227) [1827 bp, 608 aa] {ON} Syntenic ho...    70   1e-11
KLLA0E03587g Chr5 complement(323764..325707) [1944 bp, 647 aa] {...    70   1e-11
ACL054W Chr3 (269703..272621) [2919 bp, 972 aa] {ON} Syntenic ho...    70   1e-11
Skud_4.546 Chr4 complement(967636..972618) [4983 bp, 1660 aa] {O...    71   1e-11
KAFR0A08360 Chr1 complement(1677561..1680050) [2490 bp, 829 aa] ...    70   1e-11
TBLA0B03860 Chr2 (887855..890821) [2967 bp, 988 aa] {ON} Anc_8.6...    70   1e-11
TBLA0B02310 Chr2 (539362..541821) [2460 bp, 819 aa] {ON} Anc_3.9...    70   1e-11
ZYRO0E07018g Chr5 (531316..532419) [1104 bp, 367 aa] {ON} simila...    69   1e-11
YOL100W Chr15 (129237..132482) [3246 bp, 1081 aa] {ON}  PKH2Seri...    70   1e-11
KNAG0A03040 Chr1 complement(372150..374084) [1935 bp, 644 aa] {O...    70   1e-11
TBLA0F00240 Chr6 complement(45510..49256) [3747 bp, 1248 aa] {ON...    70   1e-11
KLTH0H03982g Chr8 complement(363432..364628) [1197 bp, 398 aa] {...    69   1e-11
KLLA0C17160g Chr3 (1498959..1501454) [2496 bp, 831 aa] {ON} simi...    70   1e-11
KLTH0E06754g Chr5 (619163..621784) [2622 bp, 873 aa] {ON} simila...    70   1e-11
TPHA0P01270 Chr16 complement(254480..257137) [2658 bp, 885 aa] {...    70   1e-11
TBLA0D05010 Chr4 complement(1234934..1236238) [1305 bp, 434 aa] ...    69   1e-11
Kpol_1012.6 s1012 (11581..13467) [1887 bp, 628 aa] {ON} (11581.....    70   1e-11
AFL143C Chr6 complement(164241..165326) [1086 bp, 361 aa] {ON} S...    69   2e-11
KNAG0J01590 Chr10 (292565..294982) [2418 bp, 805 aa] {ON} Anc_8....    70   2e-11
Ecym_5588 Chr5 complement(1205102..1206943) [1842 bp, 613 aa] {O...    70   2e-11
SAKL0D12628g Chr4 (1048973..1051429) [2457 bp, 818 aa] {ON} weak...    70   2e-11
YCL024W Chr3 (79162..82275) [3114 bp, 1037 aa] {ON}  KCC4Protein...    70   2e-11
KNAG0H03140 Chr8 complement(589553..592363) [2811 bp, 936 aa] {O...    70   2e-11
KAFR0F01150 Chr6 complement(218711..219811) [1101 bp, 366 aa] {O...    69   2e-11
KLTH0C02662g Chr3 complement(240347..242674) [2328 bp, 775 aa] {...    70   2e-11
NDAI0F01340 Chr6 complement(327928..329148) [1221 bp, 406 aa] {O...    69   2e-11
ACR119W Chr3 (560761..563556) [2796 bp, 931 aa] {ON} Syntenic ho...    70   2e-11
Suva_10.180 Chr10 (337364..340843) [3480 bp, 1159 aa] {ON} YLR09...    70   2e-11
TDEL0E03300 Chr5 complement(621448..626409) [4962 bp, 1653 aa] {...    70   2e-11
KNAG0A03060 Chr1 complement(375640..377142) [1503 bp, 500 aa] {O...    69   2e-11
YER129W Chr5 (417281..420709) [3429 bp, 1142 aa] {ON}  SAK1Upstr...    70   2e-11
ZYRO0F17402g Chr6 complement(1445685..1449254) [3570 bp, 1189 aa...    70   2e-11
Ecym_2194 Chr2 complement(381633..382733) [1101 bp, 366 aa] {ON}...    68   2e-11
Skud_6.89 Chr6 (166257..167594) [1338 bp, 446 aa] {ON} YFR014C (...    69   2e-11
Kwal_23.5668 s23 (1263868..1268937) [5070 bp, 1689 aa] {ON} YDR2...    70   2e-11
YPL141C Chr16 complement(283464..286061) [2598 bp, 865 aa] {ON} ...    69   2e-11
KAFR0A03710 Chr1 (758918..760399) [1482 bp, 493 aa] {ON} Anc_8.6...    69   2e-11
ADL315C Chr4 complement(146096..147400) [1305 bp, 434 aa] {ON} S...    69   2e-11
NDAI0H00940 Chr8 complement(209645..211702) [2058 bp, 685 aa] {O...    69   2e-11
SAKL0C09174g Chr3 complement(833618..836833) [3216 bp, 1071 aa] ...    70   2e-11
ZYRO0C02288g Chr3 complement(181604..184327) [2724 bp, 907 aa] {...    69   3e-11
TPHA0G01710 Chr7 complement(350452..352869) [2418 bp, 805 aa] {O...    69   3e-11
TDEL0E00690 Chr5 (144269..146770) [2502 bp, 833 aa] {ON} Anc_3.6...    69   3e-11
Kpol_541.49 s541 complement(156530..159514) [2985 bp, 994 aa] {O...    69   3e-11
ADR167W Chr4 (994581..997202) [2622 bp, 873 aa] {ON} Syntenic ho...    69   3e-11
SAKL0G10384g Chr7 complement(883824..888848) [5025 bp, 1674 aa] ...    69   3e-11
Suva_15.124 Chr15 (215781..219101) [3321 bp, 1106 aa] {ON} YOL04...    69   3e-11
NDAI0H03520 Chr8 (860096..861472) [1377 bp, 458 aa] {ON}               68   3e-11
TBLA0B08520 Chr2 complement(2038517..2041321) [2805 bp, 934 aa] ...    69   3e-11
Smik_1.50 Chr1 (103132..107205) [4074 bp, 1357 aa] {ON} YAL017W ...    69   3e-11
Kpol_495.14 s495 (33810..35684) [1875 bp, 624 aa] {ON} (33810..3...    69   4e-11
NCAS0B01470 Chr2 (241003..243186) [2184 bp, 727 aa] {ON} Anc_8.654     69   4e-11
Ecym_3586 Chr3 complement(1112070..1115303) [3234 bp, 1077 aa] {...    69   4e-11
Suva_6.78 Chr6 (135988..137325) [1338 bp, 445 aa] {ON} YFR014C (...    68   4e-11
Suva_2.449 Chr2 complement(789612..794603) [4992 bp, 1663 aa] {O...    69   4e-11
Kwal_26.7682 s26 complement(470565..472121) [1557 bp, 518 aa] {O...    68   4e-11
Skud_12.164 Chr12 (315700..319182) [3483 bp, 1160 aa] {ON} YLR09...    69   4e-11
Skud_15.399 Chr15 (714789..717212) [2424 bp, 807 aa] {ON} YOR233...    69   5e-11
CAGL0I03498g Chr9 (297344..298699) [1356 bp, 451 aa] {ON} simila...    67   5e-11
Smik_5.275 Chr5 (426176..429601) [3426 bp, 1141 aa] {ON} YER129W...    69   5e-11
ZYRO0A05544g Chr1 (450809..452704) [1896 bp, 631 aa] {ON} highly...    68   5e-11
Suva_8.284 Chr8 (514891..517317) [2427 bp, 808 aa] {ON} YOR233W ...    68   6e-11
KAFR0C05860 Chr3 (1160586..1162520) [1935 bp, 644 aa] {ON} Anc_5...    68   6e-11
SAKL0H24750g Chr8 complement(2152673..2155420) [2748 bp, 915 aa]...    68   6e-11
AEL205W Chr5 (246871..249252) [2382 bp, 793 aa] {ON} Syntenic ho...    68   6e-11
SAKL0B07304g Chr2 (625541..627007) [1467 bp, 488 aa] {ON} simila...    67   6e-11
TBLA0C03180 Chr3 complement(770462..775468) [5007 bp, 1668 aa] {...    68   7e-11
Kpol_1069.13 s1069 complement(27223..28506) [1284 bp, 427 aa] {O...    67   7e-11
KLTH0G06468g Chr7 complement(513119..518251) [5133 bp, 1710 aa] ...    68   7e-11
KAFR0H02510 Chr8 complement(476574..479213) [2640 bp, 879 aa] {O...    68   7e-11
Kpol_1072.31 s1072 complement(67104..68684) [1581 bp, 526 aa] {O...    67   7e-11
NDAI0A01970 Chr1 (440268..442184) [1917 bp, 638 aa] {ON} Anc_7.335     68   7e-11
Kwal_23.5290 s23 complement(1095011..1097470) [2460 bp, 819 aa] ...    68   7e-11
KAFR0A01760 Chr1 complement(363462..366119) [2658 bp, 885 aa] {O...    68   7e-11
Suva_16.169 Chr16 complement(292738..295314) [2577 bp, 858 aa] {...    68   8e-11
NDAI0A08560 Chr1 complement(1969778..1973731) [3954 bp, 1317 aa]...    68   8e-11
TPHA0P01050 Chr16 complement(212259..215624) [3366 bp, 1121 aa] ...    68   8e-11
Kpol_1054.2 s1054 complement(4365..7655) [3291 bp, 1096 aa] {ON}...    68   8e-11
Ecym_5251 Chr5 (522785..525466) [2682 bp, 893 aa] {ON} similar t...    68   8e-11
Kpol_1028.16 s1028 complement(45186..47825) [2640 bp, 879 aa] {O...    68   8e-11
NCAS0A05370 Chr1 complement(1061671..1066197) [4527 bp, 1508 aa]...    68   9e-11
Kwal_26.8703 s26 (905007..906341) [1335 bp, 444 aa] {ON} YOR231W...    67   9e-11
KLLA0D07348g Chr4 (626999..629728) [2730 bp, 909 aa] {ON} simila...    67   9e-11
TDEL0C02110 Chr3 (364853..366340) [1488 bp, 495 aa] {ON} Anc_7.3...    67   9e-11
Ecym_8337 Chr8 (679844..681460) [1617 bp, 538 aa] {ON} similar t...    67   9e-11
Skud_16.140 Chr16 complement(255090..257687) [2598 bp, 865 aa] {...    67   1e-10
TBLA0I00280 Chr9 (42870..46820) [3951 bp, 1316 aa] {ON} Anc_2.49...    67   1e-10
SAKL0A00484g Chr1 complement(57938..60544) [2607 bp, 868 aa] {ON...    67   1e-10
Smik_6.339 Chr6 (538177..540774) [2598 bp, 865 aa] {ON} YPL141C ...    67   1e-10
TPHA0M02080 Chr13 (426966..429635) [2670 bp, 889 aa] {ON} Anc_6....    67   1e-10
Smik_12.155 Chr12 (312480..315968) [3489 bp, 1162 aa] {ON} YLR09...    67   1e-10
Ecym_3525 Chr3 (993328..995784) [2457 bp, 818 aa] {ON} similar t...    67   1e-10
ZYRO0D17468g Chr4 (1439376..1441958) [2583 bp, 860 aa] {ON} weak...    67   1e-10
CAGL0M08910g Chr13 complement(887703..889541) [1839 bp, 612 aa] ...    67   1e-10
TBLA0B03970 Chr2 complement(904167..907793) [3627 bp, 1208 aa] {...    67   1e-10
KAFR0B05410 Chr2 complement(1111152..1112771) [1620 bp, 539 aa] ...    67   1e-10
Kpol_1018.65 s1018 (189779..191584) [1806 bp, 601 aa] {ON} (1897...    67   1e-10
KNAG0D04040 Chr4 (730581..731897) [1317 bp, 438 aa] {ON} Anc_4.1...    66   1e-10
ZYRO0F06842g Chr6 (561269..563800) [2532 bp, 843 aa] {ON} simila...    67   1e-10
NDAI0E02320 Chr5 (480203..483001) [2799 bp, 932 aa] {ON}               67   1e-10
Kwal_23.6458 s23 (1592349..1594955) [2607 bp, 868 aa] {ON} YNR04...    67   1e-10
YPL209C Chr16 complement(156490..157593) [1104 bp, 367 aa] {ON} ...    66   1e-10
NCAS0C01590 Chr3 (293327..295921) [2595 bp, 864 aa] {ON} Anc_8.654     67   1e-10
TBLA0A02240 Chr1 (539297..540538) [1242 bp, 413 aa] {ON} Anc_6.2...    66   1e-10
TBLA0I02400 Chr9 complement(548975..554167) [5193 bp, 1730 aa] {...    67   1e-10
KLLA0C10802g Chr3 complement(926916..931934) [5019 bp, 1672 aa] ...    67   2e-10
KNAG0D01090 Chr4 complement(183319..184437) [1119 bp, 372 aa] {O...    65   2e-10
NCAS0A09960 Chr1 complement(1993554..1995926) [2373 bp, 790 aa] ...    67   2e-10
ACR117W Chr3 (557738..559312) [1575 bp, 524 aa] {ON} Syntenic ho...    66   2e-10
KLTH0A01320g Chr1 (118671..121115) [2445 bp, 814 aa] {ON} simila...    67   2e-10
Suva_2.651 Chr2 (1164264..1166165) [1902 bp, 633 aa] {ON} YDR477...    66   2e-10
CAGL0D01694g Chr4 complement(176981..178279) [1299 bp, 432 aa] {...    65   2e-10
TBLA0C05800 Chr3 complement(1402262..1405207) [2946 bp, 981 aa] ...    66   2e-10
KNAG0B03230 Chr2 complement(625072..626997) [1926 bp, 641 aa] {O...    66   2e-10
ZYRO0B06512g Chr2 complement(521075..524410) [3336 bp, 1111 aa] ...    66   2e-10
KLTH0A07458g Chr1 (620459..623080) [2622 bp, 873 aa] {ON} simila...    66   2e-10
Smik_4.754 Chr4 (1333667..1335565) [1899 bp, 632 aa] {ON} YDR477...    66   2e-10
SAKL0G06952g Chr7 (570584..572383) [1800 bp, 599 aa] {ON} simila...    66   2e-10
Smik_14.34 Chr14 (53272..55788) [2517 bp, 838 aa] {ON} YNL298W (...    66   3e-10
Kwal_23.6325 s23 complement(1533223..1537851) [4629 bp, 1542 aa]...    66   3e-10
KNAG0A06750 Chr1 (1053919..1056294) [2376 bp, 791 aa] {ON} Anc_2...    66   3e-10
Skud_4.751 Chr4 (1332135..1334039) [1905 bp, 634 aa] {ON} YDR477...    65   3e-10
Skud_16.141 Chr16 complement(259166..260707) [1542 bp, 513 aa] {...    65   3e-10
Kpol_541.48 s541 (152877..153692,153695..156046) [3168 bp, 1055 ...    66   3e-10
KAFR0E01490 Chr5 (298209..303167) [4959 bp, 1652 aa] {ON} Anc_5....    66   3e-10
KLLA0E17073g Chr5 complement(1515721..1518279) [2559 bp, 852 aa]...    66   3e-10
Kpol_376.5 s376 (6334..7767) [1434 bp, 477 aa] {ON} (6334..7767)...    65   3e-10
YDR477W Chr4 (1412373..1414274) [1902 bp, 633 aa] {ON}  SNF1AMP-...    65   3e-10
AFR377C Chr6 complement(1116589..1118769) [2181 bp, 726 aa] {ON}...    65   3e-10
Kwal_47.18233 s47 complement(743846..745642) [1797 bp, 598 aa] {...    65   3e-10
KLTH0G05698g Chr7 (453530..455323) [1794 bp, 597 aa] {ON} simila...    65   3e-10
Kpol_1066.45 s1066 complement(76786..79428) [2643 bp, 880 aa] {O...    65   3e-10
KLLA0C04191g Chr3 (384198..386591) [2394 bp, 797 aa] {ON} weakly...    65   4e-10
Kwal_27.12559 s27 (1273349..1274593) [1245 bp, 414 aa] {ON} YPR0...    65   4e-10
NCAS0I02840 Chr9 (528136..529344) [1209 bp, 402 aa] {ON} Anc_1.2...    65   4e-10
SAKL0E03344g Chr5 (272024..273754) [1731 bp, 576 aa] {ON} simila...    65   4e-10
TPHA0L00500 Chr12 (83710..86589) [2880 bp, 959 aa] {ON} Anc_7.86...    65   4e-10
Skud_14.40 Chr14 (62496..65006) [2511 bp, 836 aa] {ON} YNL298W (...    65   4e-10
KAFR0J02620 Chr10 complement(502187..504265) [2079 bp, 692 aa] {...    65   4e-10
AAL083W Chr1 (196774..201870) [5097 bp, 1698 aa] {ON} Syntenic h...    65   4e-10
KNAG0M01450 Chr13 (254622..256061) [1440 bp, 479 aa] {ON}              65   4e-10
Ecym_6344 Chr6 complement(664647..668840) [4194 bp, 1397 aa] {ON...    65   4e-10
KAFR0E01580 Chr5 (318991..320280) [1290 bp, 429 aa] {ON} Anc_5.2...    65   4e-10
KNAG0K01240 Chr11 (243154..246096) [2943 bp, 980 aa] {ON} Anc_3....    65   4e-10
YOL113W Chr15 (104326..106293) [1968 bp, 655 aa] {ON}  SKM1Membe...    65   4e-10
Smik_15.417 Chr15 (725513..727933) [2421 bp, 806 aa] {ON} YOR233...    65   5e-10
CAGL0H00979g Chr8 complement(94328..95527) [1200 bp, 399 aa] {ON...    64   5e-10
KLTH0F09988g Chr6 complement(868693..869931) [1239 bp, 412 aa] {...    64   5e-10
NCAS0A02180 Chr1 (410419..411489) [1071 bp, 356 aa] {ON} Anc_4.192     64   5e-10
KNAG0C02080 Chr3 complement(404332..405588) [1257 bp, 418 aa] {O...    64   5e-10
SAKL0A01254g Chr1 (119884..124560) [4677 bp, 1558 aa] {ON} simil...    65   5e-10
YNL298W Chr14 (68915..71443) [2529 bp, 842 aa] {ON}  CLA4Cdc42p-...    65   5e-10
TBLA0C01750 Chr3 (412762..415707) [2946 bp, 981 aa] {ON} Anc_8.6...    65   6e-10
TBLA0C05830 Chr3 complement(1408930..1410210) [1281 bp, 426 aa] ...    64   6e-10
YCR073C Chr3 complement(242588..246583) [3996 bp, 1331 aa] {ON} ...    65   6e-10
Suva_16.170 Chr16 complement(296877..298406) [1530 bp, 509 aa] {...    64   6e-10
KLLA0F01507g Chr6 (144356..145774) [1419 bp, 472 aa] {ON} some s...    64   6e-10
KLTH0E15004g Chr5 (1328930..1330165) [1236 bp, 411 aa] {ON} simi...    64   7e-10
KNAG0C02440 Chr3 complement(475652..476857) [1206 bp, 401 aa] {O...    64   7e-10
TPHA0G01730 Chr7 complement(355001..356779) [1779 bp, 592 aa] {O...    64   7e-10
NCAS0F02520 Chr6 (495799..500631) [4833 bp, 1610 aa] {ON} Anc_5....    65   7e-10
KAFR0F03970 Chr6 (777047..778201) [1155 bp, 384 aa] {ON} Anc_4.1...    64   8e-10
TBLA0F00820 Chr6 (209607..211844) [2238 bp, 745 aa] {ON} Anc_3.1...    64   8e-10
Suva_14.42 Chr14 (65645..68239) [2595 bp, 864 aa] {ON} YNL298W (...    64   8e-10
TBLA0B03990 Chr2 complement(910314..912455) [2142 bp, 713 aa] {O...    64   8e-10
TPHA0C00470 Chr3 (81482..83377) [1896 bp, 631 aa] {ON} Anc_5.611...    64   8e-10
NDAI0C04000 Chr3 (907842..912812) [4971 bp, 1656 aa] {ON} Anc_5....    65   8e-10
KLLA0C04213g Chr3 (386815..387999) [1185 bp, 394 aa] {ON} simila...    64   8e-10
Skud_16.70 Chr16 complement(129918..131021) [1104 bp, 367 aa] {O...    63   9e-10
NCAS0B04580 Chr2 (831695..835255) [3561 bp, 1186 aa] {ON} Anc_8....    64   9e-10
TBLA0A02050 Chr1 (495735..497039) [1305 bp, 434 aa] {ON}               64   9e-10
KNAG0D00390 Chr4 (53459..58429) [4971 bp, 1656 aa] {ON} Anc_6.34...    64   9e-10
Skud_11.58 Chr11 complement(120855..122042) [1188 bp, 395 aa] {O...    63   9e-10
TBLA0E03360 Chr5 complement(838512..840476) [1965 bp, 654 aa] {O...    64   9e-10
NCAS0A11020 Chr1 (2193556..2194869) [1314 bp, 437 aa] {ON} Anc_3...    64   1e-09
Ecym_8004 Chr8 complement(5273..7957) [2685 bp, 894 aa] {ON} sim...    64   1e-09
YKL166C Chr11 complement(134509..135705) [1197 bp, 398 aa] {ON} ...    63   1e-09
TDEL0E01820 Chr5 complement(348423..349403) [981 bp, 326 aa] {ON...    63   1e-09
KNAG0F03410 Chr6 (640115..645094) [4980 bp, 1659 aa] {ON}              64   1e-09
Kpol_183.1 s183 (158..2257) [2100 bp, 699 aa] {ON} (158..2257) [...    64   1e-09
TBLA0A10420 Chr1 (2562614..2564092) [1479 bp, 492 aa] {ON} Anc_5...    63   1e-09
Kwal_0.96 s0 complement(46082..47365) [1284 bp, 427 aa] {ON} YOL...    63   1e-09
Suva_6.245 Chr6 (438131..439315) [1185 bp, 394 aa] {ON} YJL164C ...    63   1e-09
NDAI0G03470 Chr7 complement(829975..832455) [2481 bp, 826 aa] {O...    64   1e-09
AER223C Chr5 complement(1044971..1047679) [2709 bp, 902 aa] {ON}...    64   1e-09
NCAS0I00470 Chr9 (74336..77584) [3249 bp, 1082 aa] {ON} Anc_7.86       64   1e-09
ZYRO0C15862g Chr3 (1239992..1241305) [1314 bp, 437 aa] {ON} simi...    63   1e-09
KAFR0H02540 Chr8 complement(483399..485852) [2454 bp, 817 aa] {O...    64   1e-09
KLTH0D05082g Chr4 complement(457124..458680) [1557 bp, 518 aa] {...    63   2e-09
Suva_11.56 Chr11 complement(119479..120675) [1197 bp, 398 aa] {O...    62   2e-09
KLTH0A06776g Chr1 complement(562932..567503) [4572 bp, 1523 aa] ...    64   2e-09
TDEL0A05980 Chr1 (1049221..1050771) [1551 bp, 516 aa] {ON} Anc_8...    63   2e-09
KLTH0D10670g Chr4 (877472..878806) [1335 bp, 444 aa] {ON} some s...    63   2e-09
NDAI0A06130 Chr1 complement(1391744..1394203) [2460 bp, 819 aa] ...    63   2e-09
KNAG0H00560 Chr8 (89502..91268) [1767 bp, 588 aa] {ON} Anc_2.597...    63   2e-09
Smik_6.338 Chr6 (535192..536727) [1536 bp, 511 aa] {ON} YPL140C ...    63   2e-09
Skud_10.50 Chr10 complement(84697..85890) [1194 bp, 397 aa] {ON}...    62   2e-09
ZYRO0E05588g Chr5 (430271..431686) [1416 bp, 471 aa] {ON} simila...    63   2e-09
CAGL0J00539g Chr10 (47095..48561) [1467 bp, 488 aa] {ON} highly ...    63   2e-09
KNAG0K00680 Chr11 (120919..124206) [3288 bp, 1095 aa] {ON} Anc_3...    63   2e-09
YPL140C Chr16 complement(287514..289034) [1521 bp, 506 aa] {ON} ...    63   2e-09
TDEL0A04780 Chr1 (842715..844580) [1866 bp, 621 aa] {ON} Anc_5.6...    63   2e-09
NCAS0D00630 Chr4 complement(107310..108593) [1284 bp, 427 aa] {O...    62   2e-09
SAKL0F11110g Chr6 (868447..869832) [1386 bp, 461 aa] {ON} simila...    62   2e-09
KAFR0K00280 Chr11 complement(64906..65988) [1083 bp, 360 aa] {ON...    62   2e-09
TPHA0H00410 Chr8 (79426..82197) [2772 bp, 923 aa] {ON} Anc_8.141...    63   2e-09
YJL164C Chr10 complement(109966..111159) [1194 bp, 397 aa] {ON} ...    62   2e-09
NCAS0C01580 Chr3 (291554..292873) [1320 bp, 439 aa] {ON} Anc_8.652     62   2e-09
NDAI0B00210 Chr2 (27983..29185) [1203 bp, 400 aa] {ON} Anc_1.182       62   3e-09
SAKL0C08844g Chr3 (811712..813307) [1596 bp, 531 aa] {ON} simila...    62   3e-09
NCAS0A08880 Chr1 (1756271..1757539) [1269 bp, 422 aa] {ON} Anc_1...    62   3e-09
NCAS0A06680 Chr1 (1320265..1321704) [1440 bp, 479 aa] {ON} Anc_5...    62   3e-09
ZYRO0G00506g Chr7 complement(38488..40854) [2367 bp, 788 aa] {ON...    63   3e-09
Suva_15.46 Chr15 (81948..83909) [1962 bp, 653 aa] {ON} YOL113W (...    62   3e-09
Smik_11.62 Chr11 complement(120153..121346) [1194 bp, 397 aa] {O...    62   3e-09
ADR300C Chr4 complement(1222344..1225016) [2673 bp, 890 aa] {ON}...    63   3e-09
TPHA0C00160 Chr3 complement(17339..19603) [2265 bp, 754 aa] {ON}...    62   3e-09
TPHA0H01500 Chr8 complement(336652..339639) [2988 bp, 995 aa] {O...    63   3e-09
AER264C Chr5 complement(1120017..1124468) [4452 bp, 1483 aa] {ON...    63   3e-09
Ecym_4523 Chr4 (1039929..1042070) [2142 bp, 713 aa] {ON} similar...    62   3e-09
KLTH0H01584g Chr8 (143065..144453) [1389 bp, 462 aa] {ON} simila...    62   3e-09
KLLA0A03806g Chr1 complement(338807..340615) [1809 bp, 602 aa] {...    62   3e-09
Smik_10.66 Chr10 complement(108043..109236) [1194 bp, 397 aa] {O...    62   3e-09
CAGL0J03828g Chr10 (365325..366728) [1404 bp, 467 aa] {ON} simil...    62   3e-09
CAGL0F09075g Chr6 (894761..897001) [2241 bp, 746 aa] {ON} simila...    62   4e-09
NCAS0H01780 Chr8 complement(341549..344773) [3225 bp, 1074 aa] {...    62   4e-09
AAR009W Chr1 (358947..360308) [1362 bp, 453 aa] {ON} Syntenic ho...    62   4e-09
Smik_6.414 Chr6 (666806..667909) [1104 bp, 367 aa] {ON} YPL209C ...    61   4e-09
ACR196C Chr3 complement(692321..693913) [1593 bp, 530 aa] {ON} S...    62   4e-09
TDEL0A06220 Chr1 (1088622..1091006) [2385 bp, 794 aa] {ON} Anc_8...    62   4e-09
Kwal_23.3590 s23 complement(353755..355254) [1500 bp, 499 aa] {O...    62   4e-09
NDAI0C01850 Chr3 (407978..411712) [3735 bp, 1244 aa] {ON}              62   4e-09
TPHA0M01500 Chr13 (317999..319291) [1293 bp, 430 aa] {ON} Anc_3....    62   4e-09
TDEL0E02510 Chr5 (486415..489156) [2742 bp, 913 aa] {ON} Anc_5.3...    62   4e-09
Smik_15.39 Chr15 (72332..74314) [1983 bp, 660 aa] {ON} YOL113W (...    62   4e-09
CAGL0M08404g Chr13 complement(836791..838179) [1389 bp, 462 aa] ...    62   4e-09
Kpol_1033.1 s1033 complement(1..828) [828 bp, 276 aa] {ON} compl...    60   4e-09
CAGL0F03311g Chr6 complement(327599..330736) [3138 bp, 1045 aa] ...    62   4e-09
NCAS0B08280 Chr2 (1579804..1581033) [1230 bp, 409 aa] {ON} Anc_1...    61   4e-09
Kpol_265.1 s265 (4826..7099) [2274 bp, 757 aa] {ON} (4826..7099)...    62   4e-09
ZYRO0A05214g Chr1 complement(418443..421268) [2826 bp, 941 aa] {...    62   5e-09
NDAI0D03420 Chr4 (806856..809261) [2406 bp, 801 aa] {ON} Anc_4.384     62   5e-09
SAKL0C12386g Chr3 complement(1108341..1110923) [2583 bp, 860 aa]...    62   5e-09
TBLA0A02030 Chr1 complement(491365..492576) [1212 bp, 403 aa] {O...    61   5e-09
CAGL0H01199g Chr8 (110610..115556) [4947 bp, 1648 aa] {ON} highl...    62   5e-09
KLLA0D07304g Chr4 (623352..624749) [1398 bp, 465 aa] {ON} some s...    61   5e-09
TPHA0H00760 Chr8 complement(152442..155384) [2943 bp, 980 aa] {O...    62   5e-09
NDAI0D04110 Chr4 (966439..967560) [1122 bp, 373 aa] {ON} Anc_4.192     61   5e-09
TDEL0A07560 Chr1 complement(1316498..1321225) [4728 bp, 1575 aa]...    62   5e-09
Kpol_1055.25 s1055 complement(62930..67933) [5004 bp, 1667 aa] {...    62   5e-09
NDAI0E01310 Chr5 complement(260484..262094) [1611 bp, 536 aa] {O...    61   5e-09
YOL016C Chr15 complement(294777..296120) [1344 bp, 447 aa] {ON} ...    61   6e-09
TDEL0E03520 Chr5 (657779..659251) [1473 bp, 490 aa] {ON} Anc_5.2...    61   6e-09
Smik_15.153 Chr15 complement(261920..263248) [1329 bp, 442 aa] {...    61   6e-09
Smik_3.173 Chr3 complement(242285..246307) [4023 bp, 1340 aa] {O...    62   6e-09
SAKL0C07722g Chr3 (717419..720157) [2739 bp, 912 aa] {ON} simila...    62   6e-09
NCAS0A14050 Chr1 complement(2763082..2764551) [1470 bp, 489 aa] ...    61   6e-09
Ecym_8400 Chr8 complement(825315..828515) [3201 bp, 1066 aa] {ON...    62   6e-09
AEL284C Chr5 complement(106480..107919) [1440 bp, 479 aa] {ON} S...    61   6e-09
KNAG0H00790 Chr8 complement(124926..126131) [1206 bp, 401 aa] {O...    61   6e-09
NDAI0G05300 Chr7 (1289208..1290521) [1314 bp, 437 aa] {ON} Anc_1...    61   6e-09
Kpol_365.3 s365 complement(2204..4177,4180..4206,4209..4874) [26...    62   6e-09
Kwal_47.17263 s47 complement(321115..324498) [3384 bp, 1127 aa] ...    62   7e-09
Ecym_7414 Chr7 (848665..850440) [1776 bp, 591 aa] {ON} similar t...    61   7e-09
KLTH0E03652g Chr5 (330227..332671) [2445 bp, 814 aa] {ON} simila...    61   8e-09
TBLA0A10690 Chr1 (2642723..2645632) [2910 bp, 969 aa] {ON} Anc_4...    61   8e-09
KNAG0M00190 Chr13 complement(25224..27602) [2379 bp, 792 aa] {ON...    61   8e-09
TDEL0E05310 Chr5 (972769..973893) [1125 bp, 374 aa] {ON} Anc_6.2...    60   8e-09
YKL048C Chr11 complement(347214..349136) [1923 bp, 640 aa] {ON} ...    61   8e-09
KLLA0F24618g Chr6 complement(2288943..2290613) [1671 bp, 556 aa]...    61   8e-09
ZYRO0G18502g Chr7 (1528075..1529265) [1191 bp, 396 aa] {ON} simi...    60   8e-09
SAKL0H24706g Chr8 (2145552..2149100) [3549 bp, 1182 aa] {ON} sim...    61   8e-09
SAKL0G10978g Chr7 (929164..930729) [1566 bp, 521 aa] {ON} highly...    61   8e-09
NDAI0D01620 Chr4 (386654..388132) [1479 bp, 492 aa] {ON} Anc_5.274     60   8e-09
Kpol_1004.19 s1004 (36090..36101,36217..37689) [1485 bp, 494 aa]...    60   8e-09
SAKL0H07128g Chr8 complement(623681..625141) [1461 bp, 486 aa] {...    60   9e-09
KLLA0B11902g Chr2 (1041657..1043144) [1488 bp, 495 aa] {ON} unip...    60   9e-09
Suva_4.221 Chr4 complement(391492..393789) [2298 bp, 765 aa] {ON...    61   9e-09
Suva_15.216 Chr15 complement(376197..377624) [1428 bp, 475 aa] {...    60   9e-09
SAKL0B12364g Chr2 (1060853..1063021) [2169 bp, 722 aa] {ON} high...    61   9e-09
AEL115C Chr5 complement(405062..406222) [1161 bp, 386 aa] {ON} S...    60   1e-08
KLLA0B03586g Chr2 complement(326871..329075) [2205 bp, 734 aa] {...    61   1e-08
Smik_8.97 Chr8 complement(148421..149857) [1437 bp, 478 aa] {ON}...    60   1e-08
Skud_15.397 Chr15 (711559..713082) [1524 bp, 507 aa] {ON} YOR231...    60   1e-08
Suva_15.411 Chr15 (716095..718542) [2448 bp, 815 aa] {ON} YHR205...    61   1e-08
Skud_8.86 Chr8 complement(149508..150953) [1446 bp, 481 aa] {ON}...    60   1e-08
ZYRO0F11418g Chr6 complement(936573..938117) [1545 bp, 514 aa] {...    60   1e-08
YNR031C Chr14 complement(680694..685433) [4740 bp, 1579 aa] {ON}...    61   1e-08
Kpol_1037.52 s1037 complement(128841..130379) [1539 bp, 512 aa] ...    60   1e-08
KAFR0F04340 Chr6 (848844..853628) [4785 bp, 1594 aa] {ON} Anc_6....    61   1e-08
YOR231W Chr15 (772601..774127) [1527 bp, 508 aa] {ON}  MKK1Mitog...    60   1e-08
YHR082C Chr8 complement(268459..271548) [3090 bp, 1029 aa] {ON} ...    61   1e-08
KNAG0I02830 Chr9 (549811..554358) [4548 bp, 1515 aa] {ON} Anc_1....    61   1e-08
ADL389W Chr4 (27641..29776) [2136 bp, 711 aa] {ON} Syntenic homo...    60   1e-08
YHR030C Chr8 complement(168890..170344) [1455 bp, 484 aa] {ON}  ...    60   1e-08
KAFR0F01800 Chr6 complement(350480..351754) [1275 bp, 424 aa] {O...    60   1e-08
YKL161C Chr11 complement(149386..150687) [1302 bp, 433 aa] {ON} ...    60   1e-08
Ecym_2499 Chr2 complement(976395..981020) [4626 bp, 1541 aa] {ON...    61   1e-08
Skud_15.39 Chr15 (69445..71412) [1968 bp, 655 aa] {ON} YOL113W (...    60   1e-08
KLTH0E06776g Chr5 complement(622147..625575) [3429 bp, 1142 aa] ...    60   1e-08
Suva_15.275 Chr15 complement(470782..473862) [3081 bp, 1026 aa] ...    60   1e-08
KLTH0F04840g Chr6 complement(427194..428339) [1146 bp, 381 aa] {...    60   1e-08
TBLA0D02240 Chr4 complement(561856..566547) [4692 bp, 1563 aa] {...    61   1e-08
TPHA0B03850 Chr2 (909219..910841) [1623 bp, 540 aa] {ON} Anc_1.4...    60   1e-08
Ecym_8095 Chr8 (205952..207106) [1155 bp, 384 aa] {ON} similar t...    60   1e-08
KAFR0C00930 Chr3 complement(186877..189687) [2811 bp, 936 aa] {O...    60   1e-08
YHR205W Chr8 (509363..511837) [2475 bp, 824 aa] {ON}  SCH9AGC fa...    60   1e-08
NCAS0B01450 Chr2 (237824..239341) [1518 bp, 505 aa] {ON} Anc_8.652     60   1e-08
TPHA0B02440 Chr2 (560189..561592) [1404 bp, 467 aa] {ON} Anc_5.2...    60   1e-08
Kwal_47.16761 s47 (100315..102549) [2235 bp, 744 aa] {ON} YHR205...    60   2e-08
SAKL0C05368g Chr3 complement(510576..511832) [1257 bp, 418 aa] {...    60   2e-08
Smik_8.295 Chr8 (484074..486548) [2475 bp, 824 aa] {ON} YHR205W ...    60   2e-08
YDL025C Chr4 complement(405344..407206) [1863 bp, 620 aa] {ON}  ...    60   2e-08
KLLA0C03938g Chr3 complement(358851..360632) [1782 bp, 593 aa] {...    60   2e-08
Skud_4.225 Chr4 complement(400160..401992) [1833 bp, 610 aa] {ON...    60   2e-08
SAKL0G06402g Chr7 (535632..537986) [2355 bp, 784 aa] {ON} simila...    60   2e-08
TDEL0C03710 Chr3 (653934..655169) [1236 bp, 411 aa] {ON} Anc_1.1...    59   2e-08
CAGL0K01661g Chr11 complement(147781..149229) [1449 bp, 482 aa] ...    60   2e-08
Kwal_33.13846 s33 complement(419630..420757) [1128 bp, 375 aa] {...    59   2e-08
Suva_3.110 Chr3 complement(160016..164146) [4131 bp, 1376 aa] {O...    60   2e-08
Suva_11.178 Chr11 complement(330253..332184) [1932 bp, 643 aa] {...    60   2e-08
Skud_8.272 Chr8 (478199..480706) [2508 bp, 835 aa] {ON} YHR205W ...    60   2e-08
Skud_11.181 Chr11 complement(326935..328845) [1911 bp, 636 aa] {...    60   2e-08
Smik_15.415 Chr15 (722292..723815) [1524 bp, 507 aa] {ON} YOR231...    59   2e-08
CAGL0C05005g Chr3 complement(467626..470856) [3231 bp, 1076 aa] ...    60   2e-08
Suva_15.155 Chr15 complement(267680..269038) [1359 bp, 452 aa] {...    59   2e-08
Suva_8.282 Chr8 (511665..513185) [1521 bp, 506 aa] {ON} YOR231W ...    59   2e-08
CAGL0G09020g Chr7 (860266..861351) [1086 bp, 361 aa] {ON} highly...    59   2e-08
SAKL0C07744g Chr3 (720519..721799) [1281 bp, 426 aa] {ON} simila...    59   2e-08
KNAG0C03830 Chr3 (751393..752877) [1485 bp, 494 aa] {ON} Anc_7.3...    59   2e-08
Kwal_55.20189 s55 (288918..291356) [2439 bp, 812 aa] {ON} YHR082...    60   2e-08
Kpol_1033.50 s1033 complement(126043..127197) [1155 bp, 384 aa] ...    59   2e-08
ZYRO0F06798g Chr6 (558198..559676) [1479 bp, 492 aa] {ON} simila...    59   2e-08
TDEL0D04450 Chr4 complement(811665..812924) [1260 bp, 419 aa] {O...    59   2e-08
TBLA0C03140 Chr3 (759258..760763) [1506 bp, 501 aa] {ON} Anc_5.2...    59   2e-08
Skud_8.143 Chr8 complement(242422..245535) [3114 bp, 1037 aa] {O...    60   3e-08
NCAS0A10290 Chr1 complement(2051582..2053111) [1530 bp, 509 aa] ...    59   3e-08
KAFR0K00330 Chr11 (74162..75283) [1122 bp, 373 aa] {ON} Anc_6.21...    59   3e-08
SAKL0G08250g Chr7 (703212..705707) [2496 bp, 831 aa] {ON} simila...    60   3e-08
KNAG0J01700 Chr10 (309962..312424) [2463 bp, 820 aa] {ON}              59   3e-08
Suva_4.223 Chr4 complement(395869..397719) [1851 bp, 616 aa] {ON...    59   3e-08
KLTH0D17204g Chr4 complement(1426818..1429085) [2268 bp, 755 aa]...    59   3e-08
KNAG0C01060 Chr3 complement(205965..207374) [1410 bp, 469 aa] {O...    59   3e-08
Kpol_2002.75 s2002 complement(168123..169394) [1272 bp, 423 aa] ...    59   3e-08
ACL053C Chr3 complement(273163..276708) [3546 bp, 1181 aa] {ON} ...    60   3e-08
TDEL0D04560 Chr4 (835822..837885) [2064 bp, 687 aa] {ON} Anc_3.1...    59   3e-08
KLLA0E15313g Chr5 (1362851..1365025) [2175 bp, 724 aa] {ON} simi...    59   3e-08
TDEL0A04580 Chr1 (816247..818331) [2085 bp, 694 aa] {ON} Anc_5.5...    59   3e-08
KAFR0C00920 Chr3 complement(185475..186674) [1200 bp, 399 aa] {O...    59   3e-08
Suva_16.97 Chr16 complement(165977..167083) [1107 bp, 368 aa] {O...    59   3e-08
TDEL0D00330 Chr4 complement(55638..57872) [2235 bp, 744 aa] {ON}...    59   3e-08
TBLA0F02350 Chr6 complement(578797..580467) [1671 bp, 556 aa] {O...    59   3e-08
NCAS0A06440 Chr1 (1270771..1273020) [2250 bp, 749 aa] {ON} Anc_4...    59   3e-08
Skud_4.223 Chr4 complement(395836..398145) [2310 bp, 769 aa] {ON...    59   3e-08
Kpol_185.2 s185 complement(1614..3704) [2091 bp, 696 aa] {ON} co...    59   3e-08
TBLA0E02790 Chr5 complement(693136..695562) [2427 bp, 808 aa] {O...    59   3e-08
KNAG0G01250 Chr7 complement(280791..283364) [2574 bp, 857 aa] {O...    59   3e-08
KNAG0K01740 Chr11 (364195..366492) [2298 bp, 765 aa] {ON} Anc_3....    59   3e-08
YPL203W Chr16 (166256..167398) [1143 bp, 380 aa] {ON}  TPK2cAMP-...    58   4e-08
Skud_16.76 Chr16 (139571..140719) [1149 bp, 382 aa] {ON} YPL203W...    58   4e-08
SAKL0C07458g Chr3 complement(687452..689395) [1944 bp, 647 aa] {...    59   4e-08
Skud_4.97 Chr4 (168099..169670) [1572 bp, 523 aa] {ON} YDL159W (...    59   4e-08
ZYRO0G16082g Chr7 complement(1320266..1321714) [1449 bp, 482 aa]...    59   4e-08
Kpol_1028.40 s1028 (95617..100392) [4776 bp, 1591 aa] {ON} (9561...    59   4e-08
Smik_6.408 Chr6 complement(657018..658163) [1146 bp, 381 aa] {ON...    58   4e-08
KAFR0E01810 Chr5 complement(372094..373524) [1431 bp, 476 aa] {O...    59   4e-08
KNAG0B04460 Chr2 (856495..859461) [2967 bp, 988 aa] {ON} Anc_5.3...    59   4e-08
ZYRO0A03894g Chr1 (307915..309273) [1359 bp, 452 aa] {ON} simila...    58   4e-08
KAFR0E01040 Chr5 complement(214744..216252) [1509 bp, 502 aa] {O...    59   4e-08
Kpol_1018.54 s1018 (163688..166192) [2505 bp, 834 aa] {ON} (1636...    59   4e-08
KLLA0F23155g Chr6 (2157146..2158429) [1284 bp, 427 aa] {ON} simi...    58   4e-08
KAFR0G00480 Chr7 complement(131066..132268) [1203 bp, 400 aa] {O...    58   4e-08
KLTH0G06974g Chr7 (556626..558125) [1500 bp, 499 aa] {ON} highly...    58   4e-08
Ecym_7361 Chr7 complement(753862..755313) [1452 bp, 483 aa] {ON}...    58   5e-08
Ecym_7473 Chr7 (963826..966045) [2220 bp, 739 aa] {ON} similar t...    59   5e-08
KLLA0D08415g Chr4 (714473..716797) [2325 bp, 774 aa] {ON} simila...    59   5e-08
KAFR0H01040 Chr8 complement(189604..190860) [1257 bp, 418 aa] {O...    58   5e-08
KLLA0B07205g Chr2 complement(624606..625973) [1368 bp, 455 aa] {...    58   6e-08
Smik_8.160 Chr8 complement(245207..248323) [3117 bp, 1038 aa] {O...    59   6e-08
Kwal_33.14081 s33 complement(519343..521085) [1743 bp, 580 aa] {...    58   6e-08
CAGL0K11550g Chr11 (1118971..1120587) [1617 bp, 538 aa] {ON} sim...    58   7e-08
ZYRO0F01034g Chr6 (80328..82826) [2499 bp, 832 aa] {ON} similar ...    58   7e-08
SAKL0D07656g Chr4 complement(627469..628767) [1299 bp, 432 aa] {...    57   7e-08
Ecym_2397 Chr2 complement(771343..773961) [2619 bp, 872 aa] {ON}...    58   7e-08
ZYRO0A05192g Chr1 complement(416951..418198) [1248 bp, 415 aa] {...    57   7e-08
CAGL0M10829g Chr13 complement(1076233..1081236) [5004 bp, 1667 a...    58   7e-08
Kwal_23.5576 s23 complement(1223517..1225031) [1515 bp, 504 aa] ...    58   7e-08
NDAI0A05280 Chr1 complement(1191032..1192342) [1311 bp, 436 aa] ...    57   7e-08
TDEL0D03950 Chr4 (720229..721710) [1482 bp, 493 aa] {ON} Anc_3.2...    58   7e-08
Skud_15.432 Chr15 complement(761490..763601) [2112 bp, 703 aa] {...    58   7e-08
TPHA0E02840 Chr5 (594381..595589) [1209 bp, 402 aa] {ON} Anc_6.2...    57   8e-08
KLLA0D09328g Chr4 complement(788565..791705) [3141 bp, 1046 aa] ...    58   8e-08
Suva_4.87 Chr4 (160236..161810) [1575 bp, 524 aa] {ON} YDL159W (...    58   8e-08
YGR052W Chr7 (593596..594705) [1110 bp, 369 aa] {ON}  FMP48Putat...    57   8e-08
KAFR0C04480 Chr3 (894906..896213) [1308 bp, 435 aa] {ON} Anc_1.3...    57   8e-08
KNAG0D01140 Chr4 (192308..193495) [1188 bp, 395 aa] {ON}               57   8e-08
TBLA0C00720 Chr3 (149299..151149) [1851 bp, 616 aa] {ON} Anc_1.4...    58   8e-08
Kwal_14.1416 s14 (315842..316939) [1098 bp, 365 aa] {ON} YGR040W...    57   8e-08
TDEL0A06610 Chr1 complement(1151052..1152824) [1773 bp, 590 aa] ...    58   8e-08
Suva_3.129 Chr3 (193311..194282) [972 bp, 323 aa] {ON} YCR091W (...    57   8e-08
Ecym_2203 Chr2 (401590..402648) [1059 bp, 352 aa] {ON} similar t...    57   8e-08
KLTH0H11396g Chr8 complement(973355..974668) [1314 bp, 437 aa] {...    57   8e-08
Smik_4.209 Chr4 complement(385530..386995,387230..387623) [1860 ...    58   8e-08
KLTH0E16126g Chr5 complement(1427208..1429814) [2607 bp, 868 aa]...    58   9e-08
Ecym_4647 Chr4 (1261859..1263511) [1653 bp, 550 aa] {ON} similar...    57   9e-08
Skud_4.742 Chr4 (1315170..1317881) [2712 bp, 903 aa] {ON} YDR466...    58   9e-08
KAFR0B06980 Chr2 (1452754..1455081) [2328 bp, 775 aa] {ON} Anc_4...    58   9e-08
TPHA0H02390 Chr8 (561244..563436) [2193 bp, 730 aa] {ON} Anc_6.3...    58   9e-08
Skud_15.144 Chr15 complement(254620..255969) [1350 bp, 449 aa] {...    57   9e-08
Suva_16.104 Chr16 (176201..177352) [1152 bp, 383 aa] {ON} YPL203...    57   9e-08
YDL159W Chr4 (172481..174028) [1548 bp, 515 aa] {ON}  STE7Signal...    57   9e-08
SAKL0A04466g Chr1 (413816..414937) [1122 bp, 373 aa] {ON} highly...    57   9e-08
TPHA0D01770 Chr4 (365255..370279) [5025 bp, 1674 aa] {ON} Anc_5....    58   9e-08
Kwal_33.14192 s33 complement(563582..565315) [1734 bp, 577 aa] {...    57   9e-08
NCAS0C03690 Chr3 (741930..744881) [2952 bp, 983 aa] {ON}               58   1e-07
NCAS0A08610 Chr1 complement(1700839..1702704) [1866 bp, 621 aa] ...    57   1e-07
SAKL0C04576g Chr3 complement(444365..446611) [2247 bp, 748 aa] {...    57   1e-07
KNAG0A06140 Chr1 (931737..933437) [1701 bp, 566 aa] {ON} Anc_2.4...    57   1e-07
Kpol_1018.162 s1018 (414868..416904) [2037 bp, 678 aa] {ON} (414...    57   1e-07
NDAI0A07190 Chr1 (1636773..1638380) [1608 bp, 535 aa] {ON} Anc_3...    57   1e-07
KAFR0C03010 Chr3 (598970..601342) [2373 bp, 790 aa] {ON} Anc_8.1...    57   1e-07
KAFR0C04590 Chr3 complement(917915..922321) [4407 bp, 1468 aa] {...    58   1e-07
CAGL0K10604g Chr11 complement(1030055..1031395) [1341 bp, 446 aa...    57   1e-07
Kpol_530.41 s530 (94710..96326) [1617 bp, 538 aa] {ON} (94710..9...    57   1e-07
NCAS0D04600 Chr4 (875553..880604) [5052 bp, 1683 aa] {ON} Anc_6....    58   1e-07
Suva_13.281 Chr13 complement(455094..457136) [2043 bp, 680 aa] {...    57   1e-07
Kwal_56.24584 s56 complement(1063271..1064578) [1308 bp, 435 aa]...    57   1e-07
Skud_3.146 Chr3 complement(227229..231233) [4005 bp, 1334 aa] {O...    57   1e-07
Smik_4.207 Chr4 complement(381159..383456) [2298 bp, 765 aa] {ON...    57   1e-07
CAGL0K06479g Chr11 (637125..640100) [2976 bp, 991 aa] {ON} some ...    57   1e-07
SAKL0B11308g Chr2 complement(984543..986369) [1827 bp, 608 aa] {...    57   1e-07
CAGL0B04301g Chr2 (420544..422172) [1629 bp, 542 aa] {ON} simila...    57   1e-07
TBLA0D01200 Chr4 (303528..305198) [1671 bp, 556 aa] {ON} Anc_8.7...    57   1e-07
KLLA0B11946g Chr2 complement(1048033..1049352) [1320 bp, 439 aa]...    57   1e-07
CAGL0M03729g Chr13 complement(420316..422901) [2586 bp, 861 aa] ...    57   1e-07
Smik_4.79 Chr4 (149246..150796) [1551 bp, 516 aa] {ON} YDL159W (...    57   1e-07
KLTH0D12166g Chr4 complement(987310..989061) [1752 bp, 583 aa] {...    57   1e-07
Skud_14.362 Chr14 complement(648801..653540) [4740 bp, 1579 aa] ...    57   1e-07
NDAI0A00960 Chr1 complement(197205..198431) [1227 bp, 408 aa] {O...    57   1e-07
NDAI0E00960 Chr5 (195116..197251) [2136 bp, 711 aa] {ON} Anc_8.716     57   1e-07
Smik_14.360 Chr14 complement(638655..643406) [4752 bp, 1583 aa] ...    57   1e-07
CAGL0L05632g Chr12 (612478..614511) [2034 bp, 677 aa] {ON} simil...    57   2e-07
ZYRO0F07370g Chr6 (595931..598219) [2289 bp, 762 aa] {ON} simila...    57   2e-07
YDR466W Chr4 (1395121..1397817) [2697 bp, 898 aa] {ON}  PKH3Prot...    57   2e-07
KAFR0B00920 Chr2 (170792..172300) [1509 bp, 502 aa] {ON} Anc_7.3...    57   2e-07
Kpol_1031.67 s1031 (174170..175663) [1494 bp, 497 aa] {ON} (1741...    57   2e-07
TBLA0H01820 Chr8 (429920..433417) [3498 bp, 1165 aa] {ON} Anc_5....    57   2e-07
NCAS0A01100 Chr1 (218400..219464) [1065 bp, 354 aa] {ON}               56   2e-07
NCAS0I02080 Chr9 (390551..392875) [2325 bp, 774 aa] {ON} Anc_3.162     57   2e-07
CAGL0L07810g Chr12 complement(859653..861443) [1791 bp, 596 aa] ...    57   2e-07
KAFR0K02450 Chr11 (504087..504131,504190..505680) [1536 bp, 511 ...    56   2e-07
KLLA0F11143g Chr6 complement(1026129..1028570) [2442 bp, 813 aa]...    57   2e-07
Suva_8.316 Chr8 complement(561812..563914) [2103 bp, 700 aa] {ON...    57   2e-07
Ecym_7206 Chr7 complement(423402..425576) [2175 bp, 724 aa] {ON}...    57   2e-07
CAGL0C02893g Chr3 complement(286017..287966) [1950 bp, 649 aa] {...    57   2e-07
Ecym_8399 Chr8 (821221..824766) [3546 bp, 1181 aa] {ON} similar ...    57   2e-07
TPHA0G00730 Chr7 (139442..141364) [1923 bp, 640 aa] {ON} Anc_8.7...    57   2e-07
AFL090W Chr6 (274336..275376) [1041 bp, 346 aa] {ON} Syntenic ho...    55   2e-07
TBLA0B03590 Chr2 (834488..837022) [2535 bp, 844 aa] {ON} Anc_8.7...    57   2e-07
YOR267C Chr15 complement(822588..824867) [2280 bp, 759 aa] {ON} ...    57   2e-07
Kpol_1037.6 s1037 (12601..15534) [2934 bp, 977 aa] {ON} (12601.....    57   2e-07
KLLA0C14278g Chr3 (1240990..1242615) [1626 bp, 541 aa] {ON} simi...    56   2e-07
TPHA0B00240 Chr2 complement(44468..46525) [2058 bp, 685 aa] {ON}...    56   2e-07
SAKL0H05588g Chr8 (502752..504602) [1851 bp, 616 aa] {ON} simila...    56   2e-07
KLLA0B07579g Chr2 (659591..661759) [2169 bp, 722 aa] {ON} simila...    56   2e-07
TPHA0G01450 Chr7 (297855..299861) [2007 bp, 668 aa] {ON}               56   2e-07
KLTH0F06578g Chr6 complement(568519..570309) [1791 bp, 596 aa] {...    56   3e-07
Ecym_2540 Chr2 (1048071..1049792) [1722 bp, 573 aa] {ON} similar...    56   3e-07
TPHA0E03300 Chr5 (703575..704912) [1338 bp, 445 aa] {ON} Anc_1.1...    56   3e-07
TPHA0C04570 Chr3 (985491..987071) [1581 bp, 526 aa] {ON} Anc_2.3...    56   3e-07
Smik_15.449 Chr15 complement(772245..774437) [2193 bp, 730 aa] {...    56   3e-07
ABL028W Chr2 (345953..348121) [2169 bp, 722 aa] {ON} Syntenic ho...    56   3e-07
AER232C Chr5 complement(1066272..1067981) [1710 bp, 569 aa] {ON}...    56   3e-07
Kpol_1050.13 s1050 (34788..36578) [1791 bp, 596 aa] {ON} (34788....    56   3e-07
TBLA0A06670 Chr1 complement(1630701..1632023) [1323 bp, 440 aa] ...    56   3e-07
NCAS0J00960 Chr10 (157010..159121) [2112 bp, 703 aa] {ON}              56   3e-07
NDAI0F01650 Chr6 (403635..404738) [1104 bp, 367 aa] {ON} Anc_6.214     55   3e-07
Kwal_27.9763 s27 (54483..57089) [2607 bp, 868 aa] {ON} YAR019C (...    56   3e-07
KLTH0H04180g Chr8 (381111..382172) [1062 bp, 353 aa] {ON} highly...    55   3e-07
Smik_3.94 Chr3 (128344..130155) [1812 bp, 603 aa] {ON} YCR008W (...    56   3e-07
NCAS0I03020 Chr9 (555481..557853) [2373 bp, 790 aa] {ON} Anc_1.149     56   3e-07
Kpol_1032.10 s1032 (24479..26854) [2376 bp, 791 aa] {ON} (24479....    56   3e-07
YDL028C Chr4 complement(400997..403291) [2295 bp, 764 aa] {ON}  ...    56   3e-07
NCAS0A12350 Chr1 complement(2446237..2447236,2447319..2448559) [...    56   3e-07
KLTH0F03916g Chr6 complement(348177..350282) [2106 bp, 701 aa] {...    56   3e-07
KLLA0F26983g Chr6 (2489326..2490729) [1404 bp, 467 aa] {ON} some...    55   3e-07
KLLA0C03828g Chr3 (349187..351568) [2382 bp, 793 aa] {ON} simila...    56   3e-07
Skud_7.350 Chr7 (580913..582022) [1110 bp, 369 aa] {ON} YGR052W ...    55   4e-07
TBLA0I01800 Chr9 complement(401728..403617) [1890 bp, 629 aa] {O...    55   4e-07
Kpol_1033.63 s1033 complement(158652..160205) [1554 bp, 517 aa] ...    55   4e-07
KLLA0D03190g Chr4 (267933..269051) [1119 bp, 372 aa] {ON} highly...    55   4e-07
Smik_6.136 Chr6 (219577..220686) [1110 bp, 369 aa] {ON} YGR052W ...    55   4e-07
Suva_14.385 Chr14 complement(661987..666732) [4746 bp, 1581 aa] ...    56   4e-07
ZYRO0E04246g Chr5 complement(322215..324035) [1821 bp, 606 aa] {...    55   4e-07
Skud_3.73 Chr3 (110742..112556) [1815 bp, 604 aa] {ON} YCR008W (...    55   4e-07
KAFR0H01570 Chr8 complement(290698..291897) [1200 bp, 399 aa] {O...    55   4e-07
KLTH0F05918g Chr6 complement(525566..527254) [1689 bp, 562 aa] {...    55   4e-07
YCR008W Chr3 (128470..130281) [1812 bp, 603 aa] {ON}  SAT4Ser/Th...    55   4e-07
ZYRO0G02816g Chr7 complement(213421..214980) [1560 bp, 519 aa] {...    55   4e-07
TDEL0A02330 Chr1 complement(420205..421662) [1458 bp, 485 aa] {O...    55   4e-07
TDEL0A02220 Chr1 (402496..404565) [2070 bp, 689 aa] {ON} Anc_2.4...    55   4e-07
NCAS0B00420 Chr2 complement(54562..56718) [2157 bp, 718 aa] {ON}...    55   4e-07
ZYRO0G02530g Chr7 (194463..196577) [2115 bp, 704 aa] {ON} highly...    55   5e-07
TPHA0F02870 Chr6 complement(636574..638259) [1686 bp, 561 aa] {O...    55   5e-07
Suva_2.642 Chr2 (1147428..1148865,1149541..1150805) [2703 bp, 90...    55   5e-07
TPHA0L01350 Chr12 (282034..283884) [1851 bp, 616 aa] {ON}              55   5e-07
ZYRO0F08272g Chr6 (668685..670508) [1824 bp, 607 aa] {ON} simila...    55   5e-07
NDAI0K01370 Chr11 (313672..315714) [2043 bp, 680 aa] {ON}              55   5e-07
KLTH0G17512g Chr7 complement(1518329..1519426) [1098 bp, 365 aa]...    54   6e-07
SAKL0D06534g Chr4 complement(538606..540091,540155..540237) [156...    55   6e-07
KLTH0H12650g Chr8 (1072961..1074592) [1632 bp, 543 aa] {ON} simi...    55   6e-07
KNAG0B05880 Chr2 (1155395..1157695) [2301 bp, 766 aa] {ON} Anc_4...    55   6e-07
Ecym_5241 Chr5 complement(495748..497586) [1839 bp, 612 aa] {ON}...    55   6e-07
AER222C Chr5 complement(1043479..1044750) [1272 bp, 423 aa] {ON}...    55   6e-07
Ecym_3547 Chr3 complement(1034494..1036107) [1614 bp, 537 aa] {O...    55   6e-07
TDEL0C04800 Chr3 (866157..867467) [1311 bp, 436 aa] {ON} Anc_3.3...    55   6e-07
NCAS0H03070 Chr8 complement(590494..592440) [1947 bp, 648 aa] {O...    55   6e-07
Suva_11.65 Chr11 complement(134606..136120) [1515 bp, 504 aa] {O...    55   6e-07
Kpol_513.7 s513 (14160..15050) [891 bp, 296 aa] {ON} (14160..150...    54   6e-07
KNAG0G01430 Chr7 complement(322758..323822) [1065 bp, 354 aa] {O...    54   6e-07
ZYRO0A07546g Chr1 complement(619278..620747,620833..620847) [148...    55   6e-07
KLLA0C16577g Chr3 complement(1451181..1452695) [1515 bp, 504 aa]...    55   6e-07
SAKL0E05984g Chr5 complement(485895..487391,487462..487482) [151...    55   7e-07
Kpol_1000.14 s1000 complement(36018..38015) [1998 bp, 665 aa] {O...    55   7e-07
NCAS0A04440 Chr1 complement(895181..896935) [1755 bp, 584 aa] {O...    55   7e-07
KLTH0E11396g Chr5 (1018348..1020069) [1722 bp, 573 aa] {ON} simi...    55   7e-07
KAFR0D04800 Chr4 complement(942369..944690) [2322 bp, 773 aa] {O...    55   7e-07
KLTH0D04818g Chr4 (439491..441566) [2076 bp, 691 aa] {ON} simila...    55   7e-07
Ecym_5252 Chr5 (525687..526976) [1290 bp, 429 aa] {ON} similar t...    54   7e-07
TBLA0C01320 Chr3 complement(289223..290626) [1404 bp, 467 aa] {O...    54   7e-07
YKL116C Chr11 complement(221344..222900) [1557 bp, 518 aa] {ON} ...    54   8e-07
CAGL0G05720g Chr7 complement(547617..549833) [2217 bp, 738 aa] {...    55   8e-07
TDEL0E05220 Chr5 complement(957515..958597) [1083 bp, 360 aa] {O...    54   8e-07
KLTH0E16104g Chr5 complement(1425822..1427042) [1221 bp, 406 aa]...    54   8e-07
TDEL0D02650 Chr4 complement(505536..506636) [1101 bp, 366 aa] {O...    54   8e-07
TDEL0D04460 Chr4 complement(813075..815816) [2742 bp, 913 aa] {O...    55   8e-07
TPHA0L01470 Chr12 (303604..304497) [894 bp, 297 aa] {ON} Anc_8.5...    54   9e-07
Kwal_26.7635 s26 (451306..453381) [2076 bp, 691 aa] {ON} YKL126W...    54   9e-07
Smik_13.507 Chr13 (835298..837058) [1761 bp, 586 aa] {ON} YMR291...    54   9e-07
KNAG0I01480 Chr9 (287733..289055) [1323 bp, 440 aa] {ON} Anc_1.3...    54   9e-07
AER195C Chr5 complement(1005431..1006945) [1515 bp, 504 aa] {ON}...    54   9e-07
ZYRO0F12122g Chr6 complement(984069..985910) [1842 bp, 613 aa] {...    54   9e-07
Smik_13.290 Chr13 complement(457921..459951) [2031 bp, 676 aa] {...    54   9e-07
AEL173W Chr5 (313261..314856) [1596 bp, 531 aa] {ON} Syntenic ho...    54   1e-06
SAKL0C06666g Chr3 complement(628448..630367) [1920 bp, 639 aa] {...    54   1e-06
Ecym_6092 Chr6 (178965..180299) [1335 bp, 444 aa] {ON} similar t...    54   1e-06
Suva_11.108 Chr11 complement(207520..209070) [1551 bp, 516 aa] {...    54   1e-06
NDAI0C03900 Chr3 complement(883841..885310) [1470 bp, 489 aa] {O...    54   1e-06
SAKL0E03608g Chr5 complement(291806..294007) [2202 bp, 733 aa] {...    54   1e-06
TDEL0D04600 Chr4 (843530..845917) [2388 bp, 795 aa] {ON} Anc_3.1...    54   1e-06
Skud_11.113 Chr11 complement(207796..209355) [1560 bp, 519 aa] {...    54   1e-06
KLLA0E11947g Chr5 complement(1060048..1061892) [1845 bp, 614 aa]...    54   1e-06
TBLA0J01200 Chr10 (271800..275420) [3621 bp, 1206 aa] {ON} Anc_1...    54   1e-06
NDAI0G05060 Chr7 complement(1227369..1229495) [2127 bp, 708 aa] ...    54   1e-06
NDAI0C05340 Chr3 (1236394..1237296) [903 bp, 300 aa] {ON}              53   1e-06
ABL055C Chr2 complement(295495..297105) [1611 bp, 536 aa] {ON} S...    54   1e-06
NDAI0K01150 Chr11 complement(264377..266527) [2151 bp, 716 aa] {...    54   1e-06
SAKL0H10758g Chr8 complement(930403..931302) [900 bp, 299 aa] {O...    53   1e-06
SAKL0F13618g Chr6 (1085967..1089494) [3528 bp, 1175 aa] {ON} sim...    54   1e-06
Suva_3.33 Chr3 (42176..44020) [1845 bp, 614 aa] {ON} YCR008W (REAL)    54   1e-06
Smik_11.200 Chr11 complement(333676..335592) [1917 bp, 638 aa] {...    54   1e-06
KLLA0F12188g Chr6 (1122745..1124385) [1641 bp, 546 aa] {ON} some...    54   1e-06
NDAI0B02900 Chr2 complement(737651..738709) [1059 bp, 352 aa] {O...    53   1e-06
Kwal_56.22788 s56 complement(281404..282951) [1548 bp, 515 aa] {...    54   1e-06
Kwal_27.10581 s27 complement(403249..406713) [3465 bp, 1154 aa] ...    54   1e-06
SAKL0H06534g Chr8 complement(575439..577853) [2415 bp, 804 aa] {...    54   1e-06
Suva_10.345 Chr10 (601536..603365) [1830 bp, 609 aa] {ON} YLR248...    54   1e-06
TPHA0G02910 Chr7 (624676..626727) [2052 bp, 683 aa] {ON} Anc_2.4...    54   1e-06
TPHA0M01840 Chr13 complement(380953..385818) [4866 bp, 1621 aa] ...    54   1e-06
YMR291W Chr13 (852630..854390) [1761 bp, 586 aa] {ON}  TDA1Prote...    54   1e-06
NDAI0I00340 Chr9 (65047..70557) [5511 bp, 1836 aa] {ON} Anc_6.341      54   1e-06
KLLA0B09790g Chr2 complement(855327..856214) [888 bp, 295 aa] {O...    53   2e-06
Kpol_1031.76 s1031 (193193..194923) [1731 bp, 576 aa] {ON} (1931...    54   2e-06
Kwal_26.8941 s26 complement(1014543..1016528) [1986 bp, 661 aa] ...    54   2e-06
CAGL0F03707g Chr6 complement(359839..361665) [1827 bp, 608 aa] {...    54   2e-06
Kwal_YGOB_27.11919 s27 (1003201..1003830,1004866..1005135) [900 ...    52   2e-06
Skud_2.4 Chr2 complement(4805..8260) [3456 bp, 1151 aa] {ON} YBL...    54   2e-06
Skud_13.262 Chr13 complement(448758..450791) [2034 bp, 677 aa] {...    54   2e-06
TDEL0C03740 Chr3 (658468..660702) [2235 bp, 744 aa] {ON} Anc_1.1...    54   2e-06
TBLA0D02070 Chr4 complement(522456..523958) [1503 bp, 500 aa] {O...    53   2e-06
TBLA0E04970 Chr5 (1272310..1273944) [1635 bp, 544 aa] {ON} Anc_4...    54   2e-06
SAKL0B04488g Chr2 (395136..396242) [1107 bp, 368 aa] {ON} highly...    53   2e-06
KLTH0E11924g Chr5 (1059134..1060030) [897 bp, 298 aa] {ON} highl...    52   2e-06
KLLA0B12716g Chr2 (1109939..1112089) [2151 bp, 716 aa] {ON} simi...    54   2e-06
CAGL0K03399g Chr11 complement(311316..313427) [2112 bp, 703 aa] ...    54   2e-06
ZYRO0F08778g Chr6 (702733..703626) [894 bp, 297 aa] {ON} highly ...    52   2e-06
TPHA0A04170 Chr1 (937692..939233) [1542 bp, 513 aa] {ON} Anc_3.2...    53   2e-06
TBLA0I01370 Chr9 complement(294202..296526) [2325 bp, 774 aa] {O...    54   2e-06
CAGL0K04301g Chr11 (405248..406315) [1068 bp, 355 aa] {ON} simil...    53   2e-06
KNAG0G02780 Chr7 complement(615058..617202) [2145 bp, 714 aa] {O...    53   2e-06
ABL143C Chr2 complement(128215..130392) [2178 bp, 725 aa] {ON} S...    53   2e-06
Suva_2.413 Chr2 (735541..736923) [1383 bp, 460 aa] {ON} YDR247W ...    53   2e-06
AEL083W Chr5 (470964..472574) [1611 bp, 536 aa] {ON} Syntenic ho...    53   2e-06
Kpol_1037.7 s1037 (15938..17182) [1245 bp, 414 aa] {ON} (15938.....    53   2e-06
CAGL0J04290g Chr10 complement(403542..404615) [1074 bp, 357 aa] ...    52   2e-06
NCAS0F01460 Chr6 complement(290441..292465) [2025 bp, 674 aa] {O...    53   2e-06
KAFR0F03900 Chr6 (763094..764203) [1110 bp, 369 aa] {ON} Anc_4.1...    52   2e-06
ZYRO0D10252g Chr4 (860458..863109) [2652 bp, 883 aa] {ON} simila...    53   2e-06
Kwal_27.11919 s27 (1003201..1003827) [627 bp, 209 aa] {OFF} YBR1...    51   2e-06
SAKL0E12958g Chr5 (1066434..1068653) [2220 bp, 739 aa] {ON} simi...    53   2e-06
ZYRO0G08844g Chr7 complement(711678..712766) [1089 bp, 362 aa] {...    52   2e-06
KLLA0E01585g Chr5 (149305..149370,149488..150960) [1539 bp, 512 ...    53   2e-06
TDEL0C03050 Chr3 (545862..549299) [3438 bp, 1145 aa] {ON} Anc_7....    53   2e-06
Kwal_56.24059 s56 complement(829673..830734) [1062 bp, 353 aa] {...    52   2e-06
TDEL0B05820 Chr2 complement(1031136..1032863) [1728 bp, 575 aa] ...    53   2e-06
ACR191C Chr3 complement(680398..683847) [3450 bp, 1149 aa] {ON} ...    53   2e-06
TPHA0H00750 Chr8 complement(150811..152043) [1233 bp, 410 aa] {O...    52   2e-06
NCAS0I02060 Chr9 (386630..388573) [1944 bp, 647 aa] {ON} Anc_3.1...    53   2e-06
KNAG0J02660 Chr10 (495011..497425) [2415 bp, 804 aa] {ON} Anc_1....    53   3e-06
KLTH0B07106g Chr2 (571005..573260) [2256 bp, 751 aa] {ON} simila...    53   3e-06
TPHA0P00640 Chr16 (132185..133963) [1779 bp, 592 aa] {ON} Anc_3....    53   3e-06
ZYRO0B04796g Chr2 (385611..387683) [2073 bp, 690 aa] {ON} simila...    53   3e-06
ZYRO0D08184g Chr4 (706856..711601) [4746 bp, 1581 aa] {ON} simil...    53   3e-06
NDAI0G03030 Chr7 (704910..708269) [3360 bp, 1119 aa] {ON}              53   3e-06
Skud_4.509 Chr4 (910551..911945) [1395 bp, 464 aa] {ON} YDR247W ...    52   3e-06
Kwal_33.13222 s33 (127342..127788) [447 bp, 148 aa] {OFF} YDR507...    49   3e-06
KAFR0G00440 Chr7 (124896..127328) [2433 bp, 810 aa] {ON} Anc_1.1...    53   3e-06
ZYRO0C09768g Chr3 (740592..742925) [2334 bp, 777 aa] {ON} simila...    53   3e-06
TBLA0H03440 Chr8 (840759..841643) [885 bp, 294 aa] {ON} Anc_8.51...    52   3e-06
SAKL0D08294g Chr4 (692455..693966) [1512 bp, 503 aa] {ON} some s...    52   3e-06
KLTH0H11858g Chr8 (1013677..1015374) [1698 bp, 565 aa] {ON} some...    52   3e-06
YMR104C Chr13 complement(473420..475453) [2034 bp, 677 aa] {ON} ...    53   3e-06
KLTH0D11242g Chr4 (918232..920619) [2388 bp, 795 aa] {ON} simila...    53   3e-06
Suva_11.99 Chr11 (192143..194197) [2055 bp, 684 aa] {ON} YMR104C...    52   3e-06
Skud_11.103 Chr11 (192587..194629) [2043 bp, 680 aa] {ON} YMR104...    52   4e-06
KNAG0C04310 Chr3 complement(842994..846503) [3510 bp, 1169 aa] {...    53   4e-06
KLTH0E04334g Chr5 complement(391495..393723) [2229 bp, 742 aa] {...    52   4e-06
TPHA0D00360 Chr4 complement(55596..60206) [4611 bp, 1536 aa] {ON...    53   4e-06
Kwal_55.20221 s55 (304482..308006) [3525 bp, 1174 aa] {ON} YHR07...    53   4e-06
Kpol_1064.31 s1064 complement(52651..54350) [1700 bp, 566.666666...    52   4e-06
Kpol_YGOB_1064.31 s1064 complement(52620..54350) [1731 bp, 577 a...    52   4e-06
TBLA0I00910 Chr9 complement(170526..173945) [3420 bp, 1139 aa] {...    53   4e-06
AAL029W Chr1 (289989..291593) [1605 bp, 534 aa] {ON} Syntenic ho...    52   4e-06
TBLA0A01580 Chr1 complement(367370..369976) [2607 bp, 868 aa] {O...    52   4e-06
YBL105C Chr2 complement(14241..17696) [3456 bp, 1151 aa] {ON}  P...    52   4e-06
Suva_2.11 Chr2 complement(17473..18858) [1386 bp, 461 aa] {ON} Y...    52   4e-06
CAGL0F03245g Chr6 complement(316924..320034) [3111 bp, 1036 aa] ...    52   4e-06
KNAG0A06290 Chr1 (958438..960516) [2079 bp, 692 aa] {ON} Anc_2.4...    52   4e-06
CAGL0H07535g Chr8 (736241..737137) [897 bp, 298 aa] {ON} highly ...    51   4e-06
KLTH0C05478g Chr3 complement(471760..475254) [3495 bp, 1164 aa] ...    52   4e-06
KNAG0C06060 Chr3 (1183766..1186654) [2889 bp, 962 aa] {ON} Anc_5...    52   4e-06
SAKL0E04092g Chr5 complement(326532..327901,327970..327982) [138...    52   4e-06
KLTH0C08932g Chr3 (749308..750867) [1560 bp, 519 aa] {ON} simila...    52   4e-06
TBLA0G01910 Chr7 complement(500551..502596) [2046 bp, 681 aa] {O...    52   4e-06
SAKL0B05082g Chr2 (436707..438896) [2190 bp, 729 aa] {ON} simila...    52   5e-06
KNAG0A05580 Chr1 (830643..831560) [918 bp, 305 aa] {ON} Anc_2.33...    51   5e-06
TBLA0D02730 Chr4 complement(674994..676427) [1434 bp, 477 aa] {O...    52   5e-06
NDAI0B03310 Chr2 complement(844616..845557) [942 bp, 313 aa] {ON...    51   5e-06
Smik_4.745 Chr4 (1316457..1319201) [2745 bp, 914 aa] {ON} YDR466...    52   5e-06
Suva_7.106 Chr7 (202969..204540) [1572 bp, 523 aa] {ON} YGL158W ...    52   5e-06
Smik_11.125 Chr11 complement(208208..209764) [1557 bp, 518 aa] {...    52   5e-06
Smik_11.113 Chr11 (191688..193730) [2043 bp, 680 aa] {ON} YMR104...    52   5e-06
Kpol_1044.26 s1044 complement(60216..62666) [2451 bp, 816 aa] {O...    52   5e-06
KLLA0E06447g Chr5 complement(577669..581154) [3486 bp, 1161 aa] ...    52   5e-06
KNAG0D03980 Chr4 (721049..722170) [1122 bp, 373 aa] {ON} Anc_4.1...    51   5e-06
NCAS0D00710 Chr4 (122875..124737) [1863 bp, 620 aa] {ON}               52   5e-06
Ecym_6136 Chr6 complement(248721..250187) [1467 bp, 488 aa] {ON}...    52   5e-06
KLLA0F01276g Chr6 complement(120001..121560) [1560 bp, 519 aa] {...    52   5e-06
Ecym_4266 Chr4 complement(564935..566329) [1395 bp, 464 aa] {ON}...    52   5e-06
TBLA0B03840 Chr2 complement(881914..884490) [2577 bp, 858 aa] {O...    52   5e-06
TPHA0B01150 Chr2 complement(259998..262070) [2073 bp, 690 aa] {O...    52   5e-06
TBLA0B09740 Chr2 (2312062..2314815) [2754 bp, 917 aa] {ON} Anc_2...    52   5e-06
Smik_14.147 Chr14 complement(272373..274742) [2370 bp, 789 aa] {...    52   5e-06
TPHA0O01620 Chr15 (321912..324359) [2448 bp, 815 aa] {ON} Anc_2....    52   5e-06
AGL249C Chr7 complement(234347..236092) [1746 bp, 581 aa] {ON} S...    52   5e-06
AFR150C Chr6 complement(707303..708352) [1050 bp, 349 aa] {ON} S...    51   5e-06
Kpol_529.18 s529 (52782..55118) [2337 bp, 778 aa] {ON} (52782..5...    52   6e-06
Kwal_27.9773 s27 (57252..58472) [1221 bp, 406 aa] {ON} YAR018C (...    51   6e-06
YKL126W Chr11 (205707..207749) [2043 bp, 680 aa] {ON}  YPK1Serin...    52   6e-06
AGR048C Chr7 complement(807464..808825) [1362 bp, 453 aa] {ON} S...    52   6e-06
YDL101C Chr4 complement(280307..281848) [1542 bp, 513 aa] {ON}  ...    52   6e-06
KNAG0J01290 Chr10 complement(230493..232019) [1527 bp, 508 aa] {...    52   6e-06
Kpol_1072.16 s1072 complement(37585..39972) [2388 bp, 795 aa] {O...    52   6e-06
NDAI0A06630 Chr1 complement(1514165..1515943) [1779 bp, 592 aa] ...    52   6e-06
TPHA0A02630 Chr1 complement(562516..565164) [2649 bp, 882 aa] {O...    52   6e-06
NCAS0A02120 Chr1 (401097..402230) [1134 bp, 377 aa] {ON} Anc_4.184     51   7e-06
TPHA0O01030 Chr15 complement(191875..193890) [2016 bp, 671 aa] {...    52   7e-06
KNAG0K01250 Chr11 (246241..247467) [1227 bp, 408 aa] {ON} Anc_3....    51   7e-06
Suva_14.158 Chr14 complement(289281..291650) [2370 bp, 789 aa] {...    52   7e-06
TDEL0A01120 Chr1 complement(189217..191466) [2250 bp, 749 aa] {O...    52   7e-06
Suva_4.33 Chr4 complement(63334..65427) [2094 bp, 697 aa] {ON} Y...    52   7e-06
NDAI0D04050 Chr4 (952438..953538) [1101 bp, 366 aa] {ON} Anc_4.184     51   7e-06
TDEL0B01250 Chr2 complement(228145..229038) [894 bp, 297 aa] {ON...    50   7e-06
NCAS0B07380 Chr2 complement(1396315..1397898) [1584 bp, 527 aa] ...    51   7e-06
TDEL0G02820 Chr7 complement(543911..545377,545450..545476) [1494...    51   7e-06
KAFR0K02490 Chr11 (515669..518356) [2688 bp, 895 aa] {ON} Anc_5....    52   7e-06
Smik_2.13 Chr2 complement(14021..17473) [3453 bp, 1150 aa] {ON} ...    52   7e-06
Smik_2.14 Chr2 complement(14021..17473) [3453 bp, 1150 aa] {ON} ...    52   7e-06
Ecym_3160 Chr3 complement(304537..306957) [2421 bp, 806 aa] {ON}...    52   7e-06
TPHA0D02740 Chr4 (566279..568819) [2541 bp, 846 aa] {ON} Anc_5.5...    52   7e-06
Skud_13.465 Chr13 (826172..827929) [1758 bp, 585 aa] {ON} YMR291...    51   7e-06
KLTH0H08316g Chr8 (730027..731094) [1068 bp, 355 aa] {ON} simila...    51   7e-06
Skud_14.151 Chr14 complement(284115..286490) [2376 bp, 791 aa] {...    52   8e-06
NCAS0A04360 Chr1 (880768..882822) [2055 bp, 684 aa] {ON} Anc_2.446     51   8e-06
Kwal_27.11830 s27 (964584..966311) [1728 bp, 575 aa] {ON} YPL042...    51   8e-06
CAGL0M09361g Chr13 complement(928484..931918) [3435 bp, 1144 aa]...    52   8e-06
TBLA0B08650 Chr2 (2065061..2066308) [1248 bp, 415 aa] {ON} Anc_3...    51   8e-06
KLTH0F04730g Chr6 complement(417013..419133) [2121 bp, 706 aa] {...    51   8e-06
Kwal_33.14434 s33 complement(672031..674310) [2280 bp, 759 aa] {...    51   8e-06
Kpol_1033.55 s1033 (138831..140555,140557..140895) [2064 bp, 687...    51   8e-06
TDEL0E01710 Chr5 complement(330667..332706) [2040 bp, 679 aa] {O...    51   8e-06
NDAI0E02110 Chr5 complement(430989..433700) [2712 bp, 903 aa] {O...    51   8e-06
KLTH0B06424g Chr2 complement(518184..520328) [2145 bp, 714 aa] {...    51   9e-06
Skud_10.30 Chr10 complement(51698..54124) [2427 bp, 808 aa] {ON}...    51   9e-06
KLTH0D04356g Chr4 (405904..405987,406076..407401) [1410 bp, 469 ...    51   9e-06
Kwal_26.7552 s26 (416444..417829) [1386 bp, 461 aa] {ON} YKL139W...    51   9e-06
Kwal_0.155 s0 (84856..86619) [1764 bp, 587 aa] {ON} YLR248W (RCK...    51   9e-06
Kpol_1072.1 s1072 (686..2683) [1998 bp, 665 aa] {ON} (686..2683)...    51   9e-06
Ecym_4652 Chr4 (1272725..1276156) [3432 bp, 1143 aa] {ON} simila...    51   9e-06
Kpol_1041.9 s1041 (27806..29059) [1254 bp, 417 aa] {ON} (27806.....    51   9e-06
Suva_6.268 Chr6 (470348..472519) [2172 bp, 723 aa] {ON} YJL187C ...    51   1e-05
ABR177C Chr2 complement(735829..738090) [2262 bp, 753 aa] {ON} S...    51   1e-05
YJL057C Chr10 complement(328118..330121) [2004 bp, 667 aa] {ON} ...    51   1e-05
Smik_4.494 Chr4 (900954..902321) [1368 bp, 455 aa] {ON} YDR247W ...    51   1e-05
KNAG0A03900 Chr1 complement(520500..521390) [891 bp, 296 aa] {ON...    50   1e-05
Smik_4.135 Chr4 complement(256861..258402) [1542 bp, 513 aa] {ON...    51   1e-05
Kwal_0.307 s0 (145676..147145) [1470 bp, 490 aa] {OFF} YCR008W (...    51   1e-05
KAFR0D03020 Chr4 (596365..598398) [2034 bp, 677 aa] {ON} Anc_2.4...    51   1e-05
Suva_10.464 Chr10 (809505..811721) [2217 bp, 738 aa] {ON} YLR362...    51   1e-05
Kpol_1067.14 s1067 (29413..31050) [1638 bp, 545 aa] {ON} (29413....    51   1e-05
Kwal_YGOB_0.307 s0 (145676..147175) [1500 bp, 500 aa] {ON} ANNOT...    51   1e-05
NCAS0F02410 Chr6 complement(476683..478071) [1389 bp, 462 aa] {O...    50   1e-05
KAFR0C02840 Chr3 (559821..560873) [1053 bp, 350 aa] {ON} Anc_8.1...    50   1e-05
KNAG0C01020 Chr3 (200271..202595) [2325 bp, 774 aa] {ON} Anc_1.1...    51   1e-05
TDEL0D01930 Chr4 complement(373906..375753) [1848 bp, 615 aa] {O...    51   1e-05
TBLA0A08290 Chr1 complement(2039328..2041376) [2049 bp, 682 aa] ...    51   1e-05
YNL183C Chr14 complement(293137..295509) [2373 bp, 790 aa] {ON} ...    51   1e-05
Kwal_56.23841 s56 (732202..733500) [1299 bp, 432 aa] {ON} YLR113...    50   1e-05
Smik_4.128 Chr4 (244339..244354,244439..245331) [909 bp, 302 aa]...    50   1e-05
TBLA0A08430 Chr1 complement(2075682..2076773) [1092 bp, 363 aa] ...    50   1e-05
Ecym_6307 Chr6 (578677..580227) [1551 bp, 516 aa] {ON} similar t...    50   1e-05
Ecym_5624 Chr5 (1256658..1258022) [1365 bp, 454 aa] {ON} similar...    50   1e-05
KLTH0G12738g Chr7 complement(1085500..1086804) [1305 bp, 434 aa]...    50   1e-05
Skud_4.154 Chr4 complement(275783..277324) [1542 bp, 513 aa] {ON...    50   1e-05
Ecym_8129 Chr8 (269437..271626) [2190 bp, 729 aa] {ON} similar t...    51   1e-05
CAGL0J11308g Chr10 (1099969..1102155) [2187 bp, 728 aa] {ON} sim...    51   1e-05
TDEL0B04490 Chr2 (792559..793629) [1071 bp, 356 aa] {ON} Anc_8.1...    50   1e-05
TPHA0I03100 Chr9 complement(681645..683666) [2022 bp, 673 aa] {O...    50   1e-05
KLLA0D11814g Chr4 complement(1007240..1009021) [1782 bp, 593 aa]...    50   1e-05
TBLA0D00220 Chr4 (52218..54500) [2283 bp, 760 aa] {ON} Anc_2.96 ...    51   1e-05
AEL149C Chr5 complement(348350..350533) [2184 bp, 727 aa] {ON} S...    51   1e-05
AFL188C Chr6 complement(88793..90211) [1419 bp, 472 aa] {ON} Syn...    50   1e-05
AFR372W Chr6 (1109169..1111493) [2325 bp, 774 aa] {ON} Syntenic ...    50   1e-05
Kwal_33.14554 s33 (717776..719920) [2145 bp, 714 aa] {ON} YNL161...    50   1e-05
Suva_4.535 Chr4 (921278..922861) [1584 bp, 527 aa] {ON} YBR274W ...    50   1e-05
ZYRO0F03014g Chr6 complement(255189..260003) [4815 bp, 1604 aa] ...    51   1e-05
TDEL0B01470 Chr2 complement(257397..259169) [1773 bp, 590 aa] {O...    50   1e-05
Ecym_1502 Chr1 (1030765..1031838) [1074 bp, 357 aa] {ON} similar...    50   1e-05
TDEL0F02980 Chr6 (539327..541549) [2223 bp, 740 aa] {ON} Anc_1.1...    50   1e-05
SAKL0D09240g Chr4 (764130..765761) [1632 bp, 543 aa] {ON} some s...    50   1e-05
NDAI0B03190 Chr2 complement(815759..817309) [1551 bp, 516 aa] {O...    50   1e-05
TPHA0N01450 Chr14 complement(318088..320340) [2253 bp, 750 aa] {...    50   1e-05
ADR058C Chr4 complement(810939..811826) [888 bp, 295 aa] {ON} Sy...    49   2e-05
ZYRO0C13156g Chr3 complement(1041022..1042068) [1047 bp, 348 aa]...    50   2e-05
KLLA0F20053g Chr6 (1867209..1868543) [1335 bp, 444 aa] {ON} high...    50   2e-05
KAFR0I02440 Chr9 complement(493668..495128) [1461 bp, 486 aa] {O...    50   2e-05
KLLA0A02497g Chr1 (218592..219680) [1089 bp, 362 aa] {ON} highly...    50   2e-05
TPHA0H01880 Chr8 (441140..442402) [1263 bp, 420 aa] {ON} Anc_6.2...    50   2e-05
NCAS0C01370 Chr3 complement(250693..253092) [2400 bp, 799 aa] {O...    50   2e-05
TPHA0J00630 Chr10 (139476..140600) [1125 bp, 374 aa] {ON} Anc_4....    50   2e-05
Kwal_55.20326 s55 complement(351010..353262) [2253 bp, 750 aa] {...    50   2e-05
SAKL0H16038g Chr8 complement(1401627..1402931) [1305 bp, 434 aa]...    50   2e-05
Kpol_1031.32 s1031 (76827..78821) [1995 bp, 664 aa] {ON} (76827....    50   2e-05
NCAS0A09570 Chr1 complement(1907017..1909200) [2184 bp, 727 aa] ...    50   2e-05
CAGL0K07458g Chr11 complement(737165..739279) [2115 bp, 704 aa] ...    50   2e-05
KNAG0A05670 Chr1 complement(847460..849016) [1557 bp, 518 aa] {O...    50   2e-05
NCAS0G01820 Chr7 complement(323288..325690) [2403 bp, 800 aa] {O...    50   2e-05
SAKL0B01210g Chr2 complement(109892..114658) [4767 bp, 1588 aa] ...    50   2e-05
TPHA0A02770 Chr1 complement(597703..600129) [2427 bp, 808 aa] {O...    50   2e-05
KLLA0A02717g Chr1 (245082..246380) [1299 bp, 432 aa] {ON} weakly...    50   2e-05
NCAS0B05560 Chr2 complement(1050313..1051371) [1059 bp, 352 aa] ...    50   2e-05
ADR174C Chr4 complement(1008796..1010811) [2016 bp, 671 aa] {ON}...    50   2e-05
KAFR0H02430 Chr8 complement(464446..466800) [2355 bp, 784 aa] {O...    50   2e-05
ZYRO0G17094g Chr7 complement(1404552..1406804) [2253 bp, 750 aa]...    50   2e-05
Kwal_33.13831 s33 complement(413256..415358) [2103 bp, 700 aa] {...    50   2e-05
YJL187C Chr10 complement(76803..79262) [2460 bp, 819 aa] {ON}  S...    50   2e-05
NCAS0C03380 Chr3 complement(664012..665310) [1299 bp, 432 aa] {O...    50   2e-05
Skud_2.406 Chr2 (718522..720105) [1584 bp, 527 aa] {ON} YBR274W ...    50   2e-05
TPHA0G01600 Chr7 complement(329313..331850) [2538 bp, 845 aa] {O...    50   2e-05
ZYRO0F13310g Chr6 (1092612..1096322) [3711 bp, 1236 aa] {ON} som...    50   2e-05
KLTH0F18458g Chr6 complement(1491777..1493663) [1887 bp, 628 aa]...    50   2e-05
NCAS0I02850 Chr9 (529637..532042) [2406 bp, 801 aa] {ON} Anc_1.180     50   2e-05
TPHA0B01520 Chr2 complement(336164..339616) [3453 bp, 1150 aa] {...    50   2e-05
CAGL0H10318g Chr8 complement(1006299..1007222) [924 bp, 307 aa] ...    49   2e-05
KAFR0D03100 Chr4 complement(610106..611635) [1530 bp, 509 aa] {O...    50   2e-05
ZYRO0A12826g Chr1 (1014651..1015751) [1101 bp, 366 aa] {ON} high...    49   2e-05
TDEL0F00840 Chr6 (144884..146875) [1992 bp, 663 aa] {ON} Anc_2.9...    50   2e-05
KAFR0F02220 Chr6 (432967..435210) [2244 bp, 747 aa] {ON} Anc_3.1...    50   2e-05
NDAI0G02700 Chr7 complement(618268..619611) [1344 bp, 447 aa] {O...    49   2e-05
SAKL0E12342g Chr5 complement(1021369..1023795) [2427 bp, 808 aa]...    50   2e-05
Kpol_520.17 s520 complement(37953..41447) [3495 bp, 1164 aa] {ON...    50   2e-05
Kpol_1045.46 s1045 complement(106567..108372) [1806 bp, 601 aa] ...    50   2e-05
TPHA0G02990 Chr7 complement(640488..642098) [1611 bp, 536 aa] {O...    50   2e-05
ZYRO0B04906g Chr2 (395546..398089) [2544 bp, 847 aa] {ON} simila...    50   2e-05
YDL214C Chr4 complement(74446..76545) [2100 bp, 699 aa] {ON}  PR...    50   2e-05
ZYRO0D06182g Chr4 complement(529121..530416) [1296 bp, 431 aa] {...    49   3e-05
Ecym_1508 Chr1 (1045857..1050941) [5085 bp, 1694 aa] {ON} simila...    50   3e-05
SAKL0H11352g Chr8 complement(975064..976857) [1794 bp, 597 aa] {...    50   3e-05
Suva_16.439 Chr16 (755102..756796) [1695 bp, 564 aa] {ON} YPR111...    50   3e-05
Smik_16.354 Chr16 (625456..627150) [1695 bp, 564 aa] {ON} YPR111...    50   3e-05
Suva_4.145 Chr4 complement(268826..270370) [1545 bp, 514 aa] {ON...    49   3e-05
Suva_2.157 Chr2 complement(275484..277064) [1581 bp, 526 aa] {ON...    49   3e-05
YBR160W Chr2 (560078..560974) [897 bp, 298 aa] {ON}  CDC28Cataly...    49   3e-05
YLR362W Chr12 (849866..852019) [2154 bp, 717 aa] {ON}  STE11Sign...    50   3e-05
CAGL0J06072g Chr10 complement(574501..576822) [2322 bp, 773 aa] ...    50   3e-05
Suva_10.202 Chr10 (380079..381386) [1308 bp, 435 aa] {ON} YLR113...    49   3e-05
Ecym_2566 Chr2 (1105239..1106126) [888 bp, 295 aa] {ON} similar ...    49   3e-05
KLTH0D03080g Chr4 (295808..297730) [1923 bp, 640 aa] {ON} simila...    50   3e-05
Kpol_2001.31 s2001 complement(90402..93110) [2709 bp, 902 aa] {O...    50   3e-05
YLR113W Chr12 (371620..372927) [1308 bp, 435 aa] {ON}  HOG1Mitog...    49   3e-05
CAGL0M08360g Chr13 complement(833220..835520) [2301 bp, 766 aa] ...    50   3e-05
TBLA0H01330 Chr8 complement(297718..299163) [1446 bp, 481 aa] {O...    49   3e-05
KAFR0F01630 Chr6 complement(323802..326057) [2256 bp, 751 aa] {O...    50   3e-05
Kpol_534.14 s534 (34465..34591,34724..35616) [1020 bp, 339 aa] {...    49   3e-05
KAFR0A06790 Chr1 complement(1371892..1372806) [915 bp, 304 aa] {...    49   3e-05
Smik_12.173 Chr12 (351727..353034) [1308 bp, 435 aa] {ON} YLR113...    49   3e-05
KNAG0G02300 Chr7 (528489..529748) [1260 bp, 419 aa] {ON} Anc_8.3...    49   3e-05
SAKL0C07348g Chr3 (677348..679933) [2586 bp, 861 aa] {ON} some s...    50   3e-05
NCAS0A11530 Chr1 (2281835..2283223) [1389 bp, 462 aa] {ON} Anc_3...    49   3e-05
Skud_4.146 Chr4 (263181..263196,263281..264173) [909 bp, 302 aa]...    49   3e-05
Ecym_6400 Chr6 complement(779716..781983) [2268 bp, 755 aa] {ON}...    50   3e-05
TBLA0A01660 Chr1 complement(391368..392828) [1461 bp, 486 aa] {O...    49   3e-05
AFR076W Chr6 (564252..566714) [2463 bp, 820 aa] {ON} Syntenic ho...    50   3e-05
AFR019W Chr6 (471481..472560) [1080 bp, 359 aa] {ON} Syntenic ho...    49   3e-05
TPHA0A01630 Chr1 complement(328040..329347) [1308 bp, 435 aa] {O...    49   3e-05
NDAI0J01990 Chr10 (491491..493758) [2268 bp, 755 aa] {ON} Anc_4....    49   3e-05
TDEL0B01590 Chr2 complement(280143..281573) [1431 bp, 476 aa] {O...    49   3e-05
Skud_12.181 Chr12 (354407..355702) [1296 bp, 431 aa] {ON} YLR113...    49   3e-05
Smik_12.450 Chr12 (788896..791106) [2211 bp, 736 aa] {ON} YLR362...    49   3e-05
Kpol_1056.20 s1056 complement(44529..46724) [2196 bp, 731 aa] {O...    49   3e-05
ZYRO0G05214g Chr7 (420482..422980) [2499 bp, 832 aa] {ON} some s...    49   3e-05
Skud_2.287 Chr2 (527443..528339) [897 bp, 298 aa] {ON} YBR160W (...    49   3e-05
AFR035W Chr6 (498529..500688) [2160 bp, 719 aa] {ON} Syntenic ho...    49   3e-05
Kpol_543.55 s543 (126256..127533) [1278 bp, 425 aa] {ON} (126256...    49   3e-05
TDEL0F04290 Chr6 (801456..802739) [1284 bp, 427 aa] {ON} Anc_8.3...    49   3e-05
TBLA0B09590 Chr2 (2272405..2273328) [924 bp, 307 aa] {ON} Anc_2....    49   3e-05
Suva_4.411 Chr4 (729465..730361) [897 bp, 298 aa] {ON} YBR160W (...    49   3e-05
KAFR0D02900 Chr4 (575853..577313) [1461 bp, 486 aa] {ON} Anc_7.5...    49   4e-05
KLTH0E03828g Chr5 (345775..349131) [3357 bp, 1118 aa] {ON} simil...    49   4e-05
SAKL0F15510g Chr6 complement(1251475..1253373) [1899 bp, 632 aa]...    49   4e-05
SAKL0D06820g Chr4 (566145..567938) [1794 bp, 597 aa] {ON} simila...    49   4e-05
CAGL0L12650g Chr12 (1360085..1361788) [1704 bp, 567 aa] {ON} sim...    49   4e-05
Ecym_6359 Chr6 complement(699564..702176) [2613 bp, 870 aa] {ON}...    49   4e-05
ZYRO0D03344g Chr4 complement(278347..280326) [1980 bp, 659 aa] {...    49   4e-05
CAGL0I05896g Chr9 (560169..562505) [2337 bp, 778 aa] {ON} some s...    49   4e-05
TPHA0G02800 Chr7 (597211..598722) [1512 bp, 503 aa] {ON} Anc_2.4...    49   4e-05
Suva_13.481 Chr13 (834531..836279) [1749 bp, 582 aa] {ON} YMR291...    49   4e-05
NCAS0E01150 Chr5 complement(217594..219315) [1722 bp, 573 aa] {O...    49   4e-05
Suva_4.138 Chr4 (256421..257197) [777 bp, 258 aa] {ON} YDL108W (...    48   4e-05
SAKL0H19668g Chr8 (1736301..1737674) [1374 bp, 457 aa] {ON} high...    49   4e-05
NDAI0H02340 Chr8 complement(568767..570887) [2121 bp, 706 aa] {O...    49   4e-05
YLR248W Chr12 (634252..636084) [1833 bp, 610 aa] {ON}  RCK2Prote...    49   4e-05
KLLA0C07535g Chr3 (658746..660620) [1875 bp, 624 aa] {ON} some s...    49   4e-05
Smik_2.300 Chr2 (546211..547107) [897 bp, 298 aa] {ON} YBR160W (...    48   4e-05
CAGL0K12562g Chr11 (1235695..1240743) [5049 bp, 1682 aa] {ON} si...    49   4e-05
KLLA0B06501g Chr2 complement(576636..579089) [2454 bp, 817 aa] {...    49   4e-05
CAGL0I08349g Chr9 complement(813998..816001) [2004 bp, 667 aa] {...    49   4e-05
Skud_10.153 Chr10 (288733..290742) [2010 bp, 669 aa] {ON} YJL057...    49   4e-05
Kwal_33.13984 s33 complement(471429..473378) [1950 bp, 649 aa] {...    49   4e-05
TPHA0C04650 Chr3 complement(1006190..1007119) [930 bp, 309 aa] {...    48   4e-05
KAFR0G01080 Chr7 complement(243965..247417) [3453 bp, 1150 aa] {...    49   4e-05
Smik_2.417 Chr2 (735214..736797) [1584 bp, 527 aa] {ON} YBR274W ...    49   4e-05
NDAI0B00220 Chr2 (29825..32470) [2646 bp, 881 aa] {ON} Anc_1.180       49   4e-05
NCAS0I02680 Chr9 (498371..500752) [2382 bp, 793 aa] {ON}               49   4e-05
KAFR0B02980 Chr2 (623470..624804) [1335 bp, 444 aa] {ON} Anc_8.3...    49   4e-05
TDEL0D02040 Chr4 (395555..397138) [1584 bp, 527 aa] {ON} Anc_1.3...    49   4e-05
Skud_4.39 Chr4 complement(70857..72947) [2091 bp, 696 aa] {ON} Y...    49   4e-05
KAFR0E03030 Chr5 (606567..607457) [891 bp, 296 aa] {ON} Anc_8.51...    48   5e-05
Suva_7.334 Chr7 (568847..569956) [1110 bp, 369 aa] {ON} YGR052W ...    49   5e-05
TPHA0G02480 Chr7 (509815..511860) [2046 bp, 681 aa] {ON} Anc_2.4...    49   5e-05
TBLA0B01990 Chr2 complement(458264..461623) [3360 bp, 1119 aa] {...    49   5e-05
ZYRO0G20306g Chr7 complement(1675578..1677227) [1650 bp, 549 aa]...    49   5e-05
SAKL0D06666g Chr4 (551260..552522) [1263 bp, 420 aa] {ON} some s...    49   5e-05
Kwal_26.7276 s26 (293129..295069) [1941 bp, 646 aa] {ON} YJL106W...    49   5e-05
TPHA0M00300 Chr13 (59377..61701) [2325 bp, 774 aa] {ON} Anc_3.16...    49   5e-05
KAFR0A04070 Chr1 complement(817388..819325) [1938 bp, 645 aa] {O...    49   5e-05
NCAS0A07990 Chr1 complement(1578473..1581346) [2874 bp, 957 aa] ...    49   5e-05
KLTH0F05522g Chr6 complement(477035..478975) [1941 bp, 646 aa] {...    49   5e-05
Skud_16.398 Chr16 (712145..713827) [1683 bp, 560 aa] {ON} YPR111...    49   5e-05
KNAG0F01240 Chr6 complement(223003..225591) [2589 bp, 862 aa] {O...    49   5e-05
YDL108W Chr4 (267698..267725,267807..268699) [921 bp, 306 aa] {O...    48   5e-05
KLLA0B13112g Chr2 complement(1146006..1148198) [2193 bp, 730 aa]...    49   5e-05
NDAI0E03080 Chr5 complement(653882..655798) [1917 bp, 638 aa] {O...    49   5e-05
Ecym_6425 Chr6 (825834..828095) [2262 bp, 753 aa] {ON} similar t...    49   5e-05
KLLA0D07810g Chr4 complement(669095..671251) [2157 bp, 718 aa] {...    49   5e-05
CAGL0B02739g Chr2 complement(262590..264620) [2031 bp, 676 aa] {...    49   5e-05
Smik_10.45 Chr10 complement(74813..77278) [2466 bp, 821 aa] {ON}...    49   5e-05
NDAI0H02930 Chr8 (715278..716846) [1569 bp, 522 aa] {ON} Anc_2.391     49   5e-05
TPHA0L01240 Chr12 (263357..264814) [1458 bp, 485 aa] {ON} Anc_8....    49   5e-05
NCAS0B02350 Chr2 complement(394128..395018) [891 bp, 296 aa] {ON...    48   5e-05
KNAG0F01440 Chr6 (261403..263685) [2283 bp, 760 aa] {ON}               49   5e-05
NCAS0E03010 Chr5 (599358..602810) [3453 bp, 1150 aa] {ON} Anc_7....    49   5e-05
Kpol_448.13 s448 (25051..27063) [2013 bp, 670 aa] {ON} (25051..2...    49   5e-05
AFL217C Chr6 complement(30765..32840) [2076 bp, 691 aa] {ON} Syn...    49   6e-05
TDEL0H01070 Chr8 complement(192834..194624) [1791 bp, 596 aa] {O...    49   6e-05
Smik_4.25 Chr4 complement(52454..54547) [2094 bp, 697 aa] {ON} Y...    49   6e-05
Ecym_2357 Chr2 (700079..701914) [1836 bp, 611 aa] {ON} similar t...    49   6e-05
KNAG0E01390 Chr5 (275055..276776) [1722 bp, 573 aa] {ON} Anc_1.4...    49   6e-05
NDAI0G06240 Chr7 (1546580..1549282) [2703 bp, 900 aa] {ON} Anc_1...    49   6e-05
Kwal_26.8796 s26 (946406..948796) [2391 bp, 796 aa] {ON} YPL153C...    49   6e-05
ZYRO0B07854g Chr2 complement(613992..616007) [2016 bp, 671 aa] {...    49   6e-05
Smik_14.167 Chr14 (311655..312284,312591..314228) [2268 bp, 755 ...    49   6e-05
YJL141C Chr10 complement(147967..150390) [2424 bp, 807 aa] {ON} ...    49   6e-05
YNL161W Chr14 (332597..334867) [2271 bp, 756 aa] {ON}  CBK1Serin...    49   6e-05
Skud_14.172 Chr14 (323327..325564) [2238 bp, 745 aa] {ON} YNL161...    49   6e-05
YKL168C Chr11 complement(131288..133462) [2175 bp, 724 aa] {ON} ...    49   6e-05
TBLA0G00820 Chr7 complement(191559..192833) [1275 bp, 424 aa] {O...    48   6e-05
KNAG0C02600 Chr3 complement(504486..507134) [2649 bp, 882 aa] {O...    49   6e-05
Ecym_5209 Chr5 complement(445530..448133) [2604 bp, 867 aa] {ON}...    49   6e-05
Smik_10.91 Chr10 complement(145745..148153) [2409 bp, 802 aa] {O...    49   7e-05
NDAI0E04610 Chr5 (1042690..1046154) [3465 bp, 1154 aa] {ON} Anc_...    49   7e-05
AGL242C Chr7 complement(246896..247790,247838..247854) [912 bp, ...    47   7e-05
Kpol_1002.21 s1002 complement(62702..63895) [1194 bp, 397 aa] {O...    48   7e-05
TPHA0D03940 Chr4 (825250..826989) [1740 bp, 579 aa] {ON} Anc_3.4...    48   7e-05
KNAG0J01950 Chr10 complement(352815..354317) [1503 bp, 500 aa] {...    48   7e-05
CAGL0K04169g Chr11 (384567..385763) [1197 bp, 398 aa] {ON} simil...    48   7e-05
ACR142W Chr3 (597519..600032) [2514 bp, 837 aa] {ON} Syntenic ho...    49   7e-05
KNAG0C01040 Chr3 complement(203429..204976) [1548 bp, 515 aa] {O...    48   7e-05
Skud_16.129 Chr16 complement(233341..235824) [2484 bp, 827 aa] {...    48   7e-05
Suva_6.221 Chr6 (399862..400920,400924..402096) [2232 bp, 743 aa...    48   7e-05
KLTH0G18612g Chr7 (1604066..1608640) [4575 bp, 1524 aa] {ON} sim...    49   7e-05
Smik_2.101 Chr2 (186008..187069) [1062 bp, 353 aa] {ON} YBL016W ...    48   8e-05
CAGL0I04422g Chr9 (394159..395427) [1269 bp, 422 aa] {ON} some s...    48   8e-05
TBLA0D05640 Chr4 (1380616..1383066) [2451 bp, 816 aa] {ON} Anc_1...    48   8e-05
Suva_6.133 Chr6 (221952..223955) [2004 bp, 667 aa] {ON} YJL057C ...    48   8e-05
CAGL0M11748g Chr13 (1168856..1170199) [1344 bp, 447 aa] {ON} hig...    48   8e-05
Suva_14.178 Chr14 (328862..331195) [2334 bp, 777 aa] {ON} YNL161...    48   8e-05
TBLA0D05210 Chr4 (1279846..1282323) [2478 bp, 825 aa] {ON} Anc_1...    48   8e-05
Kpol_1018.137 s1018 complement(366178..367914) [1737 bp, 578 aa]...    48   8e-05
TPHA0D00430 Chr4 complement(73651..74730) [1080 bp, 359 aa] {ON}...    47   8e-05
AEL185C Chr5 complement(291129..292676) [1548 bp, 515 aa] {ON} S...    48   8e-05
Smik_6.125 Chr6 (201071..202177) [1107 bp, 368 aa] {ON} YGR040W ...    47   9e-05
KAFR0B00520 Chr2 (105553..107502) [1950 bp, 649 aa] {ON} Anc_4.1...    48   9e-05
TDEL0C00590 Chr3 complement(94223..99031) [4809 bp, 1602 aa] {ON...    48   9e-05
Ecym_6196 Chr6 (364576..365652) [1077 bp, 358 aa] {ON} similar t...    47   9e-05
Ecym_6044 Chr6 complement(84500..85756) [1257 bp, 418 aa] {ON} s...    47   9e-05
Smik_6.46 Chr6 complement(84451..89733) [5283 bp, 1760 aa] {ON} ...    48   9e-05
NCAS0C03560 Chr3 complement(710551..712476) [1926 bp, 641 aa] {O...    48   9e-05
KAFR0G01810 Chr7 (386620..389130) [2511 bp, 836 aa] {ON} Anc_1.2...    48   9e-05
KAFR0A07370 Chr1 complement(1487868..1490012) [2145 bp, 714 aa] ...    48   9e-05
Suva_2.105 Chr2 (186428..187489) [1062 bp, 353 aa] {ON} YBL016W ...    47   1e-04
NDAI0G05190 Chr7 complement(1258638..1260452) [1815 bp, 604 aa] ...    48   1e-04
KAFR0A07560 Chr1 (1525225..1527504) [2280 bp, 759 aa] {ON} Anc_2...    48   1e-04
NDAI0H03740 Chr8 (912611..915373) [2763 bp, 920 aa] {ON} Anc_2.71      48   1e-04
Ecym_6145 Chr6 complement(266766..267863) [1098 bp, 365 aa] {ON}...    47   1e-04
Skud_2.141 Chr2 complement(264097..265677) [1581 bp, 526 aa] {ON...    48   1e-04
Suva_16.157 Chr16 complement(270891..273389) [2499 bp, 832 aa] {...    48   1e-04
ZYRO0C12078g Chr3 (946320..948647) [2328 bp, 775 aa] {ON} simila...    48   1e-04
Smik_12.321 Chr12 (579087..580919) [1833 bp, 610 aa] {ON} YLR248...    48   1e-04
YFL033C Chr6 complement(69115..74427) [5313 bp, 1770 aa] {ON}  R...    48   1e-04
KAFR0F01940 Chr6 complement(379908..382283) [2376 bp, 791 aa] {O...    48   1e-04
KAFR0H01460 Chr8 complement(269957..271705) [1749 bp, 582 aa] {O...    48   1e-04
TPHA0F02150 Chr6 complement(475516..477768) [2253 bp, 750 aa] {O...    48   1e-04
Kpol_499.3 s499 complement(6075..7199) [1125 bp, 374 aa] {ON} co...    47   1e-04
YDR247W Chr4 (956013..957398) [1386 bp, 461 aa] {ON}  VHS1Cytopl...    47   1e-04
KNAG0F03730 Chr6 complement(697517..699586) [2070 bp, 689 aa] {O...    48   1e-04
TDEL0B06900 Chr2 complement(1220590..1222257) [1668 bp, 555 aa] ...    47   1e-04
NCAS0A09750 Chr1 (1940202..1942370) [2169 bp, 722 aa] {ON}             48   1e-04
Klac_YGOB_Anc_8.34 Chr6 (836287..839007,839010..841004) [4716 bp...    48   1e-04
KAFR0C03520 Chr3 (715667..720019) [4353 bp, 1450 aa] {ON} Anc_8....    48   1e-04
NDAI0F03390 Chr6 (816047..818380) [2334 bp, 777 aa] {ON}               48   1e-04
Skud_6.38 Chr6 complement(72416..77692) [5277 bp, 1758 aa] {ON} ...    48   1e-04
NCAS0B06000 Chr2 complement(1134919..1135808,1135909..1135957) [...    47   1e-04
NCAS0E01560 Chr5 (294095..295345) [1251 bp, 416 aa] {ON}               47   1e-04
ABR088C Chr2 complement(546325..547920) [1596 bp, 531 aa] {ON} S...    47   1e-04
NDAI0K01480 Chr11 complement(337108..338706) [1599 bp, 532 aa] {...    47   1e-04
NDAI0G03920 Chr7 complement(934765..935889) [1125 bp, 374 aa] {O...    47   1e-04
Smik_2.146 Chr2 complement(275270..276850) [1581 bp, 526 aa] {ON...    47   1e-04
YGR040W Chr7 (575398..576504) [1107 bp, 368 aa] {ON}  KSS1Mitoge...    47   1e-04
Suva_6.26 Chr6 complement(42811..48072) [5262 bp, 1753 aa] {ON} ...    48   1e-04
NDAI0F03200 Chr6 complement(770618..772924) [2307 bp, 768 aa] {O...    47   1e-04
AFR205C Chr6 complement(805580..806953) [1374 bp, 457 aa] {ON} S...    47   1e-04
NDAI0E01960 Chr5 (397897..399717) [1821 bp, 606 aa] {ON} Anc_2.425     47   1e-04
KAFR0G00460 Chr7 complement(128077..130023) [1947 bp, 648 aa] {O...    47   1e-04
TBLA0J00990 Chr10 (224999..227335) [2337 bp, 778 aa] {ON} Anc_1....    47   1e-04
KLLA0E07437g Chr5 complement(672690..673787) [1098 bp, 365 aa] {...    47   1e-04
NCAS0B08300 Chr2 (1582859..1584796) [1938 bp, 645 aa] {ON} Anc_1...    47   1e-04
TBLA0C06820 Chr3 (1645811..1647508) [1698 bp, 565 aa] {ON} Anc_5...    47   1e-04
KNAG0A06390 Chr1 complement(974644..976254) [1611 bp, 536 aa] {O...    47   1e-04
Kwal_17.2687 s17 complement(6084..7172) [1089 bp, 362 aa] {ON} Y...    47   1e-04
TDEL0H00890 Chr8 complement(146908..149088) [2181 bp, 726 aa] {O...    47   1e-04
NDAI0G06150 Chr7 (1519393..1521780) [2388 bp, 795 aa] {ON} Anc_1...    47   1e-04
CAGL0L07326g Chr12 (810529..812049) [1521 bp, 506 aa] {ON} simil...    47   1e-04
YBR028C Chr2 complement(294425..296002) [1578 bp, 525 aa] {ON}  ...    47   1e-04
Suva_14.32 Chr14 complement(52757..53884) [1128 bp, 375 aa] {ON}...    47   1e-04
Skud_10.107 Chr10 (189314..191254) [1941 bp, 646 aa] {ON} YJL106...    47   1e-04
Skud_10.73 Chr10 complement(123049..125436) [2388 bp, 795 aa] {O...    47   1e-04
NDAI0B02500 Chr2 (625206..629036) [3831 bp, 1276 aa] {ON} Anc_8....    47   1e-04
KLLA0D12100g Chr4 complement(1031728..1033161) [1434 bp, 477 aa]...    47   1e-04
Skud_11.56 Chr11 complement(117617..119776) [2160 bp, 719 aa] {O...    47   1e-04
TBLA0A08810 Chr1 (2161249..2162304) [1056 bp, 351 aa] {ON} Anc_8...    47   1e-04
Kwal_14.1159 s14 complement(219896..224461) [4566 bp, 1521 aa] {...    47   2e-04
KAFR0B03170 Chr2 complement(656163..658025) [1863 bp, 620 aa] {O...    47   2e-04
Kwal_33.13681 s33 complement(350547..352694) [2148 bp, 715 aa] {...    47   2e-04
TBLA0D05770 Chr4 (1424960..1427671) [2712 bp, 903 aa] {ON} Anc_1...    47   2e-04
CAGL0B03509g Chr2 complement(349638..351431) [1794 bp, 597 aa] {...    47   2e-04
TPHA0O01400 Chr15 complement(277678..279258) [1581 bp, 526 aa] {...    47   2e-04
Kpol_1042.20 s1042 (45090..47261) [2172 bp, 723 aa] {ON} (45090....    47   2e-04
Ecym_2744 Chr2 complement(1442759..1444465) [1707 bp, 568 aa] {O...    47   2e-04
Smik_11.97 Chr11 (168854..170491) [1638 bp, 545 aa] {ON} YKL139W...    47   2e-04
SAKL0C06248g Chr3 complement(577990..580185) [2196 bp, 731 aa] {...    47   2e-04
NDAI0C05160 Chr3 (1199533..1201026) [1494 bp, 497 aa] {ON} Anc_8...    47   2e-04
Kwal_27.11777 s27 (942591..943985) [1395 bp, 464 aa] {ON} YPL026...    47   2e-04
Skud_7.337 Chr7 (562750..563856) [1107 bp, 368 aa] {ON} YGR040W ...    47   2e-04
NDAI0H03460 Chr8 complement(836849..838726) [1878 bp, 625 aa] {O...    47   2e-04
Suva_7.325 Chr7 (550760..551866) [1107 bp, 368 aa] {ON} YGR040W ...    47   2e-04
KLTH0F06468g Chr6 (559256..561769) [2514 bp, 837 aa] {ON} simila...    47   2e-04
ABL011C Chr2 complement(378257..380362) [2106 bp, 701 aa] {ON} S...    47   2e-04
CAGL0E01683g Chr5 complement(166821..167948) [1128 bp, 375 aa] {...    47   2e-04
KNAG0A02220 Chr1 complement(198240..199979) [1740 bp, 579 aa] {O...    47   2e-04
TPHA0B01010 Chr2 complement(229538..231634) [2097 bp, 698 aa] {O...    47   2e-04
KNAG0C02430 Chr3 complement(472213..474804) [2592 bp, 863 aa] {O...    47   2e-04
YBR274W Chr2 (749594..751177) [1584 bp, 527 aa] {ON}  CHK1Serine...    47   2e-04
NCAS0C02390 Chr3 complement(446642..448468) [1827 bp, 608 aa] {O...    47   2e-04
KLLA0D10527g Chr4 (892955..894892) [1938 bp, 645 aa] {ON} simila...    47   2e-04
TDEL0F03120 Chr6 (570471..572192) [1722 bp, 573 aa] {ON} Anc_3.4...    47   2e-04
Suva_11.86 Chr11 (169096..170685) [1590 bp, 529 aa] {ON} YKL139W...    47   2e-04
ACR218W Chr3 (731433..736142) [4710 bp, 1569 aa] {ON} Syntenic h...    47   2e-04
CAGL0D02002g Chr4 (207419..209080) [1662 bp, 553 aa] {ON} simila...    47   2e-04
TBLA0G03450 Chr7 (913497..919415) [5919 bp, 1972 aa] {ON} Anc_8....    47   2e-04
TDEL0G02620 Chr7 (501589..501613,501677..502566) [915 bp, 304 aa...    46   2e-04
YPL153C Chr16 complement(261727..264192) [2466 bp, 821 aa] {ON} ...    47   2e-04
SAKL0D05104g Chr4 (402641..404692) [2052 bp, 683 aa] {ON} simila...    47   2e-04
Skud_4.176 Chr4 complement(308461..309594) [1134 bp, 377 aa] {ON...    46   2e-04
YJL106W Chr10 (221390..223327) [1938 bp, 645 aa] {ON}  IME2Serin...    47   2e-04
ACR249C Chr3 complement(797020..798951) [1932 bp, 643 aa] {ON} S...    47   2e-04
KAFR0A06190 Chr1 complement(1251546..1253690) [2145 bp, 714 aa] ...    47   2e-04
YKL139W Chr11 (182958..184544) [1587 bp, 528 aa] {ON}  CTK1Catal...    47   2e-04
Kpol_1014.8 s1014 (13007..14368) [1362 bp, 453 aa] {ON} (13007.....    46   2e-04
Ecym_6301 Chr6 complement(566248..567324) [1077 bp, 358 aa] {ON}...    46   2e-04
KNAG0B01670 Chr2 (307587..309860) [2274 bp, 757 aa] {ON} Anc_1.2...    47   2e-04
Skud_12.329 Chr12 (580813..582645) [1833 bp, 610 aa] {ON} YLR248...    47   2e-04
Suva_6.182 Chr6 complement(328699..330642) [1944 bp, 647 aa] {ON...    47   2e-04
NCAS0G02070 Chr7 (372747..374960) [2214 bp, 737 aa] {ON} Anc_2.96      47   2e-04
NDAI0G03110 Chr7 complement(725984..731107) [5124 bp, 1707 aa] {...    47   2e-04
KAFR0I01570 Chr9 (330982..332574) [1593 bp, 530 aa] {ON} Anc_2.5...    46   2e-04
YPR111W Chr16 (747306..749000) [1695 bp, 564 aa] {ON}  DBF20Ser/...    46   2e-04
CAGL0K00693g Chr11 complement(75466..78096) [2631 bp, 876 aa] {O...    47   3e-04
Kpol_2001.30 s2001 (87817..90093) [2277 bp, 758 aa] {ON} (87817....    47   3e-04
TBLA0B06510 Chr2 (1536156..1538489) [2334 bp, 777 aa] {ON} Anc_1...    47   3e-04
KLLA0A05819g Chr1 (541545..543659) [2115 bp, 704 aa] {ON} simila...    46   3e-04
Kpol_1035.40 s1035 (101912..102910,102960..102968,103011..106556...    47   3e-04
Kpol_1027.20 s1027 complement(43412..44974) [1563 bp, 520 aa] {O...    46   3e-04
NCAS0C01110 Chr3 (207664..209664) [2001 bp, 666 aa] {ON} Anc_8.716     46   3e-04
Kpol_2001.46 s2001 (127016..129376) [2361 bp, 786 aa] {ON} (1270...    47   3e-04
Suva_6.222 Chr6 (400975..402096) [1122 bp, 373 aa] {ON} YJL141C ...    46   3e-04
ZYRO0G18546g Chr7 (1530693..1533050) [2358 bp, 785 aa] {ON} simi...    46   3e-04
TPHA0B03130 Chr2 complement(719624..721372) [1749 bp, 582 aa] {O...    46   3e-04
KLLA0F02838g Chr6 (264329..266596) [2268 bp, 755 aa] {ON} simila...    46   3e-04
KNAG0E03200 Chr5 complement(641437..646020) [4584 bp, 1527 aa] {...    47   3e-04
NDAI0A06620 Chr1 complement(1510218..1512461) [2244 bp, 747 aa] ...    46   3e-04
KLTH0G18194g Chr7 (1570885..1572132) [1248 bp, 415 aa] {ON} weak...    46   3e-04
KLLA0F01408g Chr6 (135424..136302) [879 bp, 292 aa] {ON} conserv...    45   3e-04
TDEL0A02010 Chr1 (365325..366782) [1458 bp, 485 aa] {ON} Anc_2.4...    46   3e-04
Kwal_55.22001 s55 (1069907..1070998) [1092 bp, 363 aa] {ON} YNL3...    45   3e-04
Skud_12.447 Chr12 (790003..792210) [2208 bp, 735 aa] {ON} YLR362...    46   3e-04
NCAS0B05910 Chr2 (1120092..1121645) [1554 bp, 517 aa] {ON} Anc_2...    46   3e-04
Smik_10.183 Chr10 complement(319743..321746) [2004 bp, 667 aa] {...    46   3e-04
NDAI0B04530 Chr2 complement(1128472..1130094) [1623 bp, 540 aa] ...    46   3e-04
KLTH0F18942g Chr6 (1535941..1537032) [1092 bp, 363 aa] {ON} high...    45   3e-04
TPHA0O01080 Chr15 complement(205407..207653) [2247 bp, 748 aa] {...    46   3e-04
Kpol_161.2 s161 complement(3125..4246) [1122 bp, 373 aa] {ON} co...    45   3e-04
Kwal_14.1249 s14 (252877..253911) [1035 bp, 344 aa] {ON} YFL029C...    45   3e-04
ZYRO0D02970g Chr4 complement(231363..233669) [2307 bp, 768 aa] {...    46   3e-04
NDAI0G05370 Chr7 (1313015..1315555) [2541 bp, 846 aa] {ON} Anc_1...    46   4e-04
Skud_2.90 Chr2 (176138..177199) [1062 bp, 353 aa] {ON} YBL016W (...    45   4e-04
KAFR0C04280 Chr3 (848308..849912) [1605 bp, 534 aa] {ON} Anc_1.3...    46   4e-04
NCAS0A15040 Chr1 complement(2962030..2964036) [2007 bp, 668 aa] ...    46   4e-04
YBL016W Chr2 (192451..193512) [1062 bp, 353 aa] {ON}  FUS3Mitoge...    45   4e-04
SAKL0B11044g Chr2 complement(962142..962940,963019..963086,96315...    46   4e-04
NDAI0G01280 Chr7 complement(281834..283573) [1740 bp, 579 aa] {O...    46   4e-04
YAR018C Chr1 complement(170396..171703) [1308 bp, 435 aa] {ON}  ...    45   4e-04
NDAI0H01020 Chr8 complement(225366..228566) [3201 bp, 1066 aa] {...    46   4e-04
ZYRO0A07062g Chr1 (576600..576615,576675..577561) [903 bp, 300 a...    45   4e-04
Skud_16.460 Chr16 complement(807116..809077) [1962 bp, 653 aa] {...    46   4e-04
TBLA0H02950 Chr8 complement(721123..723906) [2784 bp, 927 aa] {O...    46   4e-04
NDAI0B04700 Chr2 complement(1164332..1165918) [1587 bp, 528 aa] ...    45   4e-04
TDEL0B06160 Chr2 complement(1086672..1088327) [1656 bp, 551 aa] ...    45   4e-04
Kwal_33.14167 s33 (554863..557379) [2517 bp, 838 aa] {ON} YDL028...    46   4e-04
KAFR0K01540 Chr11 (320997..322706) [1710 bp, 569 aa] {ON} Anc_3....    45   4e-04
TBLA0I01310 Chr9 (279407..281245) [1839 bp, 612 aa] {ON} Anc_2.4...    45   4e-04
ADL168C Chr4 complement(398517..399605) [1089 bp, 362 aa] {ON} S...    45   4e-04
YPR161C Chr16 complement(864449..866422) [1974 bp, 657 aa] {ON} ...    45   5e-04
Ecym_2457 Chr2 (888054..890165) [2112 bp, 703 aa] {ON} similar t...    45   5e-04
ADR033W Chr4 (764716..766449) [1734 bp, 577 aa] {ON} Syntenic ho...    45   5e-04
TPHA0A04570 Chr1 (1038551..1040674) [2124 bp, 707 aa] {ON} Anc_1...    45   5e-04
Skud_11.88 Chr11 (169115..170659) [1545 bp, 514 aa] {ON} YKL139W...    45   5e-04
KLLA0F17006g Chr6 complement(1561859..1563106) [1248 bp, 415 aa]...    45   5e-04
NCAS0C03770 Chr3 complement(761101..765897) [4797 bp, 1598 aa] {...    46   5e-04
TBLA0B07330 Chr2 complement(1745229..1746821,1746990..1747013) [...    45   5e-04
KAFR0B01510 Chr2 complement(284425..286092) [1668 bp, 555 aa] {O...    45   5e-04
Smik_10.132 Chr10 (212933..214873) [1941 bp, 646 aa] {ON} YJL106...    45   5e-04
Smik_6.350 Chr6 (559997..562465) [2469 bp, 822 aa] {ON} YPL153C ...    45   5e-04
AEL118C Chr5 complement(399738..401789) [2052 bp, 683 aa] {ON} S...    45   6e-04
Suva_1.84 Chr1 complement(148430..149737) [1308 bp, 435 aa] {ON}...    45   6e-04
SAKL0E06534g Chr5 complement(533369..534267,534334..534358) [924...    45   6e-04
NDAI0C00570 Chr3 (108274..110547) [2274 bp, 757 aa] {ON}               45   6e-04
Suva_16.491 Chr16 complement(848824..850794) [1971 bp, 656 aa] {...    45   6e-04
CAGL0I06248g Chr9 (600351..602792) [2442 bp, 813 aa] {ON} simila...    45   6e-04
KNAG0I01360 Chr9 complement(262712..264556) [1845 bp, 614 aa] {O...    45   6e-04
Skud_14.32 Chr14 complement(49930..51057) [1128 bp, 375 aa] {ON}...    45   6e-04
NCAS0C04540 Chr3 complement(929920..931056) [1137 bp, 378 aa] {O...    45   6e-04
Suva_11.54 Chr11 complement(116221..118401) [2181 bp, 726 aa] {O...    45   6e-04
YNL307C Chr14 complement(56446..57573) [1128 bp, 375 aa] {ON}  M...    45   6e-04
NCAS0D00400 Chr4 complement(61545..63716) [2172 bp, 723 aa] {ON}...    45   6e-04
Suva_15.271 Chr15 complement(460466..463813) [3348 bp, 1115 aa] ...    45   6e-04
CAGL0G04455g Chr7 (426386..428641) [2256 bp, 751 aa] {ON} simila...    45   7e-04
YJL128C Chr10 complement(178097..180103) [2007 bp, 668 aa] {ON} ...    45   7e-04
Smik_14.24 Chr14 complement(40883..42010) [1128 bp, 375 aa] {ON}...    45   7e-04
Ecym_2042 Chr2 complement(67312..68397) [1086 bp, 361 aa] {ON} s...    45   7e-04
Kpol_1066.19 s1066 (31013..32806) [1794 bp, 597 aa] {OFF} (31013...    45   8e-04
Kpol_YGOB_1066.19 s1066 (30983..32806) [1824 bp, 607 aa] {ON} AN...    45   8e-04
NCAS0F02190 Chr6 complement(435844..437706) [1863 bp, 620 aa] {O...    45   8e-04
NCAS0B02530 Chr2 complement(422882..424207) [1326 bp, 441 aa] {O...    45   9e-04
Smik_16.420 Chr16 complement(725685..727658) [1974 bp, 657 aa] {...    45   9e-04
KLTH0H10318g Chr8 complement(888661..890128,890228..890316) [155...    45   0.001
Suva_6.208 Chr6 (369853..371880) [2028 bp, 675 aa] {ON} YJL128C ...    45   0.001
ZYRO0G20570g Chr7 (1695518..1697305) [1788 bp, 595 aa] {ON} simi...    45   0.001
ACL191C Chr3 complement(26475..27572) [1098 bp, 365 aa] {ON} Syn...    44   0.001
Kwal_55.21900 s55 complement(1027253..1029130) [1878 bp, 625 aa]...    45   0.001
KNAG0B01130 Chr2 complement(208528..210279) [1752 bp, 583 aa] {O...    45   0.001
KNAG0B04500 Chr2 (865766..869089) [3324 bp, 1107 aa] {ON} Anc_5....    45   0.001
KAFR0F02190 Chr6 (428623..430095) [1473 bp, 490 aa] {ON} Anc_3.1...    44   0.001
TBLA0D04420 Chr4 complement(1097314..1099356) [2043 bp, 680 aa] ...    45   0.001
TBLA0C02310 Chr3 complement(546887..548596) [1710 bp, 569 aa] {O...    44   0.001
NCAS0B07200 Chr2 complement(1363351..1364940) [1590 bp, 529 aa] ...    44   0.001
TBLA0A07770 Chr1 complement(1916632..1917939) [1308 bp, 435 aa] ...    44   0.001
KLLA0E12145g Chr5 (1080245..1081612) [1368 bp, 455 aa] {ON} simi...    44   0.001
TPHA0I01240 Chr9 (283537..285210) [1674 bp, 557 aa] {ON} Anc_2.1...    44   0.001
KAFR0A01340 Chr1 (259300..261171) [1872 bp, 623 aa] {ON} Anc_1.2...    44   0.001
ZYRO0C02772g Chr3 (216325..217464) [1140 bp, 379 aa] {ON} highly...    44   0.001
KLLA0E10539g Chr5 (929989..931104) [1116 bp, 371 aa] {ON} highly...    44   0.001
Skud_16.239 Chr16 complement(438063..439727) [1665 bp, 554 aa] {...    44   0.001
TDEL0F00530 Chr6 complement(88187..90517) [2331 bp, 776 aa] {ON}...    44   0.001
ZYRO0B09196g Chr2 complement(721019..722569) [1551 bp, 516 aa] {...    44   0.001
ADR317C Chr4 complement(1263080..1265539) [2460 bp, 819 aa] {ON}...    44   0.001
Ecym_3371 Chr3 (706573..706597,706675..707570) [921 bp, 306 aa] ...    44   0.001
Kpol_1002.111 s1002 (277615..278664) [1050 bp, 349 aa] {ON} (277...    44   0.001
KNAG0K01710 Chr11 (360438..361931) [1494 bp, 497 aa] {ON} Anc_3....    44   0.001
NCAS0G03420 Chr7 (628644..630668) [2025 bp, 674 aa] {ON} Anc_1.507     44   0.001
Suva_16.274 Chr16 complement(476249..477916) [1668 bp, 555 aa] {...    44   0.001
KAFR0C01720 Chr3 (351078..352208) [1131 bp, 376 aa] {ON} Anc_3.4...    44   0.001
TBLA0D02510 Chr4 complement(626101..627234) [1134 bp, 377 aa] {O...    44   0.001
TBLA0B00770 Chr2 complement(168444..170519) [2076 bp, 691 aa] {O...    44   0.001
NDAI0D01450 Chr4 (339780..341948) [2169 bp, 722 aa] {ON} Anc_1.507     44   0.001
Kwal_14.2554 s14 (811455..813233) [1779 bp, 592 aa] {ON} YJL057C...    44   0.001
TBLA0A03220 Chr1 complement(765108..768590) [3483 bp, 1160 aa] {...    44   0.001
Kwal_14.2497 s14 complement(784224..785480) [1257 bp, 418 aa] {O...    44   0.001
TBLA0H00370 Chr8 (71216..73393) [2178 bp, 725 aa] {ON} Anc_2.425...    44   0.001
YPL042C Chr16 complement(473040..474707) [1668 bp, 555 aa] {ON} ...    44   0.001
Suva_15.332 Chr15 complement(575263..575547,575959..576084,57614...    44   0.001
Skud_10.87 Chr10 complement(153140..155164) [2025 bp, 674 aa] {O...    44   0.001
Skud_1.73 Chr1 (144821..146128) [1308 bp, 435 aa] {ON} YAR018C (...    44   0.001
CAGL0J04972g Chr10 (475587..476606) [1020 bp, 339 aa] {ON} some ...    44   0.002
KAFR0F01790 Chr6 complement(347491..349884) [2394 bp, 797 aa] {O...    44   0.002
Smik_16.193 Chr16 complement(350311..351978) [1668 bp, 555 aa] {...    44   0.002
KAFR0F00380 Chr6 complement(91358..92800) [1443 bp, 480 aa] {ON}...    44   0.002
TPHA0A05460 Chr1 (1233608..1235170) [1563 bp, 520 aa] {ON} Anc_5...    44   0.002
Smik_10.106 Chr10 complement(175752..177776) [2025 bp, 674 aa] {...    44   0.002
Smik_1.78 Chr1 complement(147996..149303) [1308 bp, 435 aa] {ON}...    44   0.002
KLLA0A06820g Chr1 complement(615686..618004) [2319 bp, 772 aa] {...    44   0.002
ADL283W Chr4 (205173..205197,205250..206145) [921 bp, 306 aa] {O...    43   0.002
Kpol_487.14 s487 complement(56520..58394) [1875 bp, 624 aa] {ON}...    44   0.002
CAGL0B04147g Chr2 (402798..404498) [1701 bp, 566 aa] {ON} highly...    44   0.002
SAKL0G08448g Chr7 (718250..721717) [3468 bp, 1155 aa] {ON} simil...    44   0.002
Kpol_513.17 s513 (49097..50824) [1728 bp, 575 aa] {ON} (49097..5...    44   0.002
Kwal_YGOB_23.3471 s23 (305207..305234,305298..306196) [927 bp, 3...    43   0.002
Kpol_1018.148 s1018 (393064..394413) [1350 bp, 449 aa] {ON} (393...    43   0.002
ZYRO0C12408g Chr3 (979857..981593) [1737 bp, 578 aa] {ON} highly...    44   0.002
NDAI0A04760 Chr1 complement(1088637..1090103) [1467 bp, 488 aa] ...    44   0.002
Kpol_463.19 s463 complement(53246..55561) [2316 bp, 771 aa] {ON}...    44   0.002
CAGL0M02233g Chr13 complement(267332..269635) [2304 bp, 767 aa] ...    44   0.002
Smik_7.115 Chr7 (201140..202663) [1524 bp, 507 aa] {ON} YGL158W ...    44   0.002
Ecym_4448 Chr4 complement(917136..918872) [1737 bp, 578 aa] {ON}...    44   0.002
YPR106W Chr16 (740061..741392) [1332 bp, 443 aa] {ON}  ISR1Predi...    43   0.002
ZYRO0A02772g Chr1 complement(223226..224473) [1248 bp, 415 aa] {...    43   0.002
KNAG0A02350 Chr1 complement(223757..225022) [1266 bp, 421 aa] {O...    43   0.002
TPHA0E02270 Chr5 (471696..472916) [1221 bp, 406 aa] {ON} Anc_5.2...    43   0.002
YGL158W Chr7 (207033..208571) [1539 bp, 512 aa] {ON}  RCK1Protei...    43   0.002
Smik_4.157 Chr4 complement(289446..290605,290830..291250) [1581 ...    43   0.003
Skud_11.67 Chr11 complement(135815..137341) [1527 bp, 508 aa] {O...    43   0.003
Ecym_6294 Chr6 complement(551351..552982) [1632 bp, 543 aa] {ON}...    43   0.003
KAFR0I02100 Chr9 (431876..433258) [1383 bp, 460 aa] {ON} Anc_1.3...    43   0.003
KNAG0C02250 Chr3 complement(444156..446639) [2484 bp, 827 aa] {O...    43   0.003
TDEL0D01220 Chr4 complement(228529..230451) [1923 bp, 640 aa] {O...    43   0.003
TPHA0O00670 Chr15 (125331..127088) [1758 bp, 585 aa] {ON} Anc_1....    43   0.003
Kwal_23.3471 s23 (305414..306196) [783 bp, 260 aa] {OFF} YDL108W...    42   0.003
TBLA0F00860 Chr6 (219628..222570) [2943 bp, 980 aa] {ON} Anc_3.1...    43   0.003
KNAG0E00360 Chr5 (54187..55563) [1377 bp, 458 aa] {ON}                 43   0.003
TBLA0J00250 Chr10 (42058..44457) [2400 bp, 799 aa] {ON} Anc_7.51...    43   0.003
SAKL0C05280g Chr3 complement(502205..504490) [2286 bp, 761 aa] {...    43   0.004
KLTH0H10582g Chr8 (914695..916440) [1746 bp, 581 aa] {ON} weakly...    43   0.004
Kpol_209.1 s209 (1823..5734) [3912 bp, 1303 aa] {ON} (1823..5734...    43   0.004
AEL179W Chr5 (302948..303817) [870 bp, 289 aa] {ON} NOHBY510; No...    42   0.004
Smik_16.346 Chr16 (617471..618802) [1332 bp, 443 aa] {ON} YPR106...    42   0.004
NDAI0C01890 Chr3 (419452..423777) [4326 bp, 1441 aa] {ON} Anc_5....    43   0.004
Kwal_26.8347 s26 complement(748254..750032) [1779 bp, 592 aa] {O...    43   0.004
KLLA0E14785g Chr5 complement(1323743..1324675) [933 bp, 310 aa] ...    42   0.004
CAGL0F00649g Chr6 (71961..73505) [1545 bp, 514 aa] {ON} similar ...    42   0.004
KNAG0C01820 Chr3 (355604..357376) [1773 bp, 590 aa] {ON}               42   0.004
CAGL0G03047g Chr7 (282299..283918) [1620 bp, 539 aa] {ON} highly...    42   0.004
SAKL0H01364g Chr8 complement(143450..145141) [1692 bp, 563 aa] {...    42   0.004
Smik_6.178 Chr6 (291601..293322) [1722 bp, 573 aa] {ON} YGR092W ...    42   0.004
ZYRO0D07502g Chr4 complement(652782..654320) [1539 bp, 512 aa] {...    42   0.004
CAGL0K01617g Chr11 complement(143308..145632) [2325 bp, 774 aa] ...    42   0.005
ZYRO0C15884g Chr3 (1241605..1245873) [4269 bp, 1422 aa] {ON} sim...    43   0.005
TPHA0H01470 Chr8 complement(329451..333578) [4128 bp, 1375 aa] {...    42   0.005
Smik_8.156 Chr8 complement(234928..238269) [3342 bp, 1113 aa] {O...    42   0.005
TPHA0C02880 Chr3 (623723..624778) [1056 bp, 351 aa] {ON} Anc_8.1...    42   0.005
CAGL0J05082g Chr10 (483782..485743) [1962 bp, 653 aa] {ON} simil...    42   0.005
CAGL0G06138g Chr7 complement(585585..587204) [1620 bp, 539 aa] {...    42   0.005
ADR379C Chr4 complement(1386598..1388076) [1479 bp, 492 aa] {ON}...    42   0.006
TBLA0D00250 Chr4 (61918..63618) [1701 bp, 566 aa] {ON} Anc_2.105...    42   0.006
KLLA0A09713g Chr1 (851952..853625) [1674 bp, 557 aa] {ON} simila...    42   0.006
NDAI0J00420 Chr10 (73312..75606) [2295 bp, 764 aa] {ON} Anc_7.515      42   0.006
TDEL0H00560 Chr8 (94614..96500) [1887 bp, 628 aa] {ON} Anc_7.515...    42   0.007
KLTH0D01386g Chr4 (129448..130053,130132..130974) [1449 bp, 482 ...    42   0.007
TDEL0E02600 Chr5 (501545..504934) [3390 bp, 1129 aa] {ON} Anc_5....    42   0.007
Skud_8.196 Chr8 complement(346056..346463,346494..347684) [1599 ...    42   0.007
NCAS0A04220 Chr1 (855791..857353) [1563 bp, 520 aa] {ON} Anc_2.425     42   0.007
TPHA0A02760 Chr1 (594482..597502) [3021 bp, 1006 aa] {ON} Anc_1....    42   0.008
KLTH0F09504g Chr6 (824743..824770,824831..825729) [927 bp, 308 a...    41   0.008
Smik_8.216 Chr8 complement(349478..351145) [1668 bp, 555 aa] {ON...    42   0.008
TBLA0F01730 Chr6 complement(431961..433004) [1044 bp, 347 aa] {O...    41   0.008
SAKL0H11748g Chr8 complement(1002207..1003541) [1335 bp, 444 aa]...    41   0.008
NCAS0H01740 Chr8 complement(331436..335284) [3849 bp, 1282 aa] {...    42   0.008
NDAI0B00400 Chr2 (74403..76643) [2241 bp, 746 aa] {ON} Anc_1.149       42   0.008
CAGL0M13167g Chr13 complement(1293074..1294906) [1833 bp, 610 aa...    42   0.009
Skud_15.519 Chr15 complement(932720..934216) [1497 bp, 498 aa] {...    41   0.009
Suva_7.375 Chr7 (643870..645591) [1722 bp, 573 aa] {ON} YGR092W ...    41   0.009
Suva_8.405 Chr8 complement(730738..732348) [1611 bp, 536 aa] {ON...    41   0.009
Smik_11.60 Chr11 complement(116793..118970) [2178 bp, 725 aa] {O...    41   0.010
Ecym_4773 Chr4 complement(1504949..1506541) [1593 bp, 530 aa] {O...    41   0.010
Skud_16.391 Chr16 (704392..705723) [1332 bp, 443 aa] {ON} YPR106...    41   0.011
YGR092W Chr7 (668189..669907) [1719 bp, 572 aa] {ON}  DBF2Ser/Th...    41   0.011
SAKL0E12100g Chr5 complement(1004036..1005622) [1587 bp, 528 aa]...    41   0.011
KLTH0F04686g Chr6 (413669..416209) [2541 bp, 846 aa] {ON} weakly...    41   0.012
SAKL0F06094g Chr6 (457709..459442) [1734 bp, 577 aa] {ON} unipro...    41   0.012
NCAS0C02510 Chr3 complement(468113..469390) [1278 bp, 425 aa] {O...    41   0.012
NCAS0A08770 Chr1 complement(1733181..1734890) [1710 bp, 569 aa] ...    41   0.012
Ecym_8098 Chr8 (210698..212857) [2160 bp, 719 aa] {ON} similar t...    41   0.012
Ecym_5236 Chr5 (486270..488864) [2595 bp, 864 aa] {ON} similar t...    41   0.012
YHR135C Chr8 complement(372694..374310) [1617 bp, 538 aa] {ON}  ...    41   0.013
Ecym_2531 Chr2 (1034031..1034047,1034135..1035023) [906 bp, 301 ...    40   0.013
Kpol_1041.29 s1041 (73725..74876) [1152 bp, 383 aa] {ON} (73725....    40   0.013
TPHA0F03520 Chr6 (755480..757756) [2277 bp, 758 aa] {ON} Anc_1.5...    41   0.013
KAFR0E02850 Chr5 (575512..576786) [1275 bp, 424 aa] {ON} Anc_8.4...    41   0.013
KAFR0D04500 Chr4 (887515..889989) [2475 bp, 824 aa] {ON} Anc_1.5...    41   0.015
Smik_13.338 Chr13 (528578..529690) [1113 bp, 370 aa] {ON} YMR139...    40   0.015
Suva_4.168 Chr4 complement(302527..303654) [1128 bp, 375 aa] {ON...    40   0.015
KAFR0B04630 Chr2 (964764..966302) [1539 bp, 512 aa] {ON} Anc_1.3...    40   0.015
TBLA0A06660 Chr1 complement(1626147..1630400) [4254 bp, 1417 aa]...    41   0.015
KAFR0D04760 Chr4 complement(932849..936205) [3357 bp, 1118 aa] {...    41   0.016
TBLA0B09215 Chr2 complement(2180179..2181375) [1197 bp, 398 aa] ...    40   0.016
Kwal_14.1273 s14 complement(259953..261200) [1248 bp, 415 aa] {O...    40   0.017
SAKL0H11638g Chr8 complement(994049..994946,995016..995032) [915...    40   0.017
KLTH0B06204g Chr2 complement(502282..503778) [1497 bp, 498 aa] {...    40   0.017
YDL079C Chr4 complement(312951..314044,314337..314748) [1506 bp,...    40   0.017
Kpol_1035.17 s1035 complement(39908..41503) [1596 bp, 531 aa] {O...    40   0.018
KNAG0B05340 Chr2 complement(1031600..1033588) [1989 bp, 662 aa] ...    40   0.019
YPL031C Chr16 complement(492018..492918,493021..493037) [918 bp,...    40   0.019
Skud_9.134 Chr9 complement(256610..257728) [1119 bp, 372 aa] {ON...    40   0.019
TPHA0I00820 Chr9 (177222..179651) [2430 bp, 809 aa] {ON} Anc_1.2...    40   0.019
AEL120W Chr5 (396394..398715) [2322 bp, 773 aa] {ON} Syntenic ho...    40   0.020
KLTH0F12012g Chr6 complement(1013169..1014881) [1713 bp, 570 aa]...    40   0.021
CAGL0I05390g Chr9 complement(508677..510041) [1365 bp, 454 aa] {...    40   0.021
YHR079C Chr8 complement(258244..261591) [3348 bp, 1115 aa] {ON} ...    40   0.021
KAFR0A00840 Chr1 complement(151896..152894) [999 bp, 332 aa] {ON...    40   0.021
KAFR0A07320 Chr1 complement(1478564..1480033) [1470 bp, 489 aa] ...    40   0.021
Kpol_1013.52 s1013 (123332..125881) [2550 bp, 849 aa] {ON} (1233...    40   0.022
KNAG0H03710 Chr8 complement(687550..689184) [1635 bp, 544 aa] {O...    40   0.023
Suva_6.246 Chr6 (439815..442373) [2559 bp, 852 aa] {ON} YJL165C ...    40   0.023
Kwal_33.14596 s33 (735962..737464) [1503 bp, 500 aa] {ON} YNL154...    40   0.025
Smik_9.156 Chr9 complement(261998..263116) [1119 bp, 372 aa] {ON...    40   0.026
ZYRO0D10472g Chr4 (876899..880357) [3459 bp, 1152 aa] {ON} simil...    40   0.026
TPHA0G02090 Chr7 complement(429178..430527) [1350 bp, 449 aa] {O...    40   0.027
CAGL0M13541g Chr13 (1333846..1335714) [1869 bp, 622 aa] {ON} sim...    40   0.028
Suva_16.433 Chr16 (747883..749205) [1323 bp, 440 aa] {ON} YPR106...    40   0.028
CAGL0G01716g Chr7 complement(155248..156390) [1143 bp, 380 aa] {...    40   0.028
KNAG0A05920 Chr1 complement(883522..884742) [1221 bp, 406 aa] {O...    40   0.029
TBLA0B08810 Chr2 (2094401..2095375) [975 bp, 324 aa] {ON} Anc_2....    39   0.030
KAFR0E00330 Chr5 complement(74619..76574) [1956 bp, 651 aa] {ON}...    40   0.030
Kwal_23.3992 s23 complement(515493..517208) [1716 bp, 571 aa] {O...    40   0.031
YIL035C Chr9 complement(287790..288908) [1119 bp, 372 aa] {ON}  ...    39   0.032
TBLA0F01550 Chr6 complement(385184..386716) [1533 bp, 510 aa] {O...    40   0.033
Suva_16.286 Chr16 complement(495354..496254,496351..496367) [918...    39   0.033
NCAS0A04010 Chr1 complement(809163..810299) [1137 bp, 378 aa] {O...    39   0.033
TDEL0F00910 Chr6 (157379..159070) [1692 bp, 563 aa] {ON} Anc_2.1...    40   0.034
KLTH0G18282g Chr7 complement(1576512..1577558) [1047 bp, 348 aa]...    39   0.036
Suva_9.165 Chr9 complement(276469..277587) [1119 bp, 372 aa] {ON...    39   0.036
Ecym_8164 Chr8 (342672..346076) [3405 bp, 1134 aa] {ON} similar ...    40   0.037
YOR351C Chr15 complement(995018..996511) [1494 bp, 497 aa] {ON} ...    39   0.037
KNAG0I00590 Chr9 (100275..102068) [1794 bp, 597 aa] {ON}               39   0.040
KNAG0H02860 Chr8 (531728..532843) [1116 bp, 371 aa] {ON}               39   0.040
CAGL0M08316g Chr13 (829069..831963) [2895 bp, 964 aa] {ON} weakl...    39   0.041
CAGL0H09152g Chr8 complement(895722..898055) [2334 bp, 777 aa] {...    39   0.041
CAGL0H08437g Chr8 complement(825191..829423) [4233 bp, 1410 aa] ...    39   0.041
NDAI0G01760 Chr7 (384420..385700) [1281 bp, 426 aa] {ON}               39   0.042
Skud_16.251 Chr16 complement(457106..458006,458108..458124) [918...    39   0.044
NDAI0E01690 Chr5 (335849..337051) [1203 bp, 400 aa] {ON} Anc_2.391     39   0.048
Smik_7.269 Chr7 (446854..449094) [2241 bp, 746 aa] {ON} YGL021W ...    39   0.050
KNAG0B00260 Chr2 complement(36240..38477) [2238 bp, 745 aa] {ON}...    39   0.050
NDAI0C03610 Chr3 (829317..831476) [2160 bp, 719 aa] {ON} Anc_5.38      39   0.053
Smik_15.535 Chr15 complement(940569..942050) [1482 bp, 493 aa] {...    39   0.054
NDAI0A04040 Chr1 complement(907696..910041) [2346 bp, 781 aa] {O...    39   0.055
ZYRO0G04488g Chr7 complement(360635..362545) [1911 bp, 636 aa] {...    39   0.055
Suva_13.319 Chr13 (525309..526421) [1113 bp, 370 aa] {ON} YMR139...    39   0.056
Skud_10.49 Chr10 complement(81651..84206) [2556 bp, 851 aa] {ON}...    39   0.057
KLLA0D14905g Chr4 (1256065..1257768) [1704 bp, 567 aa] {ON} simi...    39   0.057
ADR163W Chr4 (989728..991008) [1281 bp, 426 aa] {ON} Syntenic ho...    39   0.057
ADR293C Chr4 complement(1207021..1210425) [3405 bp, 1134 aa] {ON...    39   0.058
YKL171W Chr11 (127475..130261) [2787 bp, 928 aa] {ON}  NNK1Prote...    39   0.060
NDAI0A00940 Chr1 complement(193710..195800) [2091 bp, 696 aa] {O...    39   0.063
CAGL0H01837g Chr8 complement(176352..178736) [2385 bp, 794 aa] {...    39   0.067
CAGL0I09504g Chr9 (909589..911175) [1587 bp, 528 aa] {ON} simila...    39   0.071
Kwal_23.4276 s23 complement(648061..649626) [1566 bp, 521 aa] {O...    39   0.071
KAFR0G01670 Chr7 (363200..367459) [4260 bp, 1419 aa] {ON} Anc_3....    39   0.072
SAKL0B01474g Chr2 complement(145734..146777) [1044 bp, 347 aa] {...    38   0.073
KLTH0E11220g Chr5 (1005953..1005969,1006040..1006931) [909 bp, 3...    38   0.080
Skud_8.139 Chr8 complement(232178..235534) [3357 bp, 1118 aa] {O...    39   0.083
Skud_13.300 Chr13 (519521..520633) [1113 bp, 370 aa] {ON} YMR139...    38   0.088
YMR139W Chr13 (546125..547237) [1113 bp, 370 aa] {ON}  RIM11Prot...    38   0.092
Skud_7.391 Chr7 (652479..654200) [1722 bp, 573 aa] {ON} YGR092W ...    38   0.098
KLLA0F23507g Chr6 complement(2198603..2200066) [1464 bp, 487 aa]...    38   0.10 
Skud_7.114 Chr7 (211645..213153) [1509 bp, 502 aa] {ON} YGL158W ...    38   0.10 
KLTH0E09658g Chr5 (869857..870957) [1101 bp, 366 aa] {ON} highly...    38   0.11 
YJR059W Chr10 (545787..548243) [2457 bp, 818 aa] {ON}  PTK2Putat...    38   0.11 
TPHA0J01160 Chr10 (268613..269905) [1293 bp, 430 aa] {ON} Anc_3....    38   0.11 
CAGL0L12474g Chr12 complement(1347340..1348248) [909 bp, 302 aa]...    37   0.12 
TBLA0A01630 Chr1 complement(385348..386386,386496..386512) [1056...    37   0.12 
KLLA0D13266g Chr4 complement(1137750..1141208) [3459 bp, 1152 aa...    38   0.12 
TBLA0D03740 Chr4 complement(926538..929057) [2520 bp, 839 aa] {O...    38   0.12 
YJL165C Chr10 complement(106894..109461) [2568 bp, 855 aa] {ON} ...    38   0.12 
Smik_10.65 Chr10 complement(104987..107545) [2559 bp, 852 aa] {O...    38   0.12 
AGR334W Chr7 (1355098..1356693) [1596 bp, 531 aa] {ON} Syntenic ...    38   0.13 
NCAS0A13320 Chr1 (2622149..2623258) [1110 bp, 369 aa] {ON}             37   0.13 
NCAS0D01230 Chr4 complement(225213..226661) [1449 bp, 482 aa] {O...    37   0.13 
KAFR0A02560 Chr1 complement(532248..533351) [1104 bp, 367 aa] {O...    37   0.14 
NCAS0E02230 Chr5 (429499..430176,430250..431104) [1533 bp, 510 a...    37   0.14 
KLLA0D11990g Chr4 complement(1022895..1023792,1023928..1023944) ...    37   0.14 
Kwal_27.11803 s27 (952938..953678) [741 bp, 246 aa] {ON} YPL031C...    37   0.14 
Smik_16.204 Chr16 complement(369272..370021) [750 bp, 249 aa] {O...    37   0.14 
KAFR0C05130 Chr3 (1018035..1019402) [1368 bp, 455 aa] {ON} Anc_7...    37   0.15 
Skud_16.256 Chr16 complement(465728..467362) [1635 bp, 544 aa] {...    37   0.15 
ZYRO0E05170g Chr5 complement(390866..392593) [1728 bp, 575 aa] {...    37   0.16 
ZYRO0D01584g Chr4 (124739..126688) [1950 bp, 649 aa] {ON} some s...    37   0.16 
NDAI0G05790 Chr7 complement(1433294..1435252) [1959 bp, 652 aa] ...    37   0.17 
YPL026C Chr16 complement(500675..502183) [1509 bp, 502 aa] {ON} ...    37   0.17 
TPHA0J02290 Chr10 (508389..510779) [2391 bp, 796 aa] {ON} Anc_6....    37   0.17 
Skud_11.54 Chr11 (113775..116570) [2796 bp, 931 aa] {ON} YKL171W...    37   0.18 
NCAS0C02470 Chr3 complement(460460..461378,461483..461499) [936 ...    37   0.18 
KNAG0A04080 Chr1 complement(551409..552635) [1227 bp, 408 aa] {O...    37   0.23 
KAFR0H01530 Chr8 complement(283589..284509) [921 bp, 306 aa] {ON...    36   0.26 
CAGL0D02244g Chr4 complement(229504..230967) [1464 bp, 487 aa] {...    37   0.28 
TPHA0K02030 Chr11 (432238..434505) [2268 bp, 755 aa] {ON} Anc_4....    37   0.29 
Kpol_1035.34 s1035 (79914..80978) [1065 bp, 354 aa] {ON} (79914....    36   0.29 
NDAI0E03170 Chr5 complement(677441..678392,678524..678543) [972 ...    36   0.29 
Suva_11.24 Chr11 complement(52742..52930,52961..54523) [1752 bp,...    37   0.29 
NCAS0I01210 Chr9 complement(218242..222582) [4341 bp, 1446 aa] {...    37   0.29 
Smik_10.349 Chr10 (534756..537209) [2454 bp, 817 aa] {ON} YJR059...    37   0.30 
NCAS0C03810 Chr3 complement(772530..773660) [1131 bp, 376 aa] {O...    36   0.32 
Ecym_8100 Chr8 complement(214001..216547) [2547 bp, 848 aa] {ON}...    37   0.33 
TDEL0B01540 Chr2 complement(272561..273458,273562..273578) [915 ...    36   0.33 
Smik_6.49 Chr6 complement(93305..94408) [1104 bp, 367 aa] {ON} Y...    36   0.34 
Ecym_1313 Chr1 complement(633556..634455) [900 bp, 299 aa] {ON} ...    36   0.35 
Suva_16.291 Chr16 complement(504006..505433) [1428 bp, 475 aa] {...    36   0.37 
KLLA0F08877g Chr6 (825217..826182) [966 bp, 321 aa] {ON} uniprot...    36   0.38 
TPHA0N00370 Chr14 (68298..69650) [1353 bp, 450 aa] {ON} Anc_7.41...    36   0.38 
CAGL0I05192g Chr9 complement(493635..494756) [1122 bp, 373 aa] {...    36   0.39 
Suva_12.148 Chr12 (223571..225982) [2412 bp, 804 aa] {ON} YJR059...    36   0.40 
ZYRO0B16038g Chr2 (1300484..1301515) [1032 bp, 343 aa] {ON} high...    36   0.43 
TPHA0I02660 Chr9 (582108..584219) [2112 bp, 703 aa] {ON} Anc_1.3...    36   0.44 
ZYRO0D16170g Chr4 (1348849..1349982) [1134 bp, 377 aa] {ON} high...    36   0.45 
TPHA0C01780 Chr3 complement(407048..407965) [918 bp, 305 aa] {ON...    35   0.46 
NDAI0A02720 Chr1 complement(612346..613455) [1110 bp, 369 aa] {O...    35   0.47 
KNAG0A02310 Chr1 complement(216545..217453) [909 bp, 302 aa] {ON...    35   0.54 
Ecym_2618 Chr2 (1196140..1197453) [1314 bp, 437 aa] {ON} similar...    35   0.57 
Kpol_1007.17 s1007 (32671..32687,32861..33767) [924 bp, 307 aa] ...    35   0.58 
CAGL0K11275g Chr11 (1094626..1096203) [1578 bp, 525 aa] {ON} sim...    35   0.58 
Ecym_4364 Chr4 (772870..773997) [1128 bp, 375 aa] {ON} similar t...    35   0.59 
Skud_10.283 Chr10 (503324..505765) [2442 bp, 813 aa] {ON} YJR059...    35   0.60 
NCAS0A12200 Chr1 (2417539..2419782) [2244 bp, 747 aa] {ON} Anc_1...    35   0.62 
Kpol_1065.6 s1065 (12266..12916,12918..13280,13332..13340,13394....    35   0.62 
KLTH0D08712g Chr4 complement(728072..729886) [1815 bp, 604 aa] {...    35   0.64 
KLLA0B11924g Chr2 complement(1043344..1047582) [4239 bp, 1412 aa...    35   0.65 
ZYRO0G08316g Chr7 (677123..679465) [2343 bp, 780 aa] {ON} simila...    35   0.65 
ADL102C Chr4 complement(503667..504785) [1119 bp, 372 aa] {ON} S...    35   0.67 
KLLA0F22297g Chr6 complement(2083448..2085547) [2100 bp, 699 aa]...    35   0.68 
SAKL0G00990g Chr7 complement(89700..90824) [1125 bp, 374 aa] {ON...    35   0.68 
Suva_6.29 Chr6 complement(51588..52691) [1104 bp, 367 aa] {ON} Y...    35   0.70 
NCAS0B08320 Chr2 complement(1585766..1588471) [2706 bp, 901 aa] ...    35   0.71 
KLTH0E11110g Chr5 (997486..998847) [1362 bp, 453 aa] {ON} simila...    35   0.72 
NCAS0C05490 Chr3 (1114733..1115755) [1023 bp, 340 aa] {ON} Anc_5...    35   0.77 
TPHA0A03700 Chr1 complement(808996..813273) [4278 bp, 1425 aa] {...    35   0.79 
ADL053C Chr4 complement(589599..591014) [1416 bp, 471 aa] {ON} S...    35   0.90 
TPHA0H01300 Chr8 (293254..294282) [1029 bp, 342 aa] {ON} Anc_5.6...    35   0.91 
NCAS0A00850 Chr1 (165458..170164) [4707 bp, 1568 aa] {ON} Anc_2....    35   0.95 
TDEL0H02380 Chr8 complement(399810..400931) [1122 bp, 373 aa] {O...    35   0.98 
NDAI0G03150 Chr7 complement(741321..742463) [1143 bp, 380 aa] {O...    35   1.0  
Skud_14.97 Chr14 (180038..184807) [4770 bp, 1589 aa] {ON} YNL242...    35   1.1  
Skud_15.228 Chr15 (403382..404401) [1020 bp, 339 aa] {ON} YOR061...    34   1.1  
YNL242W Chr14 (191324..196102) [4779 bp, 1592 aa] {ON}  ATG2Peri...    35   1.2  
TDEL0C00660 Chr3 complement(107849..108952) [1104 bp, 367 aa] {O...    34   1.2  
SAKL0B04752g Chr2 (416940..418259) [1320 bp, 439 aa] {ON} weakly...    34   1.3  
ZYRO0F08074g Chr6 (654009..654025,654107..655004) [915 bp, 304 a...    34   1.3  
KNAG0G00280 Chr7 complement(43196..45262) [2067 bp, 688 aa] {ON}...    34   1.3  
NDAI0H00610 Chr8 complement(141913..143022) [1110 bp, 369 aa] {O...    34   1.4  
TBLA0E02460 Chr5 (620609..621745) [1137 bp, 378 aa] {ON} Anc_7.2...    34   1.6  
YKL198C Chr11 complement(68232..70220) [1989 bp, 662 aa] {ON}  P...    34   1.6  
SAKL0F07854g Chr6 (600324..601442) [1119 bp, 372 aa] {ON} highly...    34   1.7  
Suva_11.52 Chr11 (112355..115156) [2802 bp, 933 aa] {ON} YKL171W...    34   1.8  
TPHA0B02780 Chr2 complement(633307..634449) [1143 bp, 380 aa] {O...    33   1.9  
TDEL0B02610 Chr2 complement(470263..471282) [1020 bp, 339 aa] {O...    33   1.9  
KLTH0A03542g Chr1 (306667..307803) [1137 bp, 378 aa] {ON} highly...    33   1.9  
Kpol_1027.1 s1027 (1..2088) [2088 bp, 695 aa] {ON} (1..2088) [20...    34   2.1  
SAKL0H24508g Chr8 (2123140..2124606) [1467 bp, 488 aa] {ON} unip...    33   2.1  
Kwal_47.18098 s47 (685497..686621) [1125 bp, 374 aa] {ON} YIL035...    33   2.1  
Smik_15.241 Chr15 (407598..408617) [1020 bp, 339 aa] {ON} YOR061...    33   2.1  
KAFR0A01740 Chr1 complement(356086..358035) [1950 bp, 649 aa] {O...    33   2.2  
CAGL0F03905g Chr6 complement(377962..380088) [2127 bp, 708 aa] {...    33   2.5  
Suva_8.111 Chr8 (204414..205433) [1020 bp, 339 aa] {ON} YOR061W ...    33   2.6  
YOR061W Chr15 (441534..442553) [1020 bp, 339 aa] {ON}  CKA2Alpha...    33   2.6  
Skud_11.20 Chr11 complement(51603..53558) [1956 bp, 651 aa] {ON}...    33   2.7  
YFL029C Chr6 complement(78055..79161) [1107 bp, 368 aa] {ON}  CA...    33   3.1  
KAFR0C03480 Chr3 (708186..709277) [1092 bp, 363 aa] {ON} Anc_8.4...    33   3.3  
NDAI0E03760 Chr5 (817014..818765) [1752 bp, 583 aa] {ON} Anc_7.41      33   3.4  
SAKL0B07326g Chr2 (627224..631477) [4254 bp, 1417 aa] {ON} simil...    33   3.5  
YLL019C Chr12 complement(105686..107899) [2214 bp, 737 aa] {ON} ...    33   3.5  
Smik_16.209 Chr16 complement(377965..379425) [1461 bp, 486 aa] {...    33   3.7  
Suva_14.100 Chr14 (186040..190794) [4755 bp, 1584 aa] {ON} YNL24...    33   4.0  
AFR387C Chr6 complement(1133761..1134804) [1044 bp, 347 aa] {ON}...    33   4.0  
Ecym_4056 Chr4 complement(119406..120428) [1023 bp, 340 aa] {ON}...    32   4.5  
CAGL0K02299g Chr11 complement(206161..207777) [1617 bp, 538 aa] ...    32   4.7  
KLLA0F16467g Chr6 (1519800..1520822) [1023 bp, 340 aa] {ON} high...    32   5.5  
Smik_11.24 Chr11 complement(52600..54522) [1923 bp, 640 aa] {ON}...    32   5.5  
Kpol_1063.4 s1063 complement(10790..11932) [1143 bp, 380 aa] {ON...    32   5.8  
TBLA0A02040 Chr1 complement(493305..495056) [1752 bp, 583 aa] {O...    32   5.8  
TDEL0H03220 Chr8 complement(533898..534950) [1053 bp, 350 aa] {O...    32   6.2  
Ecym_8392 Chr8 (803292..804806) [1515 bp, 504 aa] {ON} similar t...    32   6.3  
KNAG0E03260 Chr5 complement(654134..655246) [1113 bp, 370 aa] {O...    32   7.2  
TDEL0G01540 Chr7 complement(303940..306300) [2361 bp, 786 aa] {O...    32   7.2  
Kpol_489.20 s489 complement(59150..60178) [1029 bp, 342 aa] {ON}...    32   7.5  
KAFR0B03270 Chr2 complement(677477..679231) [1755 bp, 584 aa] {O...    32   7.6  
Ecym_3487 Chr3 complement(910575..914810) [4236 bp, 1411 aa] {ON...    32   8.6  
KAFR0E02530 Chr5 (516623..519151) [2529 bp, 842 aa] {ON} Anc_5.4...    32   8.9  
Kpol_1006.14 s1006 (52420..54042) [1623 bp, 540 aa] {ON} (52420....    32   9.9  

>Kwal_27.11542 s27 complement(841389..843764) [2376 bp, 791 aa] {ON}
           YIL095W (PRK1) - probable serine/threonine-protein
           kinase [contig 27] FULL
          Length = 791

 Score = 1520 bits (3936), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 746/791 (94%), Positives = 746/791 (94%)

Query: 1   MNQPSSGIYTQGTALTVGSHQARIIKYLTSGGFAHIYSAEISPADPNSIGNVACLKRVLV 60
           MNQPSSGIYTQGTALTVGSHQARIIKYLTSGGFAHIYSAEISPADPNSIGNVACLKRVLV
Sbjct: 1   MNQPSSGIYTQGTALTVGSHQARIIKYLTSGGFAHIYSAEISPADPNSIGNVACLKRVLV 60

Query: 61  PDKQSLNVLRAEVDAMKLLRGNKHVVSYIDSHAAKSGAQDGSYEVFLLMEYCSAGGLIDF 120
           PDKQSLNVLRAEVDAMKLLRGNKHVVSYIDSHAAKSGAQDGSYEVFLLMEYCSAGGLIDF
Sbjct: 61  PDKQSLNVLRAEVDAMKLLRGNKHVVSYIDSHAAKSGAQDGSYEVFLLMEYCSAGGLIDF 120

Query: 121 MNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIENVLISDDKTFKVCDFGS 180
           MNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIENVLISDDKTFKVCDFGS
Sbjct: 121 MNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIENVLISDDKTFKVCDFGS 180

Query: 181 VCGVIRPPKNAQEFSYVQNDILKNTTAQYRSPEMIDLYRGHPINEKSDIWALGVFLYKLC 240
           VCGVIRPPKNAQEFSYVQNDILKNTTAQYRSPEMIDLYRGHPINEKSDIWALGVFLYKLC
Sbjct: 181 VCGVIRPPKNAQEFSYVQNDILKNTTAQYRSPEMIDLYRGHPINEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKVGDAAILHSRFQFPAYPQYSDRLKNLISVMLSENPNQRPNICQVLEEVSRIQ 300
           YYTTPFEKVGDAAILHSRFQFPAYPQYSDRLKNLISVMLSENPNQRPNICQVLEEVSRIQ
Sbjct: 241 YYTTPFEKVGDAAILHSRFQFPAYPQYSDRLKNLISVMLSENPNQRPNICQVLEEVSRIQ 300

Query: 301 NVPCPLRNFYLLRSMXXXXXXXXXXXXTFPSVEVHHSLSQPRMDLKNGPVLTPFKHAQSS 360
           NVPCPLRNFYLLRSM            TFPSVEVHHSLSQPRMDLKNGPVLTPFKHAQSS
Sbjct: 301 NVPCPLRNFYLLRSMQQQQQQHQQQQQTFPSVEVHHSLSQPRMDLKNGPVLTPFKHAQSS 360

Query: 361 ALRTSKTFDGAAMNGSINNYVPVLKPHQAQPVQQNYRSDPFTSIDRRTVLQEKIPLQPAS 420
           ALRTSKTFDGAAMNGSINNYVPVLKPHQAQPVQQNYRSDPFTSIDRRTVLQEKIPLQPAS
Sbjct: 361 ALRTSKTFDGAAMNGSINNYVPVLKPHQAQPVQQNYRSDPFTSIDRRTVLQEKIPLQPAS 420

Query: 421 ADFQRLSRAQTFVPVTKSPKRSSASPSFGGRGDISMIVSANPTNVDPTPIYLNSSVQTDN 480
           ADFQRLSRAQTFVPVTKSPKRSSASPSFGGRGDISMIVSANPTNVDPTPIYLNSSVQTDN
Sbjct: 421 ADFQRLSRAQTFVPVTKSPKRSSASPSFGGRGDISMIVSANPTNVDPTPIYLNSSVQTDN 480

Query: 481 PGSDLYLSKQNTRLXXXXXXXXXXXXXXXXXXXFSRTFGRRLKKVFTGEKRSISPIKSRQ 540
           PGSDLYLSKQNTRL                   FSRTFGRRLKKVFTGEKRSISPIKSRQ
Sbjct: 481 PGSDLYLSKQNTRLSESSTSSSESIETQSTGGSFSRTFGRRLKKVFTGEKRSISPIKSRQ 540

Query: 541 NTGESVKSAFATLRRGFSSGSHKGEQLSKKNTVDVTTNGSSSNGYKFRVTSSDSIEEENS 600
           NTGESVKSAFATLRRGFSSGSHKGEQLSKKNTVDVTTNGSSSNGYKFRVTSSDSIEEENS
Sbjct: 541 NTGESVKSAFATLRRGFSSGSHKGEQLSKKNTVDVTTNGSSSNGYKFRVTSSDSIEEENS 600

Query: 601 GFIYSHSRKASSTSIVSDLDSLQDDSGTNAKKYYRSHSPVKLSGSSDARSSIQKRVQNLL 660
           GFIYSHSRKASSTSIVSDLDSLQDDSGTNAKKYYRSHSPVKLSGSSDARSSIQKRVQNLL
Sbjct: 601 GFIYSHSRKASSTSIVSDLDSLQDDSGTNAKKYYRSHSPVKLSGSSDARSSIQKRVQNLL 660

Query: 661 KSSQDSPVKKSAHGYGEVSEKEDKESPEQFTGKPAVAEARPIKRTVVPPPKRYSSVEFSS 720
           KSSQDSPVKKSAHGYGEVSEKEDKESPEQFTGKPAVAEARPIKRTVVPPPKRYSSVEFSS
Sbjct: 661 KSSQDSPVKKSAHGYGEVSEKEDKESPEQFTGKPAVAEARPIKRTVVPPPKRYSSVEFSS 720

Query: 721 IVPTAKNTTAKDIEQPIRVXXXXXXXXXXXXXXADRIIKHGSSTTENPRHSSDLEIEELE 780
           IVPTAKNTTAKDIEQPIRV              ADRIIKHGSSTTENPRHSSDLEIEELE
Sbjct: 721 IVPTAKNTTAKDIEQPIRVHHKPKRPTKPPHLKADRIIKHGSSTTENPRHSSDLEIEELE 780

Query: 781 KDFQRRFPSAV 791
           KDFQRRFPSAV
Sbjct: 781 KDFQRRFPSAV 791

>KLTH0G10318g Chr7 (872129..874501) [2373 bp, 790 aa] {ON} similar
           to uniprot|P40494 Saccharomyces cerevisiae YIL095W PRK1
           Protein serine/threonine kinase regulates the
           organization and function of the actin cytoskeleton
           through the phosphorylation of the Pan1p- Sla1p-End3p
           protein complex
          Length = 790

 Score =  913 bits (2359), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 500/803 (62%), Positives = 580/803 (72%), Gaps = 25/803 (3%)

Query: 1   MNQPSSGIYTQGTALTVGSHQARIIKYLTSGGFAHIYSAEISPADPNSIGNVACLKRVLV 60
           MNQ  + IY  GT LTVGSH+ARIIKYLTSGGFAHIY+AEI PAD +S   +ACLKRVLV
Sbjct: 1   MNQSLNDIYQPGTELTVGSHRARIIKYLTSGGFAHIYTAEICPADLSSPAKIACLKRVLV 60

Query: 61  PDKQSLNVLRAEVDAMKLLRGNKHVVSYIDSHAAKSGAQDGSYEVFLLMEYCSAGGLIDF 120
           PDK SLNVLRAEVDAMKLLRGN+HVVSYIDSHAAKSG  DGSYEVFLLMEYCS GGLIDF
Sbjct: 61  PDKPSLNVLRAEVDAMKLLRGNQHVVSYIDSHAAKSGVHDGSYEVFLLMEYCSGGGLIDF 120

Query: 121 MNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIENVLISDDKTFKVCDFGS 180
           MNTRLQNRL E EVLKI SDITQGIAAMHAL PPLIHRDIKIENVLISDD+TFKVCDFGS
Sbjct: 121 MNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIKIENVLISDDRTFKVCDFGS 180

Query: 181 VCGVIRPPKNAQEFSYVQNDILKNTTAQYRSPEMIDLYRGHPINEKSDIWALGVFLYKLC 240
           VCGVIRPPKN QEF+YVQ+DILKNTTAQYR+PEMIDLYRG+PINEKSDIWALGVFLYKLC
Sbjct: 181 VCGVIRPPKNPQEFNYVQHDILKNTTAQYRAPEMIDLYRGYPINEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKVGDAAILHSRFQFPAYPQYSDRLKNLISVMLSENPNQRPNICQVLEEVSRIQ 300
           YYTTPFEKVG+AAILHSRFQFP+YPQYSD LK+LIS MLSENP QRPNICQVLEEVSRIQ
Sbjct: 241 YYTTPFEKVGEAAILHSRFQFPSYPQYSDSLKHLISFMLSENPTQRPNICQVLEEVSRIQ 300

Query: 301 NVPCPLRNFYLLRSMXXXXXXXXXXXXTFPSVEVHHSLSQPRMDLKNGPVLTPFKHAQSS 360
             PCPLRNFY+ R+M              P ++  HS SQP++D  N  +  PFK + + 
Sbjct: 301 GTPCPLRNFYVTRAMQQQQQHQQ------PKIKFDHSASQPKLDSANNIINVPFKMSHNQ 354

Query: 361 ALRTSKTFDGAAMNGSINNYVPVLKPHQAQPVQQNYRSDPFTSIDRRTVLQEKIPLQ--- 417
            LR+++TF GA +N + N Y+P LKP   QPV  ++ + PF  I+    LQ K       
Sbjct: 355 PLRSTQTFAGAPVNAASNGYLPALKPLPIQPVSSSFTNGPFKFIEGNKALQSKQTPHFQP 414

Query: 418 PASADFQRLSRAQTFVPVTKSPKRSSASPSFGGRGDISMIVSANPTNVDPTPIYLNSSVQ 477
           P S DF RL R+QTF P +    RSS SP   GRGDIS I+SANPTNV+P+PIYL+S  Q
Sbjct: 415 PISHDFNRLGRSQTFTPTSTLASRSSVSPPLAGRGDISKIISANPTNVEPSPIYLSSGTQ 474

Query: 478 TDNPGSDLYLSKQNTRLXXXXXXXXXXXXXXXXXXXFSRTFGRRLKKVFTGEKRSISPIK 537
           TD+  +  +  K                         +R FG++L KVFTGE+RSISPIK
Sbjct: 475 TDDGFASSHALKLERTKSIASLSSSESVESQHTGGSATRRFGQKL-KVFTGERRSISPIK 533

Query: 538 SRQNTGESVKSAFATLRRGFSSGSHKGEQLSKKNTVDVTTNGSSSNGYKFRVTSSDSIEE 597
           SRQNTG+SV+SAFATLRRGFS GS K E  +K+N++D+++  S SNG+KFRV+SS+SIEE
Sbjct: 534 SRQNTGDSVRSAFATLRRGFSGGSFKSELPNKRNSLDISSTSSHSNGFKFRVSSSESIEE 593

Query: 598 ENSGFIYSHSRKASSTSIVSDLDSLQDDSGTNAKKYYRSHSPVKLSGSSDARSSIQKRVQ 657
           EN    +SHSR +SS SIVSDLD LQ D  T AK YY+SHSPVK+S +  +RSSIQKRVQ
Sbjct: 594 ENVYPRFSHSRSSSSASIVSDLDQLQQDD-TGAKNYYKSHSPVKVSATQGSRSSIQKRVQ 652

Query: 658 NLLKSSQDSPVKKSAHGYGEVSE-KEDKESPEQFTGKPA---VAEARPIKRTVVPPPKRY 713
           +LLK+SQDSPVKK+AHGYG +S   E  E   Q T +     V ++      V+ P KR 
Sbjct: 653 DLLKNSQDSPVKKTAHGYGMLSPGDEAAELASQLTNETMLQNVHQSTASTPKVLSPAKRN 712

Query: 714 SSVEFSSIVPTAKNTTAKDIEQ----PIRVXXXXXXXXXXXXXXADRIIKHG-SSTTENP 768
           SSV     V  A    +KD E+                      AD+IIK   +S  E+ 
Sbjct: 713 SSV-----VIKAGQQVSKDAEEVPSSRKPAPPKPKRPKKPSHLKADKIIKEAETSAYEHS 767

Query: 769 RHSSDLEIEELEKDFQRRFPSAV 791
              SD+EI+ELEKDF+RRFPSAV
Sbjct: 768 VDISDIEIDELEKDFKRRFPSAV 790

>SAKL0E07722g Chr5 complement(625066..627441) [2376 bp, 791 aa] {ON}
           similar to uniprot|P40494 Saccharomyces cerevisiae
           YIL095W PRK1 Protein serine/threonine kinase regulates
           the organization and function of the actin cytoskeleton
           through the phosphorylation of the Pan1p-Sla1p-End3p
           protein complex
          Length = 791

 Score =  717 bits (1852), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 407/809 (50%), Positives = 518/809 (64%), Gaps = 36/809 (4%)

Query: 1   MNQPSSGIYTQGTALTVGSHQARIIKYLTSGGFAHIYSAEISPADPNSIGNVACLKRVLV 60
           M+QP    Y  GT LTVGSH+ARIIKYLTSGGFAHIYSAEISP DPNS  ++ACLKRVLV
Sbjct: 1   MSQPPLETYPSGTVLTVGSHKARIIKYLTSGGFAHIYSAEISPPDPNS-SSIACLKRVLV 59

Query: 61  PDKQSLNVLRAEVDAMKLLRGNKHVVSYIDSHAAKSGAQDGSYEVFLLMEYCSAGGLIDF 120
           PDK SLN LRAEVDAMKLL+ +K VVSYIDSHAAKS   +GSYEVFLLMEYC+ GGLIDF
Sbjct: 60  PDKPSLNSLRAEVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDF 119

Query: 121 MNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIENVLISDDKTFKVCDFGS 180
           MNTRLQNRL E EVLKIMS ++QG+AAMHAL PPLIHRDIKIENVLIS+D  FKVCDFGS
Sbjct: 120 MNTRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISEDGNFKVCDFGS 179

Query: 181 VCGVIRPPKNAQEFSYVQNDILKNTTAQYRSPEMIDLYRGHPINEKSDIWALGVFLYKLC 240
           VCGVIRPPKN QE +YVQ+DILKNTTAQYRSPEMIDLYRG P++EKSDIWALGVFLYKLC
Sbjct: 180 VCGVIRPPKNPQELNYVQHDILKNTTAQYRSPEMIDLYRGLPVDEKSDIWALGVFLYKLC 239

Query: 241 YYTTPFEKVGDAAILHSRFQFPAYPQYSDRLKNLISVMLSENPNQRPNICQVLEEVSRIQ 300
           YYTTPFEK G+ AILHS+FQFPAYPQYSD+LKNLIS +L ENP QRPNICQ+L EVSRIQ
Sbjct: 240 YYTTPFEKAGEVAILHSKFQFPAYPQYSDQLKNLISALLRENPMQRPNICQLLAEVSRIQ 299

Query: 301 NVPCPLRNFYLLRSMXXXXXXXXXXXXTFPSVEVHHSLSQPRMDLKNGPV-LTPFKHAQS 359
            VPCP++NFYL R M                  + HS+SQP+M+    P+ L P  H Q 
Sbjct: 300 GVPCPVKNFYLERKMLLQQQQQQQQQLQ----PLRHSVSQPQMEAITLPITLQP--HPQK 353

Query: 360 SALRTSKTFDGAAMNGSINNYVPVLKPHQAQPVQQNYRSDPFTSIDRRTVLQEKIPLQPA 419
                  ++    +  S      +L   ++QP+    R+DPF ++D+  +L  K  L+  
Sbjct: 354 VLASAQVSYANTGLTASPTAQQKLLY-SRSQPLPA--RNDPFLNLDKSNLLPPKTKLEFP 410

Query: 420 SADFQRLSRAQTFVPVTK--SPKRSSASPSFGGRGDISMIVSANPTNVDPTPIYLNSSVQ 477
              + +       +P T   + +R S SP   GRGDIS I+ +NPT+VD    Y++S  Q
Sbjct: 411 ELKYNK--EQLNGIPATTPYATQRRSVSPVRNGRGDISKILKSNPTSVDRLSSYVDSETQ 468

Query: 478 TDNPGSDLYLSKQNTRLXXXXXXXXXXXXXXXXXX--XFSRTFGRRLKKVFTGEKRSISP 535
           T      L  S   +                       F+R  G +LK++ + E R+ SP
Sbjct: 469 TFETIEPLSRSVSRSVSRGSASSASSQDSVEEQSTGGSFTRRIGDKLKRIISNEPRNTSP 528

Query: 536 IKSRQNTGESVKSAFATLRRGFSSGSHKGEQLSKKNTVDVTTNGSSSNGYKFRVTSSDSI 595
           I+SRQNTG S +SAF+TLRRG SS        SK+N+VD +     S G K RV+SS SI
Sbjct: 529 IRSRQNTGGSTRSAFSTLRRGTSSNFSSDR--SKRNSVDFSVRRLGSGGNKVRVSSSKSI 586

Query: 596 EE-------ENSGFIYSHSRKASSTSIVSDLDSLQDDSGTNAKKYYRSHSPVKLSGSSDA 648
           EE       EN G    H+R  S++SI SDL+  +  +G+ ++ Y ++HSP+K+S + ++
Sbjct: 587 EEKGNTNKFENKG----HNRSVSTSSITSDLNKYEGKAGSVSRGYNQAHSPIKMSANRES 642

Query: 649 RSSIQKRVQNLLKSSQDSPVKKSAHGYGEVSEKEDKESPEQFTGKPAVAEARPIKRTVVP 708
           R+SIQKRV +LLK+SQDSPV+K+A  +GE S      + +       +         VV 
Sbjct: 643 RNSIQKRVHDLLKNSQDSPVRKTAPDFGEFSSFPQDHAADHTISDKVIDVHNVTSSPVVQ 702

Query: 709 PPKRYSSVEFSSIV-PTAKNTT-----AKDIEQPIRVXXXXXXXXXXXXXXADRIIKHGS 762
                ++ + +++V PT K+ T          +P+R+                 I K G 
Sbjct: 703 KATLDTTHQSNTVVSPTRKHFTRTREKPVPPPKPVRLRPKPPPKPFHLKVKNLVIPKKGR 762

Query: 763 STTENPRHSSDLEIEELEKDFQRRFPSAV 791
            +      S +++I++LE+DF++R+PSA+
Sbjct: 763 YSNRANTLSDEVDIDDLEEDFKKRYPSAI 791

>Suva_9.104 Chr9 (178011..180428) [2418 bp, 805 aa] {ON} YIL095W
           (REAL)
          Length = 805

 Score =  608 bits (1569), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/849 (44%), Positives = 490/849 (57%), Gaps = 102/849 (12%)

Query: 1   MNQPSSGIYTQGTALTVGSHQARIIKYLTSGGFAHIYSAEISPADPNSIGNVACLKRVLV 60
           MN P   +Y  GT LTVGSH A+IIKYLTSGGFA +YSAEISP DP S  N+ACLKRV+V
Sbjct: 1   MNTPQISLYEPGTILTVGSHHAKIIKYLTSGGFAQVYSAEISPPDPYSSANIACLKRVIV 60

Query: 61  PDKQSLNVLRAEVDAMKLLRGNKHVVSYIDSHAAKSGAQDGSYEVFLLMEYCSAGGLIDF 120
           PDKQ LN LRAEVDAMKLL+ NKHVVSYIDSHAAKS     +YEVF+LMEYC  GGLIDF
Sbjct: 61  PDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKS-VNGVAYEVFVLMEYCERGGLIDF 119

Query: 121 MNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIENVLISDDKTFKVCDFGS 180
           MNTRL+NRL E+E+L IM    QGIAAMHAL PPLIHRDIKIENVLIS +  +KVCDFGS
Sbjct: 120 MNTRLKNRLQESEILDIMGQTVQGIAAMHALQPPLIHRDIKIENVLISHEGLYKVCDFGS 179

Query: 181 VCGVIRPPKNAQEFSYVQNDILKNTTAQYRSPEMIDLYRGHPINEKSDIWALGVFLYKLC 240
           V GVIRPPKN QEF+YVQ+DIL NTTAQYRSPEMIDLYRG PI+EKSDIWALGVFLYK+C
Sbjct: 180 VSGVIRPPKNPQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGVFLYKIC 239

Query: 241 YYTTPFEKVGDAAILHSRFQFPAYPQYSDRLKNLISVMLSENPNQRPNICQVLEEVSRIQ 300
           YYTTPFEK G+AAILH+R+Q+P++PQYSDRLKNLI +ML E P+QRPNICQVLEEVSR+Q
Sbjct: 240 YYTTPFEKTGEAAILHARYQYPSFPQYSDRLKNLIRLMLMEAPSQRPNICQVLEEVSRLQ 299

Query: 301 NVPCPLRNFYLLRSMXXXXXXXXXXXXTFPSVEVHHSLSQPRMDLKNGPVLTPFKHAQSS 360
           N PCP+RNFYLLR+M               +        Q   +++  P + P      S
Sbjct: 300 NRPCPIRNFYLLRAMNQNAQFGSESTSMTYTPAQQLVSPQSFQNIQAMPNIVPL-----S 354

Query: 361 ALRTSKTFDGAAMNGSINNYVPVLKPHQAQPVQQ--NYRSDPFTSIDRRTVLQEKIPLQP 418
            ++T+   D A+   + NN +  +   + Q ++   N+ S P T          K    P
Sbjct: 355 NIKTTPNLDSASNFVNNNNKMEAMLQLRTQKLETGPNF-SIPLT----------KTKSVP 403

Query: 419 ASADFQRL--------SRAQTFVPV--TKSPKRSSA--SPSFGGRGDISMIVSAN-PTNV 465
            S DF  L         +  TF  V  ++SP+R S   SP+     +   + + N P N 
Sbjct: 404 LSDDFTSLYYKELHPFQKPHTFKSVEGSQSPQRKSIPFSPTPVNSNNYDRVSTINRPNN- 462

Query: 466 DPTPIYLNSSVQTDNPGSDLYLSKQNT-RLXXXXXXXXXXXXXXXXXXXFSRTFGRRLKK 524
                Y++S  QT +  + L L    T                        R+   +LK+
Sbjct: 463 -----YVDSETQTLDSIATLKLKPSPTISNKTTGFSKESTVPENVTGGKIVRSLSSKLKR 517

Query: 525 VFTGEKRSISPIKSRQNTGESVKSAFATLRRGFSSGSHKGEQLSKKNTVDVTTNGSSSNG 584
           V TGE R+ SPIKSRQNTG+S++SAF  LR GF+         S  N+   + + +++N 
Sbjct: 518 VITGESRNGSPIKSRQNTGDSIRSAFGMLRHGFTGS-------SINNSRSTSFDNNNANS 570

Query: 585 YKFRVTSSDSI-------------EEENSGFIYSHSRKASSTSIVSDLDSLQ-DDSGTNA 630
              R+TSS S              EE +      H R++   SI+SD D  + ++S T +
Sbjct: 571 VNRRLTSSSSNPSSSNLNSDTKRKEELDKKRKLEH-RRSMPPSILSDFDQHERNNSRTGS 629

Query: 631 KKYYRSHSPVK--------------LSGSSD------ARSSIQKRVQNLLKSSQDSPVKK 670
           + YYRSHSPVK               S +SD       + SIQ+RV NLL +S+DS   K
Sbjct: 630 RDYYRSHSPVKKTQTTPTTTTRPSLKSSNSDINIDQEKKESIQRRVHNLLNNSEDSLSYK 689

Query: 671 SAHGYGEVSEKEDKESPEQFTGKPAVAEARPIKRTVVPPPKRYSSVEFSSIVPTAKNTTA 730
           SA GYG+ ++ E      + T + +     PI        +R+++   S+ +    +T++
Sbjct: 690 SASGYGKYTDTE-----AESTNRQSSVRITPITE------ERFNNYHSSNTM--NDHTSS 736

Query: 731 KDIEQPIRVXXXXXXXXXXXXXXADRIIKHGSS--------TTENPRHSSDLEIEELEKD 782
           KD  +                    R   +  S        ++E      D+ ++ELE D
Sbjct: 737 KDKPKSRPPRPPPKPLHLRTKIHNTRCSSNLQSRKPPMERISSEATETIVDVNVDELEAD 796

Query: 783 FQRRFPSAV 791
           F++RFPS V
Sbjct: 797 FRKRFPSKV 805

>Skud_9.78 Chr9 (160531..162960) [2430 bp, 809 aa] {ON} YIL095W
           (REAL)
          Length = 809

 Score =  607 bits (1564), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/727 (48%), Positives = 443/727 (60%), Gaps = 71/727 (9%)

Query: 1   MNQPSSGIYTQGTALTVGSHQARIIKYLTSGGFAHIYSAEISPADPNSIGNVACLKRVLV 60
           MN P   +Y  GT LTVGSH A+IIKYLTSGGFA +Y+AEISP DP S  N ACLKRV+V
Sbjct: 1   MNAPQISLYDPGTVLTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYSNANTACLKRVIV 60

Query: 61  PDKQSLNVLRAEVDAMKLLRGNKHVVSYIDSHAAKSGAQDGSYEVFLLMEYCSAGGLIDF 120
           PDKQ LN LRAEVDAMKLL+ NKHVVSYIDSHAAKS     +YEVF+LME+C  GGLIDF
Sbjct: 61  PDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKS-VNGIAYEVFVLMEFCERGGLIDF 119

Query: 121 MNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIENVLISDDKTFKVCDFGS 180
           MNTRLQ+RL E+E+L+IMS   QGIAAMH L PPLIHRDIKIENVLIS D  +KVCDFGS
Sbjct: 120 MNTRLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYKVCDFGS 179

Query: 181 VCGVIRPPKNAQEFSYVQNDILKNTTAQYRSPEMIDLYRGHPINEKSDIWALGVFLYKLC 240
           V GVIRPP+N+QEF+YVQ+DIL NTTAQYRSPEMIDLYR  PI+EKSDIWALGVFLYK+C
Sbjct: 180 VSGVIRPPRNSQEFNYVQHDILTNTTAQYRSPEMIDLYRNSPIDEKSDIWALGVFLYKIC 239

Query: 241 YYTTPFEKVGDAAILHSRFQFPAYPQYSDRLKNLISVMLSENPNQRPNICQVLEEVSRIQ 300
           YYTTPFEK G+AAILHSR+Q+P++PQYSDRLK LI +ML E P+QRPNICQVLEEVSR+Q
Sbjct: 240 YYTTPFEKSGEAAILHSRYQYPSFPQYSDRLKGLIHLMLMEVPSQRPNICQVLEEVSRLQ 299

Query: 301 NVPCPLRNFYLLRSMXXXXXXXXXXXXTFPSVEVHHSLSQPRMDLKNGPVLTPFKHAQS- 359
           N PCP+RNFYLLR+M              PSV  + S  Q    L     L   KH QS 
Sbjct: 300 NEPCPIRNFYLLRAMGQNAQLASEP----PSV-TYVSAQQ----LLPAQTLQGIKHLQSM 350

Query: 360 ---SALRTSKTFDGAAMNGSINNYVPVLKPHQAQPVQQNYRSDPFTSIDRRTVLQEKIPL 416
              + +RT+          + NN    + P + QP       +P            K   
Sbjct: 351 VPVTHVRTTPNLGTLTKAITNNNQTESILPVRTQPESDLNLGNPLM----------KTKS 400

Query: 417 QPASADFQRL--------SRAQTFVPVT--KSPKRSSASPSFGGRGDISMIVSANPTNVD 466
            P S DF  L         ++QTF  V   +SP+R  ++PS     +      A+ + VD
Sbjct: 401 VPLSDDFASLYYRELHPFQKSQTFKSVESFQSPQRKLSTPSSSSPVNSKNNDRASTSTVD 460

Query: 467 PTPIYLNSSVQTDNPGSDLYLSKQNTRLXX-XXXXXXXXXXXXXXXXXFSRTFGRRLKKV 525
               Y++S  QT +  + L L++ +  +                      R+   +LKKV
Sbjct: 461 RPNNYVDSVTQTIDNMAALNLNQSSVAINKPSGPPKESIVPENVTGGSIVRSLSSKLKKV 520

Query: 526 FTGEKRSISPIKSRQNTGESVKSAFATLRRGFSSGSHKGEQLSKKNTVDVTTNGSSSN-- 583
            TGE RS SPIKSRQNTG+S++SAF  LR G +  S    +    ++ +   NG+S N  
Sbjct: 521 ITGESRSSSPIKSRQNTGDSIRSAFGMLRHGLTGSSVSNNRTISFDSNNGNGNGNSVNRR 580

Query: 584 ---------GYKFRVTSSDSIEEENSGFIYSHSRKASSTSIVSDLDSLQ-DDSGTNAKKY 633
                     + F     D ++++        +R++   SI+SD D  + ++S T ++ Y
Sbjct: 581 LASSSSSSSNFNFDTKRQDDLDKKQK----LENRRSMPPSILSDFDKHERNNSRTGSRDY 636

Query: 634 YRSHSPVK--------------LSGSSDA------RSSIQKRVQNLLKSSQDSPVKKSAH 673
           YRSHSPVK               S SSD       + SIQ+RV NLL +S+D    KSA 
Sbjct: 637 YRSHSPVKKNQTTPKTASRTTLKSDSSDIDVKQVNKESIQRRVHNLLNNSEDPLAHKSAS 696

Query: 674 GYGEVSE 680
           GYG+ ++
Sbjct: 697 GYGKYTD 703

>YIL095W Chr9 (183937..186369) [2433 bp, 810 aa] {ON}  PRK1Protein
           serine/threonine kinase; regulates the organization and
           function of the actin cytoskeleton and reduces endocytic
           ability of cell through the phosphorylation of the
           Pan1p-Sla1p-End3p protein complex
          Length = 810

 Score =  605 bits (1561), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 385/850 (45%), Positives = 481/850 (56%), Gaps = 99/850 (11%)

Query: 1   MNQPSSGIYTQGTALTVGSHQARIIKYLTSGGFAHIYSAEISPADPNSIGNVACLKRVLV 60
           MN P   +Y  GT LTVGSH A+IIKYLTSGGFA +Y+AEISP DP S  N+ACLKRV+V
Sbjct: 1   MNTPQISLYEPGTILTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYSNANIACLKRVIV 60

Query: 61  PDKQSLNVLRAEVDAMKLLRGNKHVVSYIDSHAAKSGAQDGSYEVFLLMEYCSAGGLIDF 120
           P KQ LN LRAEVDAMKLLR NKHVVSYIDSHAA+S     +YEVF+LME+C  GGLIDF
Sbjct: 61  PHKQGLNTLRAEVDAMKLLRNNKHVVSYIDSHAARS-VNGIAYEVFVLMEFCERGGLIDF 119

Query: 121 MNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIENVLISDDKTFKVCDFGS 180
           MNTRLQNRL E+E+L+IMS   QGI AMHAL PPLIHRDIKIENVLIS D  +KVCDFGS
Sbjct: 120 MNTRLQNRLQESEILEIMSQTVQGITAMHALQPPLIHRDIKIENVLISHDGLYKVCDFGS 179

Query: 181 VCGVIRPPKNAQEFSYVQNDILKNTTAQYRSPEMIDLYRGHPINEKSDIWALGVFLYKLC 240
           V GVIRPP+N QEF+YVQ+DIL NTTAQYRSPEMIDLYRG PI+EKSDIWALGVFLYK+C
Sbjct: 180 VSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGVFLYKIC 239

Query: 241 YYTTPFEKVGDAAILHSRFQFPAYPQYSDRLKNLISVMLSENPNQRPNICQVLEEVSRIQ 300
           YYTTPFEK G+A ILH+R+Q+P++PQYSDRLKNLI +ML E P+QRPNICQVLEEVSR+Q
Sbjct: 240 YYTTPFEKSGEAGILHARYQYPSFPQYSDRLKNLIRLMLMEAPSQRPNICQVLEEVSRLQ 299

Query: 301 NVPCPLRNFYLLRSMXXXXXXXXXXXXT---------FPSVEVHHSLSQP-----RMDLK 346
           N PCP+RNFYLLR+M            +         F  V+   S++QP        + 
Sbjct: 300 NKPCPIRNFYLLRAMNQNANTQLAGEPSSTTYVPTQKFIPVQSLQSINQPPNMMPVTHVS 359

Query: 347 NGPVLTPFKHAQSSALRTSKTFDGAAMNGSINNYVPVLKPHQAQPVQQNYRSDPFTSIDR 406
             P L  F  + +   +T  T       GS +N    L   ++ P+     SD F S+  
Sbjct: 360 TTPNLGTFPISINDNNKTEVTAHAGLQVGSHSNLTSPLMKTKSVPL-----SDEFASL-- 412

Query: 407 RTVLQEKIPLQPASADFQRLSRAQTFVPVT--KSPKRSSASPSFGG--RGDISMIVSA-- 460
               +E  P Q          ++QTF  V   +SP+R S  P        DI   VSA  
Sbjct: 413 --YYKELHPFQ----------KSQTFKSVESFQSPQRKSMPPLSLTPVNNDIFDRVSAIN 460

Query: 461 NPTNVDPTPIYLNSSVQT-DNPG-SDLYLSKQNTRLXXXXXXXXXXXXXXXXXXXFSRTF 518
            P N      Y++S  QT DN    +L LS   T                       R+ 
Sbjct: 461 RPNN------YVDSETQTIDNMAVPNLKLSPTITS-KSLSSTKEIAAPDNINGSKIVRSL 513

Query: 519 GRRLKKVFTGEKRSISPIKSRQNTGESVKSAFATLRRGFSSGSHKGEQLSKKNTVDVTTN 578
             +LKKV TGE R  SPIKSRQNTG+S++SAF  LR GF+  S      S+  + D    
Sbjct: 514 SSKLKKVITGESRGNSPIKSRQNTGDSIRSAFGKLRHGFTGNSVNN---SRSASFDNNNV 570

Query: 579 GSSSNGYKFRVTSSDSI-----------EEENSGFIYSHSRKASSTSIVSDLDSLQ-DDS 626
             + N    R+ SS +            +EE+        R++   SI+SD D  + ++S
Sbjct: 571 NGNGNNTNRRLVSSSTSSFPKFNSDTKRKEESDKNQRLEKRRSMPPSILSDFDQHERNNS 630

Query: 627 GTNAKKYYRSHSPVKLSGSS--------------------DARSSIQKRVQNLLKSSQDS 666
            T ++ YYRSHSPVK + +S                    + + SIQ+RV NLLKSS D 
Sbjct: 631 RTGSRDYYRSHSPVKKTQASAKTTSKPTLIPDNGNVNINQEKKESIQRRVHNLLKSSDDP 690

Query: 667 PVKKSAHGYGEV----SEKEDKESPEQFTGKPAVAEARPIKRTVVPPPKRYSSVEFSSIV 722
              KSA GYG+     +E  ++ S  + T        + +K  V+    + +  + S   
Sbjct: 691 VTYKSASGYGKYTDIGTETSNRHSSVRITPITEEKFKKTLKDGVLDIKTKSNGKDKSRPP 750

Query: 723 PTAKNTTAKDIE-QPIRVXXXXXXXXXXXXXXADRIIKHGSSTTENPRHSSDLEIEELEK 781
                      E Q IR                +RI    + T        D+ +++LE 
Sbjct: 751 RPPPKPLHLRTEIQKIR----NFSRLQSKKLPIERISSEATETI------VDVNVDDLEA 800

Query: 782 DFQRRFPSAV 791
           DF++RFPS V
Sbjct: 801 DFRKRFPSKV 810

>Smik_9.84 Chr9 (162983..165409) [2427 bp, 808 aa] {ON} YIL095W
           (REAL)
          Length = 808

 Score =  593 bits (1530), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 353/730 (48%), Positives = 441/730 (60%), Gaps = 66/730 (9%)

Query: 1   MNQPSSGIYTQGTALTVGSHQARIIKYLTSGGFAHIYSAEISPADPNSIGNVACLKRVLV 60
           MN P   +Y  GT LTVGSH A+IIKYLTSGGFA +Y+AEISP DP +  N+ACLKRV+V
Sbjct: 1   MNAPQISLYEPGTILTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYTNANIACLKRVIV 60

Query: 61  PDKQSLNVLRAEVDAMKLLRGNKHVVSYIDSHAAKSGAQDGSYEVFLLMEYCSAGGLIDF 120
           PDKQ LN LRAEVDAMKLL+ NKHVVSYIDSHAAKS     +YEVF+LME+C  GGLIDF
Sbjct: 61  PDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKS-VNGVAYEVFVLMEFCERGGLIDF 119

Query: 121 MNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIENVLISDDKTFKVCDFGS 180
           MNTRLQNRL E+E+L+IMS   QGIAAMHAL PPLIHRDIKIENVLIS +  +KVCDFGS
Sbjct: 120 MNTRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIENVLISHNGLYKVCDFGS 179

Query: 181 VCGVIRPPKNAQEFSYVQNDILKNTTAQYRSPEMIDLYRGHPINEKSDIWALGVFLYKLC 240
           V GVIRPP+N QEF+YVQ+DIL NTTAQYRSPEMIDLYRG PI+EKSDIWALG+FLYK+C
Sbjct: 180 VSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGIFLYKIC 239

Query: 241 YYTTPFEKVGDAAILHSRFQFPAYPQYSDRLKNLISVMLSENPNQRPNICQVLEEVSRIQ 300
           YYTTPFEK G+A ILH+R+Q+P +PQYSDRLKNLI +ML E P++RPNICQVLEEVSR+Q
Sbjct: 240 YYTTPFEKSGEAGILHARYQYPPFPQYSDRLKNLIRLMLMETPSKRPNICQVLEEVSRLQ 299

Query: 301 NVPCPLRNFYLLRSMXXXXXXXXXXXXTFPSVEVHHSL-SQPRMDLKNGPVLTPFKHAQS 359
             PCP+RNFYLLR+M            +   V     L +Q    +K    + P  H   
Sbjct: 300 IKPCPIRNFYLLRAM-SQTAQLASEPPSMKYVPTQKFLPAQGLQSMKPISNMIPVSH--- 355

Query: 360 SALRTSKTFDGAAMNGSINNYVPVLKPHQAQPVQQNYRSDPFTSIDRRTVLQEKIPLQPA 419
             +RT+        +   NN   V K    Q V  +    P           +K    P 
Sbjct: 356 --VRTTPNLSTLPRSIDDNNMTDVTKQISLQFVGDSNVDTPL----------KKTKSVPL 403

Query: 420 SADFQRL--------SRAQTFVPVT--KSPKRSSASPSFGGRGDISMIVSANPTNVDPTP 469
           S DF  L         ++QTF  V   +SP+R S  PS     + S+I+   PT   P  
Sbjct: 404 SDDFASLYYRELHPFQKSQTFKSVENFQSPQRRSMPPSSLPPAN-SIILDKTPTMNRPNN 462

Query: 470 IYLNSSVQTDN----PGSDLYLSKQNTRLXXXXXXXXXXXXXXXXXXXFSRTFGRRLKKV 525
            Y++S  QT +     GS L  +  N  +                     R+   +LKKV
Sbjct: 463 -YVDSETQTTDIITMSGSKLSPALTNKPV---NSQKEFIAPENVSGGNIVRSLSSKLKKV 518

Query: 526 FTGEKRSISPIKSRQNTGESVKSAFATLRRGFSSGSHKGEQLSKKNTVDVTTN------- 578
            TGE R  SPIKSRQNTG+S +SA   LR GF+  S    + +  ++ + ++N       
Sbjct: 519 ITGESRGSSPIKSRQNTGDSTRSALGMLRHGFTGSSMNNNRSASFDSNNGSSNNNSVNRR 578

Query: 579 -GSSSNGYKFRVTSSDSIEEENSGFIYSHSRKASSTSIVSDLDSLQD-DSGTNAKKYYRS 636
            GSSS             +EE        +R++  +SI+SD D  +  +S T ++ YYRS
Sbjct: 579 LGSSSTSSLSVFNPDTKRQEEIDKKQKLENRRSMPSSILSDFDQHERINSRTGSRDYYRS 638

Query: 637 HSPVK--------------------LSGSSDARSSIQKRVQNLLKSSQDSPVKKSAHGYG 676
           HSPVK                    ++ + + + SIQ+RV NLLKSS+D    KSA GYG
Sbjct: 639 HSPVKKIQTTSKSAPKPITKPVIGDININQEKKESIQRRVHNLLKSSEDPLTYKSASGYG 698

Query: 677 EVSEKEDKES 686
           + ++ + + S
Sbjct: 699 KYTDTDTETS 708

>TDEL0G02150 Chr7 (422718..424703) [1986 bp, 661 aa] {ON} Anc_2.284
           YNL020C
          Length = 661

 Score =  549 bits (1415), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/482 (60%), Positives = 337/482 (69%), Gaps = 30/482 (6%)

Query: 1   MNQPSSGIYTQGTALTVGSHQARIIKYLTSGGFAHIYSAEISPADPNSIGNVACLKRVLV 60
           MNQP    Y  GT LTVGSH A++I YLTSGGFA +YSAEI PAD     NVACLKRV+V
Sbjct: 1   MNQPEIPNYNPGTVLTVGSHHAKVISYLTSGGFAQVYSAEIQPADAFIDSNVACLKRVIV 60

Query: 61  PDKQSLNVLRAEVDAMKLLRGNKHVVSYIDSHAAKSGAQDGSYEVFLLMEYCSAGGLIDF 120
           PDK SLN LRAEVDAMKLLR NKHVVSYIDSHAAKS   +GSYEVFLLMEYC+ GGLIDF
Sbjct: 61  PDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHAAKSSFPNGSYEVFLLMEYCAGGGLIDF 120

Query: 121 MNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIENVLISDDKTFKVCDFGS 180
           MNTRLQNRL E E+L IMS +TQGIAAMHAL PPLIHRDIKIENVLIS    +KVCDFGS
Sbjct: 121 MNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISHTGQYKVCDFGS 180

Query: 181 VCGVIRPPKNAQEFSYVQNDILKNTTAQYRSPEMIDLYRGHPINEKSDIWALGVFLYKLC 240
           VCGVIRPP+N QEF+YVQ+D+LKNTTAQYRSPEMIDLYRGHPI+EKSDIWALGVFLYKLC
Sbjct: 181 VCGVIRPPQNPQEFAYVQHDVLKNTTAQYRSPEMIDLYRGHPIDEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKVGDAAILHSRFQFPAYPQYSDRLKNLISVMLSENPNQRPNICQVLEEVSRIQ 300
           YYTTPFEK G+ AILHSRFQFPA P YSDRLK LI  ML ENP+QRPN+CQVLE+VSR+Q
Sbjct: 241 YYTTPFEKGGELAILHSRFQFPAQPIYSDRLKGLIRRMLMENPDQRPNVCQVLEDVSRMQ 300

Query: 301 NVPCPLRNFYLLRSMXXXXXXXXXXXXTFPSVEVHHSLSQPRMDLK--NGPVLTPFKHAQ 358
            + CP+RNFYLLR+M                 ++ +S +QP +++   + PV  P     
Sbjct: 301 GIQCPVRNFYLLRAMEQQQQST--------QNQLRYSRTQPVLNVPIISQPVGFPMHQIS 352

Query: 359 SSALRTSKTFDGAAMNGSINNYVPVLKPHQAQPVQQNYRSDPFTSIDRRTVLQEKIPLQP 418
            + L +S +    +      N VP+L    A+P     RS       R    Q       
Sbjct: 353 GAPLGSSTSHIVPS------NSVPILA---ARP-----RSAGSNGTGRS--FQTPSTSSL 396

Query: 419 ASADFQRLSRAQTFVPVTKSPKRSSASPSFGGRGDISMIVSANPTNVDPTPIYLNSSVQT 478
           ++   Q   RA +  PV+      S SP   GRG+IS IV +N T+ D  P Y++S  QT
Sbjct: 397 SAKSSQTFHRAASRSPVS---THLSTSPVRHGRGNISQIVESNRTSFD-RPRYVDSVTQT 452

Query: 479 DN 480
            +
Sbjct: 453 SD 454

 Score = 33.9 bits (76), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 26/67 (38%), Positives = 35/67 (52%), Gaps = 2/67 (2%)

Query: 645 SSDARSSIQKRVQNLLKSSQDSPVKKSAHGYGEVSEKEDKESPEQFTGKPAVAEARPIKR 704
           S +A+ SIQ+RV++LL SS+D P+ KS     E   K  + S      KP+V E    K 
Sbjct: 545 SREAKESIQRRVRDLLNSSEDLPLSKSEPKKDE--PKRGQLSKTHHDEKPSVKEKSKQKV 602

Query: 705 TVVPPPK 711
               PPK
Sbjct: 603 RPRAPPK 609

>ADL217W Chr4 (321491..323743) [2253 bp, 750 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL095W (PRK1) and
           YNL020C (ARK1)
          Length = 750

 Score =  533 bits (1374), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 321/694 (46%), Positives = 413/694 (59%), Gaps = 62/694 (8%)

Query: 1   MNQPSSGIYTQGTALTVGSHQARIIKYLTSGGFAHIYSAEISPADPNSIGNVACLKRVLV 60
           MNQ        G  LTVGSH+ +II+YLTSGGFA IYS E+    P   G++ACLKRV V
Sbjct: 1   MNQVPQDCLQPGIILTVGSHEVKIIQYLTSGGFAQIYSCEVLSPGPIQ-GSLACLKRVHV 59

Query: 61  PDKQSLNVLRAEVDAMKLLRGNKHVVSYIDSHAAKSGAQDGSYEVFLLMEYCSAGGLIDF 120
           PDK SLN LRAEVDAMK+L+G++HVVSYIDSHAAKS   DG+YEV+LLMEYC  GGLIDF
Sbjct: 60  PDKPSLNTLRAEVDAMKMLKGHRHVVSYIDSHAAKSPRHDGTYEVYLLMEYCLRGGLIDF 119

Query: 121 MNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIENVLISDDKTFKVCDFGS 180
           MN+RLQ RL+E EVLKIMS + QGI AMHAL+PPLIHRDIKIENVLIS D  FKVCDFGS
Sbjct: 120 MNSRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDFGS 179

Query: 181 VCGVIRPPKNAQEFSYVQNDILKNTTAQYRSPEMIDLYRGHPINEKSDIWALGVFLYKLC 240
           V GVIRPPKNA EF+YVQ+DILKNTTAQYR+PEMIDLYR  P++EKSDIWALGVFLYK+C
Sbjct: 180 VSGVIRPPKNAYEFNYVQHDILKNTTAQYRAPEMIDLYRALPVDEKSDIWALGVFLYKVC 239

Query: 241 YYTTPFEKVGDAAILHSRFQFPAYPQYSDRLKNLISVMLSENPNQRPNICQVLEEVSRIQ 300
           Y+TTPFEKVG+ AIL ++FQFP+YPQY+DRLKNLISVMLSE+P QRPNICQVLEEVSRIQ
Sbjct: 240 YFTTPFEKVGENAILQAKFQFPSYPQYTDRLKNLISVMLSEHPVQRPNICQVLEEVSRIQ 299

Query: 301 NVPCPLRNFYLLRSMXXXXXXXXXXXXTFPSVEVHHSLSQPRMDLK------NGPVLTPF 354
            VPCPL NFYL R                    VHHS SQP + L       + P++T  
Sbjct: 300 GVPCPLPNFYLERMKHGA------------CTPVHHSASQPALPLATHQFSTSTPMVT-- 345

Query: 355 KHAQSSALRTSKTFDGAAMNGSINNYVPVLKPHQAQP-VQQNYRSDPFTSIDRRTVL--- 410
            H Q  A + S    G  +    +N V ++  H   P ++   R +P  +I +  +    
Sbjct: 346 -HPQPPANQMSPLPHG--IQPITSNMVYMM--HNTTPNIKDIPRENPAATIQKNALYSMS 400

Query: 411 -QEKIPLQPASADFQR--LSRAQTFVPVTKSPKRSSASPSFGGRGDISMIVSANPTNVDP 467
             E +    +   F R  L  + TF  V     RSS++P    R +I   +S  P     
Sbjct: 401 GSEHLSALSSDMHFNRPQLENSHTFSGVG---PRSSSNPIKIPRNEIQKFLSGTPPTSAK 457

Query: 468 TPIYLNSSVQTDNPGSDLYLSKQNTRLXXXXXXXXXXXXXXXXXXXFSRTFGRRLKKVF- 526
            P Y++S  QT   G  +  +K  +R                     +   GR  +K   
Sbjct: 458 KPTYVDSETQT---GDIITSNKSGSRPFAMSLSPLSSPELFSEQSTGNSLLGRLSRKTIR 514

Query: 527 --TGEKRSISPIKSRQNTGESVKSAFATLRRGFSSGSHKGEQLSKKNTVDVTTNGSSSNG 584
             T +K S +P+KS+ + G+ + S  ++  R  S  +   +  SK+N+ D+++       
Sbjct: 515 SPTSDKGS-NPLKSKSSVGDDLASLLSSPSRNLSFPAQSSKS-SKRNSADLSSR------ 566

Query: 585 YKFRVTSSDSIEEENSGFIYSHSRKASSTSIVSDLDSL------QDDSGTNAKKYYRSHS 638
                  S  + +      YS   K+S+T + S   SL      +    ++  ++  + +
Sbjct: 567 ------KSPVLNKSRIAMSYSGPEKSSATGLESSSSSLFGSQNGEHRPPSSTDRHKSNST 620

Query: 639 PVKLSGSSDARSSIQKRVQNLLKSSQDSPVKKSA 672
             +L  +   ++SIQ+RV  LL +S    V K A
Sbjct: 621 SFRLVPTKKGQTSIQERVHKLLATSAQEDVSKKA 654

>Ecym_3323 Chr3 (618386..620632) [2247 bp, 748 aa] {ON} similar to
           Ashbya gossypii ADL217W
          Length = 748

 Score =  532 bits (1370), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 281/504 (55%), Positives = 345/504 (68%), Gaps = 40/504 (7%)

Query: 1   MNQPSSGIYTQGTALTVGSHQARIIKYLTSGGFAHIYSAEISPADPNSIGNVACLKRVLV 60
           MNQ     +  GT LTVGSH+ +++KYLTSGGFA IY  E+   D + + +VACLKRV V
Sbjct: 1   MNQLPQDSFQPGTVLTVGSHKVKVVKYLTSGGFAQIYCCEVISPD-SKVKDVACLKRVHV 59

Query: 61  PDKQSLNVLRAEVDAMKLLRGNKHVVSYIDSHAAKSGAQDGSYEVFLLMEYCSAGGLIDF 120
           PDKQSLN LRAEVDAMKLLRGNKH+VSYIDSHA+KS   +GSYEV LLMEYCS GGLI F
Sbjct: 60  PDKQSLNTLRAEVDAMKLLRGNKHIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLISF 119

Query: 121 MNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIENVLISDDKTFKVCDFGS 180
           MNTRLQ+RL E EVL+IM+ + QGI AMHAL PPLIHRDIKIENVLI+++   KVCDFGS
Sbjct: 120 MNTRLQDRLKEFEVLRIMNQVVQGILAMHALQPPLIHRDIKIENVLIAENGDCKVCDFGS 179

Query: 181 VCGVIRPPKNAQEFSYVQNDILKNTTAQYRSPEMIDLYRGHPINEKSDIWALGVFLYKLC 240
           VCGVIRPPKN  E SYVQ+DILKNTTAQYR+PEMIDLYRG  ++EKSDIWALGVFLYKLC
Sbjct: 180 VCGVIRPPKNTYELSYVQHDILKNTTAQYRAPEMIDLYRGFSVDEKSDIWALGVFLYKLC 239

Query: 241 YYTTPFEKVGDAAILHSRFQFPAYPQYSDRLKNLISVMLSENPNQRPNICQVLEEVSRIQ 300
           YYTTPFEK G+ AIL + FQFP+YPQYS+RLKNLI+VML+ENP  RPN CQVLEEV RIQ
Sbjct: 240 YYTTPFEKTGEVAILKANFQFPSYPQYSNRLKNLITVMLAENPIHRPNSCQVLEEVCRIQ 299

Query: 301 NVPCPLRNFYLLRSMXXXXXXXXXXXXTFPSVEVHHSLSQPRMDLK----NGPVLTPFKH 356
             PCP++NFYL RS+              PS ++ HS+SQP + +       P++ P   
Sbjct: 300 GQPCPVKNFYLERSLKQQ----------IPS-QLRHSVSQPMIAMNPQQAKIPIVIP--Q 346

Query: 357 AQSSALRTSKTFDGAAMNGSINNYVPVLKPHQAQPVQQNYRSDPFTSIDRRTVLQEKIPL 416
            Q+S L  S T +   + G+   + P  +P++        R D    + +  +L      
Sbjct: 347 VQNSVL-PSNTMNMGYVTGA---FQPASQPNEV-------RGDTALRVSKAKLLSTACDW 395

Query: 417 Q------PASADFQRLSRAQTFVPVTKSPK-RSSASPSFGGRGDISMIVSANPTNVDPTP 469
                  P S    + S     +P +  P  RSS SP   GRG+I+ I++ANP N+   P
Sbjct: 396 DKTQNFVPGSNYNSKASVESGHLPTSSLPTPRSSVSPVRSGRGNINKIIAANPINIK-RP 454

Query: 470 IYLNSSVQTDNPGSDLYLSKQNTR 493
           +Y++S +QT +  S   L K N+R
Sbjct: 455 VYVDSEMQTTDLAS---LKKANSR 475

>TPHA0C03380 Chr3 (740939..743032) [2094 bp, 697 aa] {ON} Anc_2.284
           YNL020C
          Length = 697

 Score =  519 bits (1336), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 274/505 (54%), Positives = 336/505 (66%), Gaps = 36/505 (7%)

Query: 1   MNQPSSGIYTQGTALTVGSHQARIIKYLTSGGFAHIYSAEISPADPNSIGNVACLKRVLV 60
           MNQP   +YT G  L VGSHQA+I+KYLTSGGFA +Y  EISP D +S  N+ACLKRV+V
Sbjct: 1   MNQPEIPLYTPGIILPVGSHQAKILKYLTSGGFAQVYQVEISPYDIHSGSNIACLKRVIV 60

Query: 61  PDKQSLNVLRAEVDAMKLLRGNKHVVSYIDSHAAKS----GAQDGSYEVFLLMEYCSAGG 116
           PDK SLNV RAEV+AMKLLR NK+VVSYIDSHAAKS    G  +GSYEVFLLMEYCS  G
Sbjct: 61  PDKTSLNVPRAEVEAMKLLRNNKYVVSYIDSHAAKSRPAPGVPNGSYEVFLLMEYCSGKG 120

Query: 117 LIDFMNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIENVLISDDKTFKVC 176
           LIDFMNTRLQNRL E E+L IMS ++QG+AAMHAL PPL+HRDIKIENVLIS+   FK+C
Sbjct: 121 LIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIENVLISNKNEFKLC 180

Query: 177 DFGSVCGVIRPPKNAQEFSYVQNDILKNTTAQYRSPEMIDLYRGHPINEKSDIWALGVFL 236
           DFGSVCGVIRPP N  E  +VQ+DILKNTTAQYRSPEM+ L +  PINEKSDIWALGVFL
Sbjct: 181 DFGSVCGVIRPPTNQTELDFVQHDILKNTTAQYRSPEMLSLSKSIPINEKSDIWALGVFL 240

Query: 237 YKLCYYTTPFEKVGDAAILHSRFQFPAYPQYSDRLKNLISVMLSENPNQRPNICQVLEEV 296
           YK+CYYTTPFEK G+ AILHSR+Q+PAYPQYSD LKNLI VML  +P++RPNICQV+EEV
Sbjct: 241 YKVCYYTTPFEKEGENAILHSRYQYPAYPQYSDNLKNLIRVMLMVDPSKRPNICQVVEEV 300

Query: 297 SRIQNVPCPLRNFYLLRSMXXXXXXX---XXXXXTFPSVEVHHSLSQPRMDLKNGPV--- 350
           SR+Q VPCPL+NFYL R++                FP + + HS+S P +   N  +   
Sbjct: 301 SRLQGVPCPLKNFYLERAIRQTAVQDNHFNHQMEQFPPLHLQHSISSPALSTVNNNIGLS 360

Query: 351 -LTPFKHAQSSALRTSKTFDGAAMN-------GSINNYVPVLKPHQAQPV----QQNYRS 398
            +   ++  +SA++T+ T      N        ++ N    +   +  PV    +Q +  
Sbjct: 361 NINFLQNVNNSAIQTANTTSRINNNPYSLHNSSTLQNTPQTIAADRRYPVSTAPKQQHNI 420

Query: 399 DPFTSIDRRTVLQEKIPLQPASA----------DFQR---LSRAQTFVPVTKSPKRSSAS 445
             + +      LQ+ +    A A           F R   LS  Q  V    +      S
Sbjct: 421 PAYNNQINDITLQKSLSATMADAPVSTINISDNAFDRGLHLSELQKSVTALNNDMNHIYS 480

Query: 446 -PSFGGRGDISMIVSANPTNVDPTP 469
               GGRG IS I+++NP ++D +P
Sbjct: 481 QKQEGGRGKISSILNSNPNSLDQSP 505

>CAGL0G02607g Chr7 complement(240244..242310) [2067 bp, 688 aa] {ON}
           similar to uniprot|P40494 Saccharomyces cerevisiae
           YIL095w PRK1
          Length = 688

 Score =  515 bits (1326), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 248/379 (65%), Positives = 287/379 (75%), Gaps = 13/379 (3%)

Query: 1   MNQPSSGIYTQGTALTVGSHQARIIKYLTSGGFAHIYSAEISPADPNSIGNVACLKRVLV 60
           MNQP       GT LTVG+H  +I+KYLTSGGFA IY+ EI      +  NVACLKRV V
Sbjct: 1   MNQPELDRINVGTQLTVGTHSVKILKYLTSGGFAQIYAVEILSMGLFNGSNVACLKRVKV 60

Query: 61  PDKQSLNVLRAEVDAMKLLRGNKHVVSYIDSHAAKSGAQDGSYEVFLLMEYCSAGGLIDF 120
           PDK SLN+LRAEVDAMKLL  NKHVVSYIDSHA +S   DG+YEVFLLMEYC  GGLIDF
Sbjct: 61  PDKLSLNILRAEVDAMKLLANNKHVVSYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDF 120

Query: 121 MNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIENVLISDDKTFKVCDFGS 180
           MNTRLQNRLTE E+L IMS  TQGIA MHAL+PPL+HRDIKIENVL+S    +KVCDFGS
Sbjct: 121 MNTRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKGGIYKVCDFGS 180

Query: 181 VCGVIRPPKNAQEFSYVQNDILKNTTAQYRSPEMIDLYRGHPINEKSDIWALGVFLYKLC 240
           V GVIRPP+N QE  YVQ+DI+KNTTAQYR PEM+DLYRG PI+EK+DIWALGVFLYKLC
Sbjct: 181 VSGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEMLDLYRGLPIDEKADIWALGVFLYKLC 240

Query: 241 YYTTPFEKVGDAAILHSRFQFPAYPQYSDRLKNLISVMLSENPNQRPNICQVLEEVSRIQ 300
           YYTTPFEK+G+ AILH+RFQFP++P YSDRLKNLI  ML E+P+ RPN+CQVLEEVSR+Q
Sbjct: 241 YYTTPFEKLGEPAILHARFQFPSFPNYSDRLKNLIKSMLREHPSDRPNVCQVLEEVSRMQ 300

Query: 301 NVPCPLRNFYLLRSMXXXXXXXXXXXXTFPSVEVHHSLSQPRMDLKNGPVLTPFKHAQSS 360
           NVPCP+RNFYLLR+M             +P +++   L   + D  + P++ P   AQ  
Sbjct: 301 NVPCPIRNFYLLRAM---EKVKLSTEIDYPQLQL-QKLRNAQADNLSNPMIKPMPIAQRP 356

Query: 361 ALRTSKTFDGAAMNGSINN 379
                 TF G   NG +NN
Sbjct: 357 ------TFSG---NGMVNN 366

 Score = 48.1 bits (113), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 45/161 (27%), Positives = 73/161 (45%), Gaps = 26/161 (16%)

Query: 642 LSGSSDARSSIQKRVQNLLKSSQDSPVKKSAHGYGEVSEKEDKESPEQFTGKPAVAEARP 701
           L+ +S+ R SIQ RVQ+LL +   + VKKSA GYG+ ++    E     T  P V    P
Sbjct: 543 LNPNSEKRKSIQLRVQHLLDNMSSNEVKKSAQGYGKYTD----ELSSTGTNIPKVTPDSP 598

Query: 702 IKRTVVPPPKRYSSVEFSSI----VPTAKNTTAKDIEQPIRVXXXXXXXXXXXXXXADRI 757
           +   +         ++F+ +    +P+ KN  +K  +                       
Sbjct: 599 VLADL---------IDFNDVPTIRIPSDKNQLSKSGKIKPAPPPKPKKLRSNKKISTLSA 649

Query: 758 IKHGSSTTENPRHSSD-------LEIEELEKDFQRRFPSAV 791
           ++      +N R +SD       L +++LE+DF+RRFPSAV
Sbjct: 650 LRL--EPKQNDRITSDATDVLMHLNVDDLEEDFKRRFPSAV 688

>NCAS0G03810 Chr7 complement(703842..705827) [1986 bp, 661 aa] {ON} 
          Length = 661

 Score =  514 bits (1323), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 234/312 (75%), Positives = 263/312 (84%)

Query: 1   MNQPSSGIYTQGTALTVGSHQARIIKYLTSGGFAHIYSAEISPADPNSIGNVACLKRVLV 60
           MNQP   +Y  GT LTVGSH+ +++KYLTSGGFA IY+ +ISP D  +  NVACLKRV+V
Sbjct: 1   MNQPQIPLYQPGTLLTVGSHKVQVVKYLTSGGFAQIYTVQISPPDKFTNTNVACLKRVIV 60

Query: 61  PDKQSLNVLRAEVDAMKLLRGNKHVVSYIDSHAAKSGAQDGSYEVFLLMEYCSAGGLIDF 120
           PDK SLN LRAEVD MKLLR N HVVSYIDSHAAK    +GSYEVFLLMEYC  GGLIDF
Sbjct: 61  PDKPSLNTLRAEVDTMKLLRNNAHVVSYIDSHAAKFNPNEGSYEVFLLMEYCDMGGLIDF 120

Query: 121 MNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIENVLISDDKTFKVCDFGS 180
           MNTRLQ RL E+E+L IMS +TQGIAAMHAL PPL+HRDIKIENVL++    +KVCDFGS
Sbjct: 121 MNTRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIENVLLTSKGEYKVCDFGS 180

Query: 181 VCGVIRPPKNAQEFSYVQNDILKNTTAQYRSPEMIDLYRGHPINEKSDIWALGVFLYKLC 240
           VCG+IRPP NAQE SYVQ+DI+KNTTAQYR+PEMIDLYRG PI+EKSDIWALGVFLYKLC
Sbjct: 181 VCGIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMIDLYRGLPIDEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKVGDAAILHSRFQFPAYPQYSDRLKNLISVMLSENPNQRPNICQVLEEVSRIQ 300
           YYTTPFEK G+AAILH+ FQFP YPQYSDRLK LI+ ML E P+QRPN  QVLEEVS +Q
Sbjct: 241 YYTTPFEKNGEAAILHATFQFPNYPQYSDRLKKLITYMLMEQPSQRPNSYQVLEEVSSMQ 300

Query: 301 NVPCPLRNFYLL 312
           NV CP+ NFYL+
Sbjct: 301 NVQCPIPNFYLM 312

>NDAI0G00640 Chr7 (139655..141520) [1866 bp, 621 aa] {ON} Anc_2.284
          Length = 621

 Score =  508 bits (1309), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 232/315 (73%), Positives = 266/315 (84%)

Query: 1   MNQPSSGIYTQGTALTVGSHQARIIKYLTSGGFAHIYSAEISPADPNSIGNVACLKRVLV 60
           MNQP   IY  GT L+VGSHQARIIKYLTSGGFA +Y+AEISP DP    ++ CLKRV+V
Sbjct: 1   MNQPQVAIYHPGTLLSVGSHQARIIKYLTSGGFAQVYTAEISPIDPFINSSIVCLKRVIV 60

Query: 61  PDKQSLNVLRAEVDAMKLLRGNKHVVSYIDSHAAKSGAQDGSYEVFLLMEYCSAGGLIDF 120
           PDK SLN LRAEVDAMKLLR N HVVSYIDSHAAK     GSYEVFLLMEYC  GGLIDF
Sbjct: 61  PDKPSLNTLRAEVDAMKLLRNNTHVVSYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLIDF 120

Query: 121 MNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIENVLISDDKTFKVCDFGS 180
           MNTRLQNRL ENE+L IMS ++QG+AAMHAL PPL+HRDIKIENVL++    +K+CDFGS
Sbjct: 121 MNTRLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIENVLLTSRGHYKLCDFGS 180

Query: 181 VCGVIRPPKNAQEFSYVQNDILKNTTAQYRSPEMIDLYRGHPINEKSDIWALGVFLYKLC 240
           VCG+IRPP N QEF+YVQ+DI+KNTTAQYRSPEMI+L +G PINEKSDIWALGVFLYKLC
Sbjct: 181 VCGIIRPPTNPQEFTYVQHDIMKNTTAQYRSPEMINLGKGLPINEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKVGDAAILHSRFQFPAYPQYSDRLKNLISVMLSENPNQRPNICQVLEEVSRIQ 300
           YYTTPFEK G+ AILH+ FQFP +P YSDR+K+LI + L+  P+QRPNI Q+LEEVS+IQ
Sbjct: 241 YYTTPFEKTGENAILHASFQFPNFPHYSDRMKSLIRITLNVQPSQRPNIYQLLEEVSKIQ 300

Query: 301 NVPCPLRNFYLLRSM 315
           NVPCP+ +FYL R +
Sbjct: 301 NVPCPIPDFYLQRKL 315

>KAFR0J01370 Chr10 complement(250424..252766) [2343 bp, 780 aa] {ON}
           Anc_2.284 YNL020C
          Length = 780

 Score =  513 bits (1320), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 229/316 (72%), Positives = 270/316 (85%), Gaps = 1/316 (0%)

Query: 1   MNQPSSGIYTQGTALTVGSHQARIIKYLTSGGFAHIYSAEISPADPNSIGNVACLKRVLV 60
           MN P    +  G  LTVGSH A++IKYLTSGG+A +Y  EISP+DP    N+ACLKRV+V
Sbjct: 1   MNHPQIETFPSGQILTVGSHHAKVIKYLTSGGYAQVYKVEISPSDPYINSNIACLKRVIV 60

Query: 61  PDKQSLNVLRAEVDAMKLLRGNKHVVSYIDSHAAKSGAQDGSYEVFLLMEYCSAGGLIDF 120
           PDK SLN LRAEVDAMKLL+ N+HVVSYIDSHA+KS   +G+YEVF+LME+C  GGLIDF
Sbjct: 61  PDKPSLNTLRAEVDAMKLLKNNRHVVSYIDSHASKSAIYNGAYEVFVLMEFCERGGLIDF 120

Query: 121 MNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIENVLISDDKTFKVCDFGS 180
           MN+RLQ+RLTE E+L IMS  +QGIAAMH L P L+HRDIKIENVLIS +  +KVCDFGS
Sbjct: 121 MNSRLQHRLTEAEILTIMSHTSQGIAAMHRLQPALLHRDIKIENVLISQNNEYKVCDFGS 180

Query: 181 VCGVIRPPKNAQEFSYVQNDILKNTTAQYRSPEMIDLYRGHPINEKSDIWALGVFLYKLC 240
           VCG++RPPKN QEF++V +DI+KNTTAQYRSPEM+DL +G PINEKSDIWALGVFLYKLC
Sbjct: 181 VCGIVRPPKNQQEFNFVYHDIMKNTTAQYRSPEMLDLSKGLPINEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKV-GDAAILHSRFQFPAYPQYSDRLKNLISVMLSENPNQRPNICQVLEEVSRI 299
           YYTTPFEK  G+AAIL +RFQ+P+YP YSDRLKNLI VMLS+NP+ RPN+CQVLEEVSR+
Sbjct: 241 YYTTPFEKNGGEAAILQARFQYPSYPMYSDRLKNLIRVMLSKNPSDRPNVCQVLEEVSRL 300

Query: 300 QNVPCPLRNFYLLRSM 315
           Q +PCP+RNFYLLR+M
Sbjct: 301 QGIPCPIRNFYLLRAM 316

 Score = 89.0 bits (219), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 78/286 (27%), Positives = 134/286 (46%), Gaps = 48/286 (16%)

Query: 516 RTFGRRLKKVFTGEKRSISPIKSRQNTGESVKSAFATLRRGFSSGSHKGEQLSKKNTVDV 575
           R    +LK V TGE      IKSRQNTG+S++SA  ++R GF+  ++     S  N    
Sbjct: 532 RKLSVKLKNVLTGES-----IKSRQNTGDSIRSAMNSIRSGFTGNNNNTRSASYDN---- 582

Query: 576 TTNGSSSNGYKFRVTSSDSIEEENSGFIYSHSRKASSTSIVSDLDSLQDDSGTNAKKYYR 635
              G   +     + S+   ++++  F        SS ++    +  +    T++++YYR
Sbjct: 583 ---GKRLSSVNLHMHSAILEQDDSDEFEMPRYNSVSSNTLKDVEEHERRTVNTSSREYYR 639

Query: 636 SHSPVKLSGSSDARSSIQKRVQNLLKSSQDSPVK--KSAHGYGEVSE---KEDKESP--- 687
           S SPV++S + + ++SIQKRVQ+LLK+++++     ++A GYG+ ++    +D+ SP   
Sbjct: 640 SQSPVRMSVNREMKNSIQKRVQDLLKNAEENTTATVRTASGYGKYTDYNKNKDEISPTKS 699

Query: 688 --EQFTGKPAVAEARPIKRTVVPPPKRYSSVEFSSIVPTAKNTTAKDIEQPIRVXXXXXX 745
              QF    A   +   KR   P P +  S++ +   P AK         P  +      
Sbjct: 700 RVAQFNQSTAALASLSGKRKKPPVPYKRDSLKPT---PPAK---------PAFLSSRPVA 747

Query: 746 XXXXXXXXADRIIKHGSSTTENPRHSSDLEIEELEKDFQRRFPSAV 791
                    D ++              DL ++++EKD +RRFPS V
Sbjct: 748 SSRVSSNATDMLV--------------DLSVDDIEKDIRRRFPSTV 779

>ZYRO0A01848g Chr1 (152134..154248) [2115 bp, 704 aa] {ON} similar
           to uniprot|P40494 Saccharomyces cerevisiae YIL095W PRK1
           Protein serine/threonine kinase regulates the
           organization and function of the actin cytoskeleton
           through the phosphorylation of the Pan1p-Sla1p-End3p
           protein complex
          Length = 704

 Score =  510 bits (1313), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 234/315 (74%), Positives = 268/315 (85%)

Query: 1   MNQPSSGIYTQGTALTVGSHQARIIKYLTSGGFAHIYSAEISPADPNSIGNVACLKRVLV 60
           MN P    YT GT L+VG+H A+I+KY+ SGGFA +YSAE+ PAD  +  N  CLKRV++
Sbjct: 1   MNHPEIPTYTPGTVLSVGTHHAKILKYIASGGFAQVYSAEMFPADTPTGTNKVCLKRVII 60

Query: 61  PDKQSLNVLRAEVDAMKLLRGNKHVVSYIDSHAAKSGAQDGSYEVFLLMEYCSAGGLIDF 120
           P+K  LN LRAEV+AMKLL+G+KHVV YIDSHAA+S  Q+G+YEVFLLME+C+AGGLIDF
Sbjct: 61  PEKAGLNALRAEVNAMKLLKGSKHVVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDF 120

Query: 121 MNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIENVLISDDKTFKVCDFGS 180
           MNTRLQNRL E E+L IMS +TQGIAAMHAL PPLIHRDIKIENVLIS D  +KVCDFGS
Sbjct: 121 MNTRLQNRLKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGS 180

Query: 181 VCGVIRPPKNAQEFSYVQNDILKNTTAQYRSPEMIDLYRGHPINEKSDIWALGVFLYKLC 240
           V G IRPP+N QEF++VQ+DILKNTTAQYRSPEMIDLYR   I+EKSDIWALG+FLYKLC
Sbjct: 181 VSGPIRPPRNPQEFAFVQHDILKNTTAQYRSPEMIDLYRCQAIDEKSDIWALGIFLYKLC 240

Query: 241 YYTTPFEKVGDAAILHSRFQFPAYPQYSDRLKNLISVMLSENPNQRPNICQVLEEVSRIQ 300
           YYTTPFEK GD AILHSR+QF A+P YSDRLKNLIS MLS+ P QRPNICQVLEEVSR+Q
Sbjct: 241 YYTTPFEKGGDQAILHSRYQFLAHPIYSDRLKNLISWMLSQQPMQRPNICQVLEEVSRMQ 300

Query: 301 NVPCPLRNFYLLRSM 315
            V  P+RNFYLLR+M
Sbjct: 301 GVSSPMRNFYLLRAM 315

 Score = 35.0 bits (79), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 24/31 (77%)

Query: 641 KLSGSSDARSSIQKRVQNLLKSSQDSPVKKS 671
           ++  + D + SIQK+VQ+LLK+++DSP  KS
Sbjct: 571 RIKSNPDTKESIQKKVQSLLKAAEDSPKNKS 601

>NCAS0B06260 Chr2 complement(1180650..1182821) [2172 bp, 723 aa]
           {ON} Anc_2.284
          Length = 723

 Score =  509 bits (1311), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 240/373 (64%), Positives = 283/373 (75%), Gaps = 30/373 (8%)

Query: 1   MNQPSSGIYTQGTALTVGSHQARIIKYLTSGGFAHIYSAEISPADPNSIGNVACLKRVLV 60
           MNQP+   Y  GT LTVGSH  +IIKYLTSGGFA IY+ EISP +P +    ACLKRV+V
Sbjct: 1   MNQPNIPTYPPGTLLTVGSHYCKIIKYLTSGGFAQIYTTEISPINPYNNSQTACLKRVIV 60

Query: 61  PDKQSLNVLRAEVDAMKLLRGNKHVVSYIDSHAAKSGAQDGSYEVFLLMEYCSAGGLIDF 120
           PDK  LN LRAEVDAMKLL+ N+HVVSYIDSHAA+S    G+YEVFLLMEYC  GGLIDF
Sbjct: 61  PDKAGLNTLRAEVDAMKLLKNNRHVVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLIDF 120

Query: 121 MNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIENVLISDDKTFKVCDFGS 180
           MNTRLQNRLTE E+L I+S   QG++AMHAL P LIHRDIKIENVLIS    FK+CDFGS
Sbjct: 121 MNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFKICDFGS 180

Query: 181 VCGVIRPPKNAQEFSYVQNDILKNTTAQYRSPEMIDLYRGHPINEKSDIWALGVFLYKLC 240
           VC  IRPP+N QE +YVQ+D+LKNTTAQYR+PEM+DLYRG PINEKSDIWALGVFLYKLC
Sbjct: 181 VCSYIRPPRNPQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPINEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKVGDAAILHSRFQFPAYPQYSDRLKNLISVMLSENPNQRPNICQVLEEVSRIQ 300
           YYTTPFEK G+AAILHSR+Q+PA+P Y+D+LKNLI   L E+P++RPNICQ+LEE+SRIQ
Sbjct: 241 YYTTPFEKGGEAAILHSRYQYPAFPIYTDKLKNLIRATLMEDPSKRPNICQLLEEISRIQ 300

Query: 301 NVPCPLRNFYLLRSMXXXXXXXXXXXXTFPSVEVHHSLSQPRMDLKNGPVLTP-----FK 355
            +PCP+ NFYL R                 ++ V  SL          P++TP      K
Sbjct: 301 GIPCPINNFYLSR-----------------TINVQASLM--------NPIITPTQQTALK 335

Query: 356 HAQSSALRTSKTF 368
           H+QSSA  + +++
Sbjct: 336 HSQSSATISDQSY 348

>KAFR0H03330 Chr8 complement(635910..637019) [1110 bp, 369 aa] {ON}
           Anc_2.284 YNL020C
          Length = 369

 Score =  494 bits (1271), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 231/313 (73%), Positives = 262/313 (83%), Gaps = 1/313 (0%)

Query: 1   MNQPSSGIYTQGTALTVGSHQARIIKYLTSGGFAHIYSAEISPADPNSIGNVACLKRVLV 60
           MNQP    Y  GT L VGSHQ RIIKY+TSGGFA IY+ EISP D     N+ACLKRV+V
Sbjct: 1   MNQPKIDTYHPGTILPVGSHQVRIIKYITSGGFAQIYTVEISPPDSFCDSNIACLKRVIV 60

Query: 61  PDKQSLNVLRAEVDAMKLLRGNKHVVSYIDSHAAKSGAQDGSYEVFLLMEYCSAGGLIDF 120
           PDK SLN LRAEVDAMKLLR NKHVVSYIDSHA+KS   +GSYEVFLLMEYC  GGLIDF
Sbjct: 61  PDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHASKSNFNNGSYEVFLLMEYCERGGLIDF 120

Query: 121 MNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIENVLISDDKTFKVCDFGS 180
           MNTRLQNRLTE+EVL I S + QGIAAMHAL PPL+HRDIKIENVLIS    +K+CDFGS
Sbjct: 121 MNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIENVLISKSNQYKICDFGS 180

Query: 181 VCGVIRPPKNAQEFSYVQNDILKNTTAQYRSPEMIDLYRGHPINEKSDIWALGVFLYKLC 240
           V G+IRPP N QE  YVQ+D+LKNTTAQYRSPEMID YRG PI+EKSDIWA+GVFLYKLC
Sbjct: 181 VSGIIRPPHNPQELQYVQHDVLKNTTAQYRSPEMIDFYRGLPIDEKSDIWAIGVFLYKLC 240

Query: 241 YYTTPFEK-VGDAAILHSRFQFPAYPQYSDRLKNLISVMLSENPNQRPNICQVLEEVSRI 299
           YYTTPFEK  G+AAIL +R+++P +P YS+RLK+LI  ML ENP+QRPNI QV+EE+S++
Sbjct: 241 YYTTPFEKNGGEAAILSARYEYPNFPIYSERLKHLIHAMLMENPHQRPNIYQVIEEISKM 300

Query: 300 QNVPCPLRNFYLL 312
           QNVPCP+ NFYL+
Sbjct: 301 QNVPCPIVNFYLV 313

>NDAI0B03560 Chr2 complement(892839..895109) [2271 bp, 756 aa] {ON}
           Anc_2.284
          Length = 756

 Score =  507 bits (1305), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 233/351 (66%), Positives = 273/351 (77%)

Query: 1   MNQPSSGIYTQGTALTVGSHQARIIKYLTSGGFAHIYSAEISPADPNSIGNVACLKRVLV 60
           MNQP+  +Y  GT LTVG+H+A I KYLTSGGFA IY+ EI+P D  S  NVACLKRV+V
Sbjct: 1   MNQPNIPLYPNGTLLTVGTHRALIKKYLTSGGFAQIYAVEITPVDTYSKSNVACLKRVIV 60

Query: 61  PDKQSLNVLRAEVDAMKLLRGNKHVVSYIDSHAAKSGAQDGSYEVFLLMEYCSAGGLIDF 120
           P K  LN LRAEVDAMKLL+ N+HVVSYIDS+A KS   +GSYEV LLMEYC  GGLIDF
Sbjct: 61  PTKSGLNTLRAEVDAMKLLKNNRHVVSYIDSNAVKSAFNNGSYEVLLLMEYCEGGGLIDF 120

Query: 121 MNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIENVLISDDKTFKVCDFGS 180
           MN+RLQNRL+E E+L I+S   QG+A MHAL P L+HRDIKIENVL S +  FK+CDFGS
Sbjct: 121 MNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIENVLRSGNGEFKLCDFGS 180

Query: 181 VCGVIRPPKNAQEFSYVQNDILKNTTAQYRSPEMIDLYRGHPINEKSDIWALGVFLYKLC 240
           VCG IRPP+N QE SYVQ+DILKNTTAQYR PEM+DLYRG PI+EKSDIWALGVFLYKLC
Sbjct: 181 VCGYIRPPRNQQELSYVQHDILKNTTAQYRCPEMLDLYRGLPIDEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKVGDAAILHSRFQFPAYPQYSDRLKNLISVMLSENPNQRPNICQVLEEVSRIQ 300
           YYTTPFEK G+ AILHS+FQ+PA+P YSDRLKNLI VMLSENP +RPNIC++LEE+S IQ
Sbjct: 241 YYTTPFEKTGENAILHSKFQYPAFPIYSDRLKNLIRVMLSENPTKRPNICELLEEISSIQ 300

Query: 301 NVPCPLRNFYLLRSMXXXXXXXXXXXXTFPSVEVHHSLSQPRMDLKNGPVL 351
            VPCP++NFYL+R+             T P +     + Q     +  P++
Sbjct: 301 GVPCPIQNFYLIRAQQLANQIQLQRQTTVPKIATAQPIQQLNARTQTMPII 351

 Score = 82.8 bits (203), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 57/159 (35%), Positives = 91/159 (57%), Gaps = 9/159 (5%)

Query: 514 FSRTFGRRLKKVFTGEKRSISPIKSRQNTGESVKSAFATLRRGFSSGSHKGEQL----SK 569
           F++ F  ++K+V TGE R+ SPI+SRQ+TG SV+SAF  +R  F +GS +   L    + 
Sbjct: 485 FAQKFTNKIKRVVTGESRNASPIRSRQDTGGSVRSAFGAIRGAF-TGSMRAPSLDNNTNN 543

Query: 570 KNTVDVTTNGSSSNGYKFRVTSSDSIEEENSGFIYS---HSRKASSTSIVSDLDSLQ-DD 625
               +   N S ++ Y      ++ I+EE+S  +       R      ++ DL++L+ ++
Sbjct: 544 SMHNNSNNNTSRNSSYGRHNIITNPIKEEDSRNMTKAKLAKRHTMPPGMLYDLENLEIEN 603

Query: 626 SGTNAKKYYRSHSPVKLSGSSDARSSIQKRVQNLLKSSQ 664
            G +A +YYRSHSP K   +   R +IQ+RVQNLL  S+
Sbjct: 604 EGYHASEYYRSHSPTKPFVTKTTRDNIQQRVQNLLSESE 642

>Kpol_1003.35 s1003 (89266..91407) [2142 bp, 713 aa] {ON}
           (89266..91407) [2142 nt, 714 aa]
          Length = 713

 Score =  495 bits (1275), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 223/315 (70%), Positives = 265/315 (84%)

Query: 1   MNQPSSGIYTQGTALTVGSHQARIIKYLTSGGFAHIYSAEISPADPNSIGNVACLKRVLV 60
           MNQP    Y QG +L VG H A I+KYLTSGG+A +Y A+ISP D  +  ++ CLKR++V
Sbjct: 1   MNQPDIPTYPQGISLQVGVHHATILKYLTSGGYAQVYQAKISPPDSRTGSDIVCLKRLIV 60

Query: 61  PDKQSLNVLRAEVDAMKLLRGNKHVVSYIDSHAAKSGAQDGSYEVFLLMEYCSAGGLIDF 120
           PDK SLN  RAEVDAMKLLR   HVVSYIDS+AAKSG  +G+YEV LLME+C+ GGLIDF
Sbjct: 61  PDKASLNTPRAEVDAMKLLRNFDHVVSYIDSNAAKSGLHNGAYEVLLLMEFCAEGGLIDF 120

Query: 121 MNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIENVLISDDKTFKVCDFGS 180
           MNTRLQNRL E E+L IMS +TQG+AAMH+L PPL+HRDIKIENVLIS+   +K+CDFGS
Sbjct: 121 MNTRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIENVLISNSGEYKLCDFGS 180

Query: 181 VCGVIRPPKNAQEFSYVQNDILKNTTAQYRSPEMIDLYRGHPINEKSDIWALGVFLYKLC 240
           VCGVIRPP + QEF++VQ+DILKNTTAQYR+PEMIDL R  PI+EKSDIWALGVFLYKLC
Sbjct: 181 VCGVIRPPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSRHLPIDEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKVGDAAILHSRFQFPAYPQYSDRLKNLISVMLSENPNQRPNICQVLEEVSRIQ 300
           YYTTPFEK G+AAILHSR+++ AYP YSD LKNLI +ML+  P+QRPNICQVLEEVSR+Q
Sbjct: 241 YYTTPFEKAGEAAILHSRYEYLAYPHYSDNLKNLIRLMLANQPSQRPNICQVLEEVSRLQ 300

Query: 301 NVPCPLRNFYLLRSM 315
            +PCP++NFYL R++
Sbjct: 301 GIPCPIKNFYLERAI 315

 Score = 32.0 bits (71), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 31/53 (58%), Gaps = 3/53 (5%)

Query: 650 SSIQKRVQNLLKSSQDSPVKKSAHGYGEVSEKED---KESPEQFTGKPAVAEA 699
           +SIQ R++NL+ ++ + P+ K A  YG+ ++  D   K+S E+   K  +  A
Sbjct: 586 NSIQDRMKNLIDNADNIPINKIASDYGKYTKSSDNFGKDSGEEMNDKENIKTA 638

>Skud_14.309 Chr14 complement(566344..568263) [1920 bp, 639 aa] {ON}
           YNL020C (REAL)
          Length = 639

 Score =  491 bits (1264), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 221/309 (71%), Positives = 260/309 (84%)

Query: 1   MNQPSSGIYTQGTALTVGSHQARIIKYLTSGGFAHIYSAEISPADPNSIGNVACLKRVLV 60
           MNQP  G Y  GT LTVGSHQ  I+KYLTSGGFA +YSA ISP DP+S  N+ACLKRV+V
Sbjct: 1   MNQPQIGTYNVGTQLTVGSHQVEIVKYLTSGGFAQVYSALISPPDPHSHSNIACLKRVIV 60

Query: 61  PDKQSLNVLRAEVDAMKLLRGNKHVVSYIDSHAAKSGAQDGSYEVFLLMEYCSAGGLIDF 120
           PDK SLN LRAEVDAM+LLR N++VVSYIDSHAAK+   +GSYEVF+LMEYC  GGLIDF
Sbjct: 61  PDKPSLNTLRAEVDAMRLLRNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDF 120

Query: 121 MNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIENVLISDDKTFKVCDFGS 180
           MNTRLQNRL E E+L+IMS +TQG+AAMHAL PPLIHRDIKIENVLIS +  +K+CDFGS
Sbjct: 121 MNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYKLCDFGS 180

Query: 181 VCGVIRPPKNAQEFSYVQNDILKNTTAQYRSPEMIDLYRGHPINEKSDIWALGVFLYKLC 240
           VCGVIRPP+N QE SYVQ DI KNTTAQYRSPEM+D++RG PI+EKSDIWALG+FLYKLC
Sbjct: 181 VCGVIRPPRNPQELSYVQQDIFKNTTAQYRSPEMVDIFRGLPIDEKSDIWALGIFLYKLC 240

Query: 241 YYTTPFEKVGDAAILHSRFQFPAYPQYSDRLKNLISVMLSENPNQRPNICQVLEEVSRIQ 300
           YYTTPFEK G+ AIL   F+FP YP YS++L++LI  +L +NP QRPN+ Q+L+ +S +Q
Sbjct: 241 YYTTPFEKGGEPAILSGHFEFPPYPDYSEQLRDLIRDILVQNPCQRPNVYQLLKRISIMQ 300

Query: 301 NVPCPLRNF 309
           NVPCP+ + 
Sbjct: 301 NVPCPISDI 309

>YNL020C Chr14 complement(595623..597539) [1917 bp, 638 aa] {ON}
           ARK1Serine/threonine protein kinase involved in
           regulation of the cortical actin cytoskeleton; involved
           in control of endocytosis
          Length = 638

 Score =  490 bits (1261), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 221/314 (70%), Positives = 264/314 (84%)

Query: 1   MNQPSSGIYTQGTALTVGSHQARIIKYLTSGGFAHIYSAEISPADPNSIGNVACLKRVLV 60
           MNQP  G Y  GT LTVGSHQ  IIKYLTSGGFA +YSA I+P DP+S  +VACLKRV+V
Sbjct: 1   MNQPQIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALINPPDPHSNSSVACLKRVIV 60

Query: 61  PDKQSLNVLRAEVDAMKLLRGNKHVVSYIDSHAAKSGAQDGSYEVFLLMEYCSAGGLIDF 120
           PDK SLN LRAEVDAM+LL+ N++VVSYIDSHAAK+   +GSYEVF+LMEYC  GGLIDF
Sbjct: 61  PDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDF 120

Query: 121 MNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIENVLISDDKTFKVCDFGS 180
           MNTRLQNRL E E+L+IMS +TQG+AAMHAL PPLIHRDIKIENVLIS +  +K+CDFGS
Sbjct: 121 MNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYKLCDFGS 180

Query: 181 VCGVIRPPKNAQEFSYVQNDILKNTTAQYRSPEMIDLYRGHPINEKSDIWALGVFLYKLC 240
           VCG+IRPP+N+QE SYVQ DILKNTTAQYRSPEMID +RG PI+EKSDIWALG+FLYKLC
Sbjct: 181 VCGIIRPPRNSQELSYVQQDILKNTTAQYRSPEMIDTFRGLPIDEKSDIWALGIFLYKLC 240

Query: 241 YYTTPFEKVGDAAILHSRFQFPAYPQYSDRLKNLISVMLSENPNQRPNICQVLEEVSRIQ 300
           YYTTPFEK GD AIL  +F+FP YP YS++LK LI  +L ++P  RPN+ Q+L+ +S +Q
Sbjct: 241 YYTTPFEKGGDLAILSGKFEFPLYPNYSEQLKGLIRDILVQDPRHRPNVYQLLKRISIMQ 300

Query: 301 NVPCPLRNFYLLRS 314
           NVPCP+ +  ++++
Sbjct: 301 NVPCPINDIQVVQA 314

>Suva_14.327 Chr14 complement(578572..580470) [1899 bp, 632 aa] {ON}
           YNL020C (REAL)
          Length = 632

 Score =  489 bits (1258), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 219/308 (71%), Positives = 262/308 (85%)

Query: 1   MNQPSSGIYTQGTALTVGSHQARIIKYLTSGGFAHIYSAEISPADPNSIGNVACLKRVLV 60
           MNQP  G Y  GT LTVGSHQ  IIKYLTSGGFA +YSA ISP DP++  NVACLKRV+V
Sbjct: 1   MNQPQIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALISPPDPHTNSNVACLKRVIV 60

Query: 61  PDKQSLNVLRAEVDAMKLLRGNKHVVSYIDSHAAKSGAQDGSYEVFLLMEYCSAGGLIDF 120
           PDK SLN LRAEVDAMKLLR N++VVSYIDSHAAK+   +GSYEVF+LMEYC  GGLIDF
Sbjct: 61  PDKTSLNTLRAEVDAMKLLRNNRYVVSYIDSHAAKATLHNGSYEVFVLMEYCERGGLIDF 120

Query: 121 MNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIENVLISDDKTFKVCDFGS 180
           MNTRLQNRL E+E+L+IM  +TQG+AAMHAL PPLIHRDIKIENVLIS    +K+CDFGS
Sbjct: 121 MNTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIENVLISAKNEYKLCDFGS 180

Query: 181 VCGVIRPPKNAQEFSYVQNDILKNTTAQYRSPEMIDLYRGHPINEKSDIWALGVFLYKLC 240
           VCGVIRPP+N QE SYV+ D+LKNTTAQYRSPEM+D++RG PI+EKSDIWALG+FLYKLC
Sbjct: 181 VCGVIRPPRNPQELSYVEQDVLKNTTAQYRSPEMVDIFRGLPIDEKSDIWALGIFLYKLC 240

Query: 241 YYTTPFEKVGDAAILHSRFQFPAYPQYSDRLKNLISVMLSENPNQRPNICQVLEEVSRIQ 300
           YYTTPFEK G+ AIL+ +F+F  YP YS++L+NLI  +L +NP+QRPN+ Q+L++++ +Q
Sbjct: 241 YYTTPFEKGGEPAILNGQFEFLPYPNYSEQLRNLICKLLVQNPSQRPNVFQLLKQITNMQ 300

Query: 301 NVPCPLRN 308
           N P P+R+
Sbjct: 301 NAPYPIRD 308

>KNAG0H02020 Chr8 complement(357248..359026) [1779 bp, 592 aa] {ON}
           Anc_2.284 YNL020C
          Length = 592

 Score =  483 bits (1242), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 221/315 (70%), Positives = 263/315 (83%)

Query: 1   MNQPSSGIYTQGTALTVGSHQARIIKYLTSGGFAHIYSAEISPADPNSIGNVACLKRVLV 60
           MNQP+   Y QGT LTVGSHQ +IIKYLT+GGFA IY   ISP DP S  N+ACLKRV+V
Sbjct: 1   MNQPNISTYPQGTTLTVGSHQVQIIKYLTAGGFAQIYQTTISPIDPFSGTNIACLKRVIV 60

Query: 61  PDKQSLNVLRAEVDAMKLLRGNKHVVSYIDSHAAKSGAQDGSYEVFLLMEYCSAGGLIDF 120
           PDK SLNVLRAEVDAMKLLR N+ VVSYIDSHAAKS  Q+G+YEVFLLMEYC  GGLI+F
Sbjct: 61  PDKPSLNVLRAEVDAMKLLRNNRCVVSYIDSHAAKSSFQNGTYEVFLLMEYCENGGLINF 120

Query: 121 MNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIENVLISDDKTFKVCDFGS 180
           +N+RLQNRL E+EV+ IM  ++QG+AAMHAL PPL+HRDIKIENVL+S +  FK+CDFGS
Sbjct: 121 LNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIENVLLSKNNEFKLCDFGS 180

Query: 181 VCGVIRPPKNAQEFSYVQNDILKNTTAQYRSPEMIDLYRGHPINEKSDIWALGVFLYKLC 240
           V G IRPP N QE + VQNDI++NTTAQYRSPEMID+ RG PI+EKSDIWALGVFLYK+C
Sbjct: 181 VSGPIRPPSNPQELALVQNDIMRNTTAQYRSPEMIDMSRGFPIDEKSDIWALGVFLYKIC 240

Query: 241 YYTTPFEKVGDAAILHSRFQFPAYPQYSDRLKNLISVMLSENPNQRPNICQVLEEVSRIQ 300
           YYTTPFEK G+A IL SR++FPA+P YSDRL++LIS +L+  PN RPNI  V++E+S ++
Sbjct: 241 YYTTPFEKSGEAGILTSRYEFPAFPAYSDRLRHLISKLLAVQPNHRPNIYDVVKELSDMK 300

Query: 301 NVPCPLRNFYLLRSM 315
           N+ CP+ NFYL  +M
Sbjct: 301 NISCPIINFYLKPNM 315

>Smik_14.311 Chr14 complement(558013..559926) [1914 bp, 637 aa] {ON}
           YNL020C (REAL)
          Length = 637

 Score =  484 bits (1245), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 219/309 (70%), Positives = 261/309 (84%)

Query: 1   MNQPSSGIYTQGTALTVGSHQARIIKYLTSGGFAHIYSAEISPADPNSIGNVACLKRVLV 60
           MNQP  G Y  GT LTVGSHQ  IIKYLTSGGFA +YS  ISP DP++  NVACLKRV+V
Sbjct: 1   MNQPQIGTYNVGTRLTVGSHQVEIIKYLTSGGFAQVYSVLISPPDPHTNTNVACLKRVIV 60

Query: 61  PDKQSLNVLRAEVDAMKLLRGNKHVVSYIDSHAAKSGAQDGSYEVFLLMEYCSAGGLIDF 120
           PDK SLN LRAEVDAM+LL+ N++VVSYIDSHAAK+  Q+GSYEVF+LMEYC  GGLIDF
Sbjct: 61  PDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAILQNGSYEVFVLMEYCERGGLIDF 120

Query: 121 MNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIENVLISDDKTFKVCDFGS 180
           MNTRLQNRL E E+L+I+S +TQG+AAMHAL PPLIHRDIKIENVLIS +  +K+CDFGS
Sbjct: 121 MNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIENVLISTNNEYKLCDFGS 180

Query: 181 VCGVIRPPKNAQEFSYVQNDILKNTTAQYRSPEMIDLYRGHPINEKSDIWALGVFLYKLC 240
           VCG+IR P+N+QE SYVQ DILKNTTAQYRSPEMID++RG PI+EKSDIWALG+FLYKLC
Sbjct: 181 VCGIIRLPRNSQELSYVQQDILKNTTAQYRSPEMIDIFRGLPIDEKSDIWALGIFLYKLC 240

Query: 241 YYTTPFEKVGDAAILHSRFQFPAYPQYSDRLKNLISVMLSENPNQRPNICQVLEEVSRIQ 300
           YYTTPFEK G+ AIL  +F+FP YP YS++LK+LI  +L +NP  RP++ Q+L+ +S +Q
Sbjct: 241 YYTTPFEKGGEPAILSGKFEFPLYPNYSEQLKSLIRDILVQNPCHRPSVFQLLKRISIMQ 300

Query: 301 NVPCPLRNF 309
           NVPCP+ + 
Sbjct: 301 NVPCPINDI 309

>TBLA0B05930 Chr2 (1400163..1402316) [2154 bp, 717 aa] {ON}
           Anc_2.284 YNL020C
          Length = 717

 Score =  486 bits (1251), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 219/313 (69%), Positives = 255/313 (81%)

Query: 1   MNQPSSGIYTQGTALTVGSHQARIIKYLTSGGFAHIYSAEISPADPNSIGNVACLKRVLV 60
           MNQP    Y  GT L VG HQ  IIKYLTSGGFA IY  +++P +P +  N+ACLKRV+V
Sbjct: 1   MNQPHIKNYDPGTKLNVGIHQVSIIKYLTSGGFAQIYQVQVNPPNPINGMNLACLKRVIV 60

Query: 61  PDKQSLNVLRAEVDAMKLLRGNKHVVSYIDSHAAKSGAQDGSYEVFLLMEYCSAGGLIDF 120
           P+K  LN LRAEV+AM+LL+G  HVV YIDS+AA+S + DG+YEV  LME+C  GGLIDF
Sbjct: 61  PEKSGLNTLRAEVEAMQLLKGKPHVVGYIDSNAARSISNDGTYEVLQLMEFCPGGGLIDF 120

Query: 121 MNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIENVLISDDKTFKVCDFGS 180
           MNTRLQNRL E EVL IM+ +TQGI AMH+L PPLIHRDIKIENVLIS +  +KVCDFGS
Sbjct: 121 MNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLISSNGEYKVCDFGS 180

Query: 181 VCGVIRPPKNAQEFSYVQNDILKNTTAQYRSPEMIDLYRGHPINEKSDIWALGVFLYKLC 240
           V G+IRPPKN +EF++VQ DI+KNTTAQYR PEM+DLYRG PINEKSDIWALGVFLYK+C
Sbjct: 181 VSGIIRPPKNTEEFNFVQQDIMKNTTAQYRCPEMLDLYRGQPINEKSDIWALGVFLYKIC 240

Query: 241 YYTTPFEKVGDAAILHSRFQFPAYPQYSDRLKNLISVMLSENPNQRPNICQVLEEVSRIQ 300
           YYTTPFE  G+ AILH+R+Q+P YP YS RLKNLI +ML E P QRPN+CQVLEEVS +Q
Sbjct: 241 YYTTPFENGGERAILHARYQYPQYPMYSSRLKNLIRMMLMEKPEQRPNVCQVLEEVSSMQ 300

Query: 301 NVPCPLRNFYLLR 313
            +PCPL NFYL R
Sbjct: 301 GIPCPLPNFYLQR 313

>Kpol_1039.33 s1039 complement(102096..104201) [2106 bp, 701 aa]
           {ON} complement(102096..104201) [2106 nt, 702 aa]
          Length = 701

 Score =  465 bits (1196), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 206/315 (65%), Positives = 259/315 (82%)

Query: 1   MNQPSSGIYTQGTALTVGSHQARIIKYLTSGGFAHIYSAEISPADPNSIGNVACLKRVLV 60
           MNQ    +Y   T +TVGSH A+I+KYL SGG+A +YSA ++P D +   N+ACLKRV+V
Sbjct: 1   MNQDQLPLYVPDTVVTVGSHTAKIVKYLASGGYAQVYSAYVTPVDYSPATNIACLKRVVV 60

Query: 61  PDKQSLNVLRAEVDAMKLLRGNKHVVSYIDSHAAKSGAQDGSYEVFLLMEYCSAGGLIDF 120
           PDK+SLN LRAEVDA+K+LR  K+VVSYIDSHA+K     GSYEVF+LMEYCS G LIDF
Sbjct: 61  PDKKSLNALRAEVDALKVLRNKKYVVSYIDSHASKHSGHTGSYEVFVLMEYCSGGSLIDF 120

Query: 121 MNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIENVLISDDKTFKVCDFGS 180
           +NTRL+NRL E E+L IM+ +  G+A MH L P LIHRDIKIEN+LIS++  +KVCDFGS
Sbjct: 121 LNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIENILISENGEYKVCDFGS 180

Query: 181 VCGVIRPPKNAQEFSYVQNDILKNTTAQYRSPEMIDLYRGHPINEKSDIWALGVFLYKLC 240
           VCGVIRPP++ +E  Y+Q+DI+KNTTAQYRSPEM+DL +G+ INEKSDIWALGVFL+KLC
Sbjct: 181 VCGVIRPPRSYEEMKYIQHDIMKNTTAQYRSPEMLDLTKGYQINEKSDIWALGVFLFKLC 240

Query: 241 YYTTPFEKVGDAAILHSRFQFPAYPQYSDRLKNLISVMLSENPNQRPNICQVLEEVSRIQ 300
           YYTTPFEK G+ AIL S+FQ+PAYP YSD LKN+I V+LS +P +RPNICQ++EE+SR+Q
Sbjct: 241 YYTTPFEKEGEKAILKSQFQYPAYPVYSDSLKNVIRVLLSVDPFKRPNICQLIEELSRLQ 300

Query: 301 NVPCPLRNFYLLRSM 315
            +  P++NFYL R++
Sbjct: 301 GIVPPMKNFYLSRAL 315

 Score = 73.6 bits (179), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 61/168 (36%), Positives = 93/168 (55%), Gaps = 28/168 (16%)

Query: 516 RTFGRRLKKVFTGEKRSISPIKSRQNTGESVKSAFATLRRGFSSGSHKGEQLSKKNTVDV 575
           RT  ++LK V TGEKRS+SP++SRQNTG S +S F  L  GF+ G+      S+ ++ + 
Sbjct: 506 RTLSKKLKNVITGEKRSVSPVRSRQNTGGSSRSVFTVLHEGFTGGN------SRISSSEH 559

Query: 576 TTNGSSSNGYKFRVTSSDSIEEENSGFIYSHSRKASSTSIVSDLDSLQDDSGTNAKKYYR 635
           T  G SS+ +K RV+SS    EE  GFI  H        IV   +S +   G        
Sbjct: 560 TIRGPSSSSHKSRVSSSTKNFEE--GFIRKH------VDIVE--ESAEPKVG-------- 601

Query: 636 SHSPVKLSGSSDARSSIQKRVQNLLKSSQDSPVKKSAHGYGEVSEKED 683
               +KL  + +A+ SI++RV+ LL  S+D    ++A GYG+ ++ ++
Sbjct: 602 ----IKLKTTREAKDSIKRRVRELLLVSEDEQYHRTASGYGKYTDVQE 645

>TBLA0B06940 Chr2 (1639189..1643520) [4332 bp, 1443 aa] {ON}
           Anc_2.284 YNL020C
          Length = 1443

 Score =  471 bits (1212), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 208/315 (66%), Positives = 256/315 (81%), Gaps = 2/315 (0%)

Query: 1   MNQPSSGIYTQGTALTVGSHQARIIKYLTSGGFAHIYSAEI--SPADPNSIGNVACLKRV 58
           MNQP    Y +G  L +G+HQ  I KYL  GGFA +YS  +  S    N +G +ACLKRV
Sbjct: 1   MNQPEIPKYEKGRVLPIGTHQVIIEKYLACGGFAQVYSVRVIDSSNARNELGTMACLKRV 60

Query: 59  LVPDKQSLNVLRAEVDAMKLLRGNKHVVSYIDSHAAKSGAQDGSYEVFLLMEYCSAGGLI 118
           +VPDK  LN LRAEVDAMKLL+GNK++VSYIDSHA +S  + G YEVFLLMEYCS GG+I
Sbjct: 61  IVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVI 120

Query: 119 DFMNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIENVLISDDKTFKVCDF 178
           DF+NTRL +RL E E+LKIMSD+ QG+AAMH L PPLIHRDIKIENVLIS++  +K+CDF
Sbjct: 121 DFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDF 180

Query: 179 GSVCGVIRPPKNAQEFSYVQNDILKNTTAQYRSPEMIDLYRGHPINEKSDIWALGVFLYK 238
           GS C V+RPPK  QE +++ +DI+ NTTAQYRSPEMID Y G+PI+EKSDIWALGVFLYK
Sbjct: 181 GSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFLYK 240

Query: 239 LCYYTTPFEKVGDAAILHSRFQFPAYPQYSDRLKNLISVMLSENPNQRPNICQVLEEVSR 298
           LCYYTTPFEK G+ AIL+ +FQFP+YPQYSD ++N+I++ML+++P +RPNICQVLE+VS+
Sbjct: 241 LCYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQVSK 300

Query: 299 IQNVPCPLRNFYLLR 313
           +Q VPCP+ NF L R
Sbjct: 301 LQGVPCPIENFMLTR 315

 Score = 40.8 bits (94), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 41/70 (58%), Gaps = 13/70 (18%)

Query: 638  SPVKLSGSSDARSSIQKRVQNLLKSSQ-DSPVKKSAHGYGEVSEKEDKESPEQFTGKPAV 696
            S ++L  + DA+  I+KRV  LLK+S+ D+ V ++AHGYG            ++T KP  
Sbjct: 1196 SSLRLVSNPDAKDLIKKRVMELLKNSETDNGVTRTAHGYG------------KYTDKPNT 1243

Query: 697  AEARPIKRTV 706
            ++ +  +RT+
Sbjct: 1244 SQNKAPQRTI 1253

 Score = 32.0 bits (71), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 13/17 (76%), Positives = 16/17 (94%)

Query: 534 SPIKSRQNTGESVKSAF 550
           SP+ SRQNTG+S+KSAF
Sbjct: 867 SPLSSRQNTGDSIKSAF 883

>CAGL0J03432g Chr10 (330031..331899) [1869 bp, 622 aa] {ON} similar
           to uniprot|P53974 Saccharomyces cerevisiae YNL020c ARK1
           or uniprot|P40494 Saccharomyces cerevisiae YIL095w PRK1
          Length = 622

 Score =  439 bits (1130), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 202/311 (64%), Positives = 246/311 (79%)

Query: 1   MNQPSSGIYTQGTALTVGSHQARIIKYLTSGGFAHIYSAEISPADPNSIGNVACLKRVLV 60
           MN P    Y  GT +TVGSH   I+KYLTSGG+A IYSA+I PAD     N+A LKRV+V
Sbjct: 1   MNTPHIPKYEPGTTVTVGSHSVHILKYLTSGGYAQIYSAQIMPADQFLGTNMAVLKRVIV 60

Query: 61  PDKQSLNVLRAEVDAMKLLRGNKHVVSYIDSHAAKSGAQDGSYEVFLLMEYCSAGGLIDF 120
           PDK  LN LRAEVDAMK L+ +K++VSYIDSHAAKS   DG+YEVFL+MEYCS GGLIDF
Sbjct: 61  PDKSHLNTLRAEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDF 120

Query: 121 MNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIENVLISDDKTFKVCDFGS 180
           MNTRLQNRLTE E+L I   I+QG+AAMH L PPLIHRDIKIENVLIS+D  +K+CDFGS
Sbjct: 121 MNTRLQNRLTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIENVLISNDHKYKLCDFGS 180

Query: 181 VCGVIRPPKNAQEFSYVQNDILKNTTAQYRSPEMIDLYRGHPINEKSDIWALGVFLYKLC 240
           V G IRPPK  +E +YV++DI+ +TTAQYR+PEM+DL +G  +N+KSDIWALGVFLYKLC
Sbjct: 181 VSGYIRPPKTPEELAYVRHDIMMSTTAQYRAPEMLDLTKGFSVNDKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKVGDAAILHSRFQFPAYPQYSDRLKNLISVMLSENPNQRPNICQVLEEVSRIQ 300
           YYTTPFE+ G+A IL+   +FP YP YSD +K LI  ML++NP  RPNI Q+++ VS++ 
Sbjct: 241 YYTTPFEQTGEAGILNGGVEFPPYPHYSDAVKQLIMSMLAKNPLHRPNIFQIIQTVSKLL 300

Query: 301 NVPCPLRNFYL 311
           NV CP+ N ++
Sbjct: 301 NVNCPIPNIHV 311

>KNAG0A05430 Chr1 complement(800787..803153) [2367 bp, 788 aa] {ON}
           Anc_2.284 YNL020C
          Length = 788

 Score =  440 bits (1132), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 208/317 (65%), Positives = 249/317 (78%), Gaps = 6/317 (1%)

Query: 1   MNQPSSGIYTQGTALTVGSHQARIIKYLTSGGFAHIYSAEISPADPNSIGNVACLKRVLV 60
           MNQP    Y  G  + VGSHQA+I+KYLTSGGFA IYS EISP D  +  N+ACLKRV+V
Sbjct: 1   MNQPVIPNYPPGFVIKVGSHQAKILKYLTSGGFAQIYSVEISPKDEYTNSNIACLKRVIV 60

Query: 61  PDKQSLNVLRAEVDAMKLLRGNKHVVSYIDSHAAKSGAQDGSYEVFLLMEYCSAGGLIDF 120
           P+K  LNVLR EVDAMKLL+ N+HVVSYIDS+AAKS   +GSYEVFLLMEYC  G L+DF
Sbjct: 61  PNKSGLNVLRTEVDAMKLLKNNRHVVSYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDF 120

Query: 121 MNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIENVLISDDKTFKVCDFGS 180
           MNT+L+ RL E EVL IM+ + QGIAAMH LLPPLIHRDIKIENVLIS D  FKVCDFGS
Sbjct: 121 MNTKLRERLQEQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKIENVLISGDGLFKVCDFGS 180

Query: 181 VCGVIRPPKNAQEFSYVQNDILKNTTAQYRSPEMIDLYRGHPINEK---SDIWALGVFLY 237
           VCG+IRPP+N QE  YVQ+D++KNTTAQYRSPEMIDL +G PI  K      W + + + 
Sbjct: 181 VCGIIRPPRNPQELQYVQHDVMKNTTAQYRSPEMIDLVKGFPIERKIRHLGSWCVALQIM 240

Query: 238 KLCYYTTPFEKVGDAAILHSRFQFPAYPQYSDRLKNLISVMLSENPNQRPNICQVLEEVS 297
            L +YT  F +  + AIL+ R+Q+PAYP YSDRLKN++ V+LS +P +RPNICQ+LEE+S
Sbjct: 241 -LLHYT--FREDREVAILNGRYQYPAYPIYSDRLKNVVRVLLSPHPVKRPNICQLLEEIS 297

Query: 298 RIQNVPCPLRNFYLLRS 314
           +IQN+PCP+ NFYL RS
Sbjct: 298 KIQNIPCPIDNFYLERS 314

 Score = 83.2 bits (204), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 81/313 (25%), Positives = 141/313 (45%), Gaps = 59/313 (18%)

Query: 518 FGRRLKKVFTGEKRSISPIKSRQNTGESVKSAFATLRRGFSSGSHKGEQLSKKNTVDVTT 577
            G +L+ V T +  + S I + Q TG S+KSA  +L+   S  ++  + LS +N      
Sbjct: 495 LGVQLRNVITNDSSASSSIDTVQETGNSIKSAIESLKNSVSGMANNVKALSVENA----R 550

Query: 578 NGSSSNGYKFRVTSSDSIEEENSG-----FIYSHSRKASSTSI-------VSDLDSLQDD 625
           N     G  + + S+++I + NS       + +H+  +  T++       +SD + L D 
Sbjct: 551 NHLERLGSSYSIGSNNNIAKPNSAPIIPAVVTTHTSNSLKTAVSSPTHSELSDENELYDT 610

Query: 626 SGT-NAKKYYRSHSPVKLSGSSDARSSIQKRVQNLLKSSQDSPVKKSAHGYGEVSEKEDK 684
               + K  ++S SP+K +     ++SI+KRV NLLK+++DSPVKK+A GYG+ +++   
Sbjct: 611 LHLPDPKTSFQSPSPLKYAVDRKMKASIEKRVLNLLKNAEDSPVKKTAAGYGKYTKRPKM 670

Query: 685 ESPEQFTGKPAVAEARPIKRTVVPPPKRYSSVEFSSIVPTAKNTTAKDIEQPIRVXXXXX 744
            SP             P    V     R +SV  + ++ +A+ ++   +  P  +     
Sbjct: 671 VSP-----------TNPHYHLV-----RQNSVSQTPLILSARGSSGHPVVVPALINRDND 714

Query: 745 XXXXXXXXXADRII---------------KHGSSTTENPRHS-----------SDLEIEE 778
                    A  ++                H SS   N +HS           SD  ++E
Sbjct: 715 NGKYPAKSKAPPVVPKKPDHLRPKPPKKPAHLSSLKINKKHSTTVLNTPADLLSDTAVDE 774

Query: 779 LEKDFQRRFPSAV 791
           LEK F++R+PS V
Sbjct: 775 LEKSFKQRYPSTV 787

>TPHA0D01540 Chr4 complement(316471..318594) [2124 bp, 707 aa] {ON}
           Anc_2.284 YNL020C
          Length = 707

 Score =  437 bits (1124), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 199/315 (63%), Positives = 245/315 (77%)

Query: 1   MNQPSSGIYTQGTALTVGSHQARIIKYLTSGGFAHIYSAEISPADPNSIGNVACLKRVLV 60
           M+Q     Y +GT L V SH+  I  YLTSGGFA +Y+A I+    N    + CLKRV+V
Sbjct: 1   MSQIFEDKYKKGTKLQVASHEVIIENYLTSGGFAQVYTARITSEHKNLYPELTCLKRVIV 60

Query: 61  PDKQSLNVLRAEVDAMKLLRGNKHVVSYIDSHAAKSGAQDGSYEVFLLMEYCSAGGLIDF 120
           P+KQSLN+LRAEVDAMK+L+ NK++VSYIDSHA +    + SY V LLMEYCS  GL+DF
Sbjct: 61  PNKQSLNILRAEVDAMKILKNNKYIVSYIDSHANRLQNSEDSYVVLLLMEYCSGAGLLDF 120

Query: 121 MNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIENVLISDDKTFKVCDFGS 180
           MN RL+ RL E E+LKIM+D++QG+  MH L PPL+HRDIKIENVL+S D  FK+CDFGS
Sbjct: 121 MNLRLKERLKEEEILKIMTDVSQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGS 180

Query: 181 VCGVIRPPKNAQEFSYVQNDILKNTTAQYRSPEMIDLYRGHPINEKSDIWALGVFLYKLC 240
           V GV+R P +++EF Y+QNDILKNTTAQYRSPEM++L  G PINEKSDIWALG+ LYKLC
Sbjct: 181 VSGVLRSPTSSEEFVYLQNDILKNTTAQYRSPEMVNLALGFPINEKSDIWALGILLYKLC 240

Query: 241 YYTTPFEKVGDAAILHSRFQFPAYPQYSDRLKNLISVMLSENPNQRPNICQVLEEVSRIQ 300
           YYTTPFE+ G  AI+  +F +PAYPQY+D LKN+I V+LS NP QRPNICQ+LEE+ RIQ
Sbjct: 241 YYTTPFEEHGSRAIMEGKFTYPAYPQYTDSLKNIIRVLLSTNPIQRPNICQLLEELFRIQ 300

Query: 301 NVPCPLRNFYLLRSM 315
           +   PL NFY+ R+M
Sbjct: 301 HKSSPLPNFYVQRAM 315

 Score = 74.3 bits (181), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 60/182 (32%), Positives = 96/182 (52%), Gaps = 29/182 (15%)

Query: 516 RTFGRRLKKVFTGEKRSISPIKSRQNTGESVKSAFATLRRGFSSGSHKGEQLSKKNTVDV 575
           ++ G ++K   TG KRS SPIKSRQNTG+S++SAF  +R+G +    +  ++S  ++V  
Sbjct: 509 KSLGTKIKLTTTGGKRSQSPIKSRQNTGDSIRSAFNKVRQGINL---RSSRISSNDSVVR 565

Query: 576 TTNG-------SSSNGYKFRVTSSDSIEEENSGFIYSHSRKASSTSIVSDLDSLQDDSGT 628
            +         S+ N Y+F  TS +  E         +S     +      +SL D +  
Sbjct: 566 NSEQFGGIPELSNDNKYQFDTTSKNRHEY--------NSLSRKLSLSSQKQNSLNDST-- 615

Query: 629 NAKKYYRSHSPVKLSGSSDARSSIQKRVQNLLKSSQDSPVKKSAHGYGEVSEKEDKESPE 688
                  S+ P+ L  + +A+ SI+ RVQ L+KSS D+ V  SAHGYG+ +  ++K S +
Sbjct: 616 -------SNDPIILITNLEAKKSIKDRVQALMKSSSDNHVIISAHGYGKYT--DNKSSIK 666

Query: 689 QF 690
            F
Sbjct: 667 HF 668

>Kwal_27.10945 s27 (565717..568524) [2808 bp, 935 aa] {ON} YBR059C
           (AKL1) - Serine-threonine protein kinase [contig 32]
           FULL
          Length = 935

 Score =  329 bits (844), Expect = 4e-99,   Method: Compositional matrix adjust.
 Identities = 165/314 (52%), Positives = 209/314 (66%), Gaps = 14/314 (4%)

Query: 12  GTALTVGSHQARIIKYLTSGGFAHIY---------SAEISPADPNSIGNVACLKRVLVPD 62
           G+ + VG+H+  I+KYL  GGFAHIY           E  P     +G++ACLKRVLV D
Sbjct: 74  GSQVIVGNHRVEIVKYLAEGGFAHIYVVRFIEYANELEQVPTIKLEVGDLACLKRVLVTD 133

Query: 63  KQSLNVLRAEVDAMKLLRGNKHVVSYIDSHAAKSGAQDGS--YEVFLLMEYCSAGGLIDF 120
           +  LN +R EV  MK L G  ++V Y DSHA++  A+DGS  +EV LLME C    L+D+
Sbjct: 134 ENGLNEMRNEVSVMKQLSGCPNIVQYYDSHASR--ARDGSSGFEVTLLMELCPNNSLLDY 191

Query: 121 MNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIENVLISDDKTFKVCDFGS 180
           MN RL  +L+E E+LKIM D+T+ +A MH L  PLIHRD+KIENVL+  +  FK+CDFGS
Sbjct: 192 MNQRLATKLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFKLCDFGS 251

Query: 181 VCGVIRPPKNAQEFSYVQNDILKNTTAQYRSPEMIDLYRGHPINEKSDIWALGVFLYKLC 240
                      QE + + N+I  +TT QYRSPEMIDLYR  PINEKSDIWALG+FLYKL 
Sbjct: 252 TSTCFPVANTHQEIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLL 311

Query: 241 YYTTPFEKVGDAAILHSRFQFPAYPQYSDRLKNLISVMLSENPNQRPNICQVLEEVSRIQ 300
           +YTTPFE  G  AILHS+++FP    YS +L NLI +ML+ENPN RPNI QV++ +  I 
Sbjct: 312 FYTTPFELTGQFAILHSKYEFPVN-NYSSKLINLIIIMLAENPNLRPNIYQVMDNLCSIL 370

Query: 301 NVPCPLRNFYLLRS 314
            V  PL + Y L S
Sbjct: 371 KVKNPLEDKYQLGS 384

>KLTH0C07260g Chr3 (626334..629039) [2706 bp, 901 aa] {ON} similar
           to uniprot|P38080 Saccharomyces cerevisiae YBR059C AKL1
           Ser-Thr protein kinase
          Length = 901

 Score =  328 bits (840), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 158/308 (51%), Positives = 204/308 (66%), Gaps = 10/308 (3%)

Query: 12  GTALTVGSHQARIIKYLTSGGFAHIY---------SAEISPADPNSIGNVACLKRVLVPD 62
           G+ + VG+H+  I+KYL  GGFAHIY           E +P+    +G  ACLKRVLV D
Sbjct: 32  GSQVIVGNHRVEIVKYLAEGGFAHIYVVKFVEYANELEQAPSITLKVGETACLKRVLVTD 91

Query: 63  KQSLNVLRAEVDAMKLLRGNKHVVSYIDSHAAKSGAQDGSYEVFLLMEYCSAGGLIDFMN 122
           +  LN +R EV  MK L G  ++V Y DSHA++S      +EV LLME C    L+D+MN
Sbjct: 92  ENGLNEMRNEVSVMKQLSGCPNIVQYYDSHASRSRDGVPGFEVMLLMELCPNNSLLDYMN 151

Query: 123 TRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIENVLISDDKTFKVCDFGSVC 182
            RL  +L+E E+LKIM D+T+ +A MH L  PLIHRD+KIENVL+  D  FK+CDFGS  
Sbjct: 152 QRLTTKLSEQEILKIMFDVTRALAQMHYLPIPLIHRDVKIENVLVDGDNNFKLCDFGSTS 211

Query: 183 GVIRPPKNAQEFSYVQNDILKNTTAQYRSPEMIDLYRGHPINEKSDIWALGVFLYKLCYY 242
             +      QE + + N+I  +TT QYRSPEMIDLYR  PI+EKSDIWALG+FLYKL +Y
Sbjct: 212 TCLPVANTHQEIAVLTNNIYIHTTPQYRSPEMIDLYRCLPIDEKSDIWALGIFLYKLLFY 271

Query: 243 TTPFEKVGDAAILHSRFQFPAYPQYSDRLKNLISVMLSENPNQRPNICQVLEEVSRIQNV 302
           TTPFE  G  AILHS+++FP    YS +L NLI +ML+ENPN RPNI Q+++ +  I  V
Sbjct: 272 TTPFELTGQFAILHSKYEFPI-NNYSSKLINLIIIMLAENPNLRPNIYQIMDNLCSIMKV 330

Query: 303 PCPLRNFY 310
             P+ + Y
Sbjct: 331 ENPIEDKY 338

>SAKL0D03234g Chr4 (262365..264941) [2577 bp, 858 aa] {ON} some
           similarities with uniprot|P38080 Saccharomyces
           cerevisiae YBR059C AKL1 Serine-threonine protein kinase
           member (with Ark1p and Prk1p) of the Ark kinase family
          Length = 858

 Score =  326 bits (835), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 162/309 (52%), Positives = 207/309 (66%), Gaps = 13/309 (4%)

Query: 12  GTALTVGSHQARIIKYLTSGGFAHIYSAEI--------SPADPNSIGNVACLKRVLVPDK 63
           GT + VGSH+  I+KYL  GGFAHIY  +         +P+     G++ACLKRVLV D+
Sbjct: 35  GTLIIVGSHKVEIVKYLAEGGFAHIYVVKFVEFSNELETPSSSLKEGDLACLKRVLVTDE 94

Query: 64  QSLNVLRAEVDAMKLLRGNKHVVSYIDSHAAKSGAQDGS--YEVFLLMEYCSAGGLIDFM 121
             LN LR EV+ MK L+ + ++V Y DS+A++   +DGS  YEV LLME C    L+D+M
Sbjct: 95  NGLNELRNEVEVMKQLKNSDNIVQYYDSNASRR--RDGSPGYEVLLLMELCPNKSLLDYM 152

Query: 122 NTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIENVLISDDKTFKVCDFGSV 181
           N RL  +L+E EVLKIM D+T+ +A MH L  PLIHRDIKIENVL+  +  FK+CDFGS 
Sbjct: 153 NQRLATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFKLCDFGST 212

Query: 182 CGVIRPPKNAQEFSYVQNDILKNTTAQYRSPEMIDLYRGHPINEKSDIWALGVFLYKLCY 241
                     Q+ + + N+I  +TT QYR+PEMIDLYR  PI+EKSDIWALG+FLYKL +
Sbjct: 213 SSCFPIMTTHQDIALLTNNIYVHTTPQYRAPEMIDLYRCLPIDEKSDIWALGIFLYKLLF 272

Query: 242 YTTPFEKVGDAAILHSRFQFPAYPQYSDRLKNLISVMLSENPNQRPNICQVLEEVSRIQN 301
           YTTPFE  G  AILHS++  PA   YS +L NLI +ML+ENPN RPNI QV+ +V  I  
Sbjct: 273 YTTPFELTGQFAILHSKYDIPAN-NYSSKLINLIIIMLAENPNLRPNIYQVIYQVCAIMK 331

Query: 302 VPCPLRNFY 310
           V  P  + Y
Sbjct: 332 VDVPFEDKY 340

>KNAG0J00820 Chr10 complement(137927..141202) [3276 bp, 1091 aa]
           {ON} Anc_3.273 YBR059C
          Length = 1091

 Score =  330 bits (847), Expect = 3e-98,   Method: Compositional matrix adjust.
 Identities = 164/319 (51%), Positives = 213/319 (66%), Gaps = 20/319 (6%)

Query: 9   YTQGTALTVGSHQARIIKYLTSGGFAHIYSAEISP---------------ADPNSIGNVA 53
           ++ G ++ VGSH   I+KYLT GGFA IY  +++                     IG++ 
Sbjct: 29  FSAGESVAVGSHGVEIVKYLTEGGFAQIYLVKLTEYLNEFDAIDIQNQRQQQELKIGDLV 88

Query: 54  CLKRVLVPDKQSLNVLRAEVDAMKLLRGNKHVVSYIDSHAAKSGAQDGSYEVFLLMEYCS 113
           CLKRV+V D+  L+ ++ EV+ MK LRG  +VV Y DS+A ++   +G +EVFLLMEYC 
Sbjct: 89  CLKRVMVYDEAGLSEMKNEVNVMKQLRGKPNVVQYYDSNATRNRGANGGFEVFLLMEYCP 148

Query: 114 AGGLIDFMNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIENVLISDDKTF 173
              L+D+MN RL  +LTE+E+L IM DIT G++ +H L  PLIHRDIKIENVL+  +  F
Sbjct: 149 NKSLLDYMNQRLTTKLTESEILNIMYDITLGVSQLHFLDNPLIHRDIKIENVLVDHNNRF 208

Query: 174 KVCDFGSVCGVIRPP--KNAQEFSYVQNDILKNTTAQYRSPEMIDLYRGHPINEKSDIWA 231
           K+CDFGS    I PP     Q+ S + +DI  +TT QYRSPEMIDL+R  P+NEK+DIWA
Sbjct: 209 KLCDFGSTN--ICPPIATTNQDISVLTHDIYVHTTPQYRSPEMIDLFRCLPVNEKADIWA 266

Query: 232 LGVFLYKLCYYTTPFEKVGDAAILHSRFQFPAYPQYSDRLKNLISVMLSENPNQRPNICQ 291
           LGVFLYKL +YTTPFE  G  AILHS+++ P    YS+RL NLI VML+ENPN RPNI Q
Sbjct: 267 LGVFLYKLLFYTTPFELTGQFAILHSKYEIPQS-HYSERLLNLIVVMLAENPNLRPNIYQ 325

Query: 292 VLEEVSRIQNVPCPLRNFY 310
           VL E+  I NV  P+ + Y
Sbjct: 326 VLSEICSILNVEVPIPDIY 344

>Kpol_251.4 s251 (5802..8318) [2517 bp, 838 aa] {ON} (5802..8318)
           [2517 nt, 839 aa]
          Length = 838

 Score =  322 bits (826), Expect = 3e-97,   Method: Compositional matrix adjust.
 Identities = 161/313 (51%), Positives = 205/313 (65%), Gaps = 10/313 (3%)

Query: 9   YTQGTALTVGSHQARIIKYLTSGGFAHIYSAE----ISPADPNSI-----GNVACLKRVL 59
           Y  GT + VG H+  ++KYL  GGFA IY  +    +S  DPN       G+  CLKRVL
Sbjct: 29  YVPGTIVIVGIHKVEVVKYLAEGGFAKIYVVKFLEYLSTVDPNGKEVLQNGDQLCLKRVL 88

Query: 60  VPDKQSLNVLRAEVDAMKLLRGNKHVVSYIDSHAAKSGAQDGSYEVFLLMEYCSAGGLID 119
           V D   LN +R EV+ M+ L+G   VV Y DS+A++       YEV LLME CS   L+D
Sbjct: 89  VQDDNGLNEMRNEVEVMRKLKGAPCVVQYYDSNASRRIDGAPGYEVLLLMELCSNNSLLD 148

Query: 120 FMNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIENVLISDDKTFKVCDFG 179
           +MN RL  +L+E+E+LKIM D+T  +A MH L  PLIHRDIKIENVL+     FK+CDFG
Sbjct: 149 YMNQRLATKLSEDEILKIMFDVTLAVAQMHYLPSPLIHRDIKIENVLVDSKNNFKLCDFG 208

Query: 180 SVCGVIRPPKNAQEFSYVQNDILKNTTAQYRSPEMIDLYRGHPINEKSDIWALGVFLYKL 239
           S    +    + Q+ + +  +I  +TT QYRSPEMIDLYR  P+NEKSDIWALGVFLYKL
Sbjct: 209 STSTCLPIVSSHQDIAILTQNIYVHTTPQYRSPEMIDLYRCLPVNEKSDIWALGVFLYKL 268

Query: 240 CYYTTPFEKVGDAAILHSRFQFPAYPQYSDRLKNLISVMLSENPNQRPNICQVLEEVSRI 299
            +YTTPFE+ G  AILHS+++FP    YS +L NLI VML+ENPN RPNI QVL ++  I
Sbjct: 269 MFYTTPFERTGQFAILHSKYEFPLN-NYSSKLINLIIVMLAENPNLRPNIYQVLNQICYI 327

Query: 300 QNVPCPLRNFYLL 312
             +  P+ + Y L
Sbjct: 328 SGIKNPMDDAYGL 340

>KAFR0A01040 Chr1 complement(197612..200350) [2739 bp, 912 aa] {ON}
           Anc_3.273 YBR059C
          Length = 912

 Score =  322 bits (825), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 165/330 (50%), Positives = 210/330 (63%), Gaps = 25/330 (7%)

Query: 4   PSSG-IYTQGTALTVGSHQARIIKYLTSGGFAHIYSA-------EISPADPNSI------ 49
           PSSG  +  G  + VG H+  IIKYL  GGFA IYS        E S  +P+S       
Sbjct: 13  PSSGEKFNPGAVVAVGRHKVEIIKYLAEGGFAQIYSVNFIEYLNEFS-NEPDSTEDSNID 71

Query: 50  ---------GNVACLKRVLVPDKQSLNVLRAEVDAMKLLRGNKHVVSYIDSHAAKSGAQD 100
                    GN+ACLKRV+VPD+  LN LR EV+ M+ L+G  ++V Y DS+A++    +
Sbjct: 72  EFQQFKLEPGNLACLKRVMVPDENGLNELRNEVNVMRKLKGTPNIVQYYDSNASRRHDGN 131

Query: 101 GSYEVFLLMEYCSAGGLIDFMNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDI 160
             +EV LLME C    L+D+MN RL  +L+E E+LKIM D+T GI+ MH L  PLIHRDI
Sbjct: 132 PGFEVLLLMELCPNNSLLDYMNQRLTTKLSEKEILKIMYDVTLGISQMHYLQKPLIHRDI 191

Query: 161 KIENVLISDDKTFKVCDFGSVCGVIRPPKNAQEFSYVQNDILKNTTAQYRSPEMIDLYRG 220
           KIENVL+     FK+CDFGS         + QE + +  +I  +TT QYRSPEMIDLYR 
Sbjct: 192 KIENVLVDSSNNFKLCDFGSTSACFPIVTSHQEIAVLTQNIYVHTTPQYRSPEMIDLYRN 251

Query: 221 HPINEKSDIWALGVFLYKLCYYTTPFEKVGDAAILHSRFQFPAYPQYSDRLKNLISVMLS 280
            PI+EKSDIWALGVFLYKL +YTTPFE  G  AILHS+++ P    YS RL NLI +ML+
Sbjct: 252 LPIDEKSDIWALGVFLYKLLFYTTPFEMTGQFAILHSKYEIPPN-NYSSRLINLIIIMLA 310

Query: 281 ENPNQRPNICQVLEEVSRIQNVPCPLRNFY 310
           ENPN RPNI QV+ +V     +  P+++ Y
Sbjct: 311 ENPNLRPNIYQVMHQVCITIGIEPPIKDKY 340

>KNAG0H01220 Chr8 (209884..212625) [2742 bp, 913 aa] {ON} Anc_3.273
           YBR059C
          Length = 913

 Score =  320 bits (821), Expect = 6e-96,   Method: Compositional matrix adjust.
 Identities = 161/323 (49%), Positives = 211/323 (65%), Gaps = 20/323 (6%)

Query: 9   YTQGTALTVGSHQARIIKYLTSGGFAHIYSA-----------EISPA--DPNSIGNVACL 55
           Y  G  + VGSH+  I++Y+  GGFA IYS            E SP   D   +G++ACL
Sbjct: 18  YQPGKVIVVGSHRVEILQYIAEGGFAQIYSVKFLEYANEFDREESPGSKDQLQVGDLACL 77

Query: 56  KRVLVPDKQSLNVLRAEVDAMKLLRGNKHVVSYIDSHAAK------SGAQDGSYEVFLLM 109
           KRV+V D+  LN LR EV+ MK L G  ++V Y DS+A++      S  Q+  +EV LLM
Sbjct: 78  KRVIVQDQNGLNELRNEVNVMKKLVGAPNIVQYYDSNASRLRNGTDSQPQENKFEVLLLM 137

Query: 110 EYCSAGGLIDFMNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIENVLISD 169
           E C    L+D+MN RL  +L+E E+L++M D++  IA MH L  PLIHRDIKIENVL+  
Sbjct: 138 ELCPNKSLLDYMNLRLATKLSEQEILEVMYDVSLAIAQMHYLRKPLIHRDIKIENVLVDQ 197

Query: 170 DKTFKVCDFGSVCGVIRPPKNAQEFSYVQNDILKNTTAQYRSPEMIDLYRGHPINEKSDI 229
              FK+CDFGS           ++ +Y+  +I  +TT QYRSPEMIDLYR  PI+EKSDI
Sbjct: 198 KNRFKLCDFGSTSTCFPMVVTHRDIAYLTQNIYVHTTPQYRSPEMIDLYRCLPIDEKSDI 257

Query: 230 WALGVFLYKLCYYTTPFEKVGDAAILHSRFQFPAYPQYSDRLKNLISVMLSENPNQRPNI 289
           WALG+FLYKL ++TTPFE+ G  AILHS+F+FP    YS +L NLI VMLSENPN RPNI
Sbjct: 258 WALGIFLYKLLFFTTPFERTGQFAILHSKFEFPQN-NYSFKLINLIIVMLSENPNLRPNI 316

Query: 290 CQVLEEVSRIQNVPCPLRNFYLL 312
            QVL ++ +++ VP P+ + Y L
Sbjct: 317 YQVLHQICQLKQVPIPIADKYGL 339

>CAGL0H10208g Chr8 complement(996853..999936) [3084 bp, 1027 aa]
           {ON} similar to uniprot|P38080 Saccharomyces cerevisiae
           YBR059c AKL1 Ark-family Kinase-Like protein
          Length = 1027

 Score =  322 bits (824), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 153/322 (47%), Positives = 212/322 (65%), Gaps = 11/322 (3%)

Query: 1   MNQPSSGIYTQGTALTVGSHQARIIKYLTSGGFAHIYSAE----------ISPADPNSIG 50
           +N P+   Y  G  ++VG+H+  I+ YL  GGFA IY  +          +      ++G
Sbjct: 12  LNSPNEEKYPNGQMISVGAHRVEIVSYLAEGGFAQIYVVKFVEYLNEFESLGSKSAITVG 71

Query: 51  NVACLKRVLVPDKQSLNVLRAEVDAMKLLRGNKHVVSYIDSHAAKSGAQDGSYEVFLLME 110
           ++ACLKRV+V D+  LN +R EV+ MK L+ + ++V Y DS+A++       +EV LLME
Sbjct: 72  DIACLKRVIVNDEMGLNEMRNEVEVMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLLME 131

Query: 111 YCSAGGLIDFMNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIENVLISDD 170
            C    L+D+MN RL+ +L+E+E+LKIM D++ GI+ MH L  PLIHRDIKIENVL+  +
Sbjct: 132 LCPNKSLLDYMNQRLKTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDAN 191

Query: 171 KTFKVCDFGSVCGVIRPPKNAQEFSYVQNDILKNTTAQYRSPEMIDLYRGHPINEKSDIW 230
             FK+CD GS      P  + Q+ + +  +I  +TT QYR+PEMIDLYR  PINEKSDIW
Sbjct: 192 NNFKLCDMGSTSQCSPPMMSNQDIAMMTQNIYVHTTPQYRAPEMIDLYRYLPINEKSDIW 251

Query: 231 ALGVFLYKLCYYTTPFEKVGDAAILHSRFQFPAYPQYSDRLKNLISVMLSENPNQRPNIC 290
           ALG+FLYKL +YTTPFE  G  AILHS++ FP   +YS ++ NLI +ML+ENPN RPNI 
Sbjct: 252 ALGIFLYKLLFYTTPFEITGQMAILHSKYDFPPN-KYSSKIINLIIIMLAENPNLRPNIF 310

Query: 291 QVLEEVSRIQNVPCPLRNFYLL 312
           QV+  +  I N+P P+ + Y L
Sbjct: 311 QVVYHICSIMNLPVPIEDRYGL 332

>KAFR0C00430 Chr3 complement(88561..91410) [2850 bp, 949 aa] {ON}
           Anc_3.273 YBR059C
          Length = 949

 Score =  320 bits (819), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 160/319 (50%), Positives = 205/319 (64%), Gaps = 18/319 (5%)

Query: 9   YTQGTALTVGSHQARIIKYLTSGGFAHIYSA-------EISPADPNS----------IGN 51
           + +G  L VG+H+  I+ YLT GGFA IY         E    D  S          +G+
Sbjct: 31  FEKGQNLAVGTHKVEIVDYLTEGGFAQIYVVKFIEVLNEFDNEDNGSNVRISNYSLKLGD 90

Query: 52  VACLKRVLVPDKQSLNVLRAEVDAMKLLRGNKHVVSYIDSHAAKSGAQDGSYEVFLLMEY 111
           VACLKRVLV D+  LN +R EV+ MK LRG  ++V Y DS+A +S   +  YEV LLME 
Sbjct: 91  VACLKRVLVYDEVGLNEMRNEVNVMKKLRGCPNIVQYYDSNATRSHNGNPGYEVLLLMEL 150

Query: 112 CSAGGLIDFMNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIENVLISDDK 171
           CS   L+++MN RL  +L+E EVLKIM D+T G+A MH L  PLIHRDIKIENVL+  + 
Sbjct: 151 CSNNSLLNYMNQRLATQLSEKEVLKIMYDVTSGVAQMHYLKTPLIHRDIKIENVLVDSNN 210

Query: 172 TFKVCDFGSVCGVIRPPKNAQEFSYVQNDILKNTTAQYRSPEMIDLYRGHPINEKSDIWA 231
            FK+CDFGS           Q+ + +  ++  +TT QYRSPEMIDLYR  PINEKSDIWA
Sbjct: 211 NFKLCDFGSATTCPPVATTHQDIALLGQNVYVHTTPQYRSPEMIDLYRYLPINEKSDIWA 270

Query: 232 LGVFLYKLCYYTTPFEKVGDAAILHSRFQFPAYPQYSDRLKNLISVMLSENPNQRPNICQ 291
           LGVFLYKL +YTTPFE  G  A+LHS+F  PA  +YS ++ NL+ +MLSEN N RPNI Q
Sbjct: 271 LGVFLYKLLFYTTPFETTGQFAMLHSKFDIPA-NKYSSKIINLVIIMLSENLNLRPNIYQ 329

Query: 292 VLEEVSRIQNVPCPLRNFY 310
           V+  + ++  V  P+ + Y
Sbjct: 330 VMHYICQLIQVDTPILDIY 348

>Kpol_1052.22 s1052 (72364..75669) [3306 bp, 1101 aa] {ON}
           (72364..75669) [3306 nt, 1102 aa]
          Length = 1101

 Score =  322 bits (826), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 160/309 (51%), Positives = 201/309 (65%), Gaps = 12/309 (3%)

Query: 2   NQPSS-GIYTQGTALTVGSHQARIIKYLTSGGFAHIY-------SAEISPADPN---SIG 50
           N+PS+   +  G+ + VG+ +  I+KYLT GGFA IY       S E    + N    IG
Sbjct: 17  NKPSAVEKFANGSTVVVGNKKVEIVKYLTEGGFAQIYIVKFLENSNEFDSNNSNIPLKIG 76

Query: 51  NVACLKRVLVPDKQSLNVLRAEVDAMKLLRGNKHVVSYIDSHAAKSGAQDGSYEVFLLME 110
           ++ACLKRVLV D+  LN +R EV+ MKLL+G  ++V Y DS+A++       +EV LLME
Sbjct: 77  DLACLKRVLVQDENGLNEMRNEVEVMKLLKGAPNIVQYFDSNASRRKDGTNGFEVLLLME 136

Query: 111 YCSAGGLIDFMNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIENVLISDD 170
            C    L+DFMN RL  +L+E E+L IM D+T  +A MH L PPLIHRDIKIENVL+   
Sbjct: 137 LCPNKSLLDFMNQRLTTKLSEKEILTIMHDVTLAVAQMHTLSPPLIHRDIKIENVLVDSQ 196

Query: 171 KTFKVCDFGSVCGVIRPPKNAQEFSYVQNDILKNTTAQYRSPEMIDLYRGHPINEKSDIW 230
             FK+ DFGS           Q+ + +  DI  +TT QYRSPEMIDLY+  PI+EKSDIW
Sbjct: 197 NGFKLADFGSTSKCFPAVSAHQDIAILSQDIFMHTTPQYRSPEMIDLYKCLPIDEKSDIW 256

Query: 231 ALGVFLYKLCYYTTPFEKVGDAAILHSRFQFPAYPQYSDRLKNLISVMLSENPNQRPNIC 290
           ALG+FLYKL +Y TPFE  G  AILHS++ FP    YS RL NLI +MLSENPN RPNI 
Sbjct: 257 ALGIFLYKLLFYITPFEMTGQFAILHSKYDFPQT-NYSSRLINLIIIMLSENPNLRPNIY 315

Query: 291 QVLEEVSRI 299
           QVL E+  I
Sbjct: 316 QVLHEICSI 324

>KLLA0F18612g Chr6 (1711131..1713575) [2445 bp, 814 aa] {ON} some
           similarities with uniprot|P38080 Saccharomyces
           cerevisiae YBR059C AKL1 Serine-threonine protein kinase
           member (with Ark1p and Prk1p) of the Ark kinase family
          Length = 814

 Score =  315 bits (808), Expect = 6e-95,   Method: Compositional matrix adjust.
 Identities = 157/319 (49%), Positives = 207/319 (64%), Gaps = 11/319 (3%)

Query: 4   PSSGIYTQGTALTVGSHQARIIKYLTSGGFAHIYSA---EISPADPNSI-------GNVA 53
           P+S + +  T + VG+H+  I+++L  GGFA+IY     E++      I       G++A
Sbjct: 24  PNSHLLSPNTQVVVGTHRCEILEHLAEGGFANIYKVKFLELTNEMDAGIDSKLLKAGDIA 83

Query: 54  CLKRVLVPDKQSLNVLRAEVDAMKLLRGNKHVVSYIDSHAAKSGAQDGSYEVFLLMEYCS 113
           CLKRV+VPD+  LN LR EV+ MK LRG+ ++V Y DS+A++       +E+ LLME C 
Sbjct: 84  CLKRVIVPDENGLNELRNEVETMKQLRGSPNIVQYYDSNASRHPDGSPGFEILLLMELCP 143

Query: 114 AGGLIDFMNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIENVLISDDKTF 173
              L+D+MN +L  +LTE E+LKIM D++  IA MH L  PLIHRDIKIENVL+  D  F
Sbjct: 144 KKSLLDYMNNKLATKLTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNF 203

Query: 174 KVCDFGSVCGVIRPPKNAQEFSYVQNDILKNTTAQYRSPEMIDLYRGHPINEKSDIWALG 233
           K+CDFGS           Q+ + + N+I  +TT QYRSPEMIDLYR  PINEKSDIWALG
Sbjct: 204 KLCDFGSTSMCFPIVSTHQDIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALG 263

Query: 234 VFLYKLCYYTTPFEKVGDAAILHSRFQFPAYPQYSDRLKNLISVMLSENPNQRPNICQVL 293
           +FLYKL +YTTPFE  G  AILHS+++ P    YS +L NLI +ML+ENP+ RPNI QV+
Sbjct: 264 IFLYKLLFYTTPFELTGQFAILHSKYEIPQN-GYSSKLINLIIIMLAENPSLRPNIYQVM 322

Query: 294 EEVSRIQNVPCPLRNFYLL 312
             V  I     P  + Y L
Sbjct: 323 HHVCSILKCDVPFTDKYEL 341

>Ecym_2650 Chr2 complement(1257641..1260325) [2685 bp, 894 aa] {ON}
           similar to Ashbya gossypii AGR027C
          Length = 894

 Score =  316 bits (810), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 161/310 (51%), Positives = 199/310 (64%), Gaps = 11/310 (3%)

Query: 10  TQGTALTVGSHQARIIKYLTSGGFAHIYSAEISPADPNSI---------GNVACLKRVLV 60
           T G+ L VG H+  II+YL  GGFAHIY         N +         G++ACLKRV V
Sbjct: 29  TAGSILLVGVHRVEIIEYLAEGGFAHIYKVSFIEYT-NELDRHHSVLQRGDIACLKRVQV 87

Query: 61  PDKQSLNVLRAEVDAMKLLRGNKHVVSYIDSHAAKSGAQDGSYEVFLLMEYCSAGGLIDF 120
            D+  LN LR EV+ MK L+G  +VV Y DS+A++       +EV LLME CS G L+D+
Sbjct: 88  NDENGLNELRNEVEVMKKLKGCGNVVQYYDSNASRHTDGTPGFEVLLLMELCSNGSLLDY 147

Query: 121 MNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIENVLISDDKTFKVCDFGS 180
           MN RL  +L+E EVLKIM DIT+GI+ MH L  PLIHRDIKIENVL+     FK+CDFGS
Sbjct: 148 MNQRLATKLSEREVLKIMYDITKGISHMHFLRTPLIHRDIKIENVLVDSANNFKLCDFGS 207

Query: 181 VCGVIRPPKNAQEFSYVQNDILKNTTAQYRSPEMIDLYRGHPINEKSDIWALGVFLYKLC 240
               +      QE + + N+I  +TT QYRSPEMIDLYR   INEKSDIWALG+FLYKL 
Sbjct: 208 TSTCLPAVSTHQEIAMLTNNIYVHTTPQYRSPEMIDLYRCLAINEKSDIWALGIFLYKLL 267

Query: 241 YYTTPFEKVGDAAILHSRFQFPAYPQYSDRLKNLISVMLSENPNQRPNICQVLEEVSRIQ 300
           +YTTPFE  G  AILHS++  P    +S +L NLI VML+ENP  RPNI Q+L  +  I 
Sbjct: 268 FYTTPFELTGQFAILHSKYDIPQN-NFSSKLINLIIVMLAENPYIRPNIYQILYHICSIM 326

Query: 301 NVPCPLRNFY 310
               P+ + Y
Sbjct: 327 ECDVPIEDHY 336

>TBLA0E02590 Chr5 complement(651679..654864) [3186 bp, 1061 aa] {ON}
           Anc_3.273 YBR059C
          Length = 1061

 Score =  320 bits (819), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 161/323 (49%), Positives = 203/323 (62%), Gaps = 21/323 (6%)

Query: 7   GIYTQGTALTVGSHQARIIKYLTSGGFAHIYSAEI-----------------SPADPNSI 49
           G Y  GT + VGSH+  +IKY+  GGFA IY+ +                   P  P   
Sbjct: 97  GNYPAGTPVAVGSHKVEVIKYIAEGGFAQIYTVKFIERLNEFASLPGGNQNQKPLQP--- 153

Query: 50  GNVACLKRVLVPDKQSLNVLRAEVDAMKLLRGNKHVVSYIDSHAAKSGAQDGSYEVFLLM 109
           G++ACLKRVLV D   LN +R EV+ M+ L+G   VV Y DS+A+        YEV LLM
Sbjct: 154 GDIACLKRVLVNDDNGLNEMRNEVNVMQKLQGAPCVVQYYDSNASHRSDSAPGYEVLLLM 213

Query: 110 EYCSAGGLIDFMNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIENVLISD 169
           E+C    L+D+MN RL  RL+E E++KIM D T GIA +H L  PLIHRDIKIENVL+  
Sbjct: 214 EFCPNNSLLDYMNDRLATRLSEKEIMKIMYDTTLGIAQLHYLKTPLIHRDIKIENVLVDQ 273

Query: 170 DKTFKVCDFGSVCGVIRPPKNAQEFSYVQNDILKNTTAQYRSPEMIDLYRGHPINEKSDI 229
           +  FK+CDFGS         N ++ +    +I  NTT QYRSPEMIDLYR  PI+EKSDI
Sbjct: 274 ENNFKLCDFGSTSICFPIVTNHRDIAIFTQNIYVNTTPQYRSPEMIDLYRYQPIDEKSDI 333

Query: 230 WALGVFLYKLCYYTTPFEKVGDAAILHSRFQFPAYPQYSDRLKNLISVMLSENPNQRPNI 289
           WALGVFLYKL ++TTPFE+ G  AILHS+++FP    YS +L NLI +ML+ENP+ RPNI
Sbjct: 334 WALGVFLYKLLFFTTPFERTGQFAILHSKYEFPKN-NYSSKLINLIIIMLAENPSVRPNI 392

Query: 290 CQVLEEVSRIQNVPCPLRNFYLL 312
            QVL+ +  I     PL + Y L
Sbjct: 393 YQVLQYLCSINGWKVPLNDKYGL 415

>NCAS0A10590 Chr1 complement(2108142..2111429) [3288 bp, 1095 aa]
           {ON} Anc_3.273
          Length = 1095

 Score =  318 bits (815), Expect = 9e-94,   Method: Compositional matrix adjust.
 Identities = 157/318 (49%), Positives = 207/318 (65%), Gaps = 11/318 (3%)

Query: 3   QPSSGIYTQGTALTVGSHQARIIKYLTSGGFAHIYSA---------EISPADPN-SIGNV 52
           +P++  YT GT + VG+H+  IIKY+  GGFA IY+          E +   P   +G+V
Sbjct: 16  KPNNERYTPGTQVAVGAHKVEIIKYIAEGGFAQIYAVKFIEFLNEFENNRMKPKLQMGDV 75

Query: 53  ACLKRVLVPDKQSLNVLRAEVDAMKLLRGNKHVVSYIDSHAAKSGAQDGSYEVFLLMEYC 112
           ACLKRVLV D+  LN +R EV+ MK L+G  ++V Y DS+A++       +EV LLME C
Sbjct: 76  ACLKRVLVQDENGLNEMRNEVEVMKQLQGAPNIVQYYDSNASRRHNGFPGFEVLLLMELC 135

Query: 113 SAGGLIDFMNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIENVLISDDKT 172
               L+D+MN RL  +LTE E+LKIM D+T  ++ MH L  PL+HRDIKIENVL+     
Sbjct: 136 PNKSLLDYMNQRLATKLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNN 195

Query: 173 FKVCDFGSVCGVIRPPKNAQEFSYVQNDILKNTTAQYRSPEMIDLYRGHPINEKSDIWAL 232
           FK+CDFGS           Q+ + +  +I  +TT QYRSPEMIDLYR  PI+EKSDIWAL
Sbjct: 196 FKLCDFGSTSTKFPMVTTHQDIAVLTQNIYVHTTPQYRSPEMIDLYRCLPIDEKSDIWAL 255

Query: 233 GVFLYKLCYYTTPFEKVGDAAILHSRFQFPAYPQYSDRLKNLISVMLSENPNQRPNICQV 292
           G+FLYKL ++TTPFE  G  AILHS+++FP    YS +L NLI +ML+ENPN RPNI QV
Sbjct: 256 GIFLYKLLFFTTPFELTGQFAILHSKYEFPKN-NYSSKLINLIIIMLAENPNLRPNIYQV 314

Query: 293 LEEVSRIQNVPCPLRNFY 310
           L  +  I  +  P+ + Y
Sbjct: 315 LHNICSISGMKVPIEDQY 332

>Smik_2.191 Chr2 complement(338792..342118) [3327 bp, 1108 aa] {ON}
           YBR059C (REAL)
          Length = 1108

 Score =  318 bits (815), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 157/319 (49%), Positives = 206/319 (64%), Gaps = 10/319 (3%)

Query: 1   MNQPSSGIYTQGTALTVGSHQARIIKYLTSGGFAHIYSAEI---------SPADPNSIGN 51
           M  P+   +T G  + VG+H+  +I YL  GGFA IY  +          + + P  IG+
Sbjct: 14  MGHPAVERFTPGHIVCVGTHKVEVINYLAEGGFAQIYMVKFVEYLNEFDNAASVPLKIGD 73

Query: 52  VACLKRVLVPDKQSLNVLRAEVDAMKLLRGNKHVVSYIDSHAAKSGAQDGSYEVFLLMEY 111
           VACLKRVLV D+  LN +R EV+ MK L+G  +VV Y DS+A++       +EV LLME 
Sbjct: 74  VACLKRVLVQDENGLNEMRNEVEVMKKLKGAPNVVQYFDSNASRRRDGVQGFEVLLLMEL 133

Query: 112 CSAGGLIDFMNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIENVLISDDK 171
           C    L+D+MN RL  +LTE+E++KIM D+   I+ MH L  PLIHRDIKIENVL+  + 
Sbjct: 134 CPNKSLLDYMNQRLSTKLTESEIVKIMYDVVLSISQMHYLPVPLIHRDIKIENVLVDANN 193

Query: 172 TFKVCDFGSVCGVIRPPKNAQEFSYVQNDILKNTTAQYRSPEMIDLYRGHPINEKSDIWA 231
            FK+ DFGS           Q+ + +  +I  +TT QYRSPEMIDLYR  PINEKSDIWA
Sbjct: 194 NFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWA 253

Query: 232 LGVFLYKLCYYTTPFEKVGDAAILHSRFQFPAYPQYSDRLKNLISVMLSENPNQRPNICQ 291
           LG+FLYKL ++TTPFE  G  AILHS+++FP   +YS +L NLI +ML+ENPN RPNI Q
Sbjct: 254 LGIFLYKLLFFTTPFEMTGQFAILHSKYEFPVN-KYSSKLINLIIIMLAENPNLRPNIYQ 312

Query: 292 VLEEVSRIQNVPCPLRNFY 310
           VL  +  I N+  P+ + Y
Sbjct: 313 VLYHLCEILNIEVPIEDKY 331

>TPHA0A04030 Chr1 (901665..904829) [3165 bp, 1054 aa] {ON} Anc_3.273
           YBR059C
          Length = 1054

 Score =  317 bits (812), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 164/326 (50%), Positives = 202/326 (61%), Gaps = 35/326 (10%)

Query: 9   YTQGTALTVGSHQARIIKYLTSGGFAHIYSAEI---------------SPADPNSIGNVA 53
           Y QGT LTVG  +  I+KYLT GGFA IY+                  + +    IG+VA
Sbjct: 40  YKQGTILTVGIRRIEILKYLTEGGFAQIYTVRFIEYLNEFDNDDAENDNNSRNLKIGDVA 99

Query: 54  CLKRVLVPDKQSLNVLRAEVDAMKLLRGNKHVVSYIDSHAAKSGAQDGS----------- 102
           CLKRVLVPD+  L+ +R EVD MK L    ++V Y DS+A+K   +D S           
Sbjct: 100 CLKRVLVPDENGLSEMRNEVDVMKKLVNCPNIVQYYDSNASK--IKDNSNIDTTNNNDNN 157

Query: 103 ------YEVFLLMEYCSAGGLIDFMNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLI 156
                 +E+ LLMEYC    L+DFMN RL  +LTENE+LK M+DIT  +  MH L  PLI
Sbjct: 158 KNTDLGFEILLLMEYCPNKSLLDFMNQRLTTKLTENEILKAMTDITTAVLQMHYLAQPLI 217

Query: 157 HRDIKIENVLISDDKTFKVCDFGSVCGVIRPPKNAQEFSYVQNDILKNTTAQYRSPEMID 216
           HRDIKIENVL+  +  FK+ DFGS   +  P    Q+ + +  DI  NTT QYRSPEMID
Sbjct: 218 HRDIKIENVLVDSNNNFKLADFGSTTKIQPPITTHQDIAILNKDIYMNTTPQYRSPEMID 277

Query: 217 LYRGHPINEKSDIWALGVFLYKLCYYTTPFEKVGDAAILHSRFQFPAYPQYSDRLKNLIS 276
           LY+  PI+EKSDIWALGV LYKL +YTTPFE  G  AILHS+++FPA   YS +  NLI 
Sbjct: 278 LYKCLPIDEKSDIWALGVLLYKLLFYTTPFELTGQFAILHSKYEFPA-NNYSSKFINLII 336

Query: 277 VMLSENPNQRPNICQVLEEVSRIQNV 302
           +ML+ENPN RPNI QVL  +  I N 
Sbjct: 337 IMLAENPNLRPNIFQVLYYLKSISNT 362

>Suva_4.297 Chr4 complement(523650..526973) [3324 bp, 1107 aa] {ON}
           YBR059C (REAL)
          Length = 1107

 Score =  318 bits (814), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 157/319 (49%), Positives = 206/319 (64%), Gaps = 10/319 (3%)

Query: 1   MNQPSSGIYTQGTALTVGSHQARIIKYLTSGGFAHIYSAEI---------SPADPNSIGN 51
           M  P+   YT G  + VG+H+  I+ YL  GGFA IY+ +          + + P  IG+
Sbjct: 14  MGHPAVERYTPGKIVCVGTHKVEIVNYLAEGGFAQIYAVKFLEYLNEFDNTASLPLKIGD 73

Query: 52  VACLKRVLVPDKQSLNVLRAEVDAMKLLRGNKHVVSYIDSHAAKSGAQDGSYEVFLLMEY 111
           VACLKRVLV D+  LN +R EV+ MK L+G  +VV Y DS+A++       +EV LLME 
Sbjct: 74  VACLKRVLVHDENGLNEMRNEVEVMKKLKGAANVVQYYDSNASRRRDGVQGFEVLLLMEL 133

Query: 112 CSAGGLIDFMNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIENVLISDDK 171
           C    L+D+MN RL  +L+E+E++KIM D+   I+ MH L  PLIHRDIKIENVL+  + 
Sbjct: 134 CPNKSLLDYMNQRLSTKLSESEIVKIMYDVALSISEMHYLPVPLIHRDIKIENVLVDAEN 193

Query: 172 TFKVCDFGSVCGVIRPPKNAQEFSYVQNDILKNTTAQYRSPEMIDLYRGHPINEKSDIWA 231
            FK+ DFGS           Q+ + +  +I  +TT QYRSPEMIDLYR  PINEKSDIWA
Sbjct: 194 NFKLADFGSTSTSFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWA 253

Query: 232 LGVFLYKLCYYTTPFEKVGDAAILHSRFQFPAYPQYSDRLKNLISVMLSENPNQRPNICQ 291
           LG+FLYKL ++TTPFE  G  AILHS+++FP   +YS +L NLI +ML+ENPN RPNI Q
Sbjct: 254 LGIFLYKLLFFTTPFEMTGQFAILHSKYEFPVN-KYSSKLINLIIIMLAENPNLRPNIYQ 312

Query: 292 VLEEVSRIQNVPCPLRNFY 310
           VL  +  I N   P+ + Y
Sbjct: 313 VLYHICDILNAEVPIEDKY 331

>Skud_2.179 Chr2 complement(325193..328465) [3273 bp, 1090 aa] {ON}
           YBR059C (REAL)
          Length = 1090

 Score =  317 bits (813), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 158/319 (49%), Positives = 205/319 (64%), Gaps = 10/319 (3%)

Query: 1   MNQPSSGIYTQGTALTVGSHQARIIKYLTSGGFAHIYSAEI---------SPADPNSIGN 51
           M  P+   YT G  + VG+H+  I+ YL  GGFA IY  +          + + P  IG+
Sbjct: 14  MGHPAVERYTPGDIVCVGTHKVEIVNYLAEGGFAQIYVVKFLEYLNEFDNAASVPLKIGD 73

Query: 52  VACLKRVLVPDKQSLNVLRAEVDAMKLLRGNKHVVSYIDSHAAKSGAQDGSYEVFLLMEY 111
           +ACLKRVLV D+  LN +R EV+ MK L+G  +VV Y DS+A++       +EV LLME 
Sbjct: 74  LACLKRVLVHDENGLNEMRNEVEVMKKLKGAANVVQYYDSNASRRRDGVQGFEVLLLMEL 133

Query: 112 CSAGGLIDFMNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIENVLISDDK 171
           C    L+D+MN RL  +LTE E++KIM D+   I+ MH L  PLIHRDIKIENVL+    
Sbjct: 134 CPNKSLLDYMNQRLSTKLTETEIVKIMYDVALSISQMHYLPVPLIHRDIKIENVLVDAKD 193

Query: 172 TFKVCDFGSVCGVIRPPKNAQEFSYVQNDILKNTTAQYRSPEMIDLYRGHPINEKSDIWA 231
           +FK+ DFGS           Q+ + +  +I  +TT QYRSPEMIDLYR  PINEKSDIWA
Sbjct: 194 SFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWA 253

Query: 232 LGVFLYKLCYYTTPFEKVGDAAILHSRFQFPAYPQYSDRLKNLISVMLSENPNQRPNICQ 291
           LG+FLYKL ++TTPFE  G  AILHS+++FP   +YS +L NLI +ML+ENPN RPNI Q
Sbjct: 254 LGIFLYKLLFFTTPFEMTGQFAILHSKYEFPVN-KYSSKLINLIIIMLAENPNLRPNIYQ 312

Query: 292 VLEEVSRIQNVPCPLRNFY 310
           VL  +  I NV  P+ + Y
Sbjct: 313 VLCHLCDILNVEVPIEDKY 331

>NDAI0A05700 Chr1 (1288604..1292077) [3474 bp, 1157 aa] {ON}
           Anc_3.273
          Length = 1157

 Score =  318 bits (814), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 158/326 (48%), Positives = 207/326 (63%), Gaps = 25/326 (7%)

Query: 9   YTQGTALTVGSHQARIIKYLTSGGFAHIYSA---------EISPADPNS----------- 48
           +  GT + VGSH+  IIKY+  GGFA IY+          E S  D N+           
Sbjct: 24  FPAGTQVAVGSHKVEIIKYIAEGGFAQIYAVKYVESLNEFEDSNTDENAHLSGDRQAPNP 83

Query: 49  ----IGNVACLKRVLVPDKQSLNVLRAEVDAMKLLRGNKHVVSYIDSHAAKSGAQDGSYE 104
               +G++ACLKRVLV D+  LN +R EV+ MK L+G  +VV Y DS+A++       +E
Sbjct: 84  MILKLGDIACLKRVLVQDENGLNEMRNEVEVMKKLKGAPNVVQYFDSNASRRHNGASGFE 143

Query: 105 VFLLMEYCSAGGLIDFMNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIEN 164
           V LLME C    L+D+MN RL  +LTE+E+LKIM DIT  ++ MH L  PL+HRDIKIEN
Sbjct: 144 VLLLMELCPNKSLLDYMNQRLTTKLTEHEILKIMYDITFAVSHMHYLKIPLLHRDIKIEN 203

Query: 165 VLISDDKTFKVCDFGSVCGVIRPPKNAQEFSYVQNDILKNTTAQYRSPEMIDLYRGHPIN 224
           VL+     FK+CDFGS    +      Q+ + +  +I  +TT QYRSPEMIDLYR  PI+
Sbjct: 204 VLVDAQNNFKLCDFGSTSTRLPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPID 263

Query: 225 EKSDIWALGVFLYKLCYYTTPFEKVGDAAILHSRFQFPAYPQYSDRLKNLISVMLSENPN 284
           EKSDIWALG+FLYKL ++ TPFE  G  AILHS+++FP    YS +L NLI +ML+ENPN
Sbjct: 264 EKSDIWALGIFLYKLLFFITPFEMTGQFAILHSKYEFPKN-NYSSKLINLIIIMLAENPN 322

Query: 285 QRPNICQVLEEVSRIQNVPCPLRNFY 310
            RPNI QVL+ +  + NV  P+ + Y
Sbjct: 323 LRPNIYQVLDNICSMMNVEVPIEDIY 348

>ZYRO0E06864g Chr5 complement(516731..520078) [3348 bp, 1115 aa]
           {ON} some similarities with uniprot|P38080 Saccharomyces
           cerevisiae YBR059C AKL1 Serine-threonine protein kinase
           member (with Ark1p and Prk1p) of the Ark kinase family
          Length = 1115

 Score =  317 bits (812), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 156/316 (49%), Positives = 201/316 (63%), Gaps = 16/316 (5%)

Query: 9   YTQGTALTVGSHQARIIKYLTSGGFAHIYSAEI------------SPADPNSIGNVACLK 56
           Y  GT + VG+ Q  II ++  GGFA IYS +             +P  P   G++ACLK
Sbjct: 22  YAPGTVVAVGNQQVEIISFIAEGGFAQIYSVKYIKFLGEFNNGSKAPLQP---GDIACLK 78

Query: 57  RVLVPDKQSLNVLRAEVDAMKLLRGNKHVVSYIDSHAAKSGAQDGSYEVFLLMEYCSAGG 116
           RVLVPD+  L+ +R EV+ MK LRG K ++ Y DS+A++  +    YEV LLME C    
Sbjct: 79  RVLVPDENGLSEMRNEVEVMKQLRGAKAIIQYYDSNASRRTSGQVGYEVLLLMELCPNNS 138

Query: 117 LIDFMNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIENVLISDDKTFKVC 176
           L+D+MN RL  RLTE E+LK+M D T  I+ MH L  PLIHRDIKIENVL+     FK+C
Sbjct: 139 LLDYMNQRLATRLTEKEILKVMYDTTLAISQMHYLPIPLIHRDIKIENVLVDAQNNFKLC 198

Query: 177 DFGSVCGVIRPPKNAQEFSYVQNDILKNTTAQYRSPEMIDLYRGHPINEKSDIWALGVFL 236
           DFGS           Q+ + +  +I  NTT QYRSPEMIDLYR  PINEKSDIWALG+FL
Sbjct: 199 DFGSTSTCFPLVTTHQDIAILTQNIYVNTTPQYRSPEMIDLYRCLPINEKSDIWALGIFL 258

Query: 237 YKLCYYTTPFEKVGDAAILHSRFQFPAYPQYSDRLKNLISVMLSENPNQRPNICQVLEEV 296
           YKL ++ TPFE  G  +ILHS+++FPA  +YS +L NLI +ML+ENP  RPNI QV+  +
Sbjct: 259 YKLLFFITPFEMTGQFSILHSKYEFPAN-KYSSKLINLIIIMLAENPYVRPNIYQVMHHI 317

Query: 297 SRIQNVPCPLRNFYLL 312
             +     P+ + Y L
Sbjct: 318 CSVIGCEVPIEDKYGL 333

>TPHA0M01120 Chr13 complement(223548..225914) [2367 bp, 788 aa] {ON}
           Anc_3.273 YBR059C
          Length = 788

 Score =  310 bits (793), Expect = 5e-93,   Method: Compositional matrix adjust.
 Identities = 158/313 (50%), Positives = 201/313 (64%), Gaps = 10/313 (3%)

Query: 9   YTQGTALTVGSHQARIIKYLTSGGFAHIYSAE----ISPADPNSI-----GNVACLKRVL 59
           Y  G  + VG H+  IIKYL  GGFA IY A+    I   D N I     G++ CLKRVL
Sbjct: 99  YVPGHIVEVGIHKVEIIKYLAEGGFAKIYVAKFLQYIKQIDINKIQVLQPGDLICLKRVL 158

Query: 60  VPDKQSLNVLRAEVDAMKLLRGNKHVVSYIDSHAAKSGAQDGSYEVFLLMEYCSAGGLID 119
           V D   LN +R EV  MK L G  ++V   DS+A++       YEV LLME CS   L+D
Sbjct: 159 VTDDNGLNEMRNEVSVMKKLIGAPNIVQLYDSNASRRTDGIAGYEVLLLMELCSNKSLLD 218

Query: 120 FMNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIENVLISDDKTFKVCDFG 179
           +MN RL  +LTE E+LKIM D+T  +A MH L  PLIHRDIKIENVL+     FK+CDFG
Sbjct: 219 YMNQRLAVKLTEPEILKIMFDVTLAVAQMHYLPIPLIHRDIKIENVLVDSQNNFKLCDFG 278

Query: 180 SVCGVIRPPKNAQEFSYVQNDILKNTTAQYRSPEMIDLYRGHPINEKSDIWALGVFLYKL 239
           S    +      ++ + +  ++  +TT QYRSPEMID+YR   INEKSDIWALG+FLYKL
Sbjct: 279 STSTCMPIATTHRDMAALTQNLYVHTTPQYRSPEMIDVYRCIHINEKSDIWALGIFLYKL 338

Query: 240 CYYTTPFEKVGDAAILHSRFQFPAYPQYSDRLKNLISVMLSENPNQRPNICQVLEEVSRI 299
            +Y TPFE+ G  AILHS+++FP +  YS +L NLI +ML+ENPN RPNI QVL  + +I
Sbjct: 339 LFYITPFERTGQFAILHSKYEFPQH-SYSMKLINLIIIMLAENPNLRPNIYQVLAYICKI 397

Query: 300 QNVPCPLRNFYLL 312
            N+  P+ + Y L
Sbjct: 398 INIKTPIDDIYGL 410

>YBR059C Chr2 complement(356861..360187) [3327 bp, 1108 aa] {ON}
           AKL1Ser-Thr protein kinase, member (with Ark1p and
           Prk1p) of the Ark kinase family; involved in endocytosis
           and actin cytoskeleton organization
          Length = 1108

 Score =  315 bits (806), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 157/319 (49%), Positives = 203/319 (63%), Gaps = 10/319 (3%)

Query: 1   MNQPSSGIYTQGTALTVGSHQARIIKYLTSGGFAHIYSAEI---------SPADPNSIGN 51
           M  P+   YT G  + VG+H+  ++ YL  GGFA IY  +          + + P  IG+
Sbjct: 14  MGHPAVERYTPGHIVCVGTHKVEVVNYLAEGGFAQIYVVKFLEYLNEFDNTASVPLKIGD 73

Query: 52  VACLKRVLVPDKQSLNVLRAEVDAMKLLRGNKHVVSYIDSHAAKSGAQDGSYEVFLLMEY 111
           VACLKRVLV D+  LN +R EV+ MK L+G  ++V Y DS+A++       +EV LLME 
Sbjct: 74  VACLKRVLVQDENGLNEMRNEVEVMKKLKGAPNIVQYFDSNASRRRDGVQGFEVLLLMEL 133

Query: 112 CSAGGLIDFMNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIENVLISDDK 171
           C    L+D+MN RL  +LTE E++KIM D+   I+ MH L   LIHRDIKIENVL+    
Sbjct: 134 CPNKSLLDYMNQRLSTKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKN 193

Query: 172 TFKVCDFGSVCGVIRPPKNAQEFSYVQNDILKNTTAQYRSPEMIDLYRGHPINEKSDIWA 231
            FK+ DFGS           Q+ + +  +I  +TT QYRSPEMIDLYR  PINEKSDIWA
Sbjct: 194 NFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWA 253

Query: 232 LGVFLYKLCYYTTPFEKVGDAAILHSRFQFPAYPQYSDRLKNLISVMLSENPNQRPNICQ 291
           LGVFLYKL ++TTPFE  G  AILHS+++FP   +YS +L NLI +ML+ENPN RPNI Q
Sbjct: 254 LGVFLYKLLFFTTPFEMTGQFAILHSKYEFPV-NKYSSKLINLIIIMLAENPNLRPNIYQ 312

Query: 292 VLEEVSRIQNVPCPLRNFY 310
           VL  +  I NV  P+ + Y
Sbjct: 313 VLYHLCEILNVEVPIEDKY 331

>AGR027C Chr7 complement(763303..766188) [2886 bp, 961 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR059C
           (AKL1)
          Length = 961

 Score =  308 bits (788), Expect = 7e-91,   Method: Compositional matrix adjust.
 Identities = 155/310 (50%), Positives = 199/310 (64%), Gaps = 15/310 (4%)

Query: 12  GTALTVGSHQARIIKYLTSGGFAHIY-------SAEISPAD----PNSIGNVACLKRVLV 60
           G+ + VG HQ  +I+YL  GGFAHIY       + E+   D    P   G+  CLKRV V
Sbjct: 32  GSTVLVGVHQVEVIEYLAEGGFAHIYKVSFVGYTNELDRQDRILQP---GDTVCLKRVRV 88

Query: 61  PDKQSLNVLRAEVDAMKLLRGNKHVVSYIDSHAAKSGAQDGSYEVFLLMEYCSAGGLIDF 120
            D+  LN LR EV+ MK LR   ++V Y DS+A++ G     YEV LLME C  G L+D+
Sbjct: 89  SDENGLNELRNEVEVMKKLRNCSNIVQYYDSNASRLGDGKPGYEVLLLMELCPNGSLLDY 148

Query: 121 MNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIENVLISDDKTFKVCDFGS 180
           MN RL  +L+E EVLKIM DIT G++ MH    PLIHRDIKIENVL+  D  FK+CDFGS
Sbjct: 149 MNQRLATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLCDFGS 208

Query: 181 VCGVIRPPKNAQEFSYVQNDILKNTTAQYRSPEMIDLYRGHPINEKSDIWALGVFLYKLC 240
               +    + QE + + N+I  +TT QYRSPEMIDLYR  PINEKSDIWALG+FLYKL 
Sbjct: 209 TSPCLPAVASHQEIAMLMNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLL 268

Query: 241 YYTTPFEKVGDAAILHSRFQFPAYPQYSDRLKNLISVMLSENPNQRPNICQVLEEVSRIQ 300
           +YTTPFE  G  AILHS+++ P    +S +L NL+ +ML+ENP  RPN+ QV+  +  + 
Sbjct: 269 FYTTPFELTGQFAILHSKYEIPRN-SFSSKLINLVIIMLAENPYLRPNVYQVMYHICSMM 327

Query: 301 NVPCPLRNFY 310
                + + Y
Sbjct: 328 ECEVKIDDLY 337

>CAGL0K11990g Chr11 complement(1156224..1159199) [2976 bp, 991 aa]
           {ON} some similarities with uniprot|P38080 Saccharomyces
           cerevisiae YBR059c AKL1 Ark-family Kinase-Like protein
          Length = 991

 Score =  308 bits (790), Expect = 7e-91,   Method: Compositional matrix adjust.
 Identities = 156/314 (49%), Positives = 201/314 (64%), Gaps = 18/314 (5%)

Query: 9   YTQGTALTVGSHQARIIKYLTSGGFAHIYSAEI-------------SPADPNSIGNVACL 55
           +  G  +TVGSH+  ++ YL  GGFA IY  +              S   P   G+ ACL
Sbjct: 96  FPAGKVVTVGSHRVEVVSYLAEGGFAQIYVVKFVEYTNEFERKNDESMNQPLKPGSPACL 155

Query: 56  KRVLVPDKQSLNVLRAEVDAMKLLRGNKHVVSYIDSHAAK----SGAQDGSYEVFLLMEY 111
           KRVLV D+  LN +R+EV+ MK L+G  ++V Y DS+A++    SG     +EV LLME 
Sbjct: 156 KRVLVQDEVGLNKMRSEVEVMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFEVLLLMEL 215

Query: 112 CSAGGLIDFMNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIENVLISDDK 171
           C    L+D+MN RL  +LTE E+ KIM DIT  +A MH L  PLIHRDIKIENVL+  + 
Sbjct: 216 CPNKSLLDYMNQRLATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIENVLVDANN 275

Query: 172 TFKVCDFGSVCGVIRPPKNAQEFSYVQNDILKNTTAQYRSPEMIDLYRGHPINEKSDIWA 231
            FK+CDFGS         + Q+ + +  D+  +TT QYRSPEMIDL++  PINEKSDIWA
Sbjct: 276 NFKLCDFGSTSTCFPAFTSFQDIAMLSQDLYMHTTPQYRSPEMIDLFKYIPINEKSDIWA 335

Query: 232 LGVFLYKLCYYTTPFEKVGDAAILHSRFQFPAYPQYSDRLKNLISVMLSENPNQRPNICQ 291
           LGVFLYKL ++TTPFE+ G  A+LHS+F+FP    YS +L NLI VML+ENP+ RPNI Q
Sbjct: 336 LGVFLYKLLFFTTPFERTGQFAMLHSKFEFPPN-SYSSKLINLIIVMLAENPSLRPNIYQ 394

Query: 292 VLEEVSRIQNVPCP 305
           VL  +S + N   P
Sbjct: 395 VLYYLSEVTNREVP 408

>TDEL0D03520 Chr4 (647828..650977) [3150 bp, 1049 aa] {ON} Anc_3.273
           YBR059C
          Length = 1049

 Score =  306 bits (784), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 150/316 (47%), Positives = 198/316 (62%), Gaps = 10/316 (3%)

Query: 4   PSSGIYTQGTALTVGSHQARIIKYLTSGGFAHIYSA---------EISPADPNSIGNVAC 54
           P+   +  G  + VG+H+  ++ YL  GGFA IY           E     P  +G+VAC
Sbjct: 17  PTMERFLPGAVVAVGTHRVEVVNYLAEGGFAQIYVVKFLEYLNEFENKSKVPMKVGDVAC 76

Query: 55  LKRVLVPDKQSLNVLRAEVDAMKLLRGNKHVVSYIDSHAAKSGAQDGSYEVFLLMEYCSA 114
           LKRVLV D+  L+ +R EV+ MK L G +++V Y DS+A +    +  +EV LLME C  
Sbjct: 77  LKRVLVQDENGLSEMRNEVEVMKQLMGAQNIVQYYDSNACRRHNGNAGFEVLLLMELCPN 136

Query: 115 GGLIDFMNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIENVLISDDKTFK 174
             L+D+MN RL  +LTE E+LKIM D++  ++ MH L  PLIHRDIKIENVL+    +FK
Sbjct: 137 KSLLDYMNQRLATKLTEKEILKIMYDVSLAVSQMHYLKNPLIHRDIKIENVLVDAQNSFK 196

Query: 175 VCDFGSVCGVIRPPKNAQEFSYVQNDILKNTTAQYRSPEMIDLYRGHPINEKSDIWALGV 234
           +CDFGS           QE + +  +I  +TT QYR PEMIDLYR  PINEKSDIWALG+
Sbjct: 197 LCDFGSTSQCFPVVTTHQEIAILTQNIYVHTTPQYRCPEMIDLYRCLPINEKSDIWALGI 256

Query: 235 FLYKLCYYTTPFEKVGDAAILHSRFQFPAYPQYSDRLKNLISVMLSENPNQRPNICQVLE 294
           FLYKL ++ TPFE  G  AILHS+++FP    YS +L NLI +ML+ENP  RPNI QVL 
Sbjct: 257 FLYKLLFFITPFEMTGQFAILHSKYEFPPN-HYSSQLINLIIIMLAENPFVRPNIYQVLN 315

Query: 295 EVSRIQNVPCPLRNFY 310
            +  +  V  P+ + Y
Sbjct: 316 HICTMIGVEVPIEDKY 331

>TBLA0I01930 Chr9 complement(436511..440596) [4086 bp, 1361 aa] {ON}
           Anc_3.273 YBR059C
          Length = 1361

 Score =  305 bits (781), Expect = 6e-88,   Method: Compositional matrix adjust.
 Identities = 149/313 (47%), Positives = 197/313 (62%), Gaps = 12/313 (3%)

Query: 9   YTQGTALTVGSHQARIIKYLTSGGFAHIYSA---------EISPADPNSI--GNVACLKR 57
           Y  G  ++VG+HQ +I  YL  GGFA IY           E      NS+  G++ACLKR
Sbjct: 35  YKPGKLISVGAHQVKIEDYLAEGGFAQIYKVKFIDYLNEFENKKDQLNSLKSGDIACLKR 94

Query: 58  VLVPDKQSLNVLRAEVDAMKLLRGNKHVVSYIDSHAAKSGAQDGSYEVFLLMEYCSAGGL 117
           VLV D+  LN +R EV+ MKLL+G  ++V Y DS+A +       YE+ LLME C    L
Sbjct: 95  VLVNDENGLNEMRNEVEVMKLLQGCPNIVQYYDSNALRRNDGLNGYEILLLMELCPNNSL 154

Query: 118 IDFMNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIENVLISDDKTFKVCD 177
           +D+MN RL+ +L E E++KIM D T  ++ MH L  PLIH+DIK+EN+L+  +  FK+CD
Sbjct: 155 LDYMNQRLKTKLNETEIVKIMYDTTLAVSQMHYLDKPLIHKDIKVENILVDSNNNFKLCD 214

Query: 178 FGSVCGVIRPPKNAQEFSYVQNDILKNTTAQYRSPEMIDLYRGHPINEKSDIWALGVFLY 237
           FGS         +  + + +  +I  +TT QYRSPEMIDLYR  PINE SDIWALGVFLY
Sbjct: 215 FGSTSPCYEIVTSHHDIAVLTQNIYMHTTPQYRSPEMIDLYRCLPINETSDIWALGVFLY 274

Query: 238 KLCYYTTPFEKVGDAAILHSRFQFPAYPQYSDRLKNLISVMLSENPNQRPNICQVLEEVS 297
           KL ++ TPFE+ G  +ILH++F  P    Y  +L NLI +MLSEN N RPNI QV+ E+ 
Sbjct: 275 KLLFFITPFERTGQFSILHAKFDIPVN-NYHPKLINLIIIMLSENLNLRPNIYQVMYEIC 333

Query: 298 RIQNVPCPLRNFY 310
            I N P P+ + Y
Sbjct: 334 SITNTPLPIEDKY 346

>Kwal_56.24274 s56 (932404..933444) [1041 bp, 346 aa] {ON} YPL236C -
           Hypothetical ORF [contig 165] FULL
          Length = 346

 Score = 99.0 bits (245), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 86/338 (25%), Positives = 149/338 (44%), Gaps = 55/338 (16%)

Query: 10  TQGTALTVGSHQARIIKYLTSGGFAHIYSAEISPADPNSIGNVACLKRVLVPDKQSLNVL 69
           +Q + +++   + RI K L  GG + +Y  E      +  G +  LK+   P     ++ 
Sbjct: 14  SQRSFVSINGRKYRIQKLLGEGGLSFVYLVE------SKEGELFALKKTRCPFGSIGSIS 67

Query: 70  RAEVDAMKLLR-GNKHVVSYIDSHAAKSGAQDGSYEVFLLMEYCSAGGLIDFMNTRLQN- 127
            A  +     R  + ++   +DS   +   +DGS  V++L+ Y + G L D +N  L + 
Sbjct: 68  PAMKEVANYQRFSSPYIAQIVDSQVVQE--KDGSKTVYVLLPYFAKGSLQDLINRHLLDC 125

Query: 128 -RLTENEVLKIMSDITQGIAAMH-----------------------ALLPPL-------- 155
            +++E ++L++   I +G+  +H                       +LL  L        
Sbjct: 126 TQMSELDILRMALGIARGLLCIHEANPNHETDVAYSIVSAPYAEDSSLLNDLELDTFGES 185

Query: 156 ----IHRDIKIENVLISDDKTFKVCDFGSVCGVIRPPKNA-QEFSYVQNDILKNTTAQYR 210
                HRD+K  N++IS +    + D GS C   R   N+ Q     Q     N T  Y 
Sbjct: 186 QQSYAHRDVKPSNIMISPEDLPVISDLGS-CSRARIDINSRQALLRFQEWSSDNCTLSYA 244

Query: 211 SPEMIDLYRGHPINEKSDIWALGVFLYKLCYYTTPFEK---VGDA----AILHSRFQFPA 263
           +PE++D+     I EK DIW+ G  +Y +C+  +PFE+   +  A    AI   ++  P 
Sbjct: 245 APEILDVKLNSVITEKCDIWSFGCTMYSMCFGISPFEREEQISGASVTYAITTGKYTVPR 304

Query: 264 YPQYSDRLKNLISVMLSENPNQRPNICQVLEEVSRIQN 301
              YS  L  LI   LS NP QRP++ +++  +  +Q 
Sbjct: 305 GTSYSSSLIELIGKCLSVNPEQRPSVNELIALLMELQG 342

>Skud_16.42 Chr16 complement(75193..76287) [1095 bp, 364 aa] {ON}
           YPL236C (REAL)
          Length = 364

 Score = 98.6 bits (244), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 78/333 (23%), Positives = 148/333 (44%), Gaps = 61/333 (18%)

Query: 13  TALTVGSHQARIIKYLTSGGFAHIYSAEI-----SPADPNSIGNVACLKRVLVPDKQSLN 67
           T + V   + +I + L  GG + +Y  ++     S  +  +   +  LK+++ P  ++++
Sbjct: 21  TTIRVNDRRYKIQRLLGEGGMSFVYLVQLLKGSLSMENSAATAELYALKKIICPSVENIS 80

Query: 68  VLRAEVDAMKLLRGNKHVVSYIDSHAAKSGAQDGSYEVFLLMEYCSAGGLIDFMNTRLQN 127
               E++  K  + + +V+  IDS   +   +DGS  +++++ Y S G L D +N RL  
Sbjct: 81  NGMREIENYKRFQ-SPYVIQSIDSQVMQE--KDGSKTIYIILPYYSLGSLQDSINRRLLE 137

Query: 128 R--LTENEVLKIMSDITQGIAAMH------------------------------------ 149
              ++E E ++IM  +T+G+  +H                                    
Sbjct: 138 GTFISEAECVRIMLGVTRGLLCLHDPASRQDNVTTRTTVDTISMTYSDETAMLLEDTPLE 197

Query: 150 --------ALLPPLIHRDIKIENVLISDDKTFKVCDFGSVCGVIRPPKNAQEFSYVQNDI 201
                   A L    HRDI   N+L S D    + D GS         N  + S +Q  +
Sbjct: 198 MDMLSSSSAGLIAYAHRDITPSNILFSSDGLPVIGDLGSCSQADITIGNRNQLSELQEWV 257

Query: 202 LKNTTAQYRSPEMIDLYRGHPINEKSDIWALGVFLYKLCYYTTPFEK---VGDAAILHS- 257
             N T  Y +PE+++L     ++ K DIW++G   Y L +  +PFE+   +  A++ ++ 
Sbjct: 258 NDNCTLPYTAPELLNLKLNQALSCKVDIWSMGCTFYTLMFGISPFEREEQIHGASLTYAI 317

Query: 258 ---RFQFPAYPQYSDRLKNLISVMLSENPNQRP 287
              ++ FP   ++S+RL ++I   +  +P QRP
Sbjct: 318 NTGKYSFPRNSRFSERLLDVIKRCIQVDPIQRP 350

>TDEL0A06750 Chr1 (1179818..1180936) [1119 bp, 372 aa] {ON}
           Anc_6.262 YPL236C
          Length = 372

 Score = 97.1 bits (240), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 77/312 (24%), Positives = 144/312 (46%), Gaps = 61/312 (19%)

Query: 48  SIGN---VACLKRVLVP--DKQSLNVLRAEVDAMKLLRGNKHVVSYIDSHAAKSGAQDGS 102
           S+GN   +  LKR+  P  + +S++    EVD  K  + + ++++ +DS   +   +DGS
Sbjct: 63  SLGNAPELYALKRIRCPFGNIESISAAMKEVDNYKRFQ-SPYIITLVDSQVVQE--KDGS 119

Query: 103 YEVFLLMEYCSAGGLIDFMNTRLQ--NRLTENEVLKIMSDITQGIAAMH----------- 149
             + +L+ Y   G L D +N  L     ++E E ++IM  I +G+  +H           
Sbjct: 120 KTLCILLPYFPLGSLQDMVNRNLLKGTFVSEAECIRIMIGIARGLRCLHDPSARETSDAE 179

Query: 150 --------------ALL---PPL----------------IHRDIKIENVLISDDKTFKVC 176
                         A L    PL                +HRDI++ N+L S +    V 
Sbjct: 180 TMRDTVSLSYSDEAAFLLDDTPLELDVLSSHNTVNTRSYVHRDIRLANILFSSEGLPVVS 239

Query: 177 DFGSVCGVIRPPKNAQEFSYVQNDILKNTTAQYRSPEMIDLYRGHPINEKSDIWALGVFL 236
           D GS C          + + +Q+ +  N +  Y +PE++++     I+ K+DIW++G   
Sbjct: 240 DLGSCCKADITVSTKHQLNELQDWVTANCSFPYTAPELLNVKLNSTIDCKADIWSVGCTC 299

Query: 237 YKLCYYTTPFEK---VGDAAILHS----RFQFPAYPQYSDRLKNLISVMLSENPNQRPNI 289
           Y + +  +PFE+   V  A++ ++    ++ FP   +YS+ L  +I   L  +P  RP+I
Sbjct: 300 YAMLFGMSPFERELQVSGASLTYAIGCGKYTFPKQTRYSESLLAVIKSCLQVDPTARPDI 359

Query: 290 CQVLEEVSRIQN 301
            ++L+ +  +Q 
Sbjct: 360 NELLDTLQDLQT 371

>YPL236C Chr16 complement(101608..102702) [1095 bp, 364 aa] {ON}
           ENV7Protein proposed to be involved in vacuolar
           functions; mutant shows defect in CPY processing; has
           sequence similarity with the human serine/threonine
           protein kinase STK16
          Length = 364

 Score = 95.9 bits (237), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 83/329 (25%), Positives = 148/329 (44%), Gaps = 61/329 (18%)

Query: 17  VGSHQARIIKYLTSGGFAHIYSAEISPAD---PNSIGN--VACLKRVLVPDKQSLNVLRA 71
           V   + RI + L  GG + +Y  ++S       N I    +  LK+++ P  +S++    
Sbjct: 25  VNDKRYRIQRLLGEGGMSFVYLVQLSKNSLIIDNGIATPELYALKKIICPSVESISNGMR 84

Query: 72  EVDAMKLLRGNKHVVSYIDSHAAKSGAQDGSYEVFLLMEYCSAGGLIDFMNTRLQNR--L 129
           E++  K  + + +V+  IDS   +   +DGS  +++++ Y S G L D +N RL     +
Sbjct: 85  EIENYKRFQ-SPYVIKSIDSQVMQE--KDGSKTIYIVLPYYSLGSLQDSINRRLLEGTFV 141

Query: 130 TENEVLKIMSDITQGIAAMH--------------------------ALL---PPL----- 155
           +E E ++IM  +T+G+  +H                          A+L    PL     
Sbjct: 142 SEAECVRIMLGVTRGLLCLHDPASRQDNATSRVNVDAVSMTYSDETAMLLEDTPLEMDML 201

Query: 156 ----------IHRDIKIENVLISDDKTFKVCDFGSVCGVIRPPKNAQEFSYVQNDILKNT 205
                      HRDI   N+L S D    + D GS        +N  + S +Q  +  N 
Sbjct: 202 SSNSAGSIAYAHRDITPSNILFSSDGLPVIGDLGSCSQADITIENRHQLSELQEWVNDNC 261

Query: 206 TAQYRSPEMIDLYRGHPINEKSDIWALGVFLYKLCYYTTPFEK---VGDAAILHS----R 258
           T  Y  PE+++L     ++ K DIW+LG   Y L +  +PFE+   +  A++ ++    +
Sbjct: 262 TLPYTPPELLNLKLNQVLSSKVDIWSLGCTFYTLMFGISPFEREEQIHGASLTYAINTGK 321

Query: 259 FQFPAYPQYSDRLKNLISVMLSENPNQRP 287
           + FP   ++S+ L ++I   +  +P QRP
Sbjct: 322 YSFPRNSRFSEGLLSVIKKCIQVDPIQRP 350

>KNAG0F00170 Chr6 (13778..15409) [1632 bp, 543 aa] {ON} Anc_1.24
           YDR523C
          Length = 543

 Score = 97.4 bits (241), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 75/276 (27%), Positives = 134/276 (48%), Gaps = 32/276 (11%)

Query: 24  IIKYLTSGGFAHIYSAEISPADPNSIGNVACLKRVLVPD--KQSLNVLRAEVDAMKLLRG 81
           I K +  G F  ++ A       N    V  +K + + D  +++  +++ E+  M LL+ 
Sbjct: 18  IDKCVGKGNFGDVFKAM-----NNVTKEVVAIKIINLDDSEEETFEIIK-EMRLMSLLK- 70

Query: 82  NKHVVSYIDSHAAKSGAQDGSYEVFLLMEYCSAGGLIDFMNTRLQNRLTENEVLKIMSDI 141
           + ++  YI +        +  Y ++++MEYC  G   D + T  +  L EN+V  ++  +
Sbjct: 71  SPYIARYITT-------INEDYLMWIVMEYCGGGSARDLIKTCYREGLAENKVAFVVKSV 123

Query: 142 TQGIAAMHALLPPLIHRDIKIENVLISDDKTFKVCDFGSVCGVIRPPKNAQEFSYVQNDI 201
             G+  +HA     IHRDIK  N+L++D    KV DFG V   +R    A+ F       
Sbjct: 124 LLGLQYLHAQHK--IHRDIKAANILLTDSGLVKVADFG-VSAEMRSTMKAKTFV------ 174

Query: 202 LKNTTAQYRSPEMIDLYRGHPINEKSDIWALGVFLYKLCYYTTPFEKVGDAAILHS---R 258
               T  + +PE++ +  G   NEKSDIW+LG+  Y+L     P  K     ++ +   R
Sbjct: 175 ---GTPYWMAPEVV-MNEGMGYNEKSDIWSLGITTYELLKGVPPLAKYDAIRVMRNIPKR 230

Query: 259 FQFPAYPQYSDRLKNLISVMLSENPNQRPNICQVLE 294
                +  Y++ +K+ I+  L ++P +RP+  ++LE
Sbjct: 231 KPPKLHGAYTNLVKHFIATCLIKDPEKRPSASELLE 266

>Kpol_2002.24 s2002 (48405..49868) [1464 bp, 487 aa] {ON}
           (48405..49868) [1464 nt, 488 aa]
          Length = 487

 Score = 94.4 bits (233), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 78/261 (29%), Positives = 129/261 (49%), Gaps = 30/261 (11%)

Query: 31  GGFAHIYSAEISPADPNSIGNVACLKRV-LVPDKQSLNVLRAEVDAMKLLRGNKHVVSYI 89
           G F  +Y A     D  + G +  +K V L   ++ +++L  E+  +  LR   ++ +YI
Sbjct: 24  GNFGDVYKA----FDKTN-GAIVAVKVVNLEHTEEDIDLLAQEIFFLAELRS-PYITNYI 77

Query: 90  DSHAAKSGAQDGSYEVFLLMEYCSAGGLIDFMNTRLQNRLTENEVLKIMSDITQGIAAMH 149
            +       +D S  ++++MEYC  G   D + T   N L EN+V  I  ++ +G+  +H
Sbjct: 78  TTMI-----EDVS--MWIVMEYCGGGACSDLIKTVYINGLPENKVGFITREVLKGLKYLH 130

Query: 150 ALLPPLIHRDIKIENVLISDDKTFKVCDFGSVCGVIRPPKNAQEFSYVQNDILKNTTAQY 209
                 IHRDIK  N+L++D+   K+ DFG V G IR       F           T  +
Sbjct: 131 D--QKKIHRDIKAANILLTDEGKVKLGDFG-VSGQIRATMKRGTFV---------GTPYW 178

Query: 210 RSPEMIDLYRGHPINEKSDIWALGVFLYKLCYYTTPFEKVGDAAILHS--RFQFPA-YPQ 266
            +PE+++    +  NEK+DIW+LG+ +Y+L     P  K     ++ S  R + P  + Q
Sbjct: 179 MAPEVVN-KESNGYNEKADIWSLGITVYELLKGLPPLSKCDPMKVMVSLPRRKPPKLHGQ 237

Query: 267 YSDRLKNLISVMLSENPNQRP 287
           YSD  K  ++  L ++PN RP
Sbjct: 238 YSDVAKGFVAACLVKDPNLRP 258

>Ecym_2153 Chr2 complement(287697..288788) [1092 bp, 363 aa] {ON}
           similar to Ashbya gossypii AFL143C
          Length = 363

 Score = 92.8 bits (229), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 82/352 (23%), Positives = 149/352 (42%), Gaps = 65/352 (18%)

Query: 6   SGIYTQGTALTVGSHQARIIKYLTSGGFAHIYSAEISPADPNSIGNVACLKRVLVPDKQS 65
            G +  G  +++      +   L  G    +Y  +  P   +S G V  LK+V  P  ++
Sbjct: 15  CGFWFDGVRISINGKSYLVTTLLREGELTALYQVK-CPKRSHS-GGVYALKKVTCPIGRA 72

Query: 66  LNVLRAEVDAMKLLRGNK-HVVSYIDSHAAKSGAQDGSYEVFLLMEYCSAGGLIDFMNTR 124
             V RA  +     R N  ++ + +D   A+    +G+  +++L+ Y  AG L D +N  
Sbjct: 73  DFVTRAMTEISNYQRFNSPYITNILDFQVAQH--DNGTKIIYMLLPYFPAGSLQDLINNM 130

Query: 125 L--QNRLTENEVLKIMSDITQGIAAMH--------------------------------- 149
           +   + L+E+ V+++M DI +G+  MH                                 
Sbjct: 131 IIRGDSLSESRVVRLMLDICRGVRCMHEPSESDFRDPYDVAYFDAASLRYSDETHLLVDA 190

Query: 150 ----ALLPPL--------IHRDIKIENVLISDDKTFKVCDFGSVCGVIRPP---KNAQEF 194
                L PPL        +H  +  EN+++S +    + +  S    +R P    +  + 
Sbjct: 191 MELDLLSPPLTNSEPSAYVHCGLNPENIMLSSEGLPVIYNMASC---VRAPLELTSNSKL 247

Query: 195 SYVQNDILKNTTAQYRSPEMIDLYRGHPINEKSDIWALGVFLYKLCYYTTPF---EKVGD 251
             +Q  + +N+   Y  PE++DL+    I  + DIW+LG   Y L Y  + F   +++  
Sbjct: 248 LGLQEWLNENSCLPYTCPELLDLHPNTSITNRCDIWSLGCICYALMYSISSFAREQQLCG 307

Query: 252 AAILHS----RFQFPAYPQYSDRLKNLISVMLSENPNQRPNICQVLEEVSRI 299
             I HS     F FP  P+YS  LK ++   L  +P++RP+I + L +   +
Sbjct: 308 TPIKHSISTGNFSFPDEPRYSQSLKRIVQRCLVIDPHKRPDIYETLAQFQEL 359

>KLTH0H03080g Chr8 complement(274038..275078) [1041 bp, 346 aa] {ON}
           similar to uniprot|Q7LGU7 Saccharomyces cerevisiae
           YPL236C Hypothetical ORF
          Length = 346

 Score = 92.0 bits (227), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 76/338 (22%), Positives = 151/338 (44%), Gaps = 55/338 (16%)

Query: 10  TQGTALTVGSHQARIIKYLTSGGFAHIYSAEISPADPNSIGNVACLKRVLVP--DKQSLN 67
           +Q + ++V  H+  I + L  GGF+ +Y  E      +    +  LK++  P     S++
Sbjct: 14  SQPSYVSVNGHRYHIKRLLGEGGFSFVYLVE------SRENGLMALKKIRCPFGSIGSIS 67

Query: 68  VLRAEVDAMKLLRGNKHVVSYIDSHAAKSGAQDGSYEVFLLMEYCSAGGLIDFMNTRLQN 127
               EVD  +  + + ++   IDS   +   +DGS  V++L+ Y S G L D +N  L +
Sbjct: 68  PAMKEVDNYQKFK-SPYIAQIIDSQVVQE--RDGSKTVYILLPYFSKGSLQDEINRHLLD 124

Query: 128 --RLTENEVLKIMSDITQGIAAMHALLPP------------------------------- 154
             ++ E EV+++   + +G+  +H   P                                
Sbjct: 125 CTQVPELEVVRLALGVARGLLCIHDAAPADESDVTYSIVSAPYAEDSSLLNDLELDTFGE 184

Query: 155 ----LIHRDIKIENVLISDDKTFKVCDFGSVCGVIRPPKNAQEFSYVQNDILKNTTAQYR 210
                 H DIK  N++IS +    + D GS         + Q     Q    ++ T  + 
Sbjct: 185 SHQAYAHHDIKPSNIMISSEGMPVISDLGSCSRACVEINSRQALLQFQEWRSEHCTLTFM 244

Query: 211 SPEMIDLYRGHPINEKSDIWALGVFLYKLCYYTTPFEK---VGDAAILHS----RFQFPA 263
           +PE++D+     I EK D+W+ G  +Y +C+  +PFE+   +  A++ +S    ++  P+
Sbjct: 245 APEILDVKLNSVITEKCDVWSFGCTIYTMCFGISPFEREEQISGASVTYSLTTGKYSIPS 304

Query: 264 YPQYSDRLKNLISVMLSENPNQRPNICQVLEEVSRIQN 301
              YS  L +++   L+ +P+ RP++ +++  +  +Q+
Sbjct: 305 GTNYSSGLIDVVKKCLNVDPDGRPSVDELISLLMDLQS 342

>Suva_16.70 Chr16 complement(110631..111725) [1095 bp, 364 aa] {ON}
           YPL236C (REAL)
          Length = 364

 Score = 92.0 bits (227), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 81/339 (23%), Positives = 148/339 (43%), Gaps = 61/339 (17%)

Query: 13  TALTVGSHQARIIKYLTSGGFAHIYSAEISPADPNSIGNVAC-----LKRVLVPDKQSLN 67
           T + V   + +I + L  GG + +Y  ++          VA      LK+++ P+ +S++
Sbjct: 21  TTIRVNDKRYKIQRLLGEGGLSFVYLVQLLKGSLIMENGVAAPELYALKKIICPNVESIS 80

Query: 68  VLRAEVDAMKLLRGNKHVVSYIDSHAAKSGAQDGSYEVFLLMEYCSAGGLIDFMNTRLQN 127
               E++  K  + + +V+  IDS   +   +DGS  +++++ + + G L D +N RL  
Sbjct: 81  NGMREIENYKRFQ-SPYVIQSIDSQVMQE--KDGSKSIYIILPFYTLGSLQDSINRRLLE 137

Query: 128 R--LTENEVLKIMSDITQGIAAMH--------------------------ALL---PPL- 155
              ++E E ++IM  + +G+  +H                          A L    PL 
Sbjct: 138 GTFISEAECVRIMLGVIRGLLCLHDPASRQDNTNSRTTVDTVSMTYSDETAFLLEDTPLE 197

Query: 156 --------------IHRDIKIENVLISDDKTFKVCDFGSVCGVIRPPKNAQEFSYVQNDI 201
                          HRDI   N+L S D    + D GS         N  +   +Q  +
Sbjct: 198 MDMLSSNLGASIAYAHRDITPSNILFSSDGLPVIGDLGSCSQADITIGNRNQLRELQEWV 257

Query: 202 LKNTTAQYRSPEMIDLYRGHPINEKSDIWALGVFLYKLCYYTTPFEK---VGDAAILHS- 257
             N T  Y +PE++ L     ++ K DIW+LG   Y L +  +PFE+   +  A+I ++ 
Sbjct: 258 NDNCTLPYTAPELLGLKLNQTLDCKVDIWSLGCTFYTLMFGISPFEREEQIHGASITYAI 317

Query: 258 ---RFQFPAYPQYSDRLKNLISVMLSENPNQRPNICQVL 293
              ++ FP   ++S+ L ++I   +  +P QRP   Q+L
Sbjct: 318 NTGKYSFPRNSRFSEGLLSVIKKCIQVDPVQRPTTSQLL 356

>KAFR0A05090 Chr1 (1011918..1013924) [2007 bp, 668 aa] {ON} 
          Length = 668

 Score = 94.0 bits (232), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 65/242 (26%), Positives = 116/242 (47%), Gaps = 46/242 (19%)

Query: 72  EVDAMKLLRGNKHVVSYIDSHAAKSGAQDGSYEVFLLMEYCSAGGLIDFMNTRLQNRLTE 131
           E++  KL+ G+K+++S ID     +        +++++E C AG L D +  R +  L E
Sbjct: 99  EIEIHKLVNGHKNIISMIDHFEIDAT-------MYMVLELCGAGSLYDII-CRSKRSLRE 150

Query: 132 NEVLKIMSDITQGIAAMHALLPPLIHRDIKIENVLISDDKTFKVCDFGSVCGVIRPPKNA 191
            E  ++M  +   +  +H     ++H D+K+ N+LI      ++CDFG            
Sbjct: 151 WEAKRLMIQLCGAVDWIHE--KNIVHADLKLSNILIDSSNNLQLCDFGH----------- 197

Query: 192 QEFSYVQNDILKNT-----TAQYRSPEMI---------DLYRGHPINEKSDIWALGVFLY 237
              S+V  DI  N+     T  Y SPE+I         DLY      ++SDIW++G+ LY
Sbjct: 198 ---SFVSTDIDNNSINKFGTPNYLSPEIISNFILSDKKDLY----FPKESDIWSIGIVLY 250

Query: 238 KLCYYTTPFEKVGDAA----ILHSRFQFPAYPQYSDRLKNLISVMLSENPNQRPNICQVL 293
            + +  TPFE     +    I+  ++ F    + S+++K LI  +L   P +R  I +++
Sbjct: 251 AMIFDKTPFEATTLRSTYENIVECKYGFVENKRVSNKVKKLIQNILKIQPLERKTIVEIV 310

Query: 294 EE 295
            +
Sbjct: 311 SD 312

>Kpol_1023.26 s1023 (51805..54024) [2220 bp, 739 aa] {ON}
           (51805..54024) [2220 nt, 740 aa]
          Length = 739

 Score = 92.8 bits (229), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 74/273 (27%), Positives = 128/273 (46%), Gaps = 32/273 (11%)

Query: 27  YLTSGGFAHIYSAEISPADPNSIGNVACLKRVLVPDKQSLNVLRAEVDAMKLLRGNKHVV 86
           +L  GGFA  +  +    D   +     + ++ +  +++ N L +E+   K +R ++++V
Sbjct: 103 FLGEGGFARCFQMK---DDDGKVFAAKTVAKISIKSEKARNKLLSEIQIHKNMR-HQNIV 158

Query: 87  SYIDSHAAKSGAQDGSYEVFLLMEYCSAGGLIDFMNTRLQNRLTENEVLKIMSDITQGIA 146
            +ID         +    V++L+E C  G L+D +  R    LTE EV    + I   + 
Sbjct: 159 HFIDCF-------EDDINVYILLEICPNGSLMDLLKRR--KILTEPEVRFFTTQICGALD 209

Query: 147 AMHALLPPLIHRDIKIENVLISDDKTFKVCDFGSVCGVIRPPKNAQEFSYVQNDILKNTT 206
            MH+    +IHRD+K+ N+    D   K+ DFG     I   +N ++++          T
Sbjct: 210 HMHS--RNIIHRDLKLGNIFFDKDFNLKIGDFG--LAAIINNENERKYTIC-------GT 258

Query: 207 AQYRSPEMIDLYR--GHPINEKSDIWALGVFLYKLCYYTTPFEKVGDAAIL----HSRFQ 260
             Y +PE+I   +  GH    + DIW+LGV ++ +     PF+    + I     H  + 
Sbjct: 259 PNYIAPEVIMGGKQIGHSF--EVDIWSLGVMIFAMITGKPPFQAKEVSTIYDRIKHCNYS 316

Query: 261 FPAYPQYSDRLKNLISVMLSENPNQRPNICQVL 293
           FP     S  +K LI  +LS NP +RP I ++L
Sbjct: 317 FPTDKYVSKDVKKLIQDILSMNPMERPTIQEIL 349

>Kpol_1037.20 s1037 (41658..43772) [2115 bp, 704 aa] {ON}
           (41658..43772) [2115 nt, 705 aa]
          Length = 704

 Score = 92.4 bits (228), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 77/276 (27%), Positives = 132/276 (47%), Gaps = 33/276 (11%)

Query: 27  YLTSGGFAHIYSAEISPADPNSIGNVACLKRVLVPDKQSLNVLRAEVDAMKLLRGNKHVV 86
           +L  GGFA  +  +    D   I     + ++ +  +++   L +E+   K ++ +++VV
Sbjct: 87  FLGEGGFARCFQIK---DDSGKIFAAKTVAKLSIKSEKTRKKLLSEIQIHKSMK-HQNVV 142

Query: 87  SYIDSHAAKSGAQDGSYEVFLLMEYCSAGGLIDFMNTRLQNRLTENEVLKIMSDITQGIA 146
            +ID     +        V++L+E C  G L+D +  R    LTE EV    + I   I 
Sbjct: 143 QFIDCFEDDTN-------VYILLEICPNGSLMDLLKKR--KLLTEPEVRFFTTQICGAIK 193

Query: 147 AMHALLPPLIHRDIKIENVLISDDKTFKVCDFGSVCGVIRPPKNAQEFSYVQNDILKNTT 206
            MH+    +IHRD+K+ N+    +   K+ DFG +  V+    N +E  Y         T
Sbjct: 194 YMHS--RRVIHRDLKLGNIFFDRNYNLKIGDFG-LAAVL---ANDRERKYTVCG-----T 242

Query: 207 AQYRSPE-MIDLYRGHPINEKSDIWALGVFLYKLCYYTTPFEKVGDAAILHSR-----FQ 260
             Y +PE ++  + GH  + + DIW++GV LY L     PF+   D   ++ R     F 
Sbjct: 243 PNYIAPEVLMGKHSGH--SYEVDIWSIGVMLYALLIGKPPFQS-KDVNTIYERIKCCDFS 299

Query: 261 FPAYPQYSDRLKNLISVMLSENPNQRPNICQVLEEV 296
           FP     S+  K LI  +LS +P +RP+I ++++ V
Sbjct: 300 FPKEKHISNEAKVLIQDLLSLDPLERPSISEIMDYV 335

>CAGL0J11638g Chr10 complement(1130744..1132984) [2241 bp, 746 aa]
           {ON} highly similar to uniprot|P32562 Saccharomyces
           cerevisiae YMR001c CDC5 involved in regulation of DNA
           replication
          Length = 746

 Score = 92.4 bits (228), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 79/299 (26%), Positives = 139/299 (46%), Gaps = 40/299 (13%)

Query: 4   PSSGIYTQGTALTVGSHQARIIKYLTSGGFAHIYSAEISPADPNSIGNVACLKRVLVPDK 63
           P S I T+G     G       ++L  GGFA  +  +    D   I     + ++ +  +
Sbjct: 70  PPSLIKTRGRDYHRG-------QFLGEGGFARCFQIK---DDSGKIFAAKTVAKISIKSE 119

Query: 64  QSLNVLRAEVDAMKLLRGNKHVVSYIDSHAAKSGAQDGSYEVFLLMEYCSAGGLIDFMNT 123
           ++   L +E+   K +  + ++V +ID         + +  V++L+E C  G L++ +  
Sbjct: 120 KTRKKLLSEIQIHKSM-SHTNIVQFIDCF-------EDNVNVYILLEICPNGSLMELIKK 171

Query: 124 RLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIENVLISDDKTFKVCDFGSVCG 183
           R    +TE EV   M+ I  GI  MH+    +IHRD+K+ N+   +    K+ DFG    
Sbjct: 172 R--KTITEPEVRFFMTQICGGIQYMHS--NRVIHRDLKLGNIFFDEHYNLKIGDFG--LA 225

Query: 184 VIRPPKNAQEFSYVQNDILKNTTAQYRSPE-MIDLYRGHPINEKSDIWALGVFLYKLCYY 242
            +      ++F+          T  Y +PE ++  + GH  + + DIW++GV LY L   
Sbjct: 226 AVLANDRERKFTIC-------GTPNYIAPEVLMGKHSGH--SYEVDIWSIGVMLYALLIG 276

Query: 243 TTPFEKVGDAAILHSR-----FQFPAYPQYSDRLKNLISVMLSENPNQRPNICQVLEEV 296
             PF+   D   ++ R     F +P   + S   K LI  +LS NP +RP+I ++++ V
Sbjct: 277 KPPFQ-AKDVNTIYERIKQRNFAYPKDKKISQDAKYLIDDILSLNPMERPSIQEIMDYV 334

>CAGL0K08514g Chr11 complement(854143..858612) [4470 bp, 1489 aa]
           {ON} similar to uniprot|P34244 Saccharomyces cerevisiae
           YKL101w serine/threonine-protein kinase
          Length = 1489

 Score = 93.2 bits (230), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 71/253 (28%), Positives = 121/253 (47%), Gaps = 37/253 (14%)

Query: 69  LRAEVDAMKLLRGNKHVVSYIDSHAAKSGAQDGSYEVFLLMEYCSAGGLIDFMNTRLQNR 128
           +  E+  MKL+  + +V+  ++    KS       E++L++EY   G L D++ ++   +
Sbjct: 173 IEREIVIMKLI-SHPNVMGLLEVWENKS-------ELYLVLEYVDGGELFDYLVSK--GK 222

Query: 129 LTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIENVLISD-DKTFKVCDFGSVCGVIRP 187
           L+E E +   + I QG++  H+    + HRD+K EN+L+   +K  K+ DFG     +  
Sbjct: 223 LSEPEAVHYFTQIIQGVSYCHSF--NICHRDLKPENLLLDKKNKVIKIADFG--MAALEL 278

Query: 188 PKNAQEFSYVQNDILKNTTAQYRSPEMI--DLYRGHPINEKSDIWALGVFLYKLCYYTTP 245
           P    E S          +  Y SPE++    Y G P    SD+W+ G+ L+ L     P
Sbjct: 279 PNKLLETSC--------GSPHYASPEIVMGKPYHGGP----SDVWSCGIILFALLTGHLP 326

Query: 246 FEKVGDAAIL----HSRFQFPAYPQYSDRLKNLISVMLSENPNQRPNICQVLEE--VSRI 299
           F       +L      RFQ P Y   ++  K+LI+ +L  NP +R  I ++L    + + 
Sbjct: 327 FNDDNIKKLLLKVQAGRFQLPPY--LTNDAKDLITRILVTNPEKRLTINEILNHPLIKKY 384

Query: 300 QNVPCPLRNFYLL 312
           +N P  +R   LL
Sbjct: 385 RNPPAHIRKLNLL 397

>NCAS0C04100 Chr3 (834997..837714) [2718 bp, 905 aa] {ON} Anc_8.141
          Length = 905

 Score = 92.4 bits (228), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 89/335 (26%), Positives = 151/335 (45%), Gaps = 77/335 (22%)

Query: 11  QGTALTVGSHQARIIKYLTSGGFAHIYSAE-ISPADPN---------SIGNVACLKRVLV 60
           + T + VGS +  + K +  G FA ++ A  I+P  P+         SI N  C    +V
Sbjct: 27  ERTTIYVGSDRYIVDKEIGKGSFATVHRAHLITPTSPHLHQSVVDSSSINNPTCFAIKIV 86

Query: 61  P-----DKQSLNVLRAEVDAMKLLRGNKHVVSYIDSHAAKSGAQDGSYEVFLLMEYCSAG 115
           P     +K+ L  L  E+  +K +  + H+V  ID        +  S + +L+MEYCS G
Sbjct: 87  PRSKLKNKKLLENLEIEIAILKKI-SHPHIVKLID-------FERTSKDFYLIMEYCSLG 138

Query: 116 GLIDFMNTRLQ----------------------NRLTENEVLKIMSDITQGIAAMHALLP 153
            L   +  R Q                      N L +  +L  +  ++  +  + +   
Sbjct: 139 DLTFLIKKRQQLIKNHPLLEKIFKKYPPPNEKYNGLHKAFILNYLQQLSSALKFLRS--K 196

Query: 154 PLIHRDIKIENVLIS-------DDKTFKVCDFGSVCGVIRPPKNAQEFSYVQNDILKNTT 206
            L+HRDIK +N+L+S       D K+F   D G V     P     +F + +   L NT+
Sbjct: 197 NLVHRDIKPQNLLLSAPLINYNDPKSFH--DLGFVGIYNLPILKIADFGFAR--FLPNTS 252

Query: 207 AQ--------YRSPEMIDLYRGHPINEKSDIWALGVFLYKLCYYTTPFEKVGDAAILHSR 258
                     Y +PE+++ Y+ +  N K+D+W++G  LY++CY   PF K  +   L+ +
Sbjct: 253 MAETLCGSPLYMAPEILN-YQKY--NAKADLWSVGTVLYEMCYGNPPF-KASNHLELYKK 308

Query: 259 FQ-------FPAYPQYSDRLKNLISVMLSENPNQR 286
            +       FP Y +  + LK+LIS +L+ +P +R
Sbjct: 309 IKKANDLIYFPTYIEIDNNLKSLISKLLTFDPQER 343

>ZYRO0E07876g Chr5 (616134..617243) [1110 bp, 369 aa] {ON} similar
           to uniprot|Q7LGU7 Saccharomyces cerevisiae YPL236C
           Hypothetical ORF
          Length = 369

 Score = 89.7 bits (221), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 86/334 (25%), Positives = 143/334 (42%), Gaps = 62/334 (18%)

Query: 15  LTVGSHQARIIKYLTSGGFAHIYSAE-ISPADPNSI--GNVACLKRVLVP--DKQSLNVL 69
           L++   +  I K L    F+ IY  + I     +S    N+  LKR+  P  + +S++  
Sbjct: 26  LSINGRRYSIKKLLGESNFSFIYLVQQIGSVTASSTPRTNLYALKRIRCPFGNIESISGA 85

Query: 70  RAEVDAMKLLRGNKHVVSYIDSHAAKSGAQDGSYEVFLLMEYCSAGGLIDFMNTRLQNR- 128
             EVD  K  + + +++  +DS  A+   +DGS  V++L+ Y   G L D  +  L N  
Sbjct: 86  MKEVDNYKRFQ-SPYIIHLVDSQVAQQ--RDGSKTVYILLPYFPLGSLQDSTSRNLLNGT 142

Query: 129 -LTENEVLKIMSDITQGIAAMH--------------------------ALL---PPL--- 155
            ++E E ++I+  I +G+  +H                          A L    PL   
Sbjct: 143 FISEAECIRIVIGIARGLRCLHDPSARSQDAEQQQEHDAVSMSYSDEAAFLLEDTPLELD 202

Query: 156 -------------IHRDIKIENVLISDDKTFKVCDFGSVCGVIRPPKNAQEFSYVQNDIL 202
                         HRDIK  N+L S D    + + GS            + + +Q  + 
Sbjct: 203 ILSSANTINSNFYAHRDIKPSNILFSSDGLPVISNLGSCSKADLSINTGMQLTELQAWVS 262

Query: 203 KNTTAQYRSPEMIDLYRGHPINEKSDIWALGVFLYKLCYYTTPFEK---VGDA----AIL 255
            + T  Y +PE++ +     ++ K DIW+LG   Y + +  +PFE+   +  A    AI 
Sbjct: 263 DHCTVAYTAPELLHITLNRSVDTKVDIWSLGCTCYFMLFGISPFEREEQISGASLKYAIG 322

Query: 256 HSRFQFPAYPQYSDRLKNLISVMLSENPNQRPNI 289
              F FP+  +YS+ L  LI+  L  NP  RP+I
Sbjct: 323 TGNFSFPSQDRYSEGLLKLITKCLQVNPAARPDI 356

>Smik_6.441 Chr6 (721619..722713) [1095 bp, 364 aa] {ON} YPL236C
           (REAL)
          Length = 364

 Score = 89.4 bits (220), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 81/333 (24%), Positives = 150/333 (45%), Gaps = 61/333 (18%)

Query: 13  TALTVGSHQARIIKYLTSGGFAHIYSAEI---SPADPNSIGN--VACLKRVLVPDKQSLN 67
           T + V   + +I + L  GG + +Y  ++   S    N I    +  LK+++ P  +S++
Sbjct: 21  TTIRVNDKRYKIQRLLGEGGMSFVYLVQLLKNSLIMENGIITPEMYALKKIICPSVESIS 80

Query: 68  VLRAEVDAMKLLRGNKHVVSYIDSHAAKSGAQDGSYEVFLLMEYCSAGGLIDFMNTRLQN 127
               E++  K  + + +V+  IDS   +   ++GS  +++++ Y S G L D +N RL  
Sbjct: 81  NGMREIENYKRFQ-SPYVIQSIDSQVTQE--KNGSKIIYIILPYYSLGSLQDSINRRLLE 137

Query: 128 R--LTENEVLKIMSDITQGIAAMH--------------------------ALL---PPL- 155
              ++E E ++IM  +T+G+  +H                          A+L    PL 
Sbjct: 138 GTFISEAECVRIMLGVTRGLLCLHDPASRQDNITPRVNVDAVSMTYSDETAMLLEDTPLE 197

Query: 156 --------------IHRDIKIENVLISDDKTFKVCDFGSVCGVIRPPKNAQEFSYVQNDI 201
                          HRDI   N+L S +    + D GS         +  + S +Q  +
Sbjct: 198 MDVLSSGSAGSIAYAHRDITPSNILYSSEGLPVIADLGSCSQADIRIGSRNQLSELQEWV 257

Query: 202 LKNTTAQYRSPEMIDLYRGHPINEKSDIWALGVFLYKLCYYTTPFEK---VGDAAILHS- 257
             N T  Y +PE+++L     ++ K DIW++G   Y L +  +PFE+   +  A+I ++ 
Sbjct: 258 NDNCTLPYTAPELLNLKLNQILSCKVDIWSMGCTFYTLMFGISPFEREEQIHGASITYAI 317

Query: 258 ---RFQFPAYPQYSDRLKNLISVMLSENPNQRP 287
              ++ FP   ++S+ L N+I   +  +P QRP
Sbjct: 318 NTGKYSFPRNSRFSEALLNVIKKCIQVDPIQRP 350

>TDEL0G04380 Chr7 (792278..794446) [2169 bp, 722 aa] {ON} Anc_6.31
           YMR001C
          Length = 722

 Score = 91.3 bits (225), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 76/276 (27%), Positives = 132/276 (47%), Gaps = 33/276 (11%)

Query: 27  YLTSGGFAHIYSAEISPADPNSIGNVACLKRVLVPDKQSLNVLRAEVDAMKLLRGNKHVV 86
           +L  GGFA  +  +    D   I     + ++ +  +++   L +E+   K +R + ++V
Sbjct: 106 FLGEGGFARCFQIK---DDSGKIFAAKTVAKLSIKTEKTRKKLLSEIQIHKSMR-HANIV 161

Query: 87  SYIDSHAAKSGAQDGSYEVFLLMEYCSAGGLIDFMNTRLQNRLTENEVLKIMSDITQGIA 146
            +ID    ++        V++L+E C  G L++ +  R    LTE EV    + I  GI 
Sbjct: 162 QFIDCFEDETN-------VYILLEICPNGSLMELLKKR--KTLTEPEVRFFTTQICGGIK 212

Query: 147 AMHALLPPLIHRDIKIENVLISDDKTFKVCDFGSVCGVIRPPKNAQEFSYVQNDILKNTT 206
            MH+    +IHRD+K+ N+    +   K+ DFG +  V+    N +E  Y         T
Sbjct: 213 YMHS--RRVIHRDLKLGNIFFDKNYNLKIGDFG-LAAVL---ANDRERKYTVCG-----T 261

Query: 207 AQYRSPE-MIDLYRGHPINEKSDIWALGVFLYKLCYYTTPFEKVGDAAILHSR-----FQ 260
             Y +PE ++  + GH  + + DIW++GV +Y L     PF+   D   ++ R     F 
Sbjct: 262 PNYIAPEVLMGKHSGH--SYEVDIWSIGVMIYALLIGKPPFQ-AKDVNTIYERIKCCDFV 318

Query: 261 FPAYPQYSDRLKNLISVMLSENPNQRPNICQVLEEV 296
           FP     S   + L+  +LS +P +RP+I +VL+ V
Sbjct: 319 FPKEKYISSEARILVQDLLSLDPLERPSIMEVLDYV 354

>NDAI0F04520 Chr6 complement(1098426..1099895) [1470 bp, 489 aa]
           {ON} Anc_1.24
          Length = 489

 Score = 90.1 bits (222), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 57/194 (29%), Positives = 96/194 (49%), Gaps = 16/194 (8%)

Query: 105 VFLLMEYCSAGGLIDFMNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIEN 164
           ++++MEYC  G   D +       L E++V  I  ++ +G+  +H      IHRD+K  N
Sbjct: 92  MWIVMEYCGGGSCSDLIRYHYNEGLHEDKVAFITKNVLRGLQYLHE--QRKIHRDVKAAN 149

Query: 165 VLISDDKTFKVCDFGSVCGVIRPPKNAQEFSYVQNDILKNTTAQYRSPEMIDLYRGHPIN 224
           VL++DD   K+ DFG V G +R       F           T  + +PE+I     H  N
Sbjct: 150 VLLTDDGLVKLADFG-VSGQLRSTAKRNTFV---------GTPYWMAPEIIS-NSSHGYN 198

Query: 225 EKSDIWALGVFLYKLCYYTTPFEKVGDAAILHS---RFQFPAYPQYSDRLKNLISVMLSE 281
           EK+DIW+LG+ +Y+L     P+ K     ++ +   +        +SD  K  IS  L +
Sbjct: 199 EKADIWSLGITVYELLKGCPPYAKYDAGKVMRNIPKKNLQDCMVSFSDAAKLFISACLIK 258

Query: 282 NPNQRPNICQVLEE 295
           +P++RP   ++L++
Sbjct: 259 DPDERPTATELLQQ 272

>KNAG0E00850 Chr5 complement(158992..161127) [2136 bp, 711 aa] {ON}
           Anc_6.31 YMR001C
          Length = 711

 Score = 90.9 bits (224), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 75/276 (27%), Positives = 133/276 (48%), Gaps = 33/276 (11%)

Query: 27  YLTSGGFAHIYSAEISPADPNSIGNVACLKRVLVPDKQSLNVLRAEVDAMKLLRGNKHVV 86
           +L  GGFA  +  +    +   I     + ++ +  +++   L +E+   K +R + +VV
Sbjct: 96  FLGEGGFARCFQIK---DESGKIFAAKTVAKISIKSEKTRKKLLSEIQIHKSMR-HFNVV 151

Query: 87  SYIDSHAAKSGAQDGSYEVFLLMEYCSAGGLIDFMNTRLQNRLTENEVLKIMSDITQGIA 146
            +ID     +        V++L+E C  G L++ +  R    +TE EV   M+ I   I 
Sbjct: 152 QFIDCFEDDTN-------VYILLEICPNGSLMELLKKR--RTVTEPEVRYFMTQICGAIK 202

Query: 147 AMHALLPPLIHRDIKIENVLISDDKTFKVCDFGSVCGVIRPPKNAQEFSYVQNDILKNTT 206
            MH+    +IHRD+K+ N+    +   K+ DFG +  V+    N +E  Y         T
Sbjct: 203 YMHS--RRVIHRDLKLGNIFFDKNYNLKIGDFG-LAAVL---ANDRERKYTVCG-----T 251

Query: 207 AQYRSPE-MIDLYRGHPINEKSDIWALGVFLYKLCYYTTPFEKVGDAAILHSR-----FQ 260
             Y +PE ++  + GH  + + DIW++GV +Y L     PF+   D  +++ R     F 
Sbjct: 252 PNYIAPEVLMGKHSGH--SYEVDIWSIGVMIYALLIGKPPFQS-KDVNMIYERIKNRDFA 308

Query: 261 FPAYPQYSDRLKNLISVMLSENPNQRPNICQVLEEV 296
           FP     S+  K LI  +LS +P +RP+I ++++ V
Sbjct: 309 FPKDKYISNEAKTLIHDILSTDPLERPSIEEIIDYV 344

>NDAI0C02680 Chr3 complement(621951..624203) [2253 bp, 750 aa] {ON}
           Anc_6.31
          Length = 750

 Score = 90.5 bits (223), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 74/276 (26%), Positives = 129/276 (46%), Gaps = 33/276 (11%)

Query: 27  YLTSGGFAHIYSAEISPADPNSIGNVACLKRVLVPDKQSLNVLRAEVDAMKLLRGNKHVV 86
           +L  GGFA  +  +    +   I     + ++ +  +++   L +E+   K ++ + ++V
Sbjct: 100 FLGEGGFARCFQIK---DESGKIFAAKTVAKISIKSEKTKRKLLSEIQIHKSMK-HSNIV 155

Query: 87  SYIDSHAAKSGAQDGSYEVFLLMEYCSAGGLIDFMNTRLQNRLTENEVLKIMSDITQGIA 146
            +ID     +        V++L+E C  G L+D +  R    LTE EV    + I   I 
Sbjct: 156 QFIDCFEDDAN-------VYILLEICPNGSLMDLLKKR--KSLTEPEVRFFTTQICGAIK 206

Query: 147 AMHALLPPLIHRDIKIENVLISDDKTFKVCDFGSVCGVIRPPKNAQEFSYVQNDILKNTT 206
            +H+    +IHRD+K+ N+    D   KV DFG +  V+    N +E  Y         T
Sbjct: 207 YLHS--RRIIHRDLKLGNIFFDKDYNLKVGDFG-LAAVL---ANDRERKYTVCG-----T 255

Query: 207 AQYRSPE-MIDLYRGHPINEKSDIWALGVFLYKLCYYTTPFEKVGDAAILHSRFQFPAYP 265
             Y +PE ++  + GH    + DIW++GV +Y L     PF+   D  +++ R +   Y 
Sbjct: 256 PNYIAPEVLMGKHSGHSF--EVDIWSIGVMIYALLVGKPPFQ-AKDVNVIYERIKLCKYG 312

Query: 266 QYSDRLKN-----LISVMLSENPNQRPNICQVLEEV 296
              D+  +     LI  +LS NP QRP I  ++++V
Sbjct: 313 YPKDKYVSKEAEILIHDILSLNPLQRPTIIDIIDDV 348

>SAKL0A03344g Chr1 complement(305149..306243) [1095 bp, 364 aa] {ON}
           similar to uniprot|Q7LGU7 Saccharomyces cerevisiae
           YPL236C Hypothetical ORF
          Length = 364

 Score = 88.2 bits (217), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 83/352 (23%), Positives = 147/352 (41%), Gaps = 73/352 (20%)

Query: 13  TALTVGSHQARIIKYLTSGGFAHIYSAEISPADPNSIGNVACLKRVLVP--DKQSLNVLR 70
           + L  G H A I + L  GGF+ +Y  +    +     ++  LK++  P  + +S++   
Sbjct: 20  SVLINGQHYA-IQRLLGEGGFSFVYLVQSRENN-----DLFALKKIHCPFGNIESVSEAM 73

Query: 71  AEVDAMKLLRGNKHVVSYIDSHAAKSGAQDGSYEVFLLMEYCSAGGLIDFMNTRLQN--- 127
            EV++ K  R + ++   + S   +   QDGS  VF+L+ Y   G L+D +NT L +   
Sbjct: 74  REVNSYKKFR-SPYITHCVSSQVLQE--QDGSKTVFILLPYFPTGSLLDKINTHLLDGTT 130

Query: 128 ----------------------------------------------RLTENEVLKIMSD- 140
                                                          +T NE L++++D 
Sbjct: 131 ISEEEIVRILVSVARGLRTMHNPAGQEDSIEDQTSVNTDLQYRDTVSMTYNEDLRLLNDS 190

Query: 141 -----ITQGIAAMHALLPPLIHRDIKIENVLISDDKTFKVCDFGSVCGVIRPPKNAQEFS 195
                ++   ++  A      H+DIK  N++ S D    +CD GS         +  +  
Sbjct: 191 LELDVLSGNTSSFMASTTAYSHKDIKPANIMFSSDGLPVICDLGSCSRAHVDISSRSQLV 250

Query: 196 YVQNDILKNTTAQYRSPEMIDLYRGHPINEKSDIWALGVFLYKLCYYTTPFEKVGDA--- 252
             Q    ++ T  +RSPE++++     I+EK DIW+LG  LY +C+  +PFE+       
Sbjct: 251 EFQEWCNEHCTLPFRSPELLNVTLNSKIDEKVDIWSLGCTLYCMCFGISPFEREEQLSGA 310

Query: 253 ----AILHSRFQFPAYPQYSDRLKNLISVMLSENPNQRPNICQVLEEVSRIQ 300
               AI   +F  P    YS  L  +I   +  +  +RP+I ++L  +  +Q
Sbjct: 311 SMTYAIATGKFSIPPNTNYSPELIKIIKDCIEVDSKKRPSIDELLARLQDLQ 362

>TPHA0J00420 Chr10 complement(96445..98568) [2124 bp, 707 aa] {ON}
           Anc_6.31 YMR001C
          Length = 707

 Score = 90.1 bits (222), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 77/276 (27%), Positives = 129/276 (46%), Gaps = 33/276 (11%)

Query: 27  YLTSGGFAHIYSAEISPADPNSIGNVACLKRVLVPDKQSLNVLRAEVDAMKLLRGNKHVV 86
           +L  GGFA  +       D   I     + ++ +  +++   L +E+   K ++ N ++V
Sbjct: 88  FLGEGGFARCFQFN---DDSGKIFAAKTVAKLSIKSEKTRRKLLSEIQIHKSMK-NVNIV 143

Query: 87  SYIDSHAAKSGAQDGSYEVFLLMEYCSAGGLIDFMNTRLQNRLTENEVLKIMSDITQGIA 146
            +ID     +        V++L+E C  G L+D +  R    LTE EV    + I   I 
Sbjct: 144 QFIDCFEDDTN-------VYILLEICPNGSLMDLLKKR--KSLTEPEVRFFTTQICGAIK 194

Query: 147 AMHALLPPLIHRDIKIENVLISDDKTFKVCDFGSVCGVIRPPKNAQEFSYVQNDILKNTT 206
            MH+    +IHRD+K+ N+    D   K+ DFG +  V+    N +E  Y         T
Sbjct: 195 YMHS--RRVIHRDLKLGNIFFDKDYNLKIGDFG-LAAVL---ANDRERKYTV-----CGT 243

Query: 207 AQYRSPE-MIDLYRGHPINEKSDIWALGVFLYKLCYYTTPFEKVGDAAILHSR-----FQ 260
             Y +PE ++  + GH  + + DIW++GV LY L     PF+   D   ++ R     F 
Sbjct: 244 PNYIAPEVLMGKHTGH--SYEVDIWSIGVMLYALLIGKPPFQS-KDVNTIYERIKCCDFT 300

Query: 261 FPAYPQYSDRLKNLISVMLSENPNQRPNICQVLEEV 296
           FP     S   K LI  +LS +P +RP++ ++++ V
Sbjct: 301 FPKDKYISPEAKILIQDLLSLDPLERPSVDEIIDYV 336

>YAR019C Chr1 complement(172211..175135) [2925 bp, 974 aa] {ON}
           CDC15Protein kinase of the Mitotic Exit Network that is
           localized to the spindle pole bodies at late anaphase;
           promotes mitotic exit by directly switching on the
           kinase activity of Dbf2p; required for spindle
           disassembly after meiosis II
          Length = 974

 Score = 90.5 bits (223), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 79/280 (28%), Positives = 134/280 (47%), Gaps = 33/280 (11%)

Query: 19  SHQARIIKYLTSGGFAHIYSAEISPADPNSIGNVACLKRVLVPDKQSLNVLRAEVDAMKL 78
           S Q  + + +  G +  +Y A     D      V  +K V+  + + LN + AE+  +K 
Sbjct: 22  SVQYHLKQVIGRGSYGVVYKAINKHTD-----QVVAIKEVVYENDEELNDIMAEISLLKN 76

Query: 79  LRGNKHVVSYIDSHAAKSGAQDGSYEVFLLMEYCSAGGLIDFMNTRLQNRLTENEVLKIM 138
           L  N ++V Y        G    SYE+++L+EYC+ G L   + +R    L+ENE    +
Sbjct: 77  LNHN-NIVKY-------HGFIRKSYELYILLEYCANGSLRRLI-SRSSTGLSENESKTYV 127

Query: 139 SDITQGIAAMHALLPPLIHRDIKIENVLISDDKTFKVCDFGSVCGVIRPPKNAQEFSYVQ 198
           +    G+  +H     +IHRDIK  N+L+S D T K+ DFG V  ++    N+   +   
Sbjct: 128 TQTLLGLKYLHG--EGVIHRDIKAANILLSADNTVKLADFG-VSTIV----NSSALTLAG 180

Query: 199 NDILKNTTAQYRSPEMIDLYRGHPINEKSDIWALGVFLYKLCYYTTPFEKVGDAAILHSR 258
                  T  + +PE++   RG   +  SDIW+LG  + ++     P+  + DA I ++ 
Sbjct: 181 -------TLNWMAPEILG-NRGA--STLSDIWSLGATVVEMLTKNPPYHNLTDANIYYAV 230

Query: 259 FQFPAYP--QYSDRLKNLISVMLSENPNQRPNICQVLEEV 296
                YP   +S+ LK+ +S    +N  +RP   Q+L+ V
Sbjct: 231 ENDTYYPPSSFSEPLKDFLSKCFVKNMYKRPTADQLLKHV 270

>TPHA0E03850 Chr5 complement(810694..812142) [1449 bp, 482 aa] {ON}
           Anc_1.24 YDR523C
          Length = 482

 Score = 89.0 bits (219), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 61/194 (31%), Positives = 99/194 (51%), Gaps = 18/194 (9%)

Query: 105 VFLLMEYCSAGGLIDFMNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIEN 164
           ++++MEYC  G   D +       + E++V  I+ D  +G+  +H      IHRDIK  N
Sbjct: 86  MWIVMEYCGGGSCADLIKMVYSKGIPESKVSYILRDTVKGLKYLHD--QKKIHRDIKAAN 143

Query: 165 VLISDDKTFKVCDFGSVCGVIRPPKNAQEFSYVQNDILKNTTAQYRSPEMID-LYRGHPI 223
           +L++D    K+ DFG V G IR       F           T  + +PE+I+   +G+  
Sbjct: 144 ILLTDCGKVKLGDFG-VSGQIRATMKRGTFV---------GTPYWMAPEVINKQCKGY-- 191

Query: 224 NEKSDIWALGVFLYKLCYYTTPFEKVGDAAILHS---RFQFPAYPQYSDRLKNLISVMLS 280
           NEK+DIW+LG+  Y+L     P  K     ++ +   R     + QYS++ K  +S+ L 
Sbjct: 192 NEKADIWSLGITAYELLKGVPPLSKYDPFKVMLNIPKRKPPKLHGQYSEKAKYFVSLCLI 251

Query: 281 ENPNQRPNICQVLE 294
           ++P QRP+I  +LE
Sbjct: 252 KDPKQRPSIEALLE 265

>Smik_1.79 Chr1 complement(149839..152763) [2925 bp, 974 aa] {ON}
           YAR019C (REAL)
          Length = 974

 Score = 89.7 bits (221), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 78/281 (27%), Positives = 132/281 (46%), Gaps = 35/281 (12%)

Query: 19  SHQARIIKYLTSGGFAHIYSAEISPADPNSIGNVACLKRVLVPDKQSLNVLRAEVDAMKL 78
           S Q  + + +  G +  +Y A     D      V  +K ++  + + LN + AE+  +K 
Sbjct: 22  SVQYHLKQVIGRGSYGVVYKAINKHTD-----QVVAIKEIVYENDEELNDIMAEISLLKN 76

Query: 79  LRGNKH-VVSYIDSHAAKSGAQDGSYEVFLLMEYCSAGGLIDFMNTRLQNRLTENEVLKI 137
           L  N H +V Y        G    SYE+++L+EYC+ G L   + +R    L+ENE    
Sbjct: 77  L--NHHNIVKY-------HGFIRKSYELYILLEYCANGSLRRLI-SRSSTGLSENESKTY 126

Query: 138 MSDITQGIAAMHALLPPLIHRDIKIENVLISDDKTFKVCDFGSVCGVIRPPKNAQEFSYV 197
           ++    G+  +H     +IHRDIK  N+L+S D T K+ DFG     +    N+   +  
Sbjct: 127 VTQTLLGLKYLHG--EGVIHRDIKAANILLSADNTVKLADFG-----VSTIVNSSALTLA 179

Query: 198 QNDILKNTTAQYRSPEMIDLYRGHPINEKSDIWALGVFLYKLCYYTTPFEKVGDAAILHS 257
                   T  + +PE++   RG   +  SDIW+LG  + ++     P+  + DA I ++
Sbjct: 180 G-------TLNWMAPEILG-NRGA--STLSDIWSLGATVVEMLTKNPPYHNLTDANIYYA 229

Query: 258 RFQFPAYP--QYSDRLKNLISVMLSENPNQRPNICQVLEEV 296
                 YP   +S+ LK+ +S    +N  +RP   Q+L+ V
Sbjct: 230 VENDTYYPPSSFSESLKDFLSKCFVKNMYKRPTADQLLKHV 270

>ABL034W Chr2 (333432..337709) [4278 bp, 1425 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YKL101W (HSL1)
          Length = 1425

 Score = 89.7 bits (221), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 88/326 (26%), Positives = 147/326 (45%), Gaps = 66/326 (20%)

Query: 2   NQPSSGIYTQGTALTVGSH-QARIIKYLTSGGFAHIYSAEISPADPNSIGNVACLKRVLV 60
           N+ + G +  G  L  GS  + R+ K + SG  A I   +I P            KR + 
Sbjct: 54  NRDTVGPWKLGKTLGKGSSGRVRLAKNMQSGKLAAI---KIVP------------KRNVR 98

Query: 61  PDKQSLNVL----RAEVDAMKLLRGNKHVVSYIDSHAAKSGAQDGSYEVFLLMEYCSAGG 116
            +++ +  L      E+  MKL+  + ++++  +    KS       E++L++EY   G 
Sbjct: 99  HNQKQVTALPYGIEREIIIMKLIT-HPNIMALYEVWENKS-------ELYLVLEYVEGGE 150

Query: 117 LIDFMNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIENVLIS-DDKTFKV 175
           L D++  R   +L E E +     I QG++  H     + HRD+K EN+L+   +KT K+
Sbjct: 151 LFDYLIAR--GKLPEQEAIHYFKQIVQGVSYCHNF--NICHRDLKPENLLLDKKNKTVKI 206

Query: 176 CDFGSVCGVIRPPKNAQEFSYVQNDILKNTTA--QYRSPEMI--DLYRGHPINEKSDIWA 231
            DFG           A E +   N +L+ +     Y SPE++    Y G P    SD+W+
Sbjct: 207 ADFGMA---------ALETT---NRLLETSCGSPHYASPEIVMGQKYHGSP----SDVWS 250

Query: 232 LGVFLYKLCYYTTPFEKVGDAAIL----HSRFQFPAYPQYSDRLKNLISVMLSENPNQRP 287
            G+ L+ L     PF       +L    H R+Q P+    S   K+LIS +L  +P +R 
Sbjct: 251 CGIILFALLTGHLPFNDDNVRKLLLKVQHGRYQMPS--NVSKEAKDLISKILVVDPEKRI 308

Query: 288 NICQVLEEVSRIQ-------NVPCPL 306
            + ++LE    ++        + CPL
Sbjct: 309 TVDKILEHPLLVKYDNPGKGGLACPL 334

>Suva_13.163 Chr13 complement(259136..261253) [2118 bp, 705 aa] {ON}
           YMR001C (REAL)
          Length = 705

 Score = 89.0 bits (219), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 82/299 (27%), Positives = 134/299 (44%), Gaps = 40/299 (13%)

Query: 4   PSSGIYTQGTALTVGSHQARIIKYLTSGGFAHIYSAEISPADPNSIGNVACLKRVLVPDK 63
           P S I T+G     G        +L  GGFA  +  +    D   I     + +  +  +
Sbjct: 71  PPSLIKTRGKDYHRGH-------FLGEGGFARCFQIK---DDSGEIFAAKTVAKASIKSE 120

Query: 64  QSLNVLRAEVDAMKLLRGNKHVVSYIDSHAAKSGAQDGSYEVFLLMEYCSAGGLIDFMNT 123
           ++   L +E+   K +  + ++V ++D     S        V++L+E C  G L++ +  
Sbjct: 121 KTRKKLLSEIQIHKSM-AHPNIVQFVDCFEDDSN-------VYILLEICPNGSLMELLKR 172

Query: 124 RLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIENVLISDDKTFKVCDFGSVCG 183
           R    LTE EV    + I   I  MH+    +IHRD+K+ N+    +   K+ DFG +  
Sbjct: 173 R--KVLTEPEVRFFTTQICGAIKYMHS--RRVIHRDLKLGNIFFDSNYNLKIGDFG-LAA 227

Query: 184 VIRPPKNAQEFSYVQNDILKNTTAQYRSPE-MIDLYRGHPINEKSDIWALGVFLYKLCYY 242
           V+    N  E  Y         T  Y +PE ++  + GH    + DIW+LGV LY L   
Sbjct: 228 VL---ANESERKYTICG-----TPNYIAPEVLMGKHSGHSF--EVDIWSLGVMLYALLIG 277

Query: 243 TTPFEKVGDAAILHSR-----FQFPAYPQYSDRLKNLISVMLSENPNQRPNICQVLEEV 296
             PF+   D   ++ R     F FP     SD  K LI  +LS +P +RP++ ++++ V
Sbjct: 278 KPPFQ-ARDVNTIYERIKCRDFSFPKDKPISDEGKILIRDILSLDPIERPSLTEIMDYV 335

>Skud_13.154 Chr13 complement(255263..257380) [2118 bp, 705 aa] {ON}
           YMR001C (REAL)
          Length = 705

 Score = 89.0 bits (219), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 83/299 (27%), Positives = 134/299 (44%), Gaps = 40/299 (13%)

Query: 4   PSSGIYTQGTALTVGSHQARIIKYLTSGGFAHIYSAEISPADPNSIGNVACLKRVLVPDK 63
           P S I T+G     G        +L  GGFA  +  +    D   I     + +  +  +
Sbjct: 71  PPSLIKTRGKDYHRGH-------FLGEGGFARCFQIK---DDSGEIFAAKTVAKASIKSE 120

Query: 64  QSLNVLRAEVDAMKLLRGNKHVVSYIDSHAAKSGAQDGSYEVFLLMEYCSAGGLIDFMNT 123
           ++   L +E+   K +  + ++V +ID     S        V++L+E C  G L++ +  
Sbjct: 121 KTRKKLLSEIQIHKSM-SHPNIVQFIDCFEDDSN-------VYILLEICPNGSLMELLKR 172

Query: 124 RLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIENVLISDDKTFKVCDFGSVCG 183
           R    LTE EV    + I   I  MH+    +IHRD+K+ N+    +   K+ DFG +  
Sbjct: 173 R--KVLTEPEVRFFTTQICGAIKYMHS--RRVIHRDLKLGNIFFDSNYNLKIGDFG-LAA 227

Query: 184 VIRPPKNAQEFSYVQNDILKNTTAQYRSPE-MIDLYRGHPINEKSDIWALGVFLYKLCYY 242
           V+    N  E  Y         T  Y +PE ++  + GH    + DIW+LGV LY L   
Sbjct: 228 VL---ANESERKYTICG-----TPNYIAPEVLMGKHSGHSF--EVDIWSLGVMLYALLIG 277

Query: 243 TTPFEKVGDAAILHSR-----FQFPAYPQYSDRLKNLISVMLSENPNQRPNICQVLEEV 296
             PF+   D   ++ R     F FP     SD  K LI  +LS +P +RP++ ++++ V
Sbjct: 278 KPPFQ-ARDVNTIYERIKCRDFSFPKDKPISDEGKILIRDILSLDPIERPSLTEIMDYV 335

>SAKL0H06754g Chr8 (594995..597649) [2655 bp, 884 aa] {ON} similar
           to uniprot|Q12152 Saccharomyces cerevisiae YPL150W
           Hypothetical ORF
          Length = 884

 Score = 89.0 bits (219), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 60/210 (28%), Positives = 103/210 (49%), Gaps = 53/210 (25%)

Query: 104 EVFLLMEYCSAGGLIDFMNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIE 163
           +V++ +EYC    L +++   +Q+R++  E  K+ + I   +   H+L    +HRD+K+E
Sbjct: 102 KVWMALEYCPGKELYEYL--LMQHRISLEESGKLFAQIVSAVYYAHSL--QCVHRDLKLE 157

Query: 164 NVLISDDKTFKVCDFG------------SVCGVIRPPKNAQEFSYVQNDILKNTTAQYRS 211
           N+L+      K+ DFG            +VCG                      T  Y +
Sbjct: 158 NILLDKKGRAKITDFGFTRECATKTMLETVCG----------------------TTVYMA 195

Query: 212 PEMIDL--YRGHPINEKSDIWALGVFLYKLCYYTTPFEKVGDAAILHSRFQ-FPAYPQYS 268
           PE+I+   Y G  I    DIW+LGV LY + + T PF++  +     ++++     P Y+
Sbjct: 196 PELIERKSYDGFKI----DIWSLGVILYTMIHGTMPFDEEDETK---TKWKIINEEPFYN 248

Query: 269 DRL-----KNLISVMLSENPNQRPNICQVL 293
           D +     K+LIS +L ++P+QRP + QVL
Sbjct: 249 DDVVSKDAKDLISQLLCKDPSQRPQLSQVL 278

>Smik_13.159 Chr13 complement(260249..262366) [2118 bp, 705 aa] {ON}
           YMR001C (REAL)
          Length = 705

 Score = 88.6 bits (218), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 83/299 (27%), Positives = 135/299 (45%), Gaps = 40/299 (13%)

Query: 4   PSSGIYTQGTALTVGSHQARIIKYLTSGGFAHIYSAEISPADPNSIGNVACLKRVLVPDK 63
           P S I T+G     G        +L  GGFA  +  +    D  +   VA   +  +  +
Sbjct: 71  PPSLIKTRGKDYHRGH-------FLGEGGFARCFQIKDDSGDIFAAKTVA---KASIKSE 120

Query: 64  QSLNVLRAEVDAMKLLRGNKHVVSYIDSHAAKSGAQDGSYEVFLLMEYCSAGGLIDFMNT 123
           ++   L +E+   K +  + ++V +ID     S        V++L+E C  G L++ +  
Sbjct: 121 KTRKKLLSEIQIHKSM-AHPNIVQFIDCFEDDSN-------VYILLEICPNGSLMELLKR 172

Query: 124 RLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIENVLISDDKTFKVCDFGSVCG 183
           R    L+E EV    + I   I  MH+    +IHRD+K+ N+    +   K+ DFG +  
Sbjct: 173 R--KVLSEPEVRFFTTQICGAIKYMHS--RRVIHRDLKLGNIFFDSNYNLKIGDFG-LAA 227

Query: 184 VIRPPKNAQEFSYVQNDILKNTTAQYRSPE-MIDLYRGHPINEKSDIWALGVFLYKLCYY 242
           V+    N  E  Y         T  Y +PE ++  + GH    + DIW+LGV LY L   
Sbjct: 228 VL---ANESERKYTICG-----TPNYIAPEVLMGKHSGHSF--EVDIWSLGVMLYALLIG 277

Query: 243 TTPFEKVGDAAILHSR-----FQFPAYPQYSDRLKNLISVMLSENPNQRPNICQVLEEV 296
             PF+   D   ++ R     F FP     SD  K LI  +LS +P +RP++ ++++ V
Sbjct: 278 KPPFQ-ARDVNTIYERIKCRDFSFPKDKPISDEGKILIRDILSLDPIERPSLTEIMDYV 335

>YMR001C Chr13 complement(269019..271136) [2118 bp, 705 aa] {ON}
           CDC5Polo-like kinase with multiple functions in mitosis
           and cytokinesis through substrate phosphorylation, also
           functions in adaptation to DNA damage during meiosis;
           has similarity to Xenopus Plx1 and S. pombe Plo1p;
           possible Cdc28p substrate
          Length = 705

 Score = 88.6 bits (218), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 83/299 (27%), Positives = 134/299 (44%), Gaps = 40/299 (13%)

Query: 4   PSSGIYTQGTALTVGSHQARIIKYLTSGGFAHIYSAEISPADPNSIGNVACLKRVLVPDK 63
           P S I T+G     G        +L  GGFA  +  +    D   I     + +  +  +
Sbjct: 71  PPSLIKTRGKDYHRGH-------FLGEGGFARCFQIK---DDSGEIFAAKTVAKASIKSE 120

Query: 64  QSLNVLRAEVDAMKLLRGNKHVVSYIDSHAAKSGAQDGSYEVFLLMEYCSAGGLIDFMNT 123
           ++   L +E+   K +  + ++V +ID     S        V++L+E C  G L++ +  
Sbjct: 121 KTRKKLLSEIQIHKSM-SHPNIVQFIDCFEDDSN-------VYILLEICPNGSLMELLKR 172

Query: 124 RLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIENVLISDDKTFKVCDFGSVCG 183
           R    LTE EV    + I   I  MH+    +IHRD+K+ N+    +   K+ DFG +  
Sbjct: 173 R--KVLTEPEVRFFTTQICGAIKYMHS--RRVIHRDLKLGNIFFDSNYNLKIGDFG-LAA 227

Query: 184 VIRPPKNAQEFSYVQNDILKNTTAQYRSPE-MIDLYRGHPINEKSDIWALGVFLYKLCYY 242
           V+    N  E  Y         T  Y +PE ++  + GH    + DIW+LGV LY L   
Sbjct: 228 VL---ANESERKYTICG-----TPNYIAPEVLMGKHSGHSF--EVDIWSLGVMLYALLIG 277

Query: 243 TTPFEKVGDAAILHSR-----FQFPAYPQYSDRLKNLISVMLSENPNQRPNICQVLEEV 296
             PF+   D   ++ R     F FP     SD  K LI  +LS +P +RP++ ++++ V
Sbjct: 278 KPPFQ-ARDVNTIYERIKCRDFSFPRDKPISDEGKILIRDILSLDPIERPSLTEIMDYV 335

>NCAS0D02100 Chr4 (385878..388058) [2181 bp, 726 aa] {ON} Anc_6.31
          Length = 726

 Score = 88.2 bits (217), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 73/276 (26%), Positives = 132/276 (47%), Gaps = 33/276 (11%)

Query: 27  YLTSGGFAHIYSAEISPADPNSIGNVACLKRVLVPDKQSLNVLRAEVDAMKLLRGNKHVV 86
           +L  GGFA  +  +    +   I     + ++ +  +++   L +E+   K ++ + ++V
Sbjct: 97  FLGEGGFARCFQIK---DESGKIFAAKTVAKISIKTEKTKKKLLSEIQIHKSMK-HPNIV 152

Query: 87  SYIDSHAAKSGAQDGSYEVFLLMEYCSAGGLIDFMNTRLQNRLTENEVLKIMSDITQGIA 146
            ++D     +        V++L+E CS G L+D M  R    LTE EV    + I   + 
Sbjct: 153 HFVDCFEDDTN-------VYILLEICSNGSLMDLMKKR--KTLTEPEVRFFTTQICGAVK 203

Query: 147 AMHALLPPLIHRDIKIENVLISDDKTFKVCDFGSVCGVIRPPKNAQEFSYVQNDILKNTT 206
            MH+    +IHRD+K+ N+    D   KV DFG +  V+    N +E  Y         T
Sbjct: 204 YMHS--RRVIHRDLKLGNIFFDKDYNLKVGDFG-LAAVL---ANNRERKYTVCG-----T 252

Query: 207 AQYRSPE-MIDLYRGHPINEKSDIWALGVFLYKLCYYTTPFEKVGDAAILHSR-----FQ 260
             Y +PE ++  + GH    + DIW++GV +Y L     PF+   D  +++ R     + 
Sbjct: 253 PNYIAPEVLMGKHAGHSF--EVDIWSIGVMIYALLVGKPPFQ-AKDVNVIYDRIKACQYG 309

Query: 261 FPAYPQYSDRLKNLISVMLSENPNQRPNICQVLEEV 296
           +P     S   K LI+ +L  +P +RP+I +++++V
Sbjct: 310 YPKDKYVSSEAKTLIADILCVDPVERPSIREIIDDV 345

>TBLA0A07460 Chr1 (1848207..1849757) [1551 bp, 516 aa] {ON} Anc_1.24
           YDR523C
          Length = 516

 Score = 87.4 bits (215), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 77/268 (28%), Positives = 124/268 (46%), Gaps = 32/268 (11%)

Query: 26  KYLTSGGFAHIYSA-EISPADPNSIGNVACLKRV-LVPDKQSLNVLRAEVDAMKLLRGNK 83
           K +  G F  +Y A EI        G +  +K V L    + + +L  E+  +  LR + 
Sbjct: 19  KCVGRGNFGDVYKAVEIKS------GKIVAIKVVNLEHTNEDIELLSQEIFFLAELR-SP 71

Query: 84  HVVSYIDSHAAKSGAQDGSYEVFLLMEYCSAGGLIDFMNTRLQNRLTENEVLKIMSDITQ 143
           +V  Y+ +       +D S  ++++MEYC  G   D +    +  L EN+   I  ++ +
Sbjct: 72  YVTKYLTTLL-----EDVS--IWIVMEYCGGGSCADLIKYAYKRGLPENKASFITKEVLK 124

Query: 144 GIAAMHALLPPLIHRDIKIENVLISDDKTFKVCDFGSVCGVIRPPKNAQEFSYVQNDILK 203
           G+  +H      IHRDIK  N+L++DD   K+ DFG V G I+       F         
Sbjct: 125 GLRYLHE--QKKIHRDIKAANILLTDDGMVKLGDFG-VSGQIKATLKKDTFV-------- 173

Query: 204 NTTAQYRSPEMIDLYRGHPINEKSDIWALGVFLYKLCYYTTPFEKVGDAAILHS---RFQ 260
             T  + +PE++        NEK+DIW+LG+ +Y+L     P  K     ++ S   R  
Sbjct: 174 -GTPYWMAPEVVKKDESG-YNEKADIWSLGITVYELLKGCPPLAKYDPMKVMISVPKRRA 231

Query: 261 FPAYPQYSDRLKNLISVMLSENPNQRPN 288
              +  YS+  K+ IS  L ++PN RPN
Sbjct: 232 PKLHGHYSEDAKSFISHCLIKDPNARPN 259

>KNAG0D04810 Chr4 (867817..872139) [4323 bp, 1440 aa] {ON} Anc_7.86
            YAL017W
          Length = 1440

 Score = 88.6 bits (218), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 61/183 (33%), Positives = 86/183 (46%), Gaps = 22/183 (12%)

Query: 116  GLIDFMN-TRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIENVLISDDKTFK 174
            G ID  +   L+N +TE EV  I   I  GI  +H     +IHRDIK ENV++      K
Sbjct: 1272 GCIDLFDLIELKNNMTEMEVKLIFKQIVSGIKHLHD--QAIIHRDIKDENVIVDATGFVK 1329

Query: 175  VCDFGSVCGVIRPPKNAQEFSYVQNDILKNTTAQYRSPEMI--DLYRGHPINEKSDIWAL 232
            + DFGS   V   P +     +V        T  Y +PE++  D Y G P     DIWA+
Sbjct: 1330 LIDFGSAAHVKSGPFDV----FV-------GTIDYAAPEVLSGDPYEGKP----QDIWAI 1374

Query: 233  GVFLYKLCYYTTPFEKVGDAAILHSRFQFPAYPQYSDRLKNLISVMLSENPNQRPNICQV 292
            G+ LY + +   PF  + +  IL     F      S   K LIS++L+ N  +RP I  +
Sbjct: 1375 GILLYTIVFKENPFYNIDE--ILEGELTFSESSDVSAECKALISMILNRNVQKRPTIDDI 1432

Query: 293  LEE 295
              +
Sbjct: 1433 YND 1435

>KLLA0C06138g Chr3 (540409..542535) [2127 bp, 708 aa] {ON} similar
           to uniprot|P32562 Saccharomyces cerevisiae YMR001C
          Length = 708

 Score = 87.8 bits (216), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 80/288 (27%), Positives = 129/288 (44%), Gaps = 37/288 (12%)

Query: 27  YLTSGGFAHIYSAEISPADPNSIGNVACLKRVLVPDKQSLNVLRAEVDAMKLLRGNKH-- 84
           +L  GGFA  +  +      +  G V   K V     +S    R  +  +++ +  KH  
Sbjct: 95  FLGEGGFARCFQMK------DDKGKVFAAKTVAKLSIKSEKTRRKLLSEIQIHKSMKHPN 148

Query: 85  VVSYIDSHAAKSGAQDGSYEVFLLMEYCSAGGLIDFMNTRLQNRLTENEVLKIMSDITQG 144
           +V + D     +        V++L+E C  G +++ +  R    LTE EV   M  I   
Sbjct: 149 IVQFTDCFEDDTN-------VYILLEICPNGSVMELLRQR--KHLTEPEVRFCMIQIIGA 199

Query: 145 IAAMHALLPPLIHRDIKIENVLISDDKTFKVCDFGSVCGVIRPPKNAQEFSYVQNDILKN 204
           I  MH+    +IHRD+K+ N+    +   K+ DFG +  V+    N +E  Y        
Sbjct: 200 IRYMHS--RRVIHRDLKLGNIFFDKEYNLKIGDFG-LAAVL---ANDKERKYTICG---- 249

Query: 205 TTAQYRSPEMI-DLYRGHPINEKSDIWALGVFLYKLCYYTTPFEKVGDAAILHSR----- 258
            T  Y +PE++   + GH  + + DIW++GV LY L +   PF+   +   ++ R     
Sbjct: 250 -TPNYIAPEVLTGKHTGH--SYEVDIWSIGVMLYALLFGKPPFQ-AKEVETIYERIKCRD 305

Query: 259 FQFPAYPQYSDRLKNLISVMLSENPNQRPNICQVLEEVSRIQNVPCPL 306
           F FPA    S   KNLIS +L  NP  RP++ ++ + V      P  L
Sbjct: 306 FIFPADKPVSSDAKNLISHLLQLNPAARPSLYEITDNVWFRNTFPSRL 353

>Kpol_1072.19 s1072 (44906..47596) [2691 bp, 896 aa] {ON}
           (44906..47596) [2691 nt, 897 aa]
          Length = 896

 Score = 87.8 bits (216), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 60/198 (30%), Positives = 105/198 (53%), Gaps = 29/198 (14%)

Query: 104 EVFLLMEYCSAGGLIDFMNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIE 163
           +V++++EYC    L D++ ++   R++ +E  +I + I   +   H+L    +HRD+K+E
Sbjct: 104 KVWMVIEYCPNKELYDYLLSK--KRISLDESARIFAQIVGAVYYAHSL--SCVHRDLKLE 159

Query: 164 NVLISDDKTFKVCDFGSVCGVIRPPKNAQEFSY-VQNDILKNTTAQYRSPEMI--DLYRG 220
           N+L+  D   K+ DFG            ++FS   Q + +  TT  Y +PE++  + Y G
Sbjct: 160 NILLDKDNNAKLTDFGFT----------RDFSKNTQLETICGTTV-YMAPELLRREKYDG 208

Query: 221 HPINEKSDIWALGVFLYKLCYYTTPFEKVGDAAILHSRFQFPAYPQYSDRLKN-----LI 275
           + I    DIWALG+ LY +   T PF++  D      +    A P Y ++  N     L+
Sbjct: 209 YKI----DIWALGILLYTIINGTMPFDE-DDPKKTELKI-ISASPDYDNKYFNDDSIDLV 262

Query: 276 SVMLSENPNQRPNICQVL 293
           + +LS++P+ RP I Q+L
Sbjct: 263 NRLLSKDPSMRPTIEQIL 280

>Ecym_3035 Chr3 complement(70391..72613) [2223 bp, 740 aa] {ON}
           similar to Ashbya gossypii ACL006W
          Length = 740

 Score = 87.4 bits (215), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 74/276 (26%), Positives = 128/276 (46%), Gaps = 33/276 (11%)

Query: 27  YLTSGGFAHIYSAEISPADPNSIGNVACLKRVLVPDKQSLNVLRAEVDAMKLLRGNKHVV 86
           +L  GGFA  +  +    D   I     + ++ +  +++   L +E+   K +R + ++V
Sbjct: 78  FLGEGGFARCFQMK---DDSGKIFAAKTVAKISIKSEKTRKKLLSEIQIHKSMR-HPNIV 133

Query: 87  SYIDSHAAKSGAQDGSYEVFLLMEYCSAGGLIDFMNTRLQNRLTENEVLKIMSDITQGIA 146
            + D     +        V++L+E C  G L+D +  R Q  LTE EV    + I   I 
Sbjct: 134 QFTDCFEDDTN-------VYILLEICPNGSLMDLLKQRKQ--LTEPEVRFFTTQIVGAIK 184

Query: 147 AMHALLPPLIHRDIKIENVLISDDKTFKVCDFGSVCGVIRPPKNAQEFSYVQNDILKNTT 206
            MH+    +IHRD+K+ N+        K+ DFG +  V+    N +E  Y         T
Sbjct: 185 YMHS--RRIIHRDLKLGNIFFDKHFNLKIGDFG-LAAVL---ANDRERKYTICG-----T 233

Query: 207 AQYRSPEMI-DLYRGHPINEKSDIWALGVFLYKLCYYTTPFEKVGDAAILHSR-----FQ 260
             Y +PE++   + GH    + D+W++GV +Y L     PF+   +   ++ R     F 
Sbjct: 234 PNYIAPEVLTGKHTGHSF--EVDVWSIGVMIYALLIGKPPFQ-AKEVNTIYERIKVCDFN 290

Query: 261 FPAYPQYSDRLKNLISVMLSENPNQRPNICQVLEEV 296
           FP     S   K LI  +LS +P +RP++ +++E V
Sbjct: 291 FPRDKPISSEAKVLIKDILSLDPLERPSLTEIMEYV 326

>SAKL0C00946g Chr3 (84995..86689) [1695 bp, 564 aa] {ON} similar to
           uniprot|Q751V1 Ashbya gossypii AFR724C AFR724Cp and some
           similarites with YDR523C uniprot|P08458 Saccharomyces
           cerevisiae YDR523C SPS1 dispensable for mitosis involved
           in middle/late stage of meiosis required for spore wall
           formation serine/threonine kinase homologous to Ste20p
           expressed in middle/late meiosis
          Length = 564

 Score = 87.0 bits (214), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 72/268 (26%), Positives = 126/268 (47%), Gaps = 30/268 (11%)

Query: 31  GGFAHIYSAEISPADPNSIGNVACLKRV-LVPDKQSLNVLRAEVDAMKLLRGNKHVVSYI 89
           G F  +Y A        S GN   +K V L      +++L  E+  +  L  + ++ +Y 
Sbjct: 43  GNFGDVYKA-----IDKSTGNTVAIKVVNLEETDDEIDLLAQEIYFLAELH-SPYITNYF 96

Query: 90  DSHAAKSGAQDGSYEVFLLMEYCSAGGLIDFMNTRLQNRLTENEVLKIMSDITQGIAAMH 149
            +       +D S  ++++MEYC  G   D +    +  LTE +V  I  +I +G+  +H
Sbjct: 97  STFV-----EDVS--MWIVMEYCGGGSCSDLLKCLPRGTLTEEKVAFITREILRGLEYLH 149

Query: 150 ALLPPLIHRDIKIENVLISDDKTFKVCDFGSVCGVIRPPKNAQEFSYVQNDILKNTTAQY 209
           +     IHRDIK  N+L++DD   K+ DFG V G +   +    F           T  +
Sbjct: 150 SQRK--IHRDIKAANILLTDDGKVKLGDFG-VSGQMMATRRRDTFV---------GTPFW 197

Query: 210 RSPEMIDLYRGHPINEKSDIWALGVFLYKLCYYTTPFEKVGDAAILH---SRFQFPAYPQ 266
            +PE+I        NEK+DIW+LG+ +++L     P  +     +L    SR       +
Sbjct: 198 MAPEVIARSE-QGYNEKADIWSLGITVFELLKGQPPLSQHDPMKVLMSIPSRRPPKLEDR 256

Query: 267 YSDRLKNLISVMLSENPNQRPNICQVLE 294
           YS  ++  +S+ L+++P +RP   ++L+
Sbjct: 257 YSHAIREFVSLCLNKDPAKRPTASELLK 284

>Skud_1.72 Chr1 (141337..144261) [2925 bp, 974 aa] {ON} YAR019C
           (REAL)
          Length = 974

 Score = 87.4 bits (215), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 78/288 (27%), Positives = 137/288 (47%), Gaps = 35/288 (12%)

Query: 19  SHQARIIKYLTSGGFAHIYSAEISPADPNSIGNVACLKRVLVPDKQSLNVLRAEVDAMKL 78
           S Q  + + +  G +  +Y A     D      V  +K ++    + LN + AE+  +K 
Sbjct: 22  SVQYHLKQVIGRGSYGVVYKAINKHTD-----QVVAIKEIVYESDEELNDIMAEISLLKN 76

Query: 79  LRGNKHVVSYIDSHAAKSGAQDGSYEVFLLMEYCSAGGLIDFMNTRLQNRLTENEVLKIM 138
           L  + ++V Y        G    SYE+++L+EYC+ G L   + +R    L+ENE    +
Sbjct: 77  L-NHDNIVKY-------HGFIRKSYELYILLEYCANGSLRRLI-SRSSTGLSENESKSYV 127

Query: 139 SDITQGIAAMHALLPPLIHRDIKIENVLISDDKTFKVCDFGSVCGVIRPPKNAQEFSYVQ 198
           +    G+  +H     +IHRDIK  N+L+S D T K+ DFG V  ++    N+   +   
Sbjct: 128 TQTLLGLKYLHG--EGVIHRDIKAANILLSADNTVKLADFG-VSTIV----NSSALTLAG 180

Query: 199 NDILKNTTAQYRSPEMIDLYRGHPINEKSDIWALGVFLYKLCYYTTPFEKVGDAAILHSR 258
                  T  + +PE++   RG   +  SDIW+LG  + ++     P+  + DA I ++ 
Sbjct: 181 -------TLNWMAPEILG-NRG--ASTLSDIWSLGATVVEMLTKNPPYHNLTDANIYYAV 230

Query: 259 FQFPAYP--QYSDRLKNLISVMLSENPNQRPNICQVLEE--VSRIQNV 302
                YP   +S+ LK+ +S    +N  +RP   Q+L+   ++  +NV
Sbjct: 231 ENDTYYPPSSFSESLKDFLSKCFVKNMYKRPTADQLLKHAWITSTENV 278

>KLTH0F16676g Chr6 complement(1351362..1353998) [2637 bp, 878 aa]
           {ON} weakly similar to uniprot|P38692 Saccharomyces
           cerevisiae YHR102W KIC1 Protein kinase of the PAK/Ste20
           kinase family required for cell integrity possibly
           through regulating 1 6-beta-glucan levels in the wall
           physically interacts with Cdc31p (centrin) which is a
           component of the spindle pole body
          Length = 878

 Score = 87.0 bits (214), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 74/253 (29%), Positives = 121/253 (47%), Gaps = 35/253 (13%)

Query: 51  NVACLKRVLVPDKQSLNV--LRAEVDAMKLLRGNKHVVSYIDSHAAKSGAQDGSYEVFLL 108
           N  C  +VL  D     V  ++ EV  +  L+   ++  Y  S+   +       E++++
Sbjct: 42  NRVCAIKVLNLDSADDEVEDVQKEVQFLSSLKQVPNITHYYGSYLNNT-------ELWVI 94

Query: 109 MEYCSAGGLIDFMNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIENVLIS 168
           MEYC+ G L   +      ++ E  +  IM ++   IA MH     +IHRDIK  NVLI+
Sbjct: 95  MEYCAGGSLRTLLRP---GKIGEQYIGVIMRELL--IALMHIHKDGVIHRDIKAANVLIT 149

Query: 169 DDKTFKVCDFGSVCGVIRPPKNAQEFSYVQNDILKNTTAQ---YRSPEMIDLYRGHPINE 225
           +D   K+CDFG           A + S  Q  I + T A    + +PE+I    G   + 
Sbjct: 150 NDGHIKLCDFGV----------AAQLS--QTKIRRQTMAGTPYWMAPEVI--MEGVYYDT 195

Query: 226 KSDIWALGVFLYKLCYYTTPFEKVGD--AAILHSRFQFPAYP--QYSDRLKNLISVMLSE 281
           K DIW+LG+  Y++     P+  V    A  L ++ + P     Q+S  LK  I++ L E
Sbjct: 196 KVDIWSLGITAYEIATGNPPYCDVEALRAMQLITKSKPPRLEGRQHSSALKEFIALCLDE 255

Query: 282 NPNQRPNICQVLE 294
           +P +RP+  ++L+
Sbjct: 256 DPKERPSAEELLK 268

>Kpol_431.9 s431 complement(22310..26968) [4659 bp, 1552 aa] {ON}
           complement(22310..26968) [4659 nt, 1553 aa]
          Length = 1552

 Score = 87.4 bits (215), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 61/203 (30%), Positives = 100/203 (49%), Gaps = 31/203 (15%)

Query: 100 DGSYEVFLLMEYCSAGGLIDFMNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRD 159
           + + E++L++EY   G L D++ ++   +LTE+E +     I  GI+  H+    + HRD
Sbjct: 205 ENNNELYLVLEYVDGGELFDYLVSK--GKLTESEAVHYFKQIINGISYCHSF--NICHRD 260

Query: 160 IKIENVLISDDK-TFKVCDFGSVCGVIRPPKNAQEFSYVQNDILKNTTA--QYRSPEMI- 215
           +K EN+L+   +   K+ DFG                 V N +L+ +     Y SPE++ 
Sbjct: 261 LKPENLLLDKKRRIIKIADFGMAAL------------QVSNRLLQTSCGSPHYASPEIVM 308

Query: 216 -DLYRGHPINEKSDIWALGVFLYKLCYYTTPFEKVGDAAIL----HSRFQFPAYPQYSDR 270
              Y G P    SDIW+ G+ L+ L     PF       +L    + R+Q P+Y   S  
Sbjct: 309 GKCYNGAP----SDIWSCGIILFALLTGHLPFNDDNIKKLLIKVQNGRYQMPSY--ISQE 362

Query: 271 LKNLISVMLSENPNQRPNICQVL 293
            KNLIS +L  +P++R +  Q+L
Sbjct: 363 AKNLISRILVVDPSKRISTEQIL 385

>KAFR0G01200 Chr7 (273238..274761) [1524 bp, 507 aa] {ON} Anc_1.24
           YDR523C
          Length = 507

 Score = 85.5 bits (210), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 63/234 (26%), Positives = 115/234 (49%), Gaps = 23/234 (9%)

Query: 64  QSLNVLRAEVDAMKLLRGNKHVVSYIDSHAAKSGAQDGSYEVFLLMEYCSAGGLIDFMNT 123
           + +++L  E+  +  L+ + ++++YI +       +D S  ++++M+YC  G   D +  
Sbjct: 54  EDIDLLAQEIFFLAELKSD-YIINYITTIM-----EDVS--MWIVMDYCGGGSCSDLIKI 105

Query: 124 RLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIENVLISDDKTFKVCDFGSVCG 183
              N + E +V  I+ ++  G+  +H      IHRDIK  N+L++DD   K+ DFG V G
Sbjct: 106 VYPNGIVEEKVSFIVKNVLLGLQYLHE--QKKIHRDIKAANILLTDDGQVKLGDFG-VSG 162

Query: 184 VIRPPKNAQEFSYVQNDILKNTTAQYRSPEMIDLYRGHPINEKSDIWALGVFLYKLCYYT 243
            I+       F           T  + +PE+I+    +  +EK DIW+LG+  Y+L    
Sbjct: 163 QIKATLKRDTFV---------GTPYWMAPEVINKEINNGYDEKVDIWSLGITTYELLKGV 213

Query: 244 TPFEKVGDAAILHSRFQF---PAYPQYSDRLKNLISVMLSENPNQRPNICQVLE 294
            P  K     ++ S  +      +  Y+D  K+ IS  L ++P  RPN+  +L+
Sbjct: 214 PPLSKYDPVKVMTSLVKRKPPKLHGPYNDFTKSFISFCLIKDPKLRPNVQNLLK 267

>KLTH0F00946g Chr6 (73412..74950) [1539 bp, 512 aa] {ON} similar to
           uniprot|P08458 Saccharomyces cerevisiae YDR523C SPS1
           dispensable for mitosis involved in middle/late stage of
           meiosis required for spore wall formation
           serine/threonine kinase homologous to Ste20p expressed
           in middle/late meiosis
          Length = 512

 Score = 85.5 bits (210), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 69/248 (27%), Positives = 125/248 (50%), Gaps = 25/248 (10%)

Query: 50  GNVACLKRVLVPDKQS-LNVLRAEVDAMKLLRGNKHVVSYIDSHAAKSGAQDGSYEVFLL 108
           G V  +K + + + Q  ++VL  E+  +  LR    V +Y      K+  +D S  ++++
Sbjct: 62  GEVVAIKIINLEETQDDIDVLAQEIYFLSELRA-PFVTTYF-----KTFVEDVS--MWIV 113

Query: 109 MEYCSAGGLIDFMNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIENVLIS 168
           ME+C  G   D +    ++RL+EN+V  I+ ++  G+  +H+     IHRDIK  N+L++
Sbjct: 114 MEFCGGGSCADLLKHLPEHRLSENKVAYIIREVLFGLDYLHS--QKKIHRDIKAANILLT 171

Query: 169 DDKTFKVCDFGSVCGVIRPPKNAQEFSYVQNDILKNTTAQYRSPEMIDLYRGHPINEKSD 228
           DD   K+ DFG V G I        F           T  + +PE+I   + +  NEK+D
Sbjct: 172 DDGEVKLGDFG-VSGQIMATLKRTTFV---------GTPYWMAPEII-AKKDNGYNEKAD 220

Query: 229 IWALGVFLYKLCYYTTPFEKVGDAAIL-HSRFQFPAYPQ--YSDRLKNLISVMLSENPNQ 285
           IW+LG+   +L     P+ K     +L +   + P   Q  ++   ++ I++ L ++P+ 
Sbjct: 221 IWSLGITAIELLTGQPPYAKHDPMKVLVNIPLRKPPKLQGRFTGSARDFIALCLIKDPDL 280

Query: 286 RPNICQVL 293
           RP+  ++L
Sbjct: 281 RPSAAELL 288

>ZYRO0D05500g Chr4 (473262..477050) [3789 bp, 1262 aa] {ON} weakly
            similar to uniprot|P31374 Saccharomyces cerevisiae
            YAL017W PSK1 One of two (see also PSK2) PAS domain
            containing S/T protein kinases coordinately regulates
            protein synthesis and carbohydrate metabolism and storage
            in response to a unknown metabolite that reflects
            nutritional status
          Length = 1262

 Score = 86.7 bits (213), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 58/179 (32%), Positives = 88/179 (49%), Gaps = 20/179 (11%)

Query: 116  GLIDFMN-TRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIENVLISDDKTFK 174
            G ID  +   L+  +TE E   I   +   I  +H+    ++HRDIK ENV++      K
Sbjct: 1094 GCIDLFDLIELKTNMTEYEAKLIFRQVVSAIRHLHS--QGIVHRDIKDENVVVDSKGFVK 1151

Query: 175  VCDFGSVCGVIRPPKNAQEFSYVQNDILKNTTAQYRSPEMIDLYRGHPINEK-SDIWALG 233
            + DFGS   V   P +     +V        T  Y +PE++    G P + K  DIWA+G
Sbjct: 1152 LIDFGSAAYVKSGPFDV----FV-------GTIDYAAPEVL---SGEPFDGKPQDIWAIG 1197

Query: 234  VFLYKLCYYTTPFEKVGDAAILHSRFQFPAYPQYSDRLKNLISVMLSENPNQRPNICQV 292
            V LY + +   PF  + +  IL    +F      S+   NLI ++L++NP+QRP I +V
Sbjct: 1198 VLLYTIVFKENPFYNIDE--ILEVNLKFHGTKGVSEECINLIKMILNKNPSQRPTIDEV 1254

>ACL006W Chr3 (344395..346521) [2127 bp, 708 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR001C (CDC5)
          Length = 708

 Score = 85.9 bits (211), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 73/276 (26%), Positives = 128/276 (46%), Gaps = 33/276 (11%)

Query: 27  YLTSGGFAHIYSAEISPADPNSIGNVACLKRVLVPDKQSLNVLRAEVDAMKLLRGNKHVV 86
           +L  GGFA  +  +    D   +     + ++ +  +++   L +E+   K ++ + ++V
Sbjct: 78  FLGEGGFARCFQMK---DDSGKVFAAKTVAKISIKSEKTRKKLLSEIQIHKSMK-HPNIV 133

Query: 87  SYIDSHAAKSGAQDGSYEVFLLMEYCSAGGLIDFMNTRLQNRLTENEVLKIMSDITQGIA 146
            + D     +        V++L+E C  G L+D +  R Q  LTE EV    + I   I 
Sbjct: 134 QFTDCFEDDTN-------VYILLEICPNGSLMDLLKQRKQ--LTEPEVRFFTTQIVGAIK 184

Query: 147 AMHALLPPLIHRDIKIENVLISDDKTFKVCDFGSVCGVIRPPKNAQEFSYVQNDILKNTT 206
            MH+    +IHRD+K+ N+        K+ DFG +  V+    N +E  Y         T
Sbjct: 185 YMHS--RRIIHRDLKLGNIFFDKHFNLKIGDFG-LAAVL---ANDRERKYTICG-----T 233

Query: 207 AQYRSPEMI-DLYRGHPINEKSDIWALGVFLYKLCYYTTPFEKVGDAAILHSR-----FQ 260
             Y +PE++   + GH    + DIW++GV +Y L     PF+   +   ++ R     F 
Sbjct: 234 PNYIAPEVLTGKHTGHSF--EVDIWSIGVMIYALLIGKPPFQ-AKEVNTIYERIKVCDFS 290

Query: 261 FPAYPQYSDRLKNLISVMLSENPNQRPNICQVLEEV 296
           FP     S   K LI  +LS +P +RP++ +++E V
Sbjct: 291 FPKDKPISSEAKVLIKDILSLDPLERPSLAEIMEYV 326

>TPHA0G03200 Chr7 (683296..687900) [4605 bp, 1534 aa] {ON} Anc_2.479
           YKL101W
          Length = 1534

 Score = 86.7 bits (213), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 62/200 (31%), Positives = 95/200 (47%), Gaps = 31/200 (15%)

Query: 104 EVFLLMEYCSAGGLIDFMNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIE 163
           E++L++EY   G L D++ ++   +LTE E ++    I +G+   H+    + HRD+K E
Sbjct: 234 ELYLVLEYVDGGELFDYLVSK--GKLTELEAVRYFKQIIRGVQYCHSF--NICHRDLKPE 289

Query: 164 NVLISDD-KTFKVCDFGSVCGVIRPPKNAQEFSYVQNDILKNTTA--QYRSPEMI--DLY 218
           N+L+    K  K+ DFG                 V N +LK +     Y SPE++    Y
Sbjct: 290 NLLLDKKRKLIKIADFGMAA------------LQVSNTLLKTSCGSPHYASPEIVMGKTY 337

Query: 219 RGHPINEKSDIWALGVFLYKLCYYTTPFEKVGDAAIL----HSRFQFPAYPQYSDRLKNL 274
            G P    SD+W+ G+ L+ L     PF       +L    + R+Q P Y   S   K+L
Sbjct: 338 NGGP----SDVWSCGIILFALLTGHLPFNDDSIKKLLIKVQNGRYQMPNY--LSKDAKDL 391

Query: 275 ISVMLSENPNQRPNICQVLE 294
           IS +L  NP  R    Q+LE
Sbjct: 392 ISRILLVNPKARLTTEQILE 411

>Kwal_26.8751 s26 complement(928853..931399) [2547 bp, 848 aa] {ON}
           YPL150W - Hypothetical ORF [contig 67] FULL
          Length = 848

 Score = 85.9 bits (211), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 58/207 (28%), Positives = 97/207 (46%), Gaps = 47/207 (22%)

Query: 105 VFLLMEYCSAGGLIDFMNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIEN 164
           V++ +EYC    L +++  +    L   E  ++ S I   +   H++    +HRD+K+EN
Sbjct: 103 VWMALEYCPGKELYEYLLAKKHIPL--EECSELFSQIVGAVYYAHSM--KCVHRDLKLEN 158

Query: 165 VLISDDKTFKVCDFG------------SVCGVIRPPKNAQEFSYVQNDILKNTTAQYRSP 212
           +L+      K+ DFG            ++CG                      T  Y +P
Sbjct: 159 ILLDKKGHAKLTDFGFTRECATKGILETICG----------------------TTVYMAP 196

Query: 213 EMIDL--YRGHPINEKSDIWALGVFLYKLCYYTTPFEKVGDAAILHSRFQF-PAYPQ-YS 268
           E+I+   Y G+ I    D W+LG+ LY + + T PF++V +    +    + P Y   Y 
Sbjct: 197 ELIERKPYEGYKI----DTWSLGIILYTMIHGTMPFDEVDEVKTKYKIVHYNPTYDNDYI 252

Query: 269 D-RLKNLISVMLSENPNQRPNICQVLE 294
           D   K LIS +L ++PNQRP++ QVL+
Sbjct: 253 DSNGKELISQLLEKDPNQRPSLTQVLQ 279

>Kwal_26.7355 s26 (326867..331207) [4341 bp, 1446 aa] {ON} YJL095W
            (BCK1) - MEKK serine/threonine kinase [contig 48] FULL
          Length = 1446

 Score = 85.9 bits (211), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 66/262 (25%), Positives = 127/262 (48%), Gaps = 38/262 (14%)

Query: 48   SIGNVACLKRVLVP-----DKQSLNVL---RAEVDAMKLLRGNKHVVSYIDSHAAKSGAQ 99
            + G +  +K+V VP     D+ +L+VL   R+EV  +K L  + ++V Y+       G +
Sbjct: 1167 TTGEMIAVKQVEVPRYGSQDETTLSVLEALRSEVATLKDL-DHTNIVQYL-------GFE 1218

Query: 100  DGSYEVFLLMEYCSAGGLIDFMNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRD 159
            + +Y   L +EY + G +   +  RL  +  EN +  +   + +G++ +H+    ++HRD
Sbjct: 1219 NKNYVYSLFLEYVAGGSVGSLI--RLYGKFDENLIRFLAVQVLRGLSYLHS--KKILHRD 1274

Query: 160  IKIENVLISDDKTFKVCDFGSVCGVIRPPKNAQEFSYVQNDILKNTTAQYRSPEMIDLYR 219
            +K +N+L+  D   K+ DF    G+ +   N     Y  +D+    T  + +PEM+D  +
Sbjct: 1275 MKADNLLLDVDGICKISDF----GISKKSNNI----YSNSDMTMRGTVFWMAPEMVDTKQ 1326

Query: 220  GHPINEKSDIWALGVFLYKLCYYTTPFEKVGDAAILHSRFQFPAYPQYSDRLKNLISVML 279
            G+  + K DIW+LG  + ++     P+  +   A +    +F + P   +  + +IS   
Sbjct: 1327 GY--SAKVDIWSLGCVVLEMFAGKRPWSNLEVVAAMFKIGKFKSAPPIPEDTQKIISAEG 1384

Query: 280  SE--------NPNQRPNICQVL 293
             E        NP +RP   ++L
Sbjct: 1385 KEFLDACFEINPEKRPTADELL 1406

>CAGL0M02299g Chr13 (273725..276406) [2682 bp, 893 aa] {ON} similar
           to uniprot|Q12152 Saccharomyces cerevisiae YPL150w
          Length = 893

 Score = 85.5 bits (210), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 61/214 (28%), Positives = 93/214 (43%), Gaps = 61/214 (28%)

Query: 104 EVFLLMEYCSAGGLIDFMNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIE 163
           +V++ +EYC    L D + ++  +RL   E  ++ + IT  +   H L    +HRD+K+E
Sbjct: 107 KVWMALEYCPGKELYDHLLSK--SRLPTLECAELFAQITGAVHYAHTL--NCVHRDLKLE 162

Query: 164 NVLISDDKTFKVCDFG------------SVCGVIRPPKNAQEFSYVQNDILKNTTAQYRS 211
           NVL+  +   K+ DFG            +VCG                      T  Y +
Sbjct: 163 NVLLDKNGNAKLTDFGFTRESMTKAVLETVCG----------------------TTVYMA 200

Query: 212 PEMIDL--YRGHPINEKSDIWALGVFLYKLCYYTTPFEK----------VGDAAILHSRF 259
           PEMI    Y G     K DIW+LGV LY L     PF++          + D  ++  R 
Sbjct: 201 PEMIQHKPYDGF----KVDIWSLGVILYTLLCGCLPFDEDDDLLTKQKIINDTPVIDERI 256

Query: 260 QFPAYPQYSDRLKNLISVMLSENPNQRPNICQVL 293
             P         +NLI  +LS++P +RPN   +L
Sbjct: 257 TIP-------EAQNLIEQLLSKDPTERPNTSAIL 283

>SAKL0H16632g Chr8 complement(1461613..1464801) [3189 bp, 1062 aa]
           {ON} similar to uniprot|P13186 Saccharomyces cerevisiae
           YLR096W KIN2 Serine/threonine protein kinase involved in
           regulation of exocytosis localizes to the cytoplasmic
           face of the plasma membrane closely related to Kin1p and
           to YDR122W uniprot|P13185 Saccharomyces cerevisiae
           YDR122W KIN1 Serine/threonine protein kinase involved in
           regulation of exocytosis; localizes to the cytoplasmic
           face of the plasma membrane; closely related to Kin2p
          Length = 1062

 Score = 85.5 bits (210), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 61/210 (29%), Positives = 104/210 (49%), Gaps = 24/210 (11%)

Query: 102 SYEVFLLMEYCSAGGLIDFMNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIK 161
           S   ++L EY S G L+D++       L E    K    I   +  +H  +  ++HRD+K
Sbjct: 175 SNHFYMLFEYVSGGQLLDYIIQ--HGSLRERHARKFARGIASALQYLH--MNNIVHRDLK 230

Query: 162 IENVLISDDKTFKVCDFGSVCGVIRPPKNAQEFSYVQNDILKNTTAQYRSPEMIDLYRGH 221
           IEN++IS     K+ DFG +  +  P K    F           +  + +PE++   + H
Sbjct: 231 IENIMISTSGEIKIIDFG-LSNMYDPKKQLHTFC---------GSLYFAAPELL---KAH 277

Query: 222 P-INEKSDIWALGVFLYKLCYYTTPFEKVGDAAILHSRFQFP--AYPQY-SDRLKNLISV 277
           P I  + D+W+ GV LY L     PF+   +A++LH + +     YPQ+ S  + +L+S 
Sbjct: 278 PYIGPEVDVWSFGVVLYVLVCGKVPFDD-ENASVLHEKIKQGKVEYPQHLSIEVISLLSK 336

Query: 278 MLSENPNQRPNICQVL--EEVSRIQNVPCP 305
           ML  +P++R  + QV+  + + R  + P P
Sbjct: 337 MLVVDPSKRATLKQVVSHQWMQRGYDFPAP 366

>KAFR0G02690 Chr7 complement(555573..557714) [2142 bp, 713 aa] {ON}
           Anc_6.31 YMR001C
          Length = 713

 Score = 85.1 bits (209), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 72/276 (26%), Positives = 126/276 (45%), Gaps = 33/276 (11%)

Query: 27  YLTSGGFAHIYSAEISPADPNSIGNVACLKRVLVPDKQSLNVLRAEVDAMKLLRGNKHVV 86
           +L  GGFA  +       D   I     + ++ +  +++   L +E+   K ++ + ++V
Sbjct: 100 FLGEGGFARCFQIR---DDSGKIFAAKTVAKISIKSEKTRKKLLSEIQIHKSMK-HVNIV 155

Query: 87  SYIDSHAAKSGAQDGSYEVFLLMEYCSAGGLIDFMNTRLQNRLTENEVLKIMSDITQGIA 146
            +ID     +        V++L+E C  G L+D +  R    LTE EV    + I   I 
Sbjct: 156 QFIDCFEDDTN-------VYILLEICPNGSLMDLLKKR--KSLTEPEVRFFTTQICGAIK 206

Query: 147 AMHALLPPLIHRDIKIENVLISDDKTFKVCDFGSVCGVIRPPKNAQEFSYVQNDILKNTT 206
            MH+    +IHRD+K+ N+        K+ DFG    +     N +E  Y         T
Sbjct: 207 YMHS--RKVIHRDLKLGNIFFDRKYNLKIGDFGLAATL----ANDRERKYTVCG-----T 255

Query: 207 AQYRSPE-MIDLYRGHPINEKSDIWALGVFLYKLCYYTTPFEKVGDAAILHSR-----FQ 260
             Y +PE ++  + GH  + + DIW++GV +Y L     PF+   D   ++ R     F 
Sbjct: 256 PNYIAPEVLMGKHSGH--SYEVDIWSIGVMIYALIIGRPPFQS-KDVNTIYERIKCRDFS 312

Query: 261 FPAYPQYSDRLKNLISVMLSENPNQRPNICQVLEEV 296
           FP     S   K LI  +LS +P +RP++ ++++ +
Sbjct: 313 FPKDKLISSEAKILIQDILSLDPLERPSVNEIMDYI 348

>ZYRO0C07480g Chr3 (565426..567750) [2325 bp, 774 aa] {ON} highly
           similar to uniprot|P32562 Saccharomyces cerevisiae
           YMR001C
          Length = 774

 Score = 84.7 bits (208), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 69/276 (25%), Positives = 129/276 (46%), Gaps = 33/276 (11%)

Query: 27  YLTSGGFAHIYSAEISPADPNSIGNVACLKRVLVPDKQSLNVLRAEVDAMKLLRGNKHVV 86
           +L  GGFA  +       D   +     + ++ +  +++   L +E+   K ++ ++++V
Sbjct: 150 FLGEGGFARCFQIR---DDSGKLFAAKTVAKLSIKTEKTRKKLLSEIQIHKSMK-HQNIV 205

Query: 87  SYIDSHAAKSGAQDGSYEVFLLMEYCSAGGLIDFMNTRLQNRLTENEVLKIMSDITQGIA 146
            +ID     +        V++L+E C  G L++ +  R Q  LTE EV    + I   I 
Sbjct: 206 QFIDCFEDDTN-------VYILLEICPNGSLMELLKKRKQ--LTEPEVRFFTTQICGAIK 256

Query: 147 AMHALLPPLIHRDIKIENVLISDDKTFKVCDFGSVCGVIRPPKNAQEFSYVQNDILKNTT 206
            MH+    +IHRD+K+ N+    +   K+ DFG     +      ++F+          T
Sbjct: 257 YMHS--RRVIHRDLKLGNIFFDRNYNLKIGDFG--LAAVLANDRERKFTVC-------GT 305

Query: 207 AQYRSPE-MIDLYRGHPINEKSDIWALGVFLYKLCYYTTPFEKVGDAAILHSR-----FQ 260
             Y +PE ++  + GH  + + D+W++GV +Y L     PF+   D   ++ R     F 
Sbjct: 306 PNYIAPEVLMGKHSGH--SYEVDVWSIGVMVYALLVGKPPFQ-AKDVNTIYERIKCCDFI 362

Query: 261 FPAYPQYSDRLKNLISVMLSENPNQRPNICQVLEEV 296
           FP     S   K L+  +LS +P +RP+I ++++ V
Sbjct: 363 FPKEKPISHEAKVLVQDLLSLDPLERPSISEIMDYV 398

>Kwal_33.13112 s33 (76807..78324) [1518 bp, 505 aa] {ON} YDR523C
           (SPS1) - serine/threonine kinase homologous to Ste20p;
           expressed in middle/late meiosis [contig 123] FULL
          Length = 505

 Score = 84.0 bits (206), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 75/289 (25%), Positives = 136/289 (47%), Gaps = 39/289 (13%)

Query: 13  TALTVGSHQARIIKYLTSGGFAHIYSAEISPADPNSIGNVACLKRVLVPDKQS-LNVLRA 71
           TA+   S    I + +  G F  +Y A     D  + G +  +K + + + Q  ++VL  
Sbjct: 27  TAVEKPSQLYDIKECVGKGSFGDVYRA----IDKET-GEMVAVKIINLEETQDDIDVLAQ 81

Query: 72  EVDAMKLLRGNKHVVSYIDSHAAKSGAQDGSYEVFLLMEYCSAGGLIDFMNTRLQNRLTE 131
           E+  +  LR    V +Y      K+  +D S  ++++ME+C  G   D +    ++RL E
Sbjct: 82  EIYFLSELRA-PFVTTYY-----KTYVEDVS--MWIVMEFCGGGSCADLLKHLPEHRLPE 133

Query: 132 NEVLKIMSDITQGIAAMHALLPPLIHRDIKIENVLISDDKTFKVCDFGSVCGVIRPPKNA 191
           N+V  I+ ++  G+  +H+     IHRD+K  N+L++D+   K+ DFG V G I      
Sbjct: 134 NKVAYIIREVLYGLEYLHSQRK--IHRDVKAANILLTDEGEVKLGDFG-VSGQIMATLKR 190

Query: 192 QEFSYVQNDILKNTTAQYRSPEMIDLYRGHPINEKSDIWALGVFLYKLCYYTTPFEKVGD 251
             F           T  + +PE+I    G+  +EK+DIW+LG+   +L     P+ K   
Sbjct: 191 NTFV---------GTPYWMAPEIIARDNGY--DEKADIWSLGITAMELLTGQPPYAKYDP 239

Query: 252 AAILHS-------RFQFPAYPQYSDRLKNLISVMLSENPNQRPNICQVL 293
             +L +       R Q     +++   ++ I++ L+++P  RP    +L
Sbjct: 240 MKVLMNIPLRKPPRLQ----GRFTSSARDFIALCLTKDPALRPTASDLL 284

>NCAS0A00280 Chr1 (40406..42013) [1608 bp, 535 aa] {ON} Anc_1.24
          Length = 535

 Score = 84.0 bits (206), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 77/284 (27%), Positives = 136/284 (47%), Gaps = 38/284 (13%)

Query: 19  SHQARIIKYLTSGGFAHIYSAEISPADPNSIGNVACLKRV-LVPDKQSLNVLRAEVDAMK 77
           +H   + + +  G F  +Y A        +   V  +K V L    + L VL  E+  + 
Sbjct: 19  AHNYIVKECVGRGNFGDVYRA-----IDRTTNKVVAIKVVDLENTNERLEVLAQEIFFLA 73

Query: 78  LLRGNKHVVSYIDSHAAKSGAQDGSYEVFLLMEYCSAGGLIDFMNTRLQNRLTENEVLKI 137
            L+ + ++++YI +       +D S  ++++MEYC  G   D +     N L E +V  I
Sbjct: 74  ELK-SPYIINYITTLL-----EDAS--MWIVMEYCGGGSCSDLLKYYFNNGLPEKKVAYI 125

Query: 138 MSDITQGIAAMHALLPPLIHRDIKIENVLISDDKTFKVCDFGSVCGVIRPPKNAQEFSYV 197
             +I +G+  +H      IHRDIK  N+L++++   K+ DFG V G ++        S +
Sbjct: 126 TREILKGLQYLHE--QKKIHRDIKAANILLTEEGHVKLGDFG-VSGQLK--------STL 174

Query: 198 QNDILKNTTAQYRSPEM----IDLYRGHPINEKSDIWALGVFLYKLCYYTTPFEKVGDAA 253
           +   +   T  + +PE+    I+ Y     +EK DIW+LG+ +++L     P  K+    
Sbjct: 175 RRGTIVG-TPYWMAPEVASQNIEGY-----DEKIDIWSLGITVFELLKGVPPLVKLDPIR 228

Query: 254 ILH--SRFQFPAYP-QYSDRLKNLISVMLSENPNQRPNICQVLE 294
           +L   SR   P     YSD  K+ +++ L +NPN+RP    +L+
Sbjct: 229 VLANLSRKSAPRLQGAYSDAAKSFVALCLIKNPNERPAAVDLLK 272

>ZYRO0F18062g Chr6 complement(1494752..1496167) [1416 bp, 471 aa]
           {ON} similar to uniprot|P08458 Saccharomyces cerevisiae
           YDR523C SPS1 dispensable for mitosis involved in
           middle/late stage of meiosis required for spore wall
           formation serine/threonine kinase homologous to Ste20p
           expressed in middle/late meiosis
          Length = 471

 Score = 83.6 bits (205), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 76/268 (28%), Positives = 128/268 (47%), Gaps = 30/268 (11%)

Query: 31  GGFAHIYSAEISPADPNSIGNVACLKRV-LVPDKQSLNVLRAEVDAMKLLRGNKHVVSYI 89
           G F  +Y A     D    G V  +K V L   ++ +++L  E+  +  LR +  + +YI
Sbjct: 24  GNFGDVYKA----CDKVE-GKVVAVKVVNLEHSEEDIDLLAQEIFFLAELR-SPFITNYI 77

Query: 90  DSHAAKSGAQDGSYEVFLLMEYCSAGGLIDFMNTRLQNRLTENEVLKIMSDITQGIAAMH 149
                 +  +D S  ++++MEYC  G   D +     N + E +V  I S + +G+  +H
Sbjct: 78  -----TTLTEDVS--MWIVMEYCGGGSCADLIKHIYINGMPEKKVAFITSQVLRGLVYLH 130

Query: 150 ALLPPLIHRDIKIENVLISDDKTFKVCDFGSVCGVIRPPKNAQEFSYVQNDILKNTTAQY 209
                 IHRDIK  N+L++D+ T K+ DFG V G IR       F           T  +
Sbjct: 131 E--QKKIHRDIKAANILLTDEGTVKLGDFG-VSGQIRATLKRGTFV---------GTPYW 178

Query: 210 RSPEMIDLYRGHPINEKSDIWALGVFLYKLCYYTTPFEKVGDAAILHS--RFQFPA-YPQ 266
            +PE++        +EK+DIW+LG+ +Y+L     P  K     ++ +  + + PA +  
Sbjct: 179 MAPEVVS-KENDGYDEKADIWSLGITVYELLKGAPPLSKCDPMKVMINLPKRKPPALHGH 237

Query: 267 YSDRLKNLISVMLSENPNQRPNICQVLE 294
           YS   KN +S  L +NP  R +  +++E
Sbjct: 238 YSHSAKNFVSSCLVKNPVGRASAYEMVE 265

>TDEL0A06140 Chr1 complement(1074016..1076601) [2586 bp, 861 aa]
           {ON} Anc_8.668 YPL150W
          Length = 861

 Score = 84.3 bits (207), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 78/302 (25%), Positives = 139/302 (46%), Gaps = 61/302 (20%)

Query: 8   IYTQGTALT---VGSHQARIIKYLTSGGFAHIYSAEISPADPNSIGNVACLKRVLVPDKQ 64
           +Y Q TA     VG++  +I+K +  G F  +Y A   P     +        +   DK 
Sbjct: 22  LYCQFTAEELSEVGNY--KIMKQIGEGSFGKVYLASHKPTHRKVV--------LKTSDKN 71

Query: 65  SLNVLRA-----EVDAMKLLRGNKHVVSYIDSHAAKSGAQDGSYEVFLLMEYCSAGGLID 119
             NV+R      + D + + R  + +V+                +V++ +EYC    L +
Sbjct: 72  DPNVVREVFYHRQFDYLYITRLYEVIVT--------------ETKVWMALEYCPGKELYE 117

Query: 120 FMNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIENVLISDDKTFKVCDFG 179
            +      R++ +E  ++ + I   I   H+L    +HRD+K+EN+L+      K+ DFG
Sbjct: 118 HL--LALKRISLDECSRLFAQIVGAIYYAHSL--NCVHRDLKLENILLDKKGNAKLTDFG 173

Query: 180 SVCGVIRPPKNAQEFSYVQNDILKNTTAQYRSPEMIDL--YRGHPINEKSDIWALGVFLY 237
                +         S  Q D +  TT  Y +PE+ +   Y G  I    DIWALGV LY
Sbjct: 174 FTRECV---------SKSQLDTICGTTV-YMAPELTERKSYDGFKI----DIWALGVILY 219

Query: 238 KLCYYTTPFEKVGDAAILHSRFQF-PAYPQYSDRL-----KNLISVMLSENPNQRPNICQ 291
            +   + PF++  +A    ++++     P+ ++ L     K+LI  +L+++PN+RP+I +
Sbjct: 220 TMINGSMPFDEDDEAK---TKWKIVNEMPEINEDLVSPDAKDLIEQLLAKDPNERPSIEK 276

Query: 292 VL 293
           +L
Sbjct: 277 IL 278

>TBLA0D02230 Chr4 (557816..561280) [3465 bp, 1154 aa] {ON} Anc_8.141
           YGL180W
          Length = 1154

 Score = 84.7 bits (208), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 83/310 (26%), Positives = 141/310 (45%), Gaps = 57/310 (18%)

Query: 26  KYLTSGGFAHIYSAEISPADPNSIGNVACLKRVLVPDKQSLNVLRAEVDAMKLLRGNKHV 85
           K +  G FA +Y    S  DPN    V  + +  + +K+ L  L  E+  +K L  +KH+
Sbjct: 136 KEIGKGSFAVVYRG-YSNEDPNFKLAVKSVPKSKLKNKKILENLEIEISILKKL-NHKHI 193

Query: 86  VSYIDSHAAKSGAQDGSYEVFLLMEYCSAGGLIDFMNTR---LQNRLTENEVLK------ 136
           V+ ID    K+       +  L+MEYCS G L   +  R   + N    N++ +      
Sbjct: 194 VNLIDCQRNKN-------DFLLIMEYCSLGDLTFLIKKRNELIINHPLLNQIFQKFPSPN 246

Query: 137 ----------IMSDITQGIAAMHALLP-PLIHRDIKIENVLIS-------DDKTFKVCDF 178
                     +++ + Q  +A+  L    LIHRDIK +N+L+S       D +TFK    
Sbjct: 247 PDCNGLNIAFVLNYLQQLASALKFLRSRNLIHRDIKPQNLLLSTPYTDYHDQQTFK--KL 304

Query: 179 GSVCGVIRPPKNAQEFSYVQNDILKNTTAQ--------YRSPEMIDLYRGHPINEKSDIW 230
           G +     P     +F + +   L NT+          Y +PE+++ Y+ +  N K+D+W
Sbjct: 305 GYIGISCLPILKIADFGFAR--FLPNTSLAETLCGSPLYMAPEILN-YQKY--NAKADLW 359

Query: 231 ALGVFLYKLCYYTTPFEKVGDAAIL------HSRFQFPAYPQYSDRLKNLISVMLSENPN 284
           ++G  LY++ Y   PF+      +L      +    FP+Y +  D +K LIS +L  +P 
Sbjct: 360 SVGTVLYEMVYGKPPFKANNHLELLKKIKRTNDNIPFPSYIEIDDDMKFLISRLLKFDPI 419

Query: 285 QRPNICQVLE 294
           +R +  +  E
Sbjct: 420 KRMSFQEFFE 429

>TDEL0A02550 Chr1 (457841..461950) [4110 bp, 1369 aa] {ON} Anc_2.479
           YKL101W
          Length = 1369

 Score = 84.7 bits (208), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 65/221 (29%), Positives = 104/221 (47%), Gaps = 34/221 (15%)

Query: 85  VVSYIDSHAAKSG---AQDGSYEVFLLMEYCSAGGLIDFMNTRLQNRLTENEVLKIMSDI 141
           V+  + SHA   G     +   E++L++EY   G L D++ +R   RL E E +     I
Sbjct: 168 VIMKLISHANVLGLYEVWENKSELYLVLEYVDGGELFDYLVSR--GRLCEREAVHYFKQI 225

Query: 142 TQGIAAMHALLPPLIHRDIKIENVLIS-DDKTFKVCDFGSVCGVIRPPKNAQEFSYVQND 200
            QG++  HA    + HRD+K EN+L+   + T K+ DFG           A E   V N 
Sbjct: 226 IQGVSYCHAF--NICHRDLKPENLLLDKKNSTIKIADFGMA---------ALE---VSNK 271

Query: 201 ILKNTTA--QYRSPEMI--DLYRGHPINEKSDIWALGVFLYKLCYYTTPFEKVGDAAIL- 255
           +L+ +     Y SPE++    Y G P    SD+W+ G+ L+ L     PF       +L 
Sbjct: 272 LLQTSCGSPHYASPEIVMGKQYHGGP----SDVWSCGIILFALLTGHLPFNDDSIKKLLL 327

Query: 256 ---HSRFQFPAYPQYSDRLKNLISVMLSENPNQRPNICQVL 293
                ++Q P     S   ++LI+ +L+ NP +R    ++L
Sbjct: 328 KVQSGKYQMPQ--NLSKEAQDLIAKILTVNPAKRLTTEEIL 366

>Suva_16.160 Chr16 (277393..280149) [2757 bp, 918 aa] {ON} YPL150W
           (REAL)
          Length = 918

 Score = 84.3 bits (207), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 82/314 (26%), Positives = 141/314 (44%), Gaps = 85/314 (27%)

Query: 8   IYTQGTA--LT-VGSHQARIIKYLTSGGFAHIYSAEISPADPNSIGNVACLKRVLVPDKQ 64
           +Y+Q T+  LT VG++  +I+K +  G F  +Y A   P          CLK     DK 
Sbjct: 26  LYSQFTSDELTEVGNY--KILKQVGEGSFGKVYLALHRPTHRK-----VCLK---TSDKN 75

Query: 65  SLNVLRA-----EVDAMKLLRGNKHVVSYIDSHAAKSGAQDGSYEVFLLMEYCSAGGLID 119
             N++R      + D   + +  + +V+                +V++ +EYC    L D
Sbjct: 76  DPNIVREVFYHRQFDFPYITKLYEVIVT--------------ETKVWMALEYCPGKELYD 121

Query: 120 FMNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIENVLISDDKTFKVCDFG 179
            + +   +R++  E  ++ + I+  +   H++    +HRD+K+EN+L+  +   K+ DFG
Sbjct: 122 HLLS--LHRISLLECAELFAQISGAVYYAHSM--HCVHRDLKLENILLDKNGNAKLTDFG 177

Query: 180 ------------SVCGVIRPPKNAQEFSYVQNDILKNTTAQYRSPEMID--LYRGHPINE 225
                       +VCG                      T  Y +PE+I+   Y G  I  
Sbjct: 178 FTRECMTKTTLETVCG----------------------TTVYMAPELIERRTYDGFKI-- 213

Query: 226 KSDIWALGVFLYKLCYYTTPFEKVGDAAILHSRFQF-PAYPQYS-----DRLKNLISVML 279
             DIW+LGV LY L   + PF+   D   + ++++     P Y      D  K+LIS +L
Sbjct: 214 --DIWSLGVILYTLITGSLPFD---DDDEVKTKWKIVNEEPNYDSTLIPDDAKDLISRLL 268

Query: 280 SENPNQRPNICQVL 293
           ++NP +RP++ QVL
Sbjct: 269 AKNPKERPSLPQVL 282

>KLLA0F11319g Chr6 (1042436..1044967) [2532 bp, 843 aa] {ON} similar
           to uniprot|Q12152 Saccharomyces cerevisiae YPL150W
           Hypothetical ORF
          Length = 843

 Score = 84.0 bits (206), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 61/207 (29%), Positives = 94/207 (45%), Gaps = 49/207 (23%)

Query: 105 VFLLMEYCSAGGLIDFMNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIEN 164
           V++++EYCS   L + +    + RL+  E  K+ S I   +   H L    +HRD+K+EN
Sbjct: 103 VWMVLEYCSGHELYEHLLK--EQRLSLEESKKLFSQIASAVYYAHEL--KCVHRDLKLEN 158

Query: 165 VLISDDKTFKVCDFG------------SVCGVIRPPKNAQEFSYVQNDILKNTTAQYRSP 212
           VL+  +   K+ DFG            ++CG                      T  Y +P
Sbjct: 159 VLLDGNGHAKLTDFGFTREMATRSQLETICG----------------------TTVYMAP 196

Query: 213 EMID--LYRGHPINEKSDIWALGVFLYKLCYYTTPFEKVGDA----AILHSRFQFPAYPQ 266
           E+I+   Y G     K DIW+LG+ LY +     PF++  D      I++    F     
Sbjct: 197 ELIERKCYDGF----KVDIWSLGIILYTMINGYMPFDEDDDIKTKLKIVNDELDFNQ-EW 251

Query: 267 YSDRLKNLISVMLSENPNQRPNICQVL 293
            SD   +LI  ML +NPN+R ++ QVL
Sbjct: 252 ISDDAIDLIQGMLRKNPNERISLAQVL 278

>Suva_1.86 Chr1 complement(150761..153685) [2925 bp, 974 aa] {ON}
           YAR019C (REAL)
          Length = 974

 Score = 84.0 bits (206), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 80/292 (27%), Positives = 138/292 (47%), Gaps = 43/292 (14%)

Query: 19  SHQARIIKYLTSGGFAHIYSAEISPADPNSIGNVACLKRVLVPDKQSLNVLRAEVDAMKL 78
           S Q  + + +  G +  +Y A     D      V  +K ++  + + LN + AE+ ++  
Sbjct: 22  SVQYHLKQVIGRGSYGVVYKAINKHTD-----QVVAIKEIVYENDEELNDIMAEI-SLLK 75

Query: 79  LRGNKHVVSYIDSHAAKSGAQDGSYEVFLLMEYCSAGGLIDFMNTRLQNR----LTENEV 134
              N ++V Y        G    SYE+++L+EYC+ G L      RL +R    L+ENE 
Sbjct: 76  NLNNNNIVKY-------HGFIRKSYELYILLEYCANGSL-----RRLVSRSPTGLSENES 123

Query: 135 LKIMSDITQGIAAMHALLPPLIHRDIKIENVLISDDKTFKVCDFGSVCGVIRPPKNAQEF 194
              ++    G+  +H     +IHRDIK  N+L+S D T K+ DFG V  ++    N+   
Sbjct: 124 KTYVTQTLWGLKYLHG--EGVIHRDIKAANILLSADNTVKLADFG-VSTIV----NSSAL 176

Query: 195 SYVQNDILKNTTAQYRSPEMIDLYRGHPINEKSDIWALGVFLYKLCYYTTPFEKVGDAAI 254
           +          T  + +PE++   RG   +  SDIW+LG  + +L     P+  + DA I
Sbjct: 177 TLAG-------TLNWMAPEILG-NRG--ASTLSDIWSLGATVVELLTKNPPYHNLTDANI 226

Query: 255 LHSRFQFPAYP--QYSDRLKNLISVMLSENPNQRPNICQVLEE--VSRIQNV 302
            ++      YP   +S+ LK+ +S    +N  +RP   Q+L+   ++  +NV
Sbjct: 227 YYAVENDTYYPPTAFSESLKDFLSKCFVKNMYKRPTADQLLKHAWITSTENV 278

>NDAI0K02100 Chr11 complement(469575..472304) [2730 bp, 909 aa] {ON}
           Anc_2.496
          Length = 909

 Score = 83.6 bits (205), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 65/235 (27%), Positives = 117/235 (49%), Gaps = 39/235 (16%)

Query: 73  VDAMKLLRGNKH--VVSYIDSHAAKSGAQDGSYEVFLLMEYCSAGGLIDFMNTRLQNRLT 130
           ++ + +++G+KH  +V++IDS+       DG  +++++MEY   G L D +   +   LT
Sbjct: 670 INEILVMKGSKHPNIVNFIDSYLL-----DG--DLWVIMEYMEGGSLTDVVTHCI---LT 719

Query: 131 ENEVLKIMSDITQGIAAMHALLPPLIHRDIKIENVLISDDKTFKVCDFGSVCGVIRPPKN 190
           E ++  +  +   G+  +H+    ++HRDIK +N+L+S +   K+ DFG  C        
Sbjct: 720 EGQIGAVCRETLSGLQFLHS--KGVLHRDIKSDNILLSINGNIKLTDFG-FC-------- 768

Query: 191 AQEFSYVQNDILKNTTA----QYRSPEMIDLYRGHPINEKSDIWALGVFLYKLCYYTTPF 246
               + V    LK TT      + +PE++      P   K DIW+LG+ + ++     P+
Sbjct: 769 ----AQVNETTLKRTTMVGTPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPY 821

Query: 247 --EKVGDAAILHSRFQFPAYPQ---YSDRLKNLISVMLSENPNQRPNICQVLEEV 296
             E    A  L +    P   +    SD LK+ +   LS NP+QR +  ++LE+V
Sbjct: 822 LNETPLRALYLIATNGTPELKEREKLSDVLKHFLDWCLSVNPDQRASATELLEDV 876

>Kwal_55.21545 s55 complement(882294..884891) [2598 bp, 865 aa] {ON}
           YHR102W (KIC1) - PAK/Ste20 kinase family [contig 128]
           FULL
          Length = 865

 Score = 83.6 bits (205), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 67/217 (30%), Positives = 109/217 (50%), Gaps = 32/217 (14%)

Query: 101 GSY----EVFLLMEYCSAGGLIDFMNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLI 156
           GSY    +++++MEYC+ G L   +      ++ E  +  IM ++    A MH     +I
Sbjct: 83  GSYLNDTKLWVIMEYCAGGSLRTLLR---PGKIGEQYIGVIMRELL--TALMHIHKDGVI 137

Query: 157 HRDIKIENVLISDDKTFKVCDFGSVCGVIRPPKNAQEFSYVQNDILKNTTAQ---YRSPE 213
           HRDIK  NVLI++D   K+CDFG           A + S  Q  I + T A    + +PE
Sbjct: 138 HRDIKAANVLITNDGHIKLCDFGV----------AAQLS--QTKIRRQTMAGTPYWMAPE 185

Query: 214 MIDLYRGHPINEKSDIWALGVFLYKLCYYTTPFEKVGD--AAILHSRFQFPAYP--QYSD 269
           +I    G   + K DIW+LG+  Y++     P+ +V    A  L ++ + P     Q+S 
Sbjct: 186 VI--MEGVYYDTKVDIWSLGITAYEIATGNPPYCEVEALRAMQLITKSKPPRLEGRQHSS 243

Query: 270 RLKNLISVMLSENPNQRPNICQVLEE--VSRIQNVPC 304
            LK +I++ L E+P +RP+   +L+   +   +NVP 
Sbjct: 244 ALKEIIALCLDEDPKERPSAEDLLKTKFIKLHKNVPV 280

>KNAG0F02900 Chr6 (549477..551426) [1950 bp, 649 aa] {ON} 
          Length = 649

 Score = 83.2 bits (204), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 68/261 (26%), Positives = 115/261 (44%), Gaps = 43/261 (16%)

Query: 56  KRVLVPDKQSLNVLRAEVDAMKLL--RGNKHVVSYIDSHAAKSGAQDGSYEVFLLMEYCS 113
           K+V  P+K++   +  E++  K++    + H+V+  D  A + G +     ++++++YCS
Sbjct: 70  KKVHCPNKENKRKIIKELEIYKVICRSHHNHIVALRD--AFQWGKESC---IYMILDYCS 124

Query: 114 AGGLIDFMNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIENVLISDDKTF 173
              L   +  R    L E E  ++M  +  GI  +H  L  +IH D+K+ N+L  + +  
Sbjct: 125 NNSLQSILQYR--GSLNEVECKELMIQLCGGIYWLH--LNNVIHGDLKLSNILFDEGQQL 180

Query: 174 KVCDFGSVCGVIRPPKNAQEFSYVQNDILKNTTAQYRSPEMIDLYRGHPINEKS------ 227
           K+CDFGS       P+   E            T  Y +PE +  Y    IN+        
Sbjct: 181 KICDFGSSFIATSSPRGPGEIM---------GTPYYLAPETV--YTHKNINKSGMAILLI 229

Query: 228 ----DIWALGVFLYKLCYYTTPFEKVGDAA-----------ILHSRFQFPAYPQYSDRLK 272
               DIW++G+ LY L Y   PF K  D             I     +FP         +
Sbjct: 230 SFPIDIWSMGIVLYSLLYGINPFIKSVDELHNVSLDELMQRITSGVIEFPTNKAVGAGAQ 289

Query: 273 NLISVMLSENPNQRPNICQVL 293
            LI  MLS+NP +R  + +++
Sbjct: 290 QLILKMLSQNPLERITLVEIV 310

>SAKL0E01584g Chr5 complement(121830..123917) [2088 bp, 695 aa] {ON}
           highly similar to uniprot|P32562 Saccharomyces
           cerevisiae YMR001C
          Length = 695

 Score = 82.8 bits (203), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 72/276 (26%), Positives = 130/276 (47%), Gaps = 33/276 (11%)

Query: 27  YLTSGGFAHIYSAEISPADPNSIGNVACLKRVLVPDKQSLNVLRAEVDAMKLLRGNKHVV 86
           +L  GGFA  +  +    D   I     + ++ +  +++   L +E+   K ++ + ++V
Sbjct: 82  FLGEGGFARCFQMK---DDSGKIFAAKTVAKISIKSEKTRKKLLSEIQIHKSMK-HPNIV 137

Query: 87  SYIDSHAAKSGAQDGSYEVFLLMEYCSAGGLIDFMNTRLQNRLTENEVLKIMSDITQGIA 146
            +ID     +        V++L+E C  G L+D +  R    LTE EV    + I   I 
Sbjct: 138 QFIDCFEDDTN-------VYILLEICPNGSLMDLLKKR--KVLTEPEVRYFTTQIVGAIK 188

Query: 147 AMHALLPPLIHRDIKIENVLISDDKTFKVCDFGSVCGVIRPPKNAQEFSYVQNDILKNTT 206
            MH     +IHRD+K+ N+    +   K+ DFG +  V+    N +E  Y         T
Sbjct: 189 YMHN--RRVIHRDLKLGNIFFDSNYNLKIGDFG-LAAVL---ANDRERKYTVCG-----T 237

Query: 207 AQYRSPEMI-DLYRGHPINEKSDIWALGVFLYKLCYYTTPFEKVGDAAILHSRFQ----- 260
             Y +PE++   + GH  + + DIW++GV +Y L     PF+   +  I++ R +     
Sbjct: 238 PNYIAPEVLAGKHSGH--SYEVDIWSIGVMIYALLIGKPPFQ-AKEVNIIYERIKSGDYI 294

Query: 261 FPAYPQYSDRLKNLISVMLSENPNQRPNICQVLEEV 296
           FP     S  +  LI  +LS +P +RP++ ++++ V
Sbjct: 295 FPREKPTSKEVMVLIQDILSIDPIERPSLDEIMDYV 330

>NCAS0C01670 Chr3 complement(306682..309372) [2691 bp, 896 aa] {ON}
           Anc_8.668
          Length = 896

 Score = 82.8 bits (203), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 59/209 (28%), Positives = 98/209 (46%), Gaps = 49/209 (23%)

Query: 104 EVFLLMEYCSAGGLIDFMNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIE 163
           +V++ +EYC    L D + +   +R+  +E +++ + I  G+   H+L    +HRD+K+E
Sbjct: 103 KVWMALEYCPGKELYDRVLS--MHRVPTDECVQLFAQIVGGVHYAHSL--NCVHRDLKLE 158

Query: 164 NVLISDDKTFKVCDFG------------SVCGVIRPPKNAQEFSYVQNDILKNTTAQYRS 211
           N+L+      K+ DFG            ++CG                      T  Y +
Sbjct: 159 NILLDKSGDAKLTDFGFTRECMTKTTLETICG----------------------TTVYMA 196

Query: 212 PEMIDL--YRGHPINEKSDIWALGVFLYKLCYYTTPF----EKVGDAAILHSRFQFPAYP 265
           PE+I+   Y G  I    DIW+LGV LY +   + PF    E   +  I+H   Q     
Sbjct: 197 PELIERKSYDGFKI----DIWSLGVILYTMINGSMPFDEDDETKTEWKIVHQTPQLNENI 252

Query: 266 QYSDRLKNLISVMLSENPNQRPNICQVLE 294
             +D  K+LI  +L++NPN RP + Q+L+
Sbjct: 253 VTAD-AKDLILRLLAKNPNDRPTVEQILK 280

>TBLA0A07150 Chr1 (1776160..1780335) [4176 bp, 1391 aa] {ON}
           Anc_1.52 YDR507C
          Length = 1391

 Score = 83.2 bits (204), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 76/296 (25%), Positives = 132/296 (44%), Gaps = 36/296 (12%)

Query: 7   GIYTQGTALTVGSHQARIIKYLTSGGFAHIYSAEISPADPNSIGNVACLKRVLVPDKQSL 66
           G +  G  L +GS     + Y +S G        IS A  N+    A    +L PD    
Sbjct: 18  GPWKLGETLGLGSTGKVQLAYNSSTGQQAAIKV-ISKAVFNNDNANASDSALLTPDSLPY 76

Query: 67  NVLRAEVDAMKLLRGNKHVVSYIDSHAAKSGAQDGSYEVFLLMEYCSAGGLIDFMNTRLQ 126
            + R E+  MKLL  + +V+   D     S        +++++EY   G L + +  R  
Sbjct: 77  GIER-EIIIMKLL-NHPNVLRLYDVWETDSN-------LYMVLEYAEKGELFNLLVER-- 125

Query: 127 NRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIENVLISDDKTFKVCDFGSVCGVIR 186
             L ENE ++    I  GI+  HAL   ++HRD+K EN+L+      K+ DFG       
Sbjct: 126 GPLPENEAIRFFRQIIIGISYCHAL--GIVHRDLKPENLLLDHKYNIKIADFGMAA---- 179

Query: 187 PPKNAQEFSYVQNDILKNTTA--QYRSPEMIDLYRGHPINEKSDIWALGVFLYKLCYYTT 244
                      ++ +L+ +     Y +PE+I     H +  ++D+W+ G+ L+ L     
Sbjct: 180 --------LETEDKLLETSCGSPHYAAPEIISGLPYHGL--ETDVWSCGIILFALLTGRL 229

Query: 245 PF-EKVGD-----AAILHSRFQFPAYPQYSDRLKNLISVMLSENPNQRPNICQVLE 294
           PF E+ G+       +   +F+ P   + S   ++LIS +L+ +P +R    ++L+
Sbjct: 230 PFDEEDGNIRNLLLKVQSGQFEMPGNDEISREAQDLISKILTVDPKKRIKTREILK 285

>TBLA0A04720 Chr1 (1168895..1172683) [3789 bp, 1262 aa] {ON} Anc_7.86
            YAL017W
          Length = 1262

 Score = 83.2 bits (204), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 71/250 (28%), Positives = 114/250 (45%), Gaps = 40/250 (16%)

Query: 56   KRVLVPD---KQSLNVLRAEVDAMKLLR--GNKHVVSYIDSHAAKSGAQDGSYEVFLLME 110
            +R+LV      + L  + +E+  M  L    NK+++S +D        +D  Y  ++   
Sbjct: 1036 ERILVDTWVRDRKLGTIPSEIQIMSTLNKTSNKNILSILDFF------EDDDY-YYVEQP 1088

Query: 111  YCSAGGLIDFMN-TRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIENVLISD 169
                 G ID  +    +  +TE E   I   I  GI+ +H     ++HRDIK ENV++  
Sbjct: 1089 VHGKTGCIDLFDLIEFKTNMTEFEAKLIFKQIISGISHLHE--SGIVHRDIKDENVIVDA 1146

Query: 170  DKTFKVCDFGSVCGVIRPPKNAQEFSYVQN---DILKNTTAQYRSPEMI--DLYRGHPIN 224
                K+ DFGS              +YV+N   D+   T   Y SPE++  + Y G P  
Sbjct: 1147 KGFVKLIDFGSA-------------AYVKNGPFDVFVGTI-DYASPEVLRGEKYEGKP-- 1190

Query: 225  EKSDIWALGVFLYKLCYYTTPFEKVGDAAILHSRFQFPAYPQYSDRLKNLISVMLSENPN 284
               DIWALG+ LY + +   PF  + +  IL    +FP     S    +LI ++L+ +  
Sbjct: 1191 --QDIWALGILLYTIVFKENPFYNIDE--ILEGDMKFPETENISANCIDLIKLILNRSAL 1246

Query: 285  QRPNICQVLE 294
            +RP+I  + E
Sbjct: 1247 ERPSITDISE 1256

>KLTH0D05566g Chr4 (498055..501441) [3387 bp, 1128 aa] {ON} weakly
           similar to uniprot|P34244 Saccharomyces cerevisiae
           YKL101W HSL1 Nim1p-related protein kinase that regulates
           the morphogenesis and septin checkpoints associates with
           the assembled septin filament required along with Hsl7p
           for bud neck recruitment phosphorylation and degradation
           of Swe1p
          Length = 1128

 Score = 82.8 bits (203), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 59/203 (29%), Positives = 94/203 (46%), Gaps = 31/203 (15%)

Query: 100 DGSYEVFLLMEYCSAGGLIDFMNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRD 159
           +   E+FL++EY   G L D++ +R   RL+E E +     I +G A  H+    + HRD
Sbjct: 127 ENKLELFLVLEYVDGGELFDYLVSR--GRLSEKEAIHYFRQIIEGTAYCHSF--NICHRD 182

Query: 160 IKIENVLIS-DDKTFKVCDFGSVCGVIRPPKNAQEFSYVQNDILKNTTA--QYRSPEMI- 215
           +K EN+L+   +K  K+ DFG                   N +L+ +     Y SPE++ 
Sbjct: 183 LKPENLLLDKKNKRIKIADFGMAA------------LQTSNKLLETSCGSPHYASPEIVM 230

Query: 216 -DLYRGHPINEKSDIWALGVFLYKLCYYTTPFEKVGDAAIL----HSRFQFPAYPQYSDR 270
              Y G P    SD+W+ G+ L+ L     PF       +L      ++Q P     S  
Sbjct: 231 GKTYNGGP----SDVWSCGIILFALLTGHLPFNDDNIKRLLLKVQAGKYQMPQ--AISLE 284

Query: 271 LKNLISVMLSENPNQRPNICQVL 293
            ++LIS +L  +PN+R  I  +L
Sbjct: 285 AQDLISRILVVDPNKRITINDIL 307

>Smik_4.367 Chr4 (655941..659141) [3201 bp, 1066 aa] {ON} YDR122W
           (REAL)
          Length = 1066

 Score = 82.4 bits (202), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 60/211 (28%), Positives = 107/211 (50%), Gaps = 26/211 (12%)

Query: 102 SYEVFLLMEYCSAGGLIDFMNTRLQN-RLTENEVLKIMSDITQGIAAMHALLPPLIHRDI 160
           S   ++L EY S G L+D++   +Q+  + E++  K    I   +  +HA    ++HRD+
Sbjct: 214 SNHFYMLFEYVSGGQLLDYI---IQHGSIREHQARKFARGIASALMYLHA--NNIVHRDL 268

Query: 161 KIENVLISDDKTFKVCDFGSVCGVIRPPKNAQEFSYVQNDILKNTTAQYRSPEMIDLYRG 220
           KIEN++ISD    K+ DFG +  +    K    F           +  + +PE++   + 
Sbjct: 269 KIENIMISDSSEIKIIDFG-LSNLYDSRKQLHTFC---------GSLYFAAPELL---KA 315

Query: 221 HP-INEKSDIWALGVFLYKLCYYTTPFEKVGDAAILHSRFQFP--AYPQY-SDRLKNLIS 276
           HP    + D+W+ GV L+ L     PF+   ++++LH + +     YPQ+ S  + +L+S
Sbjct: 316 HPYTGPEVDVWSFGVVLFVLVCGKVPFDD-ENSSVLHEKIKQGKVEYPQHLSIEVISLLS 374

Query: 277 VMLSENPNQRPNICQVLEEVSRIQ--NVPCP 305
            ML  +P +R  + QV+E    ++  N P P
Sbjct: 375 KMLVVDPKRRATLKQVVEHHWMVRGFNAPPP 405

>TDEL0C06780 Chr3 complement(1236767..1238173) [1407 bp, 468 aa]
           {ON} Anc_1.24 YDR523C
          Length = 468

 Score = 81.3 bits (199), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 77/282 (27%), Positives = 132/282 (46%), Gaps = 44/282 (15%)

Query: 31  GGFAHIYSA--EISPADPNSIGNVACLKRV-LVPDKQSLNVLRAEVDAMKLLRGNKHVVS 87
           G F  +Y A  ++S       G V  +K V L    + +N+L  E+  +  L+ + ++ +
Sbjct: 26  GNFGDVYKACEKVS-------GKVVAVKVVNLEHTDEDINLLAQEIFFLAELK-SPYITN 77

Query: 88  YIDSHAAKSGAQDGSYEVFLLMEYCSAGGLIDFMNTRLQNRLTENEVLKIMSDITQGIAA 147
           YI +       +D S  ++++MEYC  G   D +       L E++   I  ++ +G+  
Sbjct: 78  YITTMT-----EDVS--MWIIMEYCGGGSCADLLRNIYNCGLPESKSAYITREVLKGLEY 130

Query: 148 MHALLPPLIHRDIKIENVLISDDKTFKVCDFGSVCGVIRPPKNAQEFSYVQNDILKNTTA 207
           +H      IHRDIK  N+L++D+   K+ DFG V G IR       F           T 
Sbjct: 131 LHE--QKKIHRDIKAANILLTDEGKVKLGDFG-VSGQIRATLKRGTFV---------GTP 178

Query: 208 QYRSPEMI----DLYRGHPINEKSDIWALGVFLYKLCYYTTPFEKVGDAAI---LHSRFQ 260
            + +PE++    D Y     +EK+DIW+LG+ +Y+L   + P  K     +   L  R  
Sbjct: 179 FWMAPEVVSKDSDGY-----DEKADIWSLGITVYELLKGSPPLYKCDPMKVMVNLPKRKP 233

Query: 261 FPAYPQYSDRLKNLISVMLSENPNQRPNICQVL--EEVSRIQ 300
              +  YS   K+ ++  L +NP  RP+  ++L  E V+ +Q
Sbjct: 234 PVLHGHYSSAAKHFVASCLVKNPKNRPSAVELLNSEFVTNLQ 275

>Suva_11.123 Chr11 (235064..239644) [4581 bp, 1526 aa] {ON} YKL101W
           (REAL)
          Length = 1526

 Score = 82.4 bits (202), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 65/234 (27%), Positives = 108/234 (46%), Gaps = 36/234 (15%)

Query: 85  VVSYIDSHA---AKSGAQDGSYEVFLLMEYCSAGGLIDFMNTRLQNRLTENEVLKIMSDI 141
           V+  + SHA   A     +   E++L++EY   G L D++ +R   +L E E +     I
Sbjct: 166 VIMKLISHANVMALFEVWENKSELYLVLEYVDGGELFDYLVSR--GKLPEREAIHYFKQI 223

Query: 142 TQGIAAMHALLPPLIHRDIKIENVLIS-DDKTFKVCDFGSVCGVIRPPKNAQEFSYVQND 200
            +G++  H+    + HRD+K EN+L+   +K  K+ DFG     +  P          N 
Sbjct: 224 VEGVSYCHSF--NICHRDLKPENLLLDKKNKKIKIADFG--MAALELP----------NK 269

Query: 201 ILKNTTA--QYRSPEMI--DLYRGHPINEKSDIWALGVFLYKLCYYTTPFEKVGDAAIL- 255
           +LK +     Y SPE++    Y G P    SD+W+ G+ L+ L     PF       +L 
Sbjct: 270 LLKTSCGSPHYASPEIVMGRPYHGGP----SDVWSCGIVLFALLTGHLPFNDDNIKKLLL 325

Query: 256 ---HSRFQFPAYPQYSDRLKNLISVMLSENPNQRPNICQVLEE--VSRIQNVPC 304
                ++Q P     S   +NLIS +L  +P +R    ++LE   + +  N+P 
Sbjct: 326 KVQSGKYQMPM--NLSLEARNLISKILVIDPEKRITTQEILEHPLIKKYDNLPV 377

>KLLA0F13552g Chr6 complement(1252906..1256709) [3804 bp, 1267 aa]
           {ON} weakly similar to uniprot|P34244 Saccharomyces
           cerevisiae YKL101W HSL1 Nim1p-related protein kinase
           that regulates the morphogenesis and septin checkpoints
           associates with the assembled septin filament required
           along with Hsl7p for bud neck recruitment
           phosphorylation and degradation of Swe1p
          Length = 1267

 Score = 82.4 bits (202), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 62/201 (30%), Positives = 97/201 (48%), Gaps = 33/201 (16%)

Query: 104 EVFLLMEYCSAGGLIDFMNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIE 163
           E++L++EY   G L D++ ++   +L E+E +     I Q +A  H     + HRD+K E
Sbjct: 148 ELYLVLEYVEGGELFDYLVSK--GKLPESEAIHYFKQIVQAVAYCHGF--NICHRDLKPE 203

Query: 164 NVLISDDK-TFKVCDFGSVCGVIRPPKNAQEFSYVQNDILKNTTA---QYRSPEMI--DL 217
           N+L+   K + K+ DFG           A E S    D L  T+     Y SPE++    
Sbjct: 204 NLLLDKKKRSIKIADFGMA---------ALETS----DKLLETSCGSPHYASPEIVLGRK 250

Query: 218 YRGHPINEKSDIWALGVFLYKLCYYTTPFEKVGDAAIL----HSRFQFPAYPQYSDRLKN 273
           Y G P    SD+W+ G+ L+ L     PF       +L      ++Q P +   S   K+
Sbjct: 251 YHGSP----SDVWSCGIILFALLTGHLPFNDDNVKKLLLKVQSGKYQMPQW--LSVEAKD 304

Query: 274 LISVMLSENPNQRPNICQVLE 294
           LIS +L  +PN+R  I Q+L+
Sbjct: 305 LISRILVVDPNRRITIDQILQ 325

>Smik_7.93 Chr7 complement(158441..160132) [1692 bp, 563 aa] {ON}
           YGL179C (REAL)
          Length = 563

 Score = 81.3 bits (199), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 67/218 (30%), Positives = 108/218 (49%), Gaps = 34/218 (15%)

Query: 102 SYEVFLLMEYCSAGGLIDFMNTRLQNR------LTENEVLKIMSDITQGIAAMHALLPPL 155
           S +V+L++EYCS G +      +++ +      LT  +  KI+SD+  G+  +H+    +
Sbjct: 128 SSKVYLVLEYCSRGPVRWCPENQMEIKAVGPSILTFEQSRKILSDVVSGLEHLHS--RGI 185

Query: 156 IHRDIKIENVLISDDKTFKVCDFGSVCGVIRPPKNAQEFSYVQNDILKNTTA---QYRSP 212
            HRDIK  N+LIS + T K+ DFG          N Q  S+ Q  ILK+ T     + +P
Sbjct: 186 THRDIKPSNLLISSNGTVKISDFGVAILSTTGSTNIQS-SHEQ--ILKSKTLGTPAFLAP 242

Query: 213 EMIDLYRGHPINEKSDIWALGVFLYKLCYYTTPFE-----KVGDAAILHSRFQFPAY--- 264
           E+      H      DIW+LGV LY L + T PF      ++ D  I++   + P+Y   
Sbjct: 243 ELCSTDSEHCCTFAIDIWSLGVTLYCLLFGTLPFNANSVLELFD-KIINKSLEVPSYEEM 301

Query: 265 ----------PQYSDRLKNLISVMLSENPNQRPNICQV 292
                      +YSD  KNL+  +L +NP++R  + ++
Sbjct: 302 LNRGTSDITIEEYSDA-KNLLYKLLQKNPDKRIALAEI 338

>AGR058W Chr7 (823626..826841) [3216 bp, 1071 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR096W (KIN2) and
           YDR122W (KIN1)
          Length = 1071

 Score = 82.0 bits (201), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 58/196 (29%), Positives = 96/196 (48%), Gaps = 22/196 (11%)

Query: 102 SYEVFLLMEYCSAGGLIDFMNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIK 161
           S   ++L EY S G L+D++       L E    K    I   +  +H  L  ++HRD+K
Sbjct: 152 SNHFYMLFEYVSGGQLLDYIIQ--HGSLRERHARKFARGIASALQYLH--LNNIVHRDLK 207

Query: 162 IENVLISDDKTFKVCDFGSVCGVIRPPKNAQEFSYVQNDILKNTTAQYRSPEMIDLYRGH 221
           IEN++IS     ++ DFG +  +  P K    F           +  + +PE++   + H
Sbjct: 208 IENIMISSSGEIRIIDFG-LSNMYDPKKQLHTFC---------GSLYFAAPELL---KAH 254

Query: 222 P-INEKSDIWALGVFLYKLCYYTTPFEKVGDAAILHSRFQFP--AYPQY-SDRLKNLISV 277
           P    + DIW+ GV LY L     PF+   +A++LH + +     YPQ+ S  + +L+S 
Sbjct: 255 PYTGPEVDIWSFGVVLYVLVCGKVPFDD-ENASVLHEKIKQGKVEYPQHLSIDVISLLSK 313

Query: 278 MLSENPNQRPNICQVL 293
           ML  +P +R  + QV+
Sbjct: 314 MLVVDPYKRATLKQVV 329

>KLTH0D11044g Chr4 complement(901388..903937) [2550 bp, 849 aa] {ON}
           similar to uniprot|Q12152 Saccharomyces cerevisiae
           YPL150W
          Length = 849

 Score = 81.6 bits (200), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 55/210 (26%), Positives = 99/210 (47%), Gaps = 53/210 (25%)

Query: 105 VFLLMEYCSAGGLIDFMNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIEN 164
           V++ +EYC    L +++   ++ R+  +E   + S I   +   H++    +HRD+K+EN
Sbjct: 103 VWMALEYCPGKELYEYL--LIKKRIPLDECSHLFSQIVGAVFYAHSM--KCVHRDLKLEN 158

Query: 165 VLISDDKTFKVCDFG------------SVCGVIRPPKNAQEFSYVQNDILKNTTAQYRSP 212
           +L+      K+ DFG            +VCG                      T  Y +P
Sbjct: 159 ILLDKKGQAKLTDFGFTRECATKGILETVCG----------------------TTVYMAP 196

Query: 213 EMIDL--YRGHPINEKSDIWALGVFLYKLCYYTTPFEKVGDAAILHSRFQF-PAYPQYSD 269
           E+I+   Y G+ I    D W+LG+ LY + +   PF++  D   + ++++     P Y D
Sbjct: 197 ELIERKPYEGYKI----DTWSLGIILYTMIHGAMPFDEEDD---IKTKYRIVNNEPFYDD 249

Query: 270 RL-----KNLISVMLSENPNQRPNICQVLE 294
                  K+LI  +L ++P+QRP++ QVL+
Sbjct: 250 NFIDANGKDLIMQLLQKDPSQRPSLTQVLQ 279

>TPHA0F02430 Chr6 complement(535865..538261) [2397 bp, 798 aa] {ON}
           Anc_6.31 YMR001C
          Length = 798

 Score = 81.3 bits (199), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 75/278 (26%), Positives = 131/278 (47%), Gaps = 43/278 (15%)

Query: 28  LTSGGFAHIYSAEISPADPNSIG-NVACL---KRVLVPDKQSLNVLRAEVDAMKLLRGNK 83
           L  GGFA  +  +      + +G + AC    K+ +  ++    +L +E+   + LR + 
Sbjct: 99  LGEGGFARCFHIK------DDVGISFACKIVSKKSIKTERTKFKLL-SEIQIHQNLRYS- 150

Query: 84  HVVSYIDSHAAKSGAQDGSYEVFLLMEYCSAGGLIDFMNTRLQNRLTENEVLKIMSDITQ 143
           H+V ++D         +    V++L+E C  G L+D +  R    LTE EV  + + +  
Sbjct: 151 HIVKFMDCF-------EDELNVYILLELCPNGSLMDLLKKR--KILTEAEVKFMTTQVCG 201

Query: 144 GIAAMHALLPPLIHRDIKIENVLISDDKTFKVCDFGSVCGVIRPPKNAQEFSYVQNDILK 203
            I  MH+    +IHRD+K+ NV    +   K+ DFG    +     N  E  Y       
Sbjct: 202 AINYMHS--NNIIHRDLKLGNVFFDKNFNIKIGDFGLAATL----SNVSEKKYTMCG--- 252

Query: 204 NTTAQYRSPEMIDLYR--GHPINEKSDIWALGVFLYKLCYYTTPFEKVGDAAILHSR--- 258
             T  Y +PE+I L +  GH    ++DIW+LG+ +Y +     PF+   D   ++ +   
Sbjct: 253 --TPNYIAPEVI-LSKQIGHSF--EADIWSLGIMIYAMVLGKPPFQ-AKDVTTIYEKIKL 306

Query: 259 --FQFPAYPQYSDRLKNLISVMLSENPNQRPNICQVLE 294
             ++FP     ++ +K LI  +L  +P+QRP I  +L+
Sbjct: 307 CQYEFPPDKYITNDVKVLIQDLLVLDPSQRPRIMDILK 344

>KNAG0D00210 Chr4 complement(22721..25222) [2502 bp, 833 aa] {ON}
           Anc_6.371 YCR091W
          Length = 833

 Score = 81.3 bits (199), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 56/198 (28%), Positives = 92/198 (46%), Gaps = 21/198 (10%)

Query: 105 VFLLMEYCSAGGLIDFMNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIEN 164
           V+L MEYC  G     + TR    ++E++     S++T  +  +H L    I+RD+K EN
Sbjct: 509 VYLCMEYCMGGEFFRALQTRKAKSISEDDARFYASEVTAALEYLHLL--GFIYRDLKPEN 566

Query: 165 VLISDDKTFKVCDFG---SVCGVIRPPKN-AQEFSYVQNDILKN--------TTAQYRSP 212
           +L+       + DF          +P K  A + S V   +            T +Y +P
Sbjct: 567 ILLHKSGHIMLSDFDLSVQANDAAKPVKRVATQSSMVDTKVFSEGFRTNSFVGTEEYIAP 626

Query: 213 EMIDLYRGHPINEKSDIWALGVFLYKLCYYTTPF--EKVGD--AAILHSRFQFPAYPQYS 268
           E+I   RG+      D W LG+ +Y++ +  TPF  E   +    IL +   FP + + S
Sbjct: 627 EVI---RGNGHTAAVDWWTLGILIYEMLFGCTPFKGENTNETFCNILKNEVTFPEHHEIS 683

Query: 269 DRLKNLISVMLSENPNQR 286
              K+LI  +LS+N ++R
Sbjct: 684 RHCKDLIRKLLSKNESKR 701

>KAFR0D01220 Chr4 (246927..250094) [3168 bp, 1055 aa] {ON} Anc_7.86
            YAL017W
          Length = 1055

 Score = 81.6 bits (200), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 60/197 (30%), Positives = 91/197 (46%), Gaps = 21/197 (10%)

Query: 99   QDGSYEVFLLMEYCSAGGLIDFMNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHR 158
            +D  Y    L  +   G +  F    L+  +TE E   I   I  GI  +H     ++HR
Sbjct: 871  EDDDYYYIELESHGETGSIDLFDLIELKTNMTEFEAKLIFKQIVSGIKYLHD--QGIVHR 928

Query: 159  DIKIENVLISDDKTFKVCDFGSVCGVIRPPKNAQEFSYVQNDILKNTTAQYRSPEMI--D 216
            DIK ENV++  +   K+ DFGS       P       +V        T  Y +PE++  +
Sbjct: 929  DIKDENVIVDSNGFVKLIDFGSAAYTKTGPFEV----FVG-------TIDYAAPEILGGN 977

Query: 217  LYRGHPINEKSDIWALGVFLYKLCYYTTPFEKVGDAAILHSRFQFPAYPQYSDRLKNLIS 276
             Y+G P     DIWALGV LY L Y   PF  V +  IL  + +F      +    +LI 
Sbjct: 978  PYKGKP----QDIWALGVLLYTLIYKENPFYNVDE--ILEGQLRFDGTCNVTQDCIDLIR 1031

Query: 277  VMLSENPNQRPNICQVL 293
             +L+++ N RP+I +++
Sbjct: 1032 WILTKSVNDRPSIDEIV 1048

>CAGL0M11396g Chr13 (1122109..1125687) [3579 bp, 1192 aa] {ON}
           similar to uniprot|P13186 Saccharomyces cerevisiae
           YLR096w KIN2 ser/thr protein kinase
          Length = 1192

 Score = 81.6 bits (200), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 58/210 (27%), Positives = 106/210 (50%), Gaps = 24/210 (11%)

Query: 102 SYEVFLLMEYCSAGGLIDFMNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIK 161
           S   ++L EY + G L+D++       L E+   K    +   +  +HA    ++HRD+K
Sbjct: 204 SNHFYMLFEYVAGGQLLDYIIQ--HGSLREHHARKFARGVASALQYLHA--NNIVHRDLK 259

Query: 162 IENVLISDDKTFKVCDFGSVCGVIRPPKNAQEFSYVQNDILKNTTAQYRSPEMIDLYRGH 221
           IEN++IS+    K+ DFG +  V    K    F           +  + +PE++   + H
Sbjct: 260 IENIMISNSGEIKIIDFG-LSNVYDTRKQLHTFC---------GSLYFAAPELL---KAH 306

Query: 222 P-INEKSDIWALGVFLYKLCYYTTPFEKVGDAAILHSRFQFP--AYPQY-SDRLKNLISV 277
           P    + D+W+ GV LY L     PF+   ++++LH + +     YPQ+ S  + +L+S 
Sbjct: 307 PYTGPEVDVWSFGVVLYVLVCGKVPFDD-ENSSVLHEKIKRGKVEYPQHLSIEVMSLLSK 365

Query: 278 MLSENPNQRPNICQVLEE--VSRIQNVPCP 305
           ML  +P++R ++ QV+E   +++  + P P
Sbjct: 366 MLVVDPSRRASLKQVVEHPWMTKGYDTPAP 395

>Kwal_56.22476 s56 complement(145039..147132) [2094 bp, 697 aa] {ON}
           YMR001C (CDC5) - protein kinase which functions at the
           G(sub)2/M boundary [contig 185] FULL
          Length = 697

 Score = 80.9 bits (198), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 73/276 (26%), Positives = 128/276 (46%), Gaps = 33/276 (11%)

Query: 27  YLTSGGFAHIYSAEISPADPNSIGNVACLKRVLVPDKQSLNVLRAEVDAMKLLRGNKHVV 86
           +L  GGFA  +  +    D   I     + ++ +  +++   L +E+   K +R + ++V
Sbjct: 84  FLGEGGFARCFQIK---DDGGKIFAAKTVAKISIKSEKTRKKLLSEIQIHKSMR-HTNIV 139

Query: 87  SYIDSHAAKSGAQDGSYEVFLLMEYCSAGGLIDFMNTRLQNRLTENEVLKIMSDITQGIA 146
            ++D     +        V++L+E C  G L+D +  R    LTE EV    + I   + 
Sbjct: 140 QFVDCFEDDTN-------VYILLEICPNGSLMDLLKRR--KMLTEPEVRFFTTQIVGAVK 190

Query: 147 AMHALLPPLIHRDIKIENVLISDDKTFKVCDFGSVCGVIRPPKNAQEFSYVQNDILKNTT 206
            MH+    +IHRD+K+ N+        KV DFG +  V+    N +E  Y         T
Sbjct: 191 YMHS--RRVIHRDLKLGNIFFDKHYNLKVGDFG-LAAVL---ANDRERKYTVCG-----T 239

Query: 207 AQYRSPEMI-DLYRGHPINEKSDIWALGVFLYKLCYYTTPFEKVGDAAILHSR-----FQ 260
             Y +PE++   + GH  + + DIW+ GV +Y L     PF+   +  I++ R     F 
Sbjct: 240 PNYIAPEVLTGKHTGH--SYEVDIWSCGVMIYALLIGKPPFQ-AKEVNIIYERIKCGDFV 296

Query: 261 FPAYPQYSDRLKNLISVMLSENPNQRPNICQVLEEV 296
           FP     S     LI  +LS +P +RP++ ++++ V
Sbjct: 297 FPKDKFISPEALVLIKDILSIDPLERPSLDEIIDYV 332

>TBLA0B00490 Chr2 complement(94755..97118) [2364 bp, 787 aa] {ON}
           Anc_6.31 YMR001C
          Length = 787

 Score = 81.3 bits (199), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 76/299 (25%), Positives = 137/299 (45%), Gaps = 40/299 (13%)

Query: 4   PSSGIYTQGTALTVGSHQARIIKYLTSGGFAHIYSAEISPADPNSIGNVACLKRVLVPDK 63
           P S I T+G     G       ++L  GGFA  +  +    +   I     + ++ +  +
Sbjct: 131 PPSLIKTRGRDYRRG-------QFLGEGGFARCFQIK---DESGKIFAAKTVAKISIKTE 180

Query: 64  QSLNVLRAEVDAMKLLRGNKHVVSYIDSHAAKSGAQDGSYEVFLLMEYCSAGGLIDFMNT 123
           ++   L +E+   K ++ ++++V ++D         +    V++L+  C  G L++ +  
Sbjct: 181 KTRRKLLSEIQIHKSMK-HQNIVQFVDCF-------EDHINVYILLGMCPNGSLMELLKK 232

Query: 124 RLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIENVLISDDKTFKVCDFGSVCG 183
           R    LTE EV      I   I  MH+    +IHRD+K+ N+   ++   K+ DFG +  
Sbjct: 233 R--KILTEPEVRFFTVQICGAIKYMHS--RRVIHRDLKLGNIFFDENYNLKIGDFG-LAA 287

Query: 184 VIRPPKNAQEFSYVQNDILKNTTAQYRSPE-MIDLYRGHPINEKSDIWALGVFLYKLCYY 242
           V+    N +E  Y         T  Y +PE ++  + GH  + + DIW++GV ++ L   
Sbjct: 288 VL---ANDRERKYTVCG-----TPNYIAPEVLLGKHSGH--SYEVDIWSIGVMIFALLIG 337

Query: 243 TTPFEKVGDAAILHSR-----FQFPAYPQYSDRLKNLISVMLSENPNQRPNICQVLEEV 296
             PF+   D   ++SR     + FP     S   K LI  +L  +P  RP+I +++E V
Sbjct: 338 KPPFQ-AKDVNTIYSRIKNSEYTFPINKSISQEAKTLIQDILINDPIARPSINEIMEYV 395

>Ecym_4291 Chr4 complement(620549..623986) [3438 bp, 1145 aa] {ON}
           similar to Ashbya gossypii AGR058W
          Length = 1145

 Score = 81.3 bits (199), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 57/196 (29%), Positives = 96/196 (48%), Gaps = 22/196 (11%)

Query: 102 SYEVFLLMEYCSAGGLIDFMNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIK 161
           S   ++L EY S G L+D++       L E    K    I   +  +H  +  ++HRD+K
Sbjct: 213 SNHFYMLFEYVSGGQLLDYIIQ--HGSLRERHARKFARGIASALQYLH--MNNIVHRDLK 268

Query: 162 IENVLISDDKTFKVCDFGSVCGVIRPPKNAQEFSYVQNDILKNTTAQYRSPEMIDLYRGH 221
           IEN++IS     ++ DFG +  +  P K    F           +  + +PE++   + H
Sbjct: 269 IENIMISSSGEIRIIDFG-LSNLYDPKKQLHTFC---------GSLYFAAPELL---KAH 315

Query: 222 P-INEKSDIWALGVFLYKLCYYTTPFEKVGDAAILHSRFQFP--AYPQY-SDRLKNLISV 277
           P    + DIW+ GV LY L     PF+   +A++LH + +     YPQ+ S  + +L+S 
Sbjct: 316 PYTGPEVDIWSFGVVLYVLVCGKVPFDD-ENASVLHEKIKQGKVEYPQHLSIDVISLLSK 374

Query: 278 MLSENPNQRPNICQVL 293
           ML  +P +R  + QV+
Sbjct: 375 MLVVDPLKRATLKQVV 390

>NCAS0B04490 Chr2 (814474..815523) [1050 bp, 349 aa] {ON} Anc_8.141
          Length = 349

 Score = 79.0 bits (193), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 67/205 (32%), Positives = 102/205 (49%), Gaps = 27/205 (13%)

Query: 105 VFLLMEYCSAGGLIDFMNTRLQNRLTENEVL--KIMSDITQGIAAMHALLPPLIHRDIKI 162
           V+LLMEY   G L       L++    N+V+  + +  I   +  +H     +IHRD+K 
Sbjct: 164 VYLLMEYLVYGELYKL----LRSHGPFNDVIASRFVFQIADALNYLHD--KQIIHRDLKP 217

Query: 163 ENVLISDDKTFKVCDFGSVCGVIRPPKNAQEFSYVQNDILKNTTAQYRSPEMIDLYRGHP 222
           EN+LI  +   K+ DFG    +I P         V+   L  T   Y SPEMI   R   
Sbjct: 218 ENILIGFNNVIKLTDFG--WSIINPRG-------VKRKTLCGTI-DYLSPEMI---RSRE 264

Query: 223 INEKSDIWALGVFLYKLCYYTTPFE----KVGDAAILHSRFQFPAYPQYSDRLKNLISVM 278
            ++K D+WALGV  Y+L   + PFE    ++    IL +  +FP     S  +K+LIS +
Sbjct: 265 YDDKVDVWALGVLTYELIVGSPPFEEDTKELTYKRILKNDIKFPE--TVSHDVKDLISKL 322

Query: 279 LSENPNQRPNICQVLEEVSRIQNVP 303
           L  NP++R ++  V++    I+N P
Sbjct: 323 LKYNPSERISMRDVMKHPWIIRNKP 347

>KLTH0C10912g Chr3 (898372..900465) [2094 bp, 697 aa] {ON} highly
           similar to uniprot|P32562 Saccharomyces cerevisiae
           YMR001C
          Length = 697

 Score = 80.9 bits (198), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 72/276 (26%), Positives = 128/276 (46%), Gaps = 33/276 (11%)

Query: 27  YLTSGGFAHIYSAEISPADPNSIGNVACLKRVLVPDKQSLNVLRAEVDAMKLLRGNKHVV 86
           +L  GGFA  +  +    D   I     + ++ +  +++   L +E+   K +R + ++V
Sbjct: 84  FLGEGGFARCFQIK---DDSGKIFAAKTVAKISIKSEKTRKKLLSEIQIHKSMR-HFNIV 139

Query: 87  SYIDSHAAKSGAQDGSYEVFLLMEYCSAGGLIDFMNTRLQNRLTENEVLKIMSDITQGIA 146
            +ID     +        V++L+E C  G L+D +  R    LTE EV    + I   + 
Sbjct: 140 QFIDCFEDDTN-------VYILLEICPNGSLMDLLKRR--KVLTEPEVRFFTTQIVGAVK 190

Query: 147 AMHALLPPLIHRDIKIENVLISDDKTFKVCDFGSVCGVIRPPKNAQEFSYVQNDILKNTT 206
            MH+    +IHRD+K+ N+        K+ DFG +  V+    N +E  Y         T
Sbjct: 191 YMHS--RRVIHRDLKLGNIFFDKHYNLKIGDFG-LAAVL---ANDRERKYTVCG-----T 239

Query: 207 AQYRSPEMI-DLYRGHPINEKSDIWALGVFLYKLCYYTTPFEKVGDAAILHSRFQ----- 260
             Y +PE++   + GH  + + DIW+ GV +Y L     PF+   +  I++ R +     
Sbjct: 240 PNYIAPEVLTGKHTGH--SYEVDIWSCGVMIYALLIGKPPFQ-AKEVNIIYERIKCGDYV 296

Query: 261 FPAYPQYSDRLKNLISVMLSENPNQRPNICQVLEEV 296
           FP     S     LI  +LS +P +RP++ ++++ V
Sbjct: 297 FPRDKCISQEALTLIRDILSIDPLERPSLDEIIDYV 332

>Skud_10.119 Chr10 (215299..219744) [4446 bp, 1481 aa] {ON} YJL095W
            (REAL)
          Length = 1481

 Score = 81.3 bits (199), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 64/262 (24%), Positives = 122/262 (46%), Gaps = 38/262 (14%)

Query: 48   SIGNVACLKRVLVPDKQSLN--------VLRAEVDAMKLLRGNKHVVSYIDSHAAKSGAQ 99
            + G +  +K+V VP   S N         LR+EV  +K L  + ++V Y+       G +
Sbjct: 1199 TTGEMMAVKQVEVPKYSSQNEAILGTVEALRSEVSTLKDL-DHLNIVQYL-------GFE 1250

Query: 100  DGSYEVFLLMEYCSAGGLIDFMNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRD 159
            + +    L +EY + G +   +  R+  R  E+ +  + + + +G+A +H+    ++HRD
Sbjct: 1251 NKNNIYSLFLEYVAGGSVGSLI--RMYGRFDESLIRHLTTQVLKGLAYLHS--KGILHRD 1306

Query: 160  IKIENVLISDDKTFKVCDFGSVCGVIRPPKNAQEFSYVQNDILKNTTAQYRSPEMIDLYR 219
            +K +N+L+  D   K+ DF    G+ R  K+     Y  +D+    T  + +PEM+D  +
Sbjct: 1307 MKADNLLLDQDGICKISDF----GISRKSKDI----YSNSDMTMRGTVFWMAPEMVDTKQ 1358

Query: 220  GHPINEKSDIWALGVFLYKLCYYTTPFEKVGDAAIL----HSRFQFP----AYPQYSDRL 271
            G+  + K DIW+LG  + ++     P+  +   A +     S+   P      P  S   
Sbjct: 1359 GY--SAKVDIWSLGCIVLEMFAGKRPWSNLEVVAAMFKIGKSKSAPPIPEDTLPLISQVG 1416

Query: 272  KNLISVMLSENPNQRPNICQVL 293
            ++ +      NP +RP   ++L
Sbjct: 1417 RSFLDACFEINPEERPTATELL 1438

>ACR133C Chr3 complement(581468..584023) [2556 bp, 851 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL150W
          Length = 851

 Score = 80.9 bits (198), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 57/200 (28%), Positives = 100/200 (50%), Gaps = 33/200 (16%)

Query: 105 VFLLMEYCSAGGLIDFMNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIEN 164
           V++ +EYC    L D++   L+ R+  +E  ++ + I   +   H+L    +HRD+K+EN
Sbjct: 103 VWMALEYCPGNELYDYL--LLKQRIPLDETRRLFAQIVSAVFYAHSL--QCVHRDLKLEN 158

Query: 165 VLISDDKTFKVCDFGSV--CGVIRPPKNAQEFSYVQNDILKNTTAQYRSPEMI--DLYRG 220
           +L+  +    + DFG    C            +  Q + +  TT  Y +PE+I  + Y G
Sbjct: 159 ILLDKNGYAMLTDFGFTRECA-----------TKTQLETVCGTTV-YMAPELIKREAYDG 206

Query: 221 HPINEKSDIWALGVFLYKLCYYTTPFEKVGDA----AILHSRFQFPA-YPQY-SDRLKNL 274
           + +    D W+LG+ LY + +   PF++         I+H     PA   +Y S + K+L
Sbjct: 207 YKV----DTWSLGIILYTMLHGYMPFDEDDTVRTGLKIMHEE---PAVLDEYTSPQAKDL 259

Query: 275 ISVMLSENPNQRPNICQVLE 294
           I  +L +N  QRPN+ +VL+
Sbjct: 260 IVRLLDKNAAQRPNLNEVLQ 279

>Ecym_1030 Chr1 (56043..57365) [1323 bp, 440 aa] {ON} similar to
           Ashbya gossypii AFR724C
          Length = 440

 Score = 79.7 bits (195), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 68/279 (24%), Positives = 134/279 (48%), Gaps = 32/279 (11%)

Query: 21  QARIIKYLTSGGFAHIYSAEISPADPNSIGNVACLKRVLVPD-KQSLNVLRAEVDAMKLL 79
           Q  I++ +  G F  +Y A     +      +  +K V + D  + +++L  E+  +  L
Sbjct: 19  QYEILQCIGRGNFGDVYKARYLATN-----EIVAIKVVNLEDTDEPIDLLAQEIFFLSEL 73

Query: 80  RGNKHVVSYIDSHAAKSGAQDGSYEVFLLMEYCSAGGLIDFMNTRLQNRLTENEVLKIMS 139
           R + ++ +Y  +             ++++MEYC  G   + +    +++LTE++   I+S
Sbjct: 74  R-SPYITNYKTAFLV-------DVSMWIVMEYCGGGSCAELLKYTPEHKLTEDQCAFIVS 125

Query: 140 DITQGIAAMHALLPPLIHRDIKIENVLISDDKTFKVCDFGSVCGVIRPPKNAQEFSYVQN 199
           ++  G+  +H+     IHRDIK  N+L++D+   K+ DFG V G +   +    F     
Sbjct: 126 EVLVGLDYLHSQRK--IHRDIKSANILLTDNGHVKLGDFG-VSGQMMVTRKRDTFV---- 178

Query: 200 DILKNTTAQYRSPEMIDL-YRGHPINEKSDIWALGVFLYKLCYYTTPFEKVGDAAILHS- 257
                 T  + +PE+ID   +G+  NE +DIW+LG+ + +L     P +K      L + 
Sbjct: 179 -----GTPFWMAPEVIDRNKKGY--NEMADIWSLGITVIELLMGHPPLDKYDAMKALMAI 231

Query: 258 --RFQFPAYPQYSDRLKNLISVMLSENPNQRPNICQVLE 294
             R       ++S   K+ ++  L ++P+QRP   ++L+
Sbjct: 232 PKRDPPKLDKRFSSHAKDFVAQCLIKDPSQRPTASELLK 270

>TBLA0B08250 Chr2 complement(1968879..1972922) [4044 bp, 1347 aa]
           {ON} Anc_3.92 YDR490C
          Length = 1347

 Score = 80.9 bits (198), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 60/216 (27%), Positives = 106/216 (49%), Gaps = 18/216 (8%)

Query: 105 VFLLMEYCSAGGLIDFMNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIEN 164
           ++ L+EY S G L+  +  +      E   +   + I   I  +H++   +IHRDIK EN
Sbjct: 334 LYFLLEYASNGDLLTLL--KKYGSFDETSTIYFTAQIIDSIHYIHSM--GIIHRDIKPEN 389

Query: 165 VLISDDKTFKVCDFGSVCGVIRPPKNAQEFSYVQNDILKNT-----TAQYRSPEMI-DLY 218
           +L++ D   K+ DFG+   ++ P + +Q  S    ++L+ +     TA+Y SPE++ D Y
Sbjct: 390 ILLTKDFKIKLTDFGT-AKILDPSQPSQSQSQPHFNLLERSKSFVGTAEYVSPELLTDSY 448

Query: 219 RGHPINEKSDIWALGVFLYKLCYYTTPFEKVGDAAILHS--RFQFPAYPQYSDRLKNLIS 276
                + + DIWA G  L++L     PF+   +        + Q+     +   L++LI 
Sbjct: 449 ----TDSRCDIWAFGCILFQLIAGKPPFKATNEYLTFQKIIKLQYAFTAGFPTILRDLIK 504

Query: 277 VMLSENPNQRPNICQVLEEV-SRIQNVPCPLRNFYL 311
            +L +NPN R  I Q+   +  R ++   P   +YL
Sbjct: 505 KILIKNPNNRLTIHQIKSHLFYRSKDFSNPWNIWYL 540

>KLTH0G13288g Chr7 complement(1139058..1142486) [3429 bp, 1142 aa]
           {ON} similar to uniprot|P13186 Saccharomyces cerevisiae
           YLR096W KIN2 Serine/threonine protein kinase involved in
           regulation of exocytosis localizes to the cytoplasmic
           face of the plasma membrane closely related to Kin1p and
           to YDR122W uniprot|P13185 Saccharomyces cerevisiae
           YDR122W KIN1 Serine/threonine protein kinase involved in
           regulation of exocytosis; localizes to the cytoplasmic
           face of the plasma membrane; closely related to Kin2p
          Length = 1142

 Score = 80.9 bits (198), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 61/213 (28%), Positives = 101/213 (47%), Gaps = 30/213 (14%)

Query: 102 SYEVFLLMEYCSAGGLIDFMNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIK 161
           S   ++L EY S G L+D++       L E    K    I   +  +H  L  ++HRD+K
Sbjct: 280 SNHFYMLFEYVSGGQLLDYIIQ--HGSLRERSARKFARGIASALQYLH--LNNIVHRDLK 335

Query: 162 IENVLISDDKTFKVCDFGSVCGVIRPPKNAQEFS----YVQNDILKNTTAQYRSPEMIDL 217
           IEN++IS     K+ DFG +  +  P K    F     +   ++LK     Y  PE+   
Sbjct: 336 IENIMISTSGEIKIIDFG-LSNMFNPKKQLHTFCGSLYFAAPELLK--ACPYTGPEV--- 389

Query: 218 YRGHPINEKSDIWALGVFLYKLCYYTTPFEKVGDAAILHSRFQFP--AYPQY-SDRLKNL 274
                     D+W+ GV LY L     PF+   ++++LH + +     YPQ+ S  + +L
Sbjct: 390 ----------DVWSFGVVLYVLVCGKVPFDD-ENSSVLHEKIKQGKVEYPQHLSIEVISL 438

Query: 275 ISVMLSENPNQRPNICQVL--EEVSRIQNVPCP 305
           +S ML  +P++R  + QV+  + + R  + P P
Sbjct: 439 LSKMLVVDPSKRATLKQVVNHQWMQRGYDFPAP 471

>KNAG0F00290 Chr6 (31750..35127) [3378 bp, 1125 aa] {ON} Anc_1.52
           YDR507C
          Length = 1125

 Score = 80.5 bits (197), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 68/252 (26%), Positives = 111/252 (44%), Gaps = 35/252 (13%)

Query: 51  NVACLKRVLVPDKQSLNVLRAEVDAMKLLRGNKHVVSYIDSHAAKSGAQDGSYEVFLLME 110
           NV  +     PD     + R E+  MKLL  + +V+   D     S        +++++E
Sbjct: 58  NVTSMVDNTTPDALPYGIER-EIVIMKLL-NHANVLRLYDVWETNSN-------LYMVLE 108

Query: 111 YCSAGGLIDFMNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIENVLISDD 170
           Y   G L + +  R    L ENE ++    I  GI+  HAL   ++HRD+K EN+L+   
Sbjct: 109 YAEKGELFNLLVER--GPLPENEAIRFFRQIIIGISYCHAL--GIVHRDLKPENLLLDTK 164

Query: 171 KTFKVCDFGSVCGVIRPPKNAQEFSYVQNDILKNTTA--QYRSPEMIDLYRGHPINEKSD 228
              K+ DFG                  ++ +L+ +     Y +PE++     H     SD
Sbjct: 165 YNIKIADFGMAA------------LETEDKLLETSCGSPHYAAPEIVSGIPYHGF--ASD 210

Query: 229 IWALGVFLYKLCYYTTPF-EKVGD-----AAILHSRFQFPAYPQYSDRLKNLISVMLSEN 282
           +W+ GV LY L     PF E+ G+       +   +F+ P   + S   +NLIS +L  N
Sbjct: 211 VWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQAGQFEMPEDDEISKEAQNLISKILVVN 270

Query: 283 PNQRPNICQVLE 294
           P +R     +L+
Sbjct: 271 PAERITARDILK 282

>Smik_10.147 Chr10 (239101..243537) [4437 bp, 1478 aa] {ON} YJL095W
            (REAL)
          Length = 1478

 Score = 80.5 bits (197), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 68/271 (25%), Positives = 123/271 (45%), Gaps = 38/271 (14%)

Query: 48   SIGNVACLKRVLVPDKQSLN--------VLRAEVDAMKLLRGNKHVVSYIDSHAAKSGAQ 99
            + G +  +K+V VP   S N         LR+EV  +K L  + ++V Y+         +
Sbjct: 1196 TTGEMMAVKQVEVPKYSSQNEAILSTVEALRSEVSTLKDL-DHLNIVQYLGFEN-----K 1249

Query: 100  DGSYEVFLLMEYCSAGGLIDFMNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRD 159
            D  Y +FL  EY + G +   +  R+  R  E  +  + + + +G+A +H+    ++HRD
Sbjct: 1250 DNIYSLFL--EYVAGGSVGSLI--RMYGRFDEPLIKHLTTQVLKGLAYLHS--KGILHRD 1303

Query: 160  IKIENVLISDDKTFKVCDFGSVCGVIRPPKNAQEFSYVQNDILKNTTAQYRSPEMIDLYR 219
            +K +N+L+  D   K+ DF    G+ R  K+     Y  +D+    T  + +PEM+D  +
Sbjct: 1304 MKADNLLLDQDGICKISDF----GISRKSKDI----YSNSDMTMRGTVFWMAPEMVDTKQ 1355

Query: 220  GHPINEKSDIWALGVFLYKLCYYTTPFEKVGDAAIL----HSRFQFP----AYPQYSDRL 271
            G+  + K DIW+LG  + ++     P+  +   A +     S+   P      P  S   
Sbjct: 1356 GY--SAKVDIWSLGCIVLEMFAGKRPWSNLEVVAAMFKIGKSKSAPPIPEDTLPLISQVG 1413

Query: 272  KNLISVMLSENPNQRPNICQVLEEVSRIQNV 302
            +  +      NP +RP   ++L     + NV
Sbjct: 1414 RGFLDACFEINPEKRPTATELLSHRFSVVNV 1444

>SAKL0H07084g Chr8 complement(619288..622047) [2760 bp, 919 aa] {ON}
           weakly similar to uniprot|Q03002 Saccharomyces
           cerevisiae YPL141C Hypothetical ORF
          Length = 919

 Score = 80.5 bits (197), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 54/205 (26%), Positives = 107/205 (52%), Gaps = 28/205 (13%)

Query: 99  QDGSYEVFLLMEYCSAGGLIDFMNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHR 158
           Q+  Y + +++EY S G    ++  +   RL E+   ++ + +  G+  MH+    L+HR
Sbjct: 118 QNSKY-IGIVLEYASGGEFYRYIQKK--RRLKEHAACRLFAQLISGVHYMHS--KGLVHR 172

Query: 159 DIKIENVLISDDKTFKVCDFGSVCGVIRPPKNAQEFSYVQNDILKNTTAQ--YRSPEMID 216
           D+K+EN+L+  ++   + DFG V           EF++ +N+++K +     Y +PE++ 
Sbjct: 173 DLKLENLLLDKNENLLITDFGFV----------NEFNH-KNELMKTSCGSPCYAAPELVV 221

Query: 217 LYRGHPINEKSDIWALGVFLYKLCYYTTPFEK-----VGD--AAILHSRFQFP-AYPQYS 268
             + +    K+DIW+ GV +Y +     P++       GD  A + H   + P  +P+Y 
Sbjct: 222 TTKPYEA-RKADIWSCGVIMYAMLAGYLPWDDDSENPEGDDIAKLYHYITKTPLKFPEYI 280

Query: 269 DRL-KNLISVMLSENPNQRPNICQV 292
           + + ++L+  +L  NP +R N+ QV
Sbjct: 281 NPVPRDLLRRILVSNPKKRLNLRQV 305

>Kpol_1044.3 s1044 (4910..5845,5849..7711) [2799 bp, 932 aa] {ON}
           (4910..5845,5849..7711) [2799 nt, 933 aa]
          Length = 932

 Score = 80.5 bits (197), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 60/179 (33%), Positives = 89/179 (49%), Gaps = 23/179 (12%)

Query: 117 LIDFMNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIENVLISDDKTFKVC 176
           L DF+  +  +++ E E   I   I  GI  +H L   +IHRDIK EN++I  +   +V 
Sbjct: 766 LFDFIEKK--DKIDEVEQKLIFKQIVAGIKHIHGL--GIIHRDIKTENIIIDSEGCVQVI 821

Query: 177 DFGSVCGVIRPPKNAQEFSYVQNDILKNTTAQYRSPEMIDLYRGHPINEK-SDIWALGVF 235
           DFGS       P   Q F         + T  Y SPE++   +G P   K  D+WALG+ 
Sbjct: 822 DFGSAAYATNGP--FQVF---------HGTIDYASPEVL---KGEPYEGKPQDVWALGIL 867

Query: 236 LYKLCYYTTPFEKVGDAAILHSRFQF-PAYPQ-YSDRLKNLISVMLSENPNQRPNICQV 292
           LY + +  TPF  V  A I+ +  +  PA+ +  SD+ + LI  ML +    RP I ++
Sbjct: 868 LYIITFKQTPFNSV--AEIIENELEIDPAHSENVSDQCRVLIHKMLDKKAWARPKISEI 924

>YJL095W Chr10 (247255..251691) [4437 bp, 1478 aa] {ON}
            BCK1Mitogen-activated protein (MAP) kinase kinase kinase
            acting in the protein kinase C signaling pathway, which
            controls cell integrity; upon activation by Pkc1p
            phosphorylates downstream kinases Mkk1p and Mkk2p
          Length = 1478

 Score = 80.5 bits (197), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 65/262 (24%), Positives = 121/262 (46%), Gaps = 38/262 (14%)

Query: 48   SIGNVACLKRVLVPDKQSLN--------VLRAEVDAMKLLRGNKHVVSYIDSHAAKSGAQ 99
            + G +  +K+V VP   S N         LR+EV  +K L  + ++V Y+       G +
Sbjct: 1196 TTGEMMAVKQVEVPKYSSQNEAILSTVEALRSEVSTLKDL-DHLNIVQYL-------GFE 1247

Query: 100  DGSYEVFLLMEYCSAGGLIDFMNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRD 159
            + +    L +EY + G +   +  R+  R  E  +  + + + +G+A +H+    ++HRD
Sbjct: 1248 NKNNIYSLFLEYVAGGSVGSLI--RMYGRFDEPLIKHLTTQVLKGLAYLHS--KGILHRD 1303

Query: 160  IKIENVLISDDKTFKVCDFGSVCGVIRPPKNAQEFSYVQNDILKNTTAQYRSPEMIDLYR 219
            +K +N+L+  D   K+ DF    G+ R  K+     Y  +D+    T  + +PEM+D  +
Sbjct: 1304 MKADNLLLDQDGICKISDF----GISRKSKDI----YSNSDMTMRGTVFWMAPEMVDTKQ 1355

Query: 220  GHPINEKSDIWALGVFLYKLCYYTTPFEKVGDAAIL----HSRFQFP----AYPQYSDRL 271
            G+  + K DIW+LG  + ++     P+  +   A +     S+   P      P  S   
Sbjct: 1356 GY--SAKVDIWSLGCIVLEMFAGKRPWSNLEVVAAMFKIGKSKSAPPIPEDTLPLISQIG 1413

Query: 272  KNLISVMLSENPNQRPNICQVL 293
            +N +      NP +RP   ++L
Sbjct: 1414 RNFLDACFEINPEKRPTANELL 1435

>KLLA0C01650g Chr3 (128119..131457) [3339 bp, 1112 aa] {ON} similar
           to uniprot|Q12263 Saccharomyces cerevisiae YDR507C
          Length = 1112

 Score = 80.5 bits (197), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 80/302 (26%), Positives = 133/302 (44%), Gaps = 50/302 (16%)

Query: 7   GIYTQGTALTVGSHQARIIKYLTSGG---FAHIYSAEISPADPNSI--GNVACLKRVLVP 61
           G +  G+ L VGS    ++ Y  + G      I S  I  A  +++  GN         P
Sbjct: 15  GPWKLGSTLGVGSTGKVVMAYNETKGQQAAVKIISKSIFNAQGSTMIGGND--------P 66

Query: 62  DKQSLNVLRAEVDAMKLLRGNKHVVSYIDSHAAKSGAQDGSYEVFLLMEYCSAGGLIDFM 121
           D     + R E+  MKLL  + +V+   D         + S ++++++EY   G L + +
Sbjct: 67  DVLPYGIER-EIIIMKLL-NHPNVLRLYD-------VWETSKDLYMVLEYVEKGELFNLL 117

Query: 122 NTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIENVLISDDKTFKVCDFGSV 181
             R    L ENE ++    I  GI+  HAL   ++HRD+K EN+L+      K+ DFG  
Sbjct: 118 VER--GPLPENEAVRFFRQIIIGISYCHAL--GIVHRDLKPENLLLDHKFNVKLADFGMA 173

Query: 182 CGVIRPPKNAQEFSYVQNDILKNTTA---QYRSPEMIDLYRGHPINEKSDIWALGVFLYK 238
                             D L  T+     Y +PE++     H    +SD+W+ GV LY 
Sbjct: 174 A-------------LESKDKLLETSCGSPHYAAPEIVSGLPYHGF--ESDVWSCGVILYA 218

Query: 239 LCYYTTPF-EKVGD-----AAILHSRFQFPAYPQYSDRLKNLISVMLSENPNQRPNICQV 292
           L     PF E+ G+       +   +F+ P   + S   ++LI+ +L+ +P QR    ++
Sbjct: 219 LLTGRLPFDEEDGNIRNLLLKVQSGKFEMPGDDEISSEAQDLIARILTVDPEQRIKTREI 278

Query: 293 LE 294
           L+
Sbjct: 279 LK 280

>CAGL0B01925g Chr2 (176316..179150) [2835 bp, 944 aa] {ON} similar
           to uniprot|P13185 Saccharomyces cerevisiae YDR122w KIN1
           or uniprot|P13186 Saccharomyces cerevisiae YLR096w KIN2
          Length = 944

 Score = 80.1 bits (196), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 58/215 (26%), Positives = 105/215 (48%), Gaps = 22/215 (10%)

Query: 99  QDGSYEVFLLMEYCSAGGLIDFMNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHR 158
           Q  S   ++  E+ S G L+D++       L EN   K+   I   +  +HA    ++HR
Sbjct: 160 QTLSNHYYMFFEFISGGQLLDYIIQ--HGSLKENHARKVSRGILSALQYLHA--NNIVHR 215

Query: 159 DIKIENVLISDDKTFKVCDFGSVCGVIRPPKNAQEFSYVQNDILKNTTAQYRSPEMIDLY 218
           D+KIEN+++S     K+ DFG +  +  P K+ Q F           +  + +PE++   
Sbjct: 216 DLKIENIMLSKTGEIKLIDFG-LSNMYDPRKSLQTFC---------GSLYFAAPELL--- 262

Query: 219 RGHP-INEKSDIWALGVFLYKLCYYTTPFEKVGDAAILHSRFQFP--AYPQY-SDRLKNL 274
           + HP +  + D+W+ GV LY L     PF+    +A LH + +     YPQ+ S  + +L
Sbjct: 263 KAHPYLGPEVDVWSFGVVLYVLVCGKVPFDDENSSA-LHEKIKKGKVTYPQFLSIDVISL 321

Query: 275 ISVMLSENPNQRPNICQVLEEVSRIQNVPCPLRNF 309
           +S +L  +P +R  + QV+     ++    P +++
Sbjct: 322 LSKILVVDPQKRATLQQVVNHQWMLKGYDFPPQSY 356

>KLLA0F14190g Chr6 (1311121..1315137) [4017 bp, 1338 aa] {ON}
            uniprot|O60030 Kluyveromyces lactis BCK1 MAP kinase
            kinase kinase
          Length = 1338

 Score = 80.5 bits (197), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 63/254 (24%), Positives = 117/254 (46%), Gaps = 35/254 (13%)

Query: 31   GGFAHIYSAEISPADPNSIGNVACLKRVLVPDKQS--------LNVLRAEVDAMKLLRGN 82
            G F  +Y A        + G +  +K+V VP+  S        +  L++EV  +K L  +
Sbjct: 1047 GSFGAVYLALNV-----TTGEMLAVKQVTVPEFSSQDESAISMVEALKSEVSTLKDL-NH 1100

Query: 83   KHVVSYIDSHAAKSGAQDGSYEVFLLMEYCSAGGLIDFMNTRLQNRLTENEVLKIMSDIT 142
             ++V Y+         ++G Y +FL  EY + G +   +  R+  R  +  +  +   + 
Sbjct: 1101 VNIVQYLGFEE-----KNGIYSLFL--EYVAGGSVGSLI--RMYGRFDDQLIRHLTKQVL 1151

Query: 143  QGIAAMHALLPPLIHRDIKIENVLISDDKTFKVCDFGSVCGVIRPPKNAQEFSYVQNDIL 202
            +G+A +H+    ++HRD+K +N+L+ +D   K+ DF    G+ R   N     Y  +D+ 
Sbjct: 1152 EGLAYLHS--KGILHRDMKADNLLLDNDGVCKISDF----GISRKSNNI----YSNSDMT 1201

Query: 203  KNTTAQYRSPEMIDLYRGHPINEKSDIWALGVFLYKLCYYTTPFEKVGDAAILHSRFQFP 262
               T  + +PEM+D   G+  + K DIW+LG  + ++     P+      A +    +  
Sbjct: 1202 MRGTVFWMAPEMVDTAHGY--SAKVDIWSLGCVVLEMFAGKRPWSNFEVVAAMFQIGKSK 1259

Query: 263  AYPQYSDRLKNLIS 276
              P   D  K+L+S
Sbjct: 1260 TAPPIPDDTKDLVS 1273

>Skud_16.132 Chr16 (239797..242571) [2775 bp, 924 aa] {ON} YPL150W
           (REAL)
          Length = 924

 Score = 80.1 bits (196), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 81/314 (25%), Positives = 141/314 (44%), Gaps = 85/314 (27%)

Query: 8   IYTQGTA--LT-VGSHQARIIKYLTSGGFAHIYSAEISPADPNSIGNVACLKRVLVPDKQ 64
           +Y+Q T+  LT VG++  +I+K +  G F  +Y A   P          CLK     DK 
Sbjct: 26  LYSQFTSDELTEVGNY--KILKQIGEGSFGKVYLALHRPTHRK-----VCLK---TSDKN 75

Query: 65  SLNVLRA-----EVDAMKLLRGNKHVVSYIDSHAAKSGAQDGSYEVFLLMEYCSAGGLID 119
             N++R      + D   + +  + +V+                +V++ +EYC    L D
Sbjct: 76  DPNIVREVFYHRQFDFPYITKLYEVIVT--------------ESKVWMALEYCPGKELYD 121

Query: 120 FMNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIENVLISDDKTFKVCDFG 179
            + +   +R++  E  ++ + I+  +   H++    +HRD+K+EN+L+  +   K+ DFG
Sbjct: 122 HLLS--LHRISLLECGELFAQISGAVYYAHSM--HCVHRDLKLENILLDKNGNAKLTDFG 177

Query: 180 ------------SVCGVIRPPKNAQEFSYVQNDILKNTTAQYRSPEMI--DLYRGHPINE 225
                       +VCG                      T  Y +PE+I    Y G  I  
Sbjct: 178 FTRECMTKTTLETVCG----------------------TTVYMAPELIGRKTYDGFKI-- 213

Query: 226 KSDIWALGVFLYKLCYYTTPFEKVGDAAILHSRFQF-PAYPQYSDRL-----KNLISVML 279
             D W+LGV LY L   + PF+   +A    ++++     P+Y  +L     K+LIS +L
Sbjct: 214 --DTWSLGVILYTLITGSLPFDDDDEA---KTKWKIVNEEPKYDPKLIPDDAKDLISRLL 268

Query: 280 SENPNQRPNICQVL 293
           ++NP +RP++ QVL
Sbjct: 269 AKNPGERPSLPQVL 282

>Skud_3.39 Chr3 (66201..69254) [3054 bp, 1017 aa] {ON} YCL024W
           (REAL)
          Length = 1017

 Score = 80.1 bits (196), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 85/300 (28%), Positives = 134/300 (44%), Gaps = 51/300 (17%)

Query: 7   GIYTQGTALTVGSHQARIIKYLTSGGFAHIYSAEI-SPADPNSIGNVACLKRVLVPDKQS 65
           G +  G  L VGS  A  ++     G AH  + +I S +  N+ GN      VL      
Sbjct: 19  GPWKLGETLGVGS--AGKVRLAQHEGTAHKTAVKIISKSIFNTEGNYGNHGSVL-----P 71

Query: 66  LNVLRAEVDAMKLLRGNKHVVSYIDSHAAKSGAQDGSYEVFLLMEYCSAGGLIDFMNTRL 125
            N+ R E+  MKLL  + +V+   D         + +  ++L++EY   G L + +  R 
Sbjct: 72  YNIER-EIVIMKLL-SHPNVLGLYD-------VWETNNNLYLILEYAEKGELFNLLVDR- 121

Query: 126 QNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIENVLISDDKTFKVCDFGSVCGVI 185
              L E E +K    I   ++  HAL   ++HRD+K EN+L+  D   KV DFG      
Sbjct: 122 -GALPEREAMKCFRQIIIAVSYCHAL--GIVHRDLKPENLLLDSDYNIKVADFG------ 172

Query: 186 RPPKNAQEFSYVQND--ILKNTTA--QYRSPEMIDL--YRGHPINEKSDIWALGVFLYKL 239
                    + +Q D  +L+ +     Y +PE++    Y G      SD+W+ GV L+ L
Sbjct: 173 --------MAALQTDAALLETSCGSPHYAAPEIVSGLPYEGF----SSDVWSCGVILFAL 220

Query: 240 CYYTTPF-EKVGDAAIL-----HSRFQFPAYPQYSDRLKNLISVMLSENPNQRPNICQVL 293
                PF E+ G+   L       +F+ P   + S   ++LIS +L  +P QR  I  +L
Sbjct: 221 LTGRLPFDEENGNIRTLLLKVQRGQFEMPDDTEISKDAQDLISKILVVDPAQRIKIRDIL 280

>TDEL0H03640 Chr8 complement(600211..603924) [3714 bp, 1237 aa] {ON}
            Anc_7.86 YAL017W
          Length = 1237

 Score = 80.1 bits (196), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 55/184 (29%), Positives = 88/184 (47%), Gaps = 22/184 (11%)

Query: 116  GLIDFMN-TRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIENVLISDDKTFK 174
            G ID  +   L+  +TE E   I   +  GI  +H     ++HRDIK ENV++      K
Sbjct: 1069 GSIDLFDLIELKTNMTEFEAKLIFKQVISGIKHLHE--QGIVHRDIKDENVIVDSKGFVK 1126

Query: 175  VCDFGSVCGVIRPPKNAQEFSYVQNDILKNTTAQYRSPEMI--DLYRGHPINEKSDIWAL 232
            + DFGS   V   P +     +V        T  Y +PE++  + Y G P     DIWA+
Sbjct: 1127 LIDFGSAAYVKSGPFDV----FV-------GTIDYAAPEVLGGEPYEGKP----QDIWAV 1171

Query: 233  GVFLYKLCYYTTPFEKVGDAAILHSRFQFPAYPQYSDRLKNLISVMLSENPNQRPNICQV 292
            G+ LY + +   PF  + +  I+    +F    + S+   NLI  +L++N  +RP I  +
Sbjct: 1172 GILLYTIVFKENPFYNIDE--IMEGTLKFSIGSEVSEECVNLIKKILNKNAPKRPTIQDI 1229

Query: 293  LEEV 296
             ++V
Sbjct: 1230 YDDV 1233

>KLTH0D03454g Chr4 (327039..331340) [4302 bp, 1433 aa] {ON} similar to
            uniprot|Q01389 Saccharomyces cerevisiae YJL095W BCK1
            Mitogen-activated protein (MAP) kinase kinase kinase
            acting in the protein kinase C signaling pathway which
            controls cell integrity upon activation by Pkc1p
            phosphorylates downstream kinases Mkk1p and Mkk2p
          Length = 1433

 Score = 80.1 bits (196), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 64/261 (24%), Positives = 122/261 (46%), Gaps = 36/261 (13%)

Query: 48   SIGNVACLKRVLVP-----DKQSLNVLRAEVDAMKLLRGNKHV--VSYIDSHAAKSGAQD 100
            + G +  +K+V VP     D+ +L+VL A    +  L+   HV  V Y+       G ++
Sbjct: 1167 TTGEMMAVKQVEVPRYGSQDETTLSVLEALKSEVSTLKDLDHVNIVQYL-------GFEN 1219

Query: 101  GSYEVFLLMEYCSAGGLIDFMNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDI 160
             ++   L +EY + G +   +  RL  R  E+ +  +   + +G+A +H+    ++HRD+
Sbjct: 1220 KNHVYSLFLEYVAGGSVGSLI--RLFGRFDEDLIRFLAVQVLRGLAYLHS--KGILHRDM 1275

Query: 161  KIENVLISDDKTFKVCDFGSVCGVIRPPKNAQEFSYVQNDILKNTTAQYRSPEMIDLYRG 220
            K +N+L+  D   K+ DF    G+ +   N     Y  +D+    T  + +PEM+D  +G
Sbjct: 1276 KADNLLLDVDGICKISDF----GISKKSNNI----YSNSDMTMRGTVFWMAPEMVDTKQG 1327

Query: 221  HPINEKSDIWALGVFLYKLCYYTTPFEKVGDAAILHSRFQF---PAYPQYSDRL-----K 272
            +  + K DIW+LG  + ++     P+      A +    +F   P  P+ + +L     K
Sbjct: 1328 Y--SAKVDIWSLGCVVLEMFAGKRPWSNFEVVAAMFKIGKFKSAPPIPEDTQKLLSAEAK 1385

Query: 273  NLISVMLSENPNQRPNICQVL 293
            + +      +P +RP    +L
Sbjct: 1386 SFLDACFEIDPEKRPTADDLL 1406

>KNAG0D00830 Chr4 complement(130823..131986) [1164 bp, 387 aa] {ON}
           Anc_6.262 YPL236C
          Length = 387

 Score = 78.2 bits (191), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 69/303 (22%), Positives = 134/303 (44%), Gaps = 61/303 (20%)

Query: 55  LKRVLVP--DKQSLNVLRAEVDAMKLLRGNKHVVSYIDSHAAKSGAQDGSYEVFLLMEYC 112
           +++++ P  D +S++    E+D  +  + + +++  +DS   +   +DGS  V +L+ Y 
Sbjct: 88  VRQIMCPFGDIESVSNALKEIDNYRYFK-SPYIMQCLDSQVIQR--RDGSKTVLILLPYL 144

Query: 113 SAGGLIDFMNTRLQN--RLTENEVLKIMSDITQGIAAMH--------------------- 149
             G L D ++  L +  R++E+EV+++M    +G+  +H                     
Sbjct: 145 PLGSLRDAIDRNLLDGIRMSESEVIRVMIGTCRGLLYLHDPTSRGNLGSSMGPQNGMDAV 204

Query: 150 --------ALL------------------PPLIHRDIKIENVLISDDKTFKVCDFGSVCG 183
                   A+L                      H +IK  N+L S D    + + GS+  
Sbjct: 205 SMTLSDDAAMLLDGTPFEMDMLSSHSMKMDSYAHMNIKPSNILFSSDGLPVITELGSLQK 264

Query: 184 VIRPPKNAQEFSYVQNDILKNTTAQYRSPEMIDLYRGHPINEKSDIWALGVFLYKLCYYT 243
           +    +N +    ++    ++ T  Y  PE+++L  G  ++   DIW+LG  LY L +  
Sbjct: 265 LDLKIENVKMLKSIKEWTEEHCTVYYMPPELLNLKVGTVLDCSVDIWSLGCTLYTLLFGI 324

Query: 244 TPF---EKVGDA----AILHSRFQFPAYPQYSDRLKNLISVMLSENPNQRPNICQVLEEV 296
           +PF   E+V +      I  +R+ FP    YS +L ++I   L  NP  RP + ++L ++
Sbjct: 325 SPFKREEQVNEVPLKYGISKARYSFPEGHVYSKKLVSVIETCLQVNPTMRPTVNELLGQL 384

Query: 297 SRI 299
             I
Sbjct: 385 QDI 387

>Skud_3.165 Chr3 (258916..261066) [2151 bp, 716 aa] {ON} YCR091W
           (REAL)
          Length = 716

 Score = 79.7 bits (195), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 53/197 (26%), Positives = 93/197 (47%), Gaps = 22/197 (11%)

Query: 105 VFLLMEYCSAGGLIDFMNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIEN 164
           ++L MEYC  G     + TR   R+TE +     S++   +  +H L    I+RD+K EN
Sbjct: 393 LYLCMEYCMGGEFFRALQTRKSKRITEEDAKFYASEVVAALEYLHLL--GFIYRDLKPEN 450

Query: 165 VLISDDKTFKVCDFG-SVCGVIRPPKNAQEFSYVQNDILKN--------TTAQYRSPEMI 215
           +L+       + DF  S+          ++ +Y+   +  +         T +Y +PE+I
Sbjct: 451 ILLHQSGHVMLSDFDLSIQATGSRDPTMKDSTYLDTKVCSDGFRTNSFVGTEEYLAPEVI 510

Query: 216 DLYRGHPINEKSDIWALGVFLYKLCYYTTPFEKVGD------AAILHSRFQFPAYPQYSD 269
              RG+      D W LG+ +Y++ +  TPF+  GD      + IL    +FP   + S 
Sbjct: 511 ---RGNGHTAAVDWWTLGILVYEMLFGCTPFK--GDNSNETFSKILTEDVKFPHDKEISK 565

Query: 270 RLKNLISVMLSENPNQR 286
             K+LI  +L++N ++R
Sbjct: 566 HCKDLIKRLLNKNESKR 582

>YDR122W Chr4 (694700..697894) [3195 bp, 1064 aa] {ON}
           KIN1Serine/threonine protein kinase involved in
           regulation of exocytosis; localizes to the cytoplasmic
           face of the plasma membrane; closely related to Kin2p
          Length = 1064

 Score = 80.1 bits (196), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 56/198 (28%), Positives = 99/198 (50%), Gaps = 24/198 (12%)

Query: 102 SYEVFLLMEYCSAGGLIDFMNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIK 161
           S   ++L EY S G L+D++       + E++  K    I   +  +HA    ++HRD+K
Sbjct: 216 SNHFYMLFEYVSGGQLLDYIIQ--HGSIREHQARKFARGIASALIYLHA--NNIVHRDLK 271

Query: 162 IENVLISDDKTFKVCDFGSVCGVIRPPKNAQEFSYVQNDILKNTTAQYRSPEMI--DLYR 219
           IEN++ISD    K+ DFG +  +    K    F           +  + +PE++  + Y 
Sbjct: 272 IENIMISDSSEIKIIDFG-LSNIYDSRKQLHTFC---------GSLYFAAPELLKANPYT 321

Query: 220 GHPINEKSDIWALGVFLYKLCYYTTPFEKVGDAAILHSRFQFP--AYPQY-SDRLKNLIS 276
           G  +    D+W+ GV L+ L     PF+   ++++LH + +     YPQ+ S  + +L+S
Sbjct: 322 GPEV----DVWSFGVVLFVLVCGKVPFDD-ENSSVLHEKIKQGKVEYPQHLSIEVISLLS 376

Query: 277 VMLSENPNQRPNICQVLE 294
            ML  +P +R  + QV+E
Sbjct: 377 KMLVVDPKRRATLKQVVE 394

>Kwal_26.7788 s26 (511530..515333) [3804 bp, 1267 aa] {ON} YKL101W
           (HSL1) - Putative protein kinase homologous to S. pombe
           cdr1/nim1 [contig 55] FULL
          Length = 1267

 Score = 80.1 bits (196), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 58/203 (28%), Positives = 94/203 (46%), Gaps = 31/203 (15%)

Query: 100 DGSYEVFLLMEYCSAGGLIDFMNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRD 159
           +   E+FL++EY   G L D++ +R   RL E E +     I +G A  H     + HRD
Sbjct: 127 ENKLELFLVLEYVDGGELFDYLVSR--GRLPEKEAIHYFRQIIEGTAYCHGF--NICHRD 182

Query: 160 IKIENVLIS-DDKTFKVCDFGSVCGVIRPPKNAQEFSYVQNDILKNTTA--QYRSPEMI- 215
           +K EN+L+   +K  K+ DFG                   N +L+ +     Y SPE++ 
Sbjct: 183 LKPENLLLDKKNKRIKIADFGMAA------------LQTSNKLLETSCGSPHYASPEIVM 230

Query: 216 -DLYRGHPINEKSDIWALGVFLYKLCYYTTPFEKVGDAAIL----HSRFQFPAYPQYSDR 270
              Y G P    SD+W+ G+ L+ L     PF       +L      ++Q P     S  
Sbjct: 231 GKNYNGGP----SDVWSCGIILFALLTGHLPFNDDNIKRLLLKVQAGKYQMPQ--SVSSG 284

Query: 271 LKNLISVMLSENPNQRPNICQVL 293
            ++LIS +L  +P++R +I ++L
Sbjct: 285 AQDLISRILVVDPDKRISINEIL 307

>KLTH0G05214g Chr7 (423793..425754) [1962 bp, 653 aa] {ON} weakly
           similar to uniprot|Q03306 Saccharomyces cerevisiae
           YDR466W
          Length = 653

 Score = 79.3 bits (194), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 73/264 (27%), Positives = 120/264 (45%), Gaps = 47/264 (17%)

Query: 47  NSIGNVA---CLKRVLVPDKQSLNVLRAEVDAMKLLRGNKH---VVSYIDSHAAKSGAQD 100
           N + N A   C K+ ++ +++ +  +  E D + LL G  H   V  +   H   +    
Sbjct: 32  NGLRNYAIKVCSKKHIIRERK-VKYVTVEKDLLNLLAGGGHPGVVRLFCTFHDTDN---- 86

Query: 101 GSYEVFLLMEYCSAGGLIDFMNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDI 160
               ++ ++E+ S G L+  +  R   RL E    +I S +   +  MHA    +IHRD+
Sbjct: 87  ----LYYVLEFVSGGELLGLV--RRMGRLPEEWCRRIASQLVDTVDYMHA--KGVIHRDL 138

Query: 161 KIENVLISDDKTFKVCDFGSVC----GVIRPPKNAQEFSYVQNDILKNTTAQYRSPEMID 216
           K ENVL+S +    + DFG+ C    G   P    +  S+V        TA+Y SPE++ 
Sbjct: 139 KPENVLLSQEGRIVITDFGAACCASEGGSAPGAADRAASFVG-------TAEYVSPELLL 191

Query: 217 LYRGHPINEKSDIWALGVFLYKLCYYTTPFEKVGDAAI--------LHSRFQFPAYPQYS 268
             +    +  SD+WALG  +Y+L     PF   GD  +        L  R+ + A P   
Sbjct: 192 HSQ---CSFGSDVWALGCIIYQLTQGAPPFR--GDTELQSFEKIVALDYRWVYAAPPL-- 244

Query: 269 DRLKNLISVMLSENPNQRPNICQV 292
             +  L+  +L  +P QRP+  Q+
Sbjct: 245 --IVALVQSILVLDPLQRPSAKQL 266

>ZYRO0D06776g Chr4 complement(583027..586641) [3615 bp, 1204 aa]
           {ON} similar to uniprot|P13186 Saccharomyces cerevisiae
           YLR096W KIN2 Serine/threonine protein kinase involved in
           regulation of exocytosis localizes to the cytoplasmic
           face of the plasma membrane closely related to Kin1p and
           to YDR122W uniprot|P13185 Saccharomyces cerevisiae
           YDR122W KIN1 Serine/threonine protein kinase involved in
           regulation of exocytosis; localizes to the cytoplasmic
           face of the plasma membrane; closely related to Kin2p
          Length = 1204

 Score = 79.7 bits (195), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 59/210 (28%), Positives = 103/210 (49%), Gaps = 24/210 (11%)

Query: 102 SYEVFLLMEYCSAGGLIDFMNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIK 161
           S   ++L EY S G L+D++       L E+   K    I   +  +HA    ++HRD+K
Sbjct: 236 SNHFYMLFEYVSGGQLLDYIIQ--HGSLREHHARKFARGIASALQYLHA--NNIVHRDLK 291

Query: 162 IENVLISDDKTFKVCDFGSVCGVIRPPKNAQEFSYVQNDILKNTTAQYRSPEMIDLYRGH 221
           IEN++IS     K+ DFG +  +  P      F           +  + +PE++   +  
Sbjct: 292 IENIMISTSGEIKIIDFG-LSNMFDPRTQLHTFC---------GSLYFAAPELL---KAS 338

Query: 222 P-INEKSDIWALGVFLYKLCYYTTPFEKVGDAAILHSRFQFPA--YPQY-SDRLKNLISV 277
           P +  + D+W+ GV LY L     PF+   ++++LH + +     YPQ+ S  + +L+S 
Sbjct: 339 PYVGPEVDVWSFGVVLYVLVCGKVPFDD-ENSSVLHEKIKQGKVDYPQHLSIEVISLLSK 397

Query: 278 MLSENPNQRPNICQVLEEVSRIQ--NVPCP 305
           ML  +P +R ++ QV+E    I+  + P P
Sbjct: 398 MLVVDPRKRASLKQVVEHHWMIRGYDFPAP 427

>Suva_3.190 Chr3 (288639..288813,288870..291766) [3072 bp, 1024 aa]
           {ON} YDR507C (REAL)
          Length = 1024

 Score = 79.7 bits (195), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 68/237 (28%), Positives = 110/237 (46%), Gaps = 42/237 (17%)

Query: 69  LRAEVDAMKLLRGNKHVVSYIDSHAAKSGAQDGSYEVFLLMEYCSAGGLIDFMNTRLQNR 128
           +  E+  MKLL  + +V+S  D         + +  ++L++EY   G L + +  R    
Sbjct: 66  IEREIVVMKLL-SHPNVLSLYD-------VWETNNNLYLILEYAEKGELFNLLVDR--GP 115

Query: 129 LTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIENVLISDDKTFKVCDFGSVCGVIRPP 188
           L E E +K    I   I+  HAL   ++HRD+K EN+L+ +D   K+ DFG         
Sbjct: 116 LPEKEAVKCFRQIIIAISYCHAL--GIVHRDLKPENLLLDNDYNIKIADFG--------- 164

Query: 189 KNAQEFSYVQND--ILKNTTA--QYRSPEMIDL--YRGHPINEKSDIWALGVFLYKLCYY 242
                 + +Q D  +L+ +     Y +PE++    YRG      SD+W+ GV L+ L   
Sbjct: 165 -----MAALQTDARLLETSCGSPHYAAPEIVSGLPYRGFA----SDVWSCGVILFALLTG 215

Query: 243 TTPFEK----VGDAAILHSR--FQFPAYPQYSDRLKNLISVMLSENPNQRPNICQVL 293
             PF++    V D  +   R  F+ P   + S   +NLIS +L  +P QR     +L
Sbjct: 216 RLPFDEDNGNVRDLLLKVQRGQFEMPDATEISKDAQNLISRILVVDPTQRMKTRDIL 272

>TDEL0F04060 Chr6 (749896..753276) [3381 bp, 1126 aa] {ON} Anc_8.279
           YLR096W
          Length = 1126

 Score = 79.7 bits (195), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 58/200 (29%), Positives = 98/200 (49%), Gaps = 28/200 (14%)

Query: 102 SYEVFLLMEYCSAGGLIDFMNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIK 161
           S   ++L EY S G L+D++       L E+   K    I   +  +HA    ++HRD+K
Sbjct: 174 SNHFYMLFEYVSGGQLLDYIIQ--HGSLREHHARKFTRGIASALQYLHA--NNIVHRDLK 229

Query: 162 IENVLISDDKTFKVCDFGSVCGVIRPPKNAQEFS----YVQNDILKNTTAQYRSPEMIDL 217
           IEN++IS     K+ DFG +  +    K    F     +   ++LK   + Y  PE+   
Sbjct: 230 IENIMISTSGEIKIIDFG-LSNLFDKSKQLHTFCGSLYFAAPELLK--ASPYTGPEV--- 283

Query: 218 YRGHPINEKSDIWALGVFLYKLCYYTTPFEKVGDAAILHSRFQFP--AYPQY-SDRLKNL 274
                     D+W+ GV LY L     PF+   ++++LH + +     YPQ+ S  + +L
Sbjct: 284 ----------DVWSFGVVLYVLVCGKVPFDD-ENSSVLHEKIKQGKVEYPQHLSIEVISL 332

Query: 275 ISVMLSENPNQRPNICQVLE 294
           +S ML  +P++R ++ QV+E
Sbjct: 333 LSKMLVVDPHRRASLKQVVE 352

>NDAI0G03450 Chr7 (822716..825562) [2847 bp, 948 aa] {ON} Anc_8.141
          Length = 948

 Score = 79.3 bits (194), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 79/323 (24%), Positives = 144/323 (44%), Gaps = 67/323 (20%)

Query: 14  ALTVGSHQARIIKYLTSGGFAHIYSAEI-------SPADPNSIGNVACLKRVLVPDKQSL 66
           ++T+G     I K +  G FA ++ A +           P     +  + R  + +K+ L
Sbjct: 29  SITIGPDTYMIDKEIGKGSFATVHRAHLLRKQIKDDLTSPPLNFAIKIVSRSKLKNKKLL 88

Query: 67  NVLRAEVDAMKLLRGNKHVVSYIDSHAAKSGAQDGSYEVFLLMEYCSAGGLIDFMNTRLQ 126
             L  E+  +K +  + H+V  ID        +  + + +L+MEYC+ G L   +  R  
Sbjct: 89  ENLEIEIAILKKI-NHPHIVKLID-------CERTTTDFYLIMEYCALGDLTFLIKKR-- 138

Query: 127 NRLTENEVLK---------------------IMSDITQGIAAMHALLPP-LIHRDIKIEN 164
           + L +N  L                      I++ + Q  +A+  L    L+HRDIK +N
Sbjct: 139 HELIKNHPLLEKIFEKYPSPNENYNGLHRAFILNYLQQLASALKFLRSKNLVHRDIKPQN 198

Query: 165 VLI-------SDDKTFKVCDFGSVCGVIRPPKNAQEFSYVQNDILKNTTAQ--------Y 209
           +L+       +D K FK   F  +  +  P     +F + +   L NT+          Y
Sbjct: 199 LLLLTPLINYNDSKAFKKLGFIGIYEL--PILKIADFGFAR--FLPNTSMAETLCGSPLY 254

Query: 210 RSPEMIDLYRGHPINEKSDIWALGVFLYKLCYYTTPFEKVGDAAIL------HSRFQFPA 263
            +PE+++ Y+ +  N K+D+W++G  LY++CY T PF+      +       +++  FP 
Sbjct: 255 MAPEILN-YQKY--NAKADLWSVGTVLYEMCYGTPPFKASNHLELYKKIKRSNNKINFPN 311

Query: 264 YPQYSDRLKNLISVMLSENPNQR 286
           Y Q  + +K LIS +L+ +P +R
Sbjct: 312 YIQIQNDMKILISKLLTFDPQRR 334

>Kwal_26.7154 s26 (237387..241028) [3642 bp, 1213 aa] {ON} YOL045W -
            Hypothetical ORF [contig 47] FULL
          Length = 1213

 Score = 79.3 bits (194), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 65/244 (26%), Positives = 113/244 (46%), Gaps = 32/244 (13%)

Query: 56   KRVLVPD---KQSLNVLRAEVDAMKLLRGNKH--VVSYIDSHAAKSGAQDGSYEVFLLME 110
            +R+LV      + L  + +E+  M  L    H  ++  +D        +D  Y       
Sbjct: 987  ERILVDTWVRDRKLGTIPSEIQIMATLNAKPHENILMLLDFF------EDDDYYYIETAV 1040

Query: 111  YCSAGGLIDFMNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIENVLISDD 170
            + ++G +  F    ++  +TE+E + I   I  GI  +H     ++HRDIK ENV++  +
Sbjct: 1041 HGTSGSIDLFDLIEMKTDMTEHEAMLIFKQIASGIKNLHD--NGIVHRDIKDENVIVDCN 1098

Query: 171  KTFKVCDFGSVCGVIRPPKNAQEFSYVQNDILKNTTAQYRSPEMI--DLYRGHPINEKSD 228
               K+ DFGS   V   P +     +V        T  Y +PE++  + Y G P     D
Sbjct: 1099 GFVKIVDFGSAAYVKSGPFDV----FV-------GTIDYAAPEVLGGEPYEGKP----QD 1143

Query: 229  IWALGVFLYKLCYYTTPFEKVGDAAILHSRFQFPAYPQYSDRLKNLISVMLSENPNQRPN 288
            IWA+GV LY + Y   PF  + +  IL +  +  +  + SD    LI  +L+ + ++RP+
Sbjct: 1144 IWAIGVLLYTIIYKENPFYNIDE--ILDADLRVNSSERISDDCIALIRKILNRSVSKRPS 1201

Query: 289  ICQV 292
            I ++
Sbjct: 1202 IDEI 1205

>Smik_6.347 Chr6 complement(553316..556069) [2754 bp, 917 aa] {ON}
           YPL150W (REAL)
          Length = 917

 Score = 79.3 bits (194), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 80/312 (25%), Positives = 134/312 (42%), Gaps = 82/312 (26%)

Query: 7   GIYTQGTALTVGSHQARIIKYLTSGGFAHIYSAEISPADPNSIGNVACLKRVLVPDKQSL 66
           G +T      VG++  +I+K +  G F  +Y A   P          CLK     DK   
Sbjct: 28  GQFTSDELTEVGNY--KILKQIGEGSFGKVYLALHRPTHRK-----VCLK---TSDKNDP 77

Query: 67  NVLRA-----EVDAMKLLRGNKHVVSYIDSHAAKSGAQDGSYEVFLLMEYCSAGGLIDFM 121
           N++R      + D   + +  + +V+                +V++ +EYC    L D  
Sbjct: 78  NIVREVFYHRQFDFPYITKLYEVIVT--------------ESKVWMALEYCPGKELYD-- 121

Query: 122 NTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIENVLISDDKTFKVCDFG-- 179
           +     RL+  E  ++ + I+  +   H++    +HRD+K+EN+L+  +   K+ DFG  
Sbjct: 122 HLLSLRRLSLLECGELFAQISGAVYYAHSM--HCVHRDLKLENILLDRNGNAKLTDFGFT 179

Query: 180 ----------SVCGVIRPPKNAQEFSYVQNDILKNTTAQYRSPEMID--LYRGHPINEKS 227
                     +VCG                      T  Y +PE+I+   Y G  I    
Sbjct: 180 RECMTKTTLETVCG----------------------TTVYMAPELIERKTYDGFKI---- 213

Query: 228 DIWALGVFLYKLCYYTTPFEKVGDAAILHSRFQF-PAYPQYS-----DRLKNLISVMLSE 281
           DIW+LGV LY L     PF+   D   + ++++     P+Y      D  K+LIS +L++
Sbjct: 214 DIWSLGVILYTLITGYLPFD---DDDEVKTKWKIVNEEPKYDSKFIPDDAKDLISRLLAK 270

Query: 282 NPNQRPNICQVL 293
           NP +RP++ QVL
Sbjct: 271 NPGERPSLPQVL 282

>CAGL0F00913g Chr6 (97023..100643) [3621 bp, 1206 aa] {ON} similar to
            uniprot|P31374 Saccharomyces cerevisiae YAL017w FUN31 or
            uniprot|Q08217 Saccharomyces cerevisiae YOL045w
          Length = 1206

 Score = 79.3 bits (194), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 60/200 (30%), Positives = 93/200 (46%), Gaps = 33/200 (16%)

Query: 98   AQDGSYEVFLLMEYCSAGGLIDFMNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIH 157
             Q GS ++F ++E+              ++ +TE E   I   I  GI  +H     ++H
Sbjct: 1035 GQTGSVDLFDIIEF--------------KSNMTEFEAKLIFKQIVSGIKHLHD--QGIVH 1078

Query: 158  RDIKIENVLISDDKTFKVCDFGSVCGVIRPPKNAQEFSYVQNDILKNTTAQYRSPEMIDL 217
            RDIK ENV++      K+ DFGS   V   P +     +V        T  Y +PE++  
Sbjct: 1079 RDIKDENVIVDSKGFVKLIDFGSAAYVKSGPFDV----FV-------GTIDYAAPEVLG- 1126

Query: 218  YRGHPINEKS-DIWALGVFLYKLCYYTTPFEKVGDAAILHSRFQFPAYPQYSDRLKNLIS 276
              G+P   KS DIWA+G+ LY L Y   PF  + +  IL    +F      S   K LI+
Sbjct: 1127 --GNPYEGKSQDIWAIGILLYTLIYKENPFYNIDE--ILEGELRFNDSADVSQECKALIT 1182

Query: 277  VMLSENPNQRPNICQVLEEV 296
             +L+    +RP I ++ ++V
Sbjct: 1183 KILNRCVRKRPTIDEICQDV 1202

>ZYRO0G03366g Chr7 (261014..265864) [4851 bp, 1616 aa] {ON} similar
           to uniprot|P34244 Saccharomyces cerevisiae YKL101W HSL1
           Nim1p-related protein kinase that regulates the
           morphogenesis and septin checkpoints associates with the
           assembled septin filament required along with Hsl7p for
           bud neck recruitment phosphorylation and degradation of
           Swe1p
          Length = 1616

 Score = 79.3 bits (194), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 57/199 (28%), Positives = 93/199 (46%), Gaps = 31/199 (15%)

Query: 104 EVFLLMEYCSAGGLIDFMNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIE 163
           E++L++EY   G L D++ +R   +L E E +     I QG++  H+    + HRD+K E
Sbjct: 216 ELYLVLEYVDGGELFDYLVSR--GKLGEREAVHYFKQIVQGVSYCHSF--NICHRDLKPE 271

Query: 164 NVLIS-DDKTFKVCDFGSVCGVIRPPKNAQEFSYVQNDILKNTTA--QYRSPEMI--DLY 218
           N+L+   +K+ K+ DFG                 V N +L+ +     Y SPE++    Y
Sbjct: 272 NLLLDKKNKSIKIADFGMAA------------LEVSNKLLQTSCGSPHYASPEIVMGRPY 319

Query: 219 RGHPINEKSDIWALGVFLYKLCYYTTPFEKVGDAAIL----HSRFQFPAYPQYSDRLKNL 274
            G P    SD+W+ G+ L+ L     PF       +L      +F  P     S   K+L
Sbjct: 320 HGGP----SDVWSCGIILFALLTGHLPFNDDNIKKLLLKVQSGKFHMPQ--NLSAEAKDL 373

Query: 275 ISVMLSENPNQRPNICQVL 293
           +S +L  NP +R    ++L
Sbjct: 374 MSKILVVNPFKRIATEEIL 392

>KLLA0E21693g Chr5 complement(1936438..1939488) [3051 bp, 1016 aa]
           {ON} weakly similar to uniprot|P38692 Saccharomyces
           cerevisiae YHR102W KIC1 Protein kinase of the PAK/Ste20
           kinase family required for cell integrity possibly
           through regulating 1 6-beta-glucan levels in the wall
           physically interacts with Cdc31p (centrin) which is a
           component of the spindle pole body
          Length = 1016

 Score = 79.0 bits (193), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 57/225 (25%), Positives = 106/225 (47%), Gaps = 31/225 (13%)

Query: 69  LRAEVDAMKLLRGNKHVVSYIDSHAAKSGAQDGSYEVFLLMEYCSAGGLIDFMNTRLQNR 128
           +R E+  +  L+   ++  Y  S+   +       +++++MEYC+ G L   +   +   
Sbjct: 59  IRKEIQFLSSLKQTPNITHYYGSYLIDT-------KLWVIMEYCAGGSLRTLLRPGI--- 108

Query: 129 LTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIENVLISDDKTFKVCDFGSVCGVIRPP 188
           + E  +  IM +I   + ++H     +IHRDIK  N+LI+++ + K+CDFG    + +  
Sbjct: 109 IEEKYIGVIMREILVALISIHR--DNVIHRDIKAANILIANNGSVKLCDFGVAAQLSQSM 166

Query: 189 KNAQEFSYVQNDILKNTTAQYRSPEMIDLYRGHPINEKSDIWALGVFLYKLCYYTTPFEK 248
              Q  +          T  + +PE+I    G   + K DIW+LG+  Y++     P+  
Sbjct: 167 LKRQTMA---------GTPYWMAPEVI--MEGVYYDTKVDIWSLGITAYEIATGNPPYCH 215

Query: 249 VGDAAILHSRFQFPAYP------QYSDRLKNLISVMLSENPNQRP 287
           +   AI   +    + P      +YS  LK  I++ L E+P +RP
Sbjct: 216 M--EAIRAMQMITKSKPPRLEGREYSQPLKEFIALCLDEDPKERP 258

>Suva_2.283 Chr2 (489490..492759) [3270 bp, 1089 aa] {ON} YDR122W
           (REAL)
          Length = 1089

 Score = 79.0 bits (193), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 56/198 (28%), Positives = 99/198 (50%), Gaps = 24/198 (12%)

Query: 102 SYEVFLLMEYCSAGGLIDFMNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIK 161
           S   ++L EY S G L+D++       + E++  K    I   +  +HA    ++HRD+K
Sbjct: 227 SNHFYMLFEYVSGGQLLDYIIQ--HGSIREHQARKFARGIASALMYLHA--NNIVHRDLK 282

Query: 162 IENVLISDDKTFKVCDFGSVCGVIRPPKNAQEFSYVQNDILKNTTAQYRSPEMI--DLYR 219
           IEN++ISD    K+ DFG +  +    K    F           +  + +PE++  + Y 
Sbjct: 283 IENIMISDSSEIKIIDFG-LSNLYDSRKQLHTFC---------GSLYFAAPELLKANPYT 332

Query: 220 GHPINEKSDIWALGVFLYKLCYYTTPFEKVGDAAILHSRFQFP--AYPQY-SDRLKNLIS 276
           G  +    D+W+ GV L+ L     PF+   ++++LH + +     YPQ+ S  + +L+S
Sbjct: 333 GPEV----DVWSFGVVLFVLVCGKVPFDD-ENSSVLHEKIKQGKVEYPQHLSIEVISLLS 387

Query: 277 VMLSENPNQRPNICQVLE 294
            ML  +P +R  + QV+E
Sbjct: 388 KMLVVDPKRRATLKQVVE 405

>YPL150W Chr16 (268188..270893) [2706 bp, 901 aa] {ON} Protein
           kinase of unknown cellular role; binds
           phosphatidylinositols and cardiolipin in a large-scale
           study
          Length = 901

 Score = 79.0 bits (193), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 81/314 (25%), Positives = 139/314 (44%), Gaps = 85/314 (27%)

Query: 8   IYTQGTA--LT-VGSHQARIIKYLTSGGFAHIYSAEISPADPNSIGNVACLKRVLVPDKQ 64
           +Y+Q T+  LT VG++  +I+K +  G F  +Y A   P          CLK     DK 
Sbjct: 26  LYSQFTSDELTEVGNY--KILKQIGEGSFGKVYLALHRPTHRK-----VCLK---TSDKN 75

Query: 65  SLNVLRA-----EVDAMKLLRGNKHVVSYIDSHAAKSGAQDGSYEVFLLMEYCSAGGLID 119
             N++R      + D   + +  + +V+                +V++ +EYC    L D
Sbjct: 76  DPNIVREVFYHRQFDFPYITKLYEVIVT--------------ESKVWMALEYCPGKELYD 121

Query: 120 FMNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIENVLISDDKTFKVCDFG 179
             +     R++  E  ++ + I+  +   H++    +HRD+K+EN+L+  +   K+ DFG
Sbjct: 122 --HLLSLRRISLLECGELFAQISGAVYYAHSM--HCVHRDLKLENILLDKNGNAKLTDFG 177

Query: 180 ------------SVCGVIRPPKNAQEFSYVQNDILKNTTAQYRSPEMID--LYRGHPINE 225
                       +VCG                      T  Y +PE+I+   Y G  I  
Sbjct: 178 FTRECMTKTTLETVCG----------------------TTVYMAPELIERRTYDGFKI-- 213

Query: 226 KSDIWALGVFLYKLCYYTTPFEKVGDAAILHSRFQF-PAYPQYS-----DRLKNLISVML 279
             DIW+LGV LY L     PF+   +A    ++++     P+Y      D  ++LIS +L
Sbjct: 214 --DIWSLGVILYTLITGYLPFDDDDEAK---TKWKIVNEEPKYDAKVIPDDARDLISRLL 268

Query: 280 SENPNQRPNICQVL 293
           ++NP +RP++ QVL
Sbjct: 269 AKNPGERPSLSQVL 282

>Kwal_56.23717 s56 complement(674222..676798) [2577 bp, 858 aa] {ON}
           YDR122W (KIN1) - Serine/threonine protein kinase [contig
           174] PARTIAL
          Length = 858

 Score = 78.6 bits (192), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 59/213 (27%), Positives = 101/213 (47%), Gaps = 30/213 (14%)

Query: 102 SYEVFLLMEYCSAGGLIDFMNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIK 161
           S   ++L EY S G L+D++       L E    K    I   +  +H  +  ++HRD+K
Sbjct: 5   SNHFYMLFEYVSGGQLLDYIIQ--HGSLRERSARKFARGIASALQYLH--MNNIVHRDLK 60

Query: 162 IENVLISDDKTFKVCDFGSVCGVIRPPKNAQEFS----YVQNDILKNTTAQYRSPEMIDL 217
           IEN++IS     K+ DFG +  +  P K    F     +   ++LK     Y  PE+   
Sbjct: 61  IENIMISTSGEIKIIDFG-LSNMYNPKKQLHTFCGSLYFAAPELLK--ACPYTGPEV--- 114

Query: 218 YRGHPINEKSDIWALGVFLYKLCYYTTPFEKVGDAAILHSRFQFP--AYPQY-SDRLKNL 274
                     D+W+ GV L+ L     PF+   ++++LH + +     YPQ+ S  + +L
Sbjct: 115 ----------DVWSFGVVLFVLVCGKVPFDD-ENSSVLHEKIKQGKVEYPQHLSIEVISL 163

Query: 275 ISVMLSENPNQRPNICQVL--EEVSRIQNVPCP 305
           +S ML  +P +R ++ QV+  + + R  + P P
Sbjct: 164 LSKMLVVDPTKRASLKQVVNHQWMQRGYDFPAP 196

>YDR523C Chr4 complement(1485566..1487038) [1473 bp, 490 aa] {ON}
           SPS1Putative protein serine/threonine kinase expressed
           at the end of meiosis and localized to the prospore
           membrane, required for correct localization of enzymes
           involved in spore wall synthesis
          Length = 490

 Score = 77.8 bits (190), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 59/200 (29%), Positives = 97/200 (48%), Gaps = 32/200 (16%)

Query: 105 VFLLMEYCSAGGLIDFMNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIEN 164
           ++++MEYC  G   D +     N L E +V  I+ ++T G+  +H      IHRDIK  N
Sbjct: 89  MWIVMEYCGGGSCSDLLKRSYVNGLPEEKVSFIIHEVTLGLKYLHEQRK--IHRDIKAAN 146

Query: 165 VLISDDKTFKVCDFGSVCGVIRPPKNAQEFSYVQNDILKNTTAQYRSPEM----IDLYRG 220
           +L++++   K+ DFG V G IR        S ++ D     T  + +PE+    +D Y  
Sbjct: 147 ILLNEEGMVKLGDFG-VSGHIR--------STLKRDTFVG-TPYWMAPEVVCCEVDGY-- 194

Query: 221 HPINEKSDIWALGVFLYKLCYYTTPFEKVGDAAILHS-------RFQFPAYPQYSDRLKN 273
              NEK+DIW+LG+  Y+L     P  K     ++ +       + Q P    +SD  K+
Sbjct: 195 ---NEKADIWSLGITTYELLKGLPPLSKYDPMKVMTNLPKRKPPKLQGP----FSDAAKD 247

Query: 274 LISVMLSENPNQRPNICQVL 293
            ++  L + P  RP+   +L
Sbjct: 248 FVAGCLVKTPADRPSAYNLL 267

>ZYRO0F07194g Chr6 complement(581438..584254) [2817 bp, 938 aa] {ON}
           similar to uniprot|Q12152 Saccharomyces cerevisiae
           YPL150W Hypothetical ORF
          Length = 938

 Score = 78.6 bits (192), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 54/210 (25%), Positives = 99/210 (47%), Gaps = 53/210 (25%)

Query: 104 EVFLLMEYCSAGGLIDFMNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIE 163
           +V++ +EYC    L + +   + +R+  +E  K+ + I   +   H+L    +HRD+K+E
Sbjct: 102 KVWMALEYCPGRELYEHL--LMLHRIPLDECAKLFAQIVSAVHYAHSL--NCVHRDLKLE 157

Query: 164 NVLISDDKTFKVCDFG------------SVCGVIRPPKNAQEFSYVQNDILKNTTAQYRS 211
           N+L+  +   K+ DFG            ++CG                      T  Y +
Sbjct: 158 NILLDKNGNAKLTDFGFTRECVSKSSLETICG----------------------TTVYMA 195

Query: 212 PEMI--DLYRGHPINEKSDIWALGVFLYKLCYYTTPFEKVGDAAILHSRFQF-PAYPQYS 268
           PE+I    Y G  I    DIW+LGV LY +   T PF++  +     ++++    +P ++
Sbjct: 196 PELIQRQAYDGFKI----DIWSLGVILYTMINGTMPFDEDDETK---TKWKIVNDFPNFN 248

Query: 269 DRL-----KNLISVMLSENPNQRPNICQVL 293
           D       K+LI  +L++ P++RP + Q+L
Sbjct: 249 DNFVSHEAKDLIKRLLAKCPSERPTMEQIL 278

>TBLA0I01150 Chr9 complement(235187..240424) [5238 bp, 1745 aa] {ON}
           Anc_2.479 YKL101W
          Length = 1745

 Score = 79.0 bits (193), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 62/199 (31%), Positives = 96/199 (48%), Gaps = 31/199 (15%)

Query: 104 EVFLLMEYCSAGGLIDFMNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIE 163
           E++L++EY   G L D++ +R   +L E E +     I QG+A  HA    + HRD+K E
Sbjct: 173 ELYLVLEYVDGGELFDYLVSR--GKLPEREAVHYFKQIIQGVAYCHAF--NICHRDLKPE 228

Query: 164 NVLIS-DDKTFKVCDFGSVCGVIRPPKNAQEFSYVQNDILKNTTA---QYRSPEMI--DL 217
           N+L+   +K  K+ DFG           A E S    D L +T+     Y SPE++    
Sbjct: 229 NLLLDKKNKIIKIADFGMA---------ALEVS----DKLLSTSCGSPHYASPEIVMGKS 275

Query: 218 YRGHPINEKSDIWALGVFLYKLCYYTTPFEKVGDAAILHSRFQFPAYPQYSD---RLKNL 274
           Y G P    +D+W+ G+ L+ L     PF       +L  + Q   Y   SD     K+L
Sbjct: 276 YHGSP----TDVWSCGIILFALLTGHLPFNHDNIKKLLL-KVQSGVYHMPSDLSPDAKDL 330

Query: 275 ISVMLSENPNQRPNICQVL 293
           IS +L  +P++R    ++L
Sbjct: 331 ISKILVVDPDKRLTTTEIL 349

>SAKL0G01848g Chr7 (154547..157204) [2658 bp, 885 aa] {ON} weakly
           similar to uniprot|P38692 Saccharomyces cerevisiae
           YHR102W KIC1 Protein kinase of the PAK/Ste20 kinase
           family required for cell integrity possibly through
           regulating 1 6-beta-glucan levels in the wall physically
           interacts with Cdc31p (centrin) which is a component of
           the spindle pole body
          Length = 885

 Score = 78.6 bits (192), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 58/197 (29%), Positives = 97/197 (49%), Gaps = 30/197 (15%)

Query: 101 GSY----EVFLLMEYCSAGGLIDFMNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLI 156
           GSY    +++++MEYC+ G L   +      ++ E  +  IM ++   +  +H     +I
Sbjct: 90  GSYLYDTKLWIIMEYCAGGSLRTLLR---PGKIDEKYIGVIMRELLVALLYIHK--DNVI 144

Query: 157 HRDIKIENVLISDDKTFKVCDFGSVCGVIRPPKNAQEFSYVQNDILKNTTA---QYRSPE 213
           HRDIK  NVLI++D   K+CDFG    +             Q+++ + T A    + +PE
Sbjct: 145 HRDIKAANVLITNDGRVKLCDFGVAAQL------------TQSNVRRQTMAGTPYWMAPE 192

Query: 214 MIDLYRGHPINEKSDIWALGVFLYKLCYYTTPFEKVGD--AAILHSRFQFPAYP--QYSD 269
           +I    G   + K DIW+LG+  Y++     P+  V    A  L ++ + P     QYS 
Sbjct: 193 VI--MEGVYYDTKVDIWSLGITTYEITTGNPPYCDVEALRAMQLITKSKPPRLEGRQYSP 250

Query: 270 RLKNLISVMLSENPNQR 286
            LK  I++ L E+P +R
Sbjct: 251 LLKEFIALCLDEDPKER 267

>CAGL0K02167g Chr11 complement(192297..195785) [3489 bp, 1162 aa]
           {ON} similar to uniprot|P38990 Saccharomyces cerevisiae
           YER129w Serine/threonine-protein kinase
          Length = 1162

 Score = 78.6 bits (192), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 74/277 (26%), Positives = 124/277 (44%), Gaps = 51/277 (18%)

Query: 61  PDKQSLNVLRAEVDAMKLLRGNKHVVSYIDSHAAKSGAQDGSYEVFLLMEYCSAGGLI-- 118
           P K   + ++ E+  MK    +KHVV  I+           S +++L++EYCS G +   
Sbjct: 188 PGKTENDKIKREIAIMKKCH-HKHVVKLIEVLDDLK-----SRKIYLVLEYCSRGEVKWC 241

Query: 119 --DFMNTRLQ--NRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIENVLISDDKTFK 174
             D + T  +  + L+     +I+  +  G+  +H     +IHRDIK  N+L+S+    K
Sbjct: 242 PPDCLETEAKGPSPLSFQFTREILRGVVLGLEYLH--YQGIIHRDIKPANLLLSETGIVK 299

Query: 175 VCDFGSVCGVIRPPKNAQEFSYVQNDILKNT-TAQYRSPEMI--------------DLYR 219
           + DFG          +  + +  + ++ K   T  + +PE+               +L++
Sbjct: 300 ISDFGVSLAASSSNVDGSDETIDELELAKTAGTPAFFAPEICLGEDAFEKYQLDREELFK 359

Query: 220 GHPINEKSDIWALGVFLYKLCYYTTPFEKVGDAAILHSRFQFPA-YPQYSDRLKN----- 273
           G  I+ K DIWALGV LY L +   PF    +  +       P  +P+YSD LKN     
Sbjct: 360 GSCISFKIDIWALGVTLYCLVFGMLPFVSSFELELFEKIVNDPVKFPKYSDMLKNNQVLQ 419

Query: 274 ------------LISVMLSENPNQRPNICQVLEEVSR 298
                       L++ +L +NP +R NI    EE+ R
Sbjct: 420 MTEEAEYEAAKDLLTRLLEKNPIKRINI----EEIKR 452

>TDEL0A02720 Chr1 complement(491618..494365) [2748 bp, 915 aa] {ON}
           Anc_2.496 YHL007C
          Length = 915

 Score = 78.6 bits (192), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 63/236 (26%), Positives = 117/236 (49%), Gaps = 41/236 (17%)

Query: 73  VDAMKLLRGNKH--VVSYIDSHAAKSGAQDGSYEVFLLMEYCSAGGLIDFMNTRLQNRLT 130
           ++ + +++G+KH  +V++IDS+  K        +++++MEY   G L D +   +   LT
Sbjct: 666 INEILVMKGSKHQNIVNFIDSYVLKG-------DLWVVMEYMEGGSLTDVVTHCI---LT 715

Query: 131 ENEVLKIMSDITQGIAAMHALLPPLIHRDIKIENVLISDDKTFKVCDFGSVCGVIRPPKN 190
           E ++  +  +  +G+  +H+    +IHRDIK +N+L+S +   K+ DFG  C  I     
Sbjct: 716 EAQIGAVCRETLRGLQFLHS--KGVIHRDIKSDNILLSMNGEIKLTDFG-FCAQI----- 767

Query: 191 AQEFSYVQNDI-LKNTTA----QYRSPEMIDLYRGHPINEKSDIWALGVFLYKLCYYTTP 245
                   N+I LK TT      + +PE++      P   K DIW+LG+ + ++     P
Sbjct: 768 --------NEINLKRTTMVGTPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPP 816

Query: 246 F--EKVGDAAILHSRFQFPAYPQ---YSDRLKNLISVMLSENPNQRPNICQVLEEV 296
           +  E    A  L +    P   +    S  LK+ ++  L+ NP+ R +  ++L +V
Sbjct: 817 YLNETPLRALYLIATNGTPKLKEPEVLSPELKSFLAWCLNVNPDTRASATELLRDV 872

>TPHA0H02630 Chr8 complement(614048..618151) [4104 bp, 1367 aa] {ON}
            Anc_7.86 YAL017W
          Length = 1367

 Score = 79.0 bits (193), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 53/183 (28%), Positives = 89/183 (48%), Gaps = 22/183 (12%)

Query: 116  GLIDFMN-TRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIENVLISDDKTFK 174
            G ID  +    ++ +TE+E   I   +  GI  +H     ++HRD+K ENV++      K
Sbjct: 1199 GCIDLFDLIEFKSNMTESEARLIFIQVVLGIKHLHD--SNIVHRDVKDENVIVDAKGFVK 1256

Query: 175  VCDFGSVCGVIRPPKNAQEFSYVQNDILKNTTAQYRSPEMI--DLYRGHPINEKSDIWAL 232
            + DFGS   V   P +     +V        T  Y +PE++  + Y G P     DIWA+
Sbjct: 1257 LIDFGSAAYVNSGPFDV----FV-------GTIDYAAPEVLSGEPYLGKP----QDIWAI 1301

Query: 233  GVFLYKLCYYTTPFEKVGDAAILHSRFQFPAYPQYSDRLKNLISVMLSENPNQRPNICQV 292
            G+ LY + +   PF  + +  IL +  +       S    +LI  +L++NPN+RP I ++
Sbjct: 1302 GILLYTIMFKENPFYNIDE--ILEAELKINNTSDASQDCIDLIKRILTKNPNKRPTIDEI 1359

Query: 293  LEE 295
            + +
Sbjct: 1360 VND 1362

>CAGL0L03520g Chr12 complement(403100..407443) [4344 bp, 1447 aa] {ON}
            similar to uniprot|Q01389 Saccharomyces cerevisiae
            YJL095w BCK1
          Length = 1447

 Score = 78.6 bits (192), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 71/284 (25%), Positives = 129/284 (45%), Gaps = 51/284 (17%)

Query: 31   GGFAHIY-SAEISPADPNSIGNVACLKRVLVPD--------KQSLNVLRAEVDAMKLLRG 81
            G F  +Y S  I+       G +  +K+V VP         K  +  L++EV  +K L  
Sbjct: 1160 GSFGAVYLSLNIT------TGEMMAVKQVEVPKYGTQNELVKDMVEALKSEVATLKDL-D 1212

Query: 82   NKHVVSYIDSHAAKSGAQDGSYEVFLLMEYCSAGGLIDFMNTRLQNRLTENEVLKIMSDI 141
            + ++V Y+ S       +   Y +FL  EY + G +   +  RL  R  E  +  + + +
Sbjct: 1213 HLNIVQYLGSEI-----RGNIYSLFL--EYVAGGSVGSLI--RLYGRFDEKLIRHLNTQV 1263

Query: 142  TQGIAAMHALLPPLIHRDIKIENVLISDDKTFKVCDFGSVCGVIRPPKNAQEFSYVQNDI 201
              G+  +H+    ++HRD+K +N+L+ +D   K+ DF    G+ +  KN     Y  +D+
Sbjct: 1264 LSGLKYLHS--KGILHRDMKADNLLLDEDGICKISDF----GISKKSKNI----YSNSDM 1313

Query: 202  LKNTTAQYRSPEMIDLYRGHPINEKSDIWALGVFLYKLCYYTTPFEKVGDAAILHSRFQF 261
                T  + +PEM+D  +G+  + K DIW+LG  + ++     P+  +    ++ + FQ 
Sbjct: 1314 TMRGTVFWMAPEMVDTKQGY--SAKVDIWSLGCVVLEMFAGKRPWSNL---EVVAAMFQI 1368

Query: 262  ------PAYPQ-----YSDRLKNLISVMLSENPNQRPNICQVLE 294
                  P  P       S + K+ +S     +P +RP    +LE
Sbjct: 1369 GKSKSAPPIPDDTIQLISSKGKDFLSKCFEIDPEKRPTADDLLE 1412

>KNAG0G02110 Chr7 (477260..480838) [3579 bp, 1192 aa] {ON} Anc_8.279
           YLR096W
          Length = 1192

 Score = 78.6 bits (192), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 57/197 (28%), Positives = 97/197 (49%), Gaps = 22/197 (11%)

Query: 102 SYEVFLLMEYCSAGGLIDFMNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIK 161
           S   ++L EY S G L+D++       L E+   K    I   +  +HA    ++HRD+K
Sbjct: 205 SNHFYMLFEYVSGGQLLDYIIQ--HGSLREHHARKFARGIGSALQYLHA--NNIVHRDLK 260

Query: 162 IENVLISDDKTFKVCDFGSVCGVIRPPKNAQEFSYVQNDILKNTTAQYRSPEMIDLYRGH 221
           IEN++IS     K+ DFG +  V  P K    F           +  + +PE++   +  
Sbjct: 261 IENIMISTSGEIKIIDFG-LSNVYDPRKQLHTFC---------GSLYFAAPELL---KAR 307

Query: 222 P-INEKSDIWALGVFLYKLCYYTTPFEKVGDAAILHSRFQFP--AYPQY-SDRLKNLISV 277
           P +  + D+W+ GV LY L     PF+    +++LH + +     YP + S  + +L+S 
Sbjct: 308 PYLGPEVDVWSFGVVLYVLVCGKVPFDD-EVSSVLHEKIKQGNVEYPNHLSIEVLSLLSK 366

Query: 278 MLSENPNQRPNICQVLE 294
           ML  +P +R ++ QV+E
Sbjct: 367 MLVVDPERRASLKQVIE 383

>Suva_7.83 Chr7 complement(159329..161038) [1710 bp, 569 aa] {ON}
           YGL179C (REAL)
          Length = 569

 Score = 77.8 bits (190), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 62/212 (29%), Positives = 101/212 (47%), Gaps = 34/212 (16%)

Query: 102 SYEVFLLMEYCSAGGLIDFMNTRLQNR------LTENEVLKIMSDITQGIAAMHALLPPL 155
           S +V+L++EYCS G +      +L+ +      LT  +  KI+SD+  G+  +H+    +
Sbjct: 128 STKVYLVLEYCSRGPVKWCPENQLEIKAVGPSILTFEQARKIVSDVVSGLEYLHS--QGI 185

Query: 156 IHRDIKIENVLISDDKTFKVCDFGSVCGVIRPPKNAQEFSYVQNDILKNTTA---QYRSP 212
            HRDIK  N+LIS +   K+ DFG          N Q     Q  I K+ T     + +P
Sbjct: 186 THRDIKPSNLLISSNGAVKISDFGVSILTTTGSTNIQS---SQEQISKSKTLGTPAFFAP 242

Query: 213 EMIDLYRGHPINEKSDIWALGVFLYKLCYYTTPFEKVGDAA------ILHSRFQFPAYPQ 266
           E+      +  +   DIW+LGV LY + + T PF    ++A      I+     FP+Y Q
Sbjct: 243 ELCTADGDYRCSSAIDIWSLGVTLYCMLFGTLPFN--ANSALELFDNIISKPLSFPSYEQ 300

Query: 267 YSDR------------LKNLISVMLSENPNQR 286
            S R             K++++ +L +NP++R
Sbjct: 301 VSKRGHPNLAREEYNDAKDILNRLLKKNPSER 332

>Suva_6.169 Chr6 complement(300200..304654) [4455 bp, 1484 aa] {ON}
            YJL095W (REAL)
          Length = 1484

 Score = 78.6 bits (192), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 55/216 (25%), Positives = 106/216 (49%), Gaps = 30/216 (13%)

Query: 48   SIGNVACLKRVLVPDKQSLN--------VLRAEVDAMKLLRGNKHVVSYIDSHAAKSGAQ 99
            + G +  +K+V VP   S N         LR+EV  +K L  + ++V Y+       G +
Sbjct: 1202 TTGEMMAVKQVEVPKYSSQNEAILSTVEALRSEVSTLKDL-DHLNIVQYL-------GFE 1253

Query: 100  DGSYEVFLLMEYCSAGGLIDFMNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRD 159
            + +    L +EY + G +   +  R+  R  E+ +  + + + +G+A +H+    ++HRD
Sbjct: 1254 NKNSIYSLFLEYVAGGSVGSLI--RMYGRFDESLIKHLTTQVLRGLAYLHS--KGILHRD 1309

Query: 160  IKIENVLISDDKTFKVCDFGSVCGVIRPPKNAQEFSYVQNDILKNTTAQYRSPEMIDLYR 219
            +K +N+L+  D   K+ DF    G+ R  K+     Y  +D+    T  + +PEM+D  +
Sbjct: 1310 MKADNLLLDQDGICKISDF----GISRKSKDI----YSNSDMTMRGTVFWMAPEMVDTKQ 1361

Query: 220  GHPINEKSDIWALGVFLYKLCYYTTPFEKVGDAAIL 255
            G+  + K DIW+LG  + ++     P+  +   A +
Sbjct: 1362 GY--SAKVDIWSLGCIVLEMFAGKRPWSNLEVVAAM 1395

>KAFR0D04950 Chr4 (971956..974982) [3027 bp, 1008 aa] {ON} Anc_5.406
           YHR102W
          Length = 1008

 Score = 78.2 bits (191), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 57/202 (28%), Positives = 97/202 (48%), Gaps = 24/202 (11%)

Query: 101 GSY----EVFLLMEYCSAGGLIDFMNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLI 156
           GSY     ++++MEYC  G L   +      ++ E  +  IM +I   +  +H     +I
Sbjct: 99  GSYLKNTSLWIIMEYCGGGSLRSLLR---PGKIDEKYIGVIMREILIALKYIHK--DNVI 153

Query: 157 HRDIKIENVLISDDKTFKVCDFGSVCGVIRPPKNAQEFSYVQNDILKNTTAQYRSPEMID 216
           HRDIK  NVLI++D + K+CDFG    + +     Q  +          T  + +PE+I 
Sbjct: 154 HRDIKAANVLINNDGSIKLCDFGVAAQLNQTKSRRQTMA---------GTPYWMAPEVI- 203

Query: 217 LYRGHPINEKSDIWALGVFLYKLCYYTTPFEKVGD--AAILHSRFQFPAYP--QYSDRLK 272
              G   + K+DIW+ G+  Y++     P+  V    A  L ++ + P      YS  +K
Sbjct: 204 -MEGVYYDTKADIWSTGITAYEVTTGNPPYCDVEALRAMQLIAKSKPPRLEGRNYSALIK 262

Query: 273 NLISVMLSENPNQRPNICQVLE 294
             I+  L E+P++RP   ++L+
Sbjct: 263 EFIATCLDEDPSERPTADELLK 284

>KAFR0B02800 Chr2 (571295..574582) [3288 bp, 1095 aa] {ON} Anc_8.279
           YLR096W
          Length = 1095

 Score = 78.6 bits (192), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 61/217 (28%), Positives = 105/217 (48%), Gaps = 22/217 (10%)

Query: 102 SYEVFLLMEYCSAGGLIDFMNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIK 161
           S   ++L EY S G L+D++       L E+   K    +   +  +HA    ++HRD+K
Sbjct: 197 SNHFYMLFEYVSGGQLLDYIIQ--HGSLREHHARKFARGVASALQYLHA--NNIVHRDLK 252

Query: 162 IENVLISDDKTFKVCDFGSVCGVIRPPKNAQEFSYVQNDILKNTTAQYRSPEMIDLYRGH 221
           IEN++IS     K+ DFG +  V    K    F           +  + +PE++   + +
Sbjct: 253 IENIMISTSGEIKIIDFG-LSNVFDTRKQLHTFC---------GSLYFAAPELL---KAN 299

Query: 222 P-INEKSDIWALGVFLYKLCYYTTPFEKVGDAAILHSRFQFP--AYPQY-SDRLKNLISV 277
           P I  + DIW+ GV LY L     PF+   ++++LH + +     YP + S  + +L+S 
Sbjct: 300 PYIGPEVDIWSFGVVLYVLVCGKVPFDD-ENSSVLHEKIKQGKVEYPNHLSIEVISLLSK 358

Query: 278 MLSENPNQRPNICQVLEEVSRIQNVPCPLRNFYLLRS 314
           ML  +P +R N+ +V+E    I+    P  ++   RS
Sbjct: 359 MLVVDPLKRANLTKVIEHPWMIRGYDFPPPSYLPKRS 395

>KNAG0A06540 Chr1 (1002435..1006733) [4299 bp, 1432 aa] {ON}
           Anc_2.479 YKL101W
          Length = 1432

 Score = 78.6 bits (192), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 58/198 (29%), Positives = 93/198 (46%), Gaps = 27/198 (13%)

Query: 104 EVFLLMEYCSAGGLIDFMNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIE 163
           ++FL++EY   G L D++ ++   +L E E +     I +G+A  H+    + HRD+K E
Sbjct: 189 DLFLVLEYVDGGELFDYLVSK--GKLPEWEAVHYFKQIIEGVAFCHSY--NICHRDLKPE 244

Query: 164 NVLISD-DKTFKVCDFGSVCGVIRPPKNAQEFSYVQNDILKNTTAQYRSPEMI--DLYRG 220
           N+L+   +K  K+ DFG     +  P    E S          +  Y SPE++    Y G
Sbjct: 245 NLLLDKKNKIIKIADFG--MAALELPNKLLETSC--------GSPHYASPEIVMGKPYHG 294

Query: 221 HPINEKSDIWALGVFLYKLCYYTTPFEKVGDAAIL----HSRFQFPAYPQYSDRLKNLIS 276
            P    SD+W+ G+ L+ L     PF       +L      RF+ P     S   ++LI+
Sbjct: 295 GP----SDVWSCGIILFALLTGHLPFNDDNIRKLLLKVQSGRFRLPR--NISLEAQDLIA 348

Query: 277 VMLSENPNQRPNICQVLE 294
            +L  NP QR  I  +L+
Sbjct: 349 KILVVNPRQRIKISDILK 366

>Skud_11.126 Chr11 (235011..239567) [4557 bp, 1518 aa] {ON} YKL101W
           (REAL)
          Length = 1518

 Score = 78.6 bits (192), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 64/247 (25%), Positives = 114/247 (46%), Gaps = 41/247 (16%)

Query: 69  LRAEVDAMKLLRGNKHVVSYIDSHAAKSGAQDGSYEVFLLMEYCSAGGLIDFMNTRLQNR 128
           +  E+  MKL+  + +V++  +    KS       E++L++EY   G L D++ ++   +
Sbjct: 161 IEREIVIMKLI-SHANVMALFEVWENKS-------ELYLVLEYVDGGELFDYLVSK--GK 210

Query: 129 LTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIENVLIS-DDKTFKVCDFGSVCGVIRP 187
           L E E +     I +G++  H+    + HRD+K EN+L+   ++  K+ DFG     +  
Sbjct: 211 LPEREAIHYFKQIVEGVSFCHSF--NICHRDLKPENLLLDKKNRKIKIADFG--MAALEL 266

Query: 188 PKNAQEFSYVQNDILKNTTA--QYRSPEMI--DLYRGHPINEKSDIWALGVFLYKLCYYT 243
           P          N +LK +     Y SPE++    Y G P    SD+W+ G+ L+ L    
Sbjct: 267 P----------NKLLKTSCGSPHYASPEIVMGRPYHGGP----SDVWSCGIVLFALLTGH 312

Query: 244 TPFEKVGDAAIL----HSRFQFPAYPQYSDRLKNLISVMLSENPNQRPNICQVLEE--VS 297
            PF       +L      ++Q P     S   ++LIS +L  NP +R    ++L    + 
Sbjct: 313 LPFNDDNIKKLLLKVQSGKYQMPM--NLSAEARDLISKILVINPEKRITTQEILNHPLIK 370

Query: 298 RIQNVPC 304
           +  N+P 
Sbjct: 371 KYDNLPI 377

>SAKL0C01716g Chr3 (143880..147527) [3648 bp, 1215 aa] {ON} similar
           to uniprot|Q12263 Saccharomyces cerevisiae YDR507C
          Length = 1215

 Score = 78.2 bits (191), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 63/232 (27%), Positives = 105/232 (45%), Gaps = 36/232 (15%)

Query: 72  EVDAMKLLRGNKHVVSYIDSHAAKSGAQDGSYEVFLLMEYCSAGGLIDFMNTRLQNRLTE 131
           E+  MKLL  + +V+   D    KS        +++++EY   G L + +  R    L E
Sbjct: 89  EIIIMKLL-NHTNVLRLYDVWETKSN-------LYMVLEYVEKGELFNLLVER--GPLPE 138

Query: 132 NEVLKIMSDITQGIAAMHALLPPLIHRDIKIENVLISDDKTFKVCDFGSVCGVIRPPKNA 191
           NE ++    I  GI+  HAL   ++HRD+K EN+L+      K+ DFG            
Sbjct: 139 NEAVRFFRQIIIGISYCHAL--GIVHRDLKPENLLLDHKFNIKIADFGMAA--------- 187

Query: 192 QEFSYVQNDILKNTTA---QYRSPEMIDLYRGHPINEKSDIWALGVFLYKLCYYTTPF-E 247
                   D L  T+     Y +PE++     H    +SD+W+ GV LY L     PF E
Sbjct: 188 ----LESKDKLLETSCGSPHYAAPEIVSGLPYHGF--ESDVWSCGVILYALLTGRLPFDE 241

Query: 248 KVGDAAIL-----HSRFQFPAYPQYSDRLKNLISVMLSENPNQRPNICQVLE 294
             G+   L        ++ P   + S   ++LI+ +L+ +P++R    ++L+
Sbjct: 242 DNGNIRSLLLKVQSGEYEMPGNDEISSEAQDLIAKILTVDPDRRIKTREILK 293

>CAGL0I07513g Chr9 (722045..725275) [3231 bp, 1076 aa] {ON} similar
           to uniprot|Q12236 Saccharomyces cerevisiae YOL100w PKH2
          Length = 1076

 Score = 78.2 bits (191), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 63/248 (25%), Positives = 117/248 (47%), Gaps = 24/248 (9%)

Query: 52  VACLKRVLVPDKQSLNVLRAEVDAMKLLRGNKHVVSYIDSHAAKSGAQDGSYEVFLLMEY 111
           V  L +  +  ++ +  +  E +A++ L  ++ +V    +       QD S  ++ L+EY
Sbjct: 210 VKVLNKEYLIKQKKVKYVNIEKNALQRLNNSRGIVKLFFTF------QDES-SLYFLLEY 262

Query: 112 CSAGGLIDFMNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIENVLISDDK 171
              G  +  M  +    L+E+      + I  GI  +H+    +IHRDIK EN+L+  D 
Sbjct: 263 APNGDFLSVM--KKYGSLSEDCTRYYSAQIIDGIKYLHS--KGIIHRDIKPENILLDKDM 318

Query: 172 TFKVCDFGSVCGVIRPPKNAQEFSYVQNDILKNT----TAQYRSPEMI-DLYRGHPINEK 226
             K+ DFG+    I  PKN  E +   N + ++     TA+Y SPE++ D Y    ++ +
Sbjct: 319 KVKITDFGT--AKILEPKNEDEDNPEFNLLTRSKSFVGTAEYVSPELLNDSY----VDAR 372

Query: 227 SDIWALGVFLYKLCYYTTPFEKVGDAAILHS--RFQFPAYPQYSDRLKNLISVMLSENPN 284
            DIWA G  ++++     PF+   +        + Q+     +   +++L+  +L + P 
Sbjct: 373 CDIWAFGCMVFQMIAGKPPFKATNEYLTFQKVMKVQYAFTAGFPVVVRDLVKRILLKVPE 432

Query: 285 QRPNICQV 292
           QR  I Q+
Sbjct: 433 QRLTIPQI 440

>Skud_8.163 Chr8 (290415..293645) [3231 bp, 1076 aa] {ON} YHR102W
           (REAL)
          Length = 1076

 Score = 78.2 bits (191), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 56/196 (28%), Positives = 92/196 (46%), Gaps = 28/196 (14%)

Query: 101 GSY----EVFLLMEYCSAGGLIDFMNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLI 156
           GSY     +++LMEYC+ G L   +      ++ E  +  IM ++   +  +H     +I
Sbjct: 87  GSYLKDTSLWILMEYCAGGSLRSLLRP---GKIDEKYIGVIMRELLVALKCIHK--DNVI 141

Query: 157 HRDIKIENVLISDDKTFKVCDFGSVCGVIRPPKNAQEFSYVQNDILKNTTAQYRSPEMID 216
           HRDIK  NVLI+++ + K+CDFG    V +     Q  +          T  + +PE+I 
Sbjct: 142 HRDIKAANVLITNEGSVKLCDFGVAAQVNQTSLRRQTMA---------GTPYWMAPEVI- 191

Query: 217 LYRGHPINEKSDIWALGVFLYKLCYYTTPFEKVGDAAILHSRFQFPAYP------QYSDR 270
              G   + K DIW+LG+  Y++     P+  V   A+   +    + P       YS  
Sbjct: 192 -MEGVYYDTKVDIWSLGITTYEIATGNPPYCDV--EALRAMQLIIKSKPPRLEGRSYSSS 248

Query: 271 LKNLISVMLSENPNQR 286
           LK  I++ L E+P +R
Sbjct: 249 LKEFIALCLDEDPKER 264

>TDEL0F00930 Chr6 complement(160181..163573) [3393 bp, 1130 aa] {ON}
           Anc_8.140 YGL179C
          Length = 1130

 Score = 78.2 bits (191), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 67/235 (28%), Positives = 111/235 (47%), Gaps = 52/235 (22%)

Query: 102 SYEVFLLMEYCSAGGLI----DFMNTRLQN--RLTENEVLKIMSDITQGIAAMHALLPPL 155
           S +++L++EYCS G +     D M T  +    LT     +I+  +  G+  +H     +
Sbjct: 196 SRKIYLVLEYCSKGEVKWCPGDQMETEARGPPLLTFQRTREILRGVVLGLEYLH--YQGV 253

Query: 156 IHRDIKIENVLISDDKTFKVCDFGSVCGVIRPPKNAQEFSYVQNDI---LKNT--TAQYR 210
           IHRDIK  N+LIS+D T K+ DF    GV      A++   +++D    L  T  T  + 
Sbjct: 254 IHRDIKPANLLISEDNTVKISDF----GVSLAATGAEDADNIESDDELELAKTAGTPAFF 309

Query: 211 SPEMI--------------DLYRGHPINEKSDIWALGVFLYKLCYYTTPFEKVGD----- 251
           +PE+               DL++G  I+   DIWALGV LY L +   PF  + D     
Sbjct: 310 APEICLGNEAFEKYQLKREDLFKGSSISFMIDIWALGVTLYCLLFGMLPF--ISDYELEL 367

Query: 252 -AAILHSRFQFPAYPQY-SDRLK------------NLISVMLSENPNQRPNICQV 292
              I++   +FP+Y +   +R+             +L++ +L +NP +R  I ++
Sbjct: 368 FEKIVNDPVKFPSYEEVKGNRVSMLSSEEEYNMALDLVNRLLEKNPMKRITIAEI 422

>TPHA0E03640 Chr5 complement(769962..773375) [3414 bp, 1137 aa] {ON}
           Anc_1.52 YDR507C
          Length = 1137

 Score = 78.2 bits (191), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 53/198 (26%), Positives = 94/198 (47%), Gaps = 28/198 (14%)

Query: 105 VFLLMEYCSAGGLIDFMNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIEN 164
           +++++EY   G L + +  +    L ENE ++    I  G++  HAL   ++HRD+K EN
Sbjct: 118 LYMVLEYAEKGELFNLLVEK--GPLAENEAVRFFRQIIIGMSYCHAL--GIVHRDLKPEN 173

Query: 165 VLISDDKTFKVCDFGSVCGVIRPPKNAQEFSYVQNDILKNTTA--QYRSPEMIDLYRGHP 222
           +L+      K+ DFG                  ++ +L+ +     Y +PE++    G P
Sbjct: 174 ILLDHKSNIKIADFGMAA------------LETEDKLLETSCGSPHYAAPEIVS---GLP 218

Query: 223 INE-KSDIWALGVFLYKLCYYTTPF-EKVGD-----AAILHSRFQFPAYPQYSDRLKNLI 275
            N  ++DIW+ GV L+ L     PF E+ G+       +    F+ P   + S   ++LI
Sbjct: 219 YNGLETDIWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPGSDELSLEAQDLI 278

Query: 276 SVMLSENPNQRPNICQVL 293
             +L+ NP QR    ++L
Sbjct: 279 GKILTVNPKQRIKTREIL 296

>Skud_5.249 Chr5 complement(400867..404310) [3444 bp, 1147 aa] {ON}
           YER129W (REAL)
          Length = 1147

 Score = 78.2 bits (191), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 72/267 (26%), Positives = 119/267 (44%), Gaps = 56/267 (20%)

Query: 69  LRAEVDAMKLLRGNKHVVSYIDSHAAKSGAQDGSYEVFLLMEYCSAGGLI----DFMNTR 124
           ++ E+  MK    +KHVV  I+           S +++L++EYCS G +     D + + 
Sbjct: 189 IKREIAIMKKCH-HKHVVQLIEVLDDLK-----SRKIYLVLEYCSRGEVKWCPPDCLESD 242

Query: 125 LQ--NRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIENVLISDDKTFKVCDFGSVC 182
            +  + L+  E  +I+  +  G+  +H     +IHRDIK  N+LIS+D T K+ DFG   
Sbjct: 243 AKGPSLLSFQETREILRGVVLGLEYLH--YQGIIHRDIKPANLLISEDGTVKISDFGVSL 300

Query: 183 GVIRPPKNAQEFSYVQNDILKNT-TAQYRSPEMI--------------DLYRGHPINEKS 227
                  +    S  + ++ K   T  + +PEM               +L+RG  I+   
Sbjct: 301 AASSTNSSDSSESLNELELAKTVGTPAFFAPEMCLGEDAFTKYNLTKDNLFRGSCISFMI 360

Query: 228 DIWALGVFLYKLCYYTTP---------FEKVGDAAILHSRFQFPAYPQYSDR-------- 270
           DIWA+GV LY L +   P         FEK+ D  +     +FP Y +            
Sbjct: 361 DIWAVGVTLYCLLFGMLPFFSDFELKLFEKIVDDPL-----KFPTYEEMQSNNVSKISCE 415

Query: 271 -----LKNLISVMLSENPNQRPNICQV 292
                 K+L+S +L +NP +R  I ++
Sbjct: 416 EEYQMAKDLLSKLLEKNPQKRMTIPEI 442

>Skud_4.383 Chr4 (666354..669551) [3198 bp, 1065 aa] {ON} YDR122W
           (REAL)
          Length = 1065

 Score = 78.2 bits (191), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 57/209 (27%), Positives = 102/209 (48%), Gaps = 24/209 (11%)

Query: 102 SYEVFLLMEYCSAGGLIDFMNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIK 161
           S   ++L EY S G L+D++       + E++  K    I   +  +HA    ++HRD+K
Sbjct: 214 SNHFYMLFEYVSGGQLLDYIIQ--HGSIREHQAKKFARGIASALMYLHA--NNIVHRDLK 269

Query: 162 IENVLISDDKTFKVCDFGSVCGVIRPPKNAQEFSYVQNDILKNTTAQYRSPEMI--DLYR 219
           IEN++ISD    K+ DFG +  +    K    F           +  + +PE++  + Y 
Sbjct: 270 IENIMISDSSEIKIIDFG-LSNLYDSRKQLYTFC---------GSLYFAAPELLKANPYT 319

Query: 220 GHPINEKSDIWALGVFLYKLCYYTTPFEKVGDAAILHSRFQFP--AYPQY-SDRLKNLIS 276
           G  +    D+W+ GV L+ L     PF+   ++++LH + +     YPQ+ S  + +L+S
Sbjct: 320 GPEV----DVWSFGVVLFVLVCGKVPFDD-ENSSVLHEKIKQGKVEYPQHLSIEVISLLS 374

Query: 277 VMLSENPNQRPNICQVLEEVSRIQNVPCP 305
            ML  +P +R  + QV+E    ++    P
Sbjct: 375 KMLVVDPKRRATLKQVVEHHWMVRGFSGP 403

>Kpol_1065.3 s1065 complement(4445..5575) [1131 bp, 376 aa] {ON}
           complement(4445..5575) [1131 nt, 377 aa]
          Length = 376

 Score = 76.3 bits (186), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 76/274 (27%), Positives = 116/274 (42%), Gaps = 41/274 (14%)

Query: 28  LTSGGFAHIYSAEISPADPNSIGNVACLKRVLVPDKQSLNV---LRAEVDAMKLLRGNKH 84
           L  G F  +Y     P+     G +  LK +   +  + NV    + E+D    L     
Sbjct: 124 LGKGKFGKVYCVRHKPS-----GLICALKVMNKMEIVNFNVQKQFKREIDIQYHLNHKNL 178

Query: 85  VVSYIDSHAAKSGAQDGSYEVFLLMEYCSAGGLIDFMNTRL-QNRLTENEVLKIMSDITQ 143
              Y   H +K+        V+L+MEY   G L   +      N +T +  +  M+D   
Sbjct: 179 TKLYAFFHDSKN--------VYLVMEYLIGGELYKLLKKNGPMNDITASNYVYQMTD--- 227

Query: 144 GIAAMHALLPPLIHRDIKIENVLISDDKTFKVCDFGSVCGVIRPPKNAQEFSYVQNDILK 203
            +  MH     +IHRD+K EN+LI  +   K+ DFG     I  P N +  +        
Sbjct: 228 ALNYMHK--RKIIHRDLKPENILIGFNNQIKLTDFG---WSIYNPNNQKRKTLC------ 276

Query: 204 NTTAQYRSPEMIDLYRGHPINEKSDIWALGVFLYKLCYYTTPFEKVGDAA----ILHSRF 259
             T  Y SPE+I        +E  D+WALG+  Y+L     PFE+         I  S  
Sbjct: 277 -GTIDYLSPELIS---SREYDENVDVWALGILTYELVVGAPPFEEDTKEQTYKRIAKSDL 332

Query: 260 QFPAYPQYSDRLKNLISVMLSENPNQRPNICQVL 293
           +FP  P  S   ++LI+ +L   P++R N+ QV+
Sbjct: 333 KFP--PNVSSEARDLITNLLKVVPSERFNLQQVM 364

>Suva_15.297 Chr15 (518854..520850,520945..522172) [3225 bp, 1074
           aa] {ON} YHR102W (REAL)
          Length = 1074

 Score = 77.8 bits (190), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 55/196 (28%), Positives = 92/196 (46%), Gaps = 28/196 (14%)

Query: 101 GSY----EVFLLMEYCSAGGLIDFMNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLI 156
           GSY     ++++MEYC+ G L   +      ++ E  +  IM ++   +  +H     +I
Sbjct: 87  GSYLKDTSLWIIMEYCAGGSLRSLLR---PGKIDEKYIGVIMREVLVALKCIHK--DNVI 141

Query: 157 HRDIKIENVLISDDKTFKVCDFGSVCGVIRPPKNAQEFSYVQNDILKNTTAQYRSPEMID 216
           HRDIK  NVLI+++   K+CDFG    V +     Q  +          T  + +PE+I 
Sbjct: 142 HRDIKAANVLITNEGNVKLCDFGVAAQVNQTSLRRQTMA---------GTPYWMAPEVI- 191

Query: 217 LYRGHPINEKSDIWALGVFLYKLCYYTTPFEKVGDAAILHSRFQFPAYP------QYSDR 270
              G   + K DIW+LG+  Y++     P+ +V   A+   +    + P       YS  
Sbjct: 192 -MEGVYYDTKVDIWSLGITTYEIATGNPPYCEV--EALRAMQLIIKSKPPRLEGRSYSPS 248

Query: 271 LKNLISVMLSENPNQR 286
           LK  I++ L E+P +R
Sbjct: 249 LKEFIALCLDEDPKER 264

>AFL101C Chr6 complement(249144..250247) [1104 bp, 367 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL209C
           (IPL1)
          Length = 367

 Score = 75.9 bits (185), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 84/277 (30%), Positives = 117/277 (42%), Gaps = 41/277 (14%)

Query: 24  IIKYLTSGGFAHIYSAEISPADPNSIGNVACLKRVLVPDKQSLNV---LRAEVDAMKLLR 80
           I K L  G F  +Y      +     G V  LK +   D    N+    R EV+    LR
Sbjct: 111 IGKVLGKGKFGRVYCVRHIES-----GFVCALKAMEKKDIIQYNIEKQFRREVEIQSSLR 165

Query: 81  GNKHVVSYIDSHAAKSGAQDGSYEVFLLMEYCSAGGLIDFMNTRLQ-NRLTENEVLKIMS 139
                  Y   H  K         V+LLMEY   G L   +  R   N +  +  +  M+
Sbjct: 166 HPNLTQLYGYFHDEK--------RVYLLMEYLVNGELYKHLKGRSHFNDVVASYYVYQMA 217

Query: 140 DITQGIAAMHALLPPLIHRDIKIENVLISDDKTFKVCDFGSVCGVIRPPKNAQEFSYVQN 199
           D    +  MH     ++HRDIK EN++I  + T K+ DFG    VI  PK ++  +    
Sbjct: 218 D---ALDYMHE--RNILHRDIKPENIIIGFNNTIKLTDFG--WSVI-TPKGSKRKTLC-- 267

Query: 200 DILKNTTAQYRSPEMIDLYRGHPINEKSDIWALGVFLYKLCYYTTPFE----KVGDAAIL 255
                 T  Y SPE+I   R    NEK D+WALGV  Y+L   + PFE    ++    IL
Sbjct: 268 -----GTVDYLSPELI---RSREYNEKVDVWALGVLTYELLVGSPPFEEESKELTYKRIL 319

Query: 256 HSRFQFPAYPQYSDRLKNLISVMLSENPNQRPNICQV 292
                FP +     R  +LIS +L  +P  R  + +V
Sbjct: 320 KRNLIFPDHVDTEAR--HLISRLLEYDPGDRIPLKEV 354

>ZYRO0B01166g Chr2 complement(97168..100059) [2892 bp, 963 aa] {ON}
           weakly similar to uniprot|Q03497 Saccharomyces
           cerevisiae YHL007C STE20 Signal transducing kinase of
           the PAK (p21-activated kinase) family involved in
           pheromone response and pseudohyphal/invasive growth
           pathways activated by Cdc42p binds Ste4p at a GBB motif
           present in noncatalytic domains of PAK kinases
          Length = 963

 Score = 77.8 bits (190), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 62/235 (26%), Positives = 114/235 (48%), Gaps = 41/235 (17%)

Query: 73  VDAMKLLRGNKH--VVSYIDSHAAKSGAQDGSYEVFLLMEYCSAGGLIDFMNTRLQNRLT 130
           ++ + +++G+KH  +V++IDS+  K        +++++MEY   G L D +   +   LT
Sbjct: 698 INEIMVMKGSKHRNIVNFIDSYLLKG-------DLWVVMEYMEGGSLTDVVTHCI---LT 747

Query: 131 ENEVLKIMSDITQGIAAMHALLPPLIHRDIKIENVLISDDKTFKVCDFGSVCGVIRPPKN 190
           E ++  +  +   G+  +H+    +IHRDIK +N+L+S     K+ DFG  C  I     
Sbjct: 748 EGQIGAVCRETLAGLQFLHSK--GVIHRDIKSDNILLSMTGEIKLTDFG-FCAQI----- 799

Query: 191 AQEFSYVQNDI-LKNTTA----QYRSPEMIDLYRGHPINEKSDIWALGVFLYKLCYYTTP 245
                   N+I LK TT      + +PE++      P   K DIW+LG+ + ++     P
Sbjct: 800 --------NEINLKRTTMVGTPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPP 848

Query: 246 F--EKVGDAAILHSRFQFPAYPQ---YSDRLKNLISVMLSENPNQRPNICQVLEE 295
           +  E    A  L +    P   +     + L+N +   L+  P+QR +  Q+L++
Sbjct: 849 YLNETPLRALYLIATNGTPKLKEPDNLGEELQNFLDWCLTVEPDQRASSSQLLKD 903

>Kwal_47.17252 s47 (318148..320766) [2619 bp, 872 aa] {ON} YGL180W
           (APG1) - Protein kinase [contig 211] FULL
          Length = 872

 Score = 77.4 bits (189), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 77/310 (24%), Positives = 139/310 (44%), Gaps = 66/310 (21%)

Query: 26  KYLTS-----GGFAHIYSAEI-SPADPNSIGNVACLKRVLVPDKQSLNVLRAEVDAMKLL 79
           KYL       G FA +Y   I S  D N    +  + R  + +K+ L  L  E+  +K +
Sbjct: 19  KYLVQQEIGKGSFATVYKGRIASNRDLNDFIAIKAVSRSKLKNKKLLENLEIEIAILKKI 78

Query: 80  RGNKHVVSYIDSHAAKSGAQDGSYEVFLLMEYCSAG----------GLID---FMNTRLQ 126
           + + H+V  +D    ++GA     + FL+MEYC+ G          GLI+    + T  +
Sbjct: 79  K-HPHIVGLMDCE--RTGA-----DFFLIMEYCALGDLTFLIKKRGGLIEKHPLVRTMFE 130

Query: 127 ---------NRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIENVLIS-------DD 170
                    N L    V+  +  ++  +  + +    L+HRDIK +N+L+S       D 
Sbjct: 131 KYPPPSESHNGLNRVVVVSYLQQLSSALMFLRS--KNLVHRDIKPQNLLLSTPLVNYSDR 188

Query: 171 KTFKVCDFGSVCGVIRPPKNAQEFSYVQNDILKNTTAQ--------YRSPEMIDLYRGHP 222
           +TF    F  +  +  P     +F + +   L NT+          Y +PE++D Y+ + 
Sbjct: 189 ETFHKMGFVGIYNL--PILKIADFGFAR--FLPNTSLAETLCGSPLYMAPEILD-YQKY- 242

Query: 223 INEKSDIWALGVFLYKLCYYTTPFEKVGDAAIL------HSRFQFPAYPQYSDRLKNLIS 276
            N K+D+W++G  LY++C    PF+      +       +    FP + +   +++ LI 
Sbjct: 243 -NAKADLWSVGTVLYEMCCGRPPFKASNHLELFKKIKRANDVISFPTHCKVDPQMRELIC 301

Query: 277 VMLSENPNQR 286
            +L+ +P+QR
Sbjct: 302 GLLTFDPSQR 311

>Kpol_1031.10 s1031 (25064..28447) [3384 bp, 1127 aa] {ON}
           (25064..28447) [3384 nt, 1128 aa]
          Length = 1127

 Score = 77.8 bits (190), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 54/196 (27%), Positives = 93/196 (47%), Gaps = 28/196 (14%)

Query: 101 GSY----EVFLLMEYCSAGGLIDFMNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLI 156
           GSY     ++++MEYC+ G L   +   +   + E  +  IM ++   +  +H     +I
Sbjct: 108 GSYLQDTNLWIIMEYCAGGSLRTLLRPGM---IDEKYIGVIMRELLTALQCIHK--DNVI 162

Query: 157 HRDIKIENVLISDDKTFKVCDFGSVCGVIRPPKNAQEFSYVQNDILKNTTAQYRSPEMID 216
           HRDIK  NVLI+++   K+CDFG    + +     Q  +          T  + +PE+I 
Sbjct: 163 HRDIKAANVLITNEGKVKLCDFGVAAQLNQTSLRRQTMA---------GTPYWMAPEVI- 212

Query: 217 LYRGHPINEKSDIWALGVFLYKLCYYTTPFEKVGDAAILHSRFQFPAYP------QYSDR 270
              G   + K DIW+LG+  Y++     P+ ++   A+   +    + P      QYS  
Sbjct: 213 -MEGVYYDTKVDIWSLGITAYEIATGNPPYCEI--EALRAMQLITKSKPARLEGRQYSSG 269

Query: 271 LKNLISVMLSENPNQR 286
           LK  I++ L E+P +R
Sbjct: 270 LKEFIALCLDEDPKER 285

>NDAI0B02070 Chr2 (514024..517800) [3777 bp, 1258 aa] {ON} 
          Length = 1258

 Score = 77.8 bits (190), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 56/198 (28%), Positives = 101/198 (51%), Gaps = 24/198 (12%)

Query: 102 SYEVFLLMEYCSAGGLIDFMNTRLQN-RLTENEVLKIMSDITQGIAAMHALLPPLIHRDI 160
           S   ++L EY S G L+D++   +Q+  L E+   K    I   +  +H  L  ++HRD+
Sbjct: 260 SNHFYMLFEYVSGGQLLDYI---IQHGSLREHHARKFARGIASALQYLH--LNNIVHRDL 314

Query: 161 KIENVLISDDKTFKVCDFGSVCGVIRPPKNAQEFSYVQNDILKNTTAQYRSPEMIDLYRG 220
           KIEN++IS+    K+ DFG +  V    K    F           +  + +PE++   + 
Sbjct: 315 KIENIMISNSGEIKIIDFG-LSNVFDNRKQLHTFC---------GSLYFAAPELL---KA 361

Query: 221 HP-INEKSDIWALGVFLYKLCYYTTPFEKVGDAAILHSRFQFP--AYPQY-SDRLKNLIS 276
           HP    + D+W+ G+ LY L     PF+   ++++LH + +     YP + S  + +L+S
Sbjct: 362 HPYTGPEVDVWSFGIVLYVLVCGKVPFDD-ENSSVLHEKIRQGKVEYPNHLSIEVISLLS 420

Query: 277 VMLSENPNQRPNICQVLE 294
            M+  +P +R ++ QV+E
Sbjct: 421 KMIVVDPAKRASLRQVVE 438

>Suva_7.82 Chr7 (156049..158751) [2703 bp, 900 aa] {ON} YGL180W
           (REAL)
          Length = 900

 Score = 77.4 bits (189), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 76/313 (24%), Positives = 140/313 (44%), Gaps = 61/313 (19%)

Query: 16  TVGSHQARIIKYLTSGGFAHIYSAEISPADPNSIGNVACLKRVLVPDKQSLNVLRAEVDA 75
           + G++ A   K +  G FA +Y   ++      I  +  + R  + +K+ L  L  E+  
Sbjct: 26  SAGNYTAE--KEIGKGSFATVYRGHLTSDKSQHIA-IKEVSRAKLKNKKLLENLEIEIAI 82

Query: 76  MKLLRGNKHVVSYIDSHAAKSGAQDGSYEVFLLMEYCSAGGLIDFMNTRLQNRLTENEVL 135
           +K ++ + H+V  ID        +  S + +L+MEYC+ G L  F+  R +  +  + +L
Sbjct: 83  LKKIK-HPHIVGLID-------CERTSTDFYLIMEYCALGDLT-FLLKRRKELMENHPLL 133

Query: 136 K--------------------IMSDITQGIAAMHALLPP-LIHRDIKIENVLIS------ 168
           K                    ++S + Q  +A+  L    L+HRDIK +N+L+S      
Sbjct: 134 KTVFEKYPPPSENHNGLHRAFVLSYLQQLASALKFLRSKNLVHRDIKPQNLLLSTPLIGY 193

Query: 169 -DDKTFKVCDFGSVCGVIRPPKNAQEFSYVQNDILKNTTAQ--------YRSPEMIDLYR 219
            D KTF    F  +  +  P     +F + +   L NT+          Y +PE+++ Y+
Sbjct: 194 HDSKTFHELGFVGIYNL--PILKIADFGFAR--FLPNTSLAETLCGSPLYMAPEILN-YQ 248

Query: 220 GHPINEKSDIWALGVFLYKLCYYTTPFEKVGDAAIL------HSRFQFPAYPQYSDRLKN 273
            +  N K+D+W++G  ++++C  T PF       +       +    FP+Y      LK 
Sbjct: 249 KY--NAKADLWSVGTVVFEMCCGTPPFRASNHLELFKKIKRANDVITFPSYCNIEPELKE 306

Query: 274 LISVMLSENPNQR 286
           LI  +L+ +P +R
Sbjct: 307 LICSLLTFDPAKR 319

>KAFR0D03200 Chr4 (628993..633339) [4347 bp, 1448 aa] {ON} Anc_2.479
           YKL101W
          Length = 1448

 Score = 77.8 bits (190), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 60/200 (30%), Positives = 95/200 (47%), Gaps = 33/200 (16%)

Query: 104 EVFLLMEYCSAGGLIDFMNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIE 163
           E+FL++EY   G L D++ +R   +L+E E +     I +G++  H+    + HRD+K E
Sbjct: 193 ELFLVLEYVDGGELFDYLVSR--GKLSEREAVHYFKQIIEGVSYCHSF--NICHRDLKPE 248

Query: 164 NVLISDDK--TFKVCDFGSVCGVIRPPKNAQEFSYVQNDILKNTTA--QYRSPEMI--DL 217
           N+L+ D K  T K+ DFG     +  P          N +L  +     Y SPE++    
Sbjct: 249 NLLL-DKKINTIKIADFG--MAALELP----------NKLLVTSCGSPHYASPEIVMGKS 295

Query: 218 YRGHPINEKSDIWALGVFLYKLCYYTTPFEKVGDAAIL----HSRFQFPAYPQYSDRLKN 273
           Y G P    SD+W+ G+ L+ L     PF       +L      +FQ P     S   ++
Sbjct: 296 YHGSP----SDVWSCGIILFALLTGHLPFNDDSIKKLLLKVQSGKFQMPQ--NISLEAED 349

Query: 274 LISVMLSENPNQRPNICQVL 293
           LIS +L  +P +R  I  +L
Sbjct: 350 LISRILVVDPEKRIQINDIL 369

>AFR724C Chr6 complement(1770338..1771660) [1323 bp, 440 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR523C
           (SPS1)
          Length = 440

 Score = 76.3 bits (186), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 67/278 (24%), Positives = 132/278 (47%), Gaps = 30/278 (10%)

Query: 21  QARIIKYLTSGGFAHIYSAEISPADPNSIGNVACLKRVLVPD-KQSLNVLRAEVDAMKLL 79
           Q  I++ +  G F  +Y A     D  S   +  +K V + D  + +++L  E+  +  L
Sbjct: 19  QYEILQCIGRGNFGDVYKAR----DLTS-NEIVAIKVVNLEDTDEPIDLLAQEIFFLSEL 73

Query: 80  RGNKHVVSYIDSHAAKSGAQDGSYEVFLLMEYCSAGGLIDFMNTRLQNRLTENEVLKIMS 139
           R + ++ +Y  +             ++++MEYC  G   + +    ++++TE +   I+S
Sbjct: 74  R-SPYITNYKTAFLV-------DVSMWIVMEYCGGGSCAELLKYTPEHKVTEEQCAFIVS 125

Query: 140 DITQGIAAMHALLPPLIHRDIKIENVLISDDKTFKVCDFGSVCGVIRPPKNAQEFSYVQN 199
           ++  G+  +H+     IHRDIK  N+L++D+   K+ DFG V G +   +    F     
Sbjct: 126 EVLIGLDYLHSQRK--IHRDIKSANILLTDNGHVKLGDFG-VSGQMMVTRKRDTFV---- 178

Query: 200 DILKNTTAQYRSPEMIDLYRGHPINEKSDIWALGVFLYKLCYYTTPFEKVGDAAILHS-- 257
                 T  + +PE+ID  +    NE +DIW+LG+ + +L     P +K      L +  
Sbjct: 179 -----GTPFWMAPEVIDRNK-QGYNEMADIWSLGITVIELLMGHPPLDKYDAMKALMAIP 232

Query: 258 -RFQFPAYPQYSDRLKNLISVMLSENPNQRPNICQVLE 294
            R       ++S   ++ ++  L ++P+QRP   ++L+
Sbjct: 233 KRDPPKLDKRFSSHARDFVAQCLIKDPSQRPTAAELLK 270

>Suva_2.687 Chr2 complement(1215095..1218481) [3387 bp, 1128 aa]
           {ON} YCL024W (REAL)
          Length = 1128

 Score = 77.4 bits (189), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 80/301 (26%), Positives = 138/301 (45%), Gaps = 45/301 (14%)

Query: 7   GIYTQGTALTVGSH-QARIIKYLTSGGFAHIYSAEISPADPNSIGNVACLKRVL--VPDK 63
           G +  G  L +GS  + ++ +  ++G  A +    IS A  NS GNV+    V    PD 
Sbjct: 17  GPWKLGETLGLGSTGKVQLARNKSTGQEAAVKV--ISKAVFNS-GNVSGTSIVGSNTPDA 73

Query: 64  QSLNVLRAEVDAMKLLRGNKHVVSYIDSHAAKSGAQDGSYEVFLLMEYCSAGGLIDFMNT 123
               + R E+  MKLL  + +V+   D         + + +++L++EY   G L + +  
Sbjct: 74  LPYGIER-EIIIMKLL-NHPNVLRLYD-------VWETNTDLYLVLEYAEKGELFNLLVE 124

Query: 124 RLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIENVLISDDKTFKVCDFGSVCG 183
           R    L ENE ++    I  G++  HAL   ++HRD+K EN+L+      K+ DFG    
Sbjct: 125 R--GPLPENEAIRFFRQIIIGVSYCHAL--GIVHRDLKPENLLLDHKYNIKIADFGMAA- 179

Query: 184 VIRPPKNAQEFSYVQNDILKNTTA--QYRSPEMIDL--YRGHPINEKSDIWALGVFLYKL 239
                         +  +L+ +     Y +PE++    Y+G      SD+W+ GV L+ L
Sbjct: 180 -----------LETEGKLLETSCGSPHYAAPEIVSGIPYQGFA----SDVWSCGVILFAL 224

Query: 240 CYYTTPF-EKVGDAAIL-----HSRFQFPAYPQYSDRLKNLISVMLSENPNQRPNICQVL 293
                PF E+ G+   L        F+ P+  + S   ++LIS +L+ +P +R     +L
Sbjct: 225 LTGRLPFDEEDGNIRALLLKVQKGEFELPSDDEISREAQDLISKILTVDPERRIKARDIL 284

Query: 294 E 294
           +
Sbjct: 285 K 285

>Ecym_7392 Chr7 complement(803240..807544) [4305 bp, 1434 aa] {ON}
           similar to Ashbya gossypii ABL034W
          Length = 1434

 Score = 77.4 bits (189), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 60/202 (29%), Positives = 93/202 (46%), Gaps = 35/202 (17%)

Query: 104 EVFLLMEYCSAGGLIDFMNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIE 163
           E++L++EY   G L D++ +R   +L E E +     I QG++  H     + HRD+K E
Sbjct: 141 ELYLVLEYVEGGELFDYLISR--GKLPEQEAVHYFKQIVQGVSYCHHF--NICHRDLKPE 196

Query: 164 NVLISDDKTF--KVCDFGSVCGVIRPPKNAQEFSYVQNDILKNTTA---QYRSPEMI--D 216
           N+L+ D K    K+ DFG               +    D L  T+     Y SPE++   
Sbjct: 197 NLLL-DKKNLSVKIADFGMA-------------ALETTDKLLETSCGSPHYASPEIVMGQ 242

Query: 217 LYRGHPINEKSDIWALGVFLYKLCYYTTPFEKVGDAAIL----HSRFQFPAYPQYSDRLK 272
            Y G P    SD+W+ G+ L+ L     PF       +L      ++Q P     S+  K
Sbjct: 243 KYHGSP----SDVWSCGIILFALLTGHLPFNDDNVKKLLLKVQSGKYQMPQ--NISNEAK 296

Query: 273 NLISVMLSENPNQRPNICQVLE 294
           +LI+ +L  +P  R  I +VLE
Sbjct: 297 DLIAKILIVDPAMRITIDEVLE 318

>Ecym_2640 Chr2 complement(1232617..1236594) [3978 bp, 1325 aa] {ON}
            similar to Ashbya gossypii ACR281C
          Length = 1325

 Score = 77.4 bits (189), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 58/181 (32%), Positives = 87/181 (48%), Gaps = 25/181 (13%)

Query: 116  GLIDFMN-TRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIENVLISDDKTFK 174
            G ID  +   L+  +TE E   +   IT G+  +H     ++HRDIK ENV++ +    K
Sbjct: 1157 GSIDLFDLIELKTNMTEYEAKLLFKQITSGVKHLHD--NGIVHRDIKDENVIVDNKGCVK 1214

Query: 175  VCDFGSVCGVIRPPKNAQEFSYVQNDILKNTTAQYRSPEMI--DLYRGHPINEKSDIWAL 232
            + DFGS   V R P +     +V        T  Y +PE++  D Y G P     DIWA+
Sbjct: 1215 LIDFGSAAYVKRGPFDV----FV-------GTIDYAAPEVLEGDPYEGKP----QDIWAI 1259

Query: 233  GVFLYKLCYYTTPFEKVGDAAILHSRFQFPAYPQYSDRLKNLISVMLSENPNQRP---NI 289
            GV LY + Y   PF  V +  IL    +       S+    LI+++L  + ++RP   +I
Sbjct: 1260 GVLLYTIIYKENPFYNVDE--ILDGDLRINPSVIVSEECVALITMVLDRSLSKRPTVDDI 1317

Query: 290  C 290
            C
Sbjct: 1318 C 1318

>NCAS0C04120 Chr3 complement(840008..842755) [2748 bp, 915 aa] {ON}
           Anc_8.140
          Length = 915

 Score = 77.4 bits (189), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 67/263 (25%), Positives = 119/263 (45%), Gaps = 42/263 (15%)

Query: 61  PDKQSLNVLRAEVDAMKLLRGNKHVVSYIDSHAAKSGAQDGSYEVFLLMEYCSAGGLIDF 120
           P +   N ++ E+  MK    NKHVV  I+     S     S +++L++EYC  G ++  
Sbjct: 136 PKRNDPNKIKKEIAIMKKC-NNKHVVKLIEILDDLS-----SRKIYLVLEYCEKGPILWC 189

Query: 121 ------MNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIENVLISDDKTFK 174
                 +++R   +L+     +I  D+  G+  +H+    +IHRDIK  N+L+  +   K
Sbjct: 190 PRDQLEIDSRGPPQLSFQRAREIFRDVILGLEYLHS--QGIIHRDIKPANLLMDKNGVVK 247

Query: 175 VCDFG---SVCGVIRPPKNAQEFS--------YVQNDILKNTTAQYRSPEMIDLYRGHPI 223
           + DFG   +  G I    +  E +        Y     L     +  + +  +L+ G  I
Sbjct: 248 ISDFGVSLAANGNIDTNDDELELTKTVGTPVFYAPEICLGAAAMERFNLDKDELFNGSCI 307

Query: 224 NEKSDIWALGVFLYKLCY----YTTPFEKVGDAAILHSRFQFPAYPQYSD---------- 269
           + K DIWALG+ LY L +    + + FE      I++ + +FP +    D          
Sbjct: 308 SFKIDIWALGITLYCLLFGMLPFVSEFELKLFEKIVNEKLRFPTFETLQDNHISEISHIR 367

Query: 270 ---RLKNLISVMLSENPNQRPNI 289
                K+L++ +L +NP +R +I
Sbjct: 368 EFVHAKDLLNKLLEKNPAKRISI 390

>Smik_4.767 Chr4 complement(1353354..1355630) [2277 bp, 758 aa] {ON}
           YDR490C (REAL)
          Length = 758

 Score = 77.0 bits (188), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 66/255 (25%), Positives = 116/255 (45%), Gaps = 28/255 (10%)

Query: 52  VACLKRVLVPDKQSLNVLRAEVDAMKLLRGNKHVVSYIDSHAAKSGAQDGSYEVFLLMEY 111
           V  L +  +  ++ +  +  E  A++ L G K ++    +       QD +  ++ L+EY
Sbjct: 153 VKVLSKEYLIRQKKVKYVTVEKLALQKLNGTKGIIRLFFTF------QDEA-SLYFLLEY 205

Query: 112 CSAGGLIDFMNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIENVLISDDK 171
              G  +  +  +    L E       S I   + ++H++   +IHRDIK EN+L+  D 
Sbjct: 206 APHGDFLGLI--KKYGSLNEICARYYASQIIDAVDSLHSI--GIIHRDIKPENILLDKDM 261

Query: 172 TFKVCDFGSVCGVIRPPKNAQE----FSYVQNDILKNTTAQYRSPEMI-DLYRGHPINEK 226
             K+ DFG+   +   P NA +    F           TA+Y SPE++ D Y     + +
Sbjct: 262 KVKLTDFGTAKILPEQPSNAADGKPCFDLYAKSKSFVGTAEYVSPELLNDSY----TDSR 317

Query: 227 SDIWALGVFLYKLCYYTTPFEKVGD----AAILHSRFQFPA-YPQYSDRLKNLISVMLSE 281
            DIWA G  LY++     PF+   +      ++  ++ F A +PQ    +K+L+  +L  
Sbjct: 318 CDIWAFGCILYQMLAGKPPFKAANEYLTFQKVMKIQYAFTAGFPQI---VKDLVKKLLVR 374

Query: 282 NPNQRPNICQVLEEV 296
           +PN R  I Q+   V
Sbjct: 375 DPNDRLAIEQIKAHV 389

>NCAS0G01210 Chr7 complement(215860..216963) [1104 bp, 367 aa] {ON}
           Anc_6.262 YPL236C
          Length = 367

 Score = 75.1 bits (183), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 75/344 (21%), Positives = 144/344 (41%), Gaps = 58/344 (16%)

Query: 13  TALTVGSHQARIIKYLTSGGFAHIYSAEISPADP-NSIGNVACLKRVLVP--DKQSLNVL 69
           + +++ +   +I K L     ++ Y      ++P    G +  LKR+  P  D +S++  
Sbjct: 21  SIISINARDYKIEKLLQDENLSYSYLVRTLDSEPPFENGPLFVLKRIYCPFGDIESVSAA 80

Query: 70  RAEVDAMKLLRGNKHVVSYIDSHAAKSGAQDGSYEVFLLMEYCSAGGLIDFMN------- 122
             E+   K   GN H++S +D    +    DGS ++ +L  +   G + D +N       
Sbjct: 81  MNEISYYKKFAGNSHIISCLDYQLHQK--YDGSKQIDVLFPFYHYGSVQDDINRHLLSSS 138

Query: 123 TRLQNRLTENEVLKIMSDITQGIAAMH-------------ALL-----PPLIHRDIKIEN 164
           T L   + E + +KIM  + +G+  +H             A++      PL+  D+ +E 
Sbjct: 139 TALGTVIPEKDCIKIMIGLCRGLLPLHDPKLREQGSPDDMAIMSYSENAPLLLNDLPMEL 198

Query: 165 --------------------VLISDDKTFKVCDFGSVCGVIRPPKNAQEFSYVQNDILKN 204
                               +L+S+     + D  S            + +  Q  I ++
Sbjct: 199 SKDNENENVCFAYYNLRPDLILLSEQGNAIIADLQSCFRTNITISTEIQLNRFQQWIEEH 258

Query: 205 TTAQYRSPEMIDLYRGHPINEKSDIWALGVFLYKLCYYTTPFEK-------VGDAAILHS 257
            T Q+ +PE++ L  G  I  K DIW+LG  LY + +  +PFE+       V    I   
Sbjct: 259 CTLQFSAPELLTLKMGDKITAKVDIWSLGCVLYSMMFGISPFEREEQLNGGVVKYCIKMG 318

Query: 258 RFQFP-AYPQYSDRLKNLISVMLSENPNQRPNICQVLEEVSRIQ 300
           ++  P     YS  + ++++  L  +P++RP++  +L  +  IQ
Sbjct: 319 KYSIPDTKGTYSQEIIDILNTCLKVDPSERPSLNGILNNLQEIQ 362

>NCAS0B05090 Chr2 (946126..949758) [3633 bp, 1210 aa] {ON} 
          Length = 1210

 Score = 77.0 bits (188), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 61/211 (28%), Positives = 106/211 (50%), Gaps = 26/211 (12%)

Query: 102 SYEVFLLMEYCSAGGLIDFMNTRLQN-RLTENEVLKIMSDITQGIAAMHALLPPLIHRDI 160
           S   ++L EY S G L+D++   +Q+  L E+   K    I   +  +HA    ++HRD+
Sbjct: 258 SNHFYMLFEYVSGGQLLDYI---IQHGSLREHHARKFARGIASALEYIHANN--IVHRDL 312

Query: 161 KIENVLISDDKTFKVCDFGSVCGVIRPPKNAQEFSYVQNDILKNTTAQYRSPEMIDLYRG 220
           KIEN++IS     K+ DFG +  V    K    F           +  + +PE++   + 
Sbjct: 313 KIENIMISTSGEIKIIDFG-LSNVFDRKKQLHTFC---------GSLYFAAPELL---KA 359

Query: 221 HP-INEKSDIWALGVFLYKLCYYTTPFEKVGDAAILHSRFQFPA--YPQY-SDRLKNLIS 276
           HP    + D+W+ GV LY L     PF+   ++++LH + +     YP + S  + +L+S
Sbjct: 360 HPYTGPEVDVWSFGVVLYVLVCGKVPFDD-ENSSVLHEKIKQGKVDYPNHLSIEVISLLS 418

Query: 277 VMLSENPNQRPNICQVLEE--VSRIQNVPCP 305
            ML  +P +R ++ QV+E   ++R  + P P
Sbjct: 419 KMLVVDPLRRASLKQVVEHPWMTRGYDYPPP 449

>YGL180W Chr7 (160065..162758) [2694 bp, 897 aa] {ON}  ATG1Protein
           ser/thr kinase required for vesicle formation in
           autophagy and the cytoplasm-to-vacuole targeting (Cvt)
           pathway; structurally required for phagophore assembly
           site formation; during autophagy forms a complex with
           Atg13p and Atg17p
          Length = 897

 Score = 76.6 bits (187), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 76/314 (24%), Positives = 137/314 (43%), Gaps = 63/314 (20%)

Query: 16  TVGSHQARIIKYLTSGGFAHIYSAEISPADPNSIGNVACLKRVLVPDKQSLNVLRAEVDA 75
           + G++ A   K +  G FA +Y   ++      +  +  + R  + +K+ L  L  E+  
Sbjct: 20  SAGNYTAE--KEIGKGSFATVYRGHLTSDKSQHVA-IKEVSRAKLKNKKLLENLEIEIAI 76

Query: 76  MKLLRGNKHVVSYIDSHAAKSGAQDGSYEVFLLMEYCSAGGLIDFMNTRLQNRLTENEVL 135
           +K ++ + H+V  ID        +  S + +L+MEYC+ G L   +  R    L EN  L
Sbjct: 77  LKKIK-HPHIVGLID-------CERTSTDFYLIMEYCALGDLTFLLKRR--KELMENHPL 126

Query: 136 K---------------------IMSDITQGIAAMHALLPP-LIHRDIKIENVLIS----- 168
                                 ++S + Q  +A+  L    L+HRDIK +N+L+S     
Sbjct: 127 LRTVFEKYPPPSENHNGLHRAFVLSYLQQLASALKFLRSKNLVHRDIKPQNLLLSTPLIG 186

Query: 169 --DDKTFKVCDFGSVCGVIRPPKNAQEFSYVQNDILKNTTAQ--------YRSPEMIDLY 218
             D K+F    F  +  +  P     +F + +   L NT+          Y +PE+++ Y
Sbjct: 187 YHDSKSFHELGFVGIYNL--PILKIADFGFAR--FLPNTSLAETLCGSPLYMAPEILN-Y 241

Query: 219 RGHPINEKSDIWALGVFLYKLCYYTTPFEKVGDAAIL------HSRFQFPAYPQYSDRLK 272
           + +  N K+D+W++G  ++++C  T PF       +       +    FP+Y      LK
Sbjct: 242 QKY--NAKADLWSVGTVVFEMCCGTPPFRASNHLELFKKIKRANDVITFPSYCNIEPELK 299

Query: 273 NLISVMLSENPNQR 286
            LI  +L+ +P QR
Sbjct: 300 ELICSLLTFDPAQR 313

>Smik_7.92 Chr7 (155049..157742) [2694 bp, 897 aa] {ON} YGL180W
           (REAL)
          Length = 897

 Score = 76.6 bits (187), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 77/315 (24%), Positives = 137/315 (43%), Gaps = 63/315 (20%)

Query: 15  LTVGSHQARIIKYLTSGGFAHIYSAEISPADPNSIGNVACLKRVLVPDKQSLNVLRAEVD 74
           ++ G++ A   K +  G FA +Y   +       I  +  + R  + +K+ L  L  E+ 
Sbjct: 19  ISAGNYTAE--KEIGKGSFATVYRGHLISDKSQHIA-IKEVSRAKLKNKKLLENLEIEIA 75

Query: 75  AMKLLRGNKHVVSYIDSHAAKSGAQDGSYEVFLLMEYCSAGGLIDFMNTRLQNRLTENEV 134
            +K ++ + H+V  ID        +  S + +L+MEYC+ G L   +  R    L EN  
Sbjct: 76  ILKKIK-HPHIVGLID-------CERTSTDFYLIMEYCALGDLTFLLKRR--KELMENHP 125

Query: 135 LK---------------------IMSDITQGIAAMHALLPP-LIHRDIKIENVLIS---- 168
           L                      ++S + Q  +A+  L    L+HRDIK +N+L+S    
Sbjct: 126 LLRTVFEKYPPPSESHNGLHRAFVLSYLQQLASALKFLRSKNLVHRDIKPQNLLLSTPLI 185

Query: 169 ---DDKTFKVCDFGSVCGVIRPPKNAQEFSYVQNDILKNTTAQ--------YRSPEMIDL 217
              D KTF    F  +  +  P     +F + +   L NT+          Y +PE+++ 
Sbjct: 186 GYHDSKTFHELGFVGIYNL--PILKIADFGFAR--FLPNTSLAETLCGSPLYMAPEILN- 240

Query: 218 YRGHPINEKSDIWALGVFLYKLCYYTTPFEKVGDAAIL------HSRFQFPAYPQYSDRL 271
           Y+ +  N K+D+W++G  ++++C  T PF       +       +    FP+Y      L
Sbjct: 241 YQKY--NAKADLWSVGTVVFEMCCGTPPFRASNHLELFKKIKRANDAITFPSYCNIEPEL 298

Query: 272 KNLISVMLSENPNQR 286
           K LI  +L+ +P +R
Sbjct: 299 KKLICSLLTFDPAKR 313

>TBLA0C04600 Chr3 (1112043..1115990) [3948 bp, 1315 aa] {ON}
           Anc_8.279 YLR096W
          Length = 1315

 Score = 76.6 bits (187), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 56/198 (28%), Positives = 100/198 (50%), Gaps = 24/198 (12%)

Query: 102 SYEVFLLMEYCSAGGLIDFMNTRLQN-RLTENEVLKIMSDITQGIAAMHALLPPLIHRDI 160
           S   ++L EY S G L+D++   +Q+  L E+   K    I   +  +H+    ++HRD+
Sbjct: 279 SNHFYMLFEYVSGGQLLDYI---IQHGSLREHHARKFARGIASALQYLHS--NNIVHRDL 333

Query: 161 KIENVLISDDKTFKVCDFGSVCGVIRPPKNAQEFSYVQNDILKNTTAQYRSPEMIDLYRG 220
           KIEN++IS     K+ DFG +  +    +    F           +  + +PE++   + 
Sbjct: 334 KIENIMISTSGEIKIIDFG-LSNLYDTTRQLHTFC---------GSLYFAAPELL---KA 380

Query: 221 HP-INEKSDIWALGVFLYKLCYYTTPFEKVGDAAILHSRFQFPA--YPQY-SDRLKNLIS 276
           HP    + D+W+ GV LY L     PF+   ++++LH + +     YPQ+ S  + +L+S
Sbjct: 381 HPYTGPEVDVWSFGVVLYVLVCGKVPFDD-ENSSVLHEKIKQGKVDYPQHLSIEVISLLS 439

Query: 277 VMLSENPNQRPNICQVLE 294
            ML  +P +R  + QV+E
Sbjct: 440 KMLVVDPKKRATLRQVVE 457

>Ecym_1275 Chr1 complement(560481..561836) [1356 bp, 451 aa] {ON}
           similar to Ashbya gossypii AAR009W
          Length = 451

 Score = 75.5 bits (184), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 78/291 (26%), Positives = 131/291 (45%), Gaps = 43/291 (14%)

Query: 26  KYLTSGGFAHIYSAEISPADPNSIGNVACLKRVLVPDKQSLNVLRAEVDAMKLLRGNKHV 85
           K L +G F  +  A  S  D + +     LKR L  D+  LN+L  E+  ++ L  + H+
Sbjct: 58  KTLGAGAFGVVRQARNSNNDED-VAVKILLKRALKGDE--LNMLYDELMILQKL-DHPHI 113

Query: 86  VSYIDSHAAKSGAQDGSYEVFLLMEYCSAGGLIDFMNTRLQNRLTENEVLKIMSDITQGI 145
           V + D   +K        + +++ +  + G L D +  +   R TE + +KI+  + + I
Sbjct: 114 VKFKDWFESKD-------KFYIVTQLATGGELFDRILKK--GRFTETDAVKIVVQMLEAI 164

Query: 146 AAMHALLPPLIHRDIKIENVLI---SDDKTFKVCDFGSVCGVIRPPKNAQEFSYVQNDIL 202
             MH+    ++HRD+K ENVL    SDD    + DFG           A++ S   + I 
Sbjct: 165 EYMHS--KNVVHRDLKPENVLYLNPSDDSELVISDFGI----------AKQLSSEDHLIH 212

Query: 203 KNTTAQ-YRSPEMIDLYRGHPINEKSDIWALGVFLYKLCYYTTPFEKVGDAAILHS---- 257
           +   +  Y +PE++    GH   +  DIW+LGV  Y L    +PF        L      
Sbjct: 213 RAAGSMGYVAPEVLTT-SGH--GKPCDIWSLGVITYTLLCGYSPFVAESSEGFLEEVTRS 269

Query: 258 ----RFQFPAYPQYSDRLKNLISVMLSENPNQRPNICQVLEE---VSRIQN 301
                F  P +   S   K  I   L+ +P++RP   ++L++   +S+ QN
Sbjct: 270 KYPVTFHKPYWNSISVEAKEFILKALTLDPSERPTATELLQDTWIISKQQN 320

>TPHA0G01630 Chr7 (336511..339126) [2616 bp, 871 aa] {ON} Anc_8.668
           YPL150W
          Length = 871

 Score = 76.6 bits (187), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 57/203 (28%), Positives = 103/203 (50%), Gaps = 37/203 (18%)

Query: 104 EVFLLMEYCSAGGLIDFMNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIE 163
           +V++ +EYC    L D++   +  R+  +E  ++ + I   +   H+L    +HRD+K+E
Sbjct: 102 KVWMSLEYCPGKELYDYL--LVMRRIPLDECSRLFAQIVGAVYYAHSL--NCVHRDLKLE 157

Query: 164 NVLISDDKTFKVCDFGSV--CGVIRPPKNAQEFSYVQNDILKNTTAQYRSPEMI--DLYR 219
           N+L+      K+ DFG    C      KN       Q + +  TT  Y +PE++  D Y 
Sbjct: 158 NILLDMQGNAKLADFGFTRECAT----KN-------QLETICGTTV-YMAPELLRRDTYD 205

Query: 220 GHPINEKSDIWALGVFLYKLCYYTTPFEKVGDAAILHSRFQFPAY---PQYSDRLKN--- 273
           G  I    DIW+LGV LY L   + PF++  +     +R ++      P Y++++ N   
Sbjct: 206 GFKI----DIWSLGVILYTLINGSMPFDEEDE-----TRTEWKIINEEPDYNEKIFNANS 256

Query: 274 --LISVMLSENPNQRPNICQVLE 294
             LI  +L ++P +RP++ ++L+
Sbjct: 257 IELIKSLLIKDPKKRPSMTEILK 279

>ACL104C Chr3 complement(157357..160200) [2844 bp, 947 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YHR102W
           (KIC1)
          Length = 947

 Score = 76.6 bits (187), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 57/201 (28%), Positives = 95/201 (47%), Gaps = 24/201 (11%)

Query: 101 GSY----EVFLLMEYCSAGGLIDFMNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLI 156
           GSY    +++++MEYC+ G L   +      ++ E  +  I+  +   +  +H     +I
Sbjct: 89  GSYLYDTKLWVIMEYCAGGSLRTLLR---PGKIDEKYLGVIVRKLLIALVYIHK--DNVI 143

Query: 157 HRDIKIENVLISDDKTFKVCDFGSVCGVIRPPKNAQEFSYVQNDILKNTTAQYRSPEMID 216
           HRDIK  NVLI+++   K+CDFG    +       Q  +          T  + +PE+I 
Sbjct: 144 HRDIKAANVLITNEGHVKLCDFGVAAQLTAANHKRQTMA---------GTPYWMAPEVI- 193

Query: 217 LYRGHPINEKSDIWALGVFLYKLCYYTTPFEKVGD--AAILHSRFQFPAYP--QYSDRLK 272
              G   N K+DIW+LG+  Y++     P+  V    A  L ++ + P      YS  LK
Sbjct: 194 -MEGVYYNTKADIWSLGITAYEIATGNPPYCDVEALRAMQLITKSKPPRLEGRNYSPLLK 252

Query: 273 NLISVMLSENPNQRPNICQVL 293
             I++ L E+P +RP    +L
Sbjct: 253 EFIALCLDEDPEERPTAEDLL 273

>Smik_8.180 Chr8 (292993..296214) [3222 bp, 1073 aa] {ON} YHR102W
           (REAL)
          Length = 1073

 Score = 76.6 bits (187), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 55/196 (28%), Positives = 91/196 (46%), Gaps = 28/196 (14%)

Query: 101 GSY----EVFLLMEYCSAGGLIDFMNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLI 156
           GSY     ++++MEYC+ G L   +      ++ E  +  IM ++   +  +H     +I
Sbjct: 87  GSYLKDTSLWIIMEYCAGGSLRSLLRP---GKIDEKYIGVIMRELLVALKCIHK--DNVI 141

Query: 157 HRDIKIENVLISDDKTFKVCDFGSVCGVIRPPKNAQEFSYVQNDILKNTTAQYRSPEMID 216
           HRDIK  NVLI+++   K+CDFG    V +     Q  +          T  + +PE+I 
Sbjct: 142 HRDIKAANVLITNEGNVKLCDFGVAAQVNQTSLRRQTMA---------GTPYWMAPEVI- 191

Query: 217 LYRGHPINEKSDIWALGVFLYKLCYYTTPFEKVGDAAILHSRFQFPAYP------QYSDR 270
              G   + K DIW+LG+  Y++     P+  V   A+   +    + P       YS  
Sbjct: 192 -MEGVYYDTKVDIWSLGITTYEIATGNPPYCDV--EALRAMQLIIKSKPPRLEGRSYSPS 248

Query: 271 LKNLISVMLSENPNQR 286
           LK  I++ L E+P +R
Sbjct: 249 LKEFIALCLDEDPKER 264

>KLTH0D10714g Chr4 (880389..883007) [2619 bp, 872 aa] {ON} similar
           to uniprot|Q03002 Saccharomyces cerevisiae YPL141C
           Hypothetical ORF
          Length = 872

 Score = 76.6 bits (187), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 53/208 (25%), Positives = 100/208 (48%), Gaps = 32/208 (15%)

Query: 99  QDGSYEVFLLMEYCSAGGLIDFMNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHR 158
           Q+  Y + +++EY S G    ++  +   RL E+   ++ + +  G+  MH+    L+HR
Sbjct: 115 QNSKY-IGIVLEYASGGEFYKYIQKK--RRLKESAACRLFAQLISGVYYMHS--KGLVHR 169

Query: 159 DIKIENVLISDDKTFKVCDFGSVCGVIRPPKNAQEFSYVQNDILKNTTAQ--YRSPEMID 216
           D+K+EN+L+  ++   + DFG V           EF   +N+++K +     Y +PE++ 
Sbjct: 170 DLKLENLLLDKNENLLITDFGFV----------NEF-LPENELMKTSCGSPCYAAPELVV 218

Query: 217 LYRGHPINEKSDIWALGVFLYKLCYYTTPFEK-----VGDAA------ILHSRFQFPAYP 265
             R +    K+DIW+ GV +Y +     P++       GD        I  +  +FP Y 
Sbjct: 219 TARPYEA-RKADIWSCGVIMYAMLAGYLPWDDDPENPDGDDIGKLYRYITRTPLKFPDY- 276

Query: 266 QYSDRLKNLISVMLSENPNQRPNICQVL 293
             +   ++L+  +L  +P +R  I Q L
Sbjct: 277 -IAPVPRDLLRAILVADPKKRITIAQTL 303

>KLLA0C00979g Chr3 (73295..74746) [1452 bp, 483 aa] {ON} similar to
           uniprot|P08458 Saccharomyces cerevisiae YDR523C SPS1
           dispensable for mitosis involved in middle/late stage of
           meiosis required for spore wall formation
           serine/threonine kinase homologous to Ste20p expressed
           in middle/late meiosis
          Length = 483

 Score = 75.5 bits (184), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 74/293 (25%), Positives = 123/293 (41%), Gaps = 43/293 (14%)

Query: 20  HQARIIKYLTSGGFAHIYSAEI-----SPADPNSIGNVACLKRV--LVPDKQSLNVLRAE 72
            Q ++++ +  G F  +Y A        P DP    NV    +   L    + +++L  E
Sbjct: 5   QQFQLLECVGKGNFGDVYLAHYLGSNQEPTDPKIPKNVPLAIKCINLEHSNEPIDLLLKE 64

Query: 73  VDAMKLLRGNKHVVSYIDSHAAKSGAQDGSYEVFLLMEYCSAGGLIDFMNTRLQNRLTEN 132
           +  +  L        YI  +    G   G   ++++MEYCS G L++ +  R  +RLTE 
Sbjct: 65  IYFLSTLH-----CPYITHYY---GTFTGDCNLYIVMEYCSNGSLLNLL--RYYSRLTEQ 114

Query: 133 EVLKIMSDITQGIAAMHALLPPLIHRDIKIENVLISDDKTFKVCDFGSVCGVIR------ 186
               I+  +   +  +H     LIHRD+K  N+L++DD   ++ D G V G ++      
Sbjct: 115 TTCFIILQVCHALEYLHE--KRLIHRDLKAANILLNDDGEVRLADLG-VTGQLKFNSTRH 171

Query: 187 PPKNAQEFSYVQNDILKNTTAQYRSPEMIDLYRGHPINEKSDIWALGVFLYKLCYYTTPF 246
             KN   F           T  + +PE+I   +    + K DIW+LG+   +L     P 
Sbjct: 172 GGKNLNTFV---------GTPFWMAPEII---KNQSYDGKCDIWSLGITTLELLNGKPPM 219

Query: 247 EKVGDAAILHSRFQFPA-----YPQYSDRLKNLISVMLSENPNQRPNICQVLE 294
             +     L    +  A         S   K+ I   L ++PNQRP   Q+L+
Sbjct: 220 SHLDSMKALMRIPKLNADSILRNMDISPLGKDFIRSCLQQDPNQRPTCKQLLQ 272

>KNAG0J01670 Chr10 complement(304021..307050) [3030 bp, 1009 aa]
           {ON} 
          Length = 1009

 Score = 76.6 bits (187), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 54/200 (27%), Positives = 101/200 (50%), Gaps = 31/200 (15%)

Query: 104 EVFLLMEYCSAGGLIDFMNTRLQ-NRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKI 162
           +V++ +EYC    L D +   LQ  R+   E +++ S I   +   H+L    +HRD+K+
Sbjct: 111 KVWMALEYCPGRELYDHV---LQMKRIPAEECIQLFSQIVGAVYYAHSL--NCVHRDLKL 165

Query: 163 ENVLISDDKTFKVCDFGSVCGVIRPPKNAQEFSYVQNDILKNTTAQYRSPEMIDL--YRG 220
           EN+L+  D   K+ DFG     +           V  + +  TT  Y +PE+ +   Y G
Sbjct: 166 ENILLDKDGNAKLTDFGFTRECMEK---------VNLETICGTTV-YMAPELTERKPYDG 215

Query: 221 HPINEKSDIWALGVFLYKLCYYTTPFEKVGDAAILHSRFQ-FPAYPQYSDRL-----KNL 274
             I    DIW+LGV LY +   + PF++  +A    ++++     P+Y+ +      ++L
Sbjct: 216 FKI----DIWSLGVILYTMLSGSMPFDEDDEAK---TKWKIINEEPEYNSKFMTAEGEDL 268

Query: 275 ISVMLSENPNQRPNICQVLE 294
           +  +L ++ N RP++ ++L+
Sbjct: 269 VRKLLQKDSNLRPSVREILQ 288

>NDAI0E01290 Chr5 complement(255593..257782) [2190 bp, 729 aa] {ON}
           Anc_8.654
          Length = 729

 Score = 76.3 bits (186), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 60/239 (25%), Positives = 116/239 (48%), Gaps = 45/239 (18%)

Query: 72  EVDAMKLLRGNKHVVSYIDSHAAKSGAQDGSYEVFLLMEYCSAGGLIDFMNTRLQNRLTE 131
           E++A+KLL       ++ +    +   Q+  Y + +++E+ S G    ++  + + RL E
Sbjct: 103 EINALKLL-------THPNIVRLEEVLQNSKY-IGIVLEFASGGEFYKYL--QRKRRLKE 152

Query: 132 NEVLKIMSDITQGIAAMHALLPPLIHRDIKIENVLISDDKTFKVCDFGSVCGVIRPPKNA 191
               ++ + +  G+  MH+    L+HRD+K+EN+L+  ++   + DFG V          
Sbjct: 153 PHACQLFAQLISGVTYMHS--KGLVHRDLKLENLLLDKNENLIITDFGFV---------- 200

Query: 192 QEFSYVQNDILKNTTAQ--YRSPEMI---DLYRGHPINEKSDIWALGVFLYKLCYYTTPF 246
            EF +  N+++K +     Y +PE++   + YR      K DIW+ G+ LY +     P+
Sbjct: 201 NEF-FGSNELMKRSCGSPCYAAPELVLSTEPYRA----RKVDIWSCGIILYAMLAGYLPW 255

Query: 247 EK-----VGD------AAILHSRFQFPAYPQYSDRLKNLISVMLSENPNQRPNICQVLE 294
           +       GD        I  +  +FPAY   S   ++LI  +L+ NP++R +I  + +
Sbjct: 256 DDDSQNPNGDDIGKLYQYITKTALKFPAY--ISPLARDLIRKILTANPSRRISISYICK 312

>Skud_4.783 Chr4 complement(1382552..1385959) [3408 bp, 1135 aa]
           {ON} YDR507C (REAL)
          Length = 1135

 Score = 76.6 bits (187), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 77/301 (25%), Positives = 139/301 (46%), Gaps = 45/301 (14%)

Query: 7   GIYTQGTALTVGSH-QARIIKYLTSGGFAHIYSAEISPADPNSIGNVACLKRV--LVPDK 63
           G +  G  L +GS  + ++ +  ++G  A +    IS A  N+ GN++    V  + PD 
Sbjct: 17  GPWKLGETLGLGSTGKVQLARNKSTGQEAAVKV--ISKAVFNA-GNMSGTSIVGSITPDA 73

Query: 64  QSLNVLRAEVDAMKLLRGNKHVVSYIDSHAAKSGAQDGSYEVFLLMEYCSAGGLIDFMNT 123
               + R E+  MKLL  + +V+   D         + + +++L++EY   G L + +  
Sbjct: 74  LPYGIER-EIIIMKLL-NHPNVLRLYD-------VWETNTDLYLVLEYAEKGELFNLLVE 124

Query: 124 RLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIENVLISDDKTFKVCDFGSVCG 183
           R    L ENE ++    I  G++  HAL   ++HRD+K EN+L+      K+ DFG    
Sbjct: 125 R--GPLPENEAIRFFRQIIIGVSYCHAL--GIVHRDLKPENLLLDHKYNIKIADFGMAA- 179

Query: 184 VIRPPKNAQEFSYVQNDILKNTTA--QYRSPEMIDL--YRGHPINEKSDIWALGVFLYKL 239
                         +  +L+ +     Y +PE++    Y+G      SD+W+ GV L+ L
Sbjct: 180 -----------LETEGKLLETSCGSPHYAAPEIVSGIPYQGFA----SDVWSCGVILFAL 224

Query: 240 CYYTTPF-EKVGDAAIL-----HSRFQFPAYPQYSDRLKNLISVMLSENPNQRPNICQVL 293
                PF E+ G+   L       +F+ P+  + S   ++LI  +L+ +P +R     +L
Sbjct: 225 LTGRLPFDEEDGNIRTLLLKVQKGQFELPSDDEVSREAQDLICKILTVDPKRRIKARDIL 284

Query: 294 E 294
           +
Sbjct: 285 K 285

>CAGL0L11550g Chr12 (1232015..1235233) [3219 bp, 1072 aa] {ON}
           similar to uniprot|P38692 Saccharomyces cerevisiae
           YHR102w NRK1 ser/thr protein kinase
          Length = 1072

 Score = 76.3 bits (186), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 54/204 (26%), Positives = 97/204 (47%), Gaps = 28/204 (13%)

Query: 101 GSY----EVFLLMEYCSAGGLIDFMNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLI 156
           GSY     ++++MEYC+ G L   +      ++ E  +  IM ++   +  +H     +I
Sbjct: 80  GSYLRGTSLWIIMEYCAGGSLRSLLRP---GKIDEKYIGVIMRELLVALKVIHK--DNVI 134

Query: 157 HRDIKIENVLISDDKTFKVCDFGSVCGVIRPPKNAQEFSYVQNDILKNTTAQYRSPEMID 216
           HRDIK  NVLI+++   K+CDFG    + +     Q  +          T  + +PE+I 
Sbjct: 135 HRDIKAANVLITNEGQVKLCDFGVAAQLNQTSLRRQTMA---------GTPYWMAPEVI- 184

Query: 217 LYRGHPINEKSDIWALGVFLYKLCYYTTPFEKVGDAAILHSRFQFPAYP------QYSDR 270
              G   + K DIW+LG+  Y++     P+  V   A+   +    + P       Y+ +
Sbjct: 185 -MEGVYYDTKVDIWSLGITAYEIATGNPPYCDV--EALRAMQLIIKSKPPRLEERNYTPQ 241

Query: 271 LKNLISVMLSENPNQRPNICQVLE 294
           LK  I++ L E+P +R +  ++L+
Sbjct: 242 LKEFIALCLDEDPQERLSAEELLK 265

>KAFR0C01440 Chr3 complement(295468..298755) [3288 bp, 1095 aa] {ON}
           Anc_3.92 YDR490C
          Length = 1095

 Score = 76.3 bits (186), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 56/243 (23%), Positives = 110/243 (45%), Gaps = 18/243 (7%)

Query: 52  VACLKRVLVPDKQSLNVLRAEVDAMKLLRGNKHVVSYIDSHAAKSGAQDGSYEVFLLMEY 111
           V  L +  +  ++ +  +  E +A++ +  +K +V    +       QD S  ++ L+EY
Sbjct: 207 VKVLNKEYLIKQKKVKYVNIEKNALQRINNSKMIVKLFFTF------QDES-SLYFLLEY 259

Query: 112 CSAGGLIDFMNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIENVLISDDK 171
           C  G  +  M  +    L E       + +   I  +H     +IHRDIK EN+L+  + 
Sbjct: 260 CPNGDFLSLM--KKYGSLNETVACYYSAQVIDAIDYLHT--NGIIHRDIKPENILLDKEF 315

Query: 172 TFKVCDFGSVCGVIRPPKNAQEFSYVQNDILKNTTAQYRSPEMIDLYRGHPINEKSDIWA 231
             K+ DFG+    I       +F  +        TA+Y +PE+++      ++ + D+WA
Sbjct: 316 KIKLTDFGT--AKILDSSTNNKFDLLTRSKSFVGTAEYVAPELLN---DSFVDYRCDVWA 370

Query: 232 LGVFLYKLCYYTTPFEKVGDAAILHS--RFQFPAYPQYSDRLKNLISVMLSENPNQRPNI 289
            G  LY++     PF+   +        + Q+     +   +++L+  +L ++ NQRP+I
Sbjct: 371 FGCILYQMIAGKPPFKATNEYLTFQKVMKVQYAFTAGFPLIIRDLVKKILVKDLNQRPSI 430

Query: 290 CQV 292
            Q+
Sbjct: 431 SQI 433

>YKL101W Chr11 (248920..253476) [4557 bp, 1518 aa] {ON}
           HSL1Nim1p-related protein kinase that regulates the
           morphogenesis and septin checkpoints; associates with
           the assembled septin filament; required along with Hsl7p
           for bud neck recruitment, phosphorylation, and
           degradation of Swe1p
          Length = 1518

 Score = 76.6 bits (187), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 61/235 (25%), Positives = 111/235 (47%), Gaps = 39/235 (16%)

Query: 69  LRAEVDAMKLLRGNKHVVSYIDSHAAKSGAQDGSYEVFLLMEYCSAGGLIDFMNTRLQNR 128
           +  E+  MKL+  + +V++  +    KS       E++L++EY   G L D++ ++   +
Sbjct: 161 IEREIVIMKLI-SHTNVMALFEVWENKS-------ELYLVLEYVDGGELFDYLVSK--GK 210

Query: 129 LTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIENVLIS-DDKTFKVCDFGSVCGVIRP 187
           L E E +     I +G++  H+    + HRD+K EN+L+   ++  K+ DFG     +  
Sbjct: 211 LPEREAIHYFKQIVEGVSYCHSF--NICHRDLKPENLLLDKKNRRIKIADFG--MAALEL 266

Query: 188 PKNAQEFSYVQNDILKNTTA--QYRSPEMI--DLYRGHPINEKSDIWALGVFLYKLCYYT 243
           P          N +LK +     Y SPE++    Y G P    SD+W+ G+ L+ L    
Sbjct: 267 P----------NKLLKTSCGSPHYASPEIVMGRPYHGGP----SDVWSCGIVLFALLTGH 312

Query: 244 TPFEKVGDAAIL----HSRFQFPAYPQYSDRLKNLISVMLSENPNQRPNICQVLE 294
            PF       +L      ++Q P+    S   ++LIS +L  +P +R    ++L+
Sbjct: 313 LPFNDDNIKKLLLKVQSGKYQMPS--NLSSEARDLISKILVIDPEKRITTQEILK 365

>Skud_7.91 Chr7 (165681..168374) [2694 bp, 897 aa] {ON} YGL180W
           (REAL)
          Length = 897

 Score = 76.3 bits (186), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 77/314 (24%), Positives = 137/314 (43%), Gaps = 63/314 (20%)

Query: 16  TVGSHQARIIKYLTSGGFAHIYSAEISPADPNSIGNVACLKRVLVPDKQSLNVLRAEVDA 75
           + G++ A   K +  G FA +Y   ++      I  +  + R  + +K+ L  L  E+  
Sbjct: 20  SAGNYTAE--KEIGKGSFATVYRGHLTSDKSQHIA-IKEVSRTKLKNKKLLENLEIEIAI 76

Query: 76  MKLLRGNKHVVSYIDSHAAKSGAQDGSYEVFLLMEYCSAGGLIDFMNTRLQNRLTENEVL 135
           +K ++ + H+V  ID        +  S + +L+MEYC+ G L   +  R    L EN  L
Sbjct: 77  LKKIK-HPHIVGLID-------CERTSTDFYLIMEYCALGDLTFLLKRR--KELMENHPL 126

Query: 136 K---------------------IMSDITQGIAAMHALLPP-LIHRDIKIENVLIS----- 168
                                 ++S + Q  +A+  L    L+HRDIK +N+L+S     
Sbjct: 127 LRTVFEKYPPPSESHNGLHRAFVLSYLQQLASALKFLRSKNLVHRDIKPQNLLLSTPLIG 186

Query: 169 --DDKTFKVCDFGSVCGVIRPPKNAQEFSYVQNDILKNTTAQ--------YRSPEMIDLY 218
             D KTF    F  +  +  P     +F + +   L NT+          Y +PE+++ Y
Sbjct: 187 YHDSKTFHELGFVGIYNL--PILKIADFGFAR--FLPNTSLAETLCGSPLYMAPEILN-Y 241

Query: 219 RGHPINEKSDIWALGVFLYKLCYYTTPFEKVGDAAIL------HSRFQFPAYPQYSDRLK 272
           + +  N K+D+W++G  ++++C  T PF       +       +    FP+Y      LK
Sbjct: 242 QKY--NAKADLWSVGTVVFEMCCGTPPFRASNHLELFKKIKRANDVITFPSYCNIEPELK 299

Query: 273 NLISVMLSENPNQR 286
            LI  +L+ +P +R
Sbjct: 300 ELICSLLTFDPVKR 313

>Smik_3.189 Chr3 (273885..276044) [2160 bp, 719 aa] {ON} YCR091W
           (REAL)
          Length = 719

 Score = 75.9 bits (185), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 51/195 (26%), Positives = 90/195 (46%), Gaps = 18/195 (9%)

Query: 105 VFLLMEYCSAGGLIDFMNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIEN 164
           ++L MEYC  G     + TR    + E +     S++   +  +H L    I+RD+K EN
Sbjct: 396 LYLCMEYCMGGEFFRALQTRKSKCIAEEDAKFYASEVVAALEYLHLL--GFIYRDLKPEN 453

Query: 165 VLISDDKTFKVCDFG-SVCGVIRPPKNAQEFSYVQNDILKNT--------TAQYRSPEMI 215
           +L+       + DF  S+  +       ++ +Y+   I  +         T +Y +PE+I
Sbjct: 454 ILLHQSGHVMLSDFDLSIQAIGSKNPTMKDSTYLDTKICSDGFRTNSFVGTEEYLAPEVI 513

Query: 216 DLYRGHPINEKSDIWALGVFLYKLCYYTTPFEKVGD----AAILHSRFQFPAYPQYSDRL 271
              RG+      D W LG+ +Y++ +  TPF+ V      + IL    +FP   + S   
Sbjct: 514 ---RGNGHTAAVDWWTLGILVYEMLFGCTPFKGVNSNETFSNILAKDAKFPHGKEVSKNC 570

Query: 272 KNLISVMLSENPNQR 286
           K+LI  +L++N  +R
Sbjct: 571 KDLIKKLLNKNETKR 585

>Kpol_463.8 s463 complement(18696..23039) [4344 bp, 1447 aa] {ON}
            complement(18696..23039) [4344 nt, 1448 aa]
          Length = 1447

 Score = 76.3 bits (186), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 68/278 (24%), Positives = 124/278 (44%), Gaps = 51/278 (18%)

Query: 48   SIGNVACLKRVLVPDK--------QSLNVLRAEVDAMKLLRGNKHVVSYIDSHAAKSGAQ 99
            + G +  +K+V VP           +++ LR EV  +K L  + ++V Y+   A     +
Sbjct: 1161 TTGEMMAVKQVEVPKYGLQNETVVNTVDALRLEVSTLKDL-DHLNIVQYLGFEA-----K 1214

Query: 100  DGSYEVFLLMEYCSAGGLIDFMNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRD 159
            +G Y +FL  EY + G +   +  R+  R  +  +  +   + QG++ +H+    ++HRD
Sbjct: 1215 NGIYSLFL--EYVAGGSVGSLI--RMYGRFDDILIRHLTIQVLQGLSYLHSR--GILHRD 1268

Query: 160  IKIENVLISDDKTFKVCDFGSVCGVIRPPKNAQEFSYVQNDILKNT------TAQYRSPE 213
            +K +N+L+  D   K+ DFG               S   NDI  N+      T  + +PE
Sbjct: 1269 MKADNLLLDQDGVCKISDFG--------------ISRKSNDIYSNSEMTMKGTVFWMAPE 1314

Query: 214  MIDLYRGHPINEKSDIWALGVFLYKLCYYTTP---FEKVGDAAILHSRFQFPAYPQ---- 266
            M+D  +G+  + K DIW+LG  + ++     P   FE V     +      P  P+    
Sbjct: 1315 MVDTKQGY--SAKVDIWSLGCIVLEMFAGKRPWSNFEVVAAMFKIGQAKSAPPIPEDTLP 1372

Query: 267  -YSDRLKNLISVMLSENPNQRPNICQVLEE-VSRIQNV 302
              S+  K  +      +P +RP   ++L    S++ N+
Sbjct: 1373 LISENAKEFLDCCFEIDPEKRPTADKLLSHPFSKVNNL 1410

>Sklu_YGOB_Anc_2.496 Chr5 (185447..187306) [1860 bp, 619 aa] {ON}
           ANNOTATED BY YGOB -
          Length = 619

 Score = 75.9 bits (185), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 62/233 (26%), Positives = 111/233 (47%), Gaps = 41/233 (17%)

Query: 73  VDAMKLLRGNKH--VVSYIDSHAAKSGAQDGSYEVFLLMEYCSAGGLIDFMNTRLQNRLT 130
           ++ + +++G+KH  +V++IDS+  K        +++++MEY   G L D +   +   LT
Sbjct: 372 INEILVMKGSKHSNIVNFIDSYLLKG-------DLWVVMEYMEGGSLTDVVTHCI---LT 421

Query: 131 ENEVLKIMSDITQGIAAMHALLPPLIHRDIKIENVLISDDKTFKVCDFGSVCGVIRPPKN 190
           E ++  +  +  +G+  +H+    +IHRDIK +N+L+S +   K+ DFG  C  I     
Sbjct: 422 EGQIGAVCRETLKGLQFLHS--KGVIHRDIKSDNILLSMNGDIKLTDFG-FCAQI----- 473

Query: 191 AQEFSYVQNDI-LKNTTA----QYRSPEMIDLYRGHPINEKSDIWALGVFLYKLCYYTTP 245
                   N++ LK TT      + +PE++      P   K DIW+LG+ + ++     P
Sbjct: 474 --------NEVNLKRTTMVGTPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPP 522

Query: 246 F--EKVGDAAILHSRFQFPAY---PQYSDRLKNLISVMLSENPNQRPNICQVL 293
           +  E    A  L +    P        SD LK  +   L  +P  R N  ++L
Sbjct: 523 YLNETPLRALYLIATNGTPKLKDPENLSDTLKEFLGWCLKVDPEDRANAAELL 575

>ACR281C Chr3 complement(864528..868307) [3780 bp, 1259 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YOL045W and
            YAL017W (FUN31)
          Length = 1259

 Score = 76.3 bits (186), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 55/181 (30%), Positives = 87/181 (48%), Gaps = 25/181 (13%)

Query: 116  GLIDFMN-TRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIENVLISDDKTFK 174
            G ID  +   L+  +TE+E   +   +  G+  +H     ++HRDIK ENV++ +    K
Sbjct: 1091 GSIDLFDLIELKTNMTEHEAKLLFKQVASGLRHLHE--NGIVHRDIKDENVIVDNRGRVK 1148

Query: 175  VCDFGSVCGVIRPPKNAQEFSYVQNDILKNTTAQYRSPEMI--DLYRGHPINEKSDIWAL 232
            + DFGS   V R P +     +V        T  Y +PE++  D Y G P     D+WA+
Sbjct: 1149 IIDFGSAAYVKRGPFDV----FV-------GTIDYAAPEVLGGDPYEGKP----QDVWAV 1193

Query: 233  GVFLYKLCYYTTPFEKVGDAAILHSRFQFPAYPQYSDRLKNLISVMLSENPNQRP---NI 289
            GV LY + Y   PF  + +  IL    +       S+    LI+ +L+ + N+RP   +I
Sbjct: 1194 GVLLYTIIYKENPFYNIDE--ILDGDLRISPAVVVSEECVALITRILNRSVNRRPTVDDI 1251

Query: 290  C 290
            C
Sbjct: 1252 C 1252

>AFR696C Chr6 complement(1722130..1725558) [3429 bp, 1142 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR507C
           (GIN4) and YCL024W (KCC4)
          Length = 1142

 Score = 76.3 bits (186), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 64/232 (27%), Positives = 106/232 (45%), Gaps = 36/232 (15%)

Query: 72  EVDAMKLLRGNKHVVSYIDSHAAKSGAQDGSYEVFLLMEYCSAGGLIDFMNTRLQNRLTE 131
           E+  MKLL  + +V+   D       AQD    +++++EY   G L + +  R    L E
Sbjct: 78  EIIIMKLL-NHPNVLRLYDVWET---AQD----LYMVLEYVEKGELFNLLVQR--GPLPE 127

Query: 132 NEVLKIMSDITQGIAAMHALLPPLIHRDIKIENVLISDDKTFKVCDFGSVCGVIRPPKNA 191
           NE ++    I  GI+  HAL   ++HRD+K EN+L+      K+ DFG            
Sbjct: 128 NEAVRFFRQIIIGISYCHAL--GIVHRDLKPENLLLDHKFNIKLADFGMA---------- 175

Query: 192 QEFSYVQNDILKNTTA---QYRSPEMIDLYRGHPINEKSDIWALGVFLYKLCYYTTPF-E 247
              +    D L  T+     Y +PE++     H    +SD+W+ GV LY L     PF E
Sbjct: 176 ---ALESKDKLLETSCGSPHYAAPEIVSGLPYHGF--ESDVWSCGVILYALLTGRLPFDE 230

Query: 248 KVGD-----AAILHSRFQFPAYPQYSDRLKNLISVMLSENPNQRPNICQVLE 294
           + G+       +   +++ P   + S   ++LI  +L+  P QR    ++L+
Sbjct: 231 EDGNIRNLLLKVQSGKYEIPGEDEISPEARDLIVQILTVEPEQRIKTREILK 282

>KLTH0D02486g Chr4 (247566..251237) [3672 bp, 1223 aa] {ON} similar to
            uniprot|P31374 Saccharomyces cerevisiae YAL017W PSK1 One
            of two (see also PSK2) PAS domain containing S/T protein
            kinases coordinately regulates protein synthesis and
            carbohydrate metabolism and storage in response to a
            unknown metabolite that reflects nutritional status
          Length = 1223

 Score = 76.3 bits (186), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 54/180 (30%), Positives = 88/180 (48%), Gaps = 22/180 (12%)

Query: 116  GLIDFMN-TRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIENVLISDDKTFK 174
            G +D  +   L+  +TE+E   I   I  GI  +H     ++HRDIK ENV++  +   K
Sbjct: 1055 GSVDLFDLIELKTDMTEHEAKLIFKQIVSGIKHLHD--NGIVHRDIKDENVIVDSNGFVK 1112

Query: 175  VCDFGSVCGVIRPPKNAQEFSYVQNDILKNTTAQYRSPEMI--DLYRGHPINEKSDIWAL 232
            + DFGS   V   P +     +V        T  Y +PE++  + Y G P     DIWA+
Sbjct: 1113 IIDFGSAAYVKSGPFDV----FV-------GTIDYAAPEVLGGEPYEGKP----QDIWAI 1157

Query: 233  GVFLYKLCYYTTPFEKVGDAAILHSRFQFPAYPQYSDRLKNLISVMLSENPNQRPNICQV 292
            GV LY + +   PF  + +  IL +  +  +  + SD    LI  +L+   ++RP+I ++
Sbjct: 1158 GVLLYTIIFKENPFYNIDE--ILDADLRVDSNHRVSDECIALIRKILNRPISKRPSISKI 1215

>NDAI0J01250 Chr10 complement(291314..294844) [3531 bp, 1176 aa]
           {ON} 
          Length = 1176

 Score = 76.3 bits (186), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 55/197 (27%), Positives = 98/197 (49%), Gaps = 22/197 (11%)

Query: 102 SYEVFLLMEYCSAGGLIDFMNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIK 161
           S   ++L EY S G L+D++       L E+        I   +  +HA    ++HRD+K
Sbjct: 199 SNHFYMLFEYVSGGQLLDYIIQ--HGSLKESHARNFARQILSALKYLHA--NNIVHRDLK 254

Query: 162 IENVLISDDKTFKVCDFGSVCGVIRPPKNAQEFSYVQNDILKNTTAQYRSPEMIDLYRGH 221
           IEN++IS +   K+ DFG +  +    K  + +           +  + +PE++   R +
Sbjct: 255 IENIMISSNGNIKIIDFG-LSNLYDKSKKLKTYC---------GSLYFAAPELL---RAN 301

Query: 222 P-INEKSDIWALGVFLYKLCYYTTPFEKVGDAAILHSRFQFPA--YPQY-SDRLKNLISV 277
           P I  + D+W+ GV LY L     PF+   ++ +LH + +     YPQ+ S  + +L+S 
Sbjct: 302 PYIGPEIDVWSFGVVLYVLVCGKVPFDD-ENSNVLHEKIKQGRVFYPQFLSIEVISLLST 360

Query: 278 MLSENPNQRPNICQVLE 294
           ML  +P +R  + QV++
Sbjct: 361 MLVVDPFKRATLDQVMK 377

>NCAS0A05770 Chr1 (1132854..1137239) [4386 bp, 1461 aa] {ON}
           Anc_2.479
          Length = 1461

 Score = 76.3 bits (186), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 55/199 (27%), Positives = 98/199 (49%), Gaps = 31/199 (15%)

Query: 104 EVFLLMEYCSAGGLIDFMNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIE 163
           E++L++EY   G L D++ ++   +L+E E +     I QG++  H+    + HRD+K E
Sbjct: 210 ELYLVLEYVDGGELFDYLVSK--GKLSEKEAVHYFKQIIQGVSYCHSF--NICHRDLKPE 265

Query: 164 NVLISD-DKTFKVCDFGSVCGVIRPPKNAQEFSYVQNDILKNTTA--QYRSPEMI--DLY 218
           N+L+   +K+ K+ DFG     +  P          N +L+ +     Y SPE++    Y
Sbjct: 266 NLLLDKKNKSIKIADFG--MAALELP----------NKLLQTSCGSPHYASPEIVMGKSY 313

Query: 219 RGHPINEKSDIWALGVFLYKLCYYTTPFEKVGDAAIL----HSRFQFPAYPQYSDRLKNL 274
            G P    SD+W+ G+ L+ L     PF       +L      +F+ P+    S   ++L
Sbjct: 314 HGGP----SDVWSCGIILFALLTGHLPFNDDNIKKLLLKVQAGKFRMPS--TLSPEAQDL 367

Query: 275 ISVMLSENPNQRPNICQVL 293
           IS +L  +P++R    ++L
Sbjct: 368 ISRILVIDPSKRITTDRIL 386

>NCAS0B08600 Chr2 (1649375..1652728) [3354 bp, 1117 aa] {ON}
           Anc_5.591 YDR466W
          Length = 1117

 Score = 75.9 bits (185), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 60/234 (25%), Positives = 109/234 (46%), Gaps = 34/234 (14%)

Query: 69  LRAEVDAMKLLRGNKHVVSYIDSHAAKSGAQDGSYEVFLLMEYCSAGGLIDFMNTRLQNR 128
           +  E+  MKLLR + +V+S  D     S        +++++EY   G L + +  +    
Sbjct: 81  IEREIIIMKLLR-HANVLSLYDVWETNSN-------LYMILEYAEKGELFNLLVEK--GP 130

Query: 129 LTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIENVLISDDKTFKVCDFGSVCGVIRPP 188
           L E E ++    I  GI+  HAL   ++HRD+K EN+L+      K+ DFG         
Sbjct: 131 LPEKEAVRFFRQIIIGISYCHAL--GIVHRDLKPENLLLDHKFNIKIADFGMAA------ 182

Query: 189 KNAQEFSYVQNDILKNTTA--QYRSPEMIDLYRGHPINEKSDIWALGVFLYKLCYYTTPF 246
                    ++ +L+ +     Y +PE++     H    +SD+W+ GV L+ L     PF
Sbjct: 183 ------LETEDKLLETSCGSPHYAAPEIVSGIPYHGF--ESDVWSCGVILFALLTGRLPF 234

Query: 247 -EKVGDA-----AILHSRFQFPAYPQYSDRLKNLISVMLSENPNQRPNICQVLE 294
            E+ G+       +   +F+ P   + S   ++LIS +L+ +P +R    ++L+
Sbjct: 235 DEEDGNIRNLLLKVQSGQFEMPDDDEMSRDAQDLISRILTVDPTKRIKTREILK 288

>Kpol_1055.24 s1055 complement(57430..60243) [2814 bp, 937 aa] {ON}
           complement(57430..60243) [2814 nt, 938 aa]
          Length = 937

 Score = 75.9 bits (185), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 70/268 (26%), Positives = 127/268 (47%), Gaps = 35/268 (13%)

Query: 31  GGFAHIYSAEISPADPNSIGNVACLKRVLVPDKQSLNVLRAEVDAMKLLRGNKHVVSYID 90
           G    +Y+A     DP   G VA +K++ +  +    ++  E+  MK  + ++++V++ID
Sbjct: 659 GASGGVYTAH----DPTREGYVA-IKQMNLEKQPKKELIINEIIVMKESK-HENIVNFID 712

Query: 91  SHAAKSGAQDGSYEVFLLMEYCSAGGLIDFMNTRLQNRLTENEVLKIMSDITQGIAAMHA 150
           S+  K        +++++MEY   G L D +   L   LTE +V  +  +   G+  +H+
Sbjct: 713 SYLLKG-------DLWVIMEYMEGGSLTDVVTHCL---LTEAQVGAVCRETLSGLQFLHS 762

Query: 151 LLPPLIHRDIKIENVLISDDKTFKVCDFGSVCGVIRPPKNAQEFSYVQNDILKNTTAQYR 210
               +IHRDIK +N+L+S     K+ DFG  C  I       E +  +  ++   T  + 
Sbjct: 763 --KGVIHRDIKSDNILLSMRGDIKLTDFG-FCAQI------NELNLKRTTMVG--TPYWM 811

Query: 211 SPEMIDLYRGHPINEKSDIWALGVFLYKLCYYTTPF--EKVGDAAILHSRFQFPAYPQ-- 266
           +PE++      P   K DIW+LG+ + ++     P+  E    A  L +    P+  +  
Sbjct: 812 APEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIATNGTPSLKEPE 868

Query: 267 -YSDRLKNLISVMLSENPNQRPNICQVL 293
             SD L N +   L  NP++R +   +L
Sbjct: 869 ALSDALNNFLGWCLKVNPDERASAKDLL 896

>Smik_4.789 Chr4 complement(1385209..1388619) [3411 bp, 1136 aa]
           {ON} YDR507C (REAL)
          Length = 1136

 Score = 75.9 bits (185), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 54/201 (26%), Positives = 95/201 (47%), Gaps = 30/201 (14%)

Query: 104 EVFLLMEYCSAGGLIDFMNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIE 163
           +++L++EY   G L + +  R    L ENE ++    I  G++  HAL   ++HRD+K E
Sbjct: 105 DLYLVLEYAEKGELFNLLVER--GPLPENEAIRFFRQIIIGVSYCHAL--GIVHRDLKPE 160

Query: 164 NVLISDDKTFKVCDFGSVCGVIRPPKNAQEFSYVQNDILKNTTA--QYRSPEMIDL--YR 219
           N+L+      K+ DFG                  +  +L+ +     Y +PE++    Y+
Sbjct: 161 NLLLDHKYNIKIADFGMAA------------LETEGKLLETSCGSPHYAAPEIVSGIPYQ 208

Query: 220 GHPINEKSDIWALGVFLYKLCYYTTPF-EKVGDAAIL-----HSRFQFPAYPQYSDRLKN 273
           G      SD+W+ GV L+ L     PF E+ G+   L        F+ P+  + S   ++
Sbjct: 209 GFA----SDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGEFELPSDDEISREAQD 264

Query: 274 LISVMLSENPNQRPNICQVLE 294
           LIS +L+ +P +R     +L+
Sbjct: 265 LISRILTVDPERRIKTRDILK 285

>Skud_4.764 Chr4 complement(1351725..1353995) [2271 bp, 756 aa] {ON}
           YDR490C (REAL)
          Length = 756

 Score = 75.5 bits (184), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 73/303 (24%), Positives = 133/303 (43%), Gaps = 31/303 (10%)

Query: 4   PSSGIYTQGTALTVGSHQARIIKYLTSGGFAHIYSAEISPADPNSIGNVACLKRVLVPDK 63
           P++G  T+   + +G    +  + L  G ++ +  A  +  D      V  L +  +  +
Sbjct: 108 PATGELTKHV-VKMGIKDFKFGEQLGDGSYSSVVLA--TARDSGKKYAVKVLSKEYLIRQ 164

Query: 64  QSLNVLRAEVDAMKLLRGNKHVVSYIDSHAAKSGAQDGSYEVFLLMEYCSAGGLIDFMNT 123
           + +  +  E  A++ L G K ++    +       QD +  ++ L+EY S G  +  +  
Sbjct: 165 KKVKYVTVEKLALQKLNGTKGIIRLFFTF------QDEA-SLYFLLEYASHGDFLGLI-- 215

Query: 124 RLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIENVLISDDKTFKVCDFGSVCG 183
           +    L E       S I   + ++HA+   +IHRDIK EN+L+  D   K+ DFG+   
Sbjct: 216 KKYGSLNEKCARYYASQIIDAVDSLHAI--GIIHRDIKPENILLDKDMKVKLTDFGTAKI 273

Query: 184 VIRPPKNAQE----FSYVQNDILKNTTAQYRSPEMI-DLYRGHPINEKSDIWALGVFLYK 238
           +   P N  +    F           TA+Y SPE++ D Y     + + DIWA G  LY+
Sbjct: 274 LPEQPSNNADGKPCFDLYARSKSFVGTAEYVSPELLNDSY----TDSRCDIWAFGCILYQ 329

Query: 239 LCYYTTPFEKVGD----AAILHSRFQFPA-YPQYSDRLKNLISVMLSENPNQRPNICQVL 293
           +     PF+   +      ++  ++ F A +P  +   K+L+  +L   PN R  + Q+ 
Sbjct: 330 MVAGKPPFKAANEYLTFQKVMKIQYAFTAGFPLIA---KDLVKKLLVREPNDRLTVEQIK 386

Query: 294 EEV 296
             V
Sbjct: 387 AHV 389

>CAGL0K05709g Chr11 complement(556732..560043) [3312 bp, 1103 aa]
           {ON} similar to uniprot|Q12263 Saccharomyces cerevisiae
           YDR507c GIN4
          Length = 1103

 Score = 75.9 bits (185), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 62/237 (26%), Positives = 109/237 (45%), Gaps = 40/237 (16%)

Query: 69  LRAEVDAMKLLRGNKHVVSYIDSHAAKSGAQDGSYEVFLLMEYCSAGGLIDFMNTRLQNR 128
           +  E+  MKLL  + +V+   D     S       +++L++EY   G L + +  R    
Sbjct: 76  IEQEIIIMKLL-NHPNVLRLFDVWETNS-------DLYLVLEYAEKGELFNMLVER--GP 125

Query: 129 LTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIENVLISDDKTFKVCDFGSVCGVIRPP 188
           L ENE ++    I  GI+  H+L   ++HRD+K EN+L+ +    K+ DFG         
Sbjct: 126 LPENEAVRAFRQIIIGISYCHSL--GVVHRDLKPENLLLDNKLNIKIADFGMAA------ 177

Query: 189 KNAQEFSYVQNDILKNTTA---QYRSPEMIDL--YRGHPINEKSDIWALGVFLYKLCYYT 243
                      D L  T+     Y +PE+I    Y G      SD+W+ GV L+ L    
Sbjct: 178 -------LESEDKLLETSCGSPHYAAPEIISGLPYEGFS----SDVWSCGVILFALLTGR 226

Query: 244 TPF-EKVGD-----AAILHSRFQFPAYPQYSDRLKNLISVMLSENPNQRPNICQVLE 294
            PF E+ G+       +    F+ P   + +   ++L++ +L+ +P++R  I ++L+
Sbjct: 227 LPFDEEDGNIRNLLLKVQKGEFEMPDDDEITKEAQDLLARLLTVDPSKRITIREILK 283

>NDAI0C01700 Chr3 complement(367077..370139) [3063 bp, 1020 aa] {ON}
           Anc_5.406
          Length = 1020

 Score = 75.9 bits (185), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 54/194 (27%), Positives = 94/194 (48%), Gaps = 24/194 (12%)

Query: 101 GSY----EVFLLMEYCSAGGLIDFMNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLI 156
           GSY     ++++MEYC+ G L   +      ++ E  +  I  +I   +  +H     +I
Sbjct: 106 GSYLKDTSLWIIMEYCAGGSLRTLLR---PGKIDEKYIGVITREILIALKYIHK--DNII 160

Query: 157 HRDIKIENVLISDDKTFKVCDFGSVCGVIRPPKNAQEFSYVQNDILKNTTAQYRSPEMID 216
           HRDIK  NVLI+++ + K+CDFG    + +  K  Q  +          T  + +PE+I 
Sbjct: 161 HRDIKAANVLITNEGSIKLCDFGVAAQLNQSTKRRQTMA---------GTPYWMAPEVI- 210

Query: 217 LYRGHPINEKSDIWALGVFLYKLCYYTTPFEKVGD--AAILHSRFQFPAYP--QYSDRLK 272
              G   + K DIW+LG+  Y++     P+ ++    A  L ++ + P      YS  LK
Sbjct: 211 -MEGVYYDTKVDIWSLGITTYEIATGNPPYCEIEALRAMQLITKSKPPRLEGRNYSPLLK 269

Query: 273 NLISVMLSENPNQR 286
             +++ L E+P +R
Sbjct: 270 EFVALCLDEDPKER 283

>KLLA0F19536g Chr6 (1808263..1811577) [3315 bp, 1104 aa] {ON}
           similar to uniprot|P13186 Saccharomyces cerevisiae
           YLR096W KIN2 Serine/threonine protein kinase involved in
           regulation of exocytosis localizes to the cytoplasmic
           face of the plasma membrane closely related to Kin1p and
           to YDR122W uniprot|P13185 Saccharomyces cerevisiae
           YDR122W KIN1 Serine/threonine protein kinase involved in
           regulation of exocytosis; localizes to the cytoplasmic
           face of the plasma membrane; closely related to Kin2p
          Length = 1104

 Score = 75.9 bits (185), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 57/195 (29%), Positives = 96/195 (49%), Gaps = 22/195 (11%)

Query: 102 SYEVFLLMEYCSAGGLIDFMNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIK 161
           S   ++L EY S G L+D++       L E    K +  I   +  +H  L  ++HRD+K
Sbjct: 194 SNHFYMLFEYVSGGQLLDYIIQ--HGSLRERHARKFVRGIASALQYLH--LNNIVHRDLK 249

Query: 162 IENVLISDDKTFKVCDFGSVCGVIRPPKNAQEFSYVQNDILKNTTAQYRSPEMIDLYRGH 221
           IEN++IS     K+ DFG +  +    K    F           +  + +PE++   + +
Sbjct: 250 IENIMISTSGEIKIIDFG-LSNLYDNKKQLHTFC---------GSLYFAAPELL---KAN 296

Query: 222 P-INEKSDIWALGVFLYKLCYYTTPFEKVGDAAILHSRFQFP--AYPQY-SDRLKNLISV 277
           P I  + DIW+ GV +Y L     PF+   +A++LH + +     YPQ+ S    +L+S 
Sbjct: 297 PYIGPEVDIWSFGVVIYVLVCGKVPFDD-ENASVLHEKIKKGKVEYPQHLSIECISLLSK 355

Query: 278 MLSENPNQRPNICQV 292
           ML  +P +R ++ QV
Sbjct: 356 MLVVDPLKRASLKQV 370

>TPHA0J00820 Chr10 (193408..197064) [3657 bp, 1218 aa] {ON}
           Anc_8.279 YLR096W
          Length = 1218

 Score = 75.9 bits (185), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 55/197 (27%), Positives = 100/197 (50%), Gaps = 24/197 (12%)

Query: 102 SYEVFLLMEYCSAGGLIDFMNTRLQN-RLTENEVLKIMSDITQGIAAMHALLPPLIHRDI 160
           S   ++L EY S G L+D++   +Q+  L E+   K    I   +  +H     ++HRD+
Sbjct: 250 SNHFYMLFEYVSGGQLLDYI---IQHGSLREHHARKFTRGIASALQYLHG--NNIVHRDL 304

Query: 161 KIENVLISDDKTFKVCDFGSVCGVIRPPKNAQEFSYVQNDILKNTTAQYRSPEMIDLYRG 220
           KIEN++IS     K+ DFG +  +    K    F           +  + +PE++   + 
Sbjct: 305 KIENIMISTSGDIKIIDFG-LSNLYDSKKQLNTFC---------GSLYFAAPELL---KA 351

Query: 221 HP-INEKSDIWALGVFLYKLCYYTTPFEKVGDAAILHSRFQFPA--YPQY-SDRLKNLIS 276
           +P +  + DIW+ GV LY L     PF+   ++++LH + +     YPQ+ S  + +L+S
Sbjct: 352 NPYVGPEVDIWSFGVVLYVLACGKVPFDD-ENSSVLHEKIKQGKVDYPQHLSIEVISLLS 410

Query: 277 VMLSENPNQRPNICQVL 293
            ML  +P +R ++ Q++
Sbjct: 411 KMLVVDPKKRASLQQIV 427

>SAKL0A04246g Chr1 complement(396019..397221) [1203 bp, 400 aa] {ON}
           similar to uniprot|P38991 Saccharomyces cerevisiae
           YPL209C IPL1 Aurora kinase involved in regulating
           kinetochore-microtubule attachments associates with
           Sli5p which stimulates Ipl1p kinase activity and
           promotes its association with the mitotic spindle
           potential Cdc28p substrate
          Length = 400

 Score = 74.3 bits (181), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 62/215 (28%), Positives = 95/215 (44%), Gaps = 47/215 (21%)

Query: 105 VFLLMEYCSAGGLIDFMNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIEN 164
           V+LLMEY   G L  + + R+     +      ++ +   +  MH     ++HRDIK EN
Sbjct: 213 VYLLMEYLVNGEL--YRHLRVNGPFNDILASYYVNQMADALNYMHDR--NVLHRDIKPEN 268

Query: 165 VLISDDKTFKVCDFG------------SVCGVIRPPKNAQEFSYVQNDILKNTTAQYRSP 212
           +LI    T K+ DFG            ++CG                      T  Y SP
Sbjct: 269 ILIGFQNTLKLTDFGWSVISTTGAKRKTLCG----------------------TLDYLSP 306

Query: 213 EMIDLYRGHPINEKSDIWALGVFLYKLCYYTTPFEKVGDAA----ILHSRFQFPAYPQYS 268
           E++  YR +  +EK D+WALGV  Y+L   T PFE+         I+    +FP   Q S
Sbjct: 307 ELVK-YREY--DEKVDVWALGVLAYELLVGTPPFEEASKELTYKRIVRRDLRFPD--QMS 361

Query: 269 DRLKNLISVMLSENPNQRPNICQVLEEVSRIQNVP 303
              ++LI  +L  +P+ R ++  VL     ++N P
Sbjct: 362 IDARDLIGRLLENDPSTRISLKDVLSHPWIVKNKP 396

>NDAI0E02390 Chr5 complement(496256..498907) [2652 bp, 883 aa] {ON}
           Anc_8.668
          Length = 883

 Score = 75.5 bits (184), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 56/210 (26%), Positives = 99/210 (47%), Gaps = 53/210 (25%)

Query: 104 EVFLLMEYCSAGGLIDFMNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIE 163
           +V++  EYC    L D +   LQ R+  +  +++ + I   +   H+L    +HRD+K+E
Sbjct: 103 KVWMAQEYCPGKDLYDHV-LSLQ-RVPSSACIELFTQIVGAVYYAHSL--NCVHRDLKLE 158

Query: 164 NVLISDDKTFKVCDFG------------SVCGVIRPPKNAQEFSYVQNDILKNTTAQYRS 211
           N+L+  +   K+ DFG            ++CG                      T  Y +
Sbjct: 159 NILLDKNGNAKLTDFGFTRECMTKTSLETICG----------------------TTVYMA 196

Query: 212 PEMI--DLYRGHPINEKSDIWALGVFLYKLCYYTTPF----EKVGDAAILHSRFQFPAYP 265
           PE+I  + Y G  I    DIW+LGV LY +   + PF    E   +  I++   + P + 
Sbjct: 197 PELIKRESYDGFKI----DIWSLGVILYTMLNGSMPFDEDDETKTEWKIMN---EMPVFN 249

Query: 266 Q--YSDRLKNLISVMLSENPNQRPNICQVL 293
               S+  K+L+  +LS++PN+RP++ ++L
Sbjct: 250 DTILSEDAKDLLIKLLSKDPNERPSMQEIL 279

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.130    0.366 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 80,174,393
Number of extensions: 3430019
Number of successful extensions: 15002
Number of sequences better than 10.0: 2060
Number of HSP's gapped: 13669
Number of HSP's successfully gapped: 2209
Length of query: 791
Length of database: 53,481,399
Length adjustment: 118
Effective length of query: 673
Effective length of database: 39,950,811
Effective search space: 26886895803
Effective search space used: 26886895803
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 70 (31.6 bits)