Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_27.115322.286ON47947924900.0
KLTH0G10362g2.286ON52948320860.0
SAKL0E07678g2.286ON47748018080.0
KLLA0E08361g2.286ON49149217800.0
KAFR0H033102.286ON48848816390.0
NDAI0G006602.286ON49649916260.0
Ecym_33252.286ON49648416120.0
ADL215W2.286ON48448615850.0
TPHA0C034002.286ON49449515850.0
KNAG0H020002.286ON49849615840.0
TDEL0G021702.286ON48448715710.0
Kpol_1003.382.286ON49649615470.0
YNL022C2.286ON49049615440.0
Suva_14.3252.286ON49049215400.0
CAGL0M06941g2.286ON49249415340.0
Skud_14.3072.286ON49049215290.0
TBLA0B069602.286ON50850715060.0
Smik_14.3092.286ON49049214940.0
NCAS0G037902.286ON49249514890.0
ZYRO0A01892g2.286ON46548314630.0
TPHA0H001508.171ON6492901812e-13
TDEL0B043908.171ON6732931714e-12
AFR179C8.171ON7002891705e-12
NDAI0B018308.171ON6862921705e-12
ZYRO0G08998g8.171ON6833001643e-11
ADL254W2.247ON6032341633e-11
Kpol_1002.1098.171ON6702931634e-11
TBLA0E038502.247ON6321971591e-10
Kpol_1003.152.247ON6331971591e-10
ZYRO0A01562g2.247ON6171971591e-10
SAKL0H19448g8.171ON6912891591e-10
KLLA0F03399g2.247ON6191971581e-10
SAKL0E08624g2.247ON6111971571e-10
KAFR0J009702.247ON6101921572e-10
NCAS0G030302.247ON4901921562e-10
Ecym_32842.247ON6061971562e-10
KNAG0I018702.247ON6291971562e-10
KNAG0D020508.171ON6822921563e-10
Smik_14.2662.247ON6182161563e-10
NCAS0B043908.171ON6712941563e-10
TPHA0C031502.247ON6081971553e-10
Kwal_23.48412.247ON6272211544e-10
KLTH0G09460g2.247ON6371971544e-10
CAGL0J10032g2.247ON6191971535e-10
Skud_14.2712.247ON6191921535e-10
YNL061W (NOP2)2.247ON6182161527e-10
KNAG0G015108.171ON6662901527e-10
NDAI0D010502.247ON6251921527e-10
TDEL0C041502.247ON6142191518e-10
Ecym_23538.171ON6902901511e-09
TBLA0A087408.171ON6862931511e-09
Suva_14.2802.247ON6201921501e-09
NCAS0B056408.171ON6592961501e-09
Smik_2.928.171ON6742941501e-09
KAFR0B022208.171ON6862921492e-09
Suva_2.978.171ON6702931492e-09
KLTH0H08096g8.171ON6882901473e-09
Skud_2.818.171ON6812931464e-09
YBL024W (NCL1)8.171ON6842931446e-09
TPHA0C028708.171ON6742961446e-09
CAGL0K01991g8.171ON6722871438e-09
KLLA0F12562g8.171ON7042971359e-08
NDAI0B029808.171ON6792951304e-07
Kwal_14.20818.171ON272124950.003
Smik_6.4746.1ON31873800.24
Skud_16.116.1ON31873780.45
YPL266W (DIM1)6.1ON31873780.45
Suva_16.396.1ON31873780.51
Ecym_30036.1ON31973760.77
SAKL0E00660g6.1ON32273760.92
Kpol_449.126.1ON31976750.96
KNAG0H024605.215ON924135741.6
KNAG0L024406.1ON31780731.6
KAFR0B066506.174ON572110741.8
CAGL0L07678g6.1ON31773731.9
KAFR0B064506.1ON31876732.1
TBLA0A070806.1ON32173713.1
TPHA0J002006.1ON31973713.6
KLTH0C11704g6.1ON32273713.7
ZYRO0B11836g8.237ON77056713.8
ACR026W6.1ON31973704.2
Kwal_56.223176.1ON36273704.2
NCAS0D022506.1ON31973704.3
NDAI0I027106.1ON31973704.4
KLLA0D00594g6.1ON32073688.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_27.11532
         (479 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_27.11532 s27 complement(837572..839011) [1440 bp, 479 aa] {...   963   0.0  
KLTH0G10362g Chr7 (876756..878345) [1590 bp, 529 aa] {ON} highly...   808   0.0  
SAKL0E07678g Chr5 complement(621183..622616) [1434 bp, 477 aa] {...   701   0.0  
KLLA0E08361g Chr5 complement(751889..753364) [1476 bp, 491 aa] {...   690   0.0  
KAFR0H03310 Chr8 complement(630597..632063) [1467 bp, 488 aa] {O...   635   0.0  
NDAI0G00660 Chr7 (144471..145961) [1491 bp, 496 aa] {ON} Anc_2.2...   630   0.0  
Ecym_3325 Chr3 (623214..624704) [1491 bp, 496 aa] {ON} similar t...   625   0.0  
ADL215W Chr4 (326584..328038) [1455 bp, 484 aa] {ON} Syntenic ho...   615   0.0  
TPHA0C03400 Chr3 (747016..748500) [1485 bp, 494 aa] {ON} Anc_2.2...   615   0.0  
KNAG0H02000 Chr8 complement(353074..354570) [1497 bp, 498 aa] {O...   614   0.0  
TDEL0G02170 Chr7 (427274..428728) [1455 bp, 484 aa] {ON} Anc_2.2...   609   0.0  
Kpol_1003.38 s1003 (94479..95969) [1491 bp, 496 aa] {ON} (94479....   600   0.0  
YNL022C Chr14 complement(591427..592899) [1473 bp, 490 aa] {ON} ...   599   0.0  
Suva_14.325 Chr14 complement(574309..575781) [1473 bp, 490 aa] {...   597   0.0  
CAGL0M06941g Chr13 complement(706878..708356) [1479 bp, 492 aa] ...   595   0.0  
Skud_14.307 Chr14 complement(562104..563576) [1473 bp, 490 aa] {...   593   0.0  
TBLA0B06960 Chr2 (1646966..1648492) [1527 bp, 508 aa] {ON} Anc_2...   584   0.0  
Smik_14.309 Chr14 complement(553805..555277) [1473 bp, 490 aa] {...   580   0.0  
NCAS0G03790 Chr7 complement(699962..701440) [1479 bp, 492 aa] {O...   578   0.0  
ZYRO0A01892g Chr1 (156967..158364) [1398 bp, 465 aa] {ON} simila...   568   0.0  
TPHA0H00150 Chr8 (15977..17926) [1950 bp, 649 aa] {ON} Anc_8.171...    74   2e-13
TDEL0B04390 Chr2 (769749..771770) [2022 bp, 673 aa] {ON} Anc_8.1...    70   4e-12
AFR179C Chr6 complement(766458..768560) [2103 bp, 700 aa] {ON} S...    70   5e-12
NDAI0B01830 Chr2 (436254..438314) [2061 bp, 686 aa] {ON} Anc_8.1...    70   5e-12
ZYRO0G08998g Chr7 complement(726070..728121) [2052 bp, 683 aa] {...    68   3e-11
ADL254W Chr4 (253602..255413) [1812 bp, 603 aa] {ON} Syntenic ho...    67   3e-11
Kpol_1002.109 s1002 (272892..274904) [2013 bp, 670 aa] {ON} (272...    67   4e-11
TBLA0E03850 Chr5 (967569..969467) [1899 bp, 632 aa] {ON} Anc_2.2...    66   1e-10
Kpol_1003.15 s1003 (41683..43584) [1902 bp, 633 aa] {ON} (41683....    66   1e-10
ZYRO0A01562g Chr1 (128145..129998) [1854 bp, 617 aa] {ON} simila...    66   1e-10
SAKL0H19448g Chr8 (1713663..1715738) [2076 bp, 691 aa] {ON} high...    66   1e-10
KLLA0F03399g Chr6 (319007..320866) [1860 bp, 619 aa] {ON} simila...    65   1e-10
SAKL0E08624g Chr5 complement(704579..706414) [1836 bp, 611 aa] {...    65   1e-10
KAFR0J00970 Chr10 (174873..176705) [1833 bp, 610 aa] {ON} Anc_2....    65   2e-10
NCAS0G03030 Chr7 (556908..558380) [1473 bp, 490 aa] {ON} Anc_2.2...    65   2e-10
Ecym_3284 Chr3 (537227..539047) [1821 bp, 606 aa] {ON} similar t...    65   2e-10
KNAG0I01870 Chr9 complement(366800..368689) [1890 bp, 629 aa] {O...    65   2e-10
KNAG0D02050 Chr4 (339873..341921) [2049 bp, 682 aa] {ON} Anc_8.1...    65   3e-10
Smik_14.266 Chr14 (490908..492764) [1857 bp, 618 aa] {ON} YNL061...    65   3e-10
NCAS0B04390 Chr2 complement(795633..797648) [2016 bp, 671 aa] {O...    65   3e-10
TPHA0C03150 Chr3 (697508..699334) [1827 bp, 608 aa] {ON} Anc_2.2...    64   3e-10
Kwal_23.4841 s23 (890138..892021) [1884 bp, 627 aa] {ON} YNL061W...    64   4e-10
KLTH0G09460g Chr7 (787197..789110) [1914 bp, 637 aa] {ON} simila...    64   4e-10
CAGL0J10032g Chr10 (983405..985264) [1860 bp, 619 aa] {ON} highl...    64   5e-10
Skud_14.271 Chr14 (500809..502668) [1860 bp, 619 aa] {ON} YNL061...    64   5e-10
YNL061W Chr14 (510540..512396) [1857 bp, 618 aa] {ON}  NOP2Proba...    63   7e-10
KNAG0G01510 Chr7 complement(341469..343469) [2001 bp, 666 aa] {O...    63   7e-10
NDAI0D01050 Chr4 (236435..238312) [1878 bp, 625 aa] {ON} Anc_2.2...    63   7e-10
TDEL0C04150 Chr3 complement(734914..736758) [1845 bp, 614 aa] {O...    63   8e-10
Ecym_2353 Chr2 complement(691422..693494) [2073 bp, 690 aa] {ON}...    63   1e-09
TBLA0A08740 Chr1 (2141750..2143810) [2061 bp, 686 aa] {ON} Anc_8...    63   1e-09
Suva_14.280 Chr14 (509488..511350) [1863 bp, 620 aa] {ON} YNL061...    62   1e-09
NCAS0B05640 Chr2 complement(1068983..1070962) [1980 bp, 659 aa] ...    62   1e-09
Smik_2.92 Chr2 (166201..168225) [2025 bp, 674 aa] {ON} YBL024W (...    62   1e-09
KAFR0B02220 Chr2 complement(438809..440869) [2061 bp, 686 aa] {O...    62   2e-09
Suva_2.97 Chr2 (172667..174679) [2013 bp, 670 aa] {ON} YBL024W (...    62   2e-09
KLTH0H08096g Chr8 (706261..708327) [2067 bp, 688 aa] {ON} simila...    61   3e-09
Skud_2.81 Chr2 (156273..158318) [2046 bp, 681 aa] {ON} YBL024W (...    61   4e-09
YBL024W Chr2 (172534..174588) [2055 bp, 684 aa] {ON}  NCL1S-aden...    60   6e-09
TPHA0C02870 Chr3 (620913..622937) [2025 bp, 674 aa] {ON} Anc_8.1...    60   6e-09
CAGL0K01991g Chr11 (173969..175987) [2019 bp, 672 aa] {ON} highl...    60   8e-09
KLLA0F12562g Chr6 (1163366..1165480) [2115 bp, 704 aa] {ON} high...    57   9e-08
NDAI0B02980 Chr2 complement(757926..759965) [2040 bp, 679 aa] {O...    55   4e-07
Kwal_14.2081 s14 (598648..599463) [816 bp, 272 aa] {ON} YBL024W ...    41   0.003
Smik_6.474 Chr6 complement(781184..782140) [957 bp, 318 aa] {ON}...    35   0.24 
Skud_16.11 Chr16 (18214..19170) [957 bp, 318 aa] {ON} YPL266W (R...    35   0.45 
YPL266W Chr16 (39121..40077) [957 bp, 318 aa] {ON}  DIM1Essentia...    35   0.45 
Suva_16.39 Chr16 (54705..55661) [957 bp, 318 aa] {ON} YPL266W (R...    35   0.51 
Ecym_3003 Chr3 complement(6934..7893) [960 bp, 319 aa] {ON} simi...    34   0.77 
SAKL0E00660g Chr5 complement(42779..43747) [969 bp, 322 aa] {ON}...    34   0.92 
Kpol_449.12 s449 complement(42834..43793) [960 bp, 319 aa] {ON} ...    33   0.96 
KNAG0H02460 Chr8 complement(450266..453040) [2775 bp, 924 aa] {O...    33   1.6  
KNAG0L02440 Chr12 (434232..435185) [954 bp, 317 aa] {ON} Anc_6.1...    33   1.6  
KAFR0B06650 Chr2 complement(1386066..1387784) [1719 bp, 572 aa] ...    33   1.8  
CAGL0L07678g Chr12 complement(846285..847238) [954 bp, 317 aa] {...    33   1.9  
KAFR0B06450 Chr2 complement(1337903..1338859) [957 bp, 318 aa] {...    33   2.1  
TBLA0A07080 Chr1 complement(1748948..1749913) [966 bp, 321 aa] {...    32   3.1  
TPHA0J00200 Chr10 complement(47344..48303) [960 bp, 319 aa] {ON}...    32   3.6  
KLTH0C11704g Chr3 (966706..967674) [969 bp, 322 aa] {ON} highly ...    32   3.7  
ZYRO0B11836g Chr2 (940987..943299) [2313 bp, 770 aa] {ON} highly...    32   3.8  
ACR026W Chr3 (404011..404970) [960 bp, 319 aa] {ON} Syntenic hom...    32   4.2  
Kwal_56.22317 s56 complement(43543..44631) [1089 bp, 362 aa] {ON...    32   4.2  
NCAS0D02250 Chr4 (419581..420540) [960 bp, 319 aa] {ON} Anc_6.1 ...    32   4.3  
NDAI0I02710 Chr9 (636403..637362) [960 bp, 319 aa] {ON} Anc_6.1 ...    32   4.4  
KLLA0D00594g Chr4 complement(57894..58856) [963 bp, 320 aa] {ON}...    31   8.5  

>Kwal_27.11532 s27 complement(837572..839011) [1440 bp, 479 aa] {ON}
           YNL022C - Non-essential protein with similarity to S.
           pombe hypothetical protein E349594 [contig 27] FULL
          Length = 479

 Score =  963 bits (2490), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 465/479 (97%), Positives = 465/479 (97%)

Query: 1   MNFYRDATWVLEYVEKAESSGRVAGSLQTLVLNSCKKYNLKTNPKHLYAAVYSCWRYNXX 60
           MNFYRDATWVLEYVEKAESSGRVAGSLQTLVLNSCKKYNLKTNPKHLYAAVYSCWRYN  
Sbjct: 1   MNFYRDATWVLEYVEKAESSGRVAGSLQTLVLNSCKKYNLKTNPKHLYAAVYSCWRYNEF 60

Query: 61  XXXXXXXXXXXXDVPKKKGKEIFNPTTIKLLVHDLLFTKNKRIQMGKHPLKEFVLKHKTR 120
                       DVPKKKGKEIFNPTTIKLLVHDLLFTKNKRIQMGKHPLKEFVLKHKTR
Sbjct: 61  LEKLLKKSEILKDVPKKKGKEIFNPTTIKLLVHDLLFTKNKRIQMGKHPLKEFVLKHKTR 120

Query: 121 LNSELVRLKIKLKVTDLHQLLKDDRNDMTPVRWFRINPVRCHGKHEEVMAELAKKFPTRV 180
           LNSELVRLKIKLKVTDLHQLLKDDRNDMTPVRWFRINPVRCHGKHEEVMAELAKKFPTRV
Sbjct: 121 LNSELVRLKIKLKVTDLHQLLKDDRNDMTPVRWFRINPVRCHGKHEEVMAELAKKFPTRV 180

Query: 181 DSWKDVVPGSIYHDEYIPNLFGVHPGDKITSHELYKTGKIIIQDRASCFPAHILNPSPSD 240
           DSWKDVVPGSIYHDEYIPNLFGVHPGDKITSHELYKTGKIIIQDRASCFPAHILNPSPSD
Sbjct: 181 DSWKDVVPGSIYHDEYIPNLFGVHPGDKITSHELYKTGKIIIQDRASCFPAHILNPSPSD 240

Query: 241 VIIDACAAPGNKTTHVAAHMFLNDQPQEPLIHAFEKDPERAKTLRTMVKTAGCSKGINIH 300
           VIIDACAAPGNKTTHVAAHMFLNDQPQEPLIHAFEKDPERAKTLRTMVKTAGCSKGINIH
Sbjct: 241 VIIDACAAPGNKTTHVAAHMFLNDQPQEPLIHAFEKDPERAKTLRTMVKTAGCSKGINIH 300

Query: 301 VGDFTKLAKPSLFPNVSGFIVDPSCSGSGIFGRQIIDDHNKSREEGALPTQEEERQEIEG 360
           VGDFTKLAKPSLFPNVSGFIVDPSCSGSGIFGRQIIDDHNKSREEGALPTQEEERQEIEG
Sbjct: 301 VGDFTKLAKPSLFPNVSGFIVDPSCSGSGIFGRQIIDDHNKSREEGALPTQEEERQEIEG 360

Query: 361 KDIKNRLAKLASFQFEIVKYALSFPSAKKLVYSTCSIHAEENERIVIDLLLDSKVKEWGW 420
           KDIKNRLAKLASFQFEIVKYALSFPSAKKLVYSTCSIHAEENERIVIDLLLDSKVKEWGW
Sbjct: 361 KDIKNRLAKLASFQFEIVKYALSFPSAKKLVYSTCSIHAEENERIVIDLLLDSKVKEWGW 420

Query: 421 RVRKRAGAIPTWPRRGFYHEFEDVFREGDTAKELAEACIRVAPKEDGGIGFFAVCFERD 479
           RVRKRAGAIPTWPRRGFYHEFEDVFREGDTAKELAEACIRVAPKEDGGIGFFAVCFERD
Sbjct: 421 RVRKRAGAIPTWPRRGFYHEFEDVFREGDTAKELAEACIRVAPKEDGGIGFFAVCFERD 479

>KLTH0G10362g Chr7 (876756..878345) [1590 bp, 529 aa] {ON} highly
           similar to uniprot|P53972 Saccharomyces cerevisiae
           YNL022C
          Length = 529

 Score =  808 bits (2086), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 384/483 (79%), Positives = 425/483 (87%), Gaps = 4/483 (0%)

Query: 1   MNFYRDATWVLEYVEKAESSGRVAGSLQTLVLNSCKKYNLKTNPKHLYAAVYSCWRYNXX 60
           MNFYRDATWVLEYVE AE  GRVAGSLQTLVLNSCKKY LKTNPKH+YAAVYSCWRYN  
Sbjct: 47  MNFYRDATWVLEYVESAEKGGRVAGSLQTLVLNSCKKYQLKTNPKHIYAAVYSCWRYNEF 106

Query: 61  XXXXXXXXXXXXDVPKKKGKEIFNPTTIKLLVHDLLFTKNKRIQMGKHPLKEFVLKHKTR 120
                       D+PKKKGKE+FNPTTIKLLVHDLLF+KNKRIQMGKHPLKEFVLK+K R
Sbjct: 107 LDKLLKRSGILKDIPKKKGKEVFNPTTIKLLVHDLLFSKNKRIQMGKHPLKEFVLKYKAR 166

Query: 121 LNSELVRLKIKLKVTDLHQLLKDDRNDMTPVRWFRINPVRCHGKHEEVMAELAKKFPTRV 180
           L+SELVRLKIKLKVTDL QLLKDDRNDMTPVRWFR+NP+RC  K E+++ EL+KKFPTRV
Sbjct: 167 LSSELVRLKIKLKVTDLQQLLKDDRNDMTPVRWFRLNPIRCGAKSEDILQELSKKFPTRV 226

Query: 181 DSWKDVVPGSIYHDEYIPNLFGVHPGDKITSHELYKTGKIIIQDRASCFPAHILNPSPSD 240
           +SW ++ PG IYHDEYIP LFGVHP DKITSHELYKTGK+IIQDRASCFPAHILN S  D
Sbjct: 227 NSWTNIAPGCIYHDEYIPGLFGVHPADKITSHELYKTGKVIIQDRASCFPAHILNASSED 286

Query: 241 VIIDACAAPGNKTTHVAAHMFLNDQPQEPLIHAFEKDPERAKTLRTMVKTAGCSKGINIH 300
           +IIDACAAPGNKTTHVAAH+F +   +   IHAFEKDPERAKTLRTM+ TAGC+KGI +H
Sbjct: 287 LIIDACAAPGNKTTHVAAHIFQDQAVESVRIHAFEKDPERAKTLRTMINTAGCTKGIEVH 346

Query: 301 VGDFTKLAKPSLFPNVSGFIVDPSCSGSGIFGRQIIDDHNKSREEGALPT----QEEERQ 356
           VGDFT+LAKP  FP+V+GFI+DPSCSGSGIFGR++IDD NKS+ +GA P     +EEER+
Sbjct: 347 VGDFTQLAKPGKFPDVTGFILDPSCSGSGIFGRKMIDDRNKSKADGASPVEEEEKEEERE 406

Query: 357 EIEGKDIKNRLAKLASFQFEIVKYALSFPSAKKLVYSTCSIHAEENERIVIDLLLDSKVK 416
           +I  KD+KNRL KLASFQFEIVK+A+SFPSAKKLVYSTCS+HAEENERIV+DLLLDSKVK
Sbjct: 407 DISDKDLKNRLEKLASFQFEIVKHAMSFPSAKKLVYSTCSVHAEENERIVVDLLLDSKVK 466

Query: 417 EWGWRVRKRAGAIPTWPRRGFYHEFEDVFREGDTAKELAEACIRVAPKEDGGIGFFAVCF 476
           EWGWRVRKRAG IPTW RRGFY EFE+VFR+ DTAKELAEACIRVAPKEDGGIGFFAVCF
Sbjct: 467 EWGWRVRKRAGVIPTWSRRGFYKEFEEVFRDEDTAKELAEACIRVAPKEDGGIGFFAVCF 526

Query: 477 ERD 479
           ERD
Sbjct: 527 ERD 529

>SAKL0E07678g Chr5 complement(621183..622616) [1434 bp, 477 aa] {ON}
           highly similar to uniprot|P53972 Saccharomyces
           cerevisiae YNL022C
          Length = 477

 Score =  701 bits (1808), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/480 (70%), Positives = 401/480 (83%), Gaps = 4/480 (0%)

Query: 1   MNFYRDATWVLEYVEKAESSGRVAGSLQTLVLNSCKKYNLKTNPKHLYAAVYSCWRYNXX 60
           MN YRDATWV EYVE+ ES G++AGSLQTLVLNSCK+Y LKTNPKHLYA V+SCW+Y   
Sbjct: 1   MNLYRDATWVFEYVEQEESKGKIAGSLQTLVLNSCKRYKLKTNPKHLYAIVHSCWKYKPF 60

Query: 61  XXXXXXXXXXXXDVPKKKGKEIFNPTTIKLLVHDLLFTKNKRIQMGKHPLKEFVLKHKTR 120
                       D+PKKKG+  F+ TTI LLVHDLL +KNKRIQMGKHP+KEFVLKHK R
Sbjct: 61  LEKILKKSGILKDIPKKKGQPAFSNTTILLLVHDLLLSKNKRIQMGKHPIKEFVLKHKVR 120

Query: 121 LNSELVRLKIKLKVTDLHQLLKDDRNDMTPVRWFRINPVRCHGKHEEVMAELAKKFPTRV 180
           L +EL +LK+KL+VT+L QL+KDD NDMTPVRW RINPVRC+GK ++V  EL KKFPT+V
Sbjct: 121 LQAELAKLKVKLRVTNLSQLVKDDSNDMTPVRWIRINPVRCNGKVDDVKGELQKKFPTKV 180

Query: 181 DSWKDVVPGSIYHDEYIPNLFGVHPGDKITSHELYKTGKIIIQDRASCFPAHILNPSPSD 240
            +W ++VPG+IYHDE+IPNLFGVHP DKITSHELYK GKIIIQDRASCFPAHILNP+P D
Sbjct: 181 SNWSEIVPGTIYHDEFIPNLFGVHPADKITSHELYKRGKIIIQDRASCFPAHILNPTPED 240

Query: 241 VIIDACAAPGNKTTHVAAHMFLND-QPQEPLIHAFEKDPERAKTLRTMVKTAGCSKGINI 299
           VIID+C+APGNKTTHVAAHMF  +  P++  IHAFEKDPERAKTL+ M++ AGC K I +
Sbjct: 241 VIIDSCSAPGNKTTHVAAHMFDPEFVPKQKQIHAFEKDPERAKTLQKMIQVAGCDKSIEV 300

Query: 300 HVGDFTKLAKPSLFPNVSGFIVDPSCSGSGIFGRQIIDDHNKSREEGALPTQEEERQEIE 359
           HVGDFTKLAKP  F  V+GFIVDPSCSGSGIFGR+IIDD N   E   LP +E+E++E++
Sbjct: 301 HVGDFTKLAKPDKFSQVTGFIVDPSCSGSGIFGRKIIDDTNNKNE--VLPEEEQEKEEMD 358

Query: 360 GKDIKNRLAKLASFQFEIVKYALSFPSAKKLVYSTCSIHAEENERIVIDLLLDSKVKEWG 419
            +D+K RL KL+SFQF+I+K+A+SFP+AKKLVYSTCSIHAEENER+VIDLLLD KV++WG
Sbjct: 359 -QDLKTRLTKLSSFQFQILKHAMSFPNAKKLVYSTCSIHAEENERVVIDLLLDDKVQQWG 417

Query: 420 WRVRKRAGAIPTWPRRGFYHEFEDVFREGDTAKELAEACIRVAPKEDGGIGFFAVCFERD 479
           WRVRKRAG IPTW RRGF  EF+ V+++   A+ELA+ CIR  PKEDGGIGFFAVCFERD
Sbjct: 418 WRVRKRAGVIPTWSRRGFVEEFQQVYQDKQQAQELADGCIRALPKEDGGIGFFAVCFERD 477

>KLLA0E08361g Chr5 complement(751889..753364) [1476 bp, 491 aa] {ON}
           similar to uniprot|P53972 Saccharomyces cerevisiae
           YNL022C
          Length = 491

 Score =  690 bits (1780), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 336/492 (68%), Positives = 398/492 (80%), Gaps = 14/492 (2%)

Query: 1   MNFYRDATWVLEYVEKAESSG-RVAGSLQTLVLNSCKKYNLKTNPKHLYAAVYSCWRYNX 59
           M FYRDATWVLE+VE+  S   RVAGSLQTLVL SCK+Y LKTNP+H+YA V S W+Y  
Sbjct: 1   MEFYRDATWVLEFVEQELSKDKRVAGSLQTLVLTSCKRYKLKTNPRHIYAIVSSTWQYRE 60

Query: 60  XXXXXXXXXXXXXDVPKKKGKEIFNPTTIKLLVHDLLFTKNKRIQMGKHPLKEFVLKHKT 119
                        DVPKKKGK +FN  TI+LLVHDLL +K+KRIQMGKHP+K F+LKH+T
Sbjct: 61  YLDKIIKKSGILEDVPKKKGKPLFNKDTIRLLVHDLLLSKSKRIQMGKHPIKTFILKHQT 120

Query: 120 RLNSELVRLKIKLKVTDLHQLLK-DDRNDMTPVRWFRINPVRCHGKHEEVMAELAKKFPT 178
           RL +EL +LK+KLKVT L QL+K DD  D+TPVRW RINP+    ++++V+AEL KKFP 
Sbjct: 121 RLKAELTKLKVKLKVTSLSQLIKTDDGEDVTPVRWIRINPILVKERYDDVLAELNKKFPQ 180

Query: 179 RVDSWKDVVPGSIYHDEYIPNLFGVHPGDKITSHELYKTGKIIIQDRASCFPAHILNPSP 238
           RV+SWK +VPGSIY+DEYIPNLFG+HPGDKITSHE YK GKIIIQDRASCFPAHILNP+ 
Sbjct: 181 RVNSWKQIVPGSIYYDEYIPNLFGIHPGDKITSHEQYKRGKIIIQDRASCFPAHILNPNS 240

Query: 239 SDVIIDACAAPGNKTTHVAAHMF--LNDQPQEPLIHAFEKDPERAKTLRTMVKTAGCSKG 296
           +DV+IDACAAPGNKTTHVAAH+F  ++ +     IHAFEKDPERAKTL+ MV TAGC+KG
Sbjct: 241 TDVVIDACAAPGNKTTHVAAHIFGDVDTKVDSVKIHAFEKDPERAKTLQMMVATAGCAKG 300

Query: 297 INIHVGDFTKLAKPSLFPNVSGFIVDPSCSGSGIFGRQIIDDHNKSR--------EEGAL 348
           + IHVGDFTKL KP LF NV+GFIVDPSCSGSGIFGR+ ID  N S+        ++ ++
Sbjct: 301 VKIHVGDFTKLGKPELFQNVTGFIVDPSCSGSGIFGRKAIDKVNLSKTGSSNTDEDQTSV 360

Query: 349 PTQEEERQEIEG-KDIKNRLAKLASFQFEIVKYALSFPSAKKLVYSTCSIHAEENERIVI 407
              E+E++  E  +D+KNRLAKL+SFQ++IVK+A+SFPSAKK+ YSTCSIHAEENER+VI
Sbjct: 361 EPVEQEKELFEKEQDLKNRLAKLSSFQYQIVKHAMSFPSAKKICYSTCSIHAEENERVVI 420

Query: 408 DLLLDSKVKEWGWRVRKRAGAIPTWPRRGFYHEFEDVFREGDTAKELAEACIRVAPKEDG 467
           DLLLDSKVKEWGW+VRKR G IPTWPRRG+  EFE+VF + + AKELAE CIR  PKEDG
Sbjct: 421 DLLLDSKVKEWGWKVRKRTGVIPTWPRRGWTSEFEEVFPK-EEAKELAEGCIRALPKEDG 479

Query: 468 GIGFFAVCFERD 479
           GIGFFAVCFERD
Sbjct: 480 GIGFFAVCFERD 491

>KAFR0H03310 Chr8 complement(630597..632063) [1467 bp, 488 aa] {ON}
           Anc_2.286 YNL022C
          Length = 488

 Score =  635 bits (1639), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/488 (62%), Positives = 383/488 (78%), Gaps = 10/488 (2%)

Query: 1   MNFYRDATWVLEYVEKAESSGRVAGSLQTLVLNSCKKYNLKTNPKHLYAAVYSCWRYNXX 60
           M FYRDATWVLEY+E+ +S GR++GSLQ+LVL SC+KY LKTNPKH+YA + SCW+Y   
Sbjct: 1   MEFYRDATWVLEYIEQQDSKGRISGSLQSLVLKSCQKYKLKTNPKHIYAVLDSCWKYKPF 60

Query: 61  XXXXXXXXXXXXDVPKKKGKEIFNPTTIKLLVHDLLFTKNKRIQMGKHPLKEFVLKHKTR 120
                       D+PKKKGK ++   T+ LL+HDLL +K KRIQMGKHP+K FVL++K+R
Sbjct: 61  LEKVMSKSGILKDIPKKKGKPVYTRLTLLLLIHDLLLSKQKRIQMGKHPIKLFVLRYKSR 120

Query: 121 LNSELVRLKIKLKVTDLHQLLK--DDRNDMTPVRWFRINPVRCHGKHEEVMAELAKKFPT 178
           L+SELV+LK+K KV DL +L+   D  ND+TPVRWFRINP+RC      VM EL KKFP 
Sbjct: 121 LHSELVKLKLKAKVRDLSELVDTGDSSNDITPVRWFRINPLRCPDA-SAVMKELEKKFPQ 179

Query: 179 RVDSWKDVVPGSIYHDEYIPNLFGVHPGDKITSHELYKTGKIIIQDRASCFPAHILNPSP 238
           RV+SW+ +VPGSIYHDE+IP LFG+HP DKITSHELYK G+IIIQDRASCFPAHILNP+ 
Sbjct: 180 RVESWEGIVPGSIYHDEFIPYLFGIHPQDKITSHELYKQGRIIIQDRASCFPAHILNPTL 239

Query: 239 SDVIIDACAAPGNKTTHVAAHMFLNDQPQEPLIHAFEKDPERAKTLRTMVKTAGCSKGIN 298
            D IIDAC+APGNKTTHVA++MF N    +  I AFEKDPERAK L+ M+K AGCSK I+
Sbjct: 240 EDKIIDACSAPGNKTTHVASYMFGNGLVDDVRIFAFEKDPERAKVLQKMIKVAGCSKQIS 299

Query: 299 IHVGDFTKLAKPSLFPNVSGFIVDPSCSGSGIFGRQIIDDHNKSRE-----EGALPTQEE 353
           ++VGDFTKLA PS FP+V+GFIVDPSCSGSGIFGR+ ID  N+ ++     +  +P ++E
Sbjct: 300 VNVGDFTKLATPSKFPDVTGFIVDPSCSGSGIFGRKYIDSLNRQKKTQDIVDNGVPDEQE 359

Query: 354 ERQEIEGKDIKNRLAKLASFQFEIVKYALSFPSAKKLVYSTCSIHAEENERIVIDLLLDS 413
           E  E E  +++ RL+KL+SFQF++VK+A+SFP AK++VYSTCSIHAEENER+ +DLLLD 
Sbjct: 360 EMAEKENGNLQERLSKLSSFQFQVVKHAMSFPKAKRIVYSTCSIHAEENERVALDLLLDE 419

Query: 414 KVKEWGWRVRKRAGAIPTWPRRGFYHEFEDVFRE--GDTAKELAEACIRVAPKEDGGIGF 471
           KVK+WGW++ KR   IP WPRRGF  EF+++FR+      +E+A+ CIR  P+EDGGIGF
Sbjct: 420 KVKQWGWKIAKRESVIPQWPRRGFVSEFQEIFRDKTASECQEMADGCIRALPREDGGIGF 479

Query: 472 FAVCFERD 479
           FA+CFERD
Sbjct: 480 FAICFERD 487

>NDAI0G00660 Chr7 (144471..145961) [1491 bp, 496 aa] {ON} Anc_2.286
           YNL022C
          Length = 496

 Score =  630 bits (1626), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/499 (62%), Positives = 388/499 (77%), Gaps = 24/499 (4%)

Query: 1   MNFYRDATWVLEYVEKAESSGRVAGSLQTLVLNSCKKYNLKTNPKHLYAAVYSCWRYNXX 60
           MNFYRDATWVLEYVE+ E+ GR++GSLQTLVL SC KY LK NPKH+YA + SCW+Y   
Sbjct: 1   MNFYRDATWVLEYVEQQEAKGRISGSLQTLVLQSCTKYKLKCNPKHVYAVIDSCWKYKPY 60

Query: 61  XXXXXXXXXXXXDVPKKKGKEIFNPTTIKLLVHDLLFTKNKRIQMGKHPLKEFVLKHKTR 120
                       D+PKKKGK +++  T+ LL HDLLF+K+KRIQMGKHP+KE+VLKHK+R
Sbjct: 61  LEKVMKKSGILDDIPKKKGKPMYSRLTLMLLCHDLLFSKSKRIQMGKHPIKEYVLKHKSR 120

Query: 121 LNSELVRLKIKLKVTDLHQLL--KDDRNDMTPVRWFRINPVRCHGKHE--EVMAELAKKF 176
           L+SELVRLK+KLKV +L +++   D   D+TPVRW RINP+RC+   +   V+ EL KKF
Sbjct: 121 LHSELVRLKLKLKVKNLSEIVDNNDSTEDVTPVRWIRINPLRCYQGRDVNAVLEELGKKF 180

Query: 177 PTRVDSWKDVVPGSIYHDEYIPNLFGVHPGDKITSHELYKTGKIIIQDRASCFPAHILNP 236
           P RV++W D+VPGSIY+DEYIP+L+G+HP DKITSHELYK GKIIIQDRASCFPAHILNP
Sbjct: 181 PKRVENWNDIVPGSIYYDEYIPHLYGIHPQDKITSHELYKQGKIIIQDRASCFPAHILNP 240

Query: 237 SPSDVIIDACAAPGNKTTHVAAHMFLNDQPQEP--LIHAFEKDPERAKTLRTMVKTAGCS 294
           S  D+IIDACAAPGNKTTHVA++MF + + ++P   I+AFEKDPERAK L  M+K AGCS
Sbjct: 241 SKDDIIIDACAAPGNKTTHVASYMFGDAKQEDPHVQIYAFEKDPERAKILEKMIKVAGCS 300

Query: 295 KGINIHVGDFTKLAKPSLFPNVSGFIVDPSCSGSGIFGRQIIDDHNKSR----------- 343
           K I + VGDFTK A P  F +V+GFIVDPSCSGSGIFGR+ +D  N+ R           
Sbjct: 301 KNIQVTVGDFTKAATPDKFKDVTGFIVDPSCSGSGIFGRKYVDSLNRQRNNDTTDKDKKS 360

Query: 344 --EEGALPTQEEERQEIEGKDIKNRLAKLASFQFEIVKYALSFPSAKKLVYSTCSIHAEE 401
             E+  +P ++E+  + E  D+K RLAKL+SFQF+++K+A+SFP+AKK+VYSTCSIHAEE
Sbjct: 361 TEEDDEVPDEQEDYNKKE--DLKTRLAKLSSFQFQVIKHAMSFPTAKKIVYSTCSIHAEE 418

Query: 402 NERIVIDLLLDSKVKEWGWRVRKRAGAIPTWPRRGFYHEFEDVFREGDTAK--ELAEACI 459
           NER+V+DLLLDSKVK+WGW+V  +   IPTWPRRG   EFE+VFR+ D AK   LA+ CI
Sbjct: 419 NERVVLDLLLDSKVKQWGWKVAAKESVIPTWPRRGKIEEFEEVFRD-DPAKCQALADGCI 477

Query: 460 RVAPKEDGGIGFFAVCFER 478
           R  P++DGGIGFFAVCFER
Sbjct: 478 RALPRDDGGIGFFAVCFER 496

>Ecym_3325 Chr3 (623214..624704) [1491 bp, 496 aa] {ON} similar to
           Ashbya gossypii ADL215W
          Length = 496

 Score =  625 bits (1612), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/484 (62%), Positives = 375/484 (77%), Gaps = 6/484 (1%)

Query: 1   MNFYRDATWVLEYVEKAES-SGRVAGSLQTLVLNSCKKYNLKTNPKHLYAAVYSCWRYNX 59
           M FYRD++WVLEY+E+  S + R++GSLQTLVL SCK+Y LKTNPKH+YA V SCW+Y  
Sbjct: 14  MEFYRDSSWVLEYIEQEFSKNSRISGSLQTLVLRSCKRYKLKTNPKHIYAIVSSCWKYKM 73

Query: 60  XXXXXXXXXXXXXDVPKKKGKEIFNPTTIKLLVHDLLFTKNKRIQMGKHPLKEFVLKHKT 119
                        DVP KKG+ +F+ TTI LLVHDLL +KNKRI MGKHP+K FVLK + 
Sbjct: 74  YLEKIIKNSGLLADVPLKKGEPVFSKTTIMLLVHDLLLSKNKRIHMGKHPIKAFVLKRQV 133

Query: 120 RLNSELVRLKIKLKVTDLHQLLKDDRNDMTPVRWFRINPVRCHGKHEEVMAELAKKFPTR 179
           RL+ E  ++ +KLKV  L +L++D+  DM+PVRW RINP RC GK ++V+ EL KKFP +
Sbjct: 134 RLSGEFKKMLVKLKVKSLSELVEDNDADMSPVRWIRINPFRCQGKVDDVLKELRKKFPKQ 193

Query: 180 VDSWKDVVPGSIYHDEYIPNLFGVHPGDKITSHELYKTGKIIIQDRASCFPAHILNPSPS 239
           VD W  +VPGSIY DEYIPNL+GVHP DKITSHELYK GKIIIQDRASCFPA+ILNP+P 
Sbjct: 194 VDDWTQIVPGSIYRDEYIPNLYGVHPSDKITSHELYKRGKIIIQDRASCFPAYILNPTPH 253

Query: 240 DVIIDACAAPGNKTTHVAAHMFLNDQPQEPLIHAFEKDPERAKTLRTMVKTAGCSKGINI 299
           DV+IDAC+APGNKTTH+AAH+F +    +  I+AFE+D +RA+ L  MV +AGC   I I
Sbjct: 254 DVVIDACSAPGNKTTHIAAHIFPDGNASDVKIYAFERDAKRAEILEKMVTSAGCESCIQI 313

Query: 300 HVGDFTKLAKPSLFPNVSGFIVDPSCSGSGIFGRQIIDDHNKSREEGALPT---QEEERQ 356
            VGDFT+LAKP +F +V+GFI+DPSCSGSGIFGRQ +D  NKS+    +P    +E++ +
Sbjct: 314 SVGDFTQLAKPQMFKDVTGFILDPSCSGSGIFGRQSVDLANKSKLAEKVPNEVFEEQDPK 373

Query: 357 EIEGKDI-KNRLAKLASFQFEIVKYALSFPSAKKLVYSTCSIHAEENERIVIDLLLDSKV 415
           E+E  ++ K RLAKL+SFQF+IVK+A+SFP+AKKLVYSTCSIHAEENER+VIDLLLD  +
Sbjct: 374 EMEQNELYKTRLAKLSSFQFQIVKHAMSFPNAKKLVYSTCSIHAEENERVVIDLLLDQNI 433

Query: 416 KEWGWRVRKRAGAIPTWPRRGFYHEFEDVFREGDTAKELAEACIRVAPKEDGGIGFFAVC 475
           K++GW+V KR   IP W RRG   EFE+VF   + A+ELA+ CIR  PKEDGGIGFFAVC
Sbjct: 434 KQYGWKVAKRDSVIPAWQRRGILSEFEEVFPH-EQAQELADGCIRALPKEDGGIGFFAVC 492

Query: 476 FERD 479
           FER+
Sbjct: 493 FERE 496

>ADL215W Chr4 (326584..328038) [1455 bp, 484 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL022C
          Length = 484

 Score =  615 bits (1585), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/486 (60%), Positives = 359/486 (73%), Gaps = 9/486 (1%)

Query: 1   MNFYRDATWVLEYVEKA-ESSGRVAGSLQTLVLNSCKKYNLKTNPKHLYAAVYSCWRYNX 59
           M FYRDA+WVLEY+E+      +VAGSL +LVL S KKY LK++ +H+YA V S W+Y  
Sbjct: 1   MEFYRDASWVLEYIEQEFARKSKVAGSLHSLVLQSHKKYKLKSDVRHVYAIVASFWKYKA 60

Query: 60  XXXXXXXXXXXXXDVPKKKGKEIFNPTTIKLLVHDLLFTKNKRIQMGKHPLKEFVLKHKT 119
                        DVP+KKG+  F  +T+ L+VHDLL +K KRI MGKHPLK FVLKH+T
Sbjct: 61  YLDRIIEKSGLLKDVPRKKGEPAFKRSTLGLVVHDLLLSKKKRIHMGKHPLKAFVLKHQT 120

Query: 120 RLNSELVRLKIKLKVTDLHQLLKDDRNDMTPVRWFRINPVRCHGKHEEVMAELAKKFPTR 179
           RL  E  +  +KL V DL  L++D+R D TPVRW R+NP R  G+ EEV+ EL KKFP R
Sbjct: 121 RLRGEYAKQLVKLGVADLSVLVQDEREDATPVRWIRLNPFRIRGQREEVLQELQKKFPRR 180

Query: 180 VDSWKDVVPGSIYHDEYIPNLFGVHPGDKITSHELYKTGKIIIQDRASCFPAHILNPSPS 239
           V  W+++ PGSIY DEY+  L+GVHP DKITSHELYK GKIIIQDRASCFPA IL P  S
Sbjct: 181 VADWRELTPGSIYEDEYVAGLYGVHPADKITSHELYKRGKIIIQDRASCFPAQILAPGRS 240

Query: 240 DVIIDACAAPGNKTTHVAAHMFLNDQPQEPLIHAFEKDPERAKTLRTMVKTAGCSKGINI 299
           DVIIDACAAPGNKTTHVAAH+F         IHAFE+DP+RAKTLR M+ TAGC   I +
Sbjct: 241 DVIIDACAAPGNKTTHVAAHIFPEGGADHAQIHAFERDPQRAKTLRKMIATAGCDNAIEV 300

Query: 300 HVGDFTKLAKPSLFPNVSGFIVDPSCSGSGIFGRQIIDDHNKSRE------EGALPTQEE 353
           HVGDFT+ A+P +F NV+GFIVDPSCSGSGIFGRQ++D   ++++         +P +E 
Sbjct: 301 HVGDFTRDAQPEIFKNVTGFIVDPSCSGSGIFGRQLVDATQETQKGTETDPSADVPEEET 360

Query: 354 ERQEIEGKDIKNRLAKLASFQFEIVKYALSFPSAKKLVYSTCSIHAEENERIVIDLLLDS 413
                   ++KNRLAKL+SFQF+IVK+A+SFPSAKKL+YSTCS+HAEENER+VIDLLLDS
Sbjct: 361 FEATKSAVELKNRLAKLSSFQFQIVKHAMSFPSAKKLIYSTCSVHAEENERVVIDLLLDS 420

Query: 414 KVKEWGWRVRKRAGAIPTWPRRGFYHEFEDVFREGDTAKELAEACIRVAPKEDGGIGFFA 473
           KV++ GW+V  R+  IP WPRRG   EFE+VF   D A+ELA  CIRV PKEDGGIGFFA
Sbjct: 421 KVQKGGWKVASRSKVIPAWPRRGHQAEFEEVF--PDQAEELAGGCIRVLPKEDGGIGFFA 478

Query: 474 VCFERD 479
           VCFER+
Sbjct: 479 VCFERE 484

>TPHA0C03400 Chr3 (747016..748500) [1485 bp, 494 aa] {ON} Anc_2.286
           YNL022C
          Length = 494

 Score =  615 bits (1585), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/495 (60%), Positives = 375/495 (75%), Gaps = 18/495 (3%)

Query: 1   MNFYRDATWVLEYVEKAESSGRVAGSLQTLVLNSCKKYNLKTNPKHLYAAVYSCWRYNXX 60
           MNFYRDATWVLE++EK ++ G+++GS+Q++VL SCK Y +++NPKH+YA + SCW+Y   
Sbjct: 1   MNFYRDATWVLEFLEKEDAKGKISGSMQSIVLKSCKIYKVQSNPKHIYAVMASCWKYKPY 60

Query: 61  XXXXXXXXXXXXDVPKKKGKEIFNPTTIKLLVHDLLFTKNKRIQMGKHPLKEFVLKHKTR 120
                       ++PKK GK  F   TI LL HDLLF+K+KRIQMGKHPLKE+VLK+KT 
Sbjct: 61  LETIMKKSGILNNIPKKNGKPRFERLTILLLCHDLLFSKSKRIQMGKHPLKEYVLKYKTS 120

Query: 121 LNSELVRLKIKLKVTDLHQLL--KDDRNDMTPVRWFRINPVRC--HGKHEEVMAELAKKF 176
           L SE+V+L++K+K+     L+  +DD ND+TPVRWFRINP+R       E ++ EL KKF
Sbjct: 121 LRSEMVKLQVKMKLKSWGDLISSQDDANDITPVRWFRINPIRTPLSKGVEGILEELEKKF 180

Query: 177 PTRVDSWKDVVPGSIYHDEYIPNLFGVHPGDKITSHELYKTGKIIIQDRASCFPAHILNP 236
           PTRVD W  +  G+IYHDE+IPNLFGVH  DKITSHELYK GKIIIQDRASCFPAH+LNP
Sbjct: 181 PTRVDHWSKIEQGTIYHDEFIPNLFGVHTKDKITSHELYKQGKIIIQDRASCFPAHVLNP 240

Query: 237 SPSDVIIDACAAPGNKTTHVAAHMFLN-DQPQEPLIHAFEKDPERAKTLRTMVKTAGCSK 295
              D++ID+CAAPGNKTTH AA++     + Q+  IHAFEKDPERAK L+ MV+TAGC++
Sbjct: 241 GKDDIVIDSCAAPGNKTTHTAAYILGGPSKDQKIQIHAFEKDPERAKVLQKMVRTAGCAR 300

Query: 296 GINIHVGDFTKLAKPSLFPNVSGFIVDPSCSGSGIFGRQIIDDHNKSRE---------EG 346
            I ++VGDFTK+A P  F NV+GFIVDPSCSGSGIFGR+ ID  NK +E           
Sbjct: 301 TIEVNVGDFTKIATPEKFKNVTGFIVDPSCSGSGIFGRKFIDTLNKKKEGEDVDEDDESE 360

Query: 347 ALPTQEEERQEIEGK-DIKNRLAKLASFQFEIVKYALSFPSAKKLVYSTCSIHAEENERI 405
           ++P +++E  E   K D+K RL+KLASFQF++VK+A++FP A+KLVYSTCSIHAEENER+
Sbjct: 361 SIPVEQDE--EFSKKDDLKTRLSKLASFQFQVVKHAMTFPKARKLVYSTCSIHAEENERV 418

Query: 406 VIDLLLDSKVKEWGWRVRKRAGAIPTWPRRGFYHEFEDVFREG-DTAKELAEACIRVAPK 464
           VIDLLLD  +K+ GWRV  R   IPTWPRRG+  EF++VFR+  +  KE+A  CIR  PK
Sbjct: 419 VIDLLLDETIKKAGWRVANREKVIPTWPRRGWVDEFKEVFRDDEEKCKEIAGGCIRALPK 478

Query: 465 EDGGIGFFAVCFERD 479
           EDGGIGFFAVCFERD
Sbjct: 479 EDGGIGFFAVCFERD 493

>KNAG0H02000 Chr8 complement(353074..354570) [1497 bp, 498 aa] {ON}
           Anc_2.286 YNL022C
          Length = 498

 Score =  614 bits (1584), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/496 (62%), Positives = 370/496 (74%), Gaps = 18/496 (3%)

Query: 1   MNFYRDATWVLEYVEKAESSGRVAGSLQTLVLNSCKKYNLKTNPKHLYAAVYSCWRYNXX 60
           M+FYRDATWVLE +E  ++ G+++GSLQTLVLNSCK++ +KTNPKH+YA V SCWRY   
Sbjct: 1   MDFYRDATWVLESIENQDAKGKLSGSLQTLVLNSCKRFKVKTNPKHIYAVVSSCWRYKPF 60

Query: 61  XXXXXXXXXXXXDVPKKKGKEIFNPTTIKLLVHDLLFTKNKRIQMGKHPLKEFVLKHKTR 120
                       +VP+KKG  +F   T+ LL HDLL +K+KRIQMGKHP+K FVLK+KTR
Sbjct: 61  LEKVMKKSKILDEVPQKKGAPVFQRLTLLLLCHDLLLSKSKRIQMGKHPIKMFVLKYKTR 120

Query: 121 LNSELVRLKIKLKVTDLHQLLKDD--RNDMTPVRWFRINPVRCHGKH--EEVMAELAKKF 176
           LN+EL ++K+KLKV DL QL   D   ND+TPVRWFR+NP+RC  +   + V+ EL KKF
Sbjct: 121 LNAELAKMKVKLKVKDLSQLTDSDDLTNDITPVRWFRVNPLRCTAEKPVQSVVTELRKKF 180

Query: 177 PTRVDSWKDVVPGSIYHDEYIPNLFGVHPGDKITSHELYKTGKIIIQDRASCFPAHILNP 236
             +VDSWKDVVPGSIY+DEYIPNLF VHP DKITSHELYK GKIIIQDRASCFPAHILNP
Sbjct: 181 TEKVDSWKDVVPGSIYYDEYIPNLFCVHPQDKITSHELYKQGKIIIQDRASCFPAHILNP 240

Query: 237 SPSDVIIDACAAPGNKTTHVAAHMFLN---DQPQEPLIHAFEKDPERAKTLRTMVKTAGC 293
              D++IDACAAPGNKTTH+AAHMF +   D+  +  I+AFEKDPERA+ L  M+K AGC
Sbjct: 241 KSDDIVIDACAAPGNKTTHLAAHMFQDKTADEKPKVQIYAFEKDPERAQVLNKMIKIAGC 300

Query: 294 SKGINIHVGDFTKLAKPSLFPNVSGFIVDPSCSGSGIFGRQIIDDHNKSREEGALPTQEE 353
           SK I + VGDFTKLA P   PNV+G IVDPSCSGSGIFGR+ ID  N  + +     +E 
Sbjct: 301 SKEIEVIVGDFTKLATPQACPNVNGLIVDPSCSGSGIFGRKYIDSINHKKTDEEKEEEER 360

Query: 354 ERQEIE--------GKDIKNRLAKLASFQFEIVKYALSFPSAKKLVYSTCSIHAEENERI 405
           E   +           ++K RL+KL+SFQF+IVKYALSFP A K+VYSTCSIHAEENER+
Sbjct: 361 ELDAVPEEQEEQELDDNLKTRLSKLSSFQFQIVKYALSFPQATKVVYSTCSIHAEENERV 420

Query: 406 VIDLLLDSKVKEWGWRVRKRAGAIPTWPRRGFYHEFEDVFR---EGDTAKELAEACIRVA 462
           VIDLLLD KVKE GWRV  R+  IPTW RRG   EF+ VFR   E    +E+A+ CIR  
Sbjct: 421 VIDLLLDKKVKESGWRVAPRSKVIPTWERRGLVDEFQQVFREDSESSNCQEMADGCIRAL 480

Query: 463 PKEDGGIGFFAVCFER 478
           P+EDGGIGFFAVCFER
Sbjct: 481 PREDGGIGFFAVCFER 496

>TDEL0G02170 Chr7 (427274..428728) [1455 bp, 484 aa] {ON} Anc_2.286
           YNL022C
          Length = 484

 Score =  609 bits (1571), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/487 (62%), Positives = 370/487 (75%), Gaps = 12/487 (2%)

Query: 1   MNFYRDATWVLEYVEKAESSGRVAGSLQTLVLNSCKKYNLKTNPKHLYAAVYSCWRYNXX 60
           MNFYRDATWVLEYVE+ +  GR++GS+QTLVL SC++Y LK++PKHLYA V SCWRY   
Sbjct: 1   MNFYRDATWVLEYVEQEDEKGRLSGSMQTLVLKSCQRYKLKSDPKHLYAVVDSCWRYKAL 60

Query: 61  XXXXXXXXXXXXDVPKKKGKEIFNPTTIKLLVHDLLFTKNKRIQMGKHPLKEFVLKHKTR 120
                       D+PKKKGK I++  T+ L+ HDLL +K KRIQMGK P+KE+VLKHKTR
Sbjct: 61  LEKIMKRSKIYDDIPKKKGKPIYSRLTLLLMCHDLLISKQKRIQMGKLPIKEYVLKHKTR 120

Query: 121 LNSELVRLKIKLKVTDLHQLL--KDDRNDMTPVRWFRINPVRC-HGKHEEVMAELAKKFP 177
           LNSELV+LK+KLKV  L +++  +D  ND+TPVRW RINP+RC     E V+ EL KKFP
Sbjct: 121 LNSELVKLKLKLKVKSLSEIVDKEDSSNDVTPVRWIRINPLRCPKNDVEPVLKELIKKFP 180

Query: 178 TRVDSWKDVVPGSIYHDEYIPNLFGVHPGDKITSHELYKTGKIIIQDRASCFPAHILNPS 237
            RV  W D+  G++Y+DE++PNLFGVHP DKITSHELY+ GKIIIQDR+SCFPAHILNP 
Sbjct: 181 QRVSHWSDITSGTLYYDEFVPNLFGVHPRDKITSHELYRQGKIIIQDRSSCFPAHILNPG 240

Query: 238 PSDVIIDACAAPGNKTTHVAAHMFLN-DQPQEPLIHAFEKDPERAKTLRTMVKTAGCSKG 296
            +DV+IDACAAPGNKTTHVAAH+     + Q P I+AFEKDP RA  L+ M   AGC + 
Sbjct: 241 KNDVVIDACAAPGNKTTHVAAHILPEYTREQTPKIYAFEKDPARANILKKMTSVAGCGQT 300

Query: 297 INIHVGDFTKLAKPSLFPNVSGFIVDPSCSGSGIFGRQIIDDHN----KSREEGALPTQE 352
           + IHVGDFTKLA P+ F +V+G IVDPSCSGSGIFGR+ +D HN    K+  +  +P +E
Sbjct: 301 VEIHVGDFTKLAVPANFKDVTGLIVDPSCSGSGIFGRKSVDSHNVAKKKTETDSEIPDEE 360

Query: 353 EERQEIEGKDIKNRLAKLASFQFEIVKYALSFPSAKKLVYSTCSIHAEENERIVIDLLLD 412
           E   ++ G D+ NRL+KLASFQF++VK+A+S P+AKK+VYSTCSIHAEENER+VIDLLLD
Sbjct: 361 E---KMVGDDVANRLSKLASFQFQVVKHAMSMPNAKKIVYSTCSIHAEENERVVIDLLLD 417

Query: 413 SKVKEWGWRVRKRAGAIPTWPRRGFYHEFEDVFREGDT-AKELAEACIRVAPKEDGGIGF 471
             +KEWGW+V  R   IP WPRRG   EFE VFR+      ELA+ CIR  P+EDGGIGF
Sbjct: 418 RNIKEWGWKVASREEVIPKWPRRGKVKEFEQVFRDDPVKCNELADGCIRALPQEDGGIGF 477

Query: 472 FAVCFER 478
           FAVCF+R
Sbjct: 478 FAVCFKR 484

>Kpol_1003.38 s1003 (94479..95969) [1491 bp, 496 aa] {ON}
           (94479..95969) [1491 nt, 497 aa]
          Length = 496

 Score =  600 bits (1547), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/496 (61%), Positives = 381/496 (76%), Gaps = 17/496 (3%)

Query: 1   MNFYRDATWVLEYVEKAESSGRVAGSLQTLVLNSCKKYNLKTNPKHLYAAVYSCWRYNXX 60
           M+FYRD+TWVLEY+EK  +  +++GSLQ LVL SCKKY +K+NP+H+YAAV SCW+    
Sbjct: 1   MDFYRDSTWVLEYLEKENAKDKISGSLQGLVLKSCKKYKVKSNPRHVYAAVSSCWKVKPY 60

Query: 61  XXXXXXXXXXXXDVPKKKGKEIFNPTTIKLLVHDLLFTKNKRIQMGKHPLKEFVLKHKTR 120
                       D+P KKGK  F   T+ LL HDLL +K+KRIQMGKHP+K ++LK+KTR
Sbjct: 61  LEKVMKRSGILDDIPNKKGKPQFERLTLLLLCHDLLLSKSKRIQMGKHPIKTYILKYKTR 120

Query: 121 LNSELVRLKIKLKVTDLHQLLKDD--RNDMTPVRWFRINPVRCHGKH--EEVMAELAKKF 176
           L+SELV+LK+KLKV DL +L++D+   +D+TPVRW RINP+R       E +M EL KKF
Sbjct: 121 LHSELVKLKLKLKVRDLSELIEDENSNDDITPVRWIRINPIRAQYDKGLEPIMNELNKKF 180

Query: 177 PTRVDSWKDVVPGSIYHDEYIPNLFGVHPGDKITSHELYKTGKIIIQDRASCFPAHILNP 236
           PTRV+ W D+VPG+IYHD+YIPNLFGVH  DKITSHELYKTGK+IIQDRASCFPAHILNP
Sbjct: 181 PTRVNHWSDIVPGTIYHDDYIPNLFGVHTKDKITSHELYKTGKVIIQDRASCFPAHILNP 240

Query: 237 SPSDVIIDACAAPGNKTTHVAAHMFLN-DQPQEPLIHAFEKDPERAKTLRTMVKTAGCSK 295
             +D++IDACAAPGNKTTH A+++     + Q   I+AFEKDPERAK L+ M+K AGCS 
Sbjct: 241 GKNDIVIDACAAPGNKTTHTASYILGGPKKDQTTQIYAFEKDPERAKILQHMIKVAGCSN 300

Query: 296 GINIHVGDFTKLAKPSLFPNVSGFIVDPSCSGSGIFGRQIIDDHNKSREEG--------- 346
            I ++VGDFTK+A P  F NV+GFIVDPSCSGSGIFGR+ +D  NK ++E          
Sbjct: 301 TIQVNVGDFTKIATPEKFRNVTGFIVDPSCSGSGIFGRKYVDSINKKKQESSGDNGNQDD 360

Query: 347 --ALPTQEEERQEIEGKDIKNRLAKLASFQFEIVKYALSFPSAKKLVYSTCSIHAEENER 404
             A+P ++EE  +++  D+K RL+KLASFQF++VK+A+SFP AKK+VYSTCSIHAEENE 
Sbjct: 361 EDAVPDEQEEEFDLKRDDLKTRLSKLASFQFQVVKHAMSFPKAKKIVYSTCSIHAEENEG 420

Query: 405 IVIDLLLDSKVKEWGWRVRKRAGAIPTWPRRGFYHEFEDVFREGD-TAKELAEACIRVAP 463
           +VIDLLLD KV+EWGW+V  R+  IPTWPRRGF  EF  VFR+ D   +ELA+ CIRV P
Sbjct: 421 VVIDLLLDKKVQEWGWKVAPRSEVIPTWPRRGFQAEFSKVFRDEDEKCQELADGCIRVLP 480

Query: 464 KEDGGIGFFAVCFERD 479
           KEDGGIGFFAVCFER+
Sbjct: 481 KEDGGIGFFAVCFERN 496

>YNL022C Chr14 complement(591427..592899) [1473 bp, 490 aa] {ON}
           Putative cytosine 5-methyltransferase, contains seven
           beta-strand methyltransferase motif similar to
           NOP2/YNL061W; green fluorescent protein (GFP)-fusion
           protein localizes to the nucleus; predicted to be
           involved in ribosome biogenesis
          Length = 490

 Score =  599 bits (1544), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/496 (60%), Positives = 382/496 (77%), Gaps = 23/496 (4%)

Query: 1   MNFYRDATWVLEYVEKAESSGRVAGSLQTLVLNSCKKYNLKTNPKHLYAAVYSCWRYNXX 60
           MNFYRDATWVLE +EK  +  R++GS+QTLVL SCK+Y LK+NPKH+YA + SCW+Y   
Sbjct: 1   MNFYRDATWVLEDIEKEAAKERISGSMQTLVLKSCKRYKLKSNPKHIYAVLDSCWKYKPY 60

Query: 61  XXXXXXXXXXXXDVPKKKGKEIFNPTTIKLLVHDLLFTKNKRIQMGKHPLKEFVLKHKTR 120
                       D+PKKKGK +F+  T+ LL HDLL +K KRIQMGKHP+K++VLK K+ 
Sbjct: 61  LEKVMKKAHILEDIPKKKGKPLFSRLTLLLLCHDLLLSKQKRIQMGKHPIKDYVLKFKSP 120

Query: 121 LNSELVRLKIKLKVTDLHQLL--KDDRNDMTPVRWFRINPVRCH--GKHEEVMAELAKKF 176
           L+SE+V+LK+KLKV +L +L+  +D  ND+ PVRW RINP++CH  G+ E V+AEL KKF
Sbjct: 121 LHSEMVKLKLKLKVRELSELVLSEDISNDLPPVRWIRINPLKCHPNGETEPVLAELRKKF 180

Query: 177 PTRVDSWKDVVPGSIYHDEYIPNLFGVHPGDKITSHELYKTGKIIIQDRASCFPAHILNP 236
             +VD W ++VPGSIY+DE+IPNLFG+HP DKIT+HELYK GKIIIQDRASCFPAHILNP
Sbjct: 181 TLKVDKWSELVPGSIYYDEFIPNLFGIHPSDKITAHELYKHGKIIIQDRASCFPAHILNP 240

Query: 237 SPSDVIIDACAAPGNKTTHVAAHMFLNDQPQEP-----LIHAFEKDPERAKTLRTMVKTA 291
            PSD++ID+C+APGNKTTH A++++    P+ P      I+AFEKDPERAK L+ M+K A
Sbjct: 241 GPSDIVIDSCSAPGNKTTHTASYIY----PEPPKDNNTRIYAFEKDPERAKVLQKMIKIA 296

Query: 292 GCSKGINIHVGDFTKLAKPSLFPNVSGFIVDPSCSGSGIFGRQIIDDHN------KSREE 345
           GCS  I+++VGDFTKLA P  + +V+ FIVDPSCSGSGIFGR+  D  N      K  + 
Sbjct: 297 GCSPNISVNVGDFTKLATPEKYKDVTCFIVDPSCSGSGIFGRKFFDSFNRRKIDDKDDDG 356

Query: 346 GALPTQEEERQEIEGKDIKNRLAKLASFQFEIVKYALSFPSAKKLVYSTCSIHAEENERI 405
           G +P ++EE   I  ++++ RLAKL+SFQF++VK+A+SFP+AKK+VYSTCSIHAEENER+
Sbjct: 357 GIVPDEQEEF--IAKEELQTRLAKLSSFQFQMVKHAMSFPAAKKIVYSTCSIHAEENERV 414

Query: 406 VIDLLLDSKVKEWGWRVRKRAGAIPTWPRRGFYHEFEDVFREGDT--AKELAEACIRVAP 463
           VIDLLLD  V+EWGW+V  +   IP+WPRRG   EFE+VFR+G T   ++LAE CIR  P
Sbjct: 415 VIDLLLDKSVREWGWKVAPKREVIPSWPRRGKVEEFEEVFRDGVTYDPQQLAEGCIRALP 474

Query: 464 KEDGGIGFFAVCFERD 479
           K DGGIGFFAVCFERD
Sbjct: 475 KSDGGIGFFAVCFERD 490

>Suva_14.325 Chr14 complement(574309..575781) [1473 bp, 490 aa] {ON}
           YNL022C (REAL)
          Length = 490

 Score =  597 bits (1540), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/492 (60%), Positives = 378/492 (76%), Gaps = 17/492 (3%)

Query: 1   MNFYRDATWVLEYVEKAESSGRVAGSLQTLVLNSCKKYNLKTNPKHLYAAVYSCWRYNXX 60
           MNFYRDATWVLE +EK  +  R++GS+QTLVL SCK+Y LK+NPKH+YA + SCW+Y   
Sbjct: 1   MNFYRDATWVLEDIEKEAAKVRISGSMQTLVLKSCKRYKLKSNPKHIYAVLDSCWKYKPY 60

Query: 61  XXXXXXXXXXXXDVPKKKGKEIFNPTTIKLLVHDLLFTKNKRIQMGKHPLKEFVLKHKTR 120
                       ++PKKKGK +F   T+ LL HDLL +K KRIQMGKHP+KE+VLK K+ 
Sbjct: 61  LEKVMKKARILEEIPKKKGKPLFARLTLLLLCHDLLLSKQKRIQMGKHPIKEYVLKFKSP 120

Query: 121 LNSELVRLKIKLKVTDLHQLL--KDDRNDMTPVRWFRINPVRCH--GKHEEVMAELAKKF 176
           L+SE+V+LK+KLKV DL +L+  +D  ND+ PVRW RINP++CH  G  E V+AEL KKF
Sbjct: 121 LHSEMVKLKLKLKVRDLSELVLSEDIVNDLPPVRWIRINPLKCHPDGNTEPVLAELKKKF 180

Query: 177 PTRVDSWKDVVPGSIYHDEYIPNLFGVHPGDKITSHELYKTGKIIIQDRASCFPAHILNP 236
             +VD+W ++VPGSIYHDEYIPNLFG+HP DKIT+HELYK GKIIIQDRASCFPAHIL+P
Sbjct: 181 TQKVDNWSELVPGSIYHDEYIPNLFGIHPTDKITAHELYKHGKIIIQDRASCFPAHILHP 240

Query: 237 SPSDVIIDACAAPGNKTTHVAAHMFLNDQPQEP--LIHAFEKDPERAKTLRTMVKTAGCS 294
             +D++IDAC+APGNKTTH A+++F ++ P++    I+AFEKDPERAK L+ M+K AGCS
Sbjct: 241 GSNDIVIDACSAPGNKTTHTASYIF-SEPPKDKKIQIYAFEKDPERAKILQKMIKVAGCS 299

Query: 295 KGINIHVGDFTKLAKPSLFPNVSGFIVDPSCSGSGIFGRQIIDDHNK------SREEGAL 348
             I+++VGDFTKLA P     V+GFIVDPSCSGSGIFGR+  D  N+        E+ A+
Sbjct: 300 ANIDVNVGDFTKLATPEKCKGVTGFIVDPSCSGSGIFGRKFFDSLNRRKIDEKDDEDDAV 359

Query: 349 PTQEEERQEIEGKDIKNRLAKLASFQFEIVKYALSFPSAKKLVYSTCSIHAEENERIVID 408
           P ++EE    E  +++ RLAKL+SFQF++VK+A+SFP AKK+VYSTCSIHAEENER+VID
Sbjct: 360 PDEQEEFMAKE--ELQTRLAKLSSFQFQMVKHAMSFPGAKKIVYSTCSIHAEENERVVID 417

Query: 409 LLLDSKVKEWGWRVRKRAGAIPTWPRRGFYHEFEDVFREGDT--AKELAEACIRVAPKED 466
           LLLD  V+EWGW+V  R   +P+WPRRG   EFE+VFR+G     ++LAE CIR  PKED
Sbjct: 418 LLLDKAVQEWGWKVASRTEVVPSWPRRGKVEEFEEVFRDGSAHDPQQLAEGCIRALPKED 477

Query: 467 GGIGFFAVCFER 478
           GGIGFFAVCF R
Sbjct: 478 GGIGFFAVCFVR 489

>CAGL0M06941g Chr13 complement(706878..708356) [1479 bp, 492 aa]
           {ON} similar to uniprot|P53972 Saccharomyces cerevisiae
           YNL022c
          Length = 492

 Score =  595 bits (1534), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/494 (60%), Positives = 376/494 (76%), Gaps = 17/494 (3%)

Query: 1   MNFYRDATWVLEYVE-KAESSGRVAGSLQTLVLNSCKKYNLKTNPKHLYAAVYSCWRYNX 59
           M FYRD+TWVLEY+E + E +GRV+GSLQT+VL  CK+Y +KTNPKH+YA V SCW+Y  
Sbjct: 1   MEFYRDSTWVLEYLEGQIEKTGRVSGSLQTIVLRCCKQYRIKTNPKHIYAIVSSCWKYKP 60

Query: 60  XXXXXXXXXXXXXDVPKKKGKEIFNPTTIKLLVHDLLFTKNKRIQMGKHPLKEFVLKHKT 119
                         +P+KKGK  F+  T+ LL HDLL +K KRIQMGKHP+K +VLK+K 
Sbjct: 61  YLDKIMKKSGLLDAIPRKKGKPAFSKLTLLLLCHDLLLSKAKRIQMGKHPIKNYVLKYKN 120

Query: 120 RLNSELVRLKIKLKVTDLHQLLKDDRND--MTPVRWFRINPVRCHGKH-EEVMAELAKKF 176
            LN+E V+LKIKLK+TDL Q++  D     MTPVRW RINP+R      ++V+ EL KKF
Sbjct: 121 ALNAEFVKLKIKLKITDLSQVVDKDDAADDMTPVRWIRINPLRISNHDTDQVLNELKKKF 180

Query: 177 PTRVDSWKDVVPGSIYHDEYIPNLFGVHPGDKITSHELYKTGKIIIQDRASCFPAHILNP 236
           PTRV++WKD++PGSIY+DE+IPNL+G+H  DKITSHELYK GKIIIQDRASCFPAHILNP
Sbjct: 181 PTRVNTWKDIIPGSIYYDEFIPNLYGIHISDKITSHELYKQGKIIIQDRASCFPAHILNP 240

Query: 237 SPSDVIIDACAAPGNKTTHVAAHMFLNDQPQEP-----LIHAFEKDPERAKTLRTMVKTA 291
           S  DV+IDAC+APGNKTTHVAAH+F    P+ P      I+AFEKDPERA+ L+ M+KTA
Sbjct: 241 SADDVVIDACSAPGNKTTHVAAHIF--GDPENPRNDNVQIYAFEKDPERAQILQKMIKTA 298

Query: 292 GCSKGINIHVGDFTKLAKPSLFPNVSGFIVDPSCSGSGIFGRQIIDDHN----KSREEGA 347
           GC K I+++VGDFT++A PS + +V+GFI+DPSCSGSGIFGR+ +D  N    KS +E  
Sbjct: 299 GCHKNIDVNVGDFTQIATPSKYSDVTGFILDPSCSGSGIFGRKSVDILNNHGKKSNDEVP 358

Query: 348 LPTQEEERQEIEGKDIKNRLAKLASFQFEIVKYALSFPSAKKLVYSTCSIHAEENERIVI 407
                EE  + + + +K RL+KLASFQF+IV++A+SFP+AKK+VYSTCSIHAEENER+VI
Sbjct: 359 DENDAEETTDSKNEQLKERLSKLASFQFQIVRHAMSFPNAKKIVYSTCSIHAEENERVVI 418

Query: 408 DLLLDSKVKEWGWRVRKRAGAIPTWPRRGFYHEFEDVF--REGDTAKELAEACIRVAPKE 465
           DLLLD KV+ WGWRV K+   +PTW RRGF  EF++VF  +     +ELA+ C+R  PKE
Sbjct: 419 DLLLDKKVQSWGWRVAKKELVLPTWYRRGFKEEFQEVFTDKTEQECQELADGCVRALPKE 478

Query: 466 DGGIGFFAVCFERD 479
           DGGIGFFAVCF RD
Sbjct: 479 DGGIGFFAVCFVRD 492

>Skud_14.307 Chr14 complement(562104..563576) [1473 bp, 490 aa] {ON}
           YNL022C (REAL)
          Length = 490

 Score =  593 bits (1529), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/492 (60%), Positives = 374/492 (76%), Gaps = 17/492 (3%)

Query: 1   MNFYRDATWVLEYVEKAESSGRVAGSLQTLVLNSCKKYNLKTNPKHLYAAVYSCWRYNXX 60
           MNFYRDATWVLE +EK  +  R++GS+QTLVL SCKKY LK+NPKH+YA + SCW+Y   
Sbjct: 1   MNFYRDATWVLEDIEKEAAKERISGSMQTLVLRSCKKYKLKSNPKHIYAVLDSCWKYKPY 60

Query: 61  XXXXXXXXXXXXDVPKKKGKEIFNPTTIKLLVHDLLFTKNKRIQMGKHPLKEFVLKHKTR 120
                       D+PKKKGK +F+  T+ LL HDLL +K KRIQMGKHP+K++VLK K+ 
Sbjct: 61  LEKVMKKARILEDIPKKKGKPLFSRLTLLLLCHDLLLSKQKRIQMGKHPIKDYVLKFKSP 120

Query: 121 LNSELVRLKIKLKVTDLHQLL--KDDRNDMTPVRWFRINPVRCH--GKHEEVMAELAKKF 176
           L+SE+V+LK+KLKV DL +++  +D  ND+ PVRW RINP++CH  G  E V+AEL KKF
Sbjct: 121 LHSEMVKLKLKLKVRDLSEVVLSEDITNDLPPVRWIRINPLKCHPNGDTEPVLAELRKKF 180

Query: 177 PTRVDSWKDVVPGSIYHDEYIPNLFGVHPGDKITSHELYKTGKIIIQDRASCFPAHILNP 236
             +V+ W D+VPGSIY+DEYIPNLFG+HP DKIT+HELYK GKIIIQDRASCFPAHIL+P
Sbjct: 181 TLKVNKWSDLVPGSIYYDEYIPNLFGIHPTDKITAHELYKHGKIIIQDRASCFPAHILHP 240

Query: 237 SPSDVIIDACAAPGNKTTHVAAHMFLNDQPQEPL--IHAFEKDPERAKTLRTMVKTAGCS 294
              D++IDAC+APGNKTTH A+++  +  P++ +  I+AFEKDPERAK L+ MVK AGCS
Sbjct: 241 GADDIVIDACSAPGNKTTHTASYI-CSGPPKDNIIRIYAFEKDPERAKILQKMVKVAGCS 299

Query: 295 KGINIHVGDFTKLAKPSLFPNVSGFIVDPSCSGSGIFGRQIIDDHNKSR------EEGAL 348
             I++ VGDFTKLA P      +GFIVDPSCSGSGIFGR+  D  NK +      +   +
Sbjct: 300 SNIDVKVGDFTKLATPDKCKGATGFIVDPSCSGSGIFGRKFFDSLNKRKMDEKDDDNDVI 359

Query: 349 PTQEEERQEIEGKDIKNRLAKLASFQFEIVKYALSFPSAKKLVYSTCSIHAEENERIVID 408
           P ++EE    E  +++ RLAKL+SFQF++VK+A+SFP+AKK+VYSTCSIHAEENER+VID
Sbjct: 360 PDEQEEFMAKE--ELQTRLAKLSSFQFQMVKHAMSFPAAKKIVYSTCSIHAEENERVVID 417

Query: 409 LLLDSKVKEWGWRVRKRAGAIPTWPRRGFYHEFEDVFREGDT--AKELAEACIRVAPKED 466
           LLLD  V+EWGW+V  R   IP+WPRRG   EF +VFR+G     ++LAE CIR  PKED
Sbjct: 418 LLLDKAVQEWGWKVAPRTEVIPSWPRRGKVEEFGEVFRDGTAHNPRQLAEGCIRALPKED 477

Query: 467 GGIGFFAVCFER 478
           GGIGFFAVCFER
Sbjct: 478 GGIGFFAVCFER 489

>TBLA0B06960 Chr2 (1646966..1648492) [1527 bp, 508 aa] {ON}
           Anc_2.286 YNL022C
          Length = 508

 Score =  584 bits (1506), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/507 (58%), Positives = 377/507 (74%), Gaps = 28/507 (5%)

Query: 1   MNFYRDATWVLEYVEKAESSGRVAGSLQTLVLNSCKKYNLKTNPKHLYAAVYSCWRYNXX 60
           MNFYRDATWVLE++E  +  GRV+GSL +LV+ SCK++ +++NPKH+YA V S W++   
Sbjct: 1   MNFYRDATWVLEHLEAQDKKGRVSGSLLSLVVKSCKQFKIQSNPKHVYAVVESAWKFKPF 60

Query: 61  XXXXXXXXXXXXDVPKKKGKEIFNPTTIKLLVHDLLFTKNKRIQMGKHPLKEFVLKHKTR 120
                       D+PKKKGK I+   T+ LL+HDL+F+K++RIQMGKHP+K FVL +KTR
Sbjct: 61  IERIMAKSGILDDIPKKKGKPIYQRLTLLLLIHDLMFSKSRRIQMGKHPIKTFVLGYKTR 120

Query: 121 LNSELVRLKIKLKVTDLHQLL------KDDRNDMTPVRWFRINPVRC--HGKHEEVMAEL 172
           L+SELV+LK+KLKVT+L+ ++       D  +D+TPVRW RINP+R       ++++ EL
Sbjct: 121 LHSELVKLKLKLKVTNLNDMINANSNSNDSTDDITPVRWIRINPIRIPKQKSSDDIILEL 180

Query: 173 AKKFPTRVDSWKDVVPGSIYHDEYIPNLFGVHPGDKITSHELYKTGKIIIQDRASCFPAH 232
            KKF T+VD W  + PG IY+DEYIPNLFG+ P DKITSHELYK GKIIIQDRASCFPAH
Sbjct: 181 RKKFTTKVDHWSKIKPGCIYYDEYIPNLFGISPTDKITSHELYKNGKIIIQDRASCFPAH 240

Query: 233 ILNPSPSDVIIDACAAPGNKTTHVAAH-MFLNDQPQ----EPLIHAFEKDPERAKTLRTM 287
           ILN +P D IIDACAAPGNKTTHVA++ M LN+       +  + AFEKDPER+K L  M
Sbjct: 241 ILNATPDDYIIDACAAPGNKTTHVASYIMSLNNDTHINFDKKRVFAFEKDPERSKILDKM 300

Query: 288 VKTAGCSKGINIHVGDFTKLAKPSLFPNVSGFIVDPSCSGSGIFGRQIIDDHNKSR---- 343
           VK AGC K + I+ GDFTK+A P  +PNV+GFIVDPSCSGSGIFGR+ ID+ N ++    
Sbjct: 301 VKIAGCKKLVEINTGDFTKIATPEKYPNVTGFIVDPSCSGSGIFGRKFIDNINSNKKLTE 360

Query: 344 --------EEGALPTQEEERQEIEGK-DIKNRLAKLASFQFEIVKYALSFPSAKKLVYST 394
                   +E  +P ++E   E + K D++ RL+KL+SFQF++VK+A+SFPSAKK+VYST
Sbjct: 361 KVKDEGEDDEQDIPLEQETLAEAKAKDDLETRLSKLSSFQFQVVKHAMSFPSAKKIVYST 420

Query: 395 CSIHAEENERIVIDLLLDSKVKEWGWRVRKRAGAIPTWPRRGFYHEFEDVFREGDTA--K 452
           CSIHAEENER+VIDLLLD KVKEWGW+V  R+ +IPTW RRG   EFEDVF+       K
Sbjct: 421 CSIHAEENERVVIDLLLDKKVKEWGWKVTPRSLSIPTWERRGLVSEFEDVFKNDPAMDPK 480

Query: 453 ELAEACIRVAPKEDGGIGFFAVCFERD 479
           +LAE CIR  PKEDGGIGFFAVCFER+
Sbjct: 481 QLAEGCIRTLPKEDGGIGFFAVCFERN 507

>Smik_14.309 Chr14 complement(553805..555277) [1473 bp, 490 aa] {ON}
           YNL022C (REAL)
          Length = 490

 Score =  580 bits (1494), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/492 (60%), Positives = 378/492 (76%), Gaps = 17/492 (3%)

Query: 1   MNFYRDATWVLEYVEKAESSGRVAGSLQTLVLNSCKKYNLKTNPKHLYAAVYSCWRYNXX 60
           MNFYRDATWVLE +EK  +  R++GS+QTLVL SCK+Y LK+NPKH+YA + SCW+Y   
Sbjct: 1   MNFYRDATWVLEDIEKEAAKERISGSMQTLVLKSCKRYKLKSNPKHVYAVLDSCWKYKPY 60

Query: 61  XXXXXXXXXXXXDVPKKKGKEIFNPTTIKLLVHDLLFTKNKRIQMGKHPLKEFVLKHKTR 120
                       D+PKKKGK +F+  T+ LL HDLL +K KRIQMGKHP+K++VLK K+ 
Sbjct: 61  LEKVMKKARILEDIPKKKGKPLFSRLTLLLLCHDLLISKQKRIQMGKHPIKDYVLKFKSP 120

Query: 121 LNSELVRLKIKLKVTDLHQLL--KDDRNDMTPVRWFRINPVRCH--GKHEEVMAELAKKF 176
           L+SE+V+LK+KLKV +L +L+  +D  ND+ PVRW RINP++C+  GK E V+AEL KKF
Sbjct: 121 LHSEMVKLKLKLKVRNLSELVLSEDIANDLPPVRWIRINPLKCYPNGKTEPVLAELRKKF 180

Query: 177 PTRVDSWKDVVPGSIYHDEYIPNLFGVHPGDKITSHELYKTGKIIIQDRASCFPAHILNP 236
             +V+ W ++VP SIY+DEYIPNLFG+HP DKIT+HELYK GKIIIQDRASCFPAHILNP
Sbjct: 181 TLKVEKWSELVPESIYYDEYIPNLFGIHPSDKITAHELYKNGKIIIQDRASCFPAHILNP 240

Query: 237 SPSDVIIDACAAPGNKTTHVAAHMFLNDQPQEP--LIHAFEKDPERAKTLRTMVKTAGCS 294
            P+D++IDAC+APGNKTTH A+++  ++ P++    I+AFEKDPERAK L+ M+K AGCS
Sbjct: 241 GPNDIVIDACSAPGNKTTHTASYI-CSEPPKDSRTRIYAFEKDPERAKILQKMIKIAGCS 299

Query: 295 KGINIHVGDFTKLAKPSLFPNVSGFIVDPSCSGSGIFGRQIIDDHNKSREEGA------L 348
             I++ VGDFTKLA P  F + +GFIVDPSCSGSGIFGR+  D  N+ + +        +
Sbjct: 300 SNIDVSVGDFTKLATPEKFKDATGFIVDPSCSGSGIFGRKFFDSLNRKKMDDKDDDNDIV 359

Query: 349 PTQEEERQEIEGKDIKNRLAKLASFQFEIVKYALSFPSAKKLVYSTCSIHAEENERIVID 408
           P ++EE    E  +++ RLAKL+SFQF++VK+A+SFP AKK+VYSTCSIHAEENER+VID
Sbjct: 360 PDEQEEFMAKE--ELQTRLAKLSSFQFQMVKHAMSFPVAKKIVYSTCSIHAEENERVVID 417

Query: 409 LLLDSKVKEWGWRVRKRAGAIPTWPRRGFYHEFEDVFREGDT--AKELAEACIRVAPKED 466
           LLLD  V+EWGWRV  R+  IP WPRRG   EFE+VFREG     +ELAE CIR  PK+D
Sbjct: 418 LLLDKAVQEWGWRVAPRSEVIPFWPRRGKVEEFEEVFREGAAHDPQELAEGCIRALPKDD 477

Query: 467 GGIGFFAVCFER 478
           GGIGFFAVCFER
Sbjct: 478 GGIGFFAVCFER 489

>NCAS0G03790 Chr7 complement(699962..701440) [1479 bp, 492 aa] {ON}
           Anc_2.286 YNL022C
          Length = 492

 Score =  578 bits (1489), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/495 (59%), Positives = 376/495 (75%), Gaps = 20/495 (4%)

Query: 1   MNFYRDATWVLEYVEKAESSGRVAGSLQTLVLNSCKKYNLKTNPKHLYAAVYSCWRYNXX 60
           M FYRDATWVLE+VE+ ++ GR++GSLQTLV  SCK+Y LK NPKH+YA + SCW+Y   
Sbjct: 1   MEFYRDATWVLEFVEQEDAKGRISGSLQTLVFQSCKRYKLKCNPKHVYAVLDSCWKYKPY 60

Query: 61  XXXXXXXXXXXXDVPKKKGKEIFNPTTIKLLVHDLLFTKNKRIQMGKHPLKEFVLKHKTR 120
                       ++PK+KGK +++  T+ L+ HDLLF+K KRIQMGK P+K +VLKHK+R
Sbjct: 61  LEKVMKKSGILDEIPKRKGKPMYSRLTLMLMCHDLLFSKAKRIQMGKLPIKTYVLKHKSR 120

Query: 121 LNSELVRLKIKLKVTDLHQLLK--DDRNDMTPVRWFRINPVRCHGKHEEVMAELAKKFPT 178
           L+SELV+LK+KLKV +L +L+   D  NDMTPVRW RINP+RC    E    E+ KKFPT
Sbjct: 121 LHSELVKLKLKLKVKNLSELVSNADSENDMTPVRWIRINPLRCDV--EATKLEIQKKFPT 178

Query: 179 RVDSWKDVVPGSIYHDEYIPNLFGVHPGDKITSHELYKTGKIIIQDRASCFPAHILNPSP 238
           RV++W D+VPGSIY+DEYIPNLFG+HP DKITSH LYK GKIIIQDRASCFPAHIL+P  
Sbjct: 179 RVENWSDIVPGSIYYDEYIPNLFGIHPQDKITSHNLYKQGKIIIQDRASCFPAHILHPDE 238

Query: 239 SDVIIDACAAPGNKTTHVAAHMFLNDQPQEP--LIHAFEKDPERAKTLRTMVKTAGCSKG 296
           +DV+ID CAAPGNKTTH A++M + +  ++P   I+AFEK+PERAK L  M+K AGCSK 
Sbjct: 239 NDVVIDGCAAPGNKTTHTASYM-IKEPSKDPKIQIYAFEKNPERAKILDKMIKVAGCSKN 297

Query: 297 INIHVGDFTKLAKPSLFPNVSGFIVDPSCSGSGIFGRQIIDDHNK---SREEGALPTQEE 353
           I I+VGDFTK+A P  + +V+GFIVDPSCSGSGIFGR+ ID  N+   +++E      +E
Sbjct: 298 IKINVGDFTKIALPEKYKDVTGFIVDPSCSGSGIFGRKFIDSLNRKKMNKDEADKKEGDE 357

Query: 354 ERQEI-------EGKDIKNRLAKLASFQFEIVKYALSFPSAKKLVYSTCSIHAEENERIV 406
           E +         + +D+K RL+KL+SFQF++VK+A+SFP+AKK+VYSTCSIHAEENER+V
Sbjct: 358 EEEVPDEQEEYNKREDLKTRLSKLSSFQFQVVKHAMSFPNAKKIVYSTCSIHAEENERVV 417

Query: 407 IDLLLDSKVKEWGWRVRKRAGAIPTWPRRG-FYHEFEDVFREGDTAK--ELAEACIRVAP 463
           IDL+LDSKVK+WGW+V  R+  IPTWPRRG      E    +G+++K  ELA  CIR  P
Sbjct: 418 IDLMLDSKVKQWGWKVAPRSKVIPTWPRRGKVEEFEEVFREDGNSSKCEELAGGCIRALP 477

Query: 464 KEDGGIGFFAVCFER 478
           + DGGIGFFAVCFER
Sbjct: 478 RSDGGIGFFAVCFER 492

>ZYRO0A01892g Chr1 (156967..158364) [1398 bp, 465 aa] {ON} similar
           to uniprot|P53972 Saccharomyces cerevisiae YNL022C
          Length = 465

 Score =  568 bits (1463), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 276/483 (57%), Positives = 359/483 (74%), Gaps = 23/483 (4%)

Query: 1   MNFYRDATWVLEYVEKAESSGRVAGSLQTLVLNSCKKYNLKTNPKHLYAAVYSCWRYNXX 60
           M+FYRD+TW+LEY+E  E  G+++GSLQ+ VL +C KY +K NPKH+YA V SCW+Y   
Sbjct: 1   MDFYRDSTWILEYLEAEEKKGKLSGSLQSNVLKTCTKYKVKNNPKHIYAVVASCWKYRMY 60

Query: 61  XXXXXXXXXXXXDVPKKKGKEIFNPTTIKLLVHDLLFTKNKRIQMGKHPLKEFVLKHKTR 120
                        +P+KKGK  F+  TI LL HDLL +K KRIQMGKHP+K++VLK+KTR
Sbjct: 61  LERIMHKSGILKTIPQKKGKPAFSRLTIMLLCHDLLISKQKRIQMGKHPIKDYVLKYKTR 120

Query: 121 LNSELVRLKIKLKVTDLHQLL-KDDRNDMTPVRWFRINPVRCHGKHEEVMAELAKKFPTR 179
           L++ELV+LK+KLKV +L +L+ +DD +D TPVRW RINP++C      V+ +L KKFP R
Sbjct: 121 LHAELVKLKVKLKVKELSELVDQDDGDDATPVRWIRINPLKC--DIPVVVEQLNKKFPHR 178

Query: 180 VDSWKDVVPGSIYHDEYIPNLFGVHPGDKITSHELYKTGKIIIQDRASCFPAHILNPSPS 239
           VD W  + PGSIY+DEY+PNLFG+HP +KITSH+LYK GK+IIQDRASC PAHILNP   
Sbjct: 179 VDHWDQLSPGSIYYDEYVPNLFGIHPSEKITSHDLYKQGKVIIQDRASCLPAHILNPGKE 238

Query: 240 DVIIDACAAPGNKTTHVAAHMFL---NDQPQEPLIHAFEKDPERAKTLRTMVKTAGCSKG 296
           DV++DACAAPGNKTTH+AAH+     +    +  IHAFEK+P RAK L+ M   AGC   
Sbjct: 239 DVVMDACAAPGNKTTHLAAHIISAAGDSNGGQAQIHAFEKEPARAKVLQKMTSQAGCGSL 298

Query: 297 INIHVGDFTKLAKPSLFPNVSGFIVDPSCSGSGIFGRQIIDDHNKSREEGALPTQEEERQ 356
           + IHVGDFT+LA P  F +V+  +VDPSCSGSGIFGR+ ++  N S+++           
Sbjct: 299 VKIHVGDFTRLAVPDQFEDVTAALVDPSCSGSGIFGRKSLESSNDSQDQ----------- 347

Query: 357 EIEGKDIKNRLAKLASFQFEIVKYALSFPSAKKLVYSTCSIHAEENERIVIDLLLDSKVK 416
                 +++RL+KL+SFQF++VK+A+S P+A+K+VYSTCS+HAEENER+VIDLLLDSKVK
Sbjct: 348 -----KLQDRLSKLSSFQFQVVKHAMSMPNARKIVYSTCSVHAEENERVVIDLLLDSKVK 402

Query: 417 EWGWRVRKRAGAIPTWPRRGFYHEFEDVFREGD-TAKELAEACIRVAPKEDGGIGFFAVC 475
           EWGW++  R+  +PTWPRRG   EFE+VFR+     + LAE+CIR  P+EDGGIGFFAVC
Sbjct: 403 EWGWQLSPRSEVVPTWPRRGIAEEFEEVFRDDKPKCQLLAESCIRALPREDGGIGFFAVC 462

Query: 476 FER 478
           F+R
Sbjct: 463 FQR 465

>TPHA0H00150 Chr8 (15977..17926) [1950 bp, 649 aa] {ON} Anc_8.171
           YBL024W
          Length = 649

 Score = 74.3 bits (181), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 75/290 (25%), Positives = 119/290 (41%), Gaps = 49/290 (16%)

Query: 217 TGKIIIQDRASCFPAHILNPSPSDVIIDACAAPGNKTTHVAAHMFLNDQPQEPLIHAFEK 276
            G I  Q+  S  P  +L+  P   ++D CAAPG+KT  +   + ++       + A + 
Sbjct: 139 VGNISRQEAVSMLPPILLDVKPHHTVLDMCAAPGSKTAQLMESLHIDSDEPSGFVIANDA 198

Query: 277 DPERAKTLRTMVKTAGCSKGINI-HVGDFTKLAKPSLFPNVSGFIVDPSCSGSGIFGRQI 335
           D +R+  L   +K    S  + + H   F        FPN+     D S      F R +
Sbjct: 199 DNKRSHLLVHQLKRLSTSNVLIVNHDAQF--------FPNLKINTKDASSQEDLKFDRIL 250

Query: 336 IDDHNKSREEGALPTQEEERQEIEGKDIKNRLAKLASFQFEIVKYALSF-PSAKKLVYST 394
            D       +G   T  +     +  + +N L  L + QF I+   L+      KLVYST
Sbjct: 251 CD--VPCSGDG---TMRKNVNVWKNWNTQNALG-LHNVQFNILDRGLTLLKETGKLVYST 304

Query: 395 CSIHAEENERIVIDLLLDSKVKEWGWRVRK-----------RAGAIPTWPRRGFYHEFED 443
           CS++  ENE +V  +L     ++WG +VR            R+  + TWP      + E+
Sbjct: 305 CSLNPIENEAVVAAVL-----RKWGDKVRLVCCDDKLKGLIRSKGLTTWPV--INRDMEE 357

Query: 444 VFR---------------EGDTAKELAEACIRVAPKEDGGIGFFAVCFER 478
           V R               E + +K   + C+RV P +    GFF   FE+
Sbjct: 358 VPRNRSDDKINKSCYPPTEEEVSKFNLDRCMRVYPHQQNTGGFFITMFEK 407

>TDEL0B04390 Chr2 (769749..771770) [2022 bp, 673 aa] {ON} Anc_8.171
           YBL024W
          Length = 673

 Score = 70.5 bits (171), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 75/293 (25%), Positives = 115/293 (39%), Gaps = 58/293 (19%)

Query: 218 GKIIIQDRASCFPAHILNPSPSDVIIDACAAPGNKTTHVAAHMFLNDQPQEPLIHAFEKD 277
           G I  Q+  S  P  +L   P   ++D CAAPG+KT  +   +  +       + A + D
Sbjct: 143 GNISRQEAVSMIPPIVLEVEPHHTVLDMCAAPGSKTAQMIEALHKDTDEPTGFVVANDAD 202

Query: 278 PERAKTLRTMVKTAGCSKGINI-HVGDF-----TKLAKPSLFPNVSGF---IVDPSCSGS 328
            +R+  L   +K    +  + + H   F     +  A  S   NV  F   + D  CSG 
Sbjct: 203 SKRSHMLVHQLKRLNSANLMVVNHDAQFFPRIKSSAADDSSKANVLKFDRVLCDVPCSGD 262

Query: 329 GIFGRQIIDDHNKSREEGALPTQEEERQEIEGKDIKNRLAKLASFQFEIVKYALSFPSAK 388
           G   R+ ++       +G L                     L + QF I+   L     K
Sbjct: 263 GTM-RKNVNVWRDWTPQGGL--------------------GLHTVQFNILNRGLHLLKNK 301

Query: 389 -KLVYSTCSIHAEENERIVIDLLLDSKVKEWGWRVR-----------KRAGAIPTWP--- 433
            +LVYSTCS++  ENE +V + L     ++WG ++R            R+  +  WP   
Sbjct: 302 GRLVYSTCSMNPIENEAVVAEAL-----RKWGDKIRLVSCEDKLPGLVRSKGVSQWPVID 356

Query: 434 ------RRGFYHEFEDVF--REGDTAKELAEACIRVAPKEDGGIGFFAVCFER 478
                  +G     +  F   E + AK   E CIRV P +    GFF   FE+
Sbjct: 357 RNMTPREKGDEGTHDSWFPPTEEEAAKFNLENCIRVYPHQQNTGGFFITVFEK 409

>AFR179C Chr6 complement(766458..768560) [2103 bp, 700 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBL024W
           (NCL1)
          Length = 700

 Score = 70.1 bits (170), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 74/289 (25%), Positives = 118/289 (40%), Gaps = 54/289 (18%)

Query: 218 GKIIIQDRASCFPAHILNPSPSDVIIDACAAPGNKTTHVAAHMFLNDQPQEPLIHAFEKD 277
           G I  Q+  S  P ++L   P   ++D CAAPG+KT  +   +  N       + A + D
Sbjct: 146 GNISRQEAVSMIPPNVLGVEPHHSVLDMCAAPGSKTAQLVEALHANGPEPSGFVVANDAD 205

Query: 278 PERAKTLRTMVKTAGCSKGINI-HVGDF---TKLAKPSL-FPNVSGFIVDPSCSGSGIFG 332
             R+  L   +K    +  I + H   F    K A+ S  F      + D  CSG G   
Sbjct: 206 YRRSHMLVHQLKRLNSANLIVVNHDAQFFPRIKTAEGSKDFLKFDRVLCDVPCSGDGTMR 265

Query: 333 RQIIDDHNKSREEGALPTQEEERQEIEGKDIKNRLAKLASFQFEIVKYALS-FPSAKKLV 391
           + I    N  ++ G             G  +      L + Q  I+   L+   +  +LV
Sbjct: 266 KNI----NVWKDWGT------------GSGL-----GLHTVQLNILNRGLTLLKNGGRLV 304

Query: 392 YSTCSIHAEENERIVIDLLLDSKVKEWGWRVR-----------KRAGAIPTWPRRGFYHE 440
           YSTCS++  ENE +V      + +++WG +++            R+  I +WP     +E
Sbjct: 305 YSTCSLNPIENEAVVA-----AALRKWGAKIKLVNCDDQLLGLVRSTGISSWPVLDKNYE 359

Query: 441 FEDVFREG----------DTAKEL-AEACIRVAPKEDGGIGFFAVCFER 478
            ++   +G          + AKE   E CIRV P +    GFF   FE+
Sbjct: 360 EKNKGDDGTIATWFPPSEEEAKEFNLENCIRVYPHQQNTGGFFISVFEK 408

>NDAI0B01830 Chr2 (436254..438314) [2061 bp, 686 aa] {ON} Anc_8.171
           YBL024W
          Length = 686

 Score = 70.1 bits (170), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 69/292 (23%), Positives = 112/292 (38%), Gaps = 57/292 (19%)

Query: 218 GKIIIQDRASCFPAHILNPSPSDVIIDACAAPGNKTTHVAAHMFLNDQPQEPLIHAFEKD 277
           G I  Q+  S  P  +L   P   ++D CAAPG+KT  +   +  +       + A + D
Sbjct: 145 GNISRQEAVSMIPPIVLEVEPHHTVLDMCAAPGSKTAQLIEALHKDTDEPTGFVVANDAD 204

Query: 278 PERAKTLRTMVKTAGCSKGINI-HVGDF-------TKLAKPSLFPNVSGFIVDPSCSGSG 329
            +R+  L   +K    +  + + H   F       T   K          + D  CSG G
Sbjct: 205 AKRSHMLVHQLKRLNSANLMVVNHDAQFFPRIKLHTDAEKKKEMLKFDRILCDVPCSGDG 264

Query: 330 IFGRQIIDDHNKSREEGALPTQEEERQEIEGKDIKNRLAKLASFQFEIVKYALSF-PSAK 388
              R+ ++       +G L                     L + Q  I+   L+   S  
Sbjct: 265 TM-RKNVNVWKDWNTQGGL--------------------GLHTVQLNILNRGLNLLKSGG 303

Query: 389 KLVYSTCSIHAEENERIVIDLLLDSKVKEWGWRVR-----------KRAGAIPTWP---- 433
           +LVYSTCS++  ENE +V + L     ++WG +++            R+  I  WP    
Sbjct: 304 RLVYSTCSMNPIENEAVVAEAL-----RKWGSKIKLVNCDDKLVGLVRSKGISNWPVLDR 358

Query: 434 -----RRGFYHEFEDVFREGDTAKEL--AEACIRVAPKEDGGIGFFAVCFER 478
                 +G     E  F   +  +E+   ++CIRV P +    GFF   FE+
Sbjct: 359 NMAVKNKGDEGTIESWFPPTEEEREIFHLDSCIRVYPHQQNTGGFFITVFEK 410

>ZYRO0G08998g Chr7 complement(726070..728121) [2052 bp, 683 aa] {ON}
           similar to uniprot|P38205 Saccharomyces cerevisiae
           YBL024W
          Length = 683

 Score = 67.8 bits (164), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 72/300 (24%), Positives = 115/300 (38%), Gaps = 73/300 (24%)

Query: 218 GKIIIQDRASCFPAHILNPSPSDVIIDACAAPGNKTTHVAAHMFLNDQPQEPLIHAFEKD 277
           G I  Q+  S  P  +L+  P   ++D CAAPG+KT  +  ++  ++      + A + D
Sbjct: 142 GNISRQEAVSMIPPTLLDVQPHHTVLDMCAAPGSKTAQMIEYLHRDNDEPSGFVVANDAD 201

Query: 278 PERAKTLRTMVKTAGCSKGINI-HVGDFTKLAKPSLFPNVSG---------------FIV 321
            +R+  L   +K    +  I + H   F        FP V                  + 
Sbjct: 202 AKRSHMLVHQLKRLNSANLIVVNHDAQF--------FPRVKAHPDHTNKKDILRFDRVLC 253

Query: 322 DPSCSGSGIFGRQIIDDHNKSREEGALPTQEEERQEIEGKDIKNRLAKLASFQFEIVKYA 381
           D  CSG G   + +    N  R+                   +N LA L + Q  I+   
Sbjct: 254 DVPCSGDGTMRKNV----NVWRDWTT----------------QNGLA-LHNVQLNILNRG 292

Query: 382 LSF-PSAKKLVYSTCSIHAEENERIVIDLLLDSKVKEWGWRVR-----------KRAGAI 429
           L    S  +LVYSTCS++  ENE +V + L     ++WG +VR            R+  I
Sbjct: 293 LHLLKSGGRLVYSTCSMNPIENEAVVAEAL-----RKWGGKVRLVDCSDKLPGLVRSNGI 347

Query: 430 PTWPRRGFYHEFEDVFREG-----------DTAKELAEACIRVAPKEDGGIGFFAVCFER 478
             WP      E ++   +G           + A+   + C+RV P +    GFF    E+
Sbjct: 348 NQWPVLNRNMETKEKGEDGTNDSWFPPTDEEAARFHLDYCVRVYPHQQNTGGFFITVLEK 407

>ADL254W Chr4 (253602..255413) [1812 bp, 603 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL061W (NOP2)
          Length = 603

 Score = 67.4 bits (163), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 59/234 (25%), Positives = 101/234 (43%), Gaps = 41/234 (17%)

Query: 215 YKTGKIIIQDRASCFPAHILNPSPSDVIIDACAAPGNKTTHVAAHMFLNDQPQEPLIHAF 274
           Y  G  I+Q  +S  P   L+P  ++ I+D  AAPG KTT+++A M          + A 
Sbjct: 309 YLAGHYILQAASSFLPVIALDPHENERILDMAAAPGGKTTYISAMM-----KNTGCVFAN 363

Query: 275 EKDPERAKTLRTMVKTAGCSKGINIHVGDFTKLAKPSLFPNVSGFIVDPSCSGSGIFGRQ 334
           + +  R K+L   +   GC+  I   V ++     P +       ++D  CSG+G+ G+ 
Sbjct: 364 DANKARTKSLIANIHRLGCTNTI---VCNYDAREFPKVIGGFDRILLDAPCSGTGVIGKD 420

Query: 335 IIDDHNKSREEGALPTQEEERQEIEGKDIKNRLAKLASFQFEIVKYAL-SFPSAKK---- 389
                                Q ++    +    ++   Q +++  A+ S  S  K    
Sbjct: 421 ---------------------QSVKVNRTEKDFMQIPHLQKQLILSAIDSVDSNSKHGGV 459

Query: 390 LVYSTCSIHAEENERIVIDLLL----DSKVKEWGWRVRKRAGAIPTWPRRGFYH 439
           +VYSTCS+  EENE  V+D  L    + K+ E G  + K      ++  + F+H
Sbjct: 460 IVYSTCSVAVEENE-AVVDYALRKRPNVKLVETGLAIGKE--GFTSYRGKKFHH 510

>Kpol_1002.109 s1002 (272892..274904) [2013 bp, 670 aa] {ON}
           (272892..274904) [2013 nt, 671 aa]
          Length = 670

 Score = 67.4 bits (163), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 70/293 (23%), Positives = 114/293 (38%), Gaps = 57/293 (19%)

Query: 217 TGKIIIQDRASCFPAHILNPSPSDVIIDACAAPGNKTTHVAAHMFLNDQPQEPLIHAFEK 276
            G I  Q+  S  P  +L   P   ++D CAAPG+KT  +   + + D      + A + 
Sbjct: 144 VGNISRQEAVSMIPPIVLEVKPHHTVLDMCAAPGSKTAQLIEALHMEDDEPSGFVVANDA 203

Query: 277 DPERAKTLRTMVKTAGCSKGINI-HVGDFTKLAK----PSLFPNVSGF---IVDPSCSGS 328
           D +R+  L   +K    +  + + H   F    K     +   +V  F   + D  CSG 
Sbjct: 204 DAKRSHMLVHQLKRLNSANLMVVNHDAQFFPRIKLHEDATQKKDVLRFDRVLCDVPCSGD 263

Query: 329 GIFGRQIIDDHNKSREEGALPTQEEERQEIEGKDIKNRLAKLASFQFEIVKYALSFPSAK 388
           G   + +    + + + G                       L + Q  I+   L     K
Sbjct: 264 GTMRKNVNVWRDWNTQSGL---------------------GLHTVQLNILNRGLHLLKPK 302

Query: 389 -KLVYSTCSIHAEENERIVIDLLLDSKVKEWGWRVR-----------KRAGAIPTWP--- 433
            +LVYSTCS++  ENE +V      + +++WG ++R            R+  I TWP   
Sbjct: 303 GRLVYSTCSMNPIENEAVVA-----AALRKWGDKIRLVNCDDKLPGLVRSKGISTWPVVD 357

Query: 434 ------RRGFYHEFEDVFREGDTAKELAE--ACIRVAPKEDGGIGFFAVCFER 478
                 ++G  +  E  F       E  +  +CIRV P +    GFF   FE+
Sbjct: 358 RNMEEKKKGDENTVESWFAPTPEEAEKFDLSSCIRVYPHQQNTGGFFITVFEK 410

>TBLA0E03850 Chr5 (967569..969467) [1899 bp, 632 aa] {ON} Anc_2.247
           YNL061W
          Length = 632

 Score = 65.9 bits (159), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 50/197 (25%), Positives = 86/197 (43%), Gaps = 34/197 (17%)

Query: 215 YKTGKIIIQDRASCFPAHILNPSPSDVIIDACAAPGNKTTHVAAHMFLNDQPQEPLIHAF 274
           Y  G  I+Q  +S  P   L+P  ++ ++D  +APG KTT+++A M          I A 
Sbjct: 336 YLAGNYILQAASSFLPVIALDPQENERVLDMASAPGGKTTYISALM-----KNTGCIFAN 390

Query: 275 EKDPERAKTLRTMVKTAGCSKGINIHVGDFTKLAKPSLFPNVSGFIVDPSCSGSGIFGRQ 334
           + +  R K+L   +   GC+  I   V ++     P +       ++D  CSG+G+ G+ 
Sbjct: 391 DANKARTKSLIANIHRLGCTNTI---VCNYDAREFPKVIGGFDRILLDAPCSGTGVIGKD 447

Query: 335 IIDDHNKSREEGALPTQEEERQEIEGKDIKNRLAKLASFQFEIVKYAL-SFPSAKK---- 389
                                Q ++    +    ++   Q +++  A+ S  S  K    
Sbjct: 448 ---------------------QSVKVSRTEKDFIQIPHLQKQLILSAIDSLDSNSKNGGV 486

Query: 390 LVYSTCSIHAEENERIV 406
           LVYSTCS+  EE+E +V
Sbjct: 487 LVYSTCSVAVEEDEAVV 503

>Kpol_1003.15 s1003 (41683..43584) [1902 bp, 633 aa] {ON}
           (41683..43584) [1902 nt, 634 aa]
          Length = 633

 Score = 65.9 bits (159), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 47/197 (23%), Positives = 85/197 (43%), Gaps = 34/197 (17%)

Query: 215 YKTGKIIIQDRASCFPAHILNPSPSDVIIDACAAPGNKTTHVAAHMFLNDQPQEPLIHAF 274
           Y  G+ I+Q  +S  P   L+P  ++ ++D  AAPG KTT+++A M          + A 
Sbjct: 337 YLAGQYILQAASSFLPVVALDPQENERVLDMAAAPGGKTTYISALM-----KNTGCVFAN 391

Query: 275 EKDPERAKTLRTMVKTAGCSKGINIHVGDFTKLAKPSLFPNVSGFIVDPSCSGSGIFGRQ 334
           + +  R K+L   +   GC+   N  V ++     P +       ++D  CSG+G+ G+ 
Sbjct: 392 DANKARTKSLIANIHRLGCT---NTIVCNYDAREFPKVIGGFDRILLDAPCSGTGVIGKD 448

Query: 335 IIDDHNKSREEGALPTQEEERQEIEGKDIKNRLAKLASFQFEIVKYALSFPSAKK----- 389
                                Q ++    +    ++   Q +++  A+    A       
Sbjct: 449 ---------------------QSVKSSRTEKDFIQIPHLQKQLLLSAIDSVDANSKTGGV 487

Query: 390 LVYSTCSIHAEENERIV 406
           +VYSTCS+  EE+E +V
Sbjct: 488 IVYSTCSVAVEEDEAVV 504

>ZYRO0A01562g Chr1 (128145..129998) [1854 bp, 617 aa] {ON} similar
           to uniprot|P40991 Saccharomyces cerevisiae YNL061W NOP2
           Probable RNA m(5)C methyltransferase essential for
           processing and maturation of 27S pre-rRNA and large
           ribosomal subunit biogenesis localized to the nucleolus
          Length = 617

 Score = 65.9 bits (159), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 50/197 (25%), Positives = 87/197 (44%), Gaps = 34/197 (17%)

Query: 215 YKTGKIIIQDRASCFPAHILNPSPSDVIIDACAAPGNKTTHVAAHMFLNDQPQEPLIHAF 274
           Y  G  I+Q  +S  P   L+P  ++ I+D  AAPG KTT+++A M          + A 
Sbjct: 323 YLAGNYILQAASSFLPVIALDPQENERILDMAAAPGGKTTYISALM-----KNTGCVFAN 377

Query: 275 EKDPERAKTLRTMVKTAGCSKGINIHVGDFTKLAKPSLFPNVSGFIVDPSCSGSGIFGRQ 334
           + +  R K+L   +   GC+  I   V ++     P +       ++D  CSG+G+ G+ 
Sbjct: 378 DANKSRTKSLVANIHRLGCTNTI---VCNYDAREFPRVIGGFDRILLDAPCSGTGVIGKD 434

Query: 335 IIDDHNKSREEGALPTQEEERQEIEGKDIKNRLAKLASFQFEIVKYAL-SFPSAKK---- 389
                                Q ++    +    ++   Q +++  A+ S  S  K    
Sbjct: 435 ---------------------QSVKVSRTEKDFMQIPHLQKQLLLSAIDSVDSHSKTGGI 473

Query: 390 LVYSTCSIHAEENERIV 406
           +VYSTCS+  EE+E++V
Sbjct: 474 IVYSTCSVAVEEDEQVV 490

>SAKL0H19448g Chr8 (1713663..1715738) [2076 bp, 691 aa] {ON} highly
           similar to uniprot|P38205 Saccharomyces cerevisiae
           YBL024W
          Length = 691

 Score = 65.9 bits (159), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 69/289 (23%), Positives = 108/289 (37%), Gaps = 54/289 (18%)

Query: 218 GKIIIQDRASCFPAHILNPSPSDVIIDACAAPGNKTTHVAAHMFLNDQPQEPLIHAFEKD 277
           G I  Q+  S  P  +L   P+  ++D CAAPG+KT  +   +   +      + A + D
Sbjct: 145 GNISRQEAVSMIPPIVLEVKPNHTVLDMCAAPGSKTAQLIEALHAQEDEPTGFVVANDAD 204

Query: 278 PERAKTLRTMVKTAGCSKGINI-HVGDFTKLAKPS----LFPNVSGFIVDPSCSGSGIFG 332
            +R+  L   +K    +  + + H   F    K       F      + D  CSG G   
Sbjct: 205 AKRSHMLVHQLKRLNSANLMVVNHDAQFFPRIKSQPDSKEFLKFDRVLCDVPCSGDGTMR 264

Query: 333 RQIIDDHNKSREEGALPTQEEERQEIEGKDIKNRLAKLASFQFEIVKYALS-FPSAKKLV 391
           + +    N  R+ G                       L + Q  I+   L+      +LV
Sbjct: 265 KNV----NVWRDWGTASG-----------------LGLHTVQLNILNRGLNLLKDGGRLV 303

Query: 392 YSTCSIHAEENERIVIDLLLDSKVKEWGWRVR-----------KRAGAIPTWP------- 433
           YSTCS++  ENE ++   L     ++WG ++R            R+  I  WP       
Sbjct: 304 YSTCSLNPIENESVIAAAL-----RKWGDKIRLVNCDEKLPGLVRSKGITQWPVYDKNFA 358

Query: 434 --RRGFYHEFEDVF--REGDTAKELAEACIRVAPKEDGGIGFFAVCFER 478
              +G     E  F   E +  +   E CIRV P +    GFF   FE+
Sbjct: 359 LKEKGDEGVIETWFPPTEEEATRFHLENCIRVYPHQQNTGGFFITVFEK 407

>KLLA0F03399g Chr6 (319007..320866) [1860 bp, 619 aa] {ON} similar
           to uniprot|P40991 Saccharomyces cerevisiae YNL061W NOP2
           Probable RNA m(5)C methyltransferase essential for
           processing and maturation of 27S pre-rRNA and large
           ribosomal subunit biogenesis localized to the nucleolus
          Length = 619

 Score = 65.5 bits (158), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 50/197 (25%), Positives = 86/197 (43%), Gaps = 34/197 (17%)

Query: 215 YKTGKIIIQDRASCFPAHILNPSPSDVIIDACAAPGNKTTHVAAHMFLNDQPQEPLIHAF 274
           Y  G  I+Q  +S  P   L+P  ++ I+D  AAPG KTT+++A M          + A 
Sbjct: 319 YLAGHYILQAASSFLPVIALDPQENERILDMAAAPGGKTTYISAMM-----KNTGCVFAN 373

Query: 275 EKDPERAKTLRTMVKTAGCSKGINIHVGDFTKLAKPSLFPNVSGFIVDPSCSGSGIFGRQ 334
           + +  R K+L   +   GC+  I   V ++     P +       ++D  CSG+G+ G+ 
Sbjct: 374 DANKARTKSLIANIHRLGCTNTI---VCNYDAREFPKVIGGFDRILLDAPCSGTGVIGKD 430

Query: 335 IIDDHNKSREEGALPTQEEERQEIEGKDIKNRLAKLASFQFEIVKYAL-SFPSAKK---- 389
                                Q ++    +    ++   Q +++  A+ S  S  K    
Sbjct: 431 ---------------------QSVKVSRTEKDFMQIPHLQKQLLLSAIDSVDSNSKTGGV 469

Query: 390 LVYSTCSIHAEENERIV 406
           +VYSTCS+  +ENE +V
Sbjct: 470 IVYSTCSVAVDENEAVV 486

>SAKL0E08624g Chr5 complement(704579..706414) [1836 bp, 611 aa] {ON}
           similar to uniprot|P40991 Saccharomyces cerevisiae
           YNL061W NOP2 Probable RNA m(5)C methyltransferase
           essential for processing and maturation of 27S pre-rRNA
           and large ribosomal subunit biogenesis localized to the
           nucleolus
          Length = 611

 Score = 65.1 bits (157), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 49/197 (24%), Positives = 83/197 (42%), Gaps = 34/197 (17%)

Query: 215 YKTGKIIIQDRASCFPAHILNPSPSDVIIDACAAPGNKTTHVAAHMFLNDQPQEPLIHAF 274
           Y  G  I+Q  +S  P   L+P  ++ I+D  AAPG KTT+++A M          + A 
Sbjct: 316 YLAGHYILQAASSFLPVIALDPQENERILDMAAAPGGKTTYISALM-----KNTGCVFAN 370

Query: 275 EKDPERAKTLRTMVKTAGCSKGINIHVGDFTKLAKPSLFPNVSGFIVDPSCSGSGIFGRQ 334
           + +  R K+L   +   GC   I   V ++     P +       ++D  CSG+G+ G+ 
Sbjct: 371 DANKARTKSLIANIHRLGCHNTI---VCNYDAREFPKVIGGFDRILLDAPCSGTGVIGKD 427

Query: 335 IIDDHNKSREEGALPTQEEERQEIEGKDIKNRLAKLASFQFEIVKYALSFPSAKK----- 389
                                Q ++    +    ++   Q +++  A+    A       
Sbjct: 428 ---------------------QSVKVSRTEKDFMQIPHLQKQLILSAIDSVDAHSKTGGV 466

Query: 390 LVYSTCSIHAEENERIV 406
           +VYSTCS+  EENE +V
Sbjct: 467 IVYSTCSVAVEENEAVV 483

>KAFR0J00970 Chr10 (174873..176705) [1833 bp, 610 aa] {ON} Anc_2.247
           YNL061W
          Length = 610

 Score = 65.1 bits (157), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 49/192 (25%), Positives = 87/192 (45%), Gaps = 24/192 (12%)

Query: 215 YKTGKIIIQDRASCFPAHILNPSPSDVIIDACAAPGNKTTHVAAHMFLNDQPQEPLIHAF 274
           Y  G+ I+Q  +S  P   L+P  ++ I+D  +APG KTT+++A M          + A 
Sbjct: 317 YLAGQYILQAASSFLPVIALDPQENERILDMASAPGGKTTYISALM-----KNTGCVFAN 371

Query: 275 EKDPERAKTLRTMVKTAGCSKGINIHVGDFTKLAKPSLFPNVSGFIVDPSCSGSGIFGRQ 334
           + +  R K+L   +   GC+  I   V ++     P +       ++D  CSG+G+ G+ 
Sbjct: 372 DANKNRTKSLIANIHRLGCTNTI---VCNYDAREFPKVIGGFDRILLDAPCSGTGVIGK- 427

Query: 335 IIDDHNKSREEGALPTQEEERQEIEGKDIKNRLAKLASFQFEIVKYALSFPSAKKLVYST 394
                     + ++     E+  I+   ++ +L   A     I     +  S   +VYST
Sbjct: 428 ----------DQSVKVSRTEKDFIQIPHLQKQLLLSA-----IDSVDANSKSGGVIVYST 472

Query: 395 CSIHAEENERIV 406
           CS+  EE+E +V
Sbjct: 473 CSVAVEEDEAVV 484

>NCAS0G03030 Chr7 (556908..558380) [1473 bp, 490 aa] {ON} Anc_2.247
           YNL061W
          Length = 490

 Score = 64.7 bits (156), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 49/192 (25%), Positives = 85/192 (44%), Gaps = 24/192 (12%)

Query: 215 YKTGKIIIQDRASCFPAHILNPSPSDVIIDACAAPGNKTTHVAAHMFLNDQPQEPLIHAF 274
           Y  G  I+Q  +S  P   L+P  ++ I+D  AAPG KTT+++A M          + A 
Sbjct: 194 YLAGNYILQAASSFLPVIALDPHENERILDMAAAPGGKTTYISAMM-----KNTGCVFAN 248

Query: 275 EKDPERAKTLRTMVKTAGCSKGINIHVGDFTKLAKPSLFPNVSGFIVDPSCSGSGIFGRQ 334
           + +  R K+L   +   GC+  I   V ++     P +       ++D  CSG+G+ G+ 
Sbjct: 249 DANKNRTKSLIANIHRLGCTNTI---VCNYDAREFPKVIGGFDRILLDAPCSGTGVIGK- 304

Query: 335 IIDDHNKSREEGALPTQEEERQEIEGKDIKNRLAKLASFQFEIVKYALSFPSAKKLVYST 394
                     + ++     E+  I+   ++ +L   A     I     +      +VYST
Sbjct: 305 ----------DQSVKVSRTEKDFIQIPHLQKQLLLSA-----IDSVDCNSKHGGVIVYST 349

Query: 395 CSIHAEENERIV 406
           CS+  EE+E +V
Sbjct: 350 CSVAVEEDEAVV 361

>Ecym_3284 Chr3 (537227..539047) [1821 bp, 606 aa] {ON} similar to
           Ashbya gossypii ADL254W
          Length = 606

 Score = 64.7 bits (156), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 50/197 (25%), Positives = 85/197 (43%), Gaps = 34/197 (17%)

Query: 215 YKTGKIIIQDRASCFPAHILNPSPSDVIIDACAAPGNKTTHVAAHMFLNDQPQEPLIHAF 274
           Y  G  I+Q  +S  P   L+P  ++ I+D  AAPG KTT+++A M          + A 
Sbjct: 311 YLAGHYILQAASSFLPVIALDPQENERILDMAAAPGGKTTYISALM-----KNTGCVFAN 365

Query: 275 EKDPERAKTLRTMVKTAGCSKGINIHVGDFTKLAKPSLFPNVSGFIVDPSCSGSGIFGRQ 334
           + +  R K+L   +   GC+  I   V ++     P +       ++D  CSG+G+  + 
Sbjct: 366 DANKARTKSLIANIHRLGCTNTI---VCNYDAREFPKVIGGFDRILLDAPCSGTGVIAKD 422

Query: 335 IIDDHNKSREEGALPTQEEERQEIEGKDIKNRLAKLASFQFEIVKYAL-SFPSAKK---- 389
                                Q ++    +    ++   Q +++  A+ S  S  K    
Sbjct: 423 ---------------------QSVKVSRTEKDFMQIPHLQKQLILSAIDSVDSNSKTGGI 461

Query: 390 LVYSTCSIHAEENERIV 406
           +VYSTCS+  EENE +V
Sbjct: 462 IVYSTCSVAVEENEAVV 478

>KNAG0I01870 Chr9 complement(366800..368689) [1890 bp, 629 aa] {ON}
           Anc_2.247 YNL061W
          Length = 629

 Score = 64.7 bits (156), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 48/197 (24%), Positives = 84/197 (42%), Gaps = 34/197 (17%)

Query: 215 YKTGKIIIQDRASCFPAHILNPSPSDVIIDACAAPGNKTTHVAAHMFLNDQPQEPLIHAF 274
           Y  G  I+Q  +S  P   L+P  ++ I+D  AAPG KTT+++A M          + A 
Sbjct: 334 YLAGHYILQAASSFLPVIALDPQENERILDMAAAPGGKTTYISAMM-----KNTGCVFAN 388

Query: 275 EKDPERAKTLRTMVKTAGCSKGINIHVGDFTKLAKPSLFPNVSGFIVDPSCSGSGIFGRQ 334
           + +  R K+L   +   GC+   N  V ++     P +       ++D  CSG+G+ G+ 
Sbjct: 389 DANKNRTKSLIANIHRLGCT---NTIVCNYDAREFPKVIGGFDRILLDAPCSGTGVIGKD 445

Query: 335 IIDDHNKSREEGALPTQEEERQEIEGKDIKNRLAKLASFQFEIVKYALSFPSAKK----- 389
                                Q ++    +    ++   Q +++  A+    A       
Sbjct: 446 ---------------------QSVKVSRTEKDFIQIPHLQKQLLLSAIDSVDANSKKGGI 484

Query: 390 LVYSTCSIHAEENERIV 406
           +VYSTCS+  EE+E +V
Sbjct: 485 IVYSTCSVAVEEDEAVV 501

>KNAG0D02050 Chr4 (339873..341921) [2049 bp, 682 aa] {ON} Anc_8.171
           YBL024W
          Length = 682

 Score = 64.7 bits (156), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 73/292 (25%), Positives = 106/292 (36%), Gaps = 57/292 (19%)

Query: 218 GKIIIQDRASCFPAHILNPSPSDVIIDACAAPGNKTTHVAAHMFLNDQPQEPLIHAFEKD 277
           G I  Q+  S  P  +L   P   ++D CAAPG+KT  +   +  +       + A + D
Sbjct: 145 GNISRQEAVSMIPPIVLEVEPQHTVLDMCAAPGSKTAQLLEALHRDTDEPTGFVVANDAD 204

Query: 278 PERAKTLRTMVKTAGCSKGINI-HVGDF-------TKLAKPSLFPNVSGFIVDPSCSGSG 329
             R+  L   +K    +  I + H   F           K S        + D  CSG G
Sbjct: 205 NRRSHMLVHQLKRLNSANLIVVNHDAQFFPRIKTSKNSEKKSDLLKFDRILCDVPCSGDG 264

Query: 330 IFGRQIIDDHNKSREEGALPTQEEERQEIEGKDIKNRLAKLASFQFEIVKYALSF-PSAK 388
              + +    N  R+                 + +N L  L   Q  I+   L       
Sbjct: 265 TMRKNV----NVWRD----------------WNTQNALG-LHQVQANILNRGLHLLKKGG 303

Query: 389 KLVYSTCSIHAEENERIVIDLLLDSKVKEWGWRVR-----------KRAGAIPTWPRRGF 437
           +LVYSTCS++  ENE +V   L     ++WG +VR            R   I  WP    
Sbjct: 304 RLVYSTCSMNPIENEAVVAQAL-----RKWGDKVRLVNCDDKLPGLVRNKGISKWPTLNR 358

Query: 438 YHEFEDVFREG-----------DTAKELAEACIRVAPKEDGGIGFFAVCFER 478
             E  +  +EG           +  K   E CIRV P +    GFF   FE+
Sbjct: 359 NMEEMEKGQEGANDSWFQPTEEEAEKFQLENCIRVYPHQQNTGGFFITVFEK 410

>Smik_14.266 Chr14 (490908..492764) [1857 bp, 618 aa] {ON} YNL061W
           (REAL)
          Length = 618

 Score = 64.7 bits (156), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 57/216 (26%), Positives = 95/216 (43%), Gaps = 29/216 (13%)

Query: 215 YKTGKIIIQDRASCFPAHILNPSPSDVIIDACAAPGNKTTHVAAHMFLNDQPQEPLIHAF 274
           Y  G  I+Q  +S  P   L+P  ++ I+D  AAPG KTT+++A M          + A 
Sbjct: 322 YLAGHYILQAASSFLPVIALDPHENERILDMAAAPGGKTTYISAMM-----KNTGCVFAN 376

Query: 275 EKDPERAKTLRTMVKTAGCSKGINIHVGDFTKLAKPSLFPNVSGFIVDPSCSGSGIFGRQ 334
           + +  R K+L   +   GC+  I   V ++     P +       ++D  CSG+G+ G+ 
Sbjct: 377 DANKSRTKSLIANIHRLGCTNTI---VCNYDAREFPKVIGGFDRILLDAPCSGTGVIGK- 432

Query: 335 IIDDHNKSREEGALPTQEEERQEIEGKDIKNRLAKLASFQFEIVKYALSFPSAKKLVYST 394
                     + ++     E+  I+   ++ +L   A     I     +      +VYST
Sbjct: 433 ----------DQSVKVSRTEKDFIQIPHLQKQLLLSA-----IDSVDCNSKHGGVIVYST 477

Query: 395 CSIHAEENERIVIDLLL----DSKVKEWGWRVRKRA 426
           CS+  EE+E  VID  L    + K+ E G  + K A
Sbjct: 478 CSVAVEEDE-AVIDYALRKRPNVKLVETGLAIGKEA 512

>NCAS0B04390 Chr2 complement(795633..797648) [2016 bp, 671 aa] {ON}
           Anc_8.171 YBL024W
          Length = 671

 Score = 64.7 bits (156), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 74/294 (25%), Positives = 114/294 (38%), Gaps = 59/294 (20%)

Query: 217 TGKIIIQDRASCFPAHILNPSPSDVIIDACAAPGNKTTHVAAHMFLNDQPQEPLIHAFEK 276
            G I  Q+  S  P  +L   P   ++D CAAPG+KT  +   +  +       + A + 
Sbjct: 144 VGNISRQEAVSMIPPIVLEVEPQHTVLDMCAAPGSKTAQLIEALHKDTDEPTGFVVANDA 203

Query: 277 DPERAKTLRTMVKTAGCSKGINI-HVGDF---TKL----AKPSLFPNVSGFIVDPSCSGS 328
           D  R+  L   +K    +  + + H   F    KL     K          + D  CSG 
Sbjct: 204 DARRSHMLVHQLKRLNSANLMVVNHDAQFFPRIKLHDDAEKKRDMLKFDRILCDVPCSGD 263

Query: 329 GIFGRQIIDDHNKSREEGALPTQEEERQEIEGKDIKNRLAKLASFQFEIVKYALSF--PS 386
           G   R+ ++       +GAL                     L + Q+ I+   L    P+
Sbjct: 264 GTM-RKNVNVWKDWNAQGAL--------------------GLHTVQWNILNRGLHLLKPN 302

Query: 387 AKKLVYSTCSIHAEENERIVIDLLLDSKVKEWGWRVR-----------KRAGAIPTWPRR 435
            + LVYSTCS++  ENE +V   L     ++WG ++R            R+  I  WP  
Sbjct: 303 GR-LVYSTCSLNPIENEAVVAQAL-----RKWGNKIRLVNCDEKLPGLVRSKGISQWPVL 356

Query: 436 GFYHEFEDVFREG------DTAKELA-----EACIRVAPKEDGGIGFFAVCFER 478
               E ++   EG        ++E A     +ACIRV P +    GFF   FE+
Sbjct: 357 NRDLETKNKNDEGVLESWFPPSEEEASLFNLDACIRVYPHQQNTGGFFITVFEK 410

>TPHA0C03150 Chr3 (697508..699334) [1827 bp, 608 aa] {ON} Anc_2.247
           YNL061W
          Length = 608

 Score = 64.3 bits (155), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 47/197 (23%), Positives = 85/197 (43%), Gaps = 34/197 (17%)

Query: 215 YKTGKIIIQDRASCFPAHILNPSPSDVIIDACAAPGNKTTHVAAHMFLNDQPQEPLIHAF 274
           Y  G+ I+Q  +S  P   L+P  ++ ++D  AAPG KTT+++A M          + A 
Sbjct: 317 YLAGQYILQAASSFLPVVALDPQLNERVLDMAAAPGGKTTYISALM-----KNTGCVFAN 371

Query: 275 EKDPERAKTLRTMVKTAGCSKGINIHVGDFTKLAKPSLFPNVSGFIVDPSCSGSGIFGRQ 334
           + +  R K+L   +   GC+   N  V ++     P +       ++D  CSG+G+ G+ 
Sbjct: 372 DANKARTKSLIANIHRLGCT---NTIVCNYDAREFPKVIGGFDRILLDAPCSGTGVIGKD 428

Query: 335 IIDDHNKSREEGALPTQEEERQEIEGKDIKNRLAKLASFQFEIVKYALSFPSAKK----- 389
                                Q ++    +    ++   Q +++  A+    A       
Sbjct: 429 ---------------------QSVKVSRTEKDFIQIPHLQKQLLLSAIDSVDANSKTGGF 467

Query: 390 LVYSTCSIHAEENERIV 406
           +VYSTCS+  EE+E +V
Sbjct: 468 IVYSTCSVAVEEDEAVV 484

>Kwal_23.4841 s23 (890138..892021) [1884 bp, 627 aa] {ON} YNL061W
           (NOP2) - 90-kDa protein, located in nucleolus, that is
           homologous to a human proliferation-associated nucleolar
           protein, p120 [contig 5] FULL
          Length = 627

 Score = 63.9 bits (154), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 55/221 (24%), Positives = 93/221 (42%), Gaps = 39/221 (17%)

Query: 215 YKTGKIIIQDRASCFPAHILNPSPSDVIIDACAAPGNKTTHVAAHMFLNDQPQEPLIHAF 274
           Y  G  I+Q  +S  P   L+P  ++ I+D  AAPG KTT+++A M          + A 
Sbjct: 331 YLAGHYILQAASSFLPVIALDPHENERILDMAAAPGGKTTYISAMM-----KNTGCVFAN 385

Query: 275 EKDPERAKTLRTMVKTAGCSKGINIHVGDFTKLAKPSLFPNVSGFIVDPSCSGSGIFGRQ 334
           + +  R K+L   +   GC+  I   V ++     P +       ++D  CSG+G+  + 
Sbjct: 386 DANKARTKSLIANIHRLGCTNTI---VCNYDAREFPKVIGGFDRILLDAPCSGTGVIAKD 442

Query: 335 IIDDHNKSREEGALPTQEEERQEIEGKDIKNRLAKLASFQFEIVKYALSFPSAKK----- 389
                                Q ++    +    ++   Q +++  A+    A       
Sbjct: 443 ---------------------QSVKVSRTEKDFIQIPHLQKQLLLSAIDSVDANSKTGGV 481

Query: 390 LVYSTCSIHAEENERIVIDLLL----DSKVKEWGWRVRKRA 426
           +VYSTCS+  EENE  VID  L    + K+ + G  + K A
Sbjct: 482 IVYSTCSVAVEENE-AVIDYALRKRPNVKLVDAGLSIGKEA 521

>KLTH0G09460g Chr7 (787197..789110) [1914 bp, 637 aa] {ON} similar
           to uniprot|P40991 Saccharomyces cerevisiae YNL061W NOP2
           Probable RNA m(5)C methyltransferase essential for
           processing and maturation of 27S pre-rRNA and large
           ribosomal subunit biogenesis localized to the nucleolus
          Length = 637

 Score = 63.9 bits (154), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 48/197 (24%), Positives = 82/197 (41%), Gaps = 34/197 (17%)

Query: 215 YKTGKIIIQDRASCFPAHILNPSPSDVIIDACAAPGNKTTHVAAHMFLNDQPQEPLIHAF 274
           Y  G  I+Q  +S  P   L+P  ++ I+D  AAPG KTT+++A M          + A 
Sbjct: 333 YLAGHYILQAASSFLPVVALDPHENERILDMAAAPGGKTTYISAMM-----KNTGCVFAN 387

Query: 275 EKDPERAKTLRTMVKTAGCSKGINIHVGDFTKLAKPSLFPNVSGFIVDPSCSGSGIFGRQ 334
           + +  R K+L   +   GC+  I   V ++     P +       ++D  CSG+G+  + 
Sbjct: 388 DANKARTKSLIANIHRLGCTNTI---VCNYDAREFPKVIGGFDRILLDAPCSGTGVIAKD 444

Query: 335 IIDDHNKSREEGALPTQEEERQEIEGKDIKNRLAKLASFQFEIVKYALSFPSAKK----- 389
                                Q ++         ++   Q +++  A+    A       
Sbjct: 445 ---------------------QSVKVSRTDKDFMQIPHLQKQLLLSAIDSVDANSKTGGV 483

Query: 390 LVYSTCSIHAEENERIV 406
           +VYSTCS+  EENE +V
Sbjct: 484 IVYSTCSVAVEENEAVV 500

>CAGL0J10032g Chr10 (983405..985264) [1860 bp, 619 aa] {ON} highly
           similar to uniprot|P40991 Saccharomyces cerevisiae
           YNL061w NOP2
          Length = 619

 Score = 63.5 bits (153), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 46/197 (23%), Positives = 85/197 (43%), Gaps = 34/197 (17%)

Query: 215 YKTGKIIIQDRASCFPAHILNPSPSDVIIDACAAPGNKTTHVAAHMFLNDQPQEPLIHAF 274
           Y  G  I+Q  +S  P   L+P  ++ ++D  +APG KTT+++A M          + A 
Sbjct: 325 YLAGNYILQAASSFLPVVALDPQENERVLDMASAPGGKTTYISALM-----KNTGCVFAN 379

Query: 275 EKDPERAKTLRTMVKTAGCSKGINIHVGDFTKLAKPSLFPNVSGFIVDPSCSGSGIFGRQ 334
           + + +R K+L   +   GC+   N  V ++     P +       ++D  CSG+G+ G+ 
Sbjct: 380 DANKKRTKSLIANIHRLGCT---NTIVCNYDAREFPKVIGGFDRVLLDAPCSGTGVIGKD 436

Query: 335 IIDDHNKSREEGALPTQEEERQEIEGKDIKNRLAKLASFQFEIVKYALSFPSAKK----- 389
                                Q ++    +    ++   Q +++  A+    A       
Sbjct: 437 ---------------------QSVKVSRTEKDFIQIPHLQKQLLLSAIDSVDANSKKGGV 475

Query: 390 LVYSTCSIHAEENERIV 406
           +VYSTCS+  EE+E +V
Sbjct: 476 IVYSTCSVAVEEDEAVV 492

>Skud_14.271 Chr14 (500809..502668) [1860 bp, 619 aa] {ON} YNL061W
           (REAL)
          Length = 619

 Score = 63.5 bits (153), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 49/192 (25%), Positives = 85/192 (44%), Gaps = 24/192 (12%)

Query: 215 YKTGKIIIQDRASCFPAHILNPSPSDVIIDACAAPGNKTTHVAAHMFLNDQPQEPLIHAF 274
           Y  G  I+Q  +S  P   L+P  ++ I+D  AAPG KTT+++A M          + A 
Sbjct: 323 YLAGHYILQAASSFLPVIALDPHENERILDMAAAPGGKTTYISAMM-----KNTGCVFAN 377

Query: 275 EKDPERAKTLRTMVKTAGCSKGINIHVGDFTKLAKPSLFPNVSGFIVDPSCSGSGIFGRQ 334
           + +  R K+L   +   GC+  I   V ++     P +       ++D  CSG+G+ G+ 
Sbjct: 378 DANKSRTKSLIANIHRLGCTNTI---VCNYDAREFPKVIGGFDRILLDAPCSGTGVIGK- 433

Query: 335 IIDDHNKSREEGALPTQEEERQEIEGKDIKNRLAKLASFQFEIVKYALSFPSAKKLVYST 394
                     + ++     E+  I+   ++ +L   A     I     +      +VYST
Sbjct: 434 ----------DQSVKVSRTEKDFIQIPHLQKQLLLSA-----IDSVDCNSKHGGVIVYST 478

Query: 395 CSIHAEENERIV 406
           CS+  EE+E +V
Sbjct: 479 CSVAVEEDEAVV 490

>YNL061W Chr14 (510540..512396) [1857 bp, 618 aa] {ON}  NOP2Probable
           RNA m(5)C methyltransferase, essential for processing
           and maturation of 27S pre-rRNA and large ribosomal
           subunit biogenesis; localized to the nucleolus;
           constituent of 66S pre-ribosomal particles
          Length = 618

 Score = 63.2 bits (152), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 56/216 (25%), Positives = 95/216 (43%), Gaps = 29/216 (13%)

Query: 215 YKTGKIIIQDRASCFPAHILNPSPSDVIIDACAAPGNKTTHVAAHMFLNDQPQEPLIHAF 274
           Y  G  I+Q  +S  P   L+P  ++ I+D  AAPG KTT+++A M          + A 
Sbjct: 322 YLAGHYILQAASSFLPVIALDPHENERILDMAAAPGGKTTYISAMM-----KNTGCVFAN 376

Query: 275 EKDPERAKTLRTMVKTAGCSKGINIHVGDFTKLAKPSLFPNVSGFIVDPSCSGSGIFGRQ 334
           + +  R K+L   +   GC+  I   V ++     P +       ++D  CSG+G+ G+ 
Sbjct: 377 DANKSRTKSLIANIHRLGCTNTI---VCNYDAREFPKVIGGFDRILLDAPCSGTGVIGK- 432

Query: 335 IIDDHNKSREEGALPTQEEERQEIEGKDIKNRLAKLASFQFEIVKYALSFPSAKKLVYST 394
                     + ++     E+  I+   ++ +L   A     I     +      +VYST
Sbjct: 433 ----------DQSVKVSRTEKDFIQIPHLQKQLLLSA-----IDSVDCNSKHGGVIVYST 477

Query: 395 CSIHAEENERIVIDLLL----DSKVKEWGWRVRKRA 426
           CS+  EE+E  VID  L    + K+ + G  + K A
Sbjct: 478 CSVAVEEDE-AVIDYALRKRPNVKLVDTGLAIGKEA 512

>KNAG0G01510 Chr7 complement(341469..343469) [2001 bp, 666 aa] {ON}
           Anc_8.171 YBL024W
          Length = 666

 Score = 63.2 bits (152), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 73/290 (25%), Positives = 111/290 (38%), Gaps = 53/290 (18%)

Query: 218 GKIIIQDRASCFPAHILNPSPSDVIIDACAAPGNKTTHVAAHMFLNDQPQEPLIHAFEKD 277
           G I  Q+  S  P  +L    +  ++D CAAPG+KT  +   +  +      +I A + D
Sbjct: 159 GNISRQEAVSMIPPLLLRLESNHNVLDMCAAPGSKTAQLIEQLHKDTDEPTGIIVANDSD 218

Query: 278 PERAKTLRTMVKTAGCSK--GINIHVGDFTKLAKPSLFPNVSG----FIVDPSCSGSGIF 331
             R+  L   +K    S    +N     F  +   SL  N++      + D  CSG G  
Sbjct: 219 MRRSYLLVHQLKRLNSSNILVVNHDAQFFPNIRTNSLNNNITMKFDRILCDVPCSGDGTL 278

Query: 332 GRQIIDDHNKSREEGALPTQEEERQEIEGKDIKNRLAKLASFQFEIVKYALSFPSAKKLV 391
            R+ I+  N  R + AL     +       +I NR  +L               +  +LV
Sbjct: 279 -RKNINIWNDWRFQNALGLHRLQ------NNILNRGLQL-------------LRNGGRLV 318

Query: 392 YSTCSIHAEENERIVIDLLLDSKVKEWGWRVRK-----------RAGAIPTWP------- 433
           YSTCS++  ENE ++ + L     + W   V             R+  I +WP       
Sbjct: 319 YSTCSMNPIENEAVIANAL-----RNWAGEVSLVNFDDELPGLIRSRGISSWPVIDRNGE 373

Query: 434 --RRGFYHEFEDVF-REGDTAKEL-AEACIRVAPKEDGGIGFFAVCFERD 479
              RG     +  F    D  K    E CIRV P +     FF   FE++
Sbjct: 374 MRERGDPETLDSWFPPTADEQKTFNLEKCIRVYPHQQDTGAFFIAVFEKN 423

>NDAI0D01050 Chr4 (236435..238312) [1878 bp, 625 aa] {ON} Anc_2.247
           YNL061W
          Length = 625

 Score = 63.2 bits (152), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 49/192 (25%), Positives = 85/192 (44%), Gaps = 24/192 (12%)

Query: 215 YKTGKIIIQDRASCFPAHILNPSPSDVIIDACAAPGNKTTHVAAHMFLNDQPQEPLIHAF 274
           Y  G  I+Q  +S  P   L+P  ++ I+D  AAPG KTT+++A M          + A 
Sbjct: 329 YLAGNYILQAASSFLPVIALDPHENERILDMAAAPGGKTTYISALM-----KNTGTVFAN 383

Query: 275 EKDPERAKTLRTMVKTAGCSKGINIHVGDFTKLAKPSLFPNVSGFIVDPSCSGSGIFGRQ 334
           + +  R K+L   +   GC+  I   V ++     P +       ++D  CSG+G+ G+ 
Sbjct: 384 DANKNRTKSLIANIHRLGCTNTI---VCNYDAREFPKVIGGFDRILLDAPCSGTGVIGK- 439

Query: 335 IIDDHNKSREEGALPTQEEERQEIEGKDIKNRLAKLASFQFEIVKYALSFPSAKKLVYST 394
                     + ++     E+  I+   ++ +L   A     I     +      +VYST
Sbjct: 440 ----------DQSVKVSRTEKDFIQIPHLQKQLLLSA-----IDSVDCNSKHGGIIVYST 484

Query: 395 CSIHAEENERIV 406
           CS+  EE+E +V
Sbjct: 485 CSVAVEEDEAVV 496

>TDEL0C04150 Chr3 complement(734914..736758) [1845 bp, 614 aa] {ON}
           Anc_2.247 YNL061W
          Length = 614

 Score = 62.8 bits (151), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 55/219 (25%), Positives = 96/219 (43%), Gaps = 39/219 (17%)

Query: 215 YKTGKIIIQDRASCFPAHILNPSPSDVIIDACAAPGNKTTHVAAHMFLNDQPQEPLIHAF 274
           Y  G  I+Q  +S  P   L+P  ++ I+D  AAPG KTT+++A M          + A 
Sbjct: 319 YLAGNYILQAASSFLPVIALDPHENERILDMAAAPGGKTTYISALM-----KNTGCVFAN 373

Query: 275 EKDPERAKTLRTMVKTAGCSKGINIHVGDFTKLAKPSLFPNVSGFIVDPSCSGSGIFGRQ 334
           + +  R K+L   +   GC+  I   V ++     P +       ++D  C+G+G+ G+ 
Sbjct: 374 DANKARTKSLIANIHRLGCTNTI---VCNYDAREFPKVIGGFDRILLDAPCTGTGVIGKD 430

Query: 335 IIDDHNKSREEGALPTQEEERQEIEGKDIKNRLAKLASFQFEIVKYAL-SFPSAKK---- 389
                                Q ++    +    ++   Q +++  A+ S  S  K    
Sbjct: 431 ---------------------QSVKVSRTEKDFIQVPHLQKQLLLSAIDSVDSNSKTGGI 469

Query: 390 LVYSTCSIHAEENERIVIDLLL----DSKVKEWGWRVRK 424
           +VYSTCS+  EE+E +V+D  L    + K+ E G  + K
Sbjct: 470 IVYSTCSVAVEEDE-MVVDYALRKRPNVKLVEAGLAIGK 507

>Ecym_2353 Chr2 complement(691422..693494) [2073 bp, 690 aa] {ON}
           similar to Ashbya gossypii AFR179C
          Length = 690

 Score = 62.8 bits (151), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 70/290 (24%), Positives = 110/290 (37%), Gaps = 54/290 (18%)

Query: 217 TGKIIIQDRASCFPAHILNPSPSDVIIDACAAPGNKTTHVAAHMFLNDQPQEPLIHAFEK 276
            G I  Q+  S  P  +L   P   ++D CAAPG+KT  +   +          + A + 
Sbjct: 144 VGNISRQEAVSMIPPLLLEVEPQHTVLDMCAAPGSKTAQLIEALHAKGPEPSGFVVANDA 203

Query: 277 DPERAKTLRTMVKTAGCSKGINI-HVGDFTKLAKPSL----FPNVSGFIVDPSCSGSGIF 331
           D  R+  L   +K    +  I + H   F    K S     F      + D  CSG G  
Sbjct: 204 DYRRSHMLVHQLKRLNSANLIVVNHDAQFFPRIKTSEGSKDFLRFDRVLCDVPCSGDGTM 263

Query: 332 GRQIIDDHNKSREEGALPTQEEERQEIEGKDIKNRLAKLASFQFEIVKYALS-FPSAKKL 390
            + I    + +   G                       L + Q  I+   L+      +L
Sbjct: 264 RKNINVWKDWATASG---------------------LGLHTVQVNILNRGLNLLKDGGRL 302

Query: 391 VYSTCSIHAEENERIVIDLLLDSKVKEWGWRVRK-----------RAGAIPTWP--RRGF 437
           VYSTCS++  ENE +V      + +++WG +++            R+  I  WP   +GF
Sbjct: 303 VYSTCSLNPIENEAVVA-----AALRKWGDKIKLVECGDKLPGLIRSQGISQWPVYDKGF 357

Query: 438 -----YHEFEDVFREGDTAKELA----EACIRVAPKEDGGIGFFAVCFER 478
                  E  D      T +E++    E+C+RV P +    GFF   FE+
Sbjct: 358 NAKQRSDEGVDASWFPPTDEEISKFHLESCVRVYPHQQNTGGFFIAVFEK 407

>TBLA0A08740 Chr1 (2141750..2143810) [2061 bp, 686 aa] {ON}
           Anc_8.171 YBL024W
          Length = 686

 Score = 62.8 bits (151), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 67/293 (22%), Positives = 110/293 (37%), Gaps = 59/293 (20%)

Query: 218 GKIIIQDRASCFPAHILNPSPSDVIIDACAAPGNKTTHVAAHMFLNDQPQEPLIHAFEKD 277
           G I  Q+  S  P  +L   P   ++D CAAPG+KT  +   + + +      + A + D
Sbjct: 145 GNISRQEAVSMIPPLVLEVKPHHTVLDMCAAPGSKTAQMIEALHMENAEPTGFVVANDSD 204

Query: 278 PERAKTLRTMVKTAGCSKGINI-HVGDFTKLAKPSLFPNVSG-------FIVDPSCSGSG 329
             R+  L   +K    +  + + H   F    K S+  N +         + D  CSG G
Sbjct: 205 YRRSHMLVHQLKRLNSANMMVVNHDAQFFPRIKLSVGDNKAKDALKFDRILCDVPCSGDG 264

Query: 330 IFGRQIIDDHNKSREEGALPTQEEERQEIEGKDIKNRLAKLASFQFEIVKYALS-FPSAK 388
              + +    + + + G                       L + Q+ I+   L    +  
Sbjct: 265 TMRKNVNVWKDWNTQAG---------------------LGLHTIQYNILNRGLHLLKTGG 303

Query: 389 KLVYSTCSIHAEENERIVIDLLLDSKVKEWGWRVR-----------KRAGAIPTWP---- 433
           +LVYSTCS++  ENE +V   L     + WG +++            R+  +  WP    
Sbjct: 304 RLVYSTCSLNPIENEAVVARAL-----RTWGSKIKIINCDDKLPGLIRSNGVTQWPVFDR 358

Query: 434 -----RRGFYHEFEDVFREGD---TAKELAEACIRVAPKEDGGIGFFAVCFER 478
                 +G     E  F   D   TA  L + C+RV P +    GFF    E+
Sbjct: 359 NMESKNKGDEGTLESWFPPTDEEVTAFNL-QNCMRVYPHQQNTGGFFITVIEK 410

>Suva_14.280 Chr14 (509488..511350) [1863 bp, 620 aa] {ON} YNL061W
           (REAL)
          Length = 620

 Score = 62.4 bits (150), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 49/192 (25%), Positives = 85/192 (44%), Gaps = 24/192 (12%)

Query: 215 YKTGKIIIQDRASCFPAHILNPSPSDVIIDACAAPGNKTTHVAAHMFLNDQPQEPLIHAF 274
           Y  G  I+Q  +S  P   L+P  ++ I+D  AAPG KTT+++A M          + A 
Sbjct: 324 YLAGHYILQAASSFLPVIALDPHENERILDMAAAPGGKTTYISAMM-----KNTGCVFAN 378

Query: 275 EKDPERAKTLRTMVKTAGCSKGINIHVGDFTKLAKPSLFPNVSGFIVDPSCSGSGIFGRQ 334
           + +  R K+L   +   GC+  I   V ++     P +       ++D  CSG+G+ G+ 
Sbjct: 379 DANKSRTKSLIANIHRLGCTNTI---VCNYDAREFPKVIGGFDRILLDAPCSGTGVIGK- 434

Query: 335 IIDDHNKSREEGALPTQEEERQEIEGKDIKNRLAKLASFQFEIVKYALSFPSAKKLVYST 394
                     + ++     E+  I+   ++ +L   A     I     +      +VYST
Sbjct: 435 ----------DQSVKVSRTEKDFIQIPHLQKQLLLSA-----IDSVDCNSKHGGVIVYST 479

Query: 395 CSIHAEENERIV 406
           CS+  EE+E +V
Sbjct: 480 CSVAVEEDEAVV 491

>NCAS0B05640 Chr2 complement(1068983..1070962) [1980 bp, 659 aa]
           {ON} 
          Length = 659

 Score = 62.4 bits (150), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 67/296 (22%), Positives = 108/296 (36%), Gaps = 65/296 (21%)

Query: 218 GKIIIQDRASCFPAHILNPSPSDVIIDACAAPGNKTTHVAAHMFLNDQPQEPLIHAFEKD 277
           G I  Q+  S  P  +L   P   ++D CAAPG+KT  +   +  +       + A + D
Sbjct: 139 GNISRQEAVSMIPPIVLEVEPHHTVLDMCAAPGSKTAQLLEALHRDSNEPTGFVVANDSD 198

Query: 278 PERAKTLRTMVKTAGCSK--GINIHVGDFTKLAKPSLFPNVSGF------IVDPSCSGSG 329
             RA  L   +K    +    +N     F K+   +   N SG       + D  CSG G
Sbjct: 199 SRRAYMLVHQLKRLNSANLLVVNHDAQFFPKIKLRADATNKSGMLKYDRILCDVPCSGDG 258

Query: 330 IFGR--QIIDDHNKSREEGALPTQEEERQEIEGKDIKNRLAKLASFQFEIVKYALS-FPS 386
              +   +  D N     G                       L + Q  I+   L     
Sbjct: 259 TMRKNVNVWKDWNTQNALG-----------------------LHNVQLNILNRGLQLLKD 295

Query: 387 AKKLVYSTCSIHAEENERIVIDLLLDSKVKEWGWRVR-----------KRAGAIPTWPRR 435
             +LVYSTCS++  ENE +V      + +++WG +++            R+  I  W   
Sbjct: 296 NGRLVYSTCSLNPIENEAVVA-----AALRKWGNKIKLVDCQNKLQGLVRSNGISHW--S 348

Query: 436 GFYHEFEDVFREGDTAKEL-------------AEACIRVAPKEDGGIGFFAVCFER 478
            +  E   + ++ ++ K                E C+RV P +    GFF   FE+
Sbjct: 349 VYDREMNAITKDSESTKSSWFEPTDAEKENFNLEHCMRVYPHQQNTGGFFIAVFEK 404

>Smik_2.92 Chr2 (166201..168225) [2025 bp, 674 aa] {ON} YBL024W
           (REAL)
          Length = 674

 Score = 62.4 bits (150), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 66/294 (22%), Positives = 109/294 (37%), Gaps = 59/294 (20%)

Query: 217 TGKIIIQDRASCFPAHILNPSPSDVIIDACAAPGNKTTHVAAHMFLNDQPQEPLIHAFEK 276
            G I  Q+  S  P  +L   P   ++D CAAPG+KT  +   +  +       + A + 
Sbjct: 144 VGNISRQEAVSMIPPIVLEVKPHHTVLDMCAAPGSKTAQLIEALHKDTDEPSGFVVANDA 203

Query: 277 DPERAKTLRTMVKTAGCSKGINIHVGDFTKLAKPSLFPNVSG---------FIVDPSCSG 327
           D  R+  L   +K    S  + +   D     +  L  N S           + D  CSG
Sbjct: 204 DARRSHMLVHQLKRLN-SANLMVVNHDAQFFPRIRLHGNSSNKNDVLKFDRILCDVPCSG 262

Query: 328 SGIFGRQIIDDHNKSREEGALPTQEEERQEIEGKDIKNRLAKLASFQFEIVKYALSF-PS 386
            G   + +    + + + G                       L + Q  I+   L    +
Sbjct: 263 DGTMRKNVNVWKDWNTQAGL---------------------GLHTVQLNILNRGLHLLKN 301

Query: 387 AKKLVYSTCSIHAEENERIVIDLLLDSKVKEWGWRVRK-----------RAGAIPTWP-- 433
             +LVYSTCS++  ENE +V + L     ++WG ++R            R+  +  WP  
Sbjct: 302 NGRLVYSTCSLNPIENEAVVAEAL-----RKWGDKIRLVNCDDKLPGLIRSKGVSKWPVY 356

Query: 434 -------RRGFYHEFEDVF--REGDTAKELAEACIRVAPKEDGGIGFFAVCFER 478
                   +G     E  F   E + ++   + C+RV P +    GFF   FE+
Sbjct: 357 DRNLTEKTKGDEGTLESFFSPSEEEASRFNLQNCMRVYPHQQNTGGFFITVFEK 410

>KAFR0B02220 Chr2 complement(438809..440869) [2061 bp, 686 aa] {ON}
           Anc_8.171 YBL024W
          Length = 686

 Score = 62.0 bits (149), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 67/292 (22%), Positives = 106/292 (36%), Gaps = 57/292 (19%)

Query: 218 GKIIIQDRASCFPAHILNPSPSDVIIDACAAPGNKTTHVAAHMFLNDQPQEPLIHAFEKD 277
           G I  Q+  S  P  +L   P   ++D CAAPG+KT  +   + ++       + A + D
Sbjct: 146 GNISRQEAVSMIPPIVLEVEPQHTVLDMCAAPGSKTAQLIEALHMDTDEPTGFVVANDAD 205

Query: 278 PERAKTLRTMVKTAGCSKGINI-HVGDFTKLAKPSL-------FPNVSGFIVDPSCSGSG 329
             R+  L   +K    +  + + H   F    K S               + D  CSG G
Sbjct: 206 SRRSHMLVHQLKRLNSANLMVVNHDAQFFPRIKISNDSDKKKDLLKFDRILCDVPCSGDG 265

Query: 330 IFGRQIIDDHNKSREEGALPTQEEERQEIEGKDIKNRLAKLASFQFEIVKYALSF-PSAK 388
              + +    + + + G                       L + Q+ I+   L+   S  
Sbjct: 266 TMRKNVNVWKDWNTQSGL---------------------GLHTVQYNILNRGLNLLKSGG 304

Query: 389 KLVYSTCSIHAEENERIVIDLLLDSKVKEWGWRVR-----------KRAGAIPTWP---- 433
           +LVYSTCS++  ENE +V   L     + WG +++            R+  I  WP    
Sbjct: 305 RLVYSTCSLNPIENEAVVAQAL-----RTWGDKIKLVNCGDKLPGLVRSQGISQWPVIDR 359

Query: 434 -----RRGFYHEFEDVF--REGDTAKELAEACIRVAPKEDGGIGFFAVCFER 478
                 +G     E  F   E +      E CIRV P +    GFF    E+
Sbjct: 360 NMTEKNKGDEGTIESWFPPSEEEAKNFHLENCIRVYPHQQNTGGFFITVIEK 411

>Suva_2.97 Chr2 (172667..174679) [2013 bp, 670 aa] {ON} YBL024W
           (REAL)
          Length = 670

 Score = 62.0 bits (149), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 66/293 (22%), Positives = 110/293 (37%), Gaps = 57/293 (19%)

Query: 217 TGKIIIQDRASCFPAHILNPSPSDVIIDACAAPGNKTTHVAAHMFLNDQPQEPLIHAFEK 276
            G I  Q+  S  P  +L   P   ++D CAAPG+KT  +   +  +       + A + 
Sbjct: 144 VGNISRQEAVSMIPPIVLEVKPHHTVLDMCAAPGSKTAQLIEALHKDTDEPSGFVVANDA 203

Query: 277 DPERAKTLRTMVKTAGCSKGINI-HVGDF---TKLAKPSLFPN----VSGFIVDPSCSGS 328
           D  R+  L   +K    +  + + H   F    +L + S   N        + D  CSG 
Sbjct: 204 DARRSHMLVHQLKRLNSANLMVVNHDAQFFPRIRLHENSNKKNDVLKFDRILCDVPCSGD 263

Query: 329 GIFGRQIIDDHNKSREEGALPTQEEERQEIEGKDIKNRLAKLASFQFEIVKYALSF-PSA 387
           G   + +    + + + G                       L + Q  I+   L      
Sbjct: 264 GTMRKNVNVWKDWNTQAGL---------------------GLHTVQLNILNRGLHLLKDG 302

Query: 388 KKLVYSTCSIHAEENERIVIDLLLDSKVKEWGWRVR-----------KRAGAIPTWP--- 433
            +LVYSTCS++  ENE ++ + L     ++WG ++R            R+  +  WP   
Sbjct: 303 GRLVYSTCSLNPIENEAVIAEAL-----RKWGDKIRLVNCDDKLSGLVRSKGVSKWPVYD 357

Query: 434 ------RRGFYHEFEDVF--REGDTAKELAEACIRVAPKEDGGIGFFAVCFER 478
                  +G     E  F   E + +K   + C+RV P +    GFF   FE+
Sbjct: 358 RNLTEKTKGDEGTLESFFAPSEEEASKFNLQNCMRVYPHQQNTGGFFITVFEK 410

>KLTH0H08096g Chr8 (706261..708327) [2067 bp, 688 aa] {ON} similar
           to uniprot|P38205 Saccharomyces cerevisiae YBL024W
          Length = 688

 Score = 61.2 bits (147), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 69/290 (23%), Positives = 110/290 (37%), Gaps = 54/290 (18%)

Query: 217 TGKIIIQDRASCFPAHILNPSPSDVIIDACAAPGNKTTHVAAHMFLNDQPQEPLIHAFEK 276
            G I  Q+  S  P  +L       ++D CAAPG+KT  +   +  ++      + A + 
Sbjct: 144 VGNISRQEAVSMIPPIVLEVESHHSVLDMCAAPGSKTAQMIEALHSSEDEPTGFVVANDA 203

Query: 277 DPERAKTLRTMVKTAGCSKGINI-HVGDFTKLAKP----SLFPNVSGFIVDPSCSGSGIF 331
           D  R+  L   +K    +  + + H   F    K     + F      + D  CSG G  
Sbjct: 204 DARRSHMLVHQLKRLNSANLVVVNHDAQFFPRVKTDKETNQFLKFDRILCDVPCSGDGTM 263

Query: 332 GRQIIDDHNKSREEGALPTQEEERQEIEGKDIKNRLAKLASFQFEIVKYALSF-PSAKKL 390
            + +    N  ++ G                       L + Q  I+K  L+      +L
Sbjct: 264 RKNV----NVWKDWGTASG-----------------LGLHTVQLNILKRGLNLLKKGGRL 302

Query: 391 VYSTCSIHAEENERIVIDLLLDSKVKEWGWRVR-----------KRAGAIPTWPRRGFYH 439
           VYSTCS++  ENE +V   L     ++WG +++            R+  I  WP      
Sbjct: 303 VYSTCSMNPIENEAVVAAAL-----RQWGDKIKLVDCSDKLPGLVRSKGISNWPVIDKAF 357

Query: 440 EFEDVFREGDT-------AKELA----EACIRVAPKEDGGIGFFAVCFER 478
           E ++   EG T       A+E A    + CIRV P +    GFF    E+
Sbjct: 358 EKKEKGDEGTTESWFPPSAEEAADFHLDRCIRVYPHQQNTGGFFITVIEK 407

>Skud_2.81 Chr2 (156273..158318) [2046 bp, 681 aa] {ON} YBL024W
           (REAL)
          Length = 681

 Score = 60.8 bits (146), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 66/293 (22%), Positives = 109/293 (37%), Gaps = 59/293 (20%)

Query: 218 GKIIIQDRASCFPAHILNPSPSDVIIDACAAPGNKTTHVAAHMFLNDQPQEPLIHAFEKD 277
           G I  Q+  S  P  +L   P   ++D CAAPG+KT  +   +  +       + A + D
Sbjct: 145 GNISRQEAVSMIPPIVLEVKPHHTVLDMCAAPGSKTAQLIEALHKDTDEPSGFVVANDAD 204

Query: 278 PERAKTLRTMVKTAGCSKGINIHVGDFTKLAKPSLFPNVSG---------FIVDPSCSGS 328
             R+  L   +K    S  + +   D     +  L  N +           + D  CSG 
Sbjct: 205 ARRSHMLVHQLKRLN-SANLMVVNHDAQFFPRIRLHGNSNKKNDILKFDRILCDVPCSGD 263

Query: 329 GIFGRQIIDDHNKSREEGALPTQEEERQEIEGKDIKNRLAKLASFQFEIVKYALSF-PSA 387
           G   + +    + + + G                       L + Q  I+   L    S 
Sbjct: 264 GTMRKNVNVWKDWNTQAGL---------------------GLHTVQLNILNRGLHLLKSN 302

Query: 388 KKLVYSTCSIHAEENERIVIDLLLDSKVKEWGWRVRK-----------RAGAIPTWP--- 433
            +LVYSTCS++  ENE ++ + L     ++WG ++R            R+  +  WP   
Sbjct: 303 GRLVYSTCSLNPIENEAVIAEAL-----RKWGDKIRLVNCDDKLTGLIRSKGVSKWPVYD 357

Query: 434 ------RRGFYHEFEDVF--REGDTAKELAEACIRVAPKEDGGIGFFAVCFER 478
                  +G     E  F   E + +K   + C+RV P +    GFF   FE+
Sbjct: 358 RNLTEKNKGDEGTLESFFPPSEEEASKFNLKNCMRVYPHQQNTGGFFISVFEK 410

>YBL024W Chr2 (172534..174588) [2055 bp, 684 aa] {ON}
           NCL1S-adenosyl-L-methionine-dependent tRNA:
           m5C-methyltransferase, methylates cytosine to m5C at
           several positions in tRNAs and intron-containing
           pre-tRNAs; increases proportion of tRNALeu(CAA) with m5C
           at wobble position in response to hydrogen peroxide,
           causing selective translation of mRNA from genes
           enriched in TTG codon; loss of NCL1 confers
           hypersensitivity to oxidative stress; similar to Nop2p
           and human proliferation associated nucleolar protein
           p120
          Length = 684

 Score = 60.1 bits (144), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 65/293 (22%), Positives = 109/293 (37%), Gaps = 59/293 (20%)

Query: 218 GKIIIQDRASCFPAHILNPSPSDVIIDACAAPGNKTTHVAAHMFLNDQPQEPLIHAFEKD 277
           G I  Q+  S  P  +L   P   ++D CAAPG+KT  +   +  +       + A + D
Sbjct: 145 GNISRQEAVSMIPPIVLEVKPHHTVLDMCAAPGSKTAQLIEALHKDTDEPSGFVVANDAD 204

Query: 278 PERAKTLRTMVKTAGCSKGINIHVGDFTKLAKPSLFPNVSG---------FIVDPSCSGS 328
             R+  L   +K    S  + +   D     +  L  N +           + D  CSG 
Sbjct: 205 ARRSHMLVHQLKRLN-SANLMVVNHDAQFFPRIRLHGNSNNKNDVLKFDRILCDVPCSGD 263

Query: 329 GIFGRQIIDDHNKSREEGALPTQEEERQEIEGKDIKNRLAKLASFQFEIVKYALSF-PSA 387
           G   + +    + + + G                       L + Q  I+   L    + 
Sbjct: 264 GTMRKNVNVWKDWNTQAGL---------------------GLHAVQLNILNRGLHLLKNN 302

Query: 388 KKLVYSTCSIHAEENERIVIDLLLDSKVKEWGWRVRK-----------RAGAIPTWP--- 433
            +LVYSTCS++  ENE +V + L     ++WG ++R            R+  +  WP   
Sbjct: 303 GRLVYSTCSLNPIENEAVVAEAL-----RKWGDKIRLVNCDDKLPGLIRSKGVSKWPVYD 357

Query: 434 ------RRGFYHEFEDVF--REGDTAKELAEACIRVAPKEDGGIGFFAVCFER 478
                  +G     +  F   E + +K   + C+RV P +    GFF   FE+
Sbjct: 358 RNLTEKTKGDEGTLDSFFSPSEEEASKFNLQNCMRVYPHQQNTGGFFITVFEK 410

>TPHA0C02870 Chr3 (620913..622937) [2025 bp, 674 aa] {ON} Anc_8.171
           YBL024W
          Length = 674

 Score = 60.1 bits (144), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 64/296 (21%), Positives = 114/296 (38%), Gaps = 63/296 (21%)

Query: 217 TGKIIIQDRASCFPAHILNPSPSDVIIDACAAPGNKTTHVAAHMFLNDQPQEPLIHAFEK 276
            G I  Q+  S  P  +L    +  ++D CAAPG+KT  +   +  N+     ++ A + 
Sbjct: 143 VGNISRQEAVSMIPPILLEVESNHTVLDMCAAPGSKTAQLIEALHTNEDEPTGIVVANDA 202

Query: 277 DPERAKTLRTMVKTAGCSK--GINIHVGDFTKLA------KPSLFPNVSGFIVDPSCSGS 328
           D  R+  L   +K    +    +N     F ++A        + F      + D  CSG 
Sbjct: 203 DARRSHMLVHQLKRLNSANLMVVNHDAQFFPRIALHENTTDSNDFLKFDRILCDVPCSGD 262

Query: 329 GIFGRQIIDDHNKSREEGALPTQEEERQEIEGKDIKNRLAKLASFQFEIVKYALSFPSAK 388
           G   R+ ++       +G L                     L + Q  I+   L     K
Sbjct: 263 GTM-RKNVNVWRDWTSQGGL--------------------GLHNIQLNILNRGLHLLKPK 301

Query: 389 -KLVYSTCSIHAEENERIVIDLLLDSKVKEWGWRVR-----------KRAGAIPTWPRRG 436
            +LVYSTCS++  ENE ++      + +++WG ++R            R+  I +WP   
Sbjct: 302 GRLVYSTCSMNPIENEAVIA-----AALRKWGSKIRVINCDEKLPGLVRSKGIDSWP--- 353

Query: 437 FYHEFEDVFREGDT--------------AKELAEACIRVAPKEDGGIGFFAVCFER 478
            ++   ++ ++GD               ++   + CIRV P +     FF    E+
Sbjct: 354 VFNRDMEIRQKGDQGVSNTWFPPSEEEKSQFNLQNCIRVYPHQQNTGAFFITVIEK 409

>CAGL0K01991g Chr11 (173969..175987) [2019 bp, 672 aa] {ON} highly
           similar to uniprot|P38205 Saccharomyces cerevisiae
           YBL024w NCL1 tRNA (cytosine-5-)-methyltransferase
          Length = 672

 Score = 59.7 bits (143), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 70/287 (24%), Positives = 106/287 (36%), Gaps = 57/287 (19%)

Query: 217 TGKIIIQDRASCFPAHILNPSPSDVIIDACAAPGNKTTHVAAHMFLNDQPQEPLIHAFEK 276
            G I  Q+  S  P  +L   P   ++D CAAPG+KTT +   +  +       + A + 
Sbjct: 142 VGNISRQEAVSMIPPIVLEVEPHHTVLDMCAAPGSKTTQMIEALHKDTDEPTGFVVANDA 201

Query: 277 DPERAKTLRTMVKTAGCSKGINI-HVGDFTKLAKPSLFPN-------VSGFIVDPSCSGS 328
           D  R+  L   +K    +  + + H   F      S  P+           + D  CSG 
Sbjct: 202 DSRRSHMLVHQLKRLNSANLMVVNHDAQFFPRIILSDEPSKKKAQLKFDRILCDVPCSGD 261

Query: 329 GIFGRQIIDDHNKSREEGALPTQEEERQEIEGKDIKNRLAKLASFQFEIVKYALSF-PSA 387
           G   R+ ++       +GAL                     L + Q  I+   L    + 
Sbjct: 262 GTM-RKNVNVWKDWNTQGAL--------------------GLHTVQLNILDRGLHLLQNN 300

Query: 388 KKLVYSTCSIHAEENERIVIDLLLDSKVKEWGWRVRK-----------RAGAIPTWPRRG 436
            +LVYSTCS++  ENE +V + L     + WG +VR            R+  I  WP   
Sbjct: 301 GRLVYSTCSMNPIENEAVVAEAL-----RRWGDKVRLVDCSEKLPGLIRSQGITQWPVID 355

Query: 437 FYHEFEDVFREG-----------DTAKELAEACIRVAPKEDGGIGFF 472
              E      EG           + +K   E C+RV P +    GFF
Sbjct: 356 RNMEERKKEDEGMINSWFPPSEEEVSKFHLERCMRVYPHQQNTGGFF 402

>KLLA0F12562g Chr6 (1163366..1165480) [2115 bp, 704 aa] {ON} highly
           similar to uniprot|P38205 Saccharomyces cerevisiae
           YBL024W
          Length = 704

 Score = 56.6 bits (135), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 69/297 (23%), Positives = 110/297 (37%), Gaps = 66/297 (22%)

Query: 218 GKIIIQDRASCFPAHILNPSPSDVIIDACAAPGNKTTHVAAHMFLNDQPQEPLIHAFEKD 277
           G I  Q+  S  P  +L+  P   ++D CAAPG+KT  +   +          + A + D
Sbjct: 145 GNISRQEAVSMIPPIVLDVKPHHYVLDMCAAPGSKTAQLIEALHAESDEPSGFVIANDAD 204

Query: 278 PERAKTLRTMVKTAGCSKGINI-HVGDF--------TKLAKPSLFPNVSGFIVDPSCSGS 328
            +R+  L   +K    +  + + H   F        T+ +K   F      + D  CSG 
Sbjct: 205 YKRSHMLVHQLKRLNSANLMVVNHDAQFFPRIKVDSTEGSKGPQFLKFDRVLCDVPCSGD 264

Query: 329 GIFGR--QIIDDHNKSREEGALPTQEEERQEIEGKDIKNRLAKLASFQFEIVKYALS-FP 385
           G   +   +  D N     G                       L   Q  I++  L+   
Sbjct: 265 GTMRKNVNVWKDWNTGSGLG-----------------------LHIVQLNILERGLNLLK 301

Query: 386 SAKKLVYSTCSIHAEENERIVIDLLLDSKVKEWGWRVR-----------KRAGAIPTWP- 433
              KLVYSTCS++  ENE ++      + ++ WG +VR            R+  I  W  
Sbjct: 302 EGGKLVYSTCSLNPIENEAVIA-----AALRRWGDKVRLVNCDDQLPGLVRSKGITEWKV 356

Query: 434 --------RRGFYHEFEDVFREGDTAKELA----EACIRVAPKEDGGIGFFAVCFER 478
                    +G  +  +  F    TA+E+     E C+RV   +    GFF   FE+
Sbjct: 357 YDKQFQVREKGHENCLDSWF--PPTAEEVEKFHLENCMRVYQHQQNTGGFFITVFEK 411

>NDAI0B02980 Chr2 complement(757926..759965) [2040 bp, 679 aa] {ON} 
          Length = 679

 Score = 54.7 bits (130), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 68/295 (23%), Positives = 108/295 (36%), Gaps = 60/295 (20%)

Query: 217 TGKIIIQDRASCFPAHILNPSPSDVIIDACAAPGNKTTHVAAHMFLNDQPQEPLIHAFEK 276
            G I  Q+  S  P  +L+  P   ++D CAAPG+KT  +   + ++       + A + 
Sbjct: 138 VGNISRQEAVSMIPPIVLDVKPHHTVLDMCAAPGSKTAQLIEALHMDGPEPSGFVVANDS 197

Query: 277 DPERAKTLRTMVKTAGCSK--GINIHVGDFTKLAKPS-------LFPNVSGFIVDPSCSG 327
           D +R+  L   +K    +    +N     F K+   S        +      + D  CSG
Sbjct: 198 DSKRSHMLVHQLKRLNSANLMVVNHDAQFFPKIQLDSNKGRHNKEYLKFDRILCDVPCSG 257

Query: 328 SGIFGR--QIIDDHNKSREEGALPTQEEERQEIEGKDIKNRLAKLASFQFEIVKYALSFP 385
            G   +   I  D N     G    Q          +I NR  +L               
Sbjct: 258 DGTIRKNVNIWKDWNTQNSLGLHNVQ---------LNILNRGIQL-------------LK 295

Query: 386 SAKKLVYSTCSIHAEENERIVIDLLLDSKVKEWGWRVR------KRAGAI--PTWPRRGF 437
           S  +LVYSTCS+   ENE ++      + +++WG +++         G I  P   +   
Sbjct: 296 SGGRLVYSTCSLSPIENEAVI-----SATLRKWGNKIKLVDCKEMLPGLISSPGISKWEV 350

Query: 438 YHEFEDVFREG-----DTAKELAEA---------CIRVAPKEDGGIGFFAVCFER 478
           Y     +  +G     DT  +  E          CIRV P +    GFF    E+
Sbjct: 351 YDRTMSIVSKGAEKSKDTWFQPTEEEANDFNLSHCIRVFPHQQNTGGFFIAVLEK 405

>Kwal_14.2081 s14 (598648..599463) [816 bp, 272 aa] {ON} YBL024W
           (NCL1) - Probable proliferating-cell nucleolar antigen
           (human p120) [contig 230] PARTIAL
          Length = 272

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 29/124 (23%), Positives = 48/124 (38%), Gaps = 5/124 (4%)

Query: 217 TGKIIIQDRASCFPAHILNPSPSDVIIDACAAPGNKTTHVAAHMFLNDQPQEPLIHAFEK 276
            G I  Q+  S  P  +L   P   ++D CAAPG+KT  +   +   +      + A + 
Sbjct: 144 VGNISRQEAVSMIPPIVLEVEPHHAVLDMCAAPGSKTAQMIEALHATEDEPTGFVVANDA 203

Query: 277 DPERAKTLRTMVKTAGCSKGINI-HVGDFTKLAK----PSLFPNVSGFIVDPSCSGSGIF 331
           D  R+  L   +K    +  + + H   F    K     + F      + D  CSG G  
Sbjct: 204 DARRSHMLVHQLKRLNSANLMVVNHDAQFFPRVKLDNDSNQFLKFDRVLCDVPCSGDGTM 263

Query: 332 GRQI 335
            + +
Sbjct: 264 RKNV 267

>Smik_6.474 Chr6 complement(781184..782140) [957 bp, 318 aa] {ON}
           YPL266W (REAL)
          Length = 318

 Score = 35.4 bits (80), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 30/73 (41%), Gaps = 8/73 (10%)

Query: 238 PSDVIIDACAAPGNKTTHVAAHMFLNDQPQEPLIHAFEKDPERAKTLRTMVKTAGCSKGI 297
           PSDV+++     GN T  +          Q   + A E DP  A  L   V+     K +
Sbjct: 56  PSDVVLEVGPGTGNLTVRILE--------QAKSVVAVEMDPRMAAELTKRVRGTQVEKKL 107

Query: 298 NIHVGDFTKLAKP 310
            I +GDF K   P
Sbjct: 108 EIMLGDFMKTELP 120

>Skud_16.11 Chr16 (18214..19170) [957 bp, 318 aa] {ON} YPL266W
           (REAL)
          Length = 318

 Score = 34.7 bits (78), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 30/73 (41%), Gaps = 8/73 (10%)

Query: 238 PSDVIIDACAAPGNKTTHVAAHMFLNDQPQEPLIHAFEKDPERAKTLRTMVKTAGCSKGI 297
           PSDV+++     GN T  +          Q   + A E DP  A  L   V+     K +
Sbjct: 56  PSDVVLEVGPGTGNLTVRILE--------QAKNVVAVEMDPRMAAELTKRVRGTPVEKKL 107

Query: 298 NIHVGDFTKLAKP 310
            I +GDF K   P
Sbjct: 108 EIMLGDFMKTELP 120

>YPL266W Chr16 (39121..40077) [957 bp, 318 aa] {ON}  DIM1Essential
           18S rRNA dimethylase (dimethyladenosine transferase),
           responsible for conserved m6(2)Am6(2)A dimethylation in
           3'-terminal loop of 18S rRNA, part of 90S and 40S
           pre-particles in nucleolus, involved in pre-ribosomal
           RNA processing
          Length = 318

 Score = 34.7 bits (78), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 30/73 (41%), Gaps = 8/73 (10%)

Query: 238 PSDVIIDACAAPGNKTTHVAAHMFLNDQPQEPLIHAFEKDPERAKTLRTMVKTAGCSKGI 297
           PSDV+++     GN T  +          Q   + A E DP  A  L   V+     K +
Sbjct: 56  PSDVVLEVGPGTGNLTVRILE--------QAKNVVAVEMDPRMAAELTKRVRGTPVEKKL 107

Query: 298 NIHVGDFTKLAKP 310
            I +GDF K   P
Sbjct: 108 EIMLGDFMKTELP 120

>Suva_16.39 Chr16 (54705..55661) [957 bp, 318 aa] {ON} YPL266W
           (REAL)
          Length = 318

 Score = 34.7 bits (78), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 30/73 (41%), Gaps = 8/73 (10%)

Query: 238 PSDVIIDACAAPGNKTTHVAAHMFLNDQPQEPLIHAFEKDPERAKTLRTMVKTAGCSKGI 297
           PSDV+++     GN T  +          Q   + A E DP  A  L   V+     K +
Sbjct: 56  PSDVVLEVGPGTGNLTVRILE--------QAKNVVAVEMDPRMAAELTKRVRGTPVEKKL 107

Query: 298 NIHVGDFTKLAKP 310
            I +GDF K   P
Sbjct: 108 EILLGDFMKTELP 120

>Ecym_3003 Chr3 complement(6934..7893) [960 bp, 319 aa] {ON} similar
           to Ashbya gossypii ACR026W
          Length = 319

 Score = 33.9 bits (76), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 31/73 (42%), Gaps = 8/73 (10%)

Query: 238 PSDVIIDACAAPGNKTTHVAAHMFLNDQPQEPLIHAFEKDPERAKTLRTMVKTAGCSKGI 297
           PSD++++     GN TT +          +   + A E DP  A  L   V      K +
Sbjct: 56  PSDIVLEVGPGTGNLTTRILE--------KARKVVAVEFDPRMAAELTKRVHGTAAEKKL 107

Query: 298 NIHVGDFTKLAKP 310
            I +GDFTK   P
Sbjct: 108 EIILGDFTKTELP 120

>SAKL0E00660g Chr5 complement(42779..43747) [969 bp, 322 aa] {ON}
           highly similar to uniprot|P41819 Saccharomyces
           cerevisiae YPL266W DIM1 Essential 18S rRNA dimethylase
           responsible for conserved m6(2)Am6(2)A dimethylation in
           3'- terminal loop of 18 S rRNA part of 90S and 40S pre-
           particles in nucleolus involved in pre-ribosomal RNA
           processing
          Length = 322

 Score = 33.9 bits (76), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 29/73 (39%), Gaps = 8/73 (10%)

Query: 238 PSDVIIDACAAPGNKTTHVAAHMFLNDQPQEPLIHAFEKDPERAKTLRTMVKTAGCSKGI 297
           PSDV+++     GN T  +          Q   + A E DP  A  L   V      K +
Sbjct: 57  PSDVVLEVGPGTGNLTVRILE--------QARRVVAVEMDPRMAAELTKRVHGTAAEKKL 108

Query: 298 NIHVGDFTKLAKP 310
            I +GDF K   P
Sbjct: 109 EILLGDFMKTELP 121

>Kpol_449.12 s449 complement(42834..43793) [960 bp, 319 aa] {ON}
           complement(42834..43793) [960 nt, 320 aa]
          Length = 319

 Score = 33.5 bits (75), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 30/76 (39%), Gaps = 8/76 (10%)

Query: 235 NPSPSDVIIDACAAPGNKTTHVAAHMFLNDQPQEPLIHAFEKDPERAKTLRTMVKTAGCS 294
           N  PSD++++     GN T  +          Q   + A E DP  A  L   V      
Sbjct: 54  NIKPSDIVLEVGPGTGNLTVRILE--------QARKVVAVEMDPRMAAELTKRVHGTPAE 105

Query: 295 KGINIHVGDFTKLAKP 310
           K + I +GDF K   P
Sbjct: 106 KKLEIMLGDFMKTELP 121

>KNAG0H02460 Chr8 complement(450266..453040) [2775 bp, 924 aa] {ON}
           Anc_5.215 YLL003W
          Length = 924

 Score = 33.1 bits (74), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 33/135 (24%), Positives = 57/135 (42%), Gaps = 17/135 (12%)

Query: 273 AFEKDPERAKTLRTMVKTAGCSKG--INIHVGDFTKLAKPSLFPNVSGFIVDPS---CSG 327
           A  +D ERA++   +  T     G  IN+      + +   L  +V G I + S    S 
Sbjct: 8   ALFRDGERAESRNGVPDTIDLVTGGLINVSTERLLQESLTGLLGSVIGGIDEESRGYISD 67

Query: 328 SGIFGRQIIDDHNKSREEGALPTQEEERQEIEGKDIKNRLAKLASFQFEIVKYALSFPSA 387
           + + GR++ +D   S  +  +PT  +E    EG      L K   FQ   V++ L     
Sbjct: 68  TDVVGRRLFEDLKVSSADDEIPTTGQEESRYEG------LPKDTMFQIRQVEHVL----- 116

Query: 388 KKLVYSTCSIHAEEN 402
            +++Y+T  +    N
Sbjct: 117 -EMLYNTIQVFLLRN 130

>KNAG0L02440 Chr12 (434232..435185) [954 bp, 317 aa] {ON} Anc_6.1
           YPL266W
          Length = 317

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 33/80 (41%), Gaps = 11/80 (13%)

Query: 231 AHILNPSPSDVIIDACAAPGNKTTHVAAHMFLNDQPQEPLIHAFEKDPERAKTLRTMVKT 290
           AHI    PSD++++     GN T  +          +   + A E DP  A  L   V  
Sbjct: 52  AHI---KPSDIVLEVGPGTGNLTVRILE--------KAKKVVAVEMDPRMAAELTKRVHG 100

Query: 291 AGCSKGINIHVGDFTKLAKP 310
               K ++I +GDF K   P
Sbjct: 101 TPAEKKLDIMLGDFMKTELP 120

>KAFR0B06650 Chr2 complement(1386066..1387784) [1719 bp, 572 aa]
           {ON} Anc_6.174 YGL095C
          Length = 572

 Score = 33.1 bits (74), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 31/110 (28%), Positives = 57/110 (51%), Gaps = 20/110 (18%)

Query: 133 KVTDLHQLLKD-----DRNDMTPVRWF------RINPVRCHGKHEEVMAELAKKFPTRVD 181
           K+ ++ ++LK+     D N +  +R F      R+       K +++++ELAKKF TR+D
Sbjct: 416 KINEVFEILKNFLPIEDINYLHKIRSFYDKRSTRVESSTSSNK-DDLLSELAKKFNTRMD 474

Query: 182 SWKDV-VPGSIYHDEYIPNLFGV---HPGDKITSHE---LYKTGKIIIQD 224
           ++K   V  ++Y  ++IP L  +      +K+++ E   L K     IQD
Sbjct: 475 AYKKTNVSNNVYM-QHIPKLSNILTDLSNNKLSTEEFPFLNKQATAQIQD 523

>CAGL0L07678g Chr12 complement(846285..847238) [954 bp, 317 aa] {ON}
           highly similar to uniprot|P41819 Saccharomyces
           cerevisiae YPL266w DIM1
          Length = 317

 Score = 32.7 bits (73), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 29/73 (39%), Gaps = 8/73 (10%)

Query: 238 PSDVIIDACAAPGNKTTHVAAHMFLNDQPQEPLIHAFEKDPERAKTLRTMVKTAGCSKGI 297
           PSD++++     GN T  +          Q   + A E DP  A  L   V      K +
Sbjct: 56  PSDIVLEVGPGTGNLTVRILE--------QARKVVAVEMDPRMAAELTKRVHGTPAEKKL 107

Query: 298 NIHVGDFTKLAKP 310
            I +GDF K   P
Sbjct: 108 EIMLGDFMKTELP 120

>KAFR0B06450 Chr2 complement(1337903..1338859) [957 bp, 318 aa] {ON}
           Anc_6.1 YPL266W
          Length = 318

 Score = 32.7 bits (73), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 30/76 (39%), Gaps = 8/76 (10%)

Query: 235 NPSPSDVIIDACAAPGNKTTHVAAHMFLNDQPQEPLIHAFEKDPERAKTLRTMVKTAGCS 294
           N  PSDV+++     GN T  +          Q   + A E DP  A  L   V      
Sbjct: 53  NIKPSDVVLEVGPGTGNLTVRILE--------QARKVVAVEMDPRMAAELTKRVHGTPAE 104

Query: 295 KGINIHVGDFTKLAKP 310
           + + I +GDF K   P
Sbjct: 105 RKLEIILGDFMKTELP 120

>TBLA0A07080 Chr1 complement(1748948..1749913) [966 bp, 321 aa] {ON}
           Anc_6.1 YPL266W
          Length = 321

 Score = 32.0 bits (71), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 30/73 (41%), Gaps = 8/73 (10%)

Query: 238 PSDVIIDACAAPGNKTTHVAAHMFLNDQPQEPLIHAFEKDPERAKTLRTMVKTAGCSKGI 297
           PSD++++     GN T  +          Q   + A E DP  A  L   V      K +
Sbjct: 57  PSDIVLEVGPGTGNLTVRILE--------QARKVIAVEFDPRMAAELTKRVHGTPAEKKL 108

Query: 298 NIHVGDFTKLAKP 310
           +I +GDF K   P
Sbjct: 109 DIILGDFMKTELP 121

>TPHA0J00200 Chr10 complement(47344..48303) [960 bp, 319 aa] {ON}
           Anc_6.1 YPL266W
          Length = 319

 Score = 32.0 bits (71), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 30/73 (41%), Gaps = 8/73 (10%)

Query: 238 PSDVIIDACAAPGNKTTHVAAHMFLNDQPQEPLIHAFEKDPERAKTLRTMVKTAGCSKGI 297
           PSD++++     GN T  +          Q   + A E DP  A  L   V      K +
Sbjct: 57  PSDIVLEVGPGTGNLTVRILE--------QARKVVAVEMDPRMAAELTKRVHGTPGEKKL 108

Query: 298 NIHVGDFTKLAKP 310
           +I +GDF K   P
Sbjct: 109 DILLGDFMKTDLP 121

>KLTH0C11704g Chr3 (966706..967674) [969 bp, 322 aa] {ON} highly
           similar to uniprot|P41819 Saccharomyces cerevisiae
           YPL266W DIM1 Essential 18S rRNA dimethylase responsible
           for conserved m6(2)Am6(2)A dimethylation in 3'- terminal
           loop of 18 S rRNA part of 90S and 40S pre- particles in
           nucleolus involved in pre-ribosomal RNA processing
          Length = 322

 Score = 32.0 bits (71), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 29/73 (39%), Gaps = 8/73 (10%)

Query: 238 PSDVIIDACAAPGNKTTHVAAHMFLNDQPQEPLIHAFEKDPERAKTLRTMVKTAGCSKGI 297
           PSDV+++     GN T  +          Q   + A E DP     L   V      K +
Sbjct: 57  PSDVVLEVGPGTGNLTVRILE--------QARKVIAVEMDPRMGAELTKRVHGTAGEKKL 108

Query: 298 NIHVGDFTKLAKP 310
           +I +GDF K   P
Sbjct: 109 DILLGDFMKTDLP 121

>ZYRO0B11836g Chr2 (940987..943299) [2313 bp, 770 aa] {ON} highly
           similar to uniprot|P06839 Saccharomyces cerevisiae
           YER171W RAD3 5' to 3' DNA helicase involved in
           nucleotide excision repair and transcription subunit of
           RNA polymerase II transcription initiation factor TFIIH
           subunit of Nucleotide Excision Repair Factor 3 (NEF3)
           homolog of human XPD protein
          Length = 770

 Score = 32.0 bits (71), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 30/56 (53%), Gaps = 4/56 (7%)

Query: 368 AKLASFQFEIVKYALSFPSAKKLVYSTCSIHAEENERIVIDL--LLDSKVKEWGWR 421
            K  S     + Y + +P  +K++Y  CS    E E+ +++L  L+D + KE G+R
Sbjct: 47  GKTVSLLSLTIAYQMHYPEHRKIIY--CSRTMSEIEKALVELENLMDYRTKELGYR 100

>ACR026W Chr3 (404011..404970) [960 bp, 319 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL266W (DIM1)
          Length = 319

 Score = 31.6 bits (70), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 29/73 (39%), Gaps = 8/73 (10%)

Query: 238 PSDVIIDACAAPGNKTTHVAAHMFLNDQPQEPLIHAFEKDPERAKTLRTMVKTAGCSKGI 297
           PSD++++     GN T  +          Q   + A E DP  A  L   V      K +
Sbjct: 56  PSDIVLEVGPGTGNLTVRILE--------QARKVVAVEFDPRMAAELTKRVHGTPAEKKL 107

Query: 298 NIHVGDFTKLAKP 310
            I +GDF K   P
Sbjct: 108 EIMLGDFMKTELP 120

>Kwal_56.22317 s56 complement(43543..44631) [1089 bp, 362 aa] {ON}
           YPL266W (DIM1) - dimethyladenosine transferase [contig
           186] FULL
          Length = 362

 Score = 31.6 bits (70), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 29/73 (39%), Gaps = 8/73 (10%)

Query: 238 PSDVIIDACAAPGNKTTHVAAHMFLNDQPQEPLIHAFEKDPERAKTLRTMVKTAGCSKGI 297
           PSDV+++     GN T  +          Q   + A E DP     L   V      K +
Sbjct: 97  PSDVVLEVGPGTGNLTVRILE--------QARKVIAVEMDPRMGAELTKRVHGTSGEKKL 148

Query: 298 NIHVGDFTKLAKP 310
           +I +GDF K   P
Sbjct: 149 DILLGDFMKTDLP 161

>NCAS0D02250 Chr4 (419581..420540) [960 bp, 319 aa] {ON} Anc_6.1
           YPL266W
          Length = 319

 Score = 31.6 bits (70), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 29/73 (39%), Gaps = 8/73 (10%)

Query: 238 PSDVIIDACAAPGNKTTHVAAHMFLNDQPQEPLIHAFEKDPERAKTLRTMVKTAGCSKGI 297
           PSD++++     GN T  +          Q   + A E DP  A  L   V      K +
Sbjct: 57  PSDIVLEVGPGTGNLTVRILE--------QARKVVAVEMDPRMAAELTKRVHGTPSEKKL 108

Query: 298 NIHVGDFTKLAKP 310
            I +GDF K   P
Sbjct: 109 EILLGDFMKTDLP 121

>NDAI0I02710 Chr9 (636403..637362) [960 bp, 319 aa] {ON} Anc_6.1
           YPL266W
          Length = 319

 Score = 31.6 bits (70), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 29/73 (39%), Gaps = 8/73 (10%)

Query: 238 PSDVIIDACAAPGNKTTHVAAHMFLNDQPQEPLIHAFEKDPERAKTLRTMVKTAGCSKGI 297
           PSD++++     GN T  +          Q   + A E DP  A  L   V      K +
Sbjct: 57  PSDIVLEVGPGTGNLTVRILE--------QARNVIAVEMDPRMAAELTKRVHGTPGEKKL 108

Query: 298 NIHVGDFTKLAKP 310
            I +GDF K   P
Sbjct: 109 EIMLGDFMKTELP 121

>KLLA0D00594g Chr4 complement(57894..58856) [963 bp, 320 aa] {ON}
           highly similar to uniprot|P41819 Saccharomyces
           cerevisiae YPL266W DIM1 Essential 18S rRNA dimethylase
           responsible for conserved m6(2)Am6(2)A dimethylation in
           3'- terminal loop of 18 S rRNA part of 90S and 40S pre-
           particles in nucleolus involved in pre-ribosomal RNA
           processing
          Length = 320

 Score = 30.8 bits (68), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 29/73 (39%), Gaps = 8/73 (10%)

Query: 238 PSDVIIDACAAPGNKTTHVAAHMFLNDQPQEPLIHAFEKDPERAKTLRTMVKTAGCSKGI 297
           PSD++++     GN T  +          Q   + A E DP  A  L   V      K +
Sbjct: 57  PSDIVLEIGPGTGNLTVRILE--------QARKVVAVEFDPRMAAELTKRVHGTPVEKKL 108

Query: 298 NIHVGDFTKLAKP 310
            I +GDF K   P
Sbjct: 109 EILLGDFMKTELP 121

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.137    0.419 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 51,814,015
Number of extensions: 2273437
Number of successful extensions: 6045
Number of sequences better than 10.0: 92
Number of HSP's gapped: 6028
Number of HSP's successfully gapped: 109
Length of query: 479
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 366
Effective length of database: 40,524,141
Effective search space: 14831835606
Effective search space used: 14831835606
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 68 (30.8 bits)