Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_27.115372.285ON70870838180.0
KLTH0G10340g2.285ON70870834320.0
SAKL0E07700g2.285ON71270630660.0
Ecym_33242.285ON70667029320.0
NCAS0G038002.285ON72667028910.0
NDAI0G006502.285ON68966928690.0
ZYRO0A01870g2.285ON70771328590.0
YNL021W (HDA1)2.285ON70670728530.0
ADL216C2.285ON70568728500.0
Skud_14.3082.285ON70670728480.0
Smik_14.3102.285ON70670328480.0
TDEL0G021602.285ON71469728420.0
Suva_14.3262.285ON70668528330.0
CAGL0J03454g2.285ON69369828250.0
KNAG0H020102.285ON69367528000.0
KLLA0E08383g2.285ON70467527880.0
KAFR0H033202.285ON70268627230.0
Kpol_1039.322.285ON65965826350.0
TPHA0C033902.285ON70170925300.0
TBLA0B069502.285ON79546619420.0
Kpol_1003.372.285ON57831913141e-173
TPHA0H003208.153ON4503693739e-38
SAKL0H25124g8.153ON4484553684e-37
Ecym_23468.153ON4853363688e-37
KAFR0C029208.153ON4533643571e-35
NCAS0B054808.153ON4513643571e-35
KLLA0F09119g8.153ON4523653534e-35
TDEL0B045808.153ON4463603517e-35
Suva_14.113.8ON4333263481e-34
AFR172C8.153ON4493353492e-34
KLTH0E06446g8.153ON4493513482e-34
NDAI0G037403.8ON4333263472e-34
YGL194C (HOS2)8.153ON4523303472e-34
NDAI0B027108.153ON4533563472e-34
KNAG0A011603.8ON4333283463e-34
Skud_14.113.8ON4333263463e-34
Smik_7.798.153ON4523303454e-34
CAGL0B01441g3.8ON4333263436e-34
Kpol_1038.113.8ON4333263436e-34
Skud_7.798.153ON4523293446e-34
KAFR0A086303.8ON4333283437e-34
Kwal_55.221423.8ON4323413437e-34
Kwal_55.207908.153ON4493353439e-34
TBLA0I005603.8ON4333283411e-33
TBLA0D021408.153ON4563333421e-33
AGR395W3.8ON4333263411e-33
NCAS0C043203.8ON4343263411e-33
Ecym_20103.8ON4333263401e-33
Kpol_246.58.153ON4533673412e-33
Smik_14.23.8ON4333263402e-33
KLTH0F19668g3.8ON4323413392e-33
CAGL0A03322g8.153ON4503703402e-33
ZYRO0C03498g3.8ON4333263392e-33
YNL330C (RPD3)3.8ON4333263392e-33
TPHA0A003003.8ON4333283392e-33
SAKL0C13706g3.8ON4333263392e-33
KLLA0E01981g3.8ON4323263392e-33
Suva_7.718.153ON4523293393e-33
TDEL0A002703.8ON4333263358e-33
KNAG0G013508.153ON4513353368e-33
ZYRO0G19316g8.153ON4483353341e-32
NDAI0A051203.362ON5082811903e-14
KLTH0F10582g3.362ON4742221885e-14
TDEL0A055208.607ON6743761886e-14
SAKL0B07854g3.362ON4892301867e-14
Skud_16.3533.362ON4711761868e-14
Ecym_82908.607ON7093331871e-13
TDEL0C050403.362ON4541821832e-13
Suva_16.3963.362ON4771761832e-13
NCAS0A111803.362ON4902571805e-13
Kwal_23.37243.362ON4732101796e-13
YPL116W (HOS3)8.607ON6973721798e-13
Kpol_376.153.362ON5181761771e-12
YPR068C (HOS1)3.362ON4701761771e-12
Kpol_479.68.607ON6882991781e-12
CAGL0D01430g3.362ON4452061751e-12
Smik_16.3093.362ON4701761752e-12
Suva_16.1948.607ON6993731772e-12
ZYRO0C16390g3.362ON4362261715e-12
TBLA0B023903.362ON5791771701e-11
TBLA0E040808.607ON6942971701e-11
KAFR0H008903.362ON4741851681e-11
KNAG0H006303.362ON4561431681e-11
ZYRO0F10780g8.607ON6683361682e-11
ADL265W8.607ON6942991682e-11
KLTH0D09592g8.607ON7053341673e-11
KLLA0B09394g3.362ON4411731626e-11
TPHA0A011208.607ON6983031621e-10
ADL339W3.362ON4371751601e-10
KNAG0J013008.607ON6773491592e-10
Kwal_26.85058.607ON7082541574e-10
KAFR0H027908.607ON7171341565e-10
Smik_6.3158.607ON6971341549e-10
Ecym_34653.362ON4451531492e-09
KLLA0F00858g8.607ON715651476e-09
Skud_16.1648.607ON6971341432e-08
NDAI0E024808.607ON684981422e-08
NCAS0C017608.607ON700961404e-08
SAKL0H08338g8.607ON6901461405e-08
TPHA0M015903.362ON4942711361e-07
CAGL0J06974g8.607ON678571262e-06
Smik_16.2238.78ON1226135761.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_27.11537
         (708 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_27.11537 s27 (839198..841324) [2127 bp, 708 aa] {ON} YNL021...  1475   0.0  
KLTH0G10340g Chr7 complement(874566..876692) [2127 bp, 708 aa] {...  1326   0.0  
SAKL0E07700g Chr5 (622822..624960) [2139 bp, 712 aa] {ON} highly...  1185   0.0  
Ecym_3324 Chr3 complement(620836..622956) [2121 bp, 706 aa] {ON}...  1134   0.0  
NCAS0G03800 Chr7 (701547..703727) [2181 bp, 726 aa] {ON}             1118   0.0  
NDAI0G00650 Chr7 complement(141981..144050) [2070 bp, 689 aa] {O...  1109   0.0  
ZYRO0A01870g Chr1 complement(154507..156630) [2124 bp, 707 aa] {...  1105   0.0  
YNL021W Chr14 (593227..595347) [2121 bp, 706 aa] {ON}  HDA1Putat...  1103   0.0  
ADL216C Chr4 complement(324197..326314) [2118 bp, 705 aa] {ON} S...  1102   0.0  
Skud_14.308 Chr14 (563902..566022) [2121 bp, 706 aa] {ON} YNL021...  1101   0.0  
Smik_14.310 Chr14 (555609..557729) [2121 bp, 706 aa] {ON} YNL021...  1101   0.0  
TDEL0G02160 Chr7 complement(424838..426982) [2145 bp, 714 aa] {O...  1099   0.0  
Suva_14.326 Chr14 (576098..578218) [2121 bp, 706 aa] {ON} YNL021...  1095   0.0  
CAGL0J03454g Chr10 complement(332090..334171) [2082 bp, 693 aa] ...  1092   0.0  
KNAG0H02010 Chr8 (354923..357004) [2082 bp, 693 aa] {ON} Anc_2.2...  1083   0.0  
KLLA0E08383g Chr5 (754048..756162) [2115 bp, 704 aa] {ON} highly...  1078   0.0  
KAFR0H03320 Chr8 (633105..635213) [2109 bp, 702 aa] {ON} Anc_2.2...  1053   0.0  
Kpol_1039.32 s1039 (99859..101838) [1980 bp, 659 aa] {ON} (99859...  1019   0.0  
TPHA0C03390 Chr3 complement(743315..745420) [2106 bp, 701 aa] {O...   979   0.0  
TBLA0B06950 Chr2 complement(1643756..1646143) [2388 bp, 795 aa] ...   752   0.0  
Kpol_1003.37 s1003 complement(91621..92301,92861..92869,92912..9...   510   e-173
TPHA0H00320 Chr8 complement(62605..63957) [1353 bp, 450 aa] {ON}...   148   9e-38
SAKL0H25124g Chr8 (2184039..2185385) [1347 bp, 448 aa] {ON} high...   146   4e-37
Ecym_2346 Chr2 complement(678792..680249) [1458 bp, 485 aa] {ON}...   146   8e-37
KAFR0C02920 Chr3 complement(584668..586029) [1362 bp, 453 aa] {O...   142   1e-35
NCAS0B05480 Chr2 complement(1033624..1034979) [1356 bp, 451 aa] ...   142   1e-35
KLLA0F09119g Chr6 (848467..849825) [1359 bp, 452 aa] {ON} highly...   140   4e-35
TDEL0B04580 Chr2 complement(817368..818708) [1341 bp, 446 aa] {O...   139   7e-35
Suva_14.11 Chr14 complement(13144..14445) [1302 bp, 433 aa] {ON}...   138   1e-34
AFR172C Chr6 complement(754470..755819) [1350 bp, 449 aa] {ON} S...   139   2e-34
KLTH0E06446g Chr5 complement(594807..596156) [1350 bp, 449 aa] {...   138   2e-34
NDAI0G03740 Chr7 complement(900866..902167) [1302 bp, 433 aa] {O...   138   2e-34
YGL194C Chr7 complement(140368..141726) [1359 bp, 452 aa] {ON}  ...   138   2e-34
NDAI0B02710 Chr2 (674610..675971) [1362 bp, 453 aa] {ON} Anc_8.153    138   2e-34
KNAG0A01160 Chr1 complement(7229..8530) [1302 bp, 433 aa] {ON} A...   137   3e-34
Skud_14.11 Chr14 complement(11451..12752) [1302 bp, 433 aa] {ON}...   137   3e-34
Smik_7.79 Chr7 complement(134747..136105) [1359 bp, 452 aa] {ON}...   137   4e-34
CAGL0B01441g Chr2 complement(130216..131517) [1302 bp, 433 aa] {...   136   6e-34
Kpol_1038.11 s1038 complement(25267..26568) [1302 bp, 433 aa] {O...   136   6e-34
Skud_7.79 Chr7 complement(146016..147374) [1359 bp, 452 aa] {ON}...   137   6e-34
KAFR0A08630 Chr1 (1731077..1732378) [1302 bp, 433 aa] {ON} Anc_3...   136   7e-34
Kwal_55.22142 s55 (1130691..1131989) [1299 bp, 432 aa] {ON} YNL3...   136   7e-34
Kwal_55.20790 s55 complement(559958..561307) [1350 bp, 449 aa] {...   136   9e-34
TBLA0I00560 Chr9 (100393..101694) [1302 bp, 433 aa] {ON} Anc_3.8...   135   1e-33
TBLA0D02140 Chr4 complement(539873..541243) [1371 bp, 456 aa] {O...   136   1e-33
AGR395W Chr7 (1455659..1456960) [1302 bp, 433 aa] {ON} Syntenic ...   135   1e-33
NCAS0C04320 Chr3 (887622..888926) [1305 bp, 434 aa] {ON} Anc_3.8      135   1e-33
Ecym_2010 Chr2 complement(12699..14000) [1302 bp, 433 aa] {ON} s...   135   1e-33
Kpol_246.5 s246 (11759..13120) [1362 bp, 453 aa] {ON} (11759..13...   135   2e-33
Smik_14.2 Chr14 complement(2435..3736) [1302 bp, 433 aa] {ON} YN...   135   2e-33
KLTH0F19668g Chr6 (1595709..1597007) [1299 bp, 432 aa] {ON} high...   135   2e-33
CAGL0A03322g Chr1 (338516..339868) [1353 bp, 450 aa] {ON} highly...   135   2e-33
ZYRO0C03498g Chr3 (278064..279365) [1302 bp, 433 aa] {ON} highly...   135   2e-33
YNL330C Chr14 complement(18001..19302) [1302 bp, 433 aa] {ON}  R...   135   2e-33
TPHA0A00300 Chr1 complement(40868..42169) [1302 bp, 433 aa] {ON}...   135   2e-33
SAKL0C13706g Chr3 (1207800..1209101) [1302 bp, 433 aa] {ON} high...   135   2e-33
KLLA0E01981g Chr5 complement(186177..187475) [1299 bp, 432 aa] {...   135   2e-33
Suva_7.71 Chr7 complement(135837..137195) [1359 bp, 452 aa] {ON}...   135   3e-33
TDEL0A00270 Chr1 complement(44950..46251) [1302 bp, 433 aa] {ON}...   133   8e-33
KNAG0G01350 Chr7 (300791..302146) [1356 bp, 451 aa] {ON} Anc_8.1...   134   8e-33
ZYRO0G19316g Chr7 (1600375..1601721) [1347 bp, 448 aa] {ON} high...   133   1e-32
NDAI0A05120 Chr1 (1164314..1165840) [1527 bp, 508 aa] {ON} Anc_3...    78   3e-14
KLTH0F10582g Chr6 (910298..911722) [1425 bp, 474 aa] {ON} simila...    77   5e-14
TDEL0A05520 Chr1 complement(970572..972596) [2025 bp, 674 aa] {O...    77   6e-14
SAKL0B07854g Chr2 complement(669743..671212) [1470 bp, 489 aa] {...    76   7e-14
Skud_16.353 Chr16 complement(647799..649214) [1416 bp, 471 aa] {...    76   8e-14
Ecym_8290 Chr8 complement(589795..591924) [2130 bp, 709 aa] {ON}...    77   1e-13
TDEL0C05040 Chr3 complement(901798..903162) [1365 bp, 454 aa] {O...    75   2e-13
Suva_16.396 Chr16 complement(689796..691229) [1434 bp, 477 aa] {...    75   2e-13
NCAS0A11180 Chr1 complement(2216701..2218173) [1473 bp, 490 aa] ...    74   5e-13
Kwal_23.3724 s23 (406773..408194) [1422 bp, 473 aa] {ON} YPR068C...    74   6e-13
YPL116W Chr16 (329606..331699) [2094 bp, 697 aa] {ON}  HOS3Trich...    74   8e-13
Kpol_376.15 s376 complement(25558..27114) [1557 bp, 518 aa] {ON}...    73   1e-12
YPR068C Chr16 complement(682941..684353) [1413 bp, 470 aa] {ON} ...    73   1e-12
Kpol_479.6 s479 complement(10892..12958) [2067 bp, 688 aa] {ON} ...    73   1e-12
CAGL0D01430g Chr4 (158990..160327) [1338 bp, 445 aa] {ON} simila...    72   1e-12
Smik_16.309 Chr16 complement(559713..561125) [1413 bp, 470 aa] {...    72   2e-12
Suva_16.194 Chr16 (339127..341226) [2100 bp, 699 aa] {ON} YPL116...    73   2e-12
ZYRO0C16390g Chr3 complement(1274651..1275961) [1311 bp, 436 aa]...    70   5e-12
TBLA0B02390 Chr2 (558067..559806) [1740 bp, 579 aa] {ON} Anc_3.3...    70   1e-11
TBLA0E04080 Chr5 complement(1026669..1028753) [2085 bp, 694 aa] ...    70   1e-11
KAFR0H00890 Chr8 (167453..168877) [1425 bp, 474 aa] {ON} Anc_3.3...    69   1e-11
KNAG0H00630 Chr8 (105506..106876) [1371 bp, 456 aa] {ON} Anc_3.3...    69   1e-11
ZYRO0F10780g Chr6 complement(879680..881686) [2007 bp, 668 aa] {...    69   2e-11
ADL265W Chr4 (237911..239995) [2085 bp, 694 aa] {ON} Syntenic ho...    69   2e-11
KLTH0D09592g Chr4 complement(792708..794825) [2118 bp, 705 aa] {...    69   3e-11
KLLA0B09394g Chr2 (822629..823954) [1326 bp, 441 aa] {ON} simila...    67   6e-11
TPHA0A01120 Chr1 (216522..218618) [2097 bp, 698 aa] {ON} Anc_8.6...    67   1e-10
ADL339W Chr4 (110772..112085) [1314 bp, 437 aa] {ON} Syntenic ho...    66   1e-10
KNAG0J01300 Chr10 (232784..234817) [2034 bp, 677 aa] {ON} Anc_8....    66   2e-10
Kwal_26.8505 s26 complement(815901..818027) [2127 bp, 708 aa] {O...    65   4e-10
KAFR0H02790 Chr8 complement(531813..533966) [2154 bp, 717 aa] {O...    65   5e-10
Smik_6.315 Chr6 complement(492590..494683) [2094 bp, 697 aa] {ON...    64   9e-10
Ecym_3465 Chr3 (874618..875955) [1338 bp, 445 aa] {ON} similar t...    62   2e-09
KLLA0F00858g Chr6 complement(78519..80666) [2148 bp, 715 aa] {ON...    61   6e-09
Skud_16.164 Chr16 (301141..303234) [2094 bp, 697 aa] {ON} YPL116...    60   2e-08
NDAI0E02480 Chr5 (512966..515020) [2055 bp, 684 aa] {ON} Anc_8.6...    59   2e-08
NCAS0C01760 Chr3 (324446..326548) [2103 bp, 700 aa] {ON} Anc_8.6...    59   4e-08
SAKL0H08338g Chr8 (716414..718486) [2073 bp, 690 aa] {ON} simila...    59   5e-08
TPHA0M01590 Chr13 complement(332934..334418) [1485 bp, 494 aa] {...    57   1e-07
CAGL0J06974g Chr10 (667811..669847) [2037 bp, 678 aa] {ON} highl...    53   2e-06
Smik_16.223 Chr16 (406804..410484) [3681 bp, 1226 aa] {ON} YPL01...    34   1.7  

>Kwal_27.11537 s27 (839198..841324) [2127 bp, 708 aa] {ON} YNL021W
           (HDA1) - histone deacetylase, shares sequence similarity
           with Rpd3p, Hos1p, Hos2p, and Hos3p [contig 27] FULL
          Length = 708

 Score = 1475 bits (3818), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 708/708 (100%), Positives = 708/708 (100%)

Query: 1   MTEAVGIKQEDSLKQENGFKRDAENALLEEENGGSETKVKRPVIVPACRAKLHYTPLKTG 60
           MTEAVGIKQEDSLKQENGFKRDAENALLEEENGGSETKVKRPVIVPACRAKLHYTPLKTG
Sbjct: 1   MTEAVGIKQEDSLKQENGFKRDAENALLEEENGGSETKVKRPVIVPACRAKLHYTPLKTG 60

Query: 61  LCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIIDPTLSGVDDIGDLML 120
           LCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIIDPTLSGVDDIGDLML
Sbjct: 61  LCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIIDPTLSGVDDIGDLML 120

Query: 121 KIPAREATDEEILQVHTPEHLEFLSKTTSMTREQLLKETEKGDSVYFNNDSYLSAKLSCG 180
           KIPAREATDEEILQVHTPEHLEFLSKTTSMTREQLLKETEKGDSVYFNNDSYLSAKLSCG
Sbjct: 121 KIPAREATDEEILQVHTPEHLEFLSKTTSMTREQLLKETEKGDSVYFNNDSYLSAKLSCG 180

Query: 181 GAIEACRAVVEGRVKNALAVVRPPGHHAEPDLAGGFCLFSNVAVAAQNILKNYPESVKKI 240
           GAIEACRAVVEGRVKNALAVVRPPGHHAEPDLAGGFCLFSNVAVAAQNILKNYPESVKKI
Sbjct: 181 GAIEACRAVVEGRVKNALAVVRPPGHHAEPDLAGGFCLFSNVAVAAQNILKNYPESVKKI 240

Query: 241 MILDWDVHHGNGTQKAFYNDDRVLYVSLHRHELGKYYPGTIHGNADRVGEGKGEGFNCNI 300
           MILDWDVHHGNGTQKAFYNDDRVLYVSLHRHELGKYYPGTIHGNADRVGEGKGEGFNCNI
Sbjct: 241 MILDWDVHHGNGTQKAFYNDDRVLYVSLHRHELGKYYPGTIHGNADRVGEGKGEGFNCNI 300

Query: 301 PWPWKGVGDAEYIWAFEQVVLPMGREFQPDLVIISSGFDAADGDTVGQCHVTPSCYGHMT 360
           PWPWKGVGDAEYIWAFEQVVLPMGREFQPDLVIISSGFDAADGDTVGQCHVTPSCYGHMT
Sbjct: 301 PWPWKGVGDAEYIWAFEQVVLPMGREFQPDLVIISSGFDAADGDTVGQCHVTPSCYGHMT 360

Query: 361 HMLKSLARGNICAVLEGGYSLDSIAKSALGVAKVLIGEPPDELPVVKQPKPEAVEVIDAV 420
           HMLKSLARGNICAVLEGGYSLDSIAKSALGVAKVLIGEPPDELPVVKQPKPEAVEVIDAV
Sbjct: 361 HMLKSLARGNICAVLEGGYSLDSIAKSALGVAKVLIGEPPDELPVVKQPKPEAVEVIDAV 420

Query: 421 IKMQSRYWQCFKSTHANDGCSFKEPVTETLLNRNFPLQTAIRQQQVRLLTTEYNFVTLPL 480
           IKMQSRYWQCFKSTHANDGCSFKEPVTETLLNRNFPLQTAIRQQQVRLLTTEYNFVTLPL
Sbjct: 421 IKMQSRYWQCFKSTHANDGCSFKEPVTETLLNRNFPLQTAIRQQQVRLLTTEYNFVTLPL 480

Query: 481 IKKELPDDTALCSPNIYDSQSIIVCVHDTPEIWAQRSRATGTIDPSTSIIVDTTLDVIKW 540
           IKKELPDDTALCSPNIYDSQSIIVCVHDTPEIWAQRSRATGTIDPSTSIIVDTTLDVIKW
Sbjct: 481 IKKELPDDTALCSPNIYDSQSIIVCVHDTPEIWAQRSRATGTIDPSTSIIVDTTLDVIKW 540

Query: 541 ASKRNYGVIDINIPQSLHEQDNYSAVLTAQEVLVYIWDSYLKYFTSLSKVAFVSIGDAYS 600
           ASKRNYGVIDINIPQSLHEQDNYSAVLTAQEVLVYIWDSYLKYFTSLSKVAFVSIGDAYS
Sbjct: 541 ASKRNYGVIDINIPQSLHEQDNYSAVLTAQEVLVYIWDSYLKYFTSLSKVAFVSIGDAYS 600

Query: 601 GVVHLLGHRDTRNVVKAAISFIDQRPLRPLVPLVDESLADWYFKNSLVFASAGHTCWGND 660
           GVVHLLGHRDTRNVVKAAISFIDQRPLRPLVPLVDESLADWYFKNSLVFASAGHTCWGND
Sbjct: 601 GVVHLLGHRDTRNVVKAAISFIDQRPLRPLVPLVDESLADWYFKNSLVFASAGHTCWGND 660

Query: 661 GAENKKPRKKFGRVLKCNSDGLNNILEERFEEATDFILDTFEEWSDSE 708
           GAENKKPRKKFGRVLKCNSDGLNNILEERFEEATDFILDTFEEWSDSE
Sbjct: 661 GAENKKPRKKFGRVLKCNSDGLNNILEERFEEATDFILDTFEEWSDSE 708

>KLTH0G10340g Chr7 complement(874566..876692) [2127 bp, 708 aa] {ON}
           highly similar to uniprot|P53973 Saccharomyces
           cerevisiae YNL021W HDA1 Putative catalytic subunit of a
           class II histone deacetylase complex that also contains
           Hda2p and Hda3p Hda1p interacts with the Hda2p-Hda3p
           subcomplex to form an active tetramer deletion increases
           histone H2B H3 and H4 acetylation
          Length = 708

 Score = 1326 bits (3432), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 619/708 (87%), Positives = 668/708 (94%)

Query: 1   MTEAVGIKQEDSLKQENGFKRDAENALLEEENGGSETKVKRPVIVPACRAKLHYTPLKTG 60
           MTE+  +KQE+  +Q NG KRD E+A L +  G   +  KRP IVPACR KLHYTPLKTG
Sbjct: 1   MTESAEVKQEEPSEQINGLKRDHESATLNDGTGNQASVAKRPTIVPACRPKLHYTPLKTG 60

Query: 61  LCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIIDPTLSGVDDIGDLML 120
           LCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLI DPTLSGVD IGDLML
Sbjct: 61  LCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIDDPTLSGVDSIGDLML 120

Query: 121 KIPAREATDEEILQVHTPEHLEFLSKTTSMTREQLLKETEKGDSVYFNNDSYLSAKLSCG 180
           KIP REATDEEILQVHT EHLEF+SKTTSMTR+QLLKETEKGDSVYFNNDSYLSAKLSCG
Sbjct: 121 KIPVREATDEEILQVHTKEHLEFISKTTSMTRDQLLKETEKGDSVYFNNDSYLSAKLSCG 180

Query: 181 GAIEACRAVVEGRVKNALAVVRPPGHHAEPDLAGGFCLFSNVAVAAQNILKNYPESVKKI 240
           GAIEAC+AVVEGRVKNALAVVRPPGHHAEP++AGGFCLFSNVAVAAQNILKNYPESV+KI
Sbjct: 181 GAIEACKAVVEGRVKNALAVVRPPGHHAEPEVAGGFCLFSNVAVAAQNILKNYPESVRKI 240

Query: 241 MILDWDVHHGNGTQKAFYNDDRVLYVSLHRHELGKYYPGTIHGNADRVGEGKGEGFNCNI 300
           M+LDWDVHHGNGTQKAFY+DDRVLY+SLHRHELGKYYPGTIHGN+DRVGEGKGEGFNCNI
Sbjct: 241 MVLDWDVHHGNGTQKAFYDDDRVLYISLHRHELGKYYPGTIHGNSDRVGEGKGEGFNCNI 300

Query: 301 PWPWKGVGDAEYIWAFEQVVLPMGREFQPDLVIISSGFDAADGDTVGQCHVTPSCYGHMT 360
           PWPWKGVGD+EY+WAFEQV++PMGREF+PDLVIISSGFDAADGDTVGQCHVTPSCYGHMT
Sbjct: 301 PWPWKGVGDSEYLWAFEQVIMPMGREFRPDLVIISSGFDAADGDTVGQCHVTPSCYGHMT 360

Query: 361 HMLKSLARGNICAVLEGGYSLDSIAKSALGVAKVLIGEPPDELPVVKQPKPEAVEVIDAV 420
           HMLKSLARGN+CAVLEGGYSLDSIAKSAL VAKVLIGEPPDELPVVKQPK EAVEVID+V
Sbjct: 361 HMLKSLARGNLCAVLEGGYSLDSIAKSALAVAKVLIGEPPDELPVVKQPKLEAVEVIDSV 420

Query: 421 IKMQSRYWQCFKSTHANDGCSFKEPVTETLLNRNFPLQTAIRQQQVRLLTTEYNFVTLPL 480
           IK QS+YW+CFKSTH NDGCSFKE  T+T +N+NFPLQ AIRQQQ+RLL  E+ FVTLPL
Sbjct: 421 IKTQSKYWKCFKSTHGNDGCSFKEQATDTAINKNFPLQNAIRQQQMRLLANEFRFVTLPL 480

Query: 481 IKKELPDDTALCSPNIYDSQSIIVCVHDTPEIWAQRSRATGTIDPSTSIIVDTTLDVIKW 540
            KKELPDDTA+CSPNIYD+ +IIVCVHDTP IWAQRSRATGTIDPSTSIIVDTTLDVIKW
Sbjct: 481 FKKELPDDTAICSPNIYDASAIIVCVHDTPSIWAQRSRATGTIDPSTSIIVDTTLDVIKW 540

Query: 541 ASKRNYGVIDINIPQSLHEQDNYSAVLTAQEVLVYIWDSYLKYFTSLSKVAFVSIGDAYS 600
           AS RNYGVIDINIPQSLHEQDNYSAV+TAQEVLV+IWD+YLKYF SL++VAFV+IGDA+S
Sbjct: 541 ASSRNYGVIDINIPQSLHEQDNYSAVITAQEVLVHIWDNYLKYFPSLNRVAFVAIGDAHS 600

Query: 601 GVVHLLGHRDTRNVVKAAISFIDQRPLRPLVPLVDESLADWYFKNSLVFASAGHTCWGND 660
           GVVHLLGHRDTR+VVK+A+SF+DQRPLRPL+PLVDE+LADWYFKNSLVFASA HTCWGND
Sbjct: 601 GVVHLLGHRDTRSVVKSAVSFVDQRPLRPLIPLVDETLADWYFKNSLVFASAEHTCWGND 660

Query: 661 GAENKKPRKKFGRVLKCNSDGLNNILEERFEEATDFILDTFEEWSDSE 708
           G ENKKPRKKFGRVLKC+SDG+NNILEERFEEATDFILDTFEEWSDSE
Sbjct: 661 GNENKKPRKKFGRVLKCDSDGINNILEERFEEATDFILDTFEEWSDSE 708

>SAKL0E07700g Chr5 (622822..624960) [2139 bp, 712 aa] {ON} highly
           similar to uniprot|P53973 Saccharomyces cerevisiae
           YNL021W HDA1 Putative catalytic subunit of a class II
           histone deacetylase complex that also contains Hda2p and
           Hda3p Hda1p interacts with the Hda2p-Hda3p subcomplex to
           form an active tetramer deletion increases histone H2B
           H3 and H4 acetylation
          Length = 712

 Score = 1185 bits (3066), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 547/706 (77%), Positives = 631/706 (89%), Gaps = 8/706 (1%)

Query: 4   AVGIKQEDSLKQENGFKRDAENALLEEENGGSETKVKRPVIVPACRAKLHYTPLKTGLCY 63
           AV +K EDSLK+    K D     +E     + T    PVIVP    ++HYT LKTGLCY
Sbjct: 14  AVEVKMEDSLKR----KVDTMEDEVESRKRSTGT---LPVIVPEVPPRIHYTQLKTGLCY 66

Query: 64  DVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIIDPTLSGVDDIGDLMLKIP 123
           DVRMRYHAKI+TSYFEYIDPHPEDPRRIYRIYKILAENGLI DPTLSGVD+IG+LMLKIP
Sbjct: 67  DVRMRYHAKIYTSYFEYIDPHPEDPRRIYRIYKILAENGLIRDPTLSGVDEIGELMLKIP 126

Query: 124 AREATDEEILQVHTPEHLEFLSKTTSMTREQLLKETEKGDSVYFNNDSYLSAKLSCGGAI 183
            REAT EEILQVHT EHL FL KT  MTREQLLKETE GDSVYFNNDS LSAKLSCGGAI
Sbjct: 127 VREATAEEILQVHTKEHLAFLEKTPKMTREQLLKETETGDSVYFNNDSLLSAKLSCGGAI 186

Query: 184 EACRAVVEGRVKNALAVVRPPGHHAEPDLAGGFCLFSNVAVAAQNILKNYPESVKKIMIL 243
           EAC+AVVEGRVKNALAV+RPPGHHAEP++AGGFCLFSNVAVAAQNILKNYPESV++IMIL
Sbjct: 187 EACKAVVEGRVKNALAVIRPPGHHAEPEIAGGFCLFSNVAVAAQNILKNYPESVRRIMIL 246

Query: 244 DWDVHHGNGTQKAFYNDDRVLYVSLHRHELGKYYPGTIHGNADRVGEGKGEGFNCNIPWP 303
           DWD+HHGNGTQKAFY+D+RVLYVSLHR+ELGKYYPGT+HGN ++ GEGKGEGFNCNIPWP
Sbjct: 247 DWDIHHGNGTQKAFYSDNRVLYVSLHRYELGKYYPGTVHGNYEQTGEGKGEGFNCNIPWP 306

Query: 304 WKGVGDAEYIWAFEQVVLPMGREFQPDLVIISSGFDAADGDTVGQCHVTPSCYGHMTHML 363
           + G+GDAEY+WAF+QVV+PMGREFQPDLVIISSGFDAADGDT+GQCHV+PSCYGHMTHML
Sbjct: 307 YGGLGDAEYMWAFQQVVMPMGREFQPDLVIISSGFDAADGDTIGQCHVSPSCYGHMTHML 366

Query: 364 KSLARGNICAVLEGGYSLDSIAKSALGVAKVLIGEPPDELP-VVKQPKPEAVEVIDAVIK 422
           KSLARGN+C VLEGGY+LDSIAKSALGVAK+LIGEPPDELP   +QPKPEA+E I+ VI+
Sbjct: 367 KSLARGNLCVVLEGGYNLDSIAKSALGVAKILIGEPPDELPHPTQQPKPEAIETIETVIR 426

Query: 423 MQSRYWQCFKSTHANDGCSFKEPVTETLLNRNFPLQTAIRQQQVRLLTTEYNFVTLPLIK 482
            QS+YW CFKSTH+NDGC+FKE VTE+ +++NFPLQ AIRQ+Q++ L+ ++ FVTLPL+ 
Sbjct: 427 TQSKYWNCFKSTHSNDGCNFKEEVTESTISKNFPLQQAIRQEQLQQLSEKFGFVTLPLLN 486

Query: 483 KELPDDTALCSPNIYDSQSIIVCVHDTPEIWAQRSRATGTIDPSTSIIVDTTLDVIKWAS 542
            E+P DT +CSPNIYD+++++VCVHDTPEIWAQR+  TGTIDPSTSIIVDTTLD+IKW+ 
Sbjct: 487 MEVPQDTVICSPNIYDAETVVVCVHDTPEIWAQRNPITGTIDPSTSIIVDTTLDIIKWSL 546

Query: 543 KRNYGVIDINIPQSLHEQDNYSAVLTAQEVLVYIWDSYLKYFTSLSKVAFVSIGDAYSGV 602
           +R Y VID+NIPQSL EQDNYSA++T+QEVLVYIWD+YLKYF SL+KVAF+ +GDAYSG+
Sbjct: 547 QRKYSVIDVNIPQSLFEQDNYSAMITSQEVLVYIWDNYLKYFPSLAKVAFIGVGDAYSGI 606

Query: 603 VHLLGHRDTRNVVKAAISFIDQRPLRPLVPLVDESLADWYFKNSLVFASAGHTCWGNDGA 662
           VHLLGHRDTR+VVKAA+SF+D +PL+ LVPLVDESL +WYFKNSLVF S  H+CWG DG 
Sbjct: 607 VHLLGHRDTRSVVKAAVSFVDTKPLKSLVPLVDESLGNWYFKNSLVFTSKNHSCWGTDGN 666

Query: 663 ENKKPRKKFGRVLKCNSDGLNNILEERFEEATDFILDTFEEWSDSE 708
           ENKKPRK+FGRVLKC++ G+NNI+EERF+EATDFILD+FEEWSDSE
Sbjct: 667 ENKKPRKRFGRVLKCDTTGMNNIVEERFQEATDFILDSFEEWSDSE 712

>Ecym_3324 Chr3 complement(620836..622956) [2121 bp, 706 aa] {ON}
           similar to Ashbya gossypii ADL216C
          Length = 706

 Score = 1134 bits (2932), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 520/670 (77%), Positives = 600/670 (89%), Gaps = 1/670 (0%)

Query: 40  KRPVIVPACRAKLHYTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILA 99
           KRP+IVP  + K+HY PLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILA
Sbjct: 37  KRPIIVPVVKPKIHYVPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILA 96

Query: 100 ENGLIIDPTLSGVDDIGDLMLKIPAREATDEEILQVHTPEHLEFLSKTTSMTREQLLKET 159
           ENGLI DPTLSGVDDIG+LMLKIP REAT++EIL VH+ EH+EFL  T +M+REQLLKET
Sbjct: 97  ENGLIEDPTLSGVDDIGNLMLKIPIREATEDEILLVHSKEHVEFLKTTNTMSREQLLKET 156

Query: 160 EKGDSVYFNNDSYLSAKLSCGGAIEACRAVVEGRVKNALAVVRPPGHHAEPDLAGGFCLF 219
           E GDSVY+NNDS +SAKLSCGGAIEAC+AVVEGRVKNALAVVRPPGHHAEP++AGGFCLF
Sbjct: 157 EAGDSVYYNNDSLVSAKLSCGGAIEACKAVVEGRVKNALAVVRPPGHHAEPEVAGGFCLF 216

Query: 220 SNVAVAAQNILKNYPESVKKIMILDWDVHHGNGTQKAFYNDDRVLYVSLHRHELGKYYPG 279
           SNVAVAA+NILKNYPESV+K+MILDWD+HHGNGTQ+AFYND+RVLYVSLHR+ELG+YYPG
Sbjct: 217 SNVAVAARNILKNYPESVRKVMILDWDIHHGNGTQRAFYNDNRVLYVSLHRYELGRYYPG 276

Query: 280 TIHGNADRVGEGKGEGFNCNIPWPWKGVGDAEYIWAFEQVVLPMGREFQPDLVIISSGFD 339
           T +GN ++ GEGKGEGFNCNIPW   GVGDAEY+WAFEQ+V+PMGREFQPDLVIISSGFD
Sbjct: 277 TEYGNYNQSGEGKGEGFNCNIPWSCGGVGDAEYMWAFEQIVIPMGREFQPDLVIISSGFD 336

Query: 340 AADGDTVGQCHVTPSCYGHMTHMLKSLARGNICAVLEGGYSLDSIAKSALGVAKVLIGEP 399
           AADGDT+GQCHV+P+CYGHMTHMLKSLA+GN+C VLEGGY+LDSIAKSALGV KVLIGEP
Sbjct: 337 AADGDTIGQCHVSPACYGHMTHMLKSLAKGNMCVVLEGGYNLDSIAKSALGVVKVLIGEP 396

Query: 400 PDELP-VVKQPKPEAVEVIDAVIKMQSRYWQCFKSTHANDGCSFKEPVTETLLNRNFPLQ 458
           PDELP   KQPKPEA+  I+ VI+ Q++YW CFKS H N G ++KEPV E+L  +NFPLQ
Sbjct: 397 PDELPDPFKQPKPEAIATIETVIREQAKYWDCFKSKHGNCGVNWKEPVDESLTFKNFPLQ 456

Query: 459 TAIRQQQVRLLTTEYNFVTLPLIKKELPDDTALCSPNIYDSQSIIVCVHDTPEIWAQRSR 518
           +A+RQ+Q R L+ EY FVTLPL+  EL  DT +CSPNI+++ ++I+CVHDTPE+WA+R+ 
Sbjct: 457 SAVRQEQFRRLSKEYKFVTLPLLDMELSGDTIICSPNIHETDTLIICVHDTPEVWAKRNP 516

Query: 519 ATGTIDPSTSIIVDTTLDVIKWASKRNYGVIDINIPQSLHEQDNYSAVLTAQEVLVYIWD 578
            TG IDPSTSIIVDTTL +  WA  R+YG+IDINIPQSL E DNYSAVLT+QEVL Y+WD
Sbjct: 517 LTGYIDPSTSIIVDTTLSITNWALGRSYGIIDINIPQSLFELDNYSAVLTSQEVLSYLWD 576

Query: 579 SYLKYFTSLSKVAFVSIGDAYSGVVHLLGHRDTRNVVKAAISFIDQRPLRPLVPLVDESL 638
            YLK+F  L++VAFV IGDAYSG VHLLGHRDTR++VK AISF D++ LRPLVPLVDES+
Sbjct: 577 HYLKFFAQLTRVAFVGIGDAYSGFVHLLGHRDTRSIVKCAISFTDKKQLRPLVPLVDESI 636

Query: 639 ADWYFKNSLVFASAGHTCWGNDGAENKKPRKKFGRVLKCNSDGLNNILEERFEEATDFIL 698
           +DWYFKNSL+F S  H+CWG +G ++KKPRKKFGRVLKCNSDG+NNILEERFEEATDFIL
Sbjct: 637 SDWYFKNSLIFTSKYHSCWGTEGNDSKKPRKKFGRVLKCNSDGMNNILEERFEEATDFIL 696

Query: 699 DTFEEWSDSE 708
           D+FEEWSDSE
Sbjct: 697 DSFEEWSDSE 706

>NCAS0G03800 Chr7 (701547..703727) [2181 bp, 726 aa] {ON} 
          Length = 726

 Score = 1118 bits (2891), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 508/670 (75%), Positives = 600/670 (89%), Gaps = 3/670 (0%)

Query: 40  KRPVIVPACRAKLHYTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILA 99
           +RPVIVP   A+L YTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILA
Sbjct: 59  ERPVIVPPRDAELSYTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILA 118

Query: 100 ENGLIIDPTLSGVDDIGDLMLKIPAREATDEEILQVHTPEHLEFLSKTTSMTREQLLKET 159
           ENGLI DPTLSG++DIGDLMLKIP R+AT+EEIL+VH+ EH +F+ KT++M RE+LLK T
Sbjct: 119 ENGLIKDPTLSGIEDIGDLMLKIPVRDATEEEILEVHSKEHYDFIEKTSTMNREELLKAT 178

Query: 160 EKGDSVYFNNDSYLSAKLSCGGAIEACRAVVEGRVKNALAVVRPPGHHAEPDLAGGFCLF 219
           EKGDSVYFNNDS+ SAKL  GG+IEAC+AVVEGRVKN+LAVVRPPGHHAEP  AGGFCLF
Sbjct: 179 EKGDSVYFNNDSFASAKLPVGGSIEACKAVVEGRVKNSLAVVRPPGHHAEPQAAGGFCLF 238

Query: 220 SNVAVAAQNILKNYPESVKKIMILDWDVHHGNGTQKAFYNDDRVLYVSLHRHELGKYYPG 279
           SNVA+AA+NILKNYPESV++IMILDWD+HHGNGTQKAFY+DDRVLY+SLHR ELGKYYPG
Sbjct: 239 SNVAIAAKNILKNYPESVRRIMILDWDIHHGNGTQKAFYDDDRVLYISLHRFELGKYYPG 298

Query: 280 TIHGNADRVGEGKGEGFNCNIPWPWKGVGDAEYIWAFEQVVLPMGREFQPDLVIISSGFD 339
           TI+G  D+ GEGKGEGFNCNI WP  GVGDAEYIWAFEQVV+PM REFQPDLVIISSGFD
Sbjct: 299 TINGQYDQTGEGKGEGFNCNITWPVGGVGDAEYIWAFEQVVMPMAREFQPDLVIISSGFD 358

Query: 340 AADGDTVGQCHVTPSCYGHMTHMLKSLARGNICAVLEGGYSLDSIAKSALGVAKVLIGEP 399
           AADGD++GQCHVTPSCYGHMTHMLKSLA+GN+C VLEGGY+LD+IA+SAL VAK+LIGEP
Sbjct: 359 AADGDSIGQCHVTPSCYGHMTHMLKSLAKGNLCVVLEGGYNLDAIARSALSVAKILIGEP 418

Query: 400 PDELP-VVKQPKPEAVEVIDAVIKMQSRYWQCFKSTHANDGCSFKEPVTETLLNRNFPLQ 458
           PDELP  ++ PKPEA+E+ID VI++QS+YW+CFK  + N GC+FK+ + E+L+++NFPLQ
Sbjct: 419 PDELPDPLRDPKPEAIEIIDKVIRLQSKYWKCFKRRYGNAGCNFKDEINESLISKNFPLQ 478

Query: 459 TAIRQQQVRLLTTEYNFVTLPLIKKELPDDTALCSPNIYDSQSIIVCVHDTPEIWAQRSR 518
            AIR+QQ+  L+ ++ F TLPL+K ELP DT LCSPN+Y S+++I+C HDTPEIWA+R  
Sbjct: 479 QAIREQQLNTLSQDFKFATLPLLKPELPKDTVLCSPNVYQSKTVIICAHDTPEIWAKRDV 538

Query: 519 ATGTIDPSTSIIVDTTLDVIKWASKRNYGVIDINIPQSLHEQDNYSAVLTAQEVLVYIWD 578
             GTIDPS+SIIVD+TLD IKWA+++ YGVIDINIPQ+L EQ+NYSA++T+QEVL YIWD
Sbjct: 539 IQGTIDPSSSIIVDSTLDFIKWANEKKYGVIDINIPQNLFEQENYSAIVTSQEVLTYIWD 598

Query: 579 SYLKYFTSLSKVAFVSIGDAYSGVVHLLGHRDTRNVVKAAISFIDQRPLRPLVPLVDESL 638
           +YLKYF ++ KVAF+ IGDAYSG+VHLLGHRDTR+VVK+ I+FI Q+ LR LVPLVDESL
Sbjct: 599 NYLKYFPNVEKVAFIGIGDAYSGIVHLLGHRDTRSVVKSVINFIAQKQLRALVPLVDESL 658

Query: 639 ADWYFKNSLVFASAGHTCWGNDGAENKKPRKKFGRVLKCNSDGLNNILEERFEEATDFIL 698
           +DWYFKNSLVF+   HT WG+   ENKKPRKK+GR+L+C +DG+NNI+EERFEEATDFIL
Sbjct: 659 SDWYFKNSLVFSDKSHTYWGD--KENKKPRKKYGRLLRCETDGINNIVEERFEEATDFIL 716

Query: 699 DTFEEWSDSE 708
           D+FEEWSDSE
Sbjct: 717 DSFEEWSDSE 726

>NDAI0G00650 Chr7 complement(141981..144050) [2070 bp, 689 aa] {ON}
           Anc_2.285 YNL021W
          Length = 689

 Score = 1109 bits (2869), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 507/669 (75%), Positives = 594/669 (88%), Gaps = 3/669 (0%)

Query: 41  RPVIVPACRAKLHYTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAE 100
           R +IVP   A++HYTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAE
Sbjct: 23  RQIIVPPRDAQIHYTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAE 82

Query: 101 NGLIIDPTLSGVDDIGDLMLKIPAREATDEEILQVHTPEHLEFLSKTTSMTREQLLKETE 160
           NGLI DPTLSG+DDIGDLMLKIP REAT EEIL+VH+ EHL+F+  T+ M REQLLK TE
Sbjct: 83  NGLIKDPTLSGIDDIGDLMLKIPVREATSEEILEVHSKEHLDFIESTSKMNREQLLKATE 142

Query: 161 KGDSVYFNNDSYLSAKLSCGGAIEACRAVVEGRVKNALAVVRPPGHHAEPDLAGGFCLFS 220
            GDSVYFN+DSY SAKL  GGAIEAC+AVVEGRVKNALAVVRPPGHHAEP+ AGGFCLFS
Sbjct: 143 SGDSVYFNSDSYASAKLPVGGAIEACKAVVEGRVKNALAVVRPPGHHAEPEAAGGFCLFS 202

Query: 221 NVAVAAQNILKNYPESVKKIMILDWDVHHGNGTQKAFYNDDRVLYVSLHRHELGKYYPGT 280
           NVA+AA+NILKNYPESV+KI+ILDWD+HHGNGTQKAFY+DDR+LYVSLHR ++GKYYPGT
Sbjct: 203 NVAIAAKNILKNYPESVRKILILDWDIHHGNGTQKAFYDDDRILYVSLHRFKMGKYYPGT 262

Query: 281 IHGNADRVGEGKGEGFNCNIPWPWKGVGDAEYIWAFEQVVLPMGREFQPDLVIISSGFDA 340
           IHG  D+ GEGKGEGFNCNI WP  GVGDAEY+WAFEQ+V+PMGREFQPDLVIIS+GFDA
Sbjct: 263 IHGRYDQTGEGKGEGFNCNITWPVGGVGDAEYMWAFEQIVMPMGREFQPDLVIISAGFDA 322

Query: 341 ADGDTVGQCHVTPSCYGHMTHMLKSLARGNICAVLEGGYSLDSIAKSALGVAKVLIGEPP 400
           ADGDT+GQCHVTPSCYGHMTHMLKSLARGN+  VLEGGY+LDSIA SAL VAK+LIGEPP
Sbjct: 323 ADGDTIGQCHVTPSCYGHMTHMLKSLARGNMAVVLEGGYNLDSIAISALSVAKILIGEPP 382

Query: 401 DELP-VVKQPKPEAVEVIDAVIKMQSRYWQCFKSTHANDGCSFKEPVTETLLNRNFPLQT 459
           DELP V + PKPE +E+ID V+++QS+YW+CFKS   N GC F+E +  ++  +NFPLQ+
Sbjct: 383 DELPDVTRDPKPEVIEMIDKVLRIQSKYWKCFKSKFGNAGCDFQEQINNSIATKNFPLQS 442

Query: 460 AIRQQQVRLLTTEYNFVTLPLIKKELPDDTALCSPNIYDSQSIIVCVHDTPEIWAQRSRA 519
           AIRQQQVR L+ E+NF  LP+ K ELP+DT LCS NIY+S +II+CVHDTPEIWA+R   
Sbjct: 443 AIRQQQVRNLSKEFNFSELPIYKSELPEDTILCSSNIYESNTIIICVHDTPEIWAKRDAI 502

Query: 520 TGTIDPSTSIIVDTTLDVIKWASKRNYGVIDINIPQSLHEQDNYSAVLTAQEVLVYIWDS 579
            GTIDPS+SIIVD++LD+IKWA +R YGVIDINIPQ+L EQ+NY +++TAQEVL+ +WD+
Sbjct: 503 QGTIDPSSSIIVDSSLDMIKWAIERKYGVIDINIPQNLLEQENYYSIITAQEVLINLWDN 562

Query: 580 YLKYFTSLSKVAFVSIGDAYSGVVHLLGHRDTRNVVKAAISFIDQRPLRPLVPLVDESLA 639
           YLKYF +++K+AFV IGDAYSG+VHLLGHRDTR+VVKA I+F+ Q+ L+PLVPLVDESL 
Sbjct: 563 YLKYFPNVNKIAFVGIGDAYSGIVHLLGHRDTRSVVKAVINFVGQKQLKPLVPLVDESLG 622

Query: 640 DWYFKNSLVFASAGHTCWGNDGAENKKPRKKFGRVLKCNSDGLNNILEERFEEATDFILD 699
           +WYFKNSLVF++  H  WG+   ENKKPRKK+GRVL+C++DG++NI+EERFEEATDFILD
Sbjct: 623 EWYFKNSLVFSNKNHIYWGD--KENKKPRKKYGRVLRCDTDGISNIMEERFEEATDFILD 680

Query: 700 TFEEWSDSE 708
           +FEEWSDSE
Sbjct: 681 SFEEWSDSE 689

>ZYRO0A01870g Chr1 complement(154507..156630) [2124 bp, 707 aa] {ON}
           highly similar to uniprot|P53973 Saccharomyces
           cerevisiae YNL021W HDA1 Putative catalytic subunit of a
           class II histone deacetylase complex that also contains
           Hda2p and Hda3p Hda1p interacts with the Hda2p-Hda3p
           subcomplex to form an active tetramer deletion increases
           histone H2B H3 and H4 acetylation
          Length = 707

 Score = 1105 bits (2859), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 523/713 (73%), Positives = 604/713 (84%), Gaps = 23/713 (3%)

Query: 7   IKQEDSLKQENGFKRDAENALLEEENGGSETK----------VKRPVIVPACRAKLHYTP 56
           +KQED      G KR  E    E  NG  E K           KR +IVPAC  K+HYTP
Sbjct: 7   VKQEDE-----GSKRKLE----ESPNGPVEKKPNVASVSNGRQKRQIIVPACEPKIHYTP 57

Query: 57  LKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIIDPTLSGVDDIG 116
           LKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLI DPTLSG DDIG
Sbjct: 58  LKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGEDDIG 117

Query: 117 DLMLKIPAREATDEEILQVHTPEHLEFLSKTTSMTREQLLKETEKGDSVYFNNDSYLSAK 176
           +LMLKIP REAT EE+LQVHT EHLEF+ KT+ M RE+LLKETE GDSVYFN+DSY +AK
Sbjct: 118 ELMLKIPVREATVEELLQVHTKEHLEFIEKTSQMNREELLKETETGDSVYFNSDSYSAAK 177

Query: 177 LSCGGAIEACRAVVEGRVKNALAVVRPPGHHAEPDLAGGFCLFSNVAVAAQNILKNYPES 236
           L CGGAIEAC+AVVEGRVKNALAV+RPPGHHAEP++AGGFCLFSNVAVAAQNILKNYPES
Sbjct: 178 LPCGGAIEACKAVVEGRVKNALAVIRPPGHHAEPEMAGGFCLFSNVAVAAQNILKNYPES 237

Query: 237 VKKIMILDWDVHHGNGTQKAFYNDDRVLYVSLHRHELGKYYPGTIHGNADRVGEGKGEGF 296
           V++I+ILDWD+HHGNGTQKAFYNDDRVLY+SLHR ELGKYYPGTIHG  D+ GEGKGEGF
Sbjct: 238 VRRILILDWDIHHGNGTQKAFYNDDRVLYISLHRFELGKYYPGTIHGQYDQTGEGKGEGF 297

Query: 297 NCNIPWPWKGVGDAEYIWAFEQVVLPMGREFQPDLVIISSGFDAADGDTVGQCHVTPSCY 356
           NCNI WP  GVGDAEY+ AFEQ+V+PM RE++PDLVIISSGFDAADGDT+GQCHV+PSCY
Sbjct: 298 NCNITWPVGGVGDAEYMLAFEQIVMPMAREYRPDLVIISSGFDAADGDTIGQCHVSPSCY 357

Query: 357 GHMTHMLKSLARGNICAVLEGGYSLDSIAKSALGVAKVLIGEPPDELP-VVKQPKPEAVE 415
           GHMTHMLKSLARGN+C  LEGGY+LD+IA SAL VAK+LIGEPP+ELP   K PK EA+E
Sbjct: 358 GHMTHMLKSLARGNLCVALEGGYNLDAIATSALSVAKILIGEPPEELPDPSKNPKLEAIE 417

Query: 416 VIDAVIKMQSRYWQCFKSTHANDGCSFKEPVTETLLNRNFPLQTAIRQQQVRLLTTEYNF 475
           +ID VI +QS+YW+CF+    N GC+FKEPVTE+L+ +NFPLQ AIRQ+Q   L  EY F
Sbjct: 418 MIDKVIHVQSKYWKCFRRL-GNSGCNFKEPVTESLITKNFPLQKAIRQEQFHQLEKEYGF 476

Query: 476 VTLPLIKKELPDDTALCSPNIYDSQSIIVCVHDTPEIWAQRSRATGTIDPSTSIIVDTTL 535
           VTLP+ K ELP+DT LCSP+++   ++I+ VHDTPEIWA+R   TG IDPSTSI VD+ L
Sbjct: 477 VTLPVPKLELPEDTVLCSPDVFQESTVIIFVHDTPEIWAKRDVITGMIDPSTSITVDSPL 536

Query: 536 DVIKWASKRNYGVIDINIPQSLHEQDNYSAVLTAQEVLVYIWDSYLKYFTSLSKVAFVSI 595
           D IKW+  R YGVID+NIPQSL EQDNYSA++T+QEVL+Y+WD+++KYF SLSKVAFV +
Sbjct: 537 DFIKWSLARKYGVIDVNIPQSLFEQDNYSAMITSQEVLIYLWDNFVKYFPSLSKVAFVGV 596

Query: 596 GDAYSGVVHLLGHRDTRNVVKAAISFIDQRPLRPLVPLVDESLADWYFKNSLVFASAGHT 655
           GDAYSG+VHLLGHRDTR+VVKA I+F+ ++ L+PLVPLVDESL DWYFKNSLVF+   + 
Sbjct: 597 GDAYSGIVHLLGHRDTRSVVKAVINFVGRKQLKPLVPLVDESLGDWYFKNSLVFSDRNNP 656

Query: 656 CWGNDGAENKKPRKKFGRVLKCNSDGLNNILEERFEEATDFILDTFEEWSDSE 708
           CW ++  ENKKPR+KFGRVL+C SDG+NN +EERF+EATDFILD+FEEWSDSE
Sbjct: 657 CWVDN--ENKKPRRKFGRVLRCESDGINNNMEERFDEATDFILDSFEEWSDSE 707

>YNL021W Chr14 (593227..595347) [2121 bp, 706 aa] {ON}  HDA1Putative
           catalytic subunit of a class II histone deacetylase
           complex that also contains Hda2p and Hda3p; Hda1p
           interacts with the Hda2p-Hda3p subcomplex to form an
           active tetramer; deletion increases histone H2B, H3 and
           H4 acetylation
          Length = 706

 Score = 1103 bits (2853), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 505/707 (71%), Positives = 606/707 (85%), Gaps = 3/707 (0%)

Query: 3   EAVGIKQEDSLKQENGFKRDAENALLEEENGGSETKVKRPVIVPACRAKLHYTPLKTGLC 62
           ++V +K+E     ++  KR  E    EE +  + +K KR VIVP C  K+HY+PLKTGLC
Sbjct: 2   DSVMVKKEVLENPDHDLKRKLEENKEEENSLSTTSKSKRQVIVPVCMPKIHYSPLKTGLC 61

Query: 63  YDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIIDPTLSGVDDIGDLMLKI 122
           YDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLI DPTLSGVDD+GDLMLKI
Sbjct: 62  YDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDDLGDLMLKI 121

Query: 123 PAREATDEEILQVHTPEHLEFLSKTTSMTREQLLKETEKGDSVYFNNDSYLSAKLSCGGA 182
           P R AT EEIL+VHT EHLEF+  T  M+RE+LLKETEKGDSVYFNNDSY SA+L CGGA
Sbjct: 122 PVRAATSEEILEVHTKEHLEFIESTEKMSREELLKETEKGDSVYFNNDSYASARLPCGGA 181

Query: 183 IEACRAVVEGRVKNALAVVRPPGHHAEPDLAGGFCLFSNVAVAAQNILKNYPESVKKIMI 242
           IEAC+AVVEGRVKN+LAVVRPPGHHAEP  AGGFCLFSNVAVAA+NILKNYPESV++IMI
Sbjct: 182 IEACKAVVEGRVKNSLAVVRPPGHHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIMI 241

Query: 243 LDWDVHHGNGTQKAFYNDDRVLYVSLHRHELGKYYPGTIHGNADRVGEGKGEGFNCNIPW 302
           LDWD+HHGNGTQK+FY DD+VLYVSLHR E+GKYYPGTI G  D+ GEGKGEGFNCNI W
Sbjct: 242 LDWDIHHGNGTQKSFYQDDQVLYVSLHRFEMGKYYPGTIQGQYDQTGEGKGEGFNCNITW 301

Query: 303 PWKGVGDAEYIWAFEQVVLPMGREFQPDLVIISSGFDAADGDTVGQCHVTPSCYGHMTHM 362
           P  GVGDAEY+WAFEQVV+PMGREF+PDLVIISSGFDAADGDT+GQCHVTPSCYGHMTHM
Sbjct: 302 PVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTHM 361

Query: 363 LKSLARGNICAVLEGGYSLDSIAKSALGVAKVLIGEPPDELP-VVKQPKPEAVEVIDAVI 421
           LKSLARGN+C VLEGGY+LD+IA+SAL VAKVLIGEPPDELP  +  PKPE +E+ID VI
Sbjct: 362 LKSLARGNLCVVLEGGYNLDAIARSALSVAKVLIGEPPDELPDPLSDPKPEVIEMIDKVI 421

Query: 422 KMQSRYWQCFKSTHANDGCSFKEPVTETLLNRNFPLQTAIRQQQVRLLTTEYNFVTLPLI 481
           ++QS+YW CF+  HAN GC+F EP+ ++++++NFPLQ AIRQQQ   L+ E+NFVTLPL+
Sbjct: 422 RLQSKYWNCFRRRHANSGCNFNEPINDSIISKNFPLQKAIRQQQQHYLSDEFNFVTLPLV 481

Query: 482 KKELPDDTALCSPNIYDSQSIIVCVHDTPEIWAQRSRATGTIDPSTSIIVDTTLDVIKWA 541
             +LPD+T LC+PNI +S +II+ VHDT +IWA+R+  +GTID S+S+I+D +LD IKW 
Sbjct: 482 SMDLPDNTVLCTPNISESNTIIIVVHDTSDIWAKRNVISGTIDLSSSVIIDNSLDFIKWG 541

Query: 542 SKRNYGVIDINIPQSLHEQDNYSAVLTAQEVLVYIWDSYLKYFTSLSKVAFVSIGDAYSG 601
             R YG+ID+NIP +L E DNYS ++T+QEVL+Y+WD+Y+KYF S++K+AF+ IGD+YSG
Sbjct: 542 LDRKYGIIDVNIPLTLFEPDNYSGMITSQEVLIYLWDNYIKYFPSVAKIAFIGIGDSYSG 601

Query: 602 VVHLLGHRDTRNVVKAAISFIDQRPLRPLVPLVDESLADWYFKNSLVFASAGHTCWGNDG 661
           +VHLLGHRDTR V K  I+F+  + L+PLVPLVDE+L++WYFKNSL+F++  H CW  + 
Sbjct: 602 IVHLLGHRDTRAVTKTVINFLGDKQLKPLVPLVDETLSEWYFKNSLIFSNNSHQCWKEN- 660

Query: 662 AENKKPRKKFGRVLKCNSDGLNNILEERFEEATDFILDTFEEWSDSE 708
            E++KPRKKFGRVL+C++DGLNNI+EERFEEATDFILD+FEEWSD E
Sbjct: 661 -ESRKPRKKFGRVLRCDTDGLNNIIEERFEEATDFILDSFEEWSDEE 706

>ADL216C Chr4 complement(324197..326314) [2118 bp, 705 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL021W
           (HDA1)
          Length = 705

 Score = 1102 bits (2850), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 522/687 (75%), Positives = 591/687 (86%), Gaps = 8/687 (1%)

Query: 30  EENGGSETK----VKRPVIVPACRAKLHYTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHP 85
           E NGG  ++     KRPVIVP  R K+ Y PLKTGLCYDVRMRYHAKIFTSYFEYIDPHP
Sbjct: 19  EANGGQASRKAIVQKRPVIVPPVRPKISYVPLKTGLCYDVRMRYHAKIFTSYFEYIDPHP 78

Query: 86  EDPRRIYRIYKILAENGLIIDPTLSGVDDIGDLMLKIPAREATDEEILQVHTPEHLEFLS 145
           EDPRRIYRIYKILAENGLI DPTLSG+D+IG+LM KIP REAT+EEIL VH+ EH+EFL 
Sbjct: 79  EDPRRIYRIYKILAENGLIEDPTLSGIDEIGELMQKIPVREATEEEILTVHSKEHVEFLK 138

Query: 146 KTTSMTREQLLKETEKGDSVYFNNDSYLSAKLSCGGAIEACRAVVEGRVKNALAVVRPPG 205
            T +M REQLLKETE GDSVY+NNDS +SA+LSCGGAIEAC+AVVEGRVKNA+AVVRPPG
Sbjct: 139 TTNTMDREQLLKETEAGDSVYYNNDSLISARLSCGGAIEACKAVVEGRVKNAMAVVRPPG 198

Query: 206 HHAEPDLAGGFCLFSNVAVAAQNILKNYPESVKKIMILDWDVHHGNGTQKAFYNDDRVLY 265
           HHAEP +AGGFCLFSNVAVAAQNILKNYPESV+++MILDWD+HHGNGTQKAFY D+RVLY
Sbjct: 199 HHAEPGVAGGFCLFSNVAVAAQNILKNYPESVRRVMILDWDIHHGNGTQKAFYGDNRVLY 258

Query: 266 VSLHRHELGKYYPGTIHGNADRVGEGKGEGFNCNIPWPWKGVGDAEYIWAFEQVVLPMGR 325
           VSLHR+ELGKYYPGT +GN D+ G+GKGEGFNCNIPW   GVGDAEY+WAFEQVV+PMGR
Sbjct: 259 VSLHRYELGKYYPGTSYGNYDQCGDGKGEGFNCNIPWSCSGVGDAEYMWAFEQVVIPMGR 318

Query: 326 EFQPDLVIISSGFDAADGDTVGQCHVTPSCYGHMTHMLKSLARGNICAVLEGGYSLDSIA 385
           EFQPDLVIISSGFDAADGDT+GQCHV+P+CYGH+THMLKSLARGN+C VLEGGY+LDSIA
Sbjct: 319 EFQPDLVIISSGFDAADGDTIGQCHVSPACYGHLTHMLKSLARGNMCVVLEGGYNLDSIA 378

Query: 386 KSALGVAKVLIGEPPDELPV-VKQPKPEAVEVID-AVIKMQSRYWQCFKSTHANDGCSFK 443
           KSALGVAKVLIGEPPDELP  +KQPKPEA+  ID  ++K QS+YW CFK  H NDG +++
Sbjct: 379 KSALGVAKVLIGEPPDELPQPLKQPKPEAIVTIDMGLVKEQSKYWNCFKGRHGNDGINWR 438

Query: 444 E-PVTETLLNRNFPLQTAIR-QQQVRLLTTEYNFVTLPLIKKELPDDTALCSPNIYDSQS 501
           E  V ++L ++NFPLQ       Q R L  EY FVTLPL+  ELP DT +CSPNI+ + +
Sbjct: 439 EGAVNDSLTSKNFPLQKCCSPTTQFRRLAKEYKFVTLPLLNMELPSDTIICSPNIHTTDA 498

Query: 502 IIVCVHDTPEIWAQRSRATGTIDPSTSIIVDTTLDVIKWASKRNYGVIDINIPQSLHEQD 561
           II+CVHDTPEIWAQR   TG IDPSTSIIVDTT+ VI WA  RNYGVIDINIPQSL EQD
Sbjct: 499 IIICVHDTPEIWAQRDSLTGHIDPSTSIIVDTTVSVINWALGRNYGVIDINIPQSLFEQD 558

Query: 562 NYSAVLTAQEVLVYIWDSYLKYFTSLSKVAFVSIGDAYSGVVHLLGHRDTRNVVKAAISF 621
           NYSAVL++QEV+ Y+WDSYLK F  L++VAFV IGDAYSG VHLLGHRDTR+VVK AI+F
Sbjct: 559 NYSAVLSSQEVVTYLWDSYLKTFPHLARVAFVGIGDAYSGFVHLLGHRDTRSVVKCAIAF 618

Query: 622 IDQRPLRPLVPLVDESLADWYFKNSLVFASAGHTCWGNDGAENKKPRKKFGRVLKCNSDG 681
            D++ LRPLVPLVDESL DWYFKNSLVF S  H CWG DG ++KKPRKKFGRVL+   DG
Sbjct: 619 ADKKQLRPLVPLVDESLGDWYFKNSLVFTSTYHPCWGTDGNDSKKPRKKFGRVLRWTCDG 678

Query: 682 LNNILEERFEEATDFILDTFEEWSDSE 708
           +NNI+EER EEATDFILD+FEEWS+SE
Sbjct: 679 MNNIVEERLEEATDFILDSFEEWSESE 705

>Skud_14.308 Chr14 (563902..566022) [2121 bp, 706 aa] {ON} YNL021W
           (REAL)
          Length = 706

 Score = 1101 bits (2848), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 497/707 (70%), Positives = 607/707 (85%), Gaps = 3/707 (0%)

Query: 3   EAVGIKQEDSLKQENGFKRDAENALLEEENGGSETKVKRPVIVPACRAKLHYTPLKTGLC 62
           ++  +K E     ++  KR  EN   ++ +  + ++ KR VIVPAC  K+HY+PLKTGLC
Sbjct: 2   DSARVKNEVLENPDHDLKRTLENTKEDQNSLSTTSRNKRQVIVPACTPKIHYSPLKTGLC 61

Query: 63  YDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIIDPTLSGVDDIGDLMLKI 122
           YDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLI DPTLSGVDDIGDLMLKI
Sbjct: 62  YDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDDIGDLMLKI 121

Query: 123 PAREATDEEILQVHTPEHLEFLSKTTSMTREQLLKETEKGDSVYFNNDSYLSAKLSCGGA 182
           P R AT EEIL+VHT EHLEF+  T  M+REQLLKETEKGDSVYFNNDSY SA+L CGGA
Sbjct: 122 PVRAATSEEILEVHTKEHLEFIESTEKMSREQLLKETEKGDSVYFNNDSYASARLPCGGA 181

Query: 183 IEACRAVVEGRVKNALAVVRPPGHHAEPDLAGGFCLFSNVAVAAQNILKNYPESVKKIMI 242
           IEAC+AVVEGRVKN+LAVVRPPGHHAEP  AGGFCLFSNVAVAA+NILKNYPESV++IMI
Sbjct: 182 IEACKAVVEGRVKNSLAVVRPPGHHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIMI 241

Query: 243 LDWDVHHGNGTQKAFYNDDRVLYVSLHRHELGKYYPGTIHGNADRVGEGKGEGFNCNIPW 302
           LDWD+HHGNGTQK+FY DD+VLYVSLHR E+GKYYPGTI G  D+ GEGKGEGFNCNI W
Sbjct: 242 LDWDIHHGNGTQKSFYQDDQVLYVSLHRFEMGKYYPGTIQGQYDQTGEGKGEGFNCNITW 301

Query: 303 PWKGVGDAEYIWAFEQVVLPMGREFQPDLVIISSGFDAADGDTVGQCHVTPSCYGHMTHM 362
           P  GVGDAEY+WAFEQVV+PMGREF+PDLVIISSGFDAADGDT+GQCHV+PSCYGHMTHM
Sbjct: 302 PVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTIGQCHVSPSCYGHMTHM 361

Query: 363 LKSLARGNICAVLEGGYSLDSIAKSALGVAKVLIGEPPDELP-VVKQPKPEAVEVIDAVI 421
           LKSLARGN+C VLEGGY+LD+IA+SAL VAKVLIGEPPDELP  +  PKPE +E+ID VI
Sbjct: 362 LKSLARGNLCVVLEGGYNLDAIARSALSVAKVLIGEPPDELPDSLSDPKPEVIEMIDKVI 421

Query: 422 KMQSRYWQCFKSTHANDGCSFKEPVTETLLNRNFPLQTAIRQQQVRLLTTEYNFVTLPLI 481
           ++QS+YW CF+  HAN GC+F EP+ ++++++NFPLQ AIRQQQ++ L+ E++FVTLPLI
Sbjct: 422 RLQSKYWNCFRRRHANSGCNFNEPINDSIISKNFPLQKAIRQQQLQYLSNEFSFVTLPLI 481

Query: 482 KKELPDDTALCSPNIYDSQSIIVCVHDTPEIWAQRSRATGTIDPSTSIIVDTTLDVIKWA 541
              LPD+TALC+PN+++S +++V VHDT ++WA+R+  +GTID S+S+I+D  +D IKW 
Sbjct: 482 NMGLPDNTALCTPNVFESNALLVVVHDTSDVWAKRNVISGTIDLSSSVIIDNCIDFIKWG 541

Query: 542 SKRNYGVIDINIPQSLHEQDNYSAVLTAQEVLVYIWDSYLKYFTSLSKVAFVSIGDAYSG 601
             R YG+ID+NIP +L E DNYS ++T+QEVL+Y+WD+Y+KYF +++K+AF+ IGD++SG
Sbjct: 542 LDRKYGIIDVNIPLTLFEADNYSGMITSQEVLIYLWDNYIKYFPNVAKIAFIGIGDSHSG 601

Query: 602 VVHLLGHRDTRNVVKAAISFIDQRPLRPLVPLVDESLADWYFKNSLVFASAGHTCWGNDG 661
           +VHLLGHRDTR V K  I+F+  + L+PLVPLVDE+L++WYFKNSL+F++  H CW  + 
Sbjct: 602 IVHLLGHRDTRAVTKTVINFLGDKQLKPLVPLVDETLSEWYFKNSLIFSNNSHQCWKEN- 660

Query: 662 AENKKPRKKFGRVLKCNSDGLNNILEERFEEATDFILDTFEEWSDSE 708
            E++KPRKKFGRVL+C++DGL+N +EERFEEATDFILD+FEEWSD E
Sbjct: 661 -ESRKPRKKFGRVLRCDTDGLSNTIEERFEEATDFILDSFEEWSDDE 706

>Smik_14.310 Chr14 (555609..557729) [2121 bp, 706 aa] {ON} YNL021W
           (REAL)
          Length = 706

 Score = 1101 bits (2848), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 502/703 (71%), Positives = 599/703 (85%), Gaps = 3/703 (0%)

Query: 7   IKQEDSLKQENGFKRDAENALLEEENGGSETKVKRPVIVPACRAKLHYTPLKTGLCYDVR 66
           +K+E     +   KR  E    ++ +  + +  KR VIVPAC  K+HY+PLKTGLCYDVR
Sbjct: 6   VKKEAWENPDGNLKRRLEETKEDQNSLSTTSNNKRQVIVPACTPKIHYSPLKTGLCYDVR 65

Query: 67  MRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIIDPTLSGVDDIGDLMLKIPARE 126
           MRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLI DPTLSGVDD+GDLMLKIP R 
Sbjct: 66  MRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDDLGDLMLKIPVRA 125

Query: 127 ATDEEILQVHTPEHLEFLSKTTSMTREQLLKETEKGDSVYFNNDSYLSAKLSCGGAIEAC 186
           AT EEIL+VHT EHLEF+  T  M+REQLLKETEKGDSVYFNNDSY SA+L CGGAIEAC
Sbjct: 126 ATSEEILEVHTKEHLEFIESTEKMSREQLLKETEKGDSVYFNNDSYASARLPCGGAIEAC 185

Query: 187 RAVVEGRVKNALAVVRPPGHHAEPDLAGGFCLFSNVAVAAQNILKNYPESVKKIMILDWD 246
           +AVVEGRVKN+LAVVRPPGHHAEP  AGGFCLFSNVAVAA+NILKNYPESV++IMILDWD
Sbjct: 186 KAVVEGRVKNSLAVVRPPGHHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIMILDWD 245

Query: 247 VHHGNGTQKAFYNDDRVLYVSLHRHELGKYYPGTIHGNADRVGEGKGEGFNCNIPWPWKG 306
           +HHGNGTQK+FY DD+VLYVSLHR E+GKYYPGTI G  D+ GEGKGEGFNCNI WP  G
Sbjct: 246 IHHGNGTQKSFYQDDQVLYVSLHRFEMGKYYPGTIQGQYDQAGEGKGEGFNCNITWPVGG 305

Query: 307 VGDAEYIWAFEQVVLPMGREFQPDLVIISSGFDAADGDTVGQCHVTPSCYGHMTHMLKSL 366
           VGDAEY+WAFEQVV+PMGREF+PDLVIISSGFDAADGDT+GQCHVTPSCYGHMTHMLKSL
Sbjct: 306 VGDAEYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTHMLKSL 365

Query: 367 ARGNICAVLEGGYSLDSIAKSALGVAKVLIGEPPDELP-VVKQPKPEAVEVIDAVIKMQS 425
           ARGN+C VLEGGY+LD+IA+SAL VAKVLIGEPPDELP     PKPE +E+ID VI++QS
Sbjct: 366 ARGNLCVVLEGGYNLDAIARSALSVAKVLIGEPPDELPDSSSDPKPEVIEMIDKVIRLQS 425

Query: 426 RYWQCFKSTHANDGCSFKEPVTETLLNRNFPLQTAIRQQQVRLLTTEYNFVTLPLIKKEL 485
           +YW CF+  HAN GC+F EP+ ++++++NFPLQ AIRQQQ   L+ E+N VTLPLI  +L
Sbjct: 426 KYWNCFRRRHANSGCNFNEPINDSIVSKNFPLQKAIRQQQQHYLSDEFNLVTLPLINMDL 485

Query: 486 PDDTALCSPNIYDSQSIIVCVHDTPEIWAQRSRATGTIDPSTSIIVDTTLDVIKWASKRN 545
           PD+T LC+PN+Y+S +++V VHDT +IWA+R+  +GTID S+S+I+D  LD IKW   R 
Sbjct: 486 PDNTVLCTPNVYESTTLLVVVHDTSDIWAKRNVISGTIDLSSSVIIDNCLDFIKWGLDRK 545

Query: 546 YGVIDINIPQSLHEQDNYSAVLTAQEVLVYIWDSYLKYFTSLSKVAFVSIGDAYSGVVHL 605
           YG+ID+NIP SL E DNYS ++T+QEVL+Y+WD+Y+KYF +++K+AFV IGD+YSG+VHL
Sbjct: 546 YGIIDVNIPLSLFEPDNYSGMITSQEVLIYLWDNYIKYFPAVAKIAFVGIGDSYSGIVHL 605

Query: 606 LGHRDTRNVVKAAISFIDQRPLRPLVPLVDESLADWYFKNSLVFASAGHTCWGNDGAENK 665
           LGHRDTR V K  I+F+  + L+PLVPLVDE+L++WYFKNSL+F++  H CW  +  E++
Sbjct: 606 LGHRDTRAVTKTVINFLGDKQLKPLVPLVDETLSEWYFKNSLIFSNNSHQCWKEN--ESR 663

Query: 666 KPRKKFGRVLKCNSDGLNNILEERFEEATDFILDTFEEWSDSE 708
           KPRKKFGRVL+C++DGLNN +EERFEEATDFILD+FEEWSD E
Sbjct: 664 KPRKKFGRVLRCDTDGLNNTIEERFEEATDFILDSFEEWSDEE 706

>TDEL0G02160 Chr7 complement(424838..426982) [2145 bp, 714 aa] {ON}
           Anc_2.285 YNL021W
          Length = 714

 Score = 1099 bits (2842), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 509/697 (73%), Positives = 595/697 (85%), Gaps = 7/697 (1%)

Query: 13  LKQENGFKRDAENALLEEENGGSETKVKRPVIVPACRAKLHYTPLKTGLCYDVRMRYHAK 72
           ++++N      ++ L   +NG +  +V    IVPAC   LHYTPLKT LCYDVRMRYHAK
Sbjct: 24  MEEQNDGLDPKKSQLARTQNGAAGKRV----IVPACAPNLHYTPLKTALCYDVRMRYHAK 79

Query: 73  IFTSYFEYIDPHPEDPRRIYRIYKILAENGLIIDPTLSGVDDIGDLMLKIPAREATDEEI 132
           IFTSYFEYIDPHPEDPRRIYR+YKILAENGLI DPTLSG+D+IGDLMLKIP REATDEEI
Sbjct: 80  IFTSYFEYIDPHPEDPRRIYRVYKILAENGLINDPTLSGIDEIGDLMLKIPVREATDEEI 139

Query: 133 LQVHTPEHLEFLSKTTSMTREQLLKETEKGDSVYFNNDSYLSAKLSCGGAIEACRAVVEG 192
           L+VH+ E+LEF+ +++ M RE+LLKETEKGDSVYFNNDSY+SAKLSCGG I+AC+AVVEG
Sbjct: 140 LEVHSKENLEFVERSSRMKREELLKETEKGDSVYFNNDSYVSAKLSCGGVIDACKAVVEG 199

Query: 193 RVKNALAVVRPPGHHAEPDLAGGFCLFSNVAVAAQNILKNYPESVKKIMILDWDVHHGNG 252
           RVKNALAVVRPPGHHAEP+  GGFCLFSNVAVAAQNILK YPESV++I+ILDWD+HHGNG
Sbjct: 200 RVKNALAVVRPPGHHAEPEAPGGFCLFSNVAVAAQNILKQYPESVRRILILDWDIHHGNG 259

Query: 253 TQKAFYNDDRVLYVSLHRHELGKYYPGTIHGNADRVGEGKGEGFNCNIPWPWKGVGDAEY 312
           TQKAFYND RVLY+SLHR E+GKYYPGTI+G  D+ GEGKGEGFNCNI WP  GVGDAEY
Sbjct: 260 TQKAFYNDPRVLYISLHRFEMGKYYPGTINGRYDQTGEGKGEGFNCNITWPVGGVGDAEY 319

Query: 313 IWAFEQVVLPMGREFQPDLVIISSGFDAADGDTVGQCHVTPSCYGHMTHMLKSLARGNIC 372
           + AFEQ+V+PM REFQPDLVIISSGFDAADGDT+GQCHVTPSCYG MTHMLKSLARGN+C
Sbjct: 320 MLAFEQIVMPMAREFQPDLVIISSGFDAADGDTIGQCHVTPSCYGQMTHMLKSLARGNLC 379

Query: 373 AVLEGGYSLDSIAKSALGVAKVLIGEPPDELP-VVKQPKPEAVEVIDAVIKMQSRYWQCF 431
             LEGGY+LD+IA SAL VAKVLIGEPPDELP   K PK EA+E+ID VI  QS+YW+CF
Sbjct: 380 VALEGGYNLDAIAISALSVAKVLIGEPPDELPDPTKDPKLEAIEMIDTVIHTQSKYWKCF 439

Query: 432 KSTHANDGCSFKEPVTETLLNRNFPLQTAIRQQQVRLLTTEYNFVTLPLIKKELPDDTAL 491
           +    N GC+F EPVTET+++++FPLQTAIRQ+Q R L+ EY FVTLP+ K E+PDD+ L
Sbjct: 440 QRKFGNAGCNFSEPVTETVISKSFPLQTAIRQEQFRQLSKEYGFVTLPISKLEIPDDSVL 499

Query: 492 CSPNIYDSQSIIVCVHDTPEIWAQRSRATGTIDPSTSIIVDTTLDVIKWASKRNYGVIDI 551
           CSP ++   +I++ VHDTPEIWA+R   TG IDPSTSIIVD+ LD  KW   R YGVID+
Sbjct: 500 CSPEVFQQSTIVIIVHDTPEIWAKRDVITGVIDPSTSIIVDSPLDFTKWCMNRKYGVIDV 559

Query: 552 NIPQSLHEQDNYSAVLTAQEVLVYIWDSYLKYFTSLSKVAFVSIGDAYSGVVHLLGHRDT 611
           NIPQSL EQDNYSA++T+QEVL+YIWD+Y+KYF SL+KVAFV  GDAY+G+VHLLGHRDT
Sbjct: 560 NIPQSLFEQDNYSAMITSQEVLLYIWDNYIKYFPSLAKVAFVGFGDAYAGIVHLLGHRDT 619

Query: 612 RNVVKAAISFIDQRPLRPLVPLVDESLADWYFKNSLVFASAGHTCWGNDGAENKKPRKKF 671
           R  VKA +SFI ++ L+PLVPLVDESL+DWYFKNSL+F    H CW ++  E+KKPRKKF
Sbjct: 620 RATVKAVVSFIGRKQLKPLVPLVDESLSDWYFKNSLIFTDKNHPCWADN--ESKKPRKKF 677

Query: 672 GRVLKCNSDGLNNILEERFEEATDFILDTFEEWSDSE 708
           GRVL+C++DGLN+ +EERFEEATDFILD FEEWSDSE
Sbjct: 678 GRVLRCDTDGLNSNMEERFEEATDFILDLFEEWSDSE 714

>Suva_14.326 Chr14 (576098..578218) [2121 bp, 706 aa] {ON} YNL021W
           (REAL)
          Length = 706

 Score = 1095 bits (2833), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 497/685 (72%), Positives = 592/685 (86%), Gaps = 4/685 (0%)

Query: 26  ALLEEENGGSET-KVKRPVIVPACRAKLHYTPLKTGLCYDVRMRYHAKIFTSYFEYIDPH 84
            + EE+N  S T K KR VIVPAC  KLHYTPL+TGLCYDVRMRYHAKIFTSYFEYIDPH
Sbjct: 24  GMKEEQNSLSTTSKNKRQVIVPACTPKLHYTPLRTGLCYDVRMRYHAKIFTSYFEYIDPH 83

Query: 85  PEDPRRIYRIYKILAENGLIIDPTLSGVDDIGDLMLKIPAREATDEEILQVHTPEHLEFL 144
           PEDPRRIYRIYKILAENGLI DPTLSGVDD+GDLMLKIP R AT EEIL+VHT EHLEF+
Sbjct: 84  PEDPRRIYRIYKILAENGLINDPTLSGVDDLGDLMLKIPVRAATSEEILEVHTKEHLEFI 143

Query: 145 SKTTSMTREQLLKETEKGDSVYFNNDSYLSAKLSCGGAIEACRAVVEGRVKNALAVVRPP 204
             T  M+REQLLKETEKGDSVYFNNDSY SA+L CGGAIEAC+AVVEGRVKN+LAVVRPP
Sbjct: 144 ESTEKMSREQLLKETEKGDSVYFNNDSYASARLPCGGAIEACKAVVEGRVKNSLAVVRPP 203

Query: 205 GHHAEPDLAGGFCLFSNVAVAAQNILKNYPESVKKIMILDWDVHHGNGTQKAFYNDDRVL 264
           GHHAEP  AGGFCLFSNVAVAA+NILKNYPESV++IMILDWD+HHGNGTQK+FY DD+VL
Sbjct: 204 GHHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIMILDWDIHHGNGTQKSFYQDDQVL 263

Query: 265 YVSLHRHELGKYYPGTIHGNADRVGEGKGEGFNCNIPWPWKGVGDAEYIWAFEQVVLPMG 324
           Y+SLHR E+GKYYPGTI G  D+ GEGKGEGFNCNI WP  GVGDAEY+WAFEQVV+PMG
Sbjct: 264 YISLHRFEIGKYYPGTIQGQYDQTGEGKGEGFNCNITWPVGGVGDAEYMWAFEQVVMPMG 323

Query: 325 REFQPDLVIISSGFDAADGDTVGQCHVTPSCYGHMTHMLKSLARGNICAVLEGGYSLDSI 384
           REF+PDLVIISSGFDAADGDT+GQCHVTPSCYGHMTHMLKSLARGN+C VLEGGY+LD+I
Sbjct: 324 REFKPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTHMLKSLARGNLCVVLEGGYNLDAI 383

Query: 385 AKSALGVAKVLIGEPPDELP-VVKQPKPEAVEVIDAVIKMQSRYWQCFKSTHANDGCSFK 443
           A SAL VAKVLIGEPPDELP  +  PKPE +E+ID V+++QS+YW CF+  HAN GC+F 
Sbjct: 384 AISALSVAKVLIGEPPDELPDPLSDPKPEVIEMIDKVVRLQSKYWNCFRRRHANSGCNFN 443

Query: 444 EPVTETLLNRNFPLQTAIRQQQVRLLTTEYNFVTLPLIKKELPDDTALCSPNIYDSQSII 503
           EP+ ++++++NFPLQ AIRQQQ+  L+ E+NFVTLPLI  ELPD+  LC+PN+ +S +++
Sbjct: 444 EPINDSIISKNFPLQKAIRQQQLHYLSDEFNFVTLPLINMELPDNIVLCTPNVSESSTLL 503

Query: 504 VCVHDTPEIWAQRSRATGTIDPSTSIIVDTTLDVIKWASKRNYGVIDINIPQSLHEQDNY 563
           V VHDT ++WA+R+  +GTID S+S+++D  LD IKW   R YG+ID+NIP +L E DNY
Sbjct: 504 VVVHDTSDVWAKRNVISGTIDLSSSVVIDNCLDFIKWGLDRKYGIIDVNIPLTLFEADNY 563

Query: 564 SAVLTAQEVLVYIWDSYLKYFTSLSKVAFVSIGDAYSGVVHLLGHRDTRNVVKAAISFID 623
           S ++T+QEVL+Y+WD+Y+KYF +++K+A++ IGD+YSG+VHLLGHRDTR V K  I+F+ 
Sbjct: 564 SGMITSQEVLIYLWDNYIKYFPAVAKIAYIGIGDSYSGIVHLLGHRDTRAVTKTVINFLG 623

Query: 624 QRPLRPLVPLVDESLADWYFKNSLVFASAGHTCWGNDGAENKKPRKKFGRVLKCNSDGLN 683
            + L+PLVPLVDE+L +WYFKNSLVF +  H CW  +  E++KPRKKFGRVL+C++DGL+
Sbjct: 624 DKQLKPLVPLVDETLTEWYFKNSLVFTNNSHQCWKEN--ESRKPRKKFGRVLRCDTDGLS 681

Query: 684 NILEERFEEATDFILDTFEEWSDSE 708
           N +EERFEEATDFILD+FEEWSD E
Sbjct: 682 NTVEERFEEATDFILDSFEEWSDEE 706

>CAGL0J03454g Chr10 complement(332090..334171) [2082 bp, 693 aa]
           {ON} highly similar to uniprot|P53973 Saccharomyces
           cerevisiae YNL021w HDA1 histone deacetylase A
          Length = 693

 Score = 1092 bits (2825), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 504/698 (72%), Positives = 606/698 (86%), Gaps = 11/698 (1%)

Query: 13  LKQENG-FKRDAENALLEEENGGSETKVKRPVIVPACRAKLHYTPLKTGLCYDVRMRYHA 71
           LKQE G  KR  E+ +  ++       VKRPVIVP  +A++HYTPLKTG+CYDVRMRYHA
Sbjct: 5   LKQEPGESKRKLEDDVASQD-------VKRPVIVPTRKAQIHYTPLKTGICYDVRMRYHA 57

Query: 72  KIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIIDPTLSGVDDIGDLMLKIPAREATDEE 131
           KIFTSYFEYIDPHPEDPRRIYRIYKILAENGLI DPTLSGV+DIGDLMLKIP R AT EE
Sbjct: 58  KIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVNDIGDLMLKIPIRAATAEE 117

Query: 132 ILQVHTPEHLEFLSKTTSMTREQLLKETEKGDSVYFNNDSYLSAKLSCGGAIEACRAVVE 191
           IL+VH+ EHLEF+ KT  M RE+LLKETEKGDSVYFNNDSY +++L CGGAIEAC+AVVE
Sbjct: 118 ILEVHSKEHLEFIEKTEKMNREELLKETEKGDSVYFNNDSYATSRLPCGGAIEACKAVVE 177

Query: 192 GRVKNALAVVRPPGHHAEPDLAGGFCLFSNVAVAAQNILKNYPESVKKIMILDWDVHHGN 251
           GRVKN+LAVVRPPGHHAEP+ AGGFCLFSNVAVAA+NILKNYPESV++I+ILDWDVHHGN
Sbjct: 178 GRVKNSLAVVRPPGHHAEPEAAGGFCLFSNVAVAAKNILKNYPESVRRILILDWDVHHGN 237

Query: 252 GTQKAFYNDDRVLYVSLHRHELGKYYPGTIHGNADRVGEGKGEGFNCNIPWPWKGVGDAE 311
           GTQKAFY+DDRVLY+SLHR ELGKYYPGTI G  D++GEGKG+GFNCNI WP  GVGDAE
Sbjct: 238 GTQKAFYDDDRVLYISLHRFELGKYYPGTIQGQYDQIGEGKGKGFNCNITWPVGGVGDAE 297

Query: 312 YIWAFEQVVLPMGREFQPDLVIISSGFDAADGDTVGQCHVTPSCYGHMTHMLKSLARGNI 371
           Y+WAFEQVV+PMGREFQPDLVIISSGFDAADGDT+GQCHVTPSCYGHMTHMLKSLARGN+
Sbjct: 298 YMWAFEQVVMPMGREFQPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTHMLKSLARGNL 357

Query: 372 CAVLEGGYSLDSIAKSALGVAKVLIGEPPDELP-VVKQPKPEAVEVIDAVIKMQSRYWQC 430
           C VLEGGY+LD+IA SAL VAK+LIGEPPDELP  +++PK EA+E+ID VI +QS+YW+C
Sbjct: 358 CVVLEGGYNLDAIAISALSVAKILIGEPPDELPDPLREPKAEALEIIDKVISLQSKYWKC 417

Query: 431 FKSTHANDGCSFKEPVTETLLNRNFPLQTAIRQQQVRLLTTEYNFVTLPLIKKELPDDTA 490
           F   + N G   +  V   +++++FPLQTAIRQ+Q   L+ ++ FVTLPL+  E+P D+ 
Sbjct: 418 FGKRYGNLGLPSENVVKALMMSKSFPLQTAIRQEQFHQLSEDFGFVTLPLLNMEVPQDSV 477

Query: 491 LCSPNIYDSQSIIVCVHDTPEIWAQRSRATGTIDPSTSIIVDTTLDVIKWASKRNYGVID 550
           +CSPN+++  +I+V VHDTPEIWA+R+  TGTIDPSTS++VD+  + IKW  +R YG++D
Sbjct: 478 ICSPNLFNETTILVVVHDTPEIWAKRNVITGTIDPSTSLVVDSGAEFIKWGLERKYGIMD 537

Query: 551 INIPQSLHEQDNYSAVLTAQEVLVYIWDSYLKYFTSLSKVAFVSIGDAYSGVVHLLGHRD 610
           INIPQSL EQ+NY+AVLT+QE+L+YIWD+YLK+F SL+KVAF+ IGDA +G+VHLLGHRD
Sbjct: 538 INIPQSLFEQENYTAVLTSQEILIYIWDNYLKFFPSLTKVAFIGIGDASAGIVHLLGHRD 597

Query: 611 TRNVVKAAISFIDQRPLRPLVPLVDESLADWYFKNSLVFASAGHTCWGNDGAENKKPRKK 670
           TR+VVK+ +SFI ++ L+PLVPLV+ESL DWYFKNSLVF    H+CWG++  EN+KPRKK
Sbjct: 598 TRSVVKSVVSFIGKKSLKPLVPLVNESLGDWYFKNSLVFTDHSHSCWGDN--ENRKPRKK 655

Query: 671 FGRVLKCNSDGLNNILEERFEEATDFILDTFEEWSDSE 708
           FGRVL+C+++G+NNI+EER EE+TDFILD+FEEWSDSE
Sbjct: 656 FGRVLRCDAEGMNNIIEERLEESTDFILDSFEEWSDSE 693

>KNAG0H02010 Chr8 (354923..357004) [2082 bp, 693 aa] {ON} Anc_2.285
           YNL021W
          Length = 693

 Score = 1083 bits (2800), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 491/675 (72%), Positives = 580/675 (85%), Gaps = 1/675 (0%)

Query: 35  SETKVKRPVIVPACRAKLHYTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRI 94
           S T  KR +IV  C  KL YTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRI
Sbjct: 19  SSTHSKRQMIVAPCAPKLRYTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRI 78

Query: 95  YKILAENGLIIDPTLSGVDDIGDLMLKIPAREATDEEILQVHTPEHLEFLSKTTSMTREQ 154
           YKILAENGLI DP LSG+DDIGDLMLKIP REAT +E+L+VH+ EHLEF+   T M+ ++
Sbjct: 79  YKILAENGLITDPMLSGIDDIGDLMLKIPVREATSQEVLEVHSKEHLEFIESVTKMSHDE 138

Query: 155 LLKETEKGDSVYFNNDSYLSAKLSCGGAIEACRAVVEGRVKNALAVVRPPGHHAEPDLAG 214
           LLK TE GDSVYFNNDS  SAKLSCGGAIEAC+AVVEGRVKNA AVVRPPGHH+EP+ AG
Sbjct: 139 LLKSTETGDSVYFNNDSSSSAKLSCGGAIEACKAVVEGRVKNAFAVVRPPGHHSEPESAG 198

Query: 215 GFCLFSNVAVAAQNILKNYPESVKKIMILDWDVHHGNGTQKAFYNDDRVLYVSLHRHELG 274
           GFCLFSNVAVA++NIL+NYPESV++IMILDWD+HHGNGTQKAFY+DDRVLY+SLHR ELG
Sbjct: 199 GFCLFSNVAVASKNILRNYPESVRRIMILDWDIHHGNGTQKAFYDDDRVLYISLHRFELG 258

Query: 275 KYYPGTIHGNADRVGEGKGEGFNCNIPWPWKGVGDAEYIWAFEQVVLPMGREFQPDLVII 334
           KYYPGT  G+ D+ GEGKGEGFNCNI WP  GVGDAEY+WAFEQVV+PM REF+PDLVII
Sbjct: 259 KYYPGTAQGHYDKTGEGKGEGFNCNITWPVGGVGDAEYMWAFEQVVMPMSREFRPDLVII 318

Query: 335 SSGFDAADGDTVGQCHVTPSCYGHMTHMLKSLARGNICAVLEGGYSLDSIAKSALGVAKV 394
           S+GFDAADGDT+GQCHV+PSCYGHMTHMLKSLA GN+C VLEGGY+LD+IA+SAL VAKV
Sbjct: 319 SAGFDAADGDTIGQCHVSPSCYGHMTHMLKSLANGNLCVVLEGGYNLDAIARSALSVAKV 378

Query: 395 LIGEPPDE-LPVVKQPKPEAVEVIDAVIKMQSRYWQCFKSTHANDGCSFKEPVTETLLNR 453
           LIGEPP+E L  VK PKPEA+E+I+ VI++QS+YW+CF+  H N GC+F++ +TE++   
Sbjct: 379 LIGEPPEELLDPVKDPKPEAIEIINKVIRLQSKYWKCFQRRHGNSGCTFEKHMTESISTD 438

Query: 454 NFPLQTAIRQQQVRLLTTEYNFVTLPLIKKELPDDTALCSPNIYDSQSIIVCVHDTPEIW 513
           NFPLQ+AIRQQQ   L+ E+ FV  PL + +L DDT +CSP +Y+  +II+ V DTPEIW
Sbjct: 439 NFPLQSAIRQQQFSALSKEFGFVKFPLFEMKLSDDTVICSPEVYNKDTIIILVRDTPEIW 498

Query: 514 AQRSRATGTIDPSTSIIVDTTLDVIKWASKRNYGVIDINIPQSLHEQDNYSAVLTAQEVL 573
           A+R    GTIDPS SII D  L  IKWA +RNYGVID+NIPQSL EQDNYSA++TAQEV+
Sbjct: 499 AKRDVIQGTIDPSASIITDAALAFIKWAMERNYGVIDVNIPQSLFEQDNYSAMITAQEVM 558

Query: 574 VYIWDSYLKYFTSLSKVAFVSIGDAYSGVVHLLGHRDTRNVVKAAISFIDQRPLRPLVPL 633
            ++WD+Y+++F S SK+AFV +GDA SG+VHLLGHRDTR+ VK+ I+FI Q+ L+PL+PL
Sbjct: 559 SFMWDNYIRFFGSASKIAFVGVGDACSGIVHLLGHRDTRSKVKSVINFIAQKTLKPLIPL 618

Query: 634 VDESLADWYFKNSLVFASAGHTCWGNDGAENKKPRKKFGRVLKCNSDGLNNILEERFEEA 693
           VDE+L DWYFKNSLVF+   H CWG++  ENKKPRKKFGRVL+CNSDGL NI+EERFEEA
Sbjct: 619 VDETLGDWYFKNSLVFSDKNHACWGDNENENKKPRKKFGRVLRCNSDGLTNIIEERFEEA 678

Query: 694 TDFILDTFEEWSDSE 708
           TDF+LD+FEEWS+S+
Sbjct: 679 TDFMLDSFEEWSESD 693

>KLLA0E08383g Chr5 (754048..756162) [2115 bp, 704 aa] {ON} highly
           similar to uniprot|P53973 Saccharomyces cerevisiae
           YNL021W HDA1 Putative catalytic subunit of a class II
           histone deacetylase complex that also contains Hda2p and
           Hda3p Hda1p interacts with the Hda2p-Hda3p subcomplex to
           form an active tetramer deletion increases histone H2B
           H3 and H4 acetylation
          Length = 704

 Score = 1078 bits (2788), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 488/675 (72%), Positives = 585/675 (86%), Gaps = 1/675 (0%)

Query: 35  SETKVKRPVIVPACRAKLHYTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRI 94
           S+ + +RPVIVP  + K+ Y+ LKTG+CYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYR+
Sbjct: 30  SKDESQRPVIVPPTKPKIRYSLLKTGICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRV 89

Query: 95  YKILAENGLIIDPTLSGVDDIGDLMLKIPAREATDEEILQVHTPEHLEFLSKTTSMTREQ 154
           YKILAENGLI DPTLSG D IGDLM+K+P REA +EEILQVH+ +HL+F+S+T  + RE 
Sbjct: 90  YKILAENGLIQDPTLSGADSIGDLMVKVPVREAEEEEILQVHSRQHLDFISQTEQLERES 149

Query: 155 LLKETEKGDSVYFNNDSYLSAKLSCGGAIEACRAVVEGRVKNALAVVRPPGHHAEPDLAG 214
           LLKETE GDSVYFNNDSYLSAKLSCGGAIEAC+AVVEGRVKN++AVVRPPGHHAEP++AG
Sbjct: 150 LLKETEGGDSVYFNNDSYLSAKLSCGGAIEACKAVVEGRVKNSIAVVRPPGHHAEPEIAG 209

Query: 215 GFCLFSNVAVAAQNILKNYPESVKKIMILDWDVHHGNGTQKAFYNDDRVLYVSLHRHELG 274
           GFCLFSNVAVAA N+LK+YPESV+KIMI+DWD+HHGNGTQKAFY+DDRVLYVSLHR++LG
Sbjct: 210 GFCLFSNVAVAAANMLKSYPESVRKIMIVDWDIHHGNGTQKAFYDDDRVLYVSLHRYQLG 269

Query: 275 KYYPGTIHGNADRVGEGKGEGFNCNIPWPWKGVGDAEYIWAFEQVVLPMGREFQPDLVII 334
           KYYPGTIHGN D+ GEGKGEGFNCNI WP  GVGDAEY+WAFEQV++PMGREF+PDLV+I
Sbjct: 270 KYYPGTIHGNYDQTGEGKGEGFNCNITWPTGGVGDAEYMWAFEQVIMPMGREFEPDLVLI 329

Query: 335 SSGFDAADGDTVGQCHVTPSCYGHMTHMLKSLARGNICAVLEGGYSLDSIAKSALGVAKV 394
           SSGFDAADGDT+GQCHVTP+CYGHMTHML SLA+GN+C VLEGGY+LDSIAKSALGV KV
Sbjct: 330 SSGFDAADGDTIGQCHVTPACYGHMTHMLLSLAKGNLCVVLEGGYNLDSIAKSALGVCKV 389

Query: 395 LIGEPPDELPV-VKQPKPEAVEVIDAVIKMQSRYWQCFKSTHANDGCSFKEPVTETLLNR 453
           L+GEPPDELP   KQP PEA ++I+ VI+ QS+YW CFK+ H NDG +FK+ +T TL  R
Sbjct: 390 LVGEPPDELPAPKKQPTPEAKKMIETVIRTQSKYWSCFKNRHGNDGINFKDAITSTLDTR 449

Query: 454 NFPLQTAIRQQQVRLLTTEYNFVTLPLIKKELPDDTALCSPNIYDSQSIIVCVHDTPEIW 513
           NFPLQ AIR+ QV  L++++NFV LP++   LP +T LC+  I DS++++V VHDTPEIW
Sbjct: 450 NFPLQNAIREYQVSQLSSQFNFVQLPILDLNLPANTMLCTSGIQDSETLVVIVHDTPEIW 509

Query: 514 AQRSRATGTIDPSTSIIVDTTLDVIKWASKRNYGVIDINIPQSLHEQDNYSAVLTAQEVL 573
           ++R   TG IDPS+SIIVD  L +I WA  R YG+IDINIPQ+L E  NY  V ++QE+L
Sbjct: 510 SERDTQTGIIDPSSSIIVDNALKMINWAMDRRYGIIDINIPQTLFEHANYPGVASSQEIL 569

Query: 574 VYIWDSYLKYFTSLSKVAFVSIGDAYSGVVHLLGHRDTRNVVKAAISFIDQRPLRPLVPL 633
           +Y+WD+YLK+F +L KVAF+ IGDAY G+VHLLGHRDTR+VVK AISF+D++PL+ +VPL
Sbjct: 570 IYLWDNYLKFFQNLQKVAFIGIGDAYGGIVHLLGHRDTRSVVKCAISFLDKKPLKVMVPL 629

Query: 634 VDESLADWYFKNSLVFASAGHTCWGNDGAENKKPRKKFGRVLKCNSDGLNNILEERFEEA 693
           +DE+L DWYFKNSLVF S+ H+CWG+   ENKK RKK+GRVLK + DG+ NI +ERFEEA
Sbjct: 630 IDETLGDWYFKNSLVFTSSTHSCWGSTANENKKLRKKYGRVLKADCDGMTNIFDERFEEA 689

Query: 694 TDFILDTFEEWSDSE 708
           TDFILD+FEEWS+SE
Sbjct: 690 TDFILDSFEEWSESE 704

>KAFR0H03320 Chr8 (633105..635213) [2109 bp, 702 aa] {ON} Anc_2.285
           YNL021W
          Length = 702

 Score = 1053 bits (2723), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 491/686 (71%), Positives = 580/686 (84%), Gaps = 8/686 (1%)

Query: 29  EEENGGSETKV-KRPVIVPACRAKLHYTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPED 87
           EEEN  S   V KR VIVP  + ++HY PLKTGLCYDVRMRYHAKIFTSYFEYIDPHPED
Sbjct: 19  EEENLESLNVVPKRQVIVPTKKPQVHYIPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPED 78

Query: 88  PRRIYRIYKILAENGLIIDPTLSGVDDIGDLMLKIPAREATDEEILQVHTPEHLEFLSKT 147
           PRRIYRIYKILAENGLI D  LSGVDDIGD+MLKIP REAT +EIL+VH+ EHLEFL  T
Sbjct: 79  PRRIYRIYKILAENGLINDTMLSGVDDIGDIMLKIPVREATADEILEVHSREHLEFLEST 138

Query: 148 TSMTREQLLKETEKGDSVYFNNDSYLSAKLSCGGAIEACRAVVEGRVKNALAVVRPPGHH 207
           T+M RE LLKETEKGDSVYFNNDSY+SAKLSCGGAIEAC+AVVEG+VKNALAVVRPPGHH
Sbjct: 139 TTMNREVLLKETEKGDSVYFNNDSYMSAKLSCGGAIEACKAVVEGKVKNALAVVRPPGHH 198

Query: 208 AEPDLAGGFCLFSNVAVAAQNILKNYPESVKKIMILDWDVHHGNGTQKAFYNDDRVLYVS 267
           +EP+ +GGFCLFSNVAVAA+NILKNYPESV+KIMILDWD+HHGNGTQKAFY D+RVLYVS
Sbjct: 199 SEPESSGGFCLFSNVAVAAKNILKNYPESVRKIMILDWDIHHGNGTQKAFYQDERVLYVS 258

Query: 268 LHRHELGKYYPGTIHGNADRVGEGKGEGFNCNIPWPWKGVGDAEYIWAFEQVVLPMGREF 327
           LHR E GKYYPGT+ G  D+ GEGKGEGFNCNI WP  GVGDAEY+WAFEQ+V+PMGREF
Sbjct: 259 LHRFEAGKYYPGTVQGQYDQCGEGKGEGFNCNITWPTGGVGDAEYMWAFEQIVMPMGREF 318

Query: 328 QPDLVIISSGFDAADGDTVGQCHVTPSCYGHMTHMLKSLARGNICAVLEGGYSLDSIAKS 387
           QPDLVIISSGFDAADGD +GQCHVTPSCYGHMTHMLKSLARGN+  VLEGGY+LDSIA S
Sbjct: 319 QPDLVIISSGFDAADGDVIGQCHVTPSCYGHMTHMLKSLARGNLVVVLEGGYNLDSIAIS 378

Query: 388 ALGVAKVLIGEPPDELP-VVKQPKPEAVEVIDAVIKMQSRYWQCFKSTHANDGCSFKEPV 446
           AL VAK LIGEPPDELP  +K PKPEA+E+I  VIK+QS+YW+CFK  H N   +F E  
Sbjct: 379 ALSVAKTLIGEPPDELPDPLKDPKPEALEMIYKVIKIQSKYWKCFKRRHGNYNINFSEVA 438

Query: 447 TETLLNRNFPLQTAIRQQQVRLLTTEYNFVTLPLIKKELPDDTALCSPNIYDSQSIIVCV 506
           ++TL  + FPLQTAIRQQQ   L  EY+FV  P    +LPDD  LCSPNI+ ++++I+ V
Sbjct: 439 SDTLATKTFPLQTAIRQQQYYNLFKEYDFVKFPTANLKLPDDLILCSPNIHTAETVIIIV 498

Query: 507 HDTPEIWAQRSRATGTIDPSTSIIVDTTLDVIKWASKRNYGVIDINIPQSL----HEQDN 562
           HDTP+IW ++   + T+DP +SII+D+TLD +KWA  R YG+ID+NIPQSL       DN
Sbjct: 499 HDTPQIWLEKDIISNTVDPCSSIIIDSTLDFLKWAHNRKYGIIDVNIPQSLIYGDENPDN 558

Query: 563 YSAVLTAQEVLVYIWDSYLKYFTSLSKVAFVSIGDAYSGVVHLLGHRDTRNVVKAAISFI 622
           YS+++ AQE+L+++WD+++K+   ++K+AF+ +GD+ SGVVHLLGHRDT+  VKA I+F+
Sbjct: 559 YSSLINAQEILLFLWDNHIKFLNEVNKIAFIGVGDSVSGVVHLLGHRDTKERVKAVINFM 618

Query: 623 DQRPLRPLVPLVDESLADWYFKNSLVFASAGHTCWGNDGAENKKPRKKFGRVLKCNSDGL 682
             + L+PLVPLVDESL+DWYFKNSLVF++  H CWG+   ENKKPRKK+GRVL+C++DGL
Sbjct: 619 ADKQLKPLVPLVDESLSDWYFKNSLVFSNRTHPCWGD--KENKKPRKKYGRVLRCDTDGL 676

Query: 683 NNILEERFEEATDFILDTFEEWSDSE 708
           N+ +EERF+EATDFILD+FEEWSDSE
Sbjct: 677 NSTIEERFDEATDFILDSFEEWSDSE 702

>Kpol_1039.32 s1039 (99859..101838) [1980 bp, 659 aa] {ON}
           (99859..101838) [1980 nt, 660 aa]
          Length = 659

 Score = 1019 bits (2635), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 458/658 (69%), Positives = 560/658 (85%), Gaps = 3/658 (0%)

Query: 50  AKLHYTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIIDPTL 109
           + L YTPLKTGLCYDVRMRYHAKI+TSY+EYIDPHPEDPRRIYRIYKILAENGLI DP L
Sbjct: 3   SSLSYTPLKTGLCYDVRMRYHAKIYTSYYEYIDPHPEDPRRIYRIYKILAENGLIRDPAL 62

Query: 110 SGVDDIGDLMLKIPAREATDEEILQVHTPEHLEFLSKTTSMTREQLLKETEKGDSVYFNN 169
           SG+DDIGDLM KIP REAT EEIL+VH  E LE+L KT  + R++LL +TE GDSVYFNN
Sbjct: 63  SGIDDIGDLMCKIPVREATSEEILEVHPKEQLEYLEKTQYLNRDELLSKTELGDSVYFNN 122

Query: 170 DSYLSAKLSCGGAIEACRAVVEGRVKNALAVVRPPGHHAEPDLAGGFCLFSNVAVAAQNI 229
           DSY SAKLSCGGAIEAC+A+V+G+VKN+LA+VRPPGHH+EP++AGGFCLFSNVAVA +NI
Sbjct: 123 DSYFSAKLSCGGAIEACKAIVDGKVKNSLAIVRPPGHHSEPEVAGGFCLFSNVAVATKNI 182

Query: 230 LKNYPESVKKIMILDWDVHHGNGTQKAFYNDDRVLYVSLHRHELGKYYPGTIHGNADRVG 289
           LKNYP+ VKK+MI+DWD+HHGNGTQKAFYNDDRVLYVSLHR ELGKYYPGTIHG  D+VG
Sbjct: 183 LKNYPDKVKKVMIVDWDIHHGNGTQKAFYNDDRVLYVSLHRFELGKYYPGTIHGQYDQVG 242

Query: 290 EGKGEGFNCNIPWPWKGVGDAEYIWAFEQVVLPMGREFQPDLVIISSGFDAADGDTVGQC 349
           EGKGEGFNCNIPW   G+GDAEYIWAFEQ+V+PMGREF+PDLVI+SSGFDAADGDT+G+C
Sbjct: 243 EGKGEGFNCNIPWSVGGIGDAEYIWAFEQIVMPMGREFRPDLVIVSSGFDAADGDTIGKC 302

Query: 350 HVTPSCYGHMTHMLKSLARGNICAVLEGGYSLDSIAKSALGVAKVLIGEPPDELPVV-KQ 408
           HVTPSCYGHMTHMLKSLA G +C VLEGGY+LD+IA+SAL VAKVLIGEPPDELP   K 
Sbjct: 303 HVTPSCYGHMTHMLKSLANGKLCVVLEGGYNLDAIARSALAVAKVLIGEPPDELPAPDKD 362

Query: 409 PKPEAVEVIDAVIKMQSRYWQCFKSTHANDGCSFKEPVTETLLNRNFPLQTAIRQQQVRL 468
           PKPEA+E+ID VI ++S+YW+CFK    N  C +K P++E+   + FP+Q AIR QQ++ 
Sbjct: 363 PKPEAIEMIDRVIDLKSKYWKCFKRQITNSNCEYKGPISESFFAKKFPIQDAIRAQQIQY 422

Query: 469 LTTEYNFVTLPLIKKELPDDTALCSPNIYDSQSIIVCVHDTPEIWAQRSRATGTIDPSTS 528
           LT +YN V LPL+   LP+DT +CS +I  S   I+ VHDTPEIW++R    G ID S S
Sbjct: 423 LTNDYNMVPLPLMNSNLPEDTVMCSTDILQSNVAIIYVHDTPEIWSKRDAIAGVIDSSAS 482

Query: 529 IIVDTTLDVIKWASKRNYGVIDINIPQSLHEQDNYSAVLTAQEVLVYIWDSYLKYFTSLS 588
           + +D +L    WA  R YG+ID+NIPQ+L+EQDNYSA LTAQEVL+ +WD+ LKYF +++
Sbjct: 483 LYMDASLQFYDWALDRGYGIIDVNIPQTLYEQDNYSASLTAQEVLIKLWDNNLKYFPNVN 542

Query: 589 KVAFVSIGDAYSGVVHLLGHRDTRNVVKAAISFIDQRPLRPLVPLVDESLADWYFKNSLV 648
           K+A++ +G+AYSG+VHLLGHRDTR+VVK+ I F+ ++PL+ LVPLV+ESLADWYFK SL+
Sbjct: 543 KIAYIGVGEAYSGLVHLLGHRDTRSVVKSVIGFVGKKPLKALVPLVEESLADWYFKTSLL 602

Query: 649 FASAGHTCWGNDGAENKKPRKKFGRVLKCNSDGLNNILEERFEEATDFILDTFEEWSD 706
           FA   H+CWG +  ++KKPRK++GRVL+C+SDG+ +++EERFEEATDFI+D+ +EW++
Sbjct: 603 FADKNHSCWGEN--DSKKPRKRYGRVLRCDSDGIFSLIEERFEEATDFIIDSLDEWTE 658

>TPHA0C03390 Chr3 complement(743315..745420) [2106 bp, 701 aa] {ON}
           Anc_2.285 YNL021W
          Length = 701

 Score =  979 bits (2530), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 459/709 (64%), Positives = 565/709 (79%), Gaps = 11/709 (1%)

Query: 1   MTEAVGIKQEDSLKQENGFKRDAENALLEEENGGSETKVKRPVIVPACRAKLHYTPLKTG 60
           M+E +G K++  LK E+ F     +  + +E    +   KRPVIVP  +  LHYTPLKTG
Sbjct: 1   MSEQIGDKRK--LKDESEFP----SVSIGDEGKVIQVLPKRPVIVPTQKPNLHYTPLKTG 54

Query: 61  LCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIIDPTLSGVDDIGDLML 120
           +CYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLI DP+L+GV DIGDLML
Sbjct: 55  ICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPSLTGVSDIGDLML 114

Query: 121 KIPAREATDEEILQVHTPEHLEFLSKTTSMTREQLLKETEKGDSVYFNNDSYLSAKLSCG 180
           KIP REAT EEIL VHT EH++FL  T  MTRE+LL +TEKGDSVY NNDSY+SA+LSCG
Sbjct: 115 KIPVREATKEEILDVHTEEHMQFLESTEKMTREELLSKTEKGDSVYLNNDSYISARLSCG 174

Query: 181 GAIEACRAVVEGRVKNALAVVRPPGHHAEPDLAGGFCLFSNVAVAAQNILKNYPESVKKI 240
           GAIEAC+AVVEGRVKNALA+VRPPGHHAEP  AGGFCLFSNV+VAA++ILK YPESV+KI
Sbjct: 175 GAIEACKAVVEGRVKNALAIVRPPGHHAEPQAAGGFCLFSNVSVAAKSILKTYPESVRKI 234

Query: 241 MILDWDVHHGNGTQKAFYNDDRVLYVSLHRHELGKYYPGTIHGNADRVGEGKGEGFNCNI 300
           +I+DWD+HHGNGTQKAFY DD VLY+SLHR ELGK+YPG   GN D+VG+GKG+GFNCNI
Sbjct: 235 LIVDWDIHHGNGTQKAFYEDDNVLYISLHRFELGKFYPGFPEGNYDKVGDGKGKGFNCNI 294

Query: 301 PWPWKGVGDAEYIWAFEQVVLPMGREFQPDLVIISSGFDAADGDTVGQCHVTPSCYGHMT 360
            WP KGVGD EYIWAFEQ+V+PM REF+PDLVI+SSGFDAA GDT+GQCHVTP+CYG+MT
Sbjct: 295 TWPVKGVGDVEYIWAFEQIVIPMAREFRPDLVIVSSGFDAAHGDTIGQCHVTPNCYGYMT 354

Query: 361 HMLKSLARGNICAVLEGGYSLDSIAKSALGVAKVLIGEPPDELPVV-KQPKPEAVEVIDA 419
           HMLKSLARGN+C VLEGGY+LDSI+ SAL VAK+LIGEPPDE+P   + PKP  +E+I+ 
Sbjct: 355 HMLKSLARGNLCVVLEGGYNLDSISNSALAVAKILIGEPPDEIPESDRDPKPGVLEMINK 414

Query: 420 VIKMQSRYWQCFKSTHANDGCSFKEPVTETLLNRNFPLQTAIRQQQVRLLTTEYNFVTLP 479
           VI++QS+YW+CF+    N G  ++  + E+ + + FPLQ AIR  Q+     ++  ++L 
Sbjct: 415 VIRVQSKYWKCFRRKFGNFGGEYENAI-ESQIPKMFPLQDAIRNAQLSHYYDDFGMISLS 473

Query: 480 LIKKELPDDTALCSPNIYDSQSIIVCVHDTPEIWAQRSRATGTIDPSTSIIVDTTLDVIK 539
           L    LP ++ +CS N + ++S+ V +HDTPE+W  R   TG IDPSTSII D++L  I 
Sbjct: 474 LPNLNLPKNSIICSSNFFKAKSLCVLLHDTPEVWGNRDIITGIIDPSTSIIFDSSLKFIN 533

Query: 540 WASKRNYGVIDINIPQSLHEQDNYSAVLTAQEVLVYIWDSYLKYFTSLSKVAFVSIGDAY 599
           WA +R   VIDINIP+S  E DNYS+ L +Q+V++ +WD++ KY  SL K+ F+ IG+A 
Sbjct: 534 WAIERETAVIDINIPRSAFEADNYSSNLLSQDVMISLWDNHFKYIESLEKLCFIGIGEAT 593

Query: 600 SGVVHLLGHRDTRNVVKAAISFIDQRPLRPLVPLVDESLADWYFKNSLVFASAGHTCWGN 659
           SG+VHLLG RDTR V KAAI+F+    L+P+VP +DESL DWYFKNSLVF    H CW  
Sbjct: 594 SGIVHLLGKRDTRTVTKAAINFVGSSSLKPIVPSLDESLGDWYFKNSLVFTDHFHGCWSE 653

Query: 660 DGAENKKPRKKFGRVLKCNSDGLNNILEERFEEATDFILDTFEEWSDSE 708
           +   +KKPRKK+GRVL+C++DG++NI+EERFEEATDFILD F+EWSD+E
Sbjct: 654 N---DKKPRKKYGRVLRCDTDGIHNIIEERFEEATDFILDAFDEWSDTE 699

>TBLA0B06950 Chr2 complement(1643756..1646143) [2388 bp, 795 aa]
           {ON} Anc_2.285 YNL021W
          Length = 795

 Score =  752 bits (1942), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 345/466 (74%), Positives = 401/466 (86%), Gaps = 5/466 (1%)

Query: 16  ENGFKRDAENALLEEENGGSETKVKRPVIVPACRAKLHYTPLKTGLCYDVRMRYHAKIFT 75
           E G K  + N +L +    +    K+ +IVP    K+HY PLKTGLCYDVRMRYHAKIFT
Sbjct: 20  ETGTKNVSTNNILNK----NPPNYKKQIIVPVQAPKIHYVPLKTGLCYDVRMRYHAKIFT 75

Query: 76  SYFEYIDPHPEDPRRIYRIYKILAENGLIIDPTLSGVDDIGDLMLKIPAREATDEEILQV 135
           SYFEYIDPHPEDPRRIYRIYKILAENGLI DPTLSGVD+IGDLMLK+P REAT  EIL+V
Sbjct: 76  SYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDNIGDLMLKLPIREATMNEILEV 135

Query: 136 HTPEHLEFLSKTTSMTREQLLKETEKGDSVYFNNDSYLSAKLSCGGAIEACRAVVEGRVK 195
           H+ EH ++L KT++  REQLLKETE GDSVYFNNDS+ SAKLSCGGAIEAC+AVVEGRVK
Sbjct: 136 HSIEHFKYLEKTSNDNREQLLKETENGDSVYFNNDSFQSAKLSCGGAIEACKAVVEGRVK 195

Query: 196 NALAVVRPPGHHAEPDLAGGFCLFSNVAVAAQNILKNYPESVKKIMILDWDVHHGNGTQK 255
           NA+AVVRPPGHH+EP+ AGGFCLFSNVAVA +NILKNYPESV+K++ILDWD+HHGNGTQK
Sbjct: 196 NAMAVVRPPGHHSEPESAGGFCLFSNVAVATKNILKNYPESVRKVLILDWDIHHGNGTQK 255

Query: 256 AFYNDDRVLYVSLHRHELGKYYPGTIHGNADRVGEGKGEGFNCNIPWPWKGVGDAEYIWA 315
           AFYNDD VLY+SLHR ELGKYYPGTI G  D+ GEGKGEGFNCNI WP   VGDAEY+WA
Sbjct: 256 AFYNDDNVLYISLHRFELGKYYPGTIQGQYDQTGEGKGEGFNCNITWPIGAVGDAEYMWA 315

Query: 316 FEQVVLPMGREFQPDLVIISSGFDAADGDTVGQCHVTPSCYGHMTHMLKSLARGNICAVL 375
           FEQVV+PM REFQPDLVIISSGFDAADGDT+GQCHV+PSCYGHMTHMLKSLARGN+C VL
Sbjct: 316 FEQVVMPMSREFQPDLVIISSGFDAADGDTIGQCHVSPSCYGHMTHMLKSLARGNLCVVL 375

Query: 376 EGGYSLDSIAKSALGVAKVLIGEPPDELP-VVKQPKPEAVEVIDAVIKMQSRYWQCFKST 434
           EGGY+LD+IA+SAL V+K+LIGEPPDELP  +K PKPE +E+ID +I++QS+YW+CF+  
Sbjct: 376 EGGYNLDAIARSALSVSKILIGEPPDELPDPLKDPKPEVIEMIDKIIRLQSKYWKCFRRR 435

Query: 435 HANDGCSFKEPVTETLLNRNFPLQTAIRQQQVRLLTTEYNFVTLPL 480
           H N GC+FKE + ++L+++NFPLQTAIR  Q + L  E NF+TLP+
Sbjct: 436 HGNLGCNFKESINDSLISKNFPLQTAIRNFQSKKLFDELNFLTLPI 481

 Score =  309 bits (792), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 137/224 (61%), Positives = 182/224 (81%), Gaps = 2/224 (0%)

Query: 485 LPDDTALCSPNIYDSQSIIVCVHDTPEIWAQRSRATGTIDPSTSIIVDTTLDVIKWASKR 544
           L ++T LCSP I  S++++V VHD+P++W +R  +TG +D S++II+D+TLD IKW+  R
Sbjct: 574 LNENTILCSPAIIRSKTLVVLVHDSPDLWTKRDVSTGVVDLSSTIIIDSTLDFIKWSLDR 633

Query: 545 NYGVIDINIPQSLHEQDNYSAVLTAQEVLVYIWDSYLKYFTSLSKVAFVSIGDAYSGVVH 604
           NYGVIDINIPQ+L EQDNYS++L AQE L+  WD+YLKYF  + K+ F+  GDA++G+VH
Sbjct: 634 NYGVIDINIPQTLFEQDNYSSILAAQETLLSFWDNYLKYFPYIEKIVFIGFGDAHAGIVH 693

Query: 605 LLGHRDTRNVVKAAISFIDQRPLRPLVPLVDESLADWYFKNSLVFASAGHTCWGNDGAEN 664
           LLGHRDTR+VVK+ I+F+ ++PL+ LVPLVDE+L+DWYFKNSLVF    H  W ++  EN
Sbjct: 694 LLGHRDTRSVVKSVINFLGKKPLKALVPLVDETLSDWYFKNSLVFTDKNHPFWADN--EN 751

Query: 665 KKPRKKFGRVLKCNSDGLNNILEERFEEATDFILDTFEEWSDSE 708
           KKPRKKFGRVL+   DG+ N++EERF+EATDFILD+FEEWSD E
Sbjct: 752 KKPRKKFGRVLRSQQDGIANLIEERFDEATDFILDSFEEWSDEE 795

>Kpol_1003.37 s1003
           complement(91621..92301,92861..92869,92912..93958) [1737
           bp, 578 aa] {ON}
           complement(91621..92301,92861..92869,92912..93958) [1737
           nt, 579 aa]
          Length = 578

 Score =  510 bits (1314), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 238/319 (74%), Positives = 269/319 (84%), Gaps = 13/319 (4%)

Query: 32  NGGSETKV-------------KRPVIVPACRAKLHYTPLKTGLCYDVRMRYHAKIFTSYF 78
           NGG ET +             KR VIVP  + KLHYTPLKTGLCYDVRMRYHAKIFTS F
Sbjct: 31  NGGKETIMNGNSKNDHFKKMPKRQVIVPIRQPKLHYTPLKTGLCYDVRMRYHAKIFTSNF 90

Query: 79  EYIDPHPEDPRRIYRIYKILAENGLIIDPTLSGVDDIGDLMLKIPAREATDEEILQVHTP 138
           EYIDPHPEDPRR+YRIYKILAENGLI D  LSG+DDIGD+MLKIP R AT+EEIL VHT 
Sbjct: 91  EYIDPHPEDPRRVYRIYKILAENGLIKDENLSGLDDIGDIMLKIPVRTATEEEILAVHTR 150

Query: 139 EHLEFLSKTTSMTREQLLKETEKGDSVYFNNDSYLSAKLSCGGAIEACRAVVEGRVKNAL 198
           EHL+F+    S +RE+L+K TEK DSVY+NNDSY SAKLSCGG IEACRAVVEGRVKN+L
Sbjct: 151 EHLDFIENIESQSREELIKLTEKADSVYYNNDSYYSAKLSCGGVIEACRAVVEGRVKNSL 210

Query: 199 AVVRPPGHHAEPDLAGGFCLFSNVAVAAQNILKNYPESVKKIMILDWDVHHGNGTQKAFY 258
           A+VRPPGHHAEP  AGGFCLFSNV+VAA++IL+ YPESV+KI+ILDWD+HHGNGTQKAFY
Sbjct: 211 AIVRPPGHHAEPQAAGGFCLFSNVSVAARSILRTYPESVRKILILDWDIHHGNGTQKAFY 270

Query: 259 NDDRVLYVSLHRHELGKYYPGTIHGNADRVGEGKGEGFNCNIPWPWKGVGDAEYIWAFEQ 318
            D+ VLY+SLHR+E   +YPGTIHG  D+VGEGKGEGFNCNI WP  GVGDAEY+WAFE 
Sbjct: 271 EDENVLYISLHRYESTAFYPGTIHGRYDQVGEGKGEGFNCNITWPVGGVGDAEYMWAFEH 330

Query: 319 VVLPMGREFQPDLVIISSG 337
           VV+P+GREF+PDLVI+SSG
Sbjct: 331 VVMPLGREFRPDLVIVSSG 349

 Score =  258 bits (660), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 111/219 (50%), Positives = 163/219 (74%), Gaps = 2/219 (0%)

Query: 490 ALCSPNIYDSQSIIVCVHDTPEIWAQRSRATGTIDPSTSIIVDTTLDVIKWASKRNYGVI 549
            L S  I+ ++++++ VHDTPE+W  R   TG +DPSTS+++DT++  IKWA+ RNY ++
Sbjct: 360 VLASQKIFKAETLVILVHDTPELWGDRDIITGVLDPSTSVLIDTSMKFIKWAADRNYSIL 419

Query: 550 DINIPQSLHEQDNYSAVLTAQEVLVYIWDSYLKYFTSLSKVAFVSIGDAYSGVVHLLGHR 609
           DINIP+S  E++ +S+   A E+++ +WD++L+Y ++L+K+ F+ IG++Y G+VHL+G R
Sbjct: 420 DINIPKSNLEKETFSSSKAANEIMLSLWDNHLQYISTLTKICFIGIGESYQGIVHLIGER 479

Query: 610 DTRNVVKAAISFIDQRPLRPLVPLVDESLADWYFKNSLVFASAGHTCWGNDGAENKKPRK 669
           D R + KA I+F+   PL+ L    DE++ DWYFKNSLVF +  H CW    +E K+PRK
Sbjct: 480 DLRVLSKAVINFVGNFPLKSLSSNFDETMVDWYFKNSLVFTNDSHNCWKE--SEEKRPRK 537

Query: 670 KFGRVLKCNSDGLNNILEERFEEATDFILDTFEEWSDSE 708
           KFGRVLK +SDG+ +I+ ERF+EATDFILD FEEWSD E
Sbjct: 538 KFGRVLKSDSDGIISIINERFDEATDFILDAFEEWSDEE 576

>TPHA0H00320 Chr8 complement(62605..63957) [1353 bp, 450 aa] {ON}
           Anc_8.153 YGL194C
          Length = 450

 Score =  148 bits (373), Expect = 9e-38,   Method: Compositional matrix adjust.
 Identities = 109/369 (29%), Positives = 182/369 (49%), Gaps = 39/369 (10%)

Query: 57  LKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIIDPTLS--GVDD 114
            + G  Y  R+ YH     S + Y   HP  P R            ++ D  +S  G+ +
Sbjct: 19  FEFGSTYSPRVSYHYNPKVSNYHYGVKHPMKPFRF-----------MLTDHLVSSYGLHN 67

Query: 115 IGDLMLKIPAREATDEEILQVHTPEHLEFLSKTT-----SMTREQLLKETEKGDSVYFNN 169
           I DL      REAT EE+LQ H+ +++EFLSK +      M R    K     D   F N
Sbjct: 68  IMDLY---ETREATKEELLQFHSEDYVEFLSKVSPDNISKMPRGTFDKYNIGDDCPIFQN 124

Query: 170 DSYLSAKLSCGGAIEACRAVVEGRVKNALAVVRPPG-HHAEPDLAGGFCLFSNVAVAAQN 228
             Y   KL  G +++A R ++    ++ +A+    G HHA+     GFC  +++ +A  N
Sbjct: 125 -IYEYCKLYAGASLDASRKLIND--QSDIAINWSGGLHHAKKSNPSGFCYVNDIVLATLN 181

Query: 229 ILKNYPESVKKIMILDWDVHHGNGTQKAFYNDDRVLYVSLHRHELGKYYPGTIHGNADRV 288
           +L+ +P    +++ +D D+HHG+G Q+AFY  DRV  VS H++  G+++PGT  GN D +
Sbjct: 182 LLRYHP----RVLYIDIDLHHGDGVQEAFYTTDRVFTVSFHKYN-GEFFPGT--GNYDEI 234

Query: 289 GEGKGEGFNCNIPWPWKGVGDAEYIWAFEQVVLPMGREFQPDLVIISSGFDAADGDTVGQ 348
           G  +G+ F  N+P    G+ D  YI  F+ V+ P+   F+P  +I   G D+   D +G 
Sbjct: 235 GCAEGKHFAMNVPLN-DGIDDDSYINLFKSVMEPIITSFKPTAIIQQCGADSLGHDRLGC 293

Query: 349 CHVTPSCYGHMTHMLKSLARGNICAVLEGGYSLDSIAK-----SALGVAKVLIGEPPDEL 403
            ++    +G     ++S     +  V  GGY+  ++++     + +    +L  E P+++
Sbjct: 294 FNLNIKAHGECVKFIRSFGIP-MVVVGGGGYTPRNVSRLYAYETGILNNVLLQSELPEDM 352

Query: 404 PVVKQPKPE 412
           P   Q  P+
Sbjct: 353 PFRNQFGPD 361

>SAKL0H25124g Chr8 (2184039..2185385) [1347 bp, 448 aa] {ON} highly
           similar to uniprot|P53096 Saccharomyces cerevisiae
           YGL194C HOS2 Histone deacetylase required for gene
           activation via specific deacetylation of lysines in H3
           and H4 histone tails subunit of the Set3 complex a
           meiotic-specific repressor of sporulation specific genes
           that contains deacetylase activity
          Length = 448

 Score =  146 bits (368), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 116/455 (25%), Positives = 215/455 (47%), Gaps = 42/455 (9%)

Query: 49  RAKLHYTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIIDPT 108
           + K  Y P + G  Y   + YH     S + Y   HP  P R+     +++  GL     
Sbjct: 9   KTKETYLPYEFGSTYSPHVSYHFNSDVSQYHYGVRHPMKPFRLMLTDHLVSSYGL----- 63

Query: 109 LSGVDDIGDLMLKIPAREATDEEILQVHTPEHLEFLSKTTSMTREQL----LKETEKGDS 164
                    +M     REAT +E+L+ H+ +++EFLSK +  T  ++    L++   GD 
Sbjct: 64  -------HKIMDLYETREATRDELLEFHSADYIEFLSKVSPDTLSKMPRGSLEKFNIGDD 116

Query: 165 VYFNNDSYLSAKLSCGGAIEACRAVVEGRVKNALAVVRPPG-HHAEPDLAGGFCLFSNVA 223
                  +  + L  G +++A R ++ G  ++ +A+    G HHA+     GFC  +++ 
Sbjct: 117 CPIFQGIFEYSSLYAGASLDASRKLIAG--QSEIAINWSGGLHHAKKAKPSGFCYVNDIV 174

Query: 224 VAAQNILKNYPESVKKIMILDWDVHHGNGTQKAFYNDDRVLYVSLHRHELGKYYPGTIHG 283
           +A  N+L+ +P    +++ +D D+HHG+G Q+AFY  DRV  VS H++  G+++PGT  G
Sbjct: 175 LAILNLLRFHP----RVLYVDIDLHHGDGVQEAFYTTDRVFTVSFHKYN-GEFFPGT--G 227

Query: 284 NADRVGEGKGEGFNCNIPWPWKGVGDAEYIWAFEQVVLPMGREFQPDLVIISSGFDAADG 343
           + D +G  +G+ F  N+P    G+ D  YI  F+ ++ P+   ++P ++I   G D+   
Sbjct: 228 DFDEIGCSRGKHFALNVPLD-DGIDDDSYINLFKSIMDPLITSYKPTVIIQQCGADSLGH 286

Query: 344 DTVGQCHVTPSCYGHMTHMLKSLARGNICAVLEGGYSLDSIAK-----SALGVAKVLIGE 398
           D +G  ++    +G     +KS     +  V  GGY+  ++++     + L    +L  E
Sbjct: 287 DRLGCFNLNIRAHGECVKFVKSFGI-PMLVVGGGGYTPRNVSRLWTYETGLLNDVLLPQE 345

Query: 399 PPDELPVVKQPKPEAV--EVIDAVIK-------MQSRYWQCFKSTHANDGCSFKEPVTET 449
            P+ +P      P+     V+D + +       +++   +C +S     G        E 
Sbjct: 346 IPENIPFRDWFGPDYSLHPVLDDLYENKNSKKFLENVRIRCLESLRYLKGAPSVRMDQEI 405

Query: 450 LLNRNFPLQTAIRQQQVRLLTTEYNFVTLPLIKKE 484
           +  ++    T   ++ +R L  E + V L  I+KE
Sbjct: 406 IPTQDISGLTQDEEEMIRDLNDENDLVRLEQIEKE 440

>Ecym_2346 Chr2 complement(678792..680249) [1458 bp, 485 aa] {ON}
           similar to Ashbya gossypii AFR172C
          Length = 485

 Score =  146 bits (368), Expect = 8e-37,   Method: Compositional matrix adjust.
 Identities = 96/336 (28%), Positives = 174/336 (51%), Gaps = 28/336 (8%)

Query: 56  PLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIIDPTLSGVDDI 115
           P + G  Y  ++ YH     S + Y   HP  P      ++++  + L+   +  G+  I
Sbjct: 53  PFEFGSSYSPQVSYHFNPKVSQYHYGVRHPMKP------FRLMLTDHLV---SCYGLHKI 103

Query: 116 GDLMLKIPAREATDEEILQVHTPEHLEFLSKTTSMTREQL----LKETEKGDSVYFNNDS 171
            DL      REAT EE+L+ H P+++EFLS  T     +L    L++   GD        
Sbjct: 104 MDLY---ETREATKEELLEFHAPDYIEFLSHVTPENLNKLPRGSLEKFNIGDDCPIFQGM 160

Query: 172 YLSAKLSCGGAIEACRAVVEGRVKNALAVVRPPG-HHAEPDLAGGFCLFSNVAVAAQNIL 230
           +  + L  G +++A R ++    ++ +A+    G HHA+     GFC  +++ +A  ++L
Sbjct: 161 FDYSILYAGASLDAARKLINN--QSEIAINWSGGLHHAKKSNPSGFCYVNDIVLAIISLL 218

Query: 231 KNYPESVKKIMILDWDVHHGNGTQKAFYNDDRVLYVSLHRHELGKYYPGTIHGNADRVGE 290
           + +P    +++ +D D+HHG+G Q+AFY  DRV  VS H++  G+++PGT  G+ D +G 
Sbjct: 219 RYHP----RVLYIDIDLHHGDGVQEAFYTTDRVFTVSFHKYN-GEFFPGT--GDLDEIGC 271

Query: 291 GKGEGFNCNIPWPWKGVGDAEYIWAFEQVVLPMGREFQPDLVIISSGFDAADGDTVGQCH 350
            KG+ F+ N+P    G+ D  YI  F+ ++ P+   ++P ++I   G D+   D +G  +
Sbjct: 272 SKGKKFSLNVPL-QDGIDDDSYINLFKSIIDPLVTSYKPTVIIQQCGADSLGHDRLGCFN 330

Query: 351 VTPSCYGHMTHMLKSLARGNICAVLEGGYSLDSIAK 386
           +    +G     +KS     +C V  GGY+  ++++
Sbjct: 331 LNIKAHGECVKFVKSFGIPILC-VGGGGYTPRNVSR 365

>KAFR0C02920 Chr3 complement(584668..586029) [1362 bp, 453 aa] {ON}
           Anc_8.153 YGL194C
          Length = 453

 Score =  142 bits (357), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 105/364 (28%), Positives = 179/364 (49%), Gaps = 35/364 (9%)

Query: 60  GLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIIDPTLSGVDDIGDLM 119
           G  Y  R+ YH     S + Y   HP  P R+     +++  GL           I DL 
Sbjct: 23  GSSYTPRVSYHFNPKVSNYHYGVNHPMKPFRLMLTDHLVSSYGL---------HKIMDLY 73

Query: 120 LKIPAREATDEEILQVHTPEHLEFLSKTTSMT-----REQLLKETEKGDSVYFNNDSYLS 174
                REAT EE+ Q H+ ++L+FL K +  T     R  L K     D   F N  Y  
Sbjct: 74  ---ETREATKEEMSQFHSSDYLDFLEKISPDTLNKIPRGTLEKFNIGSDCPIFEN-IYDY 129

Query: 175 AKLSCGGAIEACRAVVEGRVKNALAVVRPPG-HHAEPDLAGGFCLFSNVAVAAQNILKNY 233
           + L  G +++A R ++ G  ++ +A+    G HHA+ +   GFC  +++ ++  N+L+ +
Sbjct: 130 STLYTGASLDASRKLING--QSEIAINWSGGLHHAKKNNPSGFCYINDIVLSILNLLRYH 187

Query: 234 PESVKKIMILDWDVHHGNGTQKAFYNDDRVLYVSLHRHELGKYYPGTIHGNADRVGEGKG 293
           P    +++ +D D+HHG+G Q+AFY  DRV  +S H++  G+++PGT  GN D +G   G
Sbjct: 188 P----RVLYIDIDLHHGDGVQEAFYTTDRVFTISFHKYN-GEFFPGT--GNYDEIGCSGG 240

Query: 294 EGFNCNIPWPWKGVGDAEYIWAFEQVVLPMGREFQPDLVIISSGFDAADGDTVGQCHVTP 353
           + F  N+P    G+ D  YI  F+ ++ P+   +QP ++I   G D+   D +G  ++  
Sbjct: 241 KHFAMNVPLN-DGIDDDSYIKLFKSIIDPLITSYQPTVIIQQCGADSLGHDRLGCFNLNI 299

Query: 354 SCYGHMTHMLKSLARGNICAVLEGGYSLDSIAK-----SALGVAKVLIGEPPDELPVVKQ 408
             +G     + S     +  V  GGY+  ++++     + +    +L  E P+ELP  + 
Sbjct: 300 KAHGECVKFVSSFGIP-MLVVGGGGYTPRNVSRLWAYETGILNNVLLPKELPEELPFREN 358

Query: 409 PKPE 412
             P+
Sbjct: 359 FGPD 362

>NCAS0B05480 Chr2 complement(1033624..1034979) [1356 bp, 451 aa]
           {ON} Anc_8.153
          Length = 451

 Score =  142 bits (357), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 107/364 (29%), Positives = 179/364 (49%), Gaps = 35/364 (9%)

Query: 60  GLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIIDPTLSGVDDIGDLM 119
           G  Y  R+ YH     S + Y   HP  P R+     +++  GL           I DL 
Sbjct: 23  GSSYTPRVSYHFNPKVSNYHYGVRHPMKPFRLMLTDHLVSSYGL---------HKIMDLY 73

Query: 120 LKIPAREATDEEILQVHTPEHLEFLSKTT-----SMTREQLLKETEKGDSVYFNNDSYLS 174
                REAT EE+ Q H+ +++EFLSK T      M R  L K     D   F N  Y  
Sbjct: 74  ---ETREATREEMSQFHSQDYIEFLSKVTPENLSKMPRGTLEKFNIGDDCPIFQN-IYDY 129

Query: 175 AKLSCGGAIEACRAVVEGRVKNALAVVRPPG-HHAEPDLAGGFCLFSNVAVAAQNILKNY 233
           + L  G +++A R ++    ++ +A+    G HHA+ +   GFC  +++ ++  N+L+ +
Sbjct: 130 STLYTGASLDASRKLIND--QSDIAINWSGGLHHAKKNNPSGFCYVNDIVLSILNLLRYH 187

Query: 234 PESVKKIMILDWDVHHGNGTQKAFYNDDRVLYVSLHRHELGKYYPGTIHGNADRVGEGKG 293
           P    +++ +D D+HHG+G Q+AFY  DRV  +S H+   G+++PGT  G+ D +G  KG
Sbjct: 188 P----RVLYIDIDLHHGDGVQEAFYTTDRVFTISFHKFN-GEFFPGT--GDFDEIGCAKG 240

Query: 294 EGFNCNIPWPWKGVGDAEYIWAFEQVVLPMGREFQPDLVIISSGFDAADGDTVGQCHVTP 353
           + F  N+P    G+ D  YI  F+ ++ P+   ++P ++I   G D+   D +G  ++  
Sbjct: 241 KHFAMNVPLE-DGIDDDSYINLFKSIIDPLITAYKPTVIIQQCGADSLGHDRLGCFNLNI 299

Query: 354 SCYGHMTHMLKSLARGNICAVLEGGYSLDSIAK---SALGVAK--VLIGEPPDELPVVKQ 408
             +G     +KS     +  V  GGY+  ++++      GV    +L  E P+E+P    
Sbjct: 300 KAHGECVKFVKSFGIP-MLVVGGGGYTPRNVSRLWTYETGVLNNVLLPSEIPEEIPFRDS 358

Query: 409 PKPE 412
             P+
Sbjct: 359 FGPD 362

>KLLA0F09119g Chr6 (848467..849825) [1359 bp, 452 aa] {ON} highly
           similar to uniprot|P53096 Saccharomyces cerevisiae
           YGL194C HOS2 Histone deacetylase required for gene
           activation via specific deacetylation of lysines in H3
           and H4 histone tails subunit of the Set3 complex a
           meiotic-specific repressor of sporulation specific genes
           that contains deacetylase activity
          Length = 452

 Score =  140 bits (353), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 102/365 (27%), Positives = 179/365 (49%), Gaps = 36/365 (9%)

Query: 60  GLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIIDPTLSGVDDIGDLM 119
           G  Y  R+ YH     S + Y   HP  P R+     +++  GL              +M
Sbjct: 24  GTSYSPRVSYHFNSKVSQYHYGVKHPMKPFRLMLTDHLVSAYGL------------HKVM 71

Query: 120 LKIPAREATDEEILQVHTPEHLEFLSKTTSMTREQL----LKETEKGDSVYFNNDSYLSA 175
                R AT +E+ + H+ +++ FL+K T  T  +L    L++   GD        +  A
Sbjct: 72  DLYETRSATKDELTKFHSEDYVNFLAKVTPDTLNKLPRGSLEKFNIGDDCPIFQGMFDYA 131

Query: 176 KLSCGGAIEACRAVVEGRVKNALAVVRPPG-HHAEPDLAGGFCLFSNVAVAAQNILKNYP 234
            L  G +++A R ++ G  ++ +A+    G HHA+ +   GFC  +++ +A  N+L+ +P
Sbjct: 132 ALYAGASLDASRKLLNG--QSEIAINWSGGLHHAKKNNPSGFCYVNDIVLAIVNLLRYHP 189

Query: 235 ESVKKIMILDWDVHHGNGTQKAFYNDDRVLYVSLHRHELGKYYPGTIHGNADRVGEGKGE 294
               +++ +D D+HHG+G Q+AFY  DRV  VS H++  G+++PGT  G+ D +G  +G+
Sbjct: 190 ----RVLYIDIDLHHGDGVQEAFYTTDRVFTVSFHKYN-GEFFPGT--GDLDEIGCSRGK 242

Query: 295 GFNCNIPWPWKGVGDAEYIWAFEQVVLPMGREFQPDLVIISSGFDAADGDTVGQCHVTPS 354
            F  N+P    G+ D  YI  F+ ++ P+   F+P ++I   G D+   D +G  ++   
Sbjct: 243 HFALNVPL-QDGIEDDSYINLFKSIIDPVITSFRPSVIIQQCGADSLGHDRLGCFNLNIK 301

Query: 355 CYGHMTHMLKSLARGNICAVLEGGYSLDSIAKSALGVAKVLIGEPPDELPVVKQPK-PEA 413
            +G     +KS     +  V  GGY+  ++++       +L G       V+ QPK PE 
Sbjct: 302 AHGECVRFVKSFGV-PMLVVGGGGYTPRNVSRLWTYETGLLNG-------VLLQPKLPEG 353

Query: 414 VEVID 418
           +   D
Sbjct: 354 IPFRD 358

>TDEL0B04580 Chr2 complement(817368..818708) [1341 bp, 446 aa] {ON}
           Anc_8.153 YGL194C
          Length = 446

 Score =  139 bits (351), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 105/360 (29%), Positives = 179/360 (49%), Gaps = 37/360 (10%)

Query: 57  LKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIIDPTLS--GVDD 114
            + G  Y  R+ YH     S + Y   HP  P R+           L+ D  +S  G+  
Sbjct: 18  FEFGSAYCPRVSYHFNPKVSNYHYGVRHPMKPFRL-----------LLTDHLVSSYGLHK 66

Query: 115 IGDLMLKIPAREATDEEILQVHTPEHLEFLSKTTSMTREQL----LKETEKGDSVYFNND 170
           I DL      R AT EEI + HT ++++FL K T     ++    L++   GD      +
Sbjct: 67  IMDLY---ETRVATSEEIAEFHTQDYIDFLHKVTPENLSKMPRGTLEKFNIGDDCPIFQN 123

Query: 171 SYLSAKLSCGGAIEACRAVVEGRVKNALAVVRPPG-HHAEPDLAGGFCLFSNVAVAAQNI 229
            +   KL  G +++A R ++    ++ +A+    G HHA+     GFC  +++ +A  N+
Sbjct: 124 LFNYCKLYAGASLDAARKLIND--QSDIAINWSGGLHHAKKSNPSGFCYVNDIVLAILNL 181

Query: 230 LKNYPESVKKIMILDWDVHHGNGTQKAFYNDDRVLYVSLHRHELGKYYPGTIHGNADRVG 289
           L+ +P    +++ +D D+HHG+G Q+AFY  DRV  VS H++  G+++PGT  GN D VG
Sbjct: 182 LRYHP----RVLYIDIDLHHGDGVQEAFYTTDRVYTVSFHKYN-GEFFPGT--GNHDEVG 234

Query: 290 EGKGEGFNCNIPWPWKGVGDAEYIWAFEQVVLPMGREFQPDLVIISSGFDAADGDTVGQC 349
              G+ F  N+P    G+ D  YI  F+ ++ P+   ++P ++I   G D+   D +G  
Sbjct: 235 CANGKHFAMNVPLE-DGIDDDSYINLFKSIMDPLITSYKPTVIIQQCGADSLGHDRIGCF 293

Query: 350 HVTPSCYGHMTHMLKSLARGNICAVLEGGYSLDSIAK---SALGVAK--VLIGEPPDELP 404
           ++T   +G     ++S     +  V  GGY+  ++++      GV    +L  E P+E+P
Sbjct: 294 NLTIKGHGECVKFIRSFGIP-MLVVGGGGYTPRNVSRLWAYETGVLNNVLLSKELPEEIP 352

>Suva_14.11 Chr14 complement(13144..14445) [1302 bp, 433 aa] {ON}
           YNL330C (REAL)
          Length = 433

 Score =  138 bits (348), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 96/326 (29%), Positives = 164/326 (50%), Gaps = 28/326 (8%)

Query: 66  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIIDPTLSGVDDIGDLMLKIPAR 125
           R+ Y        + Y   HP  P RI   + ++   GL               M    A+
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMAHSLIMNYGLY------------KKMEIYRAK 67

Query: 126 EATDEEILQVHTPEHLEFLSKTTSMTREQLLKETEK---GDSVYFNNDSYLSAKLSCGGA 182
            AT +E+ Q HT E+++FLS+ T    E   +E+ K   GD     +  Y    +S GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLEMFKRESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 183 IEACRAVVEGRVKNALAVVRPPG-HHAEPDLAGGFCLFSNVAVAAQNILKNYPESVKKIM 241
           +E    +  G+    +AV    G HHA+   A GFC  +++ +    +L+ +P    +++
Sbjct: 128 MEGAARLNRGKCD--VAVNYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 242 ILDWDVHHGNGTQKAFYNDDRVLYVSLHRHELGKYYPGTIHGNADRVGEGKGEGFNCNIP 301
            +D DVHHG+G ++AFY  DRV+  S H++  G+++PGT  G    VG GKG+ ++ N+P
Sbjct: 182 YVDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDVGVGKGKNYSVNVP 237

Query: 302 WPWKGVGDAEYIWAFEQVVLPMGREFQPDLVIISSGFDAADGDTVGQCHVTPSCYGHMTH 361
               G+ DA Y   FE VV  +   +QP  V++ +G D+  GD +G  +++   + +  +
Sbjct: 238 L-RDGIDDATYRAVFEPVVKRIMDWYQPSAVVLQTGGDSLSGDRLGCFNLSMEGHANCVN 296

Query: 362 MLKSLARGNICAVLEGGYSLDSIAKS 387
            +KS     +  V  GGY++ ++A++
Sbjct: 297 YVKSFGI-PMMVVGGGGYTMRNVART 321

>AFR172C Chr6 complement(754470..755819) [1350 bp, 449 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL194C
           (HOS2)
          Length = 449

 Score =  139 bits (349), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 92/335 (27%), Positives = 166/335 (49%), Gaps = 28/335 (8%)

Query: 57  LKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIIDPTLSGVDDIG 116
            + G  Y  R+ YH     S + Y   HP  P R+     +++  GL             
Sbjct: 18  FEFGASYTPRVSYHYNSRVSQYHYGVRHPMKPFRLMLTDHLVSRYGL------------H 65

Query: 117 DLMLKIPAREATDEEILQVHTPEHLEFLSKTTSMTREQL----LKETEKGDSVYFNNDSY 172
            +M     R AT EE+L  H  ++++FLS        +L    L++   GD        +
Sbjct: 66  KVMDLYETRAATKEEVLAFHAQDYVDFLSHVAPENLNKLPRGSLEKFNIGDDCPIFQGLF 125

Query: 173 LSAKLSCGGAIEACRAVVEGRVKNALAVVRPPG-HHAEPDLAGGFCLFSNVAVAAQNILK 231
             + L  G +++A R ++ G  ++ +A+    G HHA+     GFC  +++ +A  N+L+
Sbjct: 126 EYSMLYAGASLDASRKLING--QSEIAINWSGGLHHAKKSNPSGFCYVNDIVLAILNLLR 183

Query: 232 NYPESVKKIMILDWDVHHGNGTQKAFYNDDRVLYVSLHRHELGKYYPGTIHGNADRVGEG 291
            +P    +++ +D D+HHG+G Q+AFY  DRV  VS H++  G+++PGT  G+ D +G  
Sbjct: 184 YHP----RVLYIDIDLHHGDGVQEAFYTTDRVFTVSFHKYN-GEFFPGT--GDLDEIGCS 236

Query: 292 KGEGFNCNIPWPWKGVGDAEYIWAFEQVVLPMGREFQPDLVIISSGFDAADGDTVGQCHV 351
           +G+ F+ N+P    G+ D  YI  F+ ++ P+   ++P ++I   G D+   D +G  ++
Sbjct: 237 RGKHFSLNVPLN-DGIDDDSYINLFKSIIDPLVTSYKPTVIIQQCGADSLGHDRLGCFNL 295

Query: 352 TPSCYGHMTHMLKSLARGNICAVLEGGYSLDSIAK 386
               +G     +KS     +C V  GGY+  ++++
Sbjct: 296 NIRAHGECVKFVKSFGIPMLC-VGGGGYTPRNVSR 329

>KLTH0E06446g Chr5 complement(594807..596156) [1350 bp, 449 aa] {ON}
           highly similar to uniprot|P53096 Saccharomyces
           cerevisiae YGL194C HOS2 Histone deacetylase required for
           gene activation via specific deacetylation of lysines in
           H3 and H4 histone tails subunit of the Set3 complex a
           meiotic-specific repressor of sporulation specific genes
           that contains deacetylase activity
          Length = 449

 Score =  138 bits (348), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 97/351 (27%), Positives = 171/351 (48%), Gaps = 29/351 (8%)

Query: 60  GLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIIDPTLSGVDDIGDLM 119
           G  Y+  + YH     S F Y   HP  P R+     +++  GL              +M
Sbjct: 21  GAPYEPNVSYHFNSDVSQFHYGVRHPMKPFRLMLTDHLVSSYGL------------HKIM 68

Query: 120 LKIPAREATDEEILQVHTPEHLEFLSKTTSMTREQL----LKETEKGDSVYFNNDSYLSA 175
                R AT EE+ + H  +++EFL+K +     +L    L++   GD        Y  +
Sbjct: 69  DLYETRPATREELCEFHADDYVEFLAKVSPDNLSKLPRGTLEKFNIGDDCPIFQGLYQYS 128

Query: 176 KLSCGGAIEACRAVVEGRVKNALAVVRPPG-HHAEPDLAGGFCLFSNVAVAAQNILKNYP 234
            L  G +++A R ++ G  ++ +A+    G HHA+     GFC  +++ ++  N+L+ +P
Sbjct: 129 TLYAGASLDATRKLING--QSEIAINWSGGLHHAKKSSPSGFCYVNDIVLSVLNLLRYHP 186

Query: 235 ESVKKIMILDWDVHHGNGTQKAFYNDDRVLYVSLHRHELGKYYPGTIHGNADRVGEGKGE 294
               +++ +D D+HHG+G Q+AFY  DRV  VS H++  G+++PGT  GN D  G  +G+
Sbjct: 187 ----RVLYIDIDLHHGDGVQEAFYTTDRVFTVSFHKYN-GEFFPGT--GNLDETGCSRGK 239

Query: 295 GFNCNIPWPWKGVGDAEYIWAFEQVVLPMGREFQPDLVIISSGFDAADGDTVGQCHVTPS 354
            F  N+P    G+ D  YI  F+ ++ P+   F+P ++I   G D+   D +G  ++   
Sbjct: 240 HFALNVPLE-DGIDDDSYINLFKSIIDPLITSFKPTVIIQQCGADSLGHDRLGCFNLNVK 298

Query: 355 CYGHMTHMLKSLARGNICAVLEGGYSLDSIAKSALGVAKVLIG-EPPDELP 404
            +G     +KS     +  +  GGY+  ++++       +L G   P E+P
Sbjct: 299 AHGECVRFVKSFGIP-MLVLGGGGYTPRNVSRLWTYETALLNGVSVPQEIP 348

>NDAI0G03740 Chr7 complement(900866..902167) [1302 bp, 433 aa] {ON}
           Anc_3.8
          Length = 433

 Score =  138 bits (347), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 96/326 (29%), Positives = 163/326 (50%), Gaps = 28/326 (8%)

Query: 66  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIIDPTLSGVDDIGDLMLKIPAR 125
           R+ Y        + Y   HP  P RI   + ++   GL               M    A+
Sbjct: 20  RVAYFYDADVGNYAYGSGHPMKPHRIRMTHSLIMNYGLY------------KKMEIYRAK 67

Query: 126 EATDEEILQVHTPEHLEFLSKTTSMTREQLLKETEK---GDSVYFNNDSYLSAKLSCGGA 182
            AT +E+ Q HT E+++FLS+ T    E   KE+ K   GD     +  Y    +S GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLELFKKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 183 IEACRAVVEGRVKNALAVVRPPG-HHAEPDLAGGFCLFSNVAVAAQNILKNYPESVKKIM 241
           +E    +  G+    +A+    G HHA+   A GFC  +++ +    +L+ +P    +++
Sbjct: 128 MEGAARLNRGKCD--VAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 242 ILDWDVHHGNGTQKAFYNDDRVLYVSLHRHELGKYYPGTIHGNADRVGEGKGEGFNCNIP 301
            +D DVHHG+G ++AFY+ DRV+  S H++  G+++PGT  G    VG GKG+ +  N+P
Sbjct: 182 YIDIDVHHGDGVEEAFYSTDRVMTCSFHKY--GEFFPGT--GELRDVGVGKGKYYAVNVP 237

Query: 302 WPWKGVGDAEYIWAFEQVVLPMGREFQPDLVIISSGFDAADGDTVGQCHVTPSCYGHMTH 361
               G+ DA Y   FE VV  +   +QP  V++  G D+  GD +G  +++   + +  +
Sbjct: 238 L-RDGIDDATYRNVFEPVVKRIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMQGHANCVN 296

Query: 362 MLKSLARGNICAVLEGGYSLDSIAKS 387
            +KS     +  V  GGY++ ++A++
Sbjct: 297 YVKSFGI-PMMVVGGGGYTMRNVART 321

>YGL194C Chr7 complement(140368..141726) [1359 bp, 452 aa] {ON}
           HOS2Histone deacetylase required for gene activation via
           specific deacetylation of lysines in H3 and H4 histone
           tails; subunit of the Set3 complex, a meiotic-specific
           repressor of sporulation specific genes that contains
           deacetylase activity
          Length = 452

 Score =  138 bits (347), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 92/330 (27%), Positives = 164/330 (49%), Gaps = 28/330 (8%)

Query: 62  CYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIIDPTLSGVDDIGDLMLK 121
            Y  R+ YH     S++ Y   HP  P R+     +++  GL              +M  
Sbjct: 23  AYSPRVSYHFNSKVSHYHYGVKHPMKPFRLMLTDHLVSSYGL------------HKIMDL 70

Query: 122 IPAREATDEEILQVHTPEHLEFLSKTTSMTREQL----LKETEKGDSVYFNNDSYLSAKL 177
              R AT +E+LQ H+ +++ FLSK +     +L    L+    GD      + Y    L
Sbjct: 71  YETRSATRDELLQFHSEDYVNFLSKVSPENANKLPRGTLENFNIGDDCPIFQNLYDYTTL 130

Query: 178 SCGGAIEACRAVVEGRVKNALAVVRPPG-HHAEPDLAGGFCLFSNVAVAAQNILKNYPES 236
             G +++A R ++    ++ +A+    G HHA+ +   GFC  +++ ++  N+L+ +P  
Sbjct: 131 YTGASLDATRKLINN--QSDIAINWSGGLHHAKKNSPSGFCYVNDIVLSILNLLRYHP-- 186

Query: 237 VKKIMILDWDVHHGNGTQKAFYNDDRVLYVSLHRHELGKYYPGTIHGNADRVGEGKGEGF 296
             +I+ +D D+HHG+G Q+AFY  DRV  +S H++  G+++PGT  G+   +G  KG+ F
Sbjct: 187 --RILYIDIDLHHGDGVQEAFYTTDRVFTLSFHKYN-GEFFPGT--GDLTEIGCDKGKHF 241

Query: 297 NCNIPWPWKGVGDAEYIWAFEQVVLPMGREFQPDLVIISSGFDAADGDTVGQCHVTPSCY 356
             N+P    G+ D  YI  F+ +V P+   F+P L++   G D+   D +G  ++    +
Sbjct: 242 ALNVPLE-DGIDDDSYINLFKSIVDPLIMTFKPTLIVQQCGADSLGHDRLGCFNLNIKAH 300

Query: 357 GHMTHMLKSLARGNICAVLEGGYSLDSIAK 386
           G     +KS     +  V  GGY+  ++++
Sbjct: 301 GECVKFVKSFGLP-MLVVGGGGYTPRNVSR 329

>NDAI0B02710 Chr2 (674610..675971) [1362 bp, 453 aa] {ON} Anc_8.153
          Length = 453

 Score =  138 bits (347), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 99/356 (27%), Positives = 173/356 (48%), Gaps = 39/356 (10%)

Query: 37  TKVKRPVIVPACRAKLHYTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYK 96
           T  K+P+   +      YTP         R+ YH     S + Y   HP  P R+     
Sbjct: 11  TAAKQPLFEESFDNSSSYTP---------RVSYHFNPKVSNYHYGVKHPMKPFRLMLTDH 61

Query: 97  ILAENGLIIDPTLSGVDDIGDLMLKIPAREATDEEILQVHTPEHLEFLSKTT-----SMT 151
           +++  GL              +M     R AT+EE++Q H+ ++L+FLSK T      M 
Sbjct: 62  LVSSYGL------------HKIMDLYETRPATNEEMVQFHSEDYLDFLSKVTPENLSKMP 109

Query: 152 REQLLKETEKGDSVYFNNDSYLSAKLSCGGAIEACRAVVEGRVKNALAVVRPPG-HHAEP 210
           R  L K     D   F N  Y  + L  G +++A R ++    ++ +A+    G HHA+ 
Sbjct: 110 RGTLEKFNIGDDCPIFQN-LYDYSTLYTGASLDATRKLIND--QSDIAINWSGGLHHAKK 166

Query: 211 DLAGGFCLFSNVAVAAQNILKNYPESVKKIMILDWDVHHGNGTQKAFYNDDRVLYVSLHR 270
           +   GFC  +++ ++  N+L+ +P    +++ +D D+HHG+G Q+AFY  DRV  +S H+
Sbjct: 167 NNPSGFCYINDIVLSIVNLLRYHP----RVLYIDIDLHHGDGVQEAFYTTDRVFTISFHK 222

Query: 271 HELGKYYPGTIHGNADRVGEGKGEGFNCNIPWPWKGVGDAEYIWAFEQVVLPMGREFQPD 330
              G+++PGT  G+ D  G  KG+ F  N+P    G+ D  YI  F+ ++ P+   ++P 
Sbjct: 223 FN-GEFFPGT--GDYDETGCAKGKHFAMNVPLE-DGIDDDSYINLFKSIMDPLITSYKPT 278

Query: 331 LVIISSGFDAADGDTVGQCHVTPSCYGHMTHMLKSLARGNICAVLEGGYSLDSIAK 386
           +++   G D+   D +G  ++    +G     +KS     +  V  GGY+  ++++
Sbjct: 279 VIVQQCGADSLGHDRLGCFNLNIKGHGECVKFIKSFGIP-MLVVGGGGYTPRNVSR 333

>KNAG0A01160 Chr1 complement(7229..8530) [1302 bp, 433 aa] {ON}
           Anc_3.8 YNL330C
          Length = 433

 Score =  137 bits (346), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 97/328 (29%), Positives = 163/328 (49%), Gaps = 32/328 (9%)

Query: 66  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIIDPTLSGVDDIGDLMLKIPAR 125
           R+ Y        + Y   HP  P RI   + ++   GL               M    A+
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMAHSLIMNYGLY------------KKMEIYRAK 67

Query: 126 EATDEEILQVHTPEHLEFLSKTTSMTREQLLKETEK---GDSVYFNNDSYLSAKLSCGGA 182
            AT +E+ Q HT E+++FLS+ T    E   KE+ K   GD     +  Y    +S GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLEMFKKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 183 IEACRAVVEGRVKNALAVVRPPG-HHAEPDLAGGFCLFSNVAVAAQNILKNYPESVKKIM 241
           +E+   +  G+    +A+    G HHA+   A GFC  +++ +    +L+ +P    +++
Sbjct: 128 MESAARLNRGKCD--IAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 242 ILDWDVHHGNGTQKAFYNDDRVLYVSLHRHELGKYYPGTIHGNADRVGEGKGEGFNCNIP 301
            +D DVHHG+G ++AFY  DRV+  S H++  G+++PGT  G    +G GKG+ +  N+P
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDIGVGKGQNYAVNVP 237

Query: 302 WPWKGVGDAEYIWAFEQVVLPMGREFQPDLVIISSGFDAADGDTVGQCHVTPSCYGHMTH 361
               G+ DA Y   FE VV  +   +QP  V++  G D+  GD +G  +++   +    +
Sbjct: 238 L-RDGIDDATYRSVFEPVVGKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMQGHASCVN 296

Query: 362 MLKSLARGNI--CAVLEGGYSLDSIAKS 387
            +KS    NI    V  GGY++ ++A++
Sbjct: 297 YVKSF---NIPMMVVGGGGYTMRNVART 321

>Skud_14.11 Chr14 complement(11451..12752) [1302 bp, 433 aa] {ON}
           YNL330C (REAL)
          Length = 433

 Score =  137 bits (346), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 94/326 (28%), Positives = 163/326 (50%), Gaps = 28/326 (8%)

Query: 66  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIIDPTLSGVDDIGDLMLKIPAR 125
           R+ Y        + Y   HP  P RI   + ++   GL               M    A+
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMAHSLIMNYGLY------------KKMEIYRAK 67

Query: 126 EATDEEILQVHTPEHLEFLSKTTSMTREQLLKETEK---GDSVYFNNDSYLSAKLSCGGA 182
            AT +E+ Q HT E+++FLS+ T    E   +E+ K   GD     +  Y    +S GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLEMFKRESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 183 IEACRAVVEGRVKNALAVVRPPG-HHAEPDLAGGFCLFSNVAVAAQNILKNYPESVKKIM 241
           +E    +  G+    +AV    G HHA+   A GFC  +++ +    +L+ +P    +++
Sbjct: 128 MEGAARLNRGKCD--VAVNYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 242 ILDWDVHHGNGTQKAFYNDDRVLYVSLHRHELGKYYPGTIHGNADRVGEGKGEGFNCNIP 301
            +D DVHHG+G ++AFY+ DRV+  S H++  G+++PGT  G    +G G G+ +  N+P
Sbjct: 182 YIDIDVHHGDGVEEAFYSTDRVMTCSFHKY--GEFFPGT--GELRDIGVGTGKNYAVNVP 237

Query: 302 WPWKGVGDAEYIWAFEQVVLPMGREFQPDLVIISSGFDAADGDTVGQCHVTPSCYGHMTH 361
               G+ DA Y   FE V+  +   +QP  V++  G D+  GD +G  +++   +G+  +
Sbjct: 238 L-RDGIDDATYRSVFEPVIKKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMEGHGNCVN 296

Query: 362 MLKSLARGNICAVLEGGYSLDSIAKS 387
            +KS     +  V  GGY++ ++A++
Sbjct: 297 YVKSFGI-PMMVVGGGGYTMRNVART 321

>Smik_7.79 Chr7 complement(134747..136105) [1359 bp, 452 aa] {ON}
           YGL194C (REAL)
          Length = 452

 Score =  137 bits (345), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 92/330 (27%), Positives = 164/330 (49%), Gaps = 28/330 (8%)

Query: 62  CYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIIDPTLSGVDDIGDLMLK 121
            Y  R+ YH     S++ Y   HP  P R+     +++  GL              +M  
Sbjct: 23  AYSPRVSYHFNSKVSHYHYGVKHPMKPFRLMLTDHLVSSYGL------------HKIMDL 70

Query: 122 IPAREATDEEILQVHTPEHLEFLSKTTSMTREQL----LKETEKGDSVYFNNDSYLSAKL 177
              R AT +E+LQ H+ +++ FLSK +     +L    L+    GD      + Y    L
Sbjct: 71  YETRSATRDELLQFHSEDYVNFLSKVSPDNANKLPRGTLENFNIGDDCPIFQNLYDYTTL 130

Query: 178 SCGGAIEACRAVVEGRVKNALAVVRPPG-HHAEPDLAGGFCLFSNVAVAAQNILKNYPES 236
             G +++A R ++    ++ +A+    G HHA+ +   GFC  +++ ++  N+L+ +P  
Sbjct: 131 YTGASLDATRKLINN--QSDIAINWSGGLHHAKKNSPSGFCYVNDIVLSILNLLRYHP-- 186

Query: 237 VKKIMILDWDVHHGNGTQKAFYNDDRVLYVSLHRHELGKYYPGTIHGNADRVGEGKGEGF 296
             +I+ +D D+HHG+G Q+AFY  DRV  +S H++  G+++PGT  G+   +G  KG+ F
Sbjct: 187 --RILYIDIDLHHGDGVQEAFYTTDRVFTLSFHKYN-GEFFPGT--GDLTEIGCDKGKHF 241

Query: 297 NCNIPWPWKGVGDAEYIWAFEQVVLPMGREFQPDLVIISSGFDAADGDTVGQCHVTPSCY 356
             N+P    G+ D  YI  F+ +V P+   F+P L++   G D+   D +G  ++    +
Sbjct: 242 ALNVPLE-DGIDDDSYINLFKSIVDPLIITFKPTLIVQQCGADSLGHDRLGCFNLNIKAH 300

Query: 357 GHMTHMLKSLARGNICAVLEGGYSLDSIAK 386
           G     +KS     +  V  GGY+  ++++
Sbjct: 301 GECVKFVKSFGLP-MLVVGGGGYTPRNVSR 329

>CAGL0B01441g Chr2 complement(130216..131517) [1302 bp, 433 aa] {ON}
           highly similar to uniprot|P32561 Saccharomyces
           cerevisiae YNL330c RPD3 histone deacetylase B or
           uniprot|P53096 Saccharomyces cerevisiae YGL194c HOS2
          Length = 433

 Score =  136 bits (343), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 94/326 (28%), Positives = 162/326 (49%), Gaps = 28/326 (8%)

Query: 66  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIIDPTLSGVDDIGDLMLKIPAR 125
           R+ Y        + Y   HP  P RI   + ++   GL               M    A+
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLIMNYGLY------------KKMEIYRAK 67

Query: 126 EATDEEILQVHTPEHLEFLSKTTSMTREQLLKETEK---GDSVYFNNDSYLSAKLSCGGA 182
            AT +E+ Q HT E+++FLS+ T    E   KE+ K   GD     +  Y    +S GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLEMFKKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 183 IEACRAVVEGRVKNALAVVRPPG-HHAEPDLAGGFCLFSNVAVAAQNILKNYPESVKKIM 241
           +E    +  G+    +A+    G HHA+   A GFC  +++ +    +L+ +P    +++
Sbjct: 128 MEGAARLNRGKCD--VAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 242 ILDWDVHHGNGTQKAFYNDDRVLYVSLHRHELGKYYPGTIHGNADRVGEGKGEGFNCNIP 301
            +D DVHHG+G ++AFY  DRV+  S H++  G+++PGT  G    +G GKG+ +  N+P
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDIGVGKGKYYAVNVP 237

Query: 302 WPWKGVGDAEYIWAFEQVVLPMGREFQPDLVIISSGFDAADGDTVGQCHVTPSCYGHMTH 361
               G+ DA Y   FE V+  +   +QP  V++  G D+  GD +G  +++   + +  +
Sbjct: 238 L-RDGIDDATYRSVFEPVIGKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMEGHANCVN 296

Query: 362 MLKSLARGNICAVLEGGYSLDSIAKS 387
            +KS     +  V  GGY++ ++A++
Sbjct: 297 YVKSFGI-PMMVVGGGGYTMRNVART 321

>Kpol_1038.11 s1038 complement(25267..26568) [1302 bp, 433 aa] {ON}
           complement(25267..26568) [1302 nt, 434 aa]
          Length = 433

 Score =  136 bits (343), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 93/326 (28%), Positives = 161/326 (49%), Gaps = 28/326 (8%)

Query: 66  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIIDPTLSGVDDIGDLMLKIPAR 125
           R+ Y        + Y   HP  P RI   + ++   GL               M    A+
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLVMNYGLY------------KKMEIYRAK 67

Query: 126 EATDEEILQVHTPEHLEFLSKTTSMTREQLLKETEK---GDSVYFNNDSYLSAKLSCGGA 182
            AT +E+ Q HT E+++FLS+ T    +   KE+ K   GD     +  Y    +S GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLDMFKKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 183 IEACRAVVEGRVKNALAVVRPPG-HHAEPDLAGGFCLFSNVAVAAQNILKNYPESVKKIM 241
           +E    +  G+    +A+    G HHA+   A GFC  +++ +    +L+ +P    +++
Sbjct: 128 MEGAARLNRGKCD--VAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 242 ILDWDVHHGNGTQKAFYNDDRVLYVSLHRHELGKYYPGTIHGNADRVGEGKGEGFNCNIP 301
            +D DVHHG+G ++AFY  DRV+  S H++  G+++PGT  G     G GKG+ +  N+P
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDTGVGKGKNYAVNVP 237

Query: 302 WPWKGVGDAEYIWAFEQVVLPMGREFQPDLVIISSGFDAADGDTVGQCHVTPSCYGHMTH 361
               G+ DA Y   FE V+  +   +QP  V++  G D+  GD +G  +++   + +  +
Sbjct: 238 L-RDGIDDATYRAVFESVISKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMRGHANCVN 296

Query: 362 MLKSLARGNICAVLEGGYSLDSIAKS 387
            +KS     +  V  GGY++ ++A++
Sbjct: 297 FVKSFGI-PLMVVGGGGYTMRNVART 321

>Skud_7.79 Chr7 complement(146016..147374) [1359 bp, 452 aa] {ON}
           YGL194C (REAL)
          Length = 452

 Score =  137 bits (344), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 91/329 (27%), Positives = 164/329 (49%), Gaps = 28/329 (8%)

Query: 63  YDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIIDPTLSGVDDIGDLMLKI 122
           Y  R+ YH     S++ Y   HP  P R+     +++  GL              +M   
Sbjct: 24  YSPRVSYHFNPKVSHYHYGVKHPMKPFRLMLTDHLVSSYGL------------HKIMDLY 71

Query: 123 PAREATDEEILQVHTPEHLEFLSKTTSMTREQL----LKETEKGDSVYFNNDSYLSAKLS 178
             R AT +E+L+ H+ +++ FLSK +     +L    L+    GD      + Y    L 
Sbjct: 72  ETRSATRDELLEFHSEDYINFLSKVSPDNSNKLPRGTLENFNIGDDCPIFQNLYDYTTLY 131

Query: 179 CGGAIEACRAVVEGRVKNALAVVRPPG-HHAEPDLAGGFCLFSNVAVAAQNILKNYPESV 237
            G +++A R ++    ++ +A+    G HHA+ +   GFC  +++ ++  N+L+ +P   
Sbjct: 132 TGASLDATRKLINN--QSDIAINWSGGLHHAKKNSPSGFCYVNDIVLSILNLLRYHP--- 186

Query: 238 KKIMILDWDVHHGNGTQKAFYNDDRVLYVSLHRHELGKYYPGTIHGNADRVGEGKGEGFN 297
            +I+ +D D+HHG+G Q+AFY  DRV  +S H++  G+++PGT  G+   +G  KG+ F 
Sbjct: 187 -RILYIDIDLHHGDGVQEAFYTTDRVFTLSFHKYN-GEFFPGT--GDLTEIGCDKGKHFA 242

Query: 298 CNIPWPWKGVGDAEYIWAFEQVVLPMGREFQPDLVIISSGFDAADGDTVGQCHVTPSCYG 357
            N+P    G+ D  YI  F+ +V P+   F+P L++   G D+   D +G  ++    +G
Sbjct: 243 LNVPLE-DGIDDDSYINLFKSIVDPLIMTFKPTLIVQQCGADSLGHDRLGCFNLNIKAHG 301

Query: 358 HMTHMLKSLARGNICAVLEGGYSLDSIAK 386
                +KS     +  V  GGY+  ++++
Sbjct: 302 ECVKFVKSFGLP-MLVVGGGGYTPRNVSR 329

>KAFR0A08630 Chr1 (1731077..1732378) [1302 bp, 433 aa] {ON} Anc_3.8
           YNL330C
          Length = 433

 Score =  136 bits (343), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 95/328 (28%), Positives = 163/328 (49%), Gaps = 32/328 (9%)

Query: 66  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIIDPTLSGVDDIGDLMLKIPAR 125
           R+ Y        + Y   HP  P RI   + ++   GL               M    A+
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLIMNYGLY------------KKMEIYRAK 67

Query: 126 EATDEEILQVHTPEHLEFLSKTTSMTREQLLKETEK---GDSVYFNNDSYLSAKLSCGGA 182
            AT +E+ Q HT E+++FLS+ T    +   KE+ K   GD     +  Y    +S GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLDMFKKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 183 IEACRAVVEGRVKNALAVVRPPG-HHAEPDLAGGFCLFSNVAVAAQNILKNYPESVKKIM 241
           +E    +  G+    +A+    G HHA+   A GFC  +++ +    +L+ +P    +++
Sbjct: 128 MEGAARLNRGKCD--IAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 242 ILDWDVHHGNGTQKAFYNDDRVLYVSLHRHELGKYYPGTIHGNADRVGEGKGEGFNCNIP 301
            +D DVHHG+G ++AFY  DRV+  S H++  G+++PGT  G    +G GKG+ +  N+P
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDIGVGKGKNYAVNVP 237

Query: 302 WPWKGVGDAEYIWAFEQVVLPMGREFQPDLVIISSGFDAADGDTVGQCHVTPSCYGHMTH 361
               G+ DA Y   FE V+  +   +QP  V++  G D+  GD +G  +++   + +  +
Sbjct: 238 L-RDGIDDATYKSVFEPVIGKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMQGHANCVN 296

Query: 362 MLKSLARGNI--CAVLEGGYSLDSIAKS 387
            +KS    NI    V  GGY++ ++A++
Sbjct: 297 YVKSF---NIPMMVVGGGGYTMRNVART 321

>Kwal_55.22142 s55 (1130691..1131989) [1299 bp, 432 aa] {ON} YNL330C
           (RPD3) - histone deacetylase [contig 124] FULL
          Length = 432

 Score =  136 bits (343), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 97/341 (28%), Positives = 167/341 (48%), Gaps = 28/341 (8%)

Query: 51  KLHYTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIIDPTLS 110
           +L +  LK       R+ Y      S + Y   HP  P RI   + ++   GL       
Sbjct: 5   QLPFDELKVKSTNKERVAYFYDSDVSNYSYGASHPMKPARIRMAHSLVMNYGLY------ 58

Query: 111 GVDDIGDLMLKIPAREATDEEILQVHTPEHLEFLSKTTSMTREQLLKETEK---GDSVYF 167
                   M    A+ AT +E+ Q HT E+++FLS+ T    E   KE+ K   GD    
Sbjct: 59  ------KKMEIYRAKPATKQEMCQFHTDEYIDFLSRVTPDNLEMFQKESVKFNVGDDCPV 112

Query: 168 NNDSYLSAKLSCGGAIEACRAVVEGRVKNALAVVRPPG-HHAEPDLAGGFCLFSNVAVAA 226
            +  Y    +S GG++E    +  G+    +A+    G HHA+   A GFC  +++ +  
Sbjct: 113 FDGLYEYCSISGGGSMEGAARLNRGKCD--VAINYAGGLHHAKKSEASGFCYLNDIVLGI 170

Query: 227 QNILKNYPESVKKIMILDWDVHHGNGTQKAFYNDDRVLYVSLHRHELGKYYPGTIHGNAD 286
             +L+ +P    +++ +D DVHHG+G ++AFY  DRV+  S H++  G+++PGT  G   
Sbjct: 171 IELLRYHP----RVLYIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELR 222

Query: 287 RVGEGKGEGFNCNIPWPWKGVGDAEYIWAFEQVVLPMGREFQPDLVIISSGFDAADGDTV 346
             G GKG+ +  N+P    G+ D+ Y   FE V+  +   +QP  V++  G D+  GD +
Sbjct: 223 DTGVGKGKYYAVNVPL-RDGIDDSTYKSVFEPVIGKIMEWYQPSAVVLQCGGDSLSGDRL 281

Query: 347 GQCHVTPSCYGHMTHMLKSLARGNICAVLEGGYSLDSIAKS 387
           G  +++   + +  + +KS     +  V  GGY++ ++A++
Sbjct: 282 GCFNLSMRGHANCVNYVKSFGI-PMLVVGGGGYTMRNVART 321

>Kwal_55.20790 s55 complement(559958..561307) [1350 bp, 449 aa] {ON}
           YGL194C (HOS2) - (putative) histone deacetylase [contig
           139] FULL
          Length = 449

 Score =  136 bits (343), Expect = 9e-34,   Method: Compositional matrix adjust.
 Identities = 91/335 (27%), Positives = 166/335 (49%), Gaps = 28/335 (8%)

Query: 57  LKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIIDPTLSGVDDIG 116
            + G  +   + YH     S F Y   HP  P R+     +++  GL             
Sbjct: 18  FEFGASHQPAVSYHFNDDVSQFHYGVKHPMKPFRLMLTDHLVSSYGL------------H 65

Query: 117 DLMLKIPAREATDEEILQVHTPEHLEFLSKTTSMTREQL----LKETEKGDSVYFNNDSY 172
            +M     R AT EE+ + H+ +++EFL++ +     +L    L++   GD        Y
Sbjct: 66  KIMDLYETRPATREELCEFHSEDYVEFLARVSPDNLAKLPRGSLEKFNIGDDCPIFQGLY 125

Query: 173 LSAKLSCGGAIEACRAVVEGRVKNALAVVRPPG-HHAEPDLAGGFCLFSNVAVAAQNILK 231
             + L  G +++A R ++ G  ++ +A+    G HHA+     GFC  +++ ++  N+L+
Sbjct: 126 QYSTLYAGASLDATRKLING--QSEIAINWSGGLHHAKKSNPSGFCYVNDIVLSVLNLLR 183

Query: 232 NYPESVKKIMILDWDVHHGNGTQKAFYNDDRVLYVSLHRHELGKYYPGTIHGNADRVGEG 291
            +P    +++ +D D+HHG+G Q+AFY  DRV  VS H++  G+++PGT  GN D +G  
Sbjct: 184 YHP----RVLYIDIDLHHGDGVQEAFYTTDRVFTVSFHKYN-GEFFPGT--GNLDEIGCS 236

Query: 292 KGEGFNCNIPWPWKGVGDAEYIWAFEQVVLPMGREFQPDLVIISSGFDAADGDTVGQCHV 351
           +G+ F  N+P    G+ D  YI  F+ ++ P+   F+P ++I   G D+   D +G  ++
Sbjct: 237 RGKHFALNVPLD-DGIDDDSYINLFKSIIDPLITSFKPTVIIQQCGADSLGHDRLGCFNL 295

Query: 352 TPSCYGHMTHMLKSLARGNICAVLEGGYSLDSIAK 386
               +G     +KS     +  V  GGY+  ++++
Sbjct: 296 NVKAHGECVKYVKSFGL-PMLVVGGGGYTPRNVSR 329

>TBLA0I00560 Chr9 (100393..101694) [1302 bp, 433 aa] {ON} Anc_3.8
           YNL330C
          Length = 433

 Score =  135 bits (341), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 94/328 (28%), Positives = 162/328 (49%), Gaps = 32/328 (9%)

Query: 66  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIIDPTLSGVDDIGDLMLKIPAR 125
           R+ Y        + Y   HP  P RI   + ++   GL  +            M    A+
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLIMNYGLYKN------------MEIYRAK 67

Query: 126 EATDEEILQVHTPEHLEFLSKTTSMTREQLLKETEK---GDSVYFNNDSYLSAKLSCGGA 182
            AT +E+ Q HT E+++FLS+ T    +   KE+ K   GD     +  Y    +S GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLDMFKKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 183 IEACRAVVEGRVKNALAVVRPPG-HHAEPDLAGGFCLFSNVAVAAQNILKNYPESVKKIM 241
           +E    +  G+    +A+    G HHA+   A GFC  +++ +    +L+ +P    +++
Sbjct: 128 MEGAARLNRGKCD--VAINYAGGLHHAKKSEASGFCFLNDIVLGIIELLRYHP----RVL 181

Query: 242 ILDWDVHHGNGTQKAFYNDDRVLYVSLHRHELGKYYPGTIHGNADRVGEGKGEGFNCNIP 301
            +D DVHHG+G ++AFY  DRV+  S H++  G+++PGT  G     G G G+ +  N+P
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDTGVGNGKNYAVNVP 237

Query: 302 WPWKGVGDAEYIWAFEQVVLPMGREFQPDLVIISSGFDAADGDTVGQCHVTPSCYGHMTH 361
               G+ DA Y   FE V+  +   +QP  V++  G D+  GD +G  +++   + +  +
Sbjct: 238 L-RDGIDDATYRSVFEPVISKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMQGHANCVN 296

Query: 362 MLKSLARGNI--CAVLEGGYSLDSIAKS 387
            +KS    NI    V  GGY++ ++A++
Sbjct: 297 FVKSF---NIPMMVVGGGGYTMRNVART 321

>TBLA0D02140 Chr4 complement(539873..541243) [1371 bp, 456 aa] {ON}
           Anc_8.153 YGL194C
          Length = 456

 Score =  136 bits (342), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 95/333 (28%), Positives = 166/333 (49%), Gaps = 30/333 (9%)

Query: 60  GLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIIDPTLSGVDDIGDLM 119
           G  Y  R+ YH     S + +   HP  P R+           ++ D  +SG   +  +M
Sbjct: 23  GSTYAPRVSYHFNPKVSSYHFGVRHPMKPFRL-----------MLTDHLVSGYG-LHKIM 70

Query: 120 LKIPAREATDEEILQVHTPEHLEFLSKTT-----SMTREQLLKETEKGDSVYFNNDSYLS 174
                R+A+D+E+L+ HT +++ FL K        M R  L K     D   F+N  Y  
Sbjct: 71  DLYETRKASDDELLEFHTDDYINFLKKVNPDNVNKMPRGTLDKFNIGDDCPIFHN-LYEY 129

Query: 175 AKLSCGGAIEACRAVVEGRVKNALAVVRPPG-HHAEPDLAGGFCLFSNVAVAAQNILKNY 233
           + L  G +++A R ++ G  ++ +A+    G HHA+     GFC  +++ ++  N+L+ +
Sbjct: 130 SSLYTGASLDASRKLLNG--QSDIAINWSGGLHHAKKTSPSGFCYINDIVLSILNLLRFH 187

Query: 234 PESVKKIMILDWDVHHGNGTQKAFYNDDRVLYVSLHRHELGKYYPGTIHGNADRVGEGKG 293
           P    +++ +D D+HHG+G Q+AFY  DRV  VS H++  G+++PGT  GN D  G   G
Sbjct: 188 P----RVLYIDIDLHHGDGVQEAFYTTDRVYTVSFHKYN-GEFFPGT--GNYDETGCSNG 240

Query: 294 EGFNCNIPWPWKGVGDAEYIWAFEQVVLPMGREFQPDLVIISSGFDAADGDTVGQCHVTP 353
           + F  N+P    G+ D  YI  F+ ++ P+   + P ++I   G D+   D +G  ++  
Sbjct: 241 KHFALNVPLK-DGIDDDSYINLFKSIIDPLITSYNPTVIIQQCGADSLGHDRLGCFNLNI 299

Query: 354 SCYGHMTHMLKSLARGNICAVLEGGYSLDSIAK 386
             +G     +KS     +  V  GGY+  ++++
Sbjct: 300 KAHGECVKFVKSFGIP-MLVVGGGGYTPKNVSR 331

>AGR395W Chr7 (1455659..1456960) [1302 bp, 433 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL330C (RPD3)
          Length = 433

 Score =  135 bits (341), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 93/326 (28%), Positives = 162/326 (49%), Gaps = 28/326 (8%)

Query: 66  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIIDPTLSGVDDIGDLMLKIPAR 125
           R+ Y        + Y   HP  P RI   + ++   GL               M    A+
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLIMNYGLY------------KKMEIYRAK 67

Query: 126 EATDEEILQVHTPEHLEFLSKTTSMTREQLLKETEK---GDSVYFNNDSYLSAKLSCGGA 182
            AT +E+ Q HT E+++FLS+ T    +   KE+ K   GD     +  Y    +S GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLDMFQKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 183 IEACRAVVEGRVKNALAVVRPPG-HHAEPDLAGGFCLFSNVAVAAQNILKNYPESVKKIM 241
           +E    +  G+    +A+    G HHA+   A GFC  +++ +    +L+ +P    +++
Sbjct: 128 MEGAARLNRGKCD--VAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 242 ILDWDVHHGNGTQKAFYNDDRVLYVSLHRHELGKYYPGTIHGNADRVGEGKGEGFNCNIP 301
            +D DVHHG+G ++AFY  DRV+  S H++  G+++PGT  G     G GKG+ ++ N+P
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDTGVGKGKYYSVNVP 237

Query: 302 WPWKGVGDAEYIWAFEQVVLPMGREFQPDLVIISSGFDAADGDTVGQCHVTPSCYGHMTH 361
               G+ DA Y   FE V+  +   +QP  V++  G D+  GD +G  +++   + +  +
Sbjct: 238 L-RDGIDDATYKSVFEPVIGKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMRGHANCVN 296

Query: 362 MLKSLARGNICAVLEGGYSLDSIAKS 387
            +KS     +  V  GGY++ ++A++
Sbjct: 297 YVKSFGI-PMMVVGGGGYTMRNVART 321

>NCAS0C04320 Chr3 (887622..888926) [1305 bp, 434 aa] {ON} Anc_3.8
          Length = 434

 Score =  135 bits (341), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 94/326 (28%), Positives = 161/326 (49%), Gaps = 28/326 (8%)

Query: 66  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIIDPTLSGVDDIGDLMLKIPAR 125
           R+ Y        + Y   HP  P RI   + ++   GL               M    A+
Sbjct: 21  RVAYFYDADVGNYAYGSGHPMKPHRIRMTHSLVMNYGLY------------KKMEIYRAK 68

Query: 126 EATDEEILQVHTPEHLEFLSKTTSMTREQLLKETEK---GDSVYFNNDSYLSAKLSCGGA 182
            AT +E+ Q HT E+++FLS+ T    E   KE+ K   GD     +  Y    +S GG+
Sbjct: 69  PATKQEMCQFHTDEYIDFLSRVTPDNLEMFKKESVKFNVGDDCPVFDGLYEYCSISGGGS 128

Query: 183 IEACRAVVEGRVKNALAVVRPPG-HHAEPDLAGGFCLFSNVAVAAQNILKNYPESVKKIM 241
           +E    +  G+    +A+    G HHA+   A GFC  +++ +    +L+ +P    +++
Sbjct: 129 MEGAARLNRGKCD--VAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRFHP----RVL 182

Query: 242 ILDWDVHHGNGTQKAFYNDDRVLYVSLHRHELGKYYPGTIHGNADRVGEGKGEGFNCNIP 301
            +D DVHHG+G ++AFY  DRV+  S H++  G+++PGT  G     G GKG+ +  N+P
Sbjct: 183 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDTGVGKGKYYAVNVP 238

Query: 302 WPWKGVGDAEYIWAFEQVVLPMGREFQPDLVIISSGFDAADGDTVGQCHVTPSCYGHMTH 361
               G+ DA Y   FE V+  +   +QP  V++  G D+  GD +G  +++   + +  +
Sbjct: 239 L-RDGIDDATYRNVFEPVIKRIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMQGHANCVN 297

Query: 362 MLKSLARGNICAVLEGGYSLDSIAKS 387
            +KS     +  V  GGY++ ++A++
Sbjct: 298 YVKSFGI-PMMVVGGGGYTMRNVART 322

>Ecym_2010 Chr2 complement(12699..14000) [1302 bp, 433 aa] {ON}
           similar to Ashbya gossypii AGR395W
          Length = 433

 Score =  135 bits (340), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 93/326 (28%), Positives = 162/326 (49%), Gaps = 28/326 (8%)

Query: 66  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIIDPTLSGVDDIGDLMLKIPAR 125
           R+ Y        + Y   HP  P RI   + ++   GL               M    A+
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLIMNYGLY------------KKMEIYRAK 67

Query: 126 EATDEEILQVHTPEHLEFLSKTTSMTREQLLKETEK---GDSVYFNNDSYLSAKLSCGGA 182
            AT +E+ Q HT E+++FLS+ T    +   KE+ K   GD     +  Y    +S GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLDMFQKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 183 IEACRAVVEGRVKNALAVVRPPG-HHAEPDLAGGFCLFSNVAVAAQNILKNYPESVKKIM 241
           +E    +  G+    +A+    G HHA+   A GFC  +++ +    +L+ +P    +++
Sbjct: 128 MEGAARLNRGKCD--VAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 242 ILDWDVHHGNGTQKAFYNDDRVLYVSLHRHELGKYYPGTIHGNADRVGEGKGEGFNCNIP 301
            +D DVHHG+G ++AFY  DRV+  S H++  G+++PGT  G     G GKG+ ++ N+P
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDTGVGKGKYYSVNVP 237

Query: 302 WPWKGVGDAEYIWAFEQVVLPMGREFQPDLVIISSGFDAADGDTVGQCHVTPSCYGHMTH 361
               G+ DA Y   FE V+  +   +QP  V++  G D+  GD +G  +++   + +  +
Sbjct: 238 L-RDGIDDATYKSVFEPVIGKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMRGHANCVN 296

Query: 362 MLKSLARGNICAVLEGGYSLDSIAKS 387
            +KS     +  V  GGY++ ++A++
Sbjct: 297 YVKSFGI-PMMVVGGGGYTMRNVART 321

>Kpol_246.5 s246 (11759..13120) [1362 bp, 453 aa] {ON}
           (11759..13120) [1362 nt, 454 aa]
          Length = 453

 Score =  135 bits (341), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 100/367 (27%), Positives = 176/367 (47%), Gaps = 35/367 (9%)

Query: 57  LKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIIDPTLSGVDDIG 116
            + G  Y  R+ YH     S + Y   HP  P R+     +++  GL             
Sbjct: 22  FEFGSAYCPRVSYHFNPKVSNYHYGVKHPMKPFRLMLTDHLVSSYGL------------H 69

Query: 117 DLMLKIPAREATDEEILQVHTPEHLEFLSKTT-----SMTREQLLKETEKGDSVYFNNDS 171
            +M     R AT +E+L  H+ +++ FL K T      M R  L K     D   F N  
Sbjct: 70  KIMDLYETRSATKDELLDFHSDDYVSFLQKVTPENLSKMPRGTLEKYNIGDDCPIFQN-L 128

Query: 172 YLSAKLSCGGAIEACRAVVEGRVKNALAVVRPPG-HHAEPDLAGGFCLFSNVAVAAQNIL 230
           Y  + L  G +++A R ++    ++ +A+    G HHA+     GFC  +++ +A  N+L
Sbjct: 129 YDYSALYAGASLDASRKLINN--QSDIAINWSGGLHHAKKTNPSGFCYVNDIVLAILNLL 186

Query: 231 KNYPESVKKIMILDWDVHHGNGTQKAFYNDDRVLYVSLHRHELGKYYPGTIHGNADRVGE 290
           + +P    +++ +D D+HHG+G Q+AFY  DRV  +S H++  G+++PGT  GN D +G 
Sbjct: 187 RYHP----RVLYIDIDLHHGDGVQEAFYTTDRVFTISFHKYN-GEFFPGT--GNYDEIGC 239

Query: 291 GKGEGFNCNIPWPWKGVGDAEYIWAFEQVVLPMGREFQPDLVIISSGFDAADGDTVGQCH 350
            +G+ F  N+P    G+ D  YI  F+ ++ P+   ++P ++I   G D+   D +G  +
Sbjct: 240 AQGKHFAMNVPLE-DGIDDDSYINLFKSIIDPLITSYKPTVIIQQCGADSLGHDRLGCFN 298

Query: 351 VTPSCYGHMTHMLKSLARGNICAVLEGGYSLDSIAK---SALGVAK--VLIGEPPDELPV 405
           +    +G     ++S     +  V  GGY+  ++++      GV    +L  E P+++P 
Sbjct: 299 LNIKAHGECVKFIRSFGIP-MLVVGGGGYTPRNVSRLWTYETGVLNNVLLPAELPEDIPF 357

Query: 406 VKQPKPE 412
                P+
Sbjct: 358 RDSFGPD 364

>Smik_14.2 Chr14 complement(2435..3736) [1302 bp, 433 aa] {ON}
           YNL330C (REAL)
          Length = 433

 Score =  135 bits (340), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 93/326 (28%), Positives = 161/326 (49%), Gaps = 28/326 (8%)

Query: 66  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIIDPTLSGVDDIGDLMLKIPAR 125
           R+ Y        + Y   HP  P RI   + ++   GL               M    A+
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMAHSLIMNYGLY------------KKMEIYRAK 67

Query: 126 EATDEEILQVHTPEHLEFLSKTTSMTREQLLKETEK---GDSVYFNNDSYLSAKLSCGGA 182
            AT +E+ Q HT E+++FLS+ T    E   +E+ K   GD     +  Y    +S GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLEMFKRESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 183 IEACRAVVEGRVKNALAVVRPPG-HHAEPDLAGGFCLFSNVAVAAQNILKNYPESVKKIM 241
           +E    +  G+    +AV    G HHA+   A GFC  +++ +    +L+ +P    +++
Sbjct: 128 MEGAARLNRGKCD--VAVNYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 242 ILDWDVHHGNGTQKAFYNDDRVLYVSLHRHELGKYYPGTIHGNADRVGEGKGEGFNCNIP 301
            +D DVHHG+G ++AFY  DRV+  S H++  G+++PGT  G    +G G G+ +  N+P
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDIGVGTGKNYAVNVP 237

Query: 302 WPWKGVGDAEYIWAFEQVVLPMGREFQPDLVIISSGFDAADGDTVGQCHVTPSCYGHMTH 361
               G+ DA Y   FE V+  +   +QP  V++  G D+  GD +G  +++   + +  +
Sbjct: 238 L-RDGIDDATYRSVFEPVIKKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMEGHANCVN 296

Query: 362 MLKSLARGNICAVLEGGYSLDSIAKS 387
            +KS     +  V  GGY++ ++A++
Sbjct: 297 YVKSFGI-PMMVVGGGGYTMRNVART 321

>KLTH0F19668g Chr6 (1595709..1597007) [1299 bp, 432 aa] {ON} highly
           similar to uniprot|P32561 Saccharomyces cerevisiae
           YNL330C RPD3 Histone deacetylase regulates transcription
           and silencing
          Length = 432

 Score =  135 bits (339), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 96/341 (28%), Positives = 167/341 (48%), Gaps = 28/341 (8%)

Query: 51  KLHYTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIIDPTLS 110
           +L +  LK       R+ Y      S + Y   HP  P RI   + ++   GL       
Sbjct: 5   QLPFDDLKVKSTNKERVAYFYDSDVSNYSYGASHPMKPARIRMAHSLVMNYGLY------ 58

Query: 111 GVDDIGDLMLKIPAREATDEEILQVHTPEHLEFLSKTTSMTREQLLKETEK---GDSVYF 167
                   M    A+ AT +E+ Q H+ E+++FLS+ T    E   KE+ K   GD    
Sbjct: 59  ------KKMEIYRAKPATKQEMCQFHSDEYIDFLSRVTPDNLEMFQKESVKFNVGDDCPV 112

Query: 168 NNDSYLSAKLSCGGAIEACRAVVEGRVKNALAVVRPPG-HHAEPDLAGGFCLFSNVAVAA 226
            +  Y    +S GG++E    +  G+    +A+    G HHA+   A GFC  +++ +  
Sbjct: 113 FDGLYEYCSISGGGSMEGAARLNRGKCD--VAINYAGGLHHAKKSEASGFCYLNDIVLGI 170

Query: 227 QNILKNYPESVKKIMILDWDVHHGNGTQKAFYNDDRVLYVSLHRHELGKYYPGTIHGNAD 286
             +L+ +P    +++ +D DVHHG+G ++AFY  DRV+  S H++  G+++PGT  G   
Sbjct: 171 IELLRYHP----RVLYIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELR 222

Query: 287 RVGEGKGEGFNCNIPWPWKGVGDAEYIWAFEQVVLPMGREFQPDLVIISSGFDAADGDTV 346
             G GKG+ ++ N+P    G+ D  Y   FE V+  +   +QP  V++  G D+  GD +
Sbjct: 223 DTGVGKGKYYSVNVPL-RDGIDDTTYKSVFEPVIGKIMEWYQPSAVVLQCGGDSLSGDRL 281

Query: 347 GQCHVTPSCYGHMTHMLKSLARGNICAVLEGGYSLDSIAKS 387
           G  +++   + +  + +KS     +  V  GGY++ ++A++
Sbjct: 282 GCFNLSMRGHANCVNYVKSFGI-PMLVVGGGGYTMRNVART 321

>CAGL0A03322g Chr1 (338516..339868) [1353 bp, 450 aa] {ON} highly
           similar to uniprot|P53096 Saccharomyces cerevisiae
           YGL194c HOS2 or uniprot|P32561 Saccharomyces cerevisiae
           YNL330c RPD3
          Length = 450

 Score =  135 bits (340), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 99/370 (26%), Positives = 183/370 (49%), Gaps = 34/370 (9%)

Query: 54  YTPL-KTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIIDPTLSGV 112
           + PL + G  Y  R+ YH     S++ Y   HP  P R+           ++ D  +SG 
Sbjct: 14  FQPLYEFGSNYAPRVSYHINPEVSHYHYGVRHPMKPFRL-----------MLTDHLVSGY 62

Query: 113 DDIGDLMLKIPAREATDEEILQVHTPEHLEFLSKTTSMTREQL----LKETEKGDSVYFN 168
             +  +M     R+AT EE+ + H+ +++ FLSK T     +L    L++   GD     
Sbjct: 63  G-LHKIMDLYKTRKATAEEMEEFHSEDYVNFLSKVTPENLSKLPRGTLEKFNIGDDCPIF 121

Query: 169 NDSYLSAKLSCGGAIEACRAVVEGRVKNALAVVRPPG-HHAEPDLAGGFCLFSNVAVAAQ 227
            + +  + L  G +++A R ++    ++ +A+    G HHA+ +   GFC  +++ +A  
Sbjct: 122 PNIFQYSSLYTGASLDASRKLINN--QSDIAINWSGGLHHAKKNSPSGFCYINDIVLAIL 179

Query: 228 NILKNYPESVKKIMILDWDVHHGNGTQKAFYNDDRVLYVSLHRHELGKYYPGTIHGNADR 287
           N+L+ +P    +++ +D D+HHG+G Q+AFY  DRV  +S H++  G+++PGT  G  D 
Sbjct: 180 NLLRYHP----RVLYIDIDLHHGDGVQEAFYTTDRVYTISFHKYN-GEFFPGT--GKNDE 232

Query: 288 VGEGKGEGFNCNIPWPWKGVGDAEYIWAFEQVVLPMGREFQPDLVIISSGFDAADGDTVG 347
            G   G+ F  N+P    G+ D  YI  F+ ++ P+   F+P +++   G D+   D +G
Sbjct: 233 TGCADGKHFAMNVPLE-DGIDDDSYINLFKSIIDPLITTFKPTVILQQCGADSLGHDRLG 291

Query: 348 QCHVTPSCYGHMTHMLKSLARGNICAVLEGGYSLDSIAK-----SALGVAKVLIGEPPDE 402
             ++    +G     ++S     +  V  GGY+  ++++     + +    +L  E PD 
Sbjct: 292 CFNLNIKAHGECVKFVRSFGIP-MLVVGGGGYTPRNVSRLWTYETGILNNVLLPEELPDN 350

Query: 403 LPVVKQPKPE 412
           LP  +   P+
Sbjct: 351 LPFKESFGPD 360

>ZYRO0C03498g Chr3 (278064..279365) [1302 bp, 433 aa] {ON} highly
           similar to uniprot|P32561 Saccharomyces cerevisiae
           YNL330C RPD3 Histone deacetylase regulates transcription
           and silencing
          Length = 433

 Score =  135 bits (339), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 94/326 (28%), Positives = 161/326 (49%), Gaps = 28/326 (8%)

Query: 66  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIIDPTLSGVDDIGDLMLKIPAR 125
           R+ Y        + Y   HP  P RI   + ++   GL               M    A+
Sbjct: 20  RVAYFYDADVGNYNYGAGHPMKPHRIRMTHSLIMNYGLY------------KKMEIYRAK 67

Query: 126 EATDEEILQVHTPEHLEFLSKTTSMTREQLLKETEK---GDSVYFNNDSYLSAKLSCGGA 182
            AT +E+ Q HT E+++FLS+ T    +   KE+ K   GD     +  Y    +S GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLDMFKKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 183 IEACRAVVEGRVKNALAVVRPPG-HHAEPDLAGGFCLFSNVAVAAQNILKNYPESVKKIM 241
           +E    +  G+    +A+    G HHA+   A GFC  +++ +    +L+ +P    +++
Sbjct: 128 MEGAARLNRGKCD--VAINYAGGLHHAKKTEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 242 ILDWDVHHGNGTQKAFYNDDRVLYVSLHRHELGKYYPGTIHGNADRVGEGKGEGFNCNIP 301
            +D DVHHG+G ++AFY  DRV+  S H++  G+++PGT  G     G GKG+ +  N+P
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDTGVGKGKYYAVNVP 237

Query: 302 WPWKGVGDAEYIWAFEQVVLPMGREFQPDLVIISSGFDAADGDTVGQCHVTPSCYGHMTH 361
               G+ DA Y   FE VV  +   +QP  V++  G D+  GD +G  +++   + +  +
Sbjct: 238 L-RDGIDDATYKSVFEPVVSRIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSIRGHANCVN 296

Query: 362 MLKSLARGNICAVLEGGYSLDSIAKS 387
            +KS     +  V  GGY++ ++A++
Sbjct: 297 FVKSFGL-PMMIVGGGGYTMRNVART 321

>YNL330C Chr14 complement(18001..19302) [1302 bp, 433 aa] {ON}
           RPD3Histone deacetylase; regulates transcription,
           silencing, and other processes by influencing chromatin
           remodeling; forms at least two different complexes which
           have distinct functions and members
          Length = 433

 Score =  135 bits (339), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 93/326 (28%), Positives = 161/326 (49%), Gaps = 28/326 (8%)

Query: 66  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIIDPTLSGVDDIGDLMLKIPAR 125
           R+ Y        + Y   HP  P RI   + ++   GL               M    A+
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMAHSLIMNYGLY------------KKMEIYRAK 67

Query: 126 EATDEEILQVHTPEHLEFLSKTTSMTREQLLKETEK---GDSVYFNNDSYLSAKLSCGGA 182
            AT +E+ Q HT E+++FLS+ T    E   +E+ K   GD     +  Y    +S GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLEMFKRESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 183 IEACRAVVEGRVKNALAVVRPPG-HHAEPDLAGGFCLFSNVAVAAQNILKNYPESVKKIM 241
           +E    +  G+    +AV    G HHA+   A GFC  +++ +    +L+ +P    +++
Sbjct: 128 MEGAARLNRGKCD--VAVNYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 242 ILDWDVHHGNGTQKAFYNDDRVLYVSLHRHELGKYYPGTIHGNADRVGEGKGEGFNCNIP 301
            +D DVHHG+G ++AFY  DRV+  S H++  G+++PGT  G    +G G G+ +  N+P
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDIGVGAGKNYAVNVP 237

Query: 302 WPWKGVGDAEYIWAFEQVVLPMGREFQPDLVIISSGFDAADGDTVGQCHVTPSCYGHMTH 361
               G+ DA Y   FE V+  +   +QP  V++  G D+  GD +G  +++   + +  +
Sbjct: 238 L-RDGIDDATYRSVFEPVIKKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMEGHANCVN 296

Query: 362 MLKSLARGNICAVLEGGYSLDSIAKS 387
            +KS     +  V  GGY++ ++A++
Sbjct: 297 YVKSFGI-PMMVVGGGGYTMRNVART 321

>TPHA0A00300 Chr1 complement(40868..42169) [1302 bp, 433 aa] {ON}
           Anc_3.8 YNL330C
          Length = 433

 Score =  135 bits (339), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 95/328 (28%), Positives = 163/328 (49%), Gaps = 32/328 (9%)

Query: 66  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIIDPTLSGVDDIGDLMLKIPAR 125
           R+ Y        + Y   HP  P RI   + ++   GL               M    A+
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLVMNYGLY------------KKMEIYRAK 67

Query: 126 EATDEEILQVHTPEHLEFLSKTTSMTREQLLKETEK---GDSVYFNNDSYLSAKLSCGGA 182
            AT +E+ Q HT E+++FLS+ T    +   KE+ K   GD     +  +    +S GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLDMFKKESVKFNVGDDCPVFDGLFEYCSISGGGS 127

Query: 183 IEACRAVVEGRVKNALAVVRPPG-HHAEPDLAGGFCLFSNVAVAAQNILKNYPESVKKIM 241
           +E    +  G+    +A+    G HHA+   A GFC  +++ +    +L+ +P    +++
Sbjct: 128 MEGAARLNRGKCD--VAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 242 ILDWDVHHGNGTQKAFYNDDRVLYVSLHRHELGKYYPGTIHGNADRVGEGKGEGFNCNIP 301
            +D DVHHG+G ++AFY  DRV+  S H++  G+++PGT  G    VG GKG+ +  N+P
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDVGIGKGKNYAVNVP 237

Query: 302 WPWKGVGDAEYIWAFEQVVLPMGREFQPDLVIISSGFDAADGDTVGQCHVTPSCYGHMTH 361
               G+ DA Y   FE V+  +   +QP  V++  G D+  GD +G  +++   + +  +
Sbjct: 238 L-RDGMDDATYRSVFESVISKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMRGHANCVN 296

Query: 362 MLKSLARGNI--CAVLEGGYSLDSIAKS 387
            +KS    NI    V  GGY++ ++A++
Sbjct: 297 FVKSF---NIPMMVVGGGGYTMRNVART 321

>SAKL0C13706g Chr3 (1207800..1209101) [1302 bp, 433 aa] {ON} highly
           similar to uniprot|P32561 Saccharomyces cerevisiae
           YNL330C RPD3 Histone deacetylase regulates transcription
           and silencing
          Length = 433

 Score =  135 bits (339), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 93/326 (28%), Positives = 161/326 (49%), Gaps = 28/326 (8%)

Query: 66  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIIDPTLSGVDDIGDLMLKIPAR 125
           R+ Y        + Y   HP  P RI   + ++   GL               M    A+
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLIMNYGLY------------KKMEIYRAK 67

Query: 126 EATDEEILQVHTPEHLEFLSKTTSMTREQLLKETEK---GDSVYFNNDSYLSAKLSCGGA 182
            AT +E+ Q HT E+++FLS+ T        KE+ K   GD     +  Y    +S GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLNMFQKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 183 IEACRAVVEGRVKNALAVVRPPG-HHAEPDLAGGFCLFSNVAVAAQNILKNYPESVKKIM 241
           +E    +  G+    +A+    G HHA+   A GFC  +++ +    +L+ +P    +++
Sbjct: 128 MEGAARLNRGKCD--VAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 242 ILDWDVHHGNGTQKAFYNDDRVLYVSLHRHELGKYYPGTIHGNADRVGEGKGEGFNCNIP 301
            +D DVHHG+G ++AFY  DRV+  S H++  G+++PGT  G     G GKG+ ++ N+P
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDTGVGKGKYYSVNVP 237

Query: 302 WPWKGVGDAEYIWAFEQVVLPMGREFQPDLVIISSGFDAADGDTVGQCHVTPSCYGHMTH 361
               G+ DA Y   FE V+  +   +QP  V++  G D+  GD +G  +++   + +  +
Sbjct: 238 L-RDGIDDATYKSVFEPVIGKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMKGHANCVN 296

Query: 362 MLKSLARGNICAVLEGGYSLDSIAKS 387
            +KS     +  V  GGY++ ++A++
Sbjct: 297 YVKSFGI-PMMVVGGGGYTMRNVART 321

>KLLA0E01981g Chr5 complement(186177..187475) [1299 bp, 432 aa] {ON}
           highly similar to uniprot|P32561 Saccharomyces
           cerevisiae YNL330C RPD3 Histone deacetylase regulates
           transcription and silencing
          Length = 432

 Score =  135 bits (339), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 93/326 (28%), Positives = 161/326 (49%), Gaps = 28/326 (8%)

Query: 66  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIIDPTLSGVDDIGDLMLKIPAR 125
           R+ Y        + Y   HP  P RI   + ++   GL               M    A+
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLIMNYGLY------------KKMEIYRAK 67

Query: 126 EATDEEILQVHTPEHLEFLSKTTSMTREQLLKETEK---GDSVYFNNDSYLSAKLSCGGA 182
            AT +E+ Q HT E+++FLS+ T    +   KE+ K   GD     +  Y    +S GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLDMFQKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 183 IEACRAVVEGRVKNALAVVRPPG-HHAEPDLAGGFCLFSNVAVAAQNILKNYPESVKKIM 241
           +E    +  G+    +A+    G HHA+   A GFC  +++ +    +L+ +P    +++
Sbjct: 128 MEGAARLNRGKCD--VAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 242 ILDWDVHHGNGTQKAFYNDDRVLYVSLHRHELGKYYPGTIHGNADRVGEGKGEGFNCNIP 301
            +D DVHHG+G ++AFY  DRV+  S H++  G+++PGT  G     G GKG+ +  N+P
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDTGVGKGKYYAVNVP 237

Query: 302 WPWKGVGDAEYIWAFEQVVLPMGREFQPDLVIISSGFDAADGDTVGQCHVTPSCYGHMTH 361
               G+ DA Y   FE V+  +   +QP  V++  G D+  GD +G  +++   + +  +
Sbjct: 238 L-RDGIDDATYKSVFEPVIGKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMKGHANCVN 296

Query: 362 MLKSLARGNICAVLEGGYSLDSIAKS 387
            +KS     +  V  GGY++ ++A++
Sbjct: 297 YMKSFGV-PLMIVGGGGYTMRNVART 321

>Suva_7.71 Chr7 complement(135837..137195) [1359 bp, 452 aa] {ON}
           YGL194C (REAL)
          Length = 452

 Score =  135 bits (339), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 91/329 (27%), Positives = 163/329 (49%), Gaps = 28/329 (8%)

Query: 63  YDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIIDPTLSGVDDIGDLMLKI 122
           Y  R+ YH     S++ Y   HP  P R+     +++  GL           I DL    
Sbjct: 24  YSPRVSYHFNPKASHYHYGVKHPMKPIRLMLTDHLVSSYGL---------HKIMDLY--- 71

Query: 123 PAREATDEEILQVHTPEHLEFLSKTTSMTREQL----LKETEKGDSVYFNNDSYLSAKLS 178
             R AT +E+ + HT +++ FLSK +     +L    L+    GD      + Y    L 
Sbjct: 72  ETRSATKDELFEFHTEDYVNFLSKVSPENVNKLPRGTLENFNIGDDCPIFQNLYDYTTLY 131

Query: 179 CGGAIEACRAVVEGRVKNALAVVRPPG-HHAEPDLAGGFCLFSNVAVAAQNILKNYPESV 237
            G  ++A R ++    ++ +A+    G HHA+ +   GFC  +++ ++  N+L+ +P   
Sbjct: 132 TGATLDATRKLINN--QSDIAINWSGGLHHAKKNSPSGFCYVNDIVLSILNLLRYHP--- 186

Query: 238 KKIMILDWDVHHGNGTQKAFYNDDRVLYVSLHRHELGKYYPGTIHGNADRVGEGKGEGFN 297
            +++ +D D+HHG+G Q+AFY  DRV  +S H++  G+++PGT  G+   +G  KG+ F 
Sbjct: 187 -RVLYIDIDLHHGDGVQEAFYTTDRVFTLSFHKYN-GEFFPGT--GDLTEIGCDKGKHFA 242

Query: 298 CNIPWPWKGVGDAEYIWAFEQVVLPMGREFQPDLVIISSGFDAADGDTVGQCHVTPSCYG 357
            N+P    G+ D  YI  F+ +V P+   F+P +++   G D+   D +G  ++    +G
Sbjct: 243 LNVPLE-DGIDDDSYINLFKSIVDPLITTFKPTVIVQQCGADSLGHDRLGCFNLNIKAHG 301

Query: 358 HMTHMLKSLARGNICAVLEGGYSLDSIAK 386
                +KS     +  V  GGY+  ++++
Sbjct: 302 ECVKFVKSFGLP-MLVVGGGGYTPKNVSR 329

>TDEL0A00270 Chr1 complement(44950..46251) [1302 bp, 433 aa] {ON}
           Anc_3.8 YNL330C
          Length = 433

 Score =  133 bits (335), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 94/326 (28%), Positives = 161/326 (49%), Gaps = 28/326 (8%)

Query: 66  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIIDPTLSGVDDIGDLMLKIPAR 125
           R+ Y        F Y   HP  P RI   + ++   GL               M    A+
Sbjct: 20  RVAYFYDADVGNFSYGQYHPMKPHRIRMAHSLIMNYGLY------------KKMEIYRAK 67

Query: 126 EATDEEILQVHTPEHLEFLSKTTSMTREQLLKETEK---GDSVYFNNDSYLSAKLSCGGA 182
            AT +E+ Q HT E+++FLS+ T    E   KE+ K   GD     +  Y    +S GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLELFKKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 183 IEACRAVVEGRVKNALAVVRPPG-HHAEPDLAGGFCLFSNVAVAAQNILKNYPESVKKIM 241
           +E    +  G+    +A+    G HHA+   A GFC  +++ +    +L+ +P    +++
Sbjct: 128 MEGAARLNRGKCD--VAINYAGGLHHAKKAEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 242 ILDWDVHHGNGTQKAFYNDDRVLYVSLHRHELGKYYPGTIHGNADRVGEGKGEGFNCNIP 301
            +D DVHHG+G ++AFY  DRV+  S H++  G+++PGT  G    +G G G+ +  N+P
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDIGVGSGKYYAVNVP 237

Query: 302 WPWKGVGDAEYIWAFEQVVLPMGREFQPDLVIISSGFDAADGDTVGQCHVTPSCYGHMTH 361
               G+ DA +   FE VV  +   +QP  V++  G D+  GD +G  +++   + +  +
Sbjct: 238 L-RDGIDDATFRNVFEPVVGKIMEWYQPAAVVLQCGGDSLSGDRLGCFNLSMRGHANCVN 296

Query: 362 MLKSLARGNICAVLEGGYSLDSIAKS 387
            +KS     +  V  GGY++ ++A++
Sbjct: 297 YVKSFGI-PMMVVGGGGYTMRNVART 321

>KNAG0G01350 Chr7 (300791..302146) [1356 bp, 451 aa] {ON} Anc_8.153
           YGL194C
          Length = 451

 Score =  134 bits (336), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 92/335 (27%), Positives = 167/335 (49%), Gaps = 28/335 (8%)

Query: 57  LKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIIDPTLSGVDDIG 116
            + G    +R+ YH     S++ Y   HP  P R+           ++ D  +SG   + 
Sbjct: 19  FELGAARPLRVSYHFNPKVSHYHYGVKHPMKPFRL-----------MLTDHLVSGYG-MH 66

Query: 117 DLMLKIPAREATDEEILQVHTPEHLEFLSKTTSMTREQL----LKETEKGDSVYFNNDSY 172
            +M     R AT++E+ + HT +++ FL K +     +L    L++   GD      + Y
Sbjct: 67  KVMDLYETRAATNDELTEFHTEDYVHFLQKVSPDNLGKLPRGTLEKFNIGDDCPIFQNLY 126

Query: 173 LSAKLSCGGAIEACRAVVEGRVKNALAVVRPPG-HHAEPDLAGGFCLFSNVAVAAQNILK 231
             A L  G +++A R ++ G  ++ +A+    G HHA+ +   GFC  +++ ++  N+L+
Sbjct: 127 DYATLYTGASLDATRKLING--QSDIAINWSGGLHHAKKNSPSGFCYVNDIVLSIVNLLR 184

Query: 232 NYPESVKKIMILDWDVHHGNGTQKAFYNDDRVLYVSLHRHELGKYYPGTIHGNADRVGEG 291
            +P    +++ +D D+HHG+G Q+AFY  DRV  +S H++  G ++PGT  G+ D  G  
Sbjct: 185 YHP----RVLYIDIDLHHGDGVQEAFYTTDRVYTISFHKYN-GDFFPGT--GDIDETGCD 237

Query: 292 KGEGFNCNIPWPWKGVGDAEYIWAFEQVVLPMGREFQPDLVIISSGFDAADGDTVGQCHV 351
            GE F  N+P    G+ D  YI  F+ V+ P+   + P ++I   G D+   D +G  ++
Sbjct: 238 AGERFALNVPLE-DGIDDDSYINLFKSVIGPLITAYNPTVIIQQCGADSLGHDRLGCFNL 296

Query: 352 TPSCYGHMTHMLKSLARGNICAVLEGGYSLDSIAK 386
               +G     +KS     +  V  GGY+  ++++
Sbjct: 297 NIKAHGECVKFVKSFGIP-MLVVGGGGYTPRNVSR 330

>ZYRO0G19316g Chr7 (1600375..1601721) [1347 bp, 448 aa] {ON} highly
           similar to uniprot|P53096 Saccharomyces cerevisiae
           YGL194C HOS2 Histone deacetylase required for gene
           activation via specific deacetylation of lysines in H3
           and H4 histone tails subunit of the Set3 complex a
           meiotic-specific repressor of sporulation specific genes
           that contains deacetylase activity
          Length = 448

 Score =  133 bits (334), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 92/335 (27%), Positives = 167/335 (49%), Gaps = 28/335 (8%)

Query: 57  LKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIIDPTLSGVDDIG 116
            + G  Y  R+ YH     S + Y   HP  P R+     +++  GL           I 
Sbjct: 17  FQFGSSYCPRVSYHFNPKVSNYHYGTKHPMKPFRLMLTDHLVSSYGL---------HKIM 67

Query: 117 DLMLKIPAREATDEEILQVHTPEHLEFLSKTTSMTREQL----LKETEKGDSVYFNNDSY 172
           DL      R AT EE+   H+ E+++F+ + T     +L    L++   GD      + Y
Sbjct: 68  DLY---ETRVATWEEMTAFHSEEYVDFMKRVTPENLNKLPRGTLEKFNIGDDCPIFPNLY 124

Query: 173 LSAKLSCGGAIEACRAVVEGRVKNALAVVRPPG-HHAEPDLAGGFCLFSNVAVAAQNILK 231
             + L  G +++A R ++    ++ +A+    G HHA+     GFC  +++ +A  N+L+
Sbjct: 125 DYSSLYAGASLDASRKLIND--QSDIAINWSGGLHHAKKSNPSGFCYVNDIVLATLNLLR 182

Query: 232 NYPESVKKIMILDWDVHHGNGTQKAFYNDDRVLYVSLHRHELGKYYPGTIHGNADRVGEG 291
            +P    +++ +D D+HHG+G Q+AFY  DRV  VS H++  G+++PGT  GN D VG  
Sbjct: 183 YHP----RVLYIDIDLHHGDGVQEAFYTTDRVYTVSFHKYN-GEFFPGT--GNHDEVGCA 235

Query: 292 KGEGFNCNIPWPWKGVGDAEYIWAFEQVVLPMGREFQPDLVIISSGFDAADGDTVGQCHV 351
           +G+ F  N+P    G+ D  YI  F+ ++ P+   ++P +++   G D+   D +G  ++
Sbjct: 236 RGKHFALNVPL-QDGIDDDSYINLFKSIIDPLITSYKPTVIVQQCGADSLGHDRLGCFNL 294

Query: 352 TPSCYGHMTHMLKSLARGNICAVLEGGYSLDSIAK 386
               +G   + ++S     +  V  GGY+  ++++
Sbjct: 295 NVKAHGECVNFVRSFGLP-MLVVGGGGYTPRNVSR 328

>NDAI0A05120 Chr1 (1164314..1165840) [1527 bp, 508 aa] {ON}
           Anc_3.362 YPR068C
          Length = 508

 Score = 77.8 bits (190), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 74/281 (26%), Positives = 129/281 (45%), Gaps = 23/281 (8%)

Query: 150 MTREQLLKETEKGDSVYFNNDSYLSA--KLSCGGAIEACRAVVEGRVKNALAVVRPPG-H 206
           M RE+L     +GD   F   SYL    ++  G  +   + +     +  +AV    G H
Sbjct: 177 MIREKLKGYNLEGDCPIF---SYLPVYCQVIVGATLSLAKHITAVANERTIAVNWDGGRH 233

Query: 207 HAEPDLAGGFCLFSNVAVAAQNILKNYPESVKKIMILDWDVHHGNGTQKAFYNDDRVLYV 266
           HA  + A GFC  +++ +  Q +  N     K+I  +D+D+HHG+G Q++F     V  +
Sbjct: 234 HALRNKASGFCYINDIVLLIQQLRSN---GYKRITYIDFDLHHGDGVQRSFQYSTSVQTI 290

Query: 267 SLHRHELGKYYPGTIHGNADRVGEGKGEGFNCNIPWPWKGVGDAEYIWAFEQVVLPMGRE 326
           S H  E G ++P T      ++G+        NIP    GV D       E+V++P  + 
Sbjct: 291 SAHMFEPG-FFPCTGSLKESKMGKNI-----VNIPL-LHGVDDMLMNEIVEKVMIPCVKR 343

Query: 327 FQPDLVIISSGFDAADGDTVGQCHVTPSCYGHMTHMLKSLARGNICAVL---EGGYSLDS 383
           + P++++I  G D   GD   +  +T   +G + ++LK L     C V+    GGY+   
Sbjct: 344 YDPEILVIQCGGDGLIGDGYAEWQLT--IHGLVNNILKLLRIFPGCPVVLLGGGGYNETV 401

Query: 384 IAKSALGVAKVLIGEPPDELPVVK--QPKPEAVEVIDAVIK 422
           +++    +   ++ E  ++  + K  Q K E +   D  IK
Sbjct: 402 MSRFYTYLTWKIVDEYSNKKSLKKPFQAKEERIHDKDRSIK 442

>KLTH0F10582g Chr6 (910298..911722) [1425 bp, 474 aa] {ON} similar
           to uniprot|Q12214 Saccharomyces cerevisiae YPR068C
          Length = 474

 Score = 77.0 bits (188), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 59/222 (26%), Positives = 107/222 (48%), Gaps = 19/222 (8%)

Query: 167 FNNDSYLSAKLS------CGGAIEACRAVVEGRVKNALAVVRPPG-HHAEPDLAGGFCLF 219
            ++D YL A L        G  +   RA    R + A+++    G HHA    A GFC  
Sbjct: 176 LSHDCYLFAYLPLYCQVIAGATLSLVRAACL-RHERAISINWDGGRHHASRSRASGFCYI 234

Query: 220 SNVAVAAQNILKNYPESVKKIMILDWDVHHGNGTQKAFYNDDRVLYVSLHRHELGKYYPG 279
           +++A+  Q + +     +++I  +D+D+HH +G ++AF +   V  +S+H HE G ++PG
Sbjct: 235 NDIALLIQKLRR---RGIRRISYIDFDLHHCDGVERAFQHSQSVQTISVHLHEPG-FFPG 290

Query: 280 TIHGNADRVGEGKGEGFNCNIPWPWKGVGDAEYIWAFEQVVLPMGREFQPDLVIISSGFD 339
           T  G+      GK      NIP    G+ D       ++V++P  R   P++++I  G D
Sbjct: 291 T--GSLKEASVGKNV---VNIPVQ-HGMDDTFLNQIVQRVIMPCIRSHNPEVLVIQCGGD 344

Query: 340 AADGDTVGQCHVT-PSCYGHMTHMLKSLARGNICAVLEGGYS 380
              GD   +  +T      ++ ++++     N+  +  GGY+
Sbjct: 345 GLMGDKYKEWQLTIKGLVNNIMYIVRGFPATNVVMLGGGGYN 386

>TDEL0A05520 Chr1 complement(970572..972596) [2025 bp, 674 aa] {ON}
           Anc_8.607 YPL116W
          Length = 674

 Score = 77.0 bits (188), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 99/376 (26%), Positives = 155/376 (41%), Gaps = 83/376 (22%)

Query: 132 ILQVHTPEHLEFLSKTTSMTREQLLK-ETEKGDSVYFNNDSYLSAKL------SCGGAIE 184
           +L+VH  +    L +      E+L K E E  DS + + D YLS+K       S G    
Sbjct: 108 VLKVHGRDWPPTLLRLCKHADEKLAKGEIEVPDS-WNSGDIYLSSKTIEALQGSIGALET 166

Query: 185 ACRAVVEG----RVKN-ALAVVRPPGHHAEPDLAGGFCLFSNVAVAAQNILKNYPESVKK 239
              ++ EG     V N A  V+RPPGHH       GFCL +N  V+ +     Y   +  
Sbjct: 167 GVDSIFEGPSPEHVSNRAFVVIRPPGHHCRAGTPSGFCLLNNAHVSIEYAHDTY--GITH 224

Query: 240 IMILDWDVHHGNGTQ-------------------------KAFYNDDRVLYVSLHRHELG 274
            ++LD+D+HHG+GTQ                         K F    RV Y S+  H++ 
Sbjct: 225 AVVLDFDLHHGDGTQDICWKRAGFRPDEQDENTGGYDEFGKKFAEFPRVGYFSM--HDIN 282

Query: 275 KYYPGTIHGNADRVGEGKG---EGFNCNIPW-----PWKGVGDAEYIWA----------- 315
            +   + +   D +         G + NI W      W+   D   ++            
Sbjct: 283 SFPTESGYATKDNIKSASTCIMNGHDLNI-WNVHLSAWETEEDFNKLYQSKYRTLFAKAD 341

Query: 316 --FEQVVLPM---GREFQPDLVIISSGFDAADGDTVGQ----CHVTPSCYGHMTHMLKSL 366
             F+   + M   G++F+  LV+IS+GFDA++ + V       +V  + Y   T     L
Sbjct: 342 EFFKNAKIEMSAKGKKFK-GLVVISAGFDASEFEQVSMQRHGVNVPTNFYTMFTKDALKL 400

Query: 367 AR----GNICAVLEGGYSLDSIAKSALGVAKVLIGEPPDELPVVKQPKPEAVEVIDAVIK 422
           A+    G + +VLEGGYS  +I     GV   LIG        +K+   E  +V+  +++
Sbjct: 401 AQMHSEGKVLSVLEGGYSDKAITS---GVFAHLIGLQNQNW--IKEWGSE--QVVKEIVR 453

Query: 423 MQSRYWQCFKSTHAND 438
                W+ +KS    D
Sbjct: 454 GCKPNWKPYKSKKTRD 469

>SAKL0B07854g Chr2 complement(669743..671212) [1470 bp, 489 aa] {ON}
           similar to uniprot|Q12214 Saccharomyces cerevisiae
           YPR068C
          Length = 489

 Score = 76.3 bits (186), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 61/230 (26%), Positives = 105/230 (45%), Gaps = 19/230 (8%)

Query: 206 HHAEPDLAGGFCLFSNVAVAAQNILKNYPESVKKIMILDWDVHHGNGTQKAFYNDDRVLY 265
           HH+    A GFC  +++ +A Q + +N+      I  +D+D+HHG+G ++AF     V  
Sbjct: 242 HHSFKSRASGFCYINDIVLAIQRLRRNF----SNISYVDFDLHHGDGVERAFQYSKNVQT 297

Query: 266 VSLHRHELGKYYPGTIHGNADRVGEGKGEGFNCNIPWPWKGVGDAEYIWAFEQVVLPMGR 325
           +SLH HE G ++PGT  G+ +   +G       NIP    G  D   +   E VV+P  +
Sbjct: 298 ISLHNHEPG-FFPGT--GSMESSQDGHSI---INIPLR-HGADDDCLMKITESVVIPCIQ 350

Query: 326 EFQPDLVIISSGFDAADGDTVGQCHVT-PSCYGHMTHMLKSLARGNICAVLEGGYSLDSI 384
           +  P +++I  G D   GD   +  +T       +  +L SL   +I  +  GGY+   +
Sbjct: 351 KHGPQVIVIQCGGDGLIGDKYEEWQLTIRGLTSSILKILSSLPDTHIILLGGGGYNDRVM 410

Query: 385 AKS----ALGVAKVLIGEPPDELPVVKQPK--PEAVEVIDAVIKMQSRYW 428
           ++        V       PP++ P +      P+  E +D       ++W
Sbjct: 411 SRFYTYLTWKVCDQFSKSPPEDPPFIDDEDLIPDH-EFLDLYTDEHYKFW 459

>Skud_16.353 Chr16 complement(647799..649214) [1416 bp, 471 aa] {ON}
           YPR068C (REAL)
          Length = 471

 Score = 76.3 bits (186), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 51/176 (28%), Positives = 87/176 (49%), Gaps = 11/176 (6%)

Query: 206 HHAEPDLAGGFCLFSNVAVAAQNILKNYPESVKKIMILDWDVHHGNGTQKAFYNDDRVLY 265
           HHA    A GFC  ++V +  Q + K     + KI  +D+D+HHG+G ++AF    ++  
Sbjct: 212 HHAFKQKANGFCYINDVVLLIQRLRK---MKLNKITYVDFDLHHGDGVERAFQYSKQIQT 268

Query: 266 VSLHRHELGKYYPGTIHGNADRVGEGKGEGFNCNIPWPWKGVGDAEYIWAFEQVVLPMGR 325
           +S+H +E G ++PGT   N  R G+        NIP    G  D+       +++ P+ +
Sbjct: 269 ISIHLYEPG-FFPGTGSLNDARKGKSV-----VNIPLK-HGCDDSYLDLVASKIISPLIK 321

Query: 326 EFQPDLVIISSGFDAADGDTVGQCHVTPSCYGH-MTHMLKSLARGNICAVLEGGYS 380
              PD++II  G D   GD   +  +T       + +++K   R +I  +  GGY+
Sbjct: 322 RHDPDVLIIECGGDGLLGDRFNEWQLTIRGLSRTIVNVMKLYPRAHIFLLGGGGYN 377

>Ecym_8290 Chr8 complement(589795..591924) [2130 bp, 709 aa] {ON}
           similar to Ashbya gossypii ADL265W
          Length = 709

 Score = 76.6 bits (187), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 84/333 (25%), Positives = 141/333 (42%), Gaps = 75/333 (22%)

Query: 132 ILQVHTPEHLEFLSKTTSMTREQL-LKETEKGDS-----VYFNNDSYLSAKLSCGGAIEA 185
           +L+VH  +  + L +     +E++  K+ E  D      +Y   ++  + + S G     
Sbjct: 108 VLKVHGSDWPKELLRLCRGAKEKIGRKQVEVPDEWNVGDIYLCEETVYALRGSIGAVEYG 167

Query: 186 CRAVVEGRVKN-----ALAVVRPPGHHAEPDLAGGFCLFSNVAVAAQNILKNYPESVKKI 240
             ++ +G V       A   +RPPGHH+      GFCL +N  +A +     Y   V   
Sbjct: 168 VDSIFKGEVNKDTANRAFVAIRPPGHHSHAATPSGFCLLNNAHIAVEYAADTY--GVTHA 225

Query: 241 MILDWDVHHGNGTQ------KAFYNDD-------------------RVLYVSLHRHELGK 275
           +ILD+D+HHG+GTQ        F  DD                   +V Y S+  H++  
Sbjct: 226 VILDFDLHHGDGTQDICWKRAGFKADDIQDAKGEYNEFDKKFAEFPKVGYFSM--HDINS 283

Query: 276 YYPGTIHGNADRVGEGKG---EGFNCNIPW-----PWKGVGDAEYIWA------------ 315
           +     + + D+V +      +  + NI W     P++   +   ++             
Sbjct: 284 FPTELNYASKDKVKDASTCIMDAHDVNI-WNIHLLPYETEEEFNKLYQTRYRTLFAKADE 342

Query: 316 -FEQVVLPMGREFQP--DLVIISSGFDAADGDTVGQ----CHVTPSCYGHMTHMLKSLAR 368
            F+   L M ++ +P   LV++S+GFDA++ + V       +V  S Y   T     LA+
Sbjct: 343 FFKAAKLSMAKDGKPFKGLVVMSAGFDASEYEQVSMQRHGVNVPTSFYSTFTKDALKLAQ 402

Query: 369 ----GNICAVLEGGYSLDSIAKSALGVAKVLIG 397
               G I ++LEGGYS  +IA    GV   LIG
Sbjct: 403 MHTNGKIISLLEGGYSDAAIAS---GVFSHLIG 432

>TDEL0C05040 Chr3 complement(901798..903162) [1365 bp, 454 aa] {ON}
           Anc_3.362 YPR068C
          Length = 454

 Score = 75.1 bits (183), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 51/182 (28%), Positives = 90/182 (49%), Gaps = 11/182 (6%)

Query: 206 HHAEPDLAGGFCLFSNVAVAAQNILKNYPESVKKIMILDWDVHHGNGTQKAFYNDDRVLY 265
           HHA    A GFC  +++ +  Q + +   +  +KI  +D+D+HHG+G +KAF     V  
Sbjct: 206 HHAFKQKASGFCYVNDIVLLIQKLRR---KGFQKISYIDFDLHHGDGVEKAFQFSSNVQT 262

Query: 266 VSLHRHELGKYYPGTIHGNADRVGEGKGEGFNCNIPWPWKGVGDAEYIWAFEQVVLPMGR 325
           +SLH  E+G ++PGT  GN   + E        NIP    G+ D       EQ+V P+  
Sbjct: 263 ISLHLFEVG-FFPGT--GN---LSESDKRRNVVNIPL-LHGLDDTSLEQLIEQIVKPVIE 315

Query: 326 EFQPDLVIISSGFDAADGDTVGQCHVTPSCYGH-MTHMLKSLARGNICAVLEGGYSLDSI 384
             +PD+++I  G D   GD   +  ++       +T ++ +     +  +  GGY++  +
Sbjct: 316 RHEPDVLVIQCGGDGLMGDGFNEWQLSIRGLAKCITELINNTKDCPVILLGGGGYNVTLM 375

Query: 385 AK 386
           ++
Sbjct: 376 SR 377

>Suva_16.396 Chr16 complement(689796..691229) [1434 bp, 477 aa] {ON}
           YPR068C (REAL)
          Length = 477

 Score = 75.1 bits (183), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 50/176 (28%), Positives = 88/176 (50%), Gaps = 11/176 (6%)

Query: 206 HHAEPDLAGGFCLFSNVAVAAQNILKNYPESVKKIMILDWDVHHGNGTQKAFYNDDRVLY 265
           HHA    A GFC  ++V +  Q + K     + K+  LD+D+HHG+G +KAF    ++  
Sbjct: 212 HHAFKQKANGFCYINDVVLLIQRLRK---LKLSKVTYLDFDLHHGDGVEKAFQYSRQIQT 268

Query: 266 VSLHRHELGKYYPGTIHGNADRVGEGKGEGFNCNIPWPWKGVGDAEYIWAFEQVVLPMGR 325
           +S+H +E G ++PGT  G+ +    GK      NIP    G  D        +++ P+ +
Sbjct: 269 ISVHLYEPG-FFPGT--GSLNDSQNGKNI---VNIPLK-HGCDDNYLNLVASKIIHPLIK 321

Query: 326 EFQPDLVIISSGFDAADGDTVGQCHVTPSCYGH-MTHMLKSLARGNICAVLEGGYS 380
              P+++I+  G D   GD   +  +T       + +++KS  + +I  +  GGY+
Sbjct: 322 RHDPEVIIMECGGDGLQGDRFNEWQLTIRGLSRTIVNIMKSYPQAHIFLLGGGGYN 377

>NCAS0A11180 Chr1 complement(2216701..2218173) [1473 bp, 490 aa]
           {ON} Anc_3.362 YPR068C
          Length = 490

 Score = 73.9 bits (180), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 65/257 (25%), Positives = 114/257 (44%), Gaps = 20/257 (7%)

Query: 181 GAIEACRAVVEGRVKNALAVVRPPG-HHAEPDLAGGFCLFSNVAVAAQNILKNYPESVKK 239
           GA  +    ++   + ++A+    G HHA  + A GFC  +++ +  Q I KN     K 
Sbjct: 189 GATLSLSKFLQPNSERSIAINWDGGRHHAFKNKASGFCYVNDIVLLIQKIRKN---GFKN 245

Query: 240 IMILDWDVHHGNGTQKAFYNDDRVLYVSLHRHELGKYYPGTIHGNADRVGEGKGEGFNCN 299
           I  +D+D+HHG+G QKAF     V  VSLH  E G ++P T       + E K      N
Sbjct: 246 ISYVDFDLHHGDGVQKAFQFSKNVQTVSLHMFEPG-FFPCT-----GSLQEAKAGSSIVN 299

Query: 300 IPWPWKGVGDAEYIWAFEQVVLPMGREFQPDLVIISSGFDAADGDTVGQCHVT-PSCYGH 358
           IP    G+         + +++P+  + +P++++I  G D   GD   +  +T     G 
Sbjct: 300 IPL-LHGLDGTFLKQLTKDIIIPVVEQHEPEVLVIQCGGDGLIGDQYNEWQLTIHDLSGA 358

Query: 359 MTHMLKSLARGNICAVLEGGYSLDSIAKS----ALGVAKVLIGEPPDELPVVKQPK---P 411
           +  ++ +    ++  +  GGY+   +++        +A      PP  L +  +     P
Sbjct: 359 IMKLINTFPSCSVVLLGGGGYNEKVMSRFYNYLTWNIAFEYSKRPPSGLFLSSELNLLIP 418

Query: 412 EAVEVIDAVIKMQSRYW 428
           +  E ID     Q +YW
Sbjct: 419 DH-EFIDVYQDEQYKYW 434

>Kwal_23.3724 s23 (406773..408194) [1422 bp, 473 aa] {ON} YPR068C
           (HOS1) - Similar to Hda1p, Rpd3p, Hos2p, and Hos3p
           [contig 254] FULL
          Length = 473

 Score = 73.6 bits (179), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 58/210 (27%), Positives = 97/210 (46%), Gaps = 13/210 (6%)

Query: 173 LSAKLSCGGAIEACRAVVEGRVKNALAVVRPPG-HHAEPDLAGGFCLFSNVAVAAQNILK 231
           +  ++  G  I+  R     R +  ++V    G HHA    A GFC  +++A+  Q + +
Sbjct: 191 MYCQVVTGATIKLAR-YASSRQQRTISVNWDGGRHHAFKSKASGFCYVNDIAILIQKLRR 249

Query: 232 NYPESVKKIMILDWDVHHGNGTQKAFYNDDRVLYVSLHRHELGKYYPGTIHGNADRVGEG 291
                + KI  LD+D+HHG+G ++AF +   V  +S+H +E G ++PGT  G       G
Sbjct: 250 ---RGIHKISYLDFDLHHGDGVERAFQHSANVQTISIHMYEEG-FFPGT--GTLKDASSG 303

Query: 292 KGEGFNCNIPWPWKGVGDAEYIWAFEQVVLPMGREFQPDLVIISSGFDAADGDTVGQCHV 351
           +      NIP    G+ D        +VV+P      P++VII  G D   GD   +  +
Sbjct: 304 RNI---VNIP-VLHGMDDTFLNEVVNRVVIPCLHNHNPEVVIIQCGGDGLIGDKYKEWQL 359

Query: 352 T-PSCYGHMTHMLKSLARGNICAVLEGGYS 380
           T       +  +++     NI  +  GGY+
Sbjct: 360 TLKGLTDTIMKVVEDFPSSNIVLLGGGGYN 389

>YPL116W Chr16 (329606..331699) [2094 bp, 697 aa] {ON}
           HOS3Trichostatin A-insensitive homodimeric histone
           deacetylase (HDAC) with specificity in vitro for
           histones H3, H4, H2A, and H2B; similar to Hda1p, Rpd3p,
           Hos1p, and Hos2p; deletion results in increased histone
           acetylation at rDNA repeats
          Length = 697

 Score = 73.6 bits (179), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 95/372 (25%), Positives = 152/372 (40%), Gaps = 76/372 (20%)

Query: 132 ILQVHTPEHLEFLSKTTSMTREQLLKETEKGDSVYFNNDSYLSAKL--SCGGAIEACRAV 189
           +L+VH       L +   M   +LLK   +    + + D YLS+K   +  G I A    
Sbjct: 110 VLKVHGSSWPAELIELCQMADAKLLKGEIEVPDTWNSGDIYLSSKTIKALQGTIGAIETG 169

Query: 190 VEGRVK---------NALAVVRPPGHHAEPDLAGGFCLFSNVAVAAQNILKNYPESVKKI 240
           V+   K          A   +RPPGHH       GFCL +N  VA +     Y  +V  +
Sbjct: 170 VDSIFKGPSAEHISNRAFVAIRPPGHHCHYGTPSGFCLLNNAHVAIEYAYDTY--NVTHV 227

Query: 241 MILDWDVHHGNGTQ------------------------KAFYNDDRVLYVSLHRHELGKY 276
           ++LD+D+HHG+GTQ                        K F    +V Y S+  H++  +
Sbjct: 228 VVLDFDLHHGDGTQDICWKRAGFKPEEEPEDSSYDDFGKKFAEFPKVGYFSM--HDINSF 285

Query: 277 YPGTIHGNADRVGEGKGEGFNCNIPWPW-----KGVGDAEY----------IWA-----F 316
              +     + +        N +    W     K   + E+          ++A     F
Sbjct: 286 PTESGFATKENIKNASTCIMNSHDLNIWNIHLSKWTTEEEFNVLYRTKYRTLFAKADEFF 345

Query: 317 EQVVLPMGREFQP--DLVIISSGFDAADGD-TVGQCH---VTPSCYGHMTHMLKSLAR-- 368
               L M ++ +P   LV+IS+GFDA++ + T  Q H   V  S Y   T     LA+  
Sbjct: 346 RSAKLEMNQQGRPFKGLVVISAGFDASEFEQTSMQRHSVNVPTSFYTTFTKDALKLAQMH 405

Query: 369 --GNICAVLEGGYSLDSIAKSALGVAKVLIGEPPDELPVVKQPKPEAVEVIDAVIKMQSR 426
             G + +++EGGYS  +I     GV   LIG    +   VK+   E  +V+  +++    
Sbjct: 406 CHGKVLSLMEGGYSDKAICS---GVFAHLIGLQNQDW--VKEWGSE--QVVKEIVRGCKP 458

Query: 427 YWQCFKSTHAND 438
            W+ +K+  A D
Sbjct: 459 AWKPYKTKRAKD 470

>Kpol_376.15 s376 complement(25558..27114) [1557 bp, 518 aa] {ON}
           complement(25558..27114) [1557 nt, 519 aa]
          Length = 518

 Score = 72.8 bits (177), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 46/176 (26%), Positives = 90/176 (51%), Gaps = 11/176 (6%)

Query: 206 HHAEPDLAGGFCLFSNVAVAAQNILKNYPESVKKIMILDWDVHHGNGTQKAFYNDDRVLY 265
           HHA  + A GFC  +++ +  Q + K   + + K+  +D+D+HHG+G +KAF     +  
Sbjct: 223 HHAIKNKASGFCYINDIVILIQKLRK---KGISKVSYIDFDLHHGDGVEKAFRYSSNIQT 279

Query: 266 VSLHRHELGKYYPGTIHGNADRVGEGKGEGFNCNIPWPWKGVGDAEYIWAFEQVVLPMGR 325
           +S+H +E G ++P T  G+ +    GK      N+P  + GV D        +++ P+  
Sbjct: 280 ISMHMYEPG-FFPCT--GSLEDTLNGKNI---VNVPL-YHGVDDNYMTEIVNELIKPLIE 332

Query: 326 EFQPDLVIISSGFDAADGDTVGQCHVTPS-CYGHMTHMLKSLARGNICAVLEGGYS 380
              P++++I  G D   GD   +  +T S    ++ ++++   + +I  +  GGY+
Sbjct: 333 RHSPEVLVIQCGGDGLIGDKFEEWQLTISGLTRNIQNLIEWFPKSDIILLGGGGYN 388

>YPR068C Chr16 complement(682941..684353) [1413 bp, 470 aa] {ON}
           HOS1Class I histone deacetylase (HDAC) family member
           that deacetylates Smc3p on lysine residues at anaphase
           onset; has sequence similarity to Hda1p, Rpd3p, Hos2p,
           and Hos3p; interacts with the Tup1p-Ssn6p corepressor
           complex
          Length = 470

 Score = 72.8 bits (177), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 50/176 (28%), Positives = 86/176 (48%), Gaps = 11/176 (6%)

Query: 206 HHAEPDLAGGFCLFSNVAVAAQNILKNYPESVKKIMILDWDVHHGNGTQKAFYNDDRVLY 265
           HHA    A GFC  ++V +  Q + K     + KI  +D+D+HHG+G +KAF    ++  
Sbjct: 210 HHAFKQRASGFCYINDVVLLIQRLRK---AKLNKITYVDFDLHHGDGVEKAFQYSKQIQT 266

Query: 266 VSLHRHELGKYYPGTIHGNADRVGEGKGEGFNCNIPWPWKGVGDAEYIWAFEQVVLPMGR 325
           +S+H +E G ++PGT       + + + +    NIP    G  D        ++V P+  
Sbjct: 267 ISVHLYEPG-FFPGT-----GSLSDSRKDKNVVNIPLK-HGCDDNYLELIASKIVNPLIE 319

Query: 326 EFQPDLVIISSGFDAADGDTVGQCHVTPSCYGH-MTHMLKSLARGNICAVLEGGYS 380
             +P+ +II  G D   GD   +  +T       + +++KS  R +I  +  GGY+
Sbjct: 320 RHEPEALIIECGGDGLLGDRFNEWQLTIRGLSRIIINIMKSYPRAHIFLLGGGGYN 375

>Kpol_479.6 s479 complement(10892..12958) [2067 bp, 688 aa] {ON}
           complement(10892..12958) [2067 nt, 689 aa]
          Length = 688

 Score = 73.2 bits (178), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 71/299 (23%), Positives = 121/299 (40%), Gaps = 70/299 (23%)

Query: 197 ALAVVRPPGHHAEPDLAGGFCLFSNVAVAAQNILKNYPESVKKIMILDWDVHHGNGTQ-- 254
           A   +RPPGHH   D   GFCL +N  +A +     Y   +   +ILD+D+HHG+GTQ  
Sbjct: 185 AFVAIRPPGHHCHVDTPSGFCLLNNAHIAIEYASDTY--GITHAVILDFDLHHGDGTQDI 242

Query: 255 -----------------------KAFYNDDRVLYVSLHRHELGKYYPGTIHGNADRVGEG 291
                                  K F    +V Y S+  H++  +   + +   + +   
Sbjct: 243 CWKRAGFRTEAEPETTEGYDEFGKKFAEFPKVGYFSM--HDINSFPTESQYATKENIRNA 300

Query: 292 KG---EGFNCNIPW-----PWKGVGDAEYIWAFEQVVL----------------PMGREF 327
                   + NI W     PW+   D + ++  +   L                 +G+ F
Sbjct: 301 STCVMNAHDVNI-WNIHLSPWETEQDFDKLYQTKYRTLFAKADEFFRNAKEEMDALGKPF 359

Query: 328 QPDLVIISSGFDAADGDTVGQCHVTPSCYGHMTHMLKSLA--------RGNICAVLEGGY 379
           Q  LV+IS+GFDA++ +       + +   H   M    A         G + +++EGGY
Sbjct: 360 Q-GLVVISAGFDASEFEQTSMQRHSVNVPTHFYTMFTKDALKLSQIHCHGKVLSIMEGGY 418

Query: 380 SLDSIAKSALGVAKVLIGEPPDELPVVKQPKPEAVEVIDAVIKMQSRYWQCFKSTHAND 438
           S  +IA    GV   LIG        +K+   E  +V+  +++    +W+ +K+  + D
Sbjct: 419 SDKAIAS---GVFSHLIGLQNQNW--IKEWGSE--QVVKEIVRGCKPHWKPYKTKKSRD 470

>CAGL0D01430g Chr4 (158990..160327) [1338 bp, 445 aa] {ON} similar
           to uniprot|Q12214 Saccharomyces cerevisiae YPR068c HOS1
          Length = 445

 Score = 72.0 bits (175), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 53/206 (25%), Positives = 98/206 (47%), Gaps = 12/206 (5%)

Query: 173 LSAKLSCGGAIEACRAVVEGRVKNALAVVRPPGHHAEPDLAGGFCLFSNVAVAAQNILKN 232
           L   +S G  +   + ++EG  +          HH+    A GFC  +++A+    + + 
Sbjct: 170 LYCYVSTGATLSLAQYILEGSERTIAINWDGGRHHSMKTKASGFCYINDIALLIMTLRRG 229

Query: 233 YPESVKKIMILDWDVHHGNGTQKAFYNDDRVLYVSLHRHELGKYYPGTIHGNADRVGEGK 292
               V +I  +D+D+HHG+G +KAF    +V  +SLH +E G ++P +  G+ +    GK
Sbjct: 230 ---GVDRISYVDFDLHHGDGVEKAFKYSKQVQTISLHMYETG-FFPCS--GSLEDNSSGK 283

Query: 293 GEGFNCNIPWPWKGVGDAEYIWAFEQVVLPMGREFQPDLVIISSGFDAADGDTVGQCHVT 352
                 NIP    G+ D+      +++++P   + QP++++I  G D   GD   +  + 
Sbjct: 284 SI---VNIPL-LHGLDDSTLQDIAKRIIVPSISKHQPNVIVIQCGGDGLKGDKYSEWQL- 338

Query: 353 PSCYGHMTHMLKSLARGNICAVLEGG 378
            S  G  + +   + + N   VL GG
Sbjct: 339 -SIKGLTSTITSLIEQFNCHIVLLGG 363

>Smik_16.309 Chr16 complement(559713..561125) [1413 bp, 470 aa] {ON}
           YPR068C (REAL)
          Length = 470

 Score = 72.0 bits (175), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 52/176 (29%), Positives = 88/176 (50%), Gaps = 11/176 (6%)

Query: 206 HHAEPDLAGGFCLFSNVAVAAQNILKNYPESVKKIMILDWDVHHGNGTQKAFYNDDRVLY 265
           HHA    A GFC  ++V +  Q + K     + KI  LD+D+HHG+G +KAF    ++  
Sbjct: 210 HHAFKQRASGFCYINDVVLLIQRLRK---IKLNKITYLDFDLHHGDGVEKAFQYSKQIQT 266

Query: 266 VSLHRHELGKYYPGTIHGNADRVGEGKGEGFNCNIPWPWKGVGDAEYIWAFEQVVLPMGR 325
           +S+H +E G ++PGT  G+ D    GK      NIP    G  D+       +++ P+  
Sbjct: 267 ISVHIYEPG-FFPGT--GSLDDSRGGKNV---VNIPLK-HGCDDSYLNLIASKIINPLID 319

Query: 326 EFQPDLVIISSGFDAADGDTVGQCHVTPSCYGH-MTHMLKSLARGNICAVLEGGYS 380
           +  P+++II  G D   GD   +  +T       + + +K  ++ +I  +  GGY+
Sbjct: 320 KHDPEVLIIECGGDGLLGDRFNEWQLTVRGLSETIINFIKRYSQAHIFLLGGGGYN 375

>Suva_16.194 Chr16 (339127..341226) [2100 bp, 699 aa] {ON} YPL116W
           (REAL)
          Length = 699

 Score = 72.8 bits (177), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 94/373 (25%), Positives = 149/373 (39%), Gaps = 78/373 (20%)

Query: 132 ILQVHTPEHLEFLSKTTSMTREQLLKETEKGDSVYFNNDSYLSAKL--SCGGAIEACRAV 189
           +L+VH       L +   M   +LLK   +    + + D YLS+K   +  G I A    
Sbjct: 110 VLKVHGSHWPTELIELCQMADAKLLKGEIEVPDTWNSGDIYLSSKTIQALQGTIGAIETG 169

Query: 190 VEGRVK---------NALAVVRPPGHHAEPDLAGGFCLFSNVAVAAQNILKNYPESVKKI 240
           V+   K          A   +RPPGHH       GFCL +N  VA +     Y   V  +
Sbjct: 170 VDSIFKGPSPEHISNRAFVAIRPPGHHCHYATPSGFCLLNNAHVAIEYAFDTY--DVTHV 227

Query: 241 MILDWDVHHGNGTQ------------------------KAFYNDDRVLYVSLHRHELGKY 276
           ++LD+D+HHG+GTQ                        K F    +V Y S+  H++  +
Sbjct: 228 VVLDFDLHHGDGTQDICWKRAGFKPEEESENSSYDNFGKKFAEFPKVGYFSM--HDINSF 285

Query: 277 YPGTIHGNADRVGEGKG---EGFNCNIPW-----PWKGVGDAEYIWA------------- 315
              +     + +           + NI W      W    D   ++              
Sbjct: 286 PTESGFATKENIKNASTCIMNSHDLNI-WNVHLSKWTTEEDFNILYRTKYRTLFAKADEF 344

Query: 316 FEQVVLPMGREFQ--PDLVIISSGFDAADGD-TVGQCH---VTPSCYGHMTHMLKSLAR- 368
           F+   L M ++ +    LV+IS+GFDA++ + T  Q H   V  S Y   T     LA+ 
Sbjct: 345 FKTAKLEMNQQEKTFKGLVVISAGFDASEFEQTSMQRHSVNVPTSFYTTFTKDALKLAQM 404

Query: 369 ---GNICAVLEGGYSLDSIAKSALGVAKVLIGEPPDELPVVKQPKPEAVEVIDAVIKMQS 425
              G + +++EGGYS  +I     GV   LIG    +   VK+   E  +V+  +++   
Sbjct: 405 HCHGKVLSLMEGGYSDKAICS---GVFAHLIGLQNQDW--VKEWGSE--QVVKEIVRGCK 457

Query: 426 RYWQCFKSTHAND 438
             W+ +K+  A D
Sbjct: 458 STWKPYKTRRAKD 470

>ZYRO0C16390g Chr3 complement(1274651..1275961) [1311 bp, 436 aa]
           {ON} similar to uniprot|Q12214 Saccharomyces cerevisiae
           YPR068C
          Length = 436

 Score = 70.5 bits (171), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 60/226 (26%), Positives = 105/226 (46%), Gaps = 18/226 (7%)

Query: 206 HHAEPDLAGGFCLFSNVAVAAQNILKNYPESVKKIMILDWDVHHGNGTQKAFYNDDRVLY 265
           HHA    A GFC  +++ +  Q +     +  +++  +D+D+HHG+G ++AF     V  
Sbjct: 195 HHAMKKRASGFCYVNDIVLLIQKLR---SKGFQRLSYIDFDLHHGDGVERAFQFSSNVQT 251

Query: 266 VSLHRHELGKYYPGTIHGNADRVGEGKGEGFNCNIPWPWKGVGDAEYIWAFEQVVLPMGR 325
           +S+H  E G ++P +  G+ +   +GK      NIP    G+ D        QVV+P+  
Sbjct: 252 ISMHLFECG-FFPTS--GSLEDNKKGKNIA---NIPLA-HGLNDEYLNEIVTQVVIPLTD 304

Query: 326 EFQPDLVIISSGFDAADGDTVGQCHVTPSCYGHMTHMLKSLARGNICAVL---EGGYSLD 382
              P ++II  G D   GD   +  +T    G   ++LK + R   C+++    GGY+  
Sbjct: 305 RHSPQVIIIQCGGDGLMGDEYNEWQLTIK--GLCENILKIVNRYKNCSIVLLGGGGYNPT 362

Query: 383 SIAKSALGVAKVLIGEPPDELPVVKQPKPEAVEVIDAVIKMQSRYW 428
            +++    +   LI   P+ L       PE  + IDA      ++W
Sbjct: 363 VMSRFYTYLTGKLI--DPNFLQDEDTIIPEH-KFIDAYHDEHYKFW 405

>TBLA0B02390 Chr2 (558067..559806) [1740 bp, 579 aa] {ON} Anc_3.362
           YPR068C
          Length = 579

 Score = 70.1 bits (170), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 47/177 (26%), Positives = 91/177 (51%), Gaps = 13/177 (7%)

Query: 206 HHAEPDLAGGFCLFSNVAVAAQNILKNYPESVKKIMILDWDVHHGNGTQKAFYNDDRVLY 265
           HH+    A GFC  +++ +  Q + +   +  +KI  LD+D+HHG+G +K+F     +  
Sbjct: 299 HHSRKKKASGFCYVNDIVLCIQKLGE---KGFRKITYLDFDLHHGDGVEKSFQYSKHIQT 355

Query: 266 VSLHRHELGKYYPGTIHGNADRVGEGKGEGFN-CNIPWPWKGVGDAEYIWAFEQVVLPMG 324
           +S+H  E G ++P T  G+     E    GFN  NIP    G+ D    +   +V++P+ 
Sbjct: 356 ISVHLFEPG-FFPCT--GSL----EETKHGFNIVNIP-TLHGLDDNYLTYLLNRVIIPLI 407

Query: 325 REFQPDLVIISSGFDAADGDTVGQCHVTPS-CYGHMTHMLKSLARGNICAVLEGGYS 380
           ++ +P+ +++  G D   GD   +  +T S    ++  +L++    ++  +  GGY+
Sbjct: 408 KKHKPECLVVQCGGDGLIGDRYKEWQMTISGLTKNIMLVLQNFPECSVVLLGGGGYN 464

>TBLA0E04080 Chr5 complement(1026669..1028753) [2085 bp, 694 aa]
           {ON} Anc_8.607 YPL116W
          Length = 694

 Score = 70.1 bits (170), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 81/297 (27%), Positives = 122/297 (41%), Gaps = 79/297 (26%)

Query: 170 DSYLSAKL--SCGGAIEACRAVV---------EGRVKNALAVVRPPGHHAEPDLAGGFCL 218
           D YLS+K   +  G+I A    +         E     A   +RPPGHH +     GFCL
Sbjct: 149 DIYLSSKTIEALEGSIAAIETGIDSIFNGPSPEHICNRAFVAIRPPGHHCKVATPSGFCL 208

Query: 219 FSNVAVAAQNILKNYPESVKKIMILDWDVHHGNGTQ------------------------ 254
            +N  ++ +    +Y   +   +ILD+D+HHG+GTQ                        
Sbjct: 209 LNNAHISIEYAADHY--GITHAVILDFDLHHGDGTQDICWKRAGFRSEDEPEGSEGYDDF 266

Query: 255 -KAFYNDDRVLYVSLHRHELGKYYPGTIHGNADRVGEGKG-----EGFNCNIPW-----P 303
            K F    +V Y S+  H++  +   T  G A +V          +G + NI W     P
Sbjct: 267 GKKFAEFPKVGYFSM--HDINSFPTET--GYATKVNIRNASTCIMDGHDLNI-WNIHLSP 321

Query: 304 WKGVGDAEYIWA-------------FEQVVLPMGREFQP--DLVIISSGFDAADGD-TVG 347
           W    D + ++              F      M +E +P   LV+IS+GFDA++ + T  
Sbjct: 322 WNTEEDFQKLYQSKYRTLFAKADDYFRNAKYQMAQEGKPFKGLVVISAGFDASEYEQTSM 381

Query: 348 QCH---VTPSCYGHMTHMLKSLA----RGNICAVLEGGYSLDSIAKSALGVAKVLIG 397
           Q H   V  + Y   T     LA    +G + ++LEGGYS  ++     GV   LIG
Sbjct: 382 QRHNVNVPTNFYTMFTKDALKLAQIHCQGKVLSLLEGGYSDKALTS---GVFAHLIG 435

>KAFR0H00890 Chr8 (167453..168877) [1425 bp, 474 aa] {ON} Anc_3.362
           YPR068C
          Length = 474

 Score = 69.3 bits (168), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 52/185 (28%), Positives = 83/185 (44%), Gaps = 14/185 (7%)

Query: 171 SYLSAKL--SCGGAIEACRAVVEGRVKNALAVVRPPG-HHAEPDLAGGFCLFSNVAVAAQ 227
           SYL   L  + G  +   + +V       + +    G HHA    A GFC  +++ +  Q
Sbjct: 181 SYLPMYLQVTTGATLSLSKFLVPNSKDRTICINWDGGRHHASKKKASGFCYINDIVLLIQ 240

Query: 228 NILKNYPESVKKIMILDWDVHHGNGTQKAFYNDDRVLYVSLHRHELGKYYPGTIHGNADR 287
            + KN     KKI  LD+D+HHG+G +KAF     +  +SLH  E G ++PGT  G    
Sbjct: 241 RMRKN---GFKKITYLDFDLHHGDGVEKAFQFSKSIQTISLHLFETG-FFPGT--GGL-- 292

Query: 288 VGEGKGEGFNCNIPWPWKGVGDAEYIWAFEQVVLPMGREFQPDLVIISSGFDAADGDTVG 347
               KG     +IP    G+ D       +Q+++P       + +++  G D   GD   
Sbjct: 293 --SNKGSRDLIDIPLS-HGLTDDYLFELVKQIIIPAIDLHAAEAIVLQCGGDGLSGDKFN 349

Query: 348 QCHVT 352
           +  +T
Sbjct: 350 EWQLT 354

>KNAG0H00630 Chr8 (105506..106876) [1371 bp, 456 aa] {ON} Anc_3.362
           YPR068C
          Length = 456

 Score = 69.3 bits (168), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 45/143 (31%), Positives = 77/143 (53%), Gaps = 17/143 (11%)

Query: 206 HHAEPDLAGGFCLFSNVAVAAQNILKNYPESVKKIMILDWDVHHGNGTQKAFYNDDRVLY 265
           HHA    A GFC  +++ +  Q + K   +   K+  LD+D+HHG+G ++AF    +V  
Sbjct: 206 HHASKGKASGFCYVNDIVLLIQKLRK---QGTGKVTYLDFDLHHGDGVERAFKFTKKVQT 262

Query: 266 VSLHRHELGKYYP--GTIHGNADRVGEGKGEGFN-CNIPWPWKGVGDAEYIWAFEQVVLP 322
           +SLH +E G ++P  G++ G++         GF+  N+P    G+ D+      +QVV P
Sbjct: 263 ISLHLYEPG-FFPCTGSLEGSS---------GFDTVNLPLQ-HGLTDSFLQGLVDQVVNP 311

Query: 323 MGREFQPDLVIISSGFDAADGDT 345
           + +   P++++I  G D   GDT
Sbjct: 312 LIQRHGPEVIVIQCGGDGLLGDT 334

>ZYRO0F10780g Chr6 complement(879680..881686) [2007 bp, 668 aa] {ON}
           similar to uniprot|Q02959 Saccharomyces cerevisiae
           YPL116W HOS3 Trichostatin A-insensitive homodimeric
           histone deacetylase (HDAC)
          Length = 668

 Score = 69.3 bits (168), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 87/336 (25%), Positives = 133/336 (39%), Gaps = 79/336 (23%)

Query: 170 DSYLSAKL------SCGGAIEACRAVVEG----RVKN-ALAVVRPPGHHAEPDLAGGFCL 218
           D YLS+K       S G    A  ++ +G     + N A   +RPPGHH       GFCL
Sbjct: 144 DIYLSSKTVEALQGSIGALETAVDSIFDGPSPEHISNRAFVAIRPPGHHCHVATPSGFCL 203

Query: 219 FSNVAVAAQNILKNYPESVKKIMILDWDVHHGNGTQ------------------------ 254
            +N  VA +     +   V    ILD+D+HHG+GTQ                        
Sbjct: 204 LNNAHVAIEYAKDRF--GVTHAAILDFDLHHGDGTQDICWKRAGFRPDEEDEDSPGYDSF 261

Query: 255 -KAFYNDDRVLYVSLHRHELGKYYPGTIHGNADRVGEGKG---EGFNCNIPW-----PWK 305
            K F    RV Y S+  H++  +   + +   + V           + NI W     PW+
Sbjct: 262 GKKFAEYPRVGYFSM--HDINSFPTESGYATKENVKNASTCIMNAHDVNI-WNIHLSPWE 318

Query: 306 GVGDAEYIWA-------------FEQVVLPMGREFQP--DLVIISSGFDAADGD-TVGQC 349
              D   ++              F+Q  + M  + +P   LV+ISSGFDA++ + T  Q 
Sbjct: 319 TEEDFAKLYHTKYRSLFVKADEFFKQGKIEMAAQNKPFKGLVVISSGFDASEFEQTSMQR 378

Query: 350 HVTPSCYGHMTHMLKSLAR-------GNICAVLEGGYSLDSIAKSALGVAKVLIGEPPDE 402
           H T       T   K   +       G + +++EGGYS  +I     GV   LIG     
Sbjct: 379 HGTNVPTYFYTAFTKDALKLSQMHCHGKVLSIMEGGYSDKAIVS---GVFAHLIGLQNQN 435

Query: 403 LPVVKQPKPEAVEVIDAVIKMQSRYWQCFKSTHAND 438
              +K+   E   V+  +++     W+ +K+  A D
Sbjct: 436 W--IKEWGSE--HVVKEIVRGCKSNWKPYKTKKARD 467

>ADL265W Chr4 (237911..239995) [2085 bp, 694 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL116W (HOS3)
          Length = 694

 Score = 69.3 bits (168), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 76/299 (25%), Positives = 119/299 (39%), Gaps = 70/299 (23%)

Query: 197 ALAVVRPPGHHAEPDLAGGFCLFSNVAVAAQNILKNYPESVKKIMILDWDVHHGNGTQ-- 254
           A   +RPPGHH+      GFCL +N  +A +     Y   V    ILD+D+HHG+GTQ  
Sbjct: 184 AFVALRPPGHHSHTSTPSGFCLLNNAHIAVEYAASRY--GVTHAAILDFDLHHGDGTQDI 241

Query: 255 -----------------------KAFYNDDRVLYVSLHR-----HELGKYYPGTIHG--- 283
                                  K F    +V Y SLH       E G  +  +I     
Sbjct: 242 CWKRAGFKPDDEEDNAAEYDDFGKRFAEFPKVGYFSLHDINSFPTEQGYAHKTSIKDASV 301

Query: 284 -----------NADRVGEGKGEGFNCNIPWPWKGV--GDAEYIWAFEQVVLPMGREFQPD 330
                      N         E FN      ++ +     E++   ++ +   G+ ++  
Sbjct: 302 CIMDSHDVNIWNIHLTAYETEEEFNKLYQTKYRAIFAKADEFLRVSQKRMASEGKNYK-G 360

Query: 331 LVIISSGFDAADGDTVGQ----CHVTPSCYGHMTHMLKSLA----RGNICAVLEGGYSLD 382
           L+IIS+GFDA++ + +       HV  S Y   T     LA    +G + ++LEGGYS  
Sbjct: 361 LIIISAGFDASEHEQLSMQRHGVHVPTSFYCAFTKDALKLAQMHTQGKLLSLLEGGYSDA 420

Query: 383 SIAKSALGVAKVLIGEPPDELPVVKQ---PKPEAVEVIDAVIKMQSRYWQCFKSTHAND 438
           ++     GV   LIG       +  Q   P+  + +VI  V +     W+ +K+  + D
Sbjct: 421 ALVS---GVFSHLIG-------MQNQNWIPEWGSAQVIKEVCRGCRPNWKAYKTKRSRD 469

>KLTH0D09592g Chr4 complement(792708..794825) [2118 bp, 705 aa] {ON}
           similar to uniprot|Q02959 Saccharomyces cerevisiae
           YPL116W HOS3 Trichostatin A-insensitive homodimeric
           histone deacetylase (HDAC)
          Length = 705

 Score = 68.9 bits (167), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 85/334 (25%), Positives = 132/334 (39%), Gaps = 73/334 (21%)

Query: 130 EEILQVHT---PEHLEFLSKTTSMTREQLLKETEK----GDSVYFNNDSYLSAKLSCGGA 182
           + +L+VH    P+ L  L K +    +Q   E  +    GD +Y +  +  + + S G  
Sbjct: 107 DHVLKVHGSDWPQELLKLCKNSQKALDQCQVEVPESWNVGD-IYLSRQTISALEGSIGAL 165

Query: 183 IEACRAV-----VEGRVKNALAVVRPPGHHAEPDLAGGFCLFSNVAVAAQNILKNYPESV 237
                ++     VE     A   +RPPGHH+      GFCL +N  +A +     Y   V
Sbjct: 166 ETGVDSIFHGPSVEQTSNRAFVALRPPGHHSHASTPSGFCLLNNAHIAIEYAADTY--GV 223

Query: 238 KKIMILDWDVHHGNGTQ-------------------------KAFYNDDRVLYVSLHR-- 270
              ++LD+D+HHG+GTQ                         K F    +V Y SLH   
Sbjct: 224 THAVVLDFDLHHGDGTQDICWKRAGFKPDGCDDGGSEYNEFGKKFAEFPKVGYFSLHDIN 283

Query: 271 ---HELGKYYPGTIHGNADRVGEG--------------KGEGFNCNIPWPWKGV--GDAE 311
               ELG      +   A  + +                 E F       ++ +     E
Sbjct: 284 SFPTELGYATKENVRNAATCIMDAHDVNIWNVHLQSYDSDEAFTKLYQTKYRTLFAKADE 343

Query: 312 YIWAFEQVVLPMGREFQPDLVIISSGFDAADGDTVGQ----CHVTPSCYGHMTHMLKSLA 367
           Y    +Q +  +G+ F+  LV+IS+GFDA++ +         +V    Y   T     LA
Sbjct: 344 YFRTAKQNMRALGKPFK-GLVVISAGFDASEYEQPSMQRHAVNVPTFFYNLFTKDALKLA 402

Query: 368 R----GNICAVLEGGYSLDSIAKSALGVAKVLIG 397
           +    G + +VLEGGYS  +I+    GV   LIG
Sbjct: 403 QMHSHGKLLSVLEGGYSDGAISS---GVFAHLIG 433

>KLLA0B09394g Chr2 (822629..823954) [1326 bp, 441 aa] {ON} similar
           to uniprot|Q12214 Saccharomyces cerevisiae YPR068C HOS1
           Putative class I histone deacetylase (HDAC) with
           sequence similarity to Hda1p, Rpd3p, Hos2p, and Hos3p;
           deletion results in increased histone acetylation at
           rDNA repeats; interacts with the Tup1p-Ssn6p complex
          Length = 441

 Score = 67.0 bits (162), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 43/173 (24%), Positives = 80/173 (46%), Gaps = 10/173 (5%)

Query: 206 HHAEPDLAGGFCLFSNVAVAAQNILKNYPESVKKIMILDWDVHHGNGTQKAFYNDDRVLY 265
           HHA    A GFC  +++ +  Q++ +   +  K++  +D+D+H+G+G  KAF   + V  
Sbjct: 193 HHALKHYASGFCYVNDIVLLIQSLRR---KGWKRVTYIDFDLHYGDGVAKAFRFSENVQT 249

Query: 266 VSLHRHELGKYYPGTIHGNADRVGEGKGEGFNCNIPWPWKGVGDAEYIWAFEQVVLPMGR 325
           +S+H +E G ++PGT       + E +      N+P    G+ D   +     V+ P+  
Sbjct: 250 ISVHLYEPG-FFPGT-----GSLEETRNSKQMVNLP-VLHGMDDKYLLELISSVITPLIE 302

Query: 326 EFQPDLVIISSGFDAADGDTVGQCHVTPSCYGHMTHMLKSLARGNICAVLEGG 378
            F  + ++I  G D   GD   +  ++     H    +  + R     +L GG
Sbjct: 303 TFNAECIVIQCGSDGLSGDKYNEWQLSIRGLTHAIISIMDMFRDKQVFLLGGG 355

>TPHA0A01120 Chr1 (216522..218618) [2097 bp, 698 aa] {ON} Anc_8.607
           YPL116W
          Length = 698

 Score = 67.0 bits (162), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 80/303 (26%), Positives = 122/303 (40%), Gaps = 74/303 (24%)

Query: 197 ALAVVRPPGHHAEPDLAGGFCLFSNVAVAAQNILKNYPESVKKIMILDWDVHHGNGTQ-- 254
           A   +RPPGHH       GFCL +N  +A +   + Y   V   +ILD+D+HHG+GTQ  
Sbjct: 186 AFVAIRPPGHHCHVSTPSGFCLLNNAQIAIEYAYEKY--GVSHAVILDFDLHHGDGTQDI 243

Query: 255 ----KAFYNDD-----------------------RVLYVSLHRHELGKYYPGTIHGNADR 287
                 F  DD                       +V Y S+  H++  +   + +   D 
Sbjct: 244 CWKRAGFKPDDGNVQDDEDKNEYDDFGKKMADFPKVGYFSM--HDINSFPTESGYATKDN 301

Query: 288 VGEGKG---EGFNCNIPW-----PWKGVGDAEYIWAFEQVVL----------------PM 323
           +        +  + NI W      W    D   ++  +   L                 M
Sbjct: 302 IKNASTCVMDAHDLNI-WNVHLQTWATEEDFNKLYQTKYRTLFAKADEFFKNAKNQMQEM 360

Query: 324 GREFQPDLVIISSGFDAADGD-TVGQCH---VTPSCYGHMTHMLKSLAR----GNICAVL 375
            + F+  LV+IS+GFDA++ + T  Q H   V  S Y   T     LA+    G + +VL
Sbjct: 361 NKPFK-GLVVISAGFDASEFEQTSMQRHSVNVPTSFYTTFTKDALKLAQLHCNGKVLSVL 419

Query: 376 EGGYSLDSIAKSALGVAKVLIGEPPDELPVVKQPKPEAVEVIDAVIKMQSRYWQCFKSTH 435
           EGGYS  +IA    GV   LIG        +K+   E  +VI  +++     W  +K+  
Sbjct: 420 EGGYSDKAIAS---GVFSHLIGLQNQNW--IKEWGSE--QVIKEIVRGCKPSWTPYKTKK 472

Query: 436 AND 438
           + D
Sbjct: 473 SRD 475

>ADL339W Chr4 (110772..112085) [1314 bp, 437 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPR068C (HOS1)
          Length = 437

 Score = 66.2 bits (160), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 52/175 (29%), Positives = 79/175 (45%), Gaps = 24/175 (13%)

Query: 181 GAIEACRAVVEGRVKNALAVVRPPG-HHAEPDLAGGFCLFSNVAVAAQNILKNYPESVKK 239
           GA  A    +     +ALAV    G HHA    A GFC  +++A+  Q + +   +   +
Sbjct: 167 GATLALAKELSRHRGSALAVNWDGGRHHALKARASGFCYVNDIALLIQTLRR---QGFLR 223

Query: 240 IMILDWDVHHGNGTQKAFYNDDRVLYVSLHRHELGKYYPGTIHGNADRVGEGKGEGFNC- 298
           +  +D+D+HHG+G + AF     V   SLH  E G ++PGT            G   NC 
Sbjct: 224 VSYVDFDLHHGDGVENAFRYSKNVQTCSLHLFEPG-FFPGT------------GACKNCT 270

Query: 299 -----NIPWPWKGVGDAEYIWAFEQVVLPMGREFQPDLVIISSGFDAADGDTVGQ 348
                N+P    GV D+      + +V P  +   P+++II  G D   GD  G+
Sbjct: 271 DNSVLNVPL-LHGVDDSTLDHVVDHIVTPAVQRHDPEVLIIQCGGDGLSGDKYGE 324

>KNAG0J01300 Chr10 (232784..234817) [2034 bp, 677 aa] {ON} Anc_8.607
           YPL116W
          Length = 677

 Score = 65.9 bits (159), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 88/349 (25%), Positives = 145/349 (41%), Gaps = 78/349 (22%)

Query: 154 QLLKETEKGDSVYFNNDSYLSAKLSCGGAIEA------CRAVVEGRVKNALAVVRPPGHH 207
           ++ KE   GD +Y ++ + L+A     GA+E         A  E        VVRPPGHH
Sbjct: 136 EVPKEWNAGD-IYLSSAT-LTALRGTIGALETGVDTIFTGASPEHISNRVFVVVRPPGHH 193

Query: 208 AEPDLAGGFCLFSNVAVAAQNILKNYPESVKKIMILDWDVHHGNGTQ-----KAFYNDD- 261
                  GFCL +N  ++ +     Y   V    ILD+D+HHG+GTQ     +A +  D 
Sbjct: 194 CHVTGPSGFCLLNNAHISIEYAADTY--GVTHAAILDFDLHHGDGTQDICWKRAGFKPDG 251

Query: 262 ---------------------RVLYVSLHRHELGKYYPGTIHGNADRVGEGKG---EGFN 297
                                +V Y S+  H++  +   + +  ++ +        +  +
Sbjct: 252 ATREENEEPYDDFGKRTAAFPKVGYFSM--HDINSFPTESGYATSENIRNASTCIMDSHD 309

Query: 298 CNIPW-----PWKGVGDAEYIWA-------------FEQVVLPMGREFQP--DLVIISSG 337
            NI W     PW    D   ++              F+   L M ++  P   LV+IS+G
Sbjct: 310 LNI-WNVHLAPWATEEDFMKLYRSKYRTLFAKADEYFKTARLEMQKQGTPFKGLVVISAG 368

Query: 338 FDAADGD-TVGQCH---VTPSCYGHMTHMLKSLA----RGNICAVLEGGYSLDSIAKSAL 389
           FDA++ + T  Q H   V    Y   T  +  LA    +G + +V+EGGYS  +I     
Sbjct: 369 FDASEFEQTSMQRHSVNVPTEFYTLFTKDVLKLAQMHTQGKVLSVMEGGYSDKAITS--- 425

Query: 390 GVAKVLIGEPPDELPVVKQPKPEAVEVIDAVIKMQSRYWQCFKSTHAND 438
           GV   LIG    +   +++   E  +V+  +++     W+ +K+  A D
Sbjct: 426 GVFAHLIGLQNQDW--IREWGSE--QVVKEIVRGCKPNWKPYKTKRAQD 470

>Kwal_26.8505 s26 complement(815901..818027) [2127 bp, 708 aa] {ON}
           YPL116W (HOS3) - sequence similar to the histone
           deacetylase Hda1p [contig 61] FULL
          Length = 708

 Score = 65.1 bits (157), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 67/254 (26%), Positives = 102/254 (40%), Gaps = 59/254 (23%)

Query: 197 ALAVVRPPGHHAEPDLAGGFCLFSNVAVAAQNILKNYPESVKKIMILDWDVHHGNGTQ-- 254
           A   +RPPGHH+      GFCL +N  +A +     Y  +V   ++LD+D+HHG+GTQ  
Sbjct: 187 AFVALRPPGHHSHASTPSGFCLLNNAHIAIEYAADTY--NVTHAVVLDFDLHHGDGTQDI 244

Query: 255 ----------------------KAFYNDDRVLYVSLHR-----HELGKYYPGTIHGNADR 287
                                 K F    +V Y S+H       ELG      I   A  
Sbjct: 245 CWKRAGFKPDECADSGEFDEFGKKFAEYPKVGYFSVHDINSFPTELGYATKENIRNAATC 304

Query: 288 VGEGKG--------------EGFNCNIPWPWKGV--GDAEYIWAFEQVVLPMGREFQPDL 331
           + +                 E F       ++ +     E+    +Q +  +G+ F+  L
Sbjct: 305 IMDAHDVNIWNVHLQPYDSEEAFTKLYQTKYRTLFAKADEFFRISKQTMKALGKPFK-GL 363

Query: 332 VIISSGFDAADGDTVGQ----CHVTPSCYGHMTHMLKSLAR----GNICAVLEGGYSLDS 383
           V+IS+GFDA++ +         +V    Y   T     LA+    G + +V+EGGYS  +
Sbjct: 364 VVISAGFDASEYEQPSMQRHAVNVPTFFYNTFTKDALKLAQMHSHGKVLSVMEGGYSDGA 423

Query: 384 IAKSALGVAKVLIG 397
           I     GV   LIG
Sbjct: 424 ITS---GVFAHLIG 434

>KAFR0H02790 Chr8 complement(531813..533966) [2154 bp, 717 aa] {ON}
           Anc_8.607 YPL116W
          Length = 717

 Score = 64.7 bits (156), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 38/134 (28%), Positives = 63/134 (47%), Gaps = 13/134 (9%)

Query: 132 ILQVHTP----EHLEFLSKTTSMTREQLLK--ETEKGDSVYFNNDSYLSAKLSCGGAIEA 185
           +++VH      E +    +  S  RE  L+  E+     +Y N+D+ ++ K S G     
Sbjct: 109 VIKVHGSKWPNEVIRLCHEADSKLREGKLEVPESWNAGDIYLNSDTIMALKGSIGAIETG 168

Query: 186 CRAVVEGR-----VKNALAVVRPPGHHAEPDLAGGFCLFSNVAVAAQNILKNYPESVKKI 240
             ++  G         A   +RPPGHH    +  GFCL +N  +  +     Y   V  +
Sbjct: 169 VDSIFNGPSPEHICNRAFVAIRPPGHHCHVGMPSGFCLLNNANITIEYAANTY--GVTHV 226

Query: 241 MILDWDVHHGNGTQ 254
           ++LD+D+HHG+GTQ
Sbjct: 227 VVLDFDLHHGDGTQ 240

 Score = 38.9 bits (89), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 37/136 (27%), Positives = 67/136 (49%), Gaps = 16/136 (11%)

Query: 311 EYIWAFEQVVLPMGREFQPDLVIISSGFDAADGDTVG----QCHVTPSCYGHMTHMLKSL 366
           E+  A +  +  MG+ ++  LV+ISSGFDA++ + V       +V  + Y   T     L
Sbjct: 346 EFFKAAKLEMASMGKPYK-GLVLISSGFDASEFEQVSMQRHSVNVPTTFYTMFTKDALKL 404

Query: 367 AR----GNICAVLEGGYSLDSIAKSALGVAKVLIGEPPDELPVVKQPKPEAVEVIDAVIK 422
           A+    G + +++EGGYS  +I     GV   LIG    +   +K+   E  +V+  +++
Sbjct: 405 AQMHCHGKVISIMEGGYSDKAITS---GVFAHLIGLQNQDW--IKEWGSE--QVVKEIVR 457

Query: 423 MQSRYWQCFKSTHAND 438
                W+ +K+   +D
Sbjct: 458 GCKPTWKPYKTKRNDD 473

>Smik_6.315 Chr6 complement(492590..494683) [2094 bp, 697 aa] {ON}
           YPL116W (REAL)
          Length = 697

 Score = 63.9 bits (154), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 45/134 (33%), Positives = 66/134 (49%), Gaps = 13/134 (9%)

Query: 132 ILQVHTPEHLEFLSKTTSMTREQLLKETEKGDSVYFNNDSYLSAKL-----SCGGAIE-A 185
           +L+VH       L +   M   +LLK   +    + + D YLS+K         GAIE  
Sbjct: 110 VLKVHGSHWPAELIELCQMADAKLLKGEIEVPDTWNSGDIYLSSKTIKALQGTIGAIETG 169

Query: 186 CRAVVEG----RVKN-ALAVVRPPGHHAEPDLAGGFCLFSNVAVAAQNILKNYPESVKKI 240
             ++ EG     + N A   +RPPGHH       GFCL +N  VA +     Y  +V  +
Sbjct: 170 VDSIFEGPSAEHISNRAFVAIRPPGHHCHYATPSGFCLLNNAHVAIEYAYDTY--NVTHV 227

Query: 241 MILDWDVHHGNGTQ 254
           ++LD+D+HHG+GTQ
Sbjct: 228 VVLDFDLHHGDGTQ 241

 Score = 38.5 bits (88), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 58/233 (24%), Positives = 95/233 (40%), Gaps = 59/233 (25%)

Query: 214 GGFCLFSNVAVAAQNILKNYPESVKKIMILDWDVHHGNGTQKAFYNDDRVLYVSLHRHEL 273
            GF    N+  A+  I+ ++  ++       W+VH    T +  +N   +LY + +R   
Sbjct: 289 SGFATKENIKNASTCIMNSHDLNI-------WNVHLSKWTTEEEFN---ILYRTKYR--- 335

Query: 274 GKYYPGTIHGNADRVGEGKGEGFNCNIPWPWKGVGDAEYIWAFEQVVLPMGREFQPDLVI 333
                 T+   AD       +  N N   P+KG                        LV+
Sbjct: 336 ------TLFAKADEFFRSAKQEMNQNEK-PFKG------------------------LVV 364

Query: 334 ISSGFDAADGD-TVGQCH---VTPSCYGHMTHMLKSLAR----GNICAVLEGGYSLDSIA 385
           IS+GFDA++ + T  Q H   V  S Y   T     LA+    G + +++EGGYS  +I 
Sbjct: 365 ISAGFDASEFEQTSMQRHSVNVPTSFYTTFTKDALKLAQMHCHGKVLSLMEGGYSDKAIC 424

Query: 386 KSALGVAKVLIGEPPDELPVVKQPKPEAVEVIDAVIKMQSRYWQCFKSTHAND 438
               GV   LIG    +   VK+   E  +V+  +++     W+ +K+  A D
Sbjct: 425 S---GVFAHLIGLQNQDW--VKEWGSE--QVVKEIVRGCKPAWKPYKTRRAKD 470

>Ecym_3465 Chr3 (874618..875955) [1338 bp, 445 aa] {ON} similar to
           Ashbya gossypii ADL339W
          Length = 445

 Score = 62.0 bits (149), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 42/153 (27%), Positives = 69/153 (45%), Gaps = 23/153 (15%)

Query: 206 HHAEPDLAGGFCLFSNVAVAAQNILKNYPESVKKIMILDWDVHHGNGTQKAFYNDDRVLY 265
           HHA    A GFC  +++ +  Q + KN      ++  +D+D+HHG+  + AF     V  
Sbjct: 195 HHAFKSRASGFCYINDIVLLIQELRKN---GYSRVSYVDFDLHHGDAVESAFQYSRNVQT 251

Query: 266 VSLHRHELGKYYPGTIHGNADRVGEGKGEGFNC------NIPWPWKGVGDAEYIWAFEQV 319
            SLH  E G ++PGT            G   NC      NIP  + G+ D       + +
Sbjct: 252 CSLHLFEAG-FFPGT------------GSFKNCRETNVVNIPL-FHGLDDESLDEIVDNI 297

Query: 320 VLPMGREFQPDLVIISSGFDAADGDTVGQCHVT 352
           ++P   +  P++++I  G D   GD   +  +T
Sbjct: 298 LIPCVNKHDPEVLVIQCGADGLSGDKYKEWQLT 330

>KLLA0F00858g Chr6 complement(78519..80666) [2148 bp, 715 aa] {ON}
           similar to uniprot|Q02959 Saccharomyces cerevisiae
           YPL116W HOS3 Trichostatin A-insensitive homodimeric
           histone deacetylase (HDAC)
          Length = 715

 Score = 61.2 bits (147), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 27/65 (41%), Positives = 37/65 (56%), Gaps = 2/65 (3%)

Query: 190 VEGRVKNALAVVRPPGHHAEPDLAGGFCLFSNVAVAAQNILKNYPESVKKIMILDWDVHH 249
           VE     A   +RPPGHH+      GFCL +N  +A +   + Y   V   +ILD+D+HH
Sbjct: 176 VEQTANRAFIAIRPPGHHSHASTPSGFCLLNNAHIAIEYAFEKY--DVTHAVILDFDLHH 233

Query: 250 GNGTQ 254
           G+GTQ
Sbjct: 234 GDGTQ 238

 Score = 37.0 bits (84), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 29/75 (38%), Positives = 39/75 (52%), Gaps = 11/75 (14%)

Query: 331 LVIISSGFDAADGDTVG----QCHVTPSCYGHMTHMLKSLAR----GNICAVLEGGYSLD 382
           LV+IS+GFDA++ +         +V  S Y   T     LA+    G I +V+EGGYS  
Sbjct: 368 LVVISAGFDASEYEQQSMQRHNVNVPTSFYNLFTKDALKLAQMHSNGKIISVMEGGYSDG 427

Query: 383 SIAKSALGVAKVLIG 397
           +IA    GV   LIG
Sbjct: 428 AIAS---GVFSHLIG 439

>Skud_16.164 Chr16 (301141..303234) [2094 bp, 697 aa] {ON} YPL116W
           (REAL)
          Length = 697

 Score = 59.7 bits (143), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 42/134 (31%), Positives = 61/134 (45%), Gaps = 13/134 (9%)

Query: 132 ILQVHTPEHLEFLSKTTSMTREQLLKETEKGDSVYFNNDSYLSAKL--SCGGAIEACRAV 189
           + +VH       L K       +LLK   +    + + D YLS+K   +  G I A    
Sbjct: 110 VFKVHGSHWPAELIKLCQEADSKLLKGEIEVPDTWNSGDIYLSSKTIKALQGTIGAIETG 169

Query: 190 VEGRVK---------NALAVVRPPGHHAEPDLAGGFCLFSNVAVAAQNILKNYPESVKKI 240
           V+   K          A   +RPPGHH       GFCL +N  VA +     Y  +V  +
Sbjct: 170 VDSIFKGPSPEHISNRAFVAIRPPGHHCHYATPSGFCLLNNAHVAIEYAHDAY--NVTHV 227

Query: 241 MILDWDVHHGNGTQ 254
           ++LD+D+HHG+GTQ
Sbjct: 228 VVLDFDLHHGDGTQ 241

 Score = 33.9 bits (76), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 36/123 (29%), Positives = 60/123 (48%), Gaps = 16/123 (13%)

Query: 324 GREFQPDLVIISSGFDAADGD-TVGQCH-VTPSCYGHMTHMLKSL------ARGNICAVL 375
           G+ F+  LV+IS+GFDA++ + T  Q H V    Y + T    +L        G + +++
Sbjct: 356 GKSFE-GLVVISAGFDASEFEQTSMQRHSVNVPTYFYTTFTKDALKLAQMHCHGKVLSLM 414

Query: 376 EGGYSLDSIAKSALGVAKVLIGEPPDELPVVKQPKPEAVEVIDAVIKMQSRYWQCFKSTH 435
           EGGYS  +I     GV   LIG    +   V +   E  +V+  +++     W+ +K+  
Sbjct: 415 EGGYSDKAICS---GVFAHLIGLQNQDW--VNEWGSE--QVVKEIVRGCKPAWKPYKTRR 467

Query: 436 AND 438
           A D
Sbjct: 468 AKD 470

>NDAI0E02480 Chr5 (512966..515020) [2055 bp, 684 aa] {ON} Anc_8.607
           YPL116W
          Length = 684

 Score = 59.3 bits (142), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 34/98 (34%), Positives = 49/98 (50%), Gaps = 13/98 (13%)

Query: 168 NNDSYLSAKL--SCGGAIEACRAVVEGRVK---------NALAVVRPPGHHAEPDLAGGF 216
           + D YLS+K   +  G+I A    V+   K          A   +RPPGHH       GF
Sbjct: 144 SGDIYLSSKTVQALQGSIGALETAVDSIFKGPSPEHISNRAFVAIRPPGHHCHFATPSGF 203

Query: 217 CLFSNVAVAAQNILKNYPESVKKIMILDWDVHHGNGTQ 254
           C+ +N  VA +    +Y   V  + +LD+D+HHG+GTQ
Sbjct: 204 CVLNNAHVAIEYAADSY--DVTHVAVLDFDLHHGDGTQ 239

>NCAS0C01760 Chr3 (324446..326548) [2103 bp, 700 aa] {ON} Anc_8.607
           YPL116W
          Length = 700

 Score = 58.5 bits (140), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 35/96 (36%), Positives = 46/96 (47%), Gaps = 13/96 (13%)

Query: 170 DSYLSAKL--SCGGAIEACRAVVEGRVK---------NALAVVRPPGHHAEPDLAGGFCL 218
           D YLS+K   +  G I A    V+   K          A   +RPPGHH       GFCL
Sbjct: 146 DIYLSSKTIQALQGTIGALETGVDSIFKGPSADHISNRAFVAIRPPGHHCHFATPSGFCL 205

Query: 219 FSNVAVAAQNILKNYPESVKKIMILDWDVHHGNGTQ 254
            +N  VA +     Y   V  + +LD+D+HHG+GTQ
Sbjct: 206 LNNAHVAIEYAADTY--GVTHVAVLDFDLHHGDGTQ 239

 Score = 36.6 bits (83), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 39/136 (28%), Positives = 65/136 (47%), Gaps = 16/136 (11%)

Query: 311 EYIWAFEQVVLPMGREFQPDLVIISSGFDAADGD-TVGQCH---VTPSCYGHMTHMLKSL 366
           EY    +  +  +GR F+  +V+IS+GFDA++ + T  Q H   V    Y   T     L
Sbjct: 343 EYFKTAKLEMAALGRPFK-GMVLISAGFDASEFEQTTMQRHGSNVPTEFYTMFTKDALKL 401

Query: 367 A----RGNICAVLEGGYSLDSIAKSALGVAKVLIGEPPDELPVVKQPKPEAVEVIDAVIK 422
           A    +G + +++EGGYS  +I     GV   LIG    +   +K+   E   VI  +++
Sbjct: 402 AQMHCQGKVLSLMEGGYSDKAITS---GVFAHLIGLQNQDW--IKEWGSE--HVIKEIVR 454

Query: 423 MQSRYWQCFKSTHAND 438
                W+ +K+  + D
Sbjct: 455 GCKPAWKPYKTKRSKD 470

>SAKL0H08338g Chr8 (716414..718486) [2073 bp, 690 aa] {ON} similar
           to uniprot|Q02959 Saccharomyces cerevisiae YPL116W HOS3
           Trichostatin A-insensitive homodimeric histone
           deacetylase (HDAC)
          Length = 690

 Score = 58.5 bits (140), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 40/146 (27%), Positives = 70/146 (47%), Gaps = 18/146 (12%)

Query: 132 ILQVHTPEHLEFLSKTTSMTREQLL-KETEKGDS-----VYFNNDSYLSAKLSCGGAIEA 185
           +L+VH  +  + L +    + E+L  K+ E  D      +Y +  +  + + S G     
Sbjct: 109 VLKVHGTDWPKELLQLCKQSSEKLAHKQVEVPDDWNVGDIYLSQQTIAALEGSIGALETG 168

Query: 186 CRAVVEGRVK-----NALAVVRPPGHHAEPDLAGGFCLFSNVAVAAQNILKNYPESVKKI 240
             ++ +G  +      A   VRPPGHH+      GFCL +N  +A +     +  +V   
Sbjct: 169 IDSIFQGSSQEDIANRAFVAVRPPGHHSHTATPSGFCLLNNAHIAIEYAADTF--NVTHA 226

Query: 241 MILDWDVHHGNGTQ-----KAFYNDD 261
           ++LD+D+HHG+GTQ     +A +N D
Sbjct: 227 VVLDFDLHHGDGTQDICWKRAGFNPD 252

 Score = 37.4 bits (85), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 29/95 (30%), Positives = 51/95 (53%), Gaps = 12/95 (12%)

Query: 311 EYIWAFEQVVLPMGREFQPDLVIISSGFDAADGDTVG-QCH--VTPSCYGHM-----THM 362
           E+    ++ +   G++F+  LV+IS+GFDA++ +    Q H    P+C+ +M       +
Sbjct: 342 EFFKNAKKEMASQGKKFK-GLVVISAGFDASEYEQPSMQRHGVNVPTCFYNMFTKDALKL 400

Query: 363 LKSLARGNICAVLEGGYSLDSIAKSALGVAKVLIG 397
            +    G + +V+EGGYS  +I+    GV   LIG
Sbjct: 401 AQMHTSGKVLSVMEGGYSDGAISS---GVFSHLIG 432

>TPHA0M01590 Chr13 complement(332934..334418) [1485 bp, 494 aa] {ON}
           Anc_3.362 YPR068C
          Length = 494

 Score = 57.0 bits (136), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 66/271 (24%), Positives = 110/271 (40%), Gaps = 39/271 (14%)

Query: 206 HHAEPDLAGGFCLFSNVAVAAQNILKNYPESV---KKIMILDWDVHHGNGTQKAFYNDDR 262
           HHA    A GFC  +++ V+  N L+  P      +K+  +D D+HHG+G + AF     
Sbjct: 206 HHAMKSRANGFCYINDI-VSLINELRKTPGQQGHKRKLTYIDLDLHHGDGVENAFNYSKD 264

Query: 263 VLYVSLHRHELGKYYPGTIHGNADRVGEGKGEGFNCNIPWPWKGVGDAEYIWAFEQVVLP 322
           +  +S+H  E G +YP T      + G+ K      N+P    G+ ++        +++P
Sbjct: 265 IQIISIHLFEPG-FYPCT---GGLKFGKPKSNNI-INLPVK-HGLSNSNMFELVTNIIIP 318

Query: 323 MGREFQPDLVIISSGFDAADGDTVGQCHVTPSCYGHMTHMLKSLAR----------GNIC 372
           +    Q D ++I  G D  + D   +  +T    G    ++K +A            N+ 
Sbjct: 319 LIELHQSDDIVILCGGDGLNNDYYNEWQLT--IIGLTRCIIKIIAAFVGPHQPGSCKNVV 376

Query: 373 AVLEGGYS--LDSIAKSALGVAKV-LIGEPPDELPVVKQPKPEAV-------------EV 416
            +  GGY+  L S   + L    + L G  P     +    P                E 
Sbjct: 377 LLGGGGYNELLASRFYTYLTYKVLQLAGRIPPAATTLAAEVPHGTIDDKDKELLIKDHEH 436

Query: 417 IDAVIKMQSRYWQCFKSTHANDGCSFKEPVT 447
           ID   K   +YW C++  +  DG SFK  + 
Sbjct: 437 IDEYEKEYYKYW-CYEIENGLDGLSFKRQIN 466

>CAGL0J06974g Chr10 (667811..669847) [2037 bp, 678 aa] {ON} highly
           similar to uniprot|Q02959 Saccharomyces cerevisiae
           YPL116w HOS3
          Length = 678

 Score = 53.1 bits (126), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 31/57 (54%), Gaps = 2/57 (3%)

Query: 198 LAVVRPPGHHAEPDLAGGFCLFSNVAVAAQNILKNYPESVKKIMILDWDVHHGNGTQ 254
              +RPPGHH       GFCL +N  +  +     Y   V   +ILD+D+HHG+GTQ
Sbjct: 183 FVAIRPPGHHCHYATPSGFCLLNNAHIGIEYAADKY--GVTHAVILDFDLHHGDGTQ 237

 Score = 37.4 bits (85), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 32/83 (38%), Positives = 45/83 (54%), Gaps = 12/83 (14%)

Query: 323 MGREFQPDLVIISSGFDAADGD-TVGQCH---VTPSCYGHMTHMLKSLA----RGNICAV 374
           +G+ F+  LV+IS+GFDA++ + T  Q H   V  S Y   T     LA    +G + ++
Sbjct: 351 LGKPFK-GLVVISAGFDASEFEQTSMQRHSVNVPTSFYTMFTKDALKLAQMHCQGKVLSL 409

Query: 375 LEGGYSLDSIAKSALGVAKVLIG 397
           LEGGYS  +I     GV   LIG
Sbjct: 410 LEGGYSDKAITS---GVFSHLIG 429

>Smik_16.223 Chr16 (406804..410484) [3681 bp, 1226 aa] {ON} YPL012W
           (REAL)
          Length = 1226

 Score = 33.9 bits (76), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 36/135 (26%), Positives = 54/135 (40%), Gaps = 30/135 (22%)

Query: 305 KGVGDAEYIWAFEQVVLPMGREF-QPDLVIISS---GFDAADGDTVGQCH-----VTPSC 355
           K V +     AF+ ++  MGR+  +P+ +I  S   G+D A  D +         ++   
Sbjct: 835 KDVNEKSRETAFDTLI-NMGRKMNEPNSIIKLSQIPGYDPATPDQLSSISEFFKIISAGL 893

Query: 356 YGHMTHMLKSLARGNICAVLEGGYSLDS--------------------IAKSALGVAKVL 395
            G   HM+ S   G  C V E    +DS                    I KSA+G  KV 
Sbjct: 894 IGESQHMVSSSITGYACLVFEFKNEIDSGILMDIYDTIELYLTSNSREIVKSAIGFTKVC 953

Query: 396 IGEPPDELPVVKQPK 410
           +   P+EL   K P+
Sbjct: 954 VLGLPEELMRPKVPE 968

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.136    0.413 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 79,536,654
Number of extensions: 3593350
Number of successful extensions: 9538
Number of sequences better than 10.0: 106
Number of HSP's gapped: 9464
Number of HSP's successfully gapped: 127
Length of query: 708
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 591
Effective length of database: 40,065,477
Effective search space: 23678696907
Effective search space used: 23678696907
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 69 (31.2 bits)