Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_27.115282.287ON36736719480.0
KLTH0G10384g2.287ON36736718460.0
SAKL0E07656g2.287ON36836817200.0
NCAS0B062502.287ON37337315990.0
TDEL0G021802.287ON36936915930.0
Suva_9.1052.287ON37135315730.0
KLLA0E08339g2.287ON36936815660.0
NDAI0B035502.287ON37237215660.0
YIL094C (LYS12)2.287ON37135315660.0
KNAG0A054202.287ON37237115610.0
Smik_9.852.287ON37137115530.0
ZYRO0A01914g2.287ON36836815520.0
Skud_9.792.287ON37135315520.0
CAGL0G02585g2.287ON37237215230.0
KAFR0J013602.287ON37337215140.0
Kpol_1003.392.287ON37037014940.0
TBLA0B059402.287ON36936914910.0
TPHA0C034102.287ON37137114790.0
Ecym_33262.287ON36636814660.0
ADL214C2.287ON36736713990.0
KLLA0E03125g5.473ON3683594472e-51
KLTH0F15048g5.473ON3683604447e-51
ADL223W2.278ON3623804402e-50
Ecym_23135.473ON3703574378e-50
Kwal_55.212735.473ON3683604324e-49
Ecym_33162.278ON3623804262e-48
TPHA0J027705.473ON3763664272e-48
Suva_8.1885.473ON3693974245e-48
CAGL0I07227g5.473ON3683644245e-48
NDAI0C014105.473ON3693584239e-48
NCAS0H022505.473ON4223644269e-48
Smik_14.2902.278ON3603514202e-47
Kpol_543.85.473ON3683584212e-47
TBLA0B022405.473ON3733584212e-47
SAKL0G03520g5.473ON3693964193e-47
KAFR0B063705.473ON3783644193e-47
Skud_14.2932.278ON3613514184e-47
Smik_15.3165.473ON3693914184e-47
AFR137C5.473ON3673904185e-47
TPHA0D015602.278ON3603774167e-47
Skud_15.3005.473ON3693644151e-46
YNL037C (IDH1)2.278ON3603514142e-46
KNAG0B040705.473ON3733584142e-46
SAKL0E07876g2.278ON3613804123e-46
KLTH0G10186g2.278ON3603804123e-46
Kwal_23.50122.278ON3613804113e-46
TPHA0E014805.473ON3773574109e-46
YOR136W (IDH2)5.473ON3693974091e-45
KLLA0F04103g2.278ON3613504011e-44
TDEL0A033705.473ON3713634021e-44
Kpol_1039.352.278ON3593783992e-44
TBLA0C015001.402ON3653684002e-44
Kpol_440.125.473ON3683573992e-44
NDAI0B035902.278ON3593553959e-44
TDEL0C038402.278ON3613833959e-44
NCAS0B062902.278ON3593533922e-43
ZYRO0D11220g5.473ON3683573922e-43
KAFR0J014102.278ON3503813904e-43
CAGL0G02673g2.278ON3583793712e-40
TDEL0B060001.402ON3623673712e-40
KNAG0A052802.278ON3613543712e-40
TBLA0B069102.278ON3653523704e-40
KLLA0D04906g1.402ON3623673687e-40
Skud_3.431.402ON3643713688e-40
YCL018W (LEU2)1.402ON3643713661e-39
Ecym_12961.402ON3633713642e-39
AAL012C1.402ON3723683634e-39
Kpol_1048.631.402ON3643653609e-39
Smik_3.661.402ON3643713601e-38
KLTH0H12188g1.402ON3643713601e-38
KNAG0I012801.402ON4473643632e-38
ZYRO0D02838g2.278ON3613523582e-38
NDAI0G042301.402ON3633643555e-38
Kwal_0.2251.402ON3643773548e-38
CAGL0H03795g1.402ON3653663478e-37
Suva_3.31.402ON3643713442e-36
ZYRO0E04796g1.402ON3623673409e-36
Suva_14.3022.278ON3003203359e-36
SAKL0D08690g1.402ON3643723337e-35
NCAS0C048701.402ON3653743329e-35
KAFR0I022001.402ON3653693302e-34
TPHA0B037301.402ON3653673197e-33
CAGL0D00770g4.254ON4233021425e-09
KLTH0D14476g4.254ON4202441425e-09
KAFR0H031601.396ON4212041391e-08
Kwal_23.42104.254ON4222961391e-08
Ecym_13061.396ON4152131363e-08
SAKL0D08426g1.396ON4112331345e-08
KLTH0H12012g1.396ON4132331336e-08
TBLA0C012901.396ON4181091336e-08
TDEL0E011604.254ON4232761329e-08
TPHA0B036601.396ON4221261311e-07
Kwal_0.1911.396ON4112111301e-07
Kpol_1055.784.254ON4272351302e-07
Kpol_1048.701.396ON4192161292e-07
KLLA0B03355g4.254ON4292051292e-07
ZYRO0E05016g1.396ON4111821292e-07
AAL022W1.396ON4152111283e-07
CAGL0H03663g1.396ON4181551283e-07
AER061C4.254ON4252101283e-07
SAKL0H02860g4.254ON4212031283e-07
TPHA0B022104.254ON4331731257e-07
NDAI0D043604.254ON4241441257e-07
TDEL0B061001.396ON4141261248e-07
KAFR0I021301.396ON4081271249e-07
Smik_4.1694.254ON4281441231e-06
Skud_4.1894.254ON4291451231e-06
YDL066W (IDP1)4.254ON4281441231e-06
Smik_12.2351.396ON4122181221e-06
NCAS0A025104.254ON4262361222e-06
YLR174W (IDP2)1.396ON4122181212e-06
KLLA0F12342g1.396ON4152031212e-06
NCAS0A087201.396ON4131301203e-06
Skud_12.2391.396ON4121261193e-06
KNAG0H016701.396ON4241271194e-06
KNAG0I013201.396ON4121261184e-06
Suva_10.2711.396ON4121301185e-06
Suva_4.1844.254ON4291441177e-06
KAFR0G032604.254ON4211671168e-06
TBLA0A080104.254ON428941159e-06
Skud_14.3181.396ON4201261151e-05
KNAG0D044104.254ON4281761151e-05
YNL009W (IDP3)1.396ON4202231151e-05
CAGL0B04917g1.396ON4111301141e-05
Suva_14.3391.396ON4171301132e-05
NCAS0G036201.396ON4181961132e-05
Smik_14.3191.396ON4181261132e-05
ZYRO0B12496g4.254ON4222051122e-05
Ecym_32654.254ON4241151104e-05
NDAI0G008501.396ON4191301071e-04
NDAI0G051601.396ON4201221052e-04
Suva_14.303singletonON5350740.090
KAFR0G003201.162ON69050721.9
Skud_6.15na 1ON55678695.3
Smik_11.511.162ON67182678.0
CAGL0G07711g1.288ON52061678.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_27.11528
         (367 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_27.11528 s27 (836437..837540) [1104 bp, 367 aa] {ON} YIL094...   754   0.0  
KLTH0G10384g Chr7 complement(878375..879478) [1104 bp, 367 aa] {...   715   0.0  
SAKL0E07656g Chr5 (620028..621134) [1107 bp, 368 aa] {ON} highly...   667   0.0  
NCAS0B06250 Chr2 (1179360..1180481) [1122 bp, 373 aa] {ON} Anc_2...   620   0.0  
TDEL0G02180 Chr7 complement(428789..429898) [1110 bp, 369 aa] {O...   618   0.0  
Suva_9.105 Chr9 complement(180626..181741) [1116 bp, 371 aa] {ON...   610   0.0  
KLLA0E08339g Chr5 (750670..751779) [1110 bp, 369 aa] {ON} highly...   607   0.0  
NDAI0B03550 Chr2 (891508..892626) [1119 bp, 372 aa] {ON} Anc_2.2...   607   0.0  
YIL094C Chr9 complement(186517..187632) [1116 bp, 371 aa] {ON}  ...   607   0.0  
KNAG0A05420 Chr1 (799521..800639) [1119 bp, 372 aa] {ON}              605   0.0  
Smik_9.85 Chr9 complement(165648..166763) [1116 bp, 371 aa] {ON}...   602   0.0  
ZYRO0A01914g Chr1 complement(158403..159509) [1107 bp, 368 aa] {...   602   0.0  
Skud_9.79 Chr9 complement(163173..164288) [1116 bp, 371 aa] {ON}...   602   0.0  
CAGL0G02585g Chr7 (238931..240049) [1119 bp, 372 aa] {ON} highly...   591   0.0  
KAFR0J01360 Chr10 (249197..250318) [1122 bp, 373 aa] {ON} Anc_2....   587   0.0  
Kpol_1003.39 s1003 complement(96083..97195) [1113 bp, 370 aa] {O...   580   0.0  
TBLA0B05940 Chr2 complement(1402869..1403978) [1110 bp, 369 aa] ...   578   0.0  
TPHA0C03410 Chr3 complement(748639..749754) [1116 bp, 371 aa] {O...   574   0.0  
Ecym_3326 Chr3 complement(624805..625905) [1101 bp, 366 aa] {ON}...   569   0.0  
ADL214C Chr4 complement(328094..329197) [1104 bp, 367 aa] {ON} S...   543   0.0  
KLLA0E03125g Chr5 (288825..289931) [1107 bp, 368 aa] {ON} highly...   176   2e-51
KLTH0F15048g Chr6 complement(1232566..1233672) [1107 bp, 368 aa]...   175   7e-51
ADL223W Chr4 (312893..313981) [1089 bp, 362 aa] {ON} Syntenic ho...   174   2e-50
Ecym_2313 Chr2 complement(610493..611605) [1113 bp, 370 aa] {ON}...   172   8e-50
Kwal_55.21273 s55 complement(762121..763227) [1107 bp, 368 aa] {...   171   4e-49
Ecym_3316 Chr3 (608744..609832) [1089 bp, 362 aa] {ON} similar t...   168   2e-48
TPHA0J02770 Chr10 (617727..618857) [1131 bp, 376 aa] {ON} Anc_2....   169   2e-48
Suva_8.188 Chr8 (335409..336518) [1110 bp, 369 aa] {ON} YOR136W ...   167   5e-48
CAGL0I07227g Chr9 complement(696605..697711) [1107 bp, 368 aa] {...   167   5e-48
NDAI0C01410 Chr3 complement(295178..296287) [1110 bp, 369 aa] {O...   167   9e-48
NCAS0H02250 Chr8 (441692..442960) [1269 bp, 422 aa] {ON} Anc_5.473    168   9e-48
Smik_14.290 Chr14 (528131..529213) [1083 bp, 360 aa] {ON} YNL037...   166   2e-47
Kpol_543.8 s543 (21411..22517) [1107 bp, 368 aa] {ON} (21411..22...   166   2e-47
TBLA0B02240 Chr2 complement(524111..525232) [1122 bp, 373 aa] {O...   166   2e-47
SAKL0G03520g Chr7 (290768..291877) [1110 bp, 369 aa] {ON} highly...   166   3e-47
KAFR0B06370 Chr2 complement(1317952..1319088) [1137 bp, 378 aa] ...   166   3e-47
Skud_14.293 Chr14 (538202..539287) [1086 bp, 361 aa] {ON} YNL037...   165   4e-47
Smik_15.316 Chr15 (541618..542727) [1110 bp, 369 aa] {ON} YOR136...   165   4e-47
AFR137C Chr6 complement(685586..686689) [1104 bp, 367 aa] {ON} S...   165   5e-47
TPHA0D01560 Chr4 complement(321751..322833) [1083 bp, 360 aa] {O...   164   7e-47
Skud_15.300 Chr15 (534346..535455) [1110 bp, 369 aa] {ON} YOR136...   164   1e-46
YNL037C Chr14 complement(557920..559002) [1083 bp, 360 aa] {ON} ...   164   2e-46
KNAG0B04070 Chr2 complement(778658..779779) [1122 bp, 373 aa] {O...   164   2e-46
SAKL0E07876g Chr5 complement(635705..636790) [1086 bp, 361 aa] {...   163   3e-46
KLTH0G10186g Chr7 (863151..864233) [1083 bp, 360 aa] {ON} highly...   163   3e-46
Kwal_23.5012 s23 (964254..965339) [1086 bp, 361 aa] {ON} YNL037C...   162   3e-46
TPHA0E01480 Chr5 complement(300222..301355) [1134 bp, 377 aa] {O...   162   9e-46
YOR136W Chr15 (580250..581359) [1110 bp, 369 aa] {ON}  IDH2Subun...   162   1e-45
KLLA0F04103g Chr6 (389159..390244) [1086 bp, 361 aa] {ON} unipro...   159   1e-44
TDEL0A03370 Chr1 (599855..600970) [1116 bp, 371 aa] {ON} Anc_5.4...   159   1e-44
Kpol_1039.35 s1039 complement(108102..109181) [1080 bp, 359 aa] ...   158   2e-44
TBLA0C01500 Chr3 complement(347212..348309) [1098 bp, 365 aa] {O...   158   2e-44
Kpol_440.12 s440 (32084..33190) [1107 bp, 368 aa] {ON} (32084..3...   158   2e-44
NDAI0B03590 Chr2 complement(901108..902187) [1080 bp, 359 aa] {O...   156   9e-44
TDEL0C03840 Chr3 complement(673007..674092) [1086 bp, 361 aa] {O...   156   9e-44
NCAS0B06290 Chr2 complement(1186838..1187917) [1080 bp, 359 aa] ...   155   2e-43
ZYRO0D11220g Chr4 (946652..947758) [1107 bp, 368 aa] {ON} highly...   155   2e-43
KAFR0J01410 Chr10 complement(256693..257745) [1053 bp, 350 aa] {...   154   4e-43
CAGL0G02673g Chr7 complement(246455..247531) [1077 bp, 358 aa] {...   147   2e-40
TDEL0B06000 Chr2 (1060828..1061916) [1089 bp, 362 aa] {ON} Anc_1...   147   2e-40
KNAG0A05280 Chr1 (780448..781533) [1086 bp, 361 aa] {ON}              147   2e-40
TBLA0B06910 Chr2 (1634845..1635942) [1098 bp, 365 aa] {ON}            147   4e-40
KLLA0D04906g Chr4 (420903..421991) [1089 bp, 362 aa] {ON} highly...   146   7e-40
Skud_3.43 Chr3 (70293..71387) [1095 bp, 364 aa] {ON} YCL018W (REAL)   146   8e-40
YCL018W Chr3 (91324..92418) [1095 bp, 364 aa] {ON}  LEU2Beta-iso...   145   1e-39
Ecym_1296 Chr1 (602530..603621) [1092 bp, 363 aa] {ON} similar t...   144   2e-39
AAL012C Chr1 complement(320148..321266) [1119 bp, 372 aa] {ON} S...   144   4e-39
Kpol_1048.63 s1048 (182096..183190) [1095 bp, 364 aa] {ON} (1820...   143   9e-39
Smik_3.66 Chr3 (89718..90812) [1095 bp, 364 aa] {ON} YCL018W (REAL)   143   1e-38
KLTH0H12188g Chr8 (1039347..1040441) [1095 bp, 364 aa] {ON} high...   143   1e-38
KNAG0I01280 Chr9 complement(245603..246946) [1344 bp, 447 aa] {O...   144   2e-38
ZYRO0D02838g Chr4 (223132..224217) [1086 bp, 361 aa] {ON} simila...   142   2e-38
NDAI0G04230 Chr7 complement(1015689..1016780) [1092 bp, 363 aa] ...   141   5e-38
Kwal_0.225 s0 (111017..112111) [1095 bp, 364 aa] {ON} YCL018W (L...   140   8e-38
CAGL0H03795g Chr8 (356535..357632) [1098 bp, 365 aa] {ON}             138   8e-37
Suva_3.3 Chr3 (1464..2558) [1095 bp, 364 aa] {ON} YCL018W (REAL)      137   2e-36
ZYRO0E04796g Chr5 (362881..363969) [1089 bp, 362 aa] {ON} unipro...   135   9e-36
Suva_14.302 Chr14 (546468..547370) [903 bp, 300 aa] {ON} YNL037C...   133   9e-36
SAKL0D08690g Chr4 complement(723302..724396) [1095 bp, 364 aa] {...   132   7e-35
NCAS0C04870 Chr3 complement(993177..994274) [1098 bp, 365 aa] {O...   132   9e-35
KAFR0I02200 Chr9 (449737..450834) [1098 bp, 365 aa] {ON} Anc_1.4...   131   2e-34
TPHA0B03730 Chr2 complement(878199..879296) [1098 bp, 365 aa] {O...   127   7e-33
CAGL0D00770g Chr4 (95715..96986) [1272 bp, 423 aa] {ON} highly s...    59   5e-09
KLTH0D14476g Chr4 complement(1184813..1186075) [1263 bp, 420 aa]...    59   5e-09
KAFR0H03160 Chr8 complement(602807..604072) [1266 bp, 421 aa] {O...    58   1e-08
Kwal_23.4210 s23 (619516..620784) [1269 bp, 422 aa] {ON} YDL066W...    58   1e-08
Ecym_1306 Chr1 complement(619565..620812) [1248 bp, 415 aa] {ON}...    57   3e-08
SAKL0D08426g Chr4 (705189..706424) [1236 bp, 411 aa] {ON} highly...    56   5e-08
KLTH0H12012g Chr8 (1026586..1027827) [1242 bp, 413 aa] {ON} high...    56   6e-08
TBLA0C01290 Chr3 complement(283624..284880) [1257 bp, 418 aa] {O...    56   6e-08
TDEL0E01160 Chr5 (234217..235488) [1272 bp, 423 aa] {ON} Anc_4.2...    55   9e-08
TPHA0B03660 Chr2 (863280..864548) [1269 bp, 422 aa] {ON} Anc_1.3...    55   1e-07
Kwal_0.191 s0 (98033..99268) [1236 bp, 411 aa] {ON} YLR174W (IDP...    55   1e-07
Kpol_1055.78 s1055 (207889..209172) [1284 bp, 427 aa] {ON} (2078...    55   2e-07
Kpol_1048.70 s1048 complement(198298..199557) [1260 bp, 419 aa] ...    54   2e-07
KLLA0B03355g Chr2 (303444..304733) [1290 bp, 429 aa] {ON} highly...    54   2e-07
ZYRO0E05016g Chr5 complement(379654..380889) [1236 bp, 411 aa] {...    54   2e-07
AAL022W Chr1 (302946..304193) [1248 bp, 415 aa] {ON} Syntenic ho...    54   3e-07
CAGL0H03663g Chr8 (337533..338789) [1257 bp, 418 aa] {ON} highly...    54   3e-07
AER061C Chr5 complement(749709..750986) [1278 bp, 425 aa] {ON} S...    54   3e-07
SAKL0H02860g Chr8 (280944..282209) [1266 bp, 421 aa] {ON} highly...    54   3e-07
TPHA0B02210 Chr2 (509945..511246) [1302 bp, 433 aa] {ON} Anc_4.2...    53   7e-07
NDAI0D04360 Chr4 (1024297..1025571) [1275 bp, 424 aa] {ON} Anc_4...    53   7e-07
TDEL0B06100 Chr2 complement(1076365..1077609) [1245 bp, 414 aa] ...    52   8e-07
KAFR0I02130 Chr9 (438428..439654) [1227 bp, 408 aa] {ON} Anc_1.3...    52   9e-07
Smik_4.169 Chr4 (311244..312530) [1287 bp, 428 aa] {ON} YDL066W ...    52   1e-06
Skud_4.189 Chr4 (330300..331589) [1290 bp, 429 aa] {ON} YDL066W ...    52   1e-06
YDL066W Chr4 (334835..336121) [1287 bp, 428 aa] {ON}  IDP1Mitoch...    52   1e-06
Smik_12.235 Chr12 (451719..452957) [1239 bp, 412 aa] {ON} YLR174...    52   1e-06
NCAS0A02510 Chr1 complement(476363..477643) [1281 bp, 426 aa] {O...    52   2e-06
YLR174W Chr12 (504591..505829) [1239 bp, 412 aa] {ON}  IDP2Cytos...    51   2e-06
KLLA0F12342g Chr6 (1137608..1138855) [1248 bp, 415 aa] {ON} high...    51   2e-06
NCAS0A08720 Chr1 complement(1722511..1723752) [1242 bp, 413 aa] ...    51   3e-06
Skud_12.239 Chr12 (451342..452580) [1239 bp, 412 aa] {ON} YLR174...    50   3e-06
KNAG0H01670 Chr8 (298481..299755) [1275 bp, 424 aa] {ON} Anc_1.3...    50   4e-06
KNAG0I01320 Chr9 complement(255478..256716) [1239 bp, 412 aa] {O...    50   4e-06
Suva_10.271 Chr10 (476726..477964) [1239 bp, 412 aa] {ON} YLR174...    50   5e-06
Suva_4.184 Chr4 (324382..325671) [1290 bp, 429 aa] {ON} YDL066W ...    50   7e-06
KAFR0G03260 Chr7 complement(675642..676907) [1266 bp, 421 aa] {O...    49   8e-06
TBLA0A08010 Chr1 (1981576..1982862) [1287 bp, 428 aa] {ON} Anc_4...    49   9e-06
Skud_14.318 Chr14 (581597..582859) [1263 bp, 420 aa] {ON} YNL009...    49   1e-05
KNAG0D04410 Chr4 complement(799414..800700) [1287 bp, 428 aa] {O...    49   1e-05
YNL009W Chr14 (614821..616083) [1263 bp, 420 aa] {ON}  IDP3Perox...    49   1e-05
CAGL0B04917g Chr2 complement(477939..479174) [1236 bp, 411 aa] {...    49   1e-05
Suva_14.339 Chr14 (594794..596047) [1254 bp, 417 aa] {ON} YNL009...    48   2e-05
NCAS0G03620 Chr7 complement(675224..676480) [1257 bp, 418 aa] {O...    48   2e-05
Smik_14.319 Chr14 (573167..574423) [1257 bp, 418 aa] {ON} YLR174...    48   2e-05
ZYRO0B12496g Chr2 complement(1007086..1008354) [1269 bp, 422 aa]...    48   2e-05
Ecym_3265 Chr3 (504267..505541) [1275 bp, 424 aa] {ON} similar t...    47   4e-05
NDAI0G00850 Chr7 (179074..180333) [1260 bp, 419 aa] {ON} Anc_1.396     46   1e-04
NDAI0G05160 Chr7 complement(1250883..1252145) [1263 bp, 420 aa] ...    45   2e-04
Suva_14.303 Chr14 (547367..547525) [159 bp, 53 aa] {ON} YNL037C ...    33   0.090
KAFR0G00320 Chr7 complement(101116..103188) [2073 bp, 690 aa] {O...    32   1.9  
Skud_6.15 Chr6 complement(24031..25701) [1671 bp, 556 aa] {ON} Y...    31   5.3  
Smik_11.51 Chr11 complement(95977..97992) [2016 bp, 671 aa] {ON}...    30   8.0  
CAGL0G07711g Chr7 (732457..734019) [1563 bp, 520 aa] {ON} simila...    30   8.4  

>Kwal_27.11528 s27 (836437..837540) [1104 bp, 367 aa] {ON} YIL094C
           (LYS12) - Homo-isocitrate dehydrogenase [contig 27] FULL
          Length = 367

 Score =  754 bits (1948), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 367/367 (100%), Positives = 367/367 (100%)

Query: 1   MLRTSFNQLARRSYTSATKSLTIGLIPGDGIGREVIPAGKLVLENLSSKHGLKFNFIDLE 60
           MLRTSFNQLARRSYTSATKSLTIGLIPGDGIGREVIPAGKLVLENLSSKHGLKFNFIDLE
Sbjct: 1   MLRTSFNQLARRSYTSATKSLTIGLIPGDGIGREVIPAGKLVLENLSSKHGLKFNFIDLE 60

Query: 61  AGWQTFLDTGKALPDETIDILKNECQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYANV 120
           AGWQTFLDTGKALPDETIDILKNECQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYANV
Sbjct: 61  AGWQTFLDTGKALPDETIDILKNECQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYANV 120

Query: 121 RPVKSVLSQEKPIDMVIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISEVATRNIANI 180
           RPVKSVLSQEKPIDMVIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISEVATRNIANI
Sbjct: 121 RPVKSVLSQEKPIDMVIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISEVATRNIANI 180

Query: 181 ALEIALQRQKVNGSATLTVTHKSNVLSQSDGLFREICRQVYESNQDKFGSINYNEQIVDS 240
           ALEIALQRQKVNGSATLTVTHKSNVLSQSDGLFREICRQVYESNQDKFGSINYNEQIVDS
Sbjct: 181 ALEIALQRQKVNGSATLTVTHKSNVLSQSDGLFREICRQVYESNQDKFGSINYNEQIVDS 240

Query: 241 MVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGFDFVVGEPCHGSAPD 300
           MVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGFDFVVGEPCHGSAPD
Sbjct: 241 MVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGFDFVVGEPCHGSAPD 300

Query: 301 IAGKGISNPVATIRSTALMLEFMGHPEAAQDIHKAVDANLRDNTVKTPDLGGKSTTQQVV 360
           IAGKGISNPVATIRSTALMLEFMGHPEAAQDIHKAVDANLRDNTVKTPDLGGKSTTQQVV
Sbjct: 301 IAGKGISNPVATIRSTALMLEFMGHPEAAQDIHKAVDANLRDNTVKTPDLGGKSTTQQVV 360

Query: 361 DDVLSRM 367
           DDVLSRM
Sbjct: 361 DDVLSRM 367

>KLTH0G10384g Chr7 complement(878375..879478) [1104 bp, 367 aa] {ON}
           highly similar to uniprot|P40495 Saccharomyces
           cerevisiae YIL094C LYS12 Homo-isocitrate dehydrogenase
           an NAD-linked mitochondrial enzyme required for the
           fourth step in the biosynthesis of lysine in which homo-
           isocitrate is oxidatively decarboxylated to alpha-
           ketoadipate
          Length = 367

 Score =  715 bits (1846), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/367 (92%), Positives = 358/367 (97%)

Query: 1   MLRTSFNQLARRSYTSATKSLTIGLIPGDGIGREVIPAGKLVLENLSSKHGLKFNFIDLE 60
           MLR SF QLARRSY SA+KSLTIGLIPGDGIG+EVIPAG+ VLENLSSKHGLKF+FIDL+
Sbjct: 1   MLRASFTQLARRSYASASKSLTIGLIPGDGIGKEVIPAGRQVLENLSSKHGLKFDFIDLQ 60

Query: 61  AGWQTFLDTGKALPDETIDILKNECQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYANV 120
           AGWQTF +TGKALPDETIDIL+N+CQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYANV
Sbjct: 61  AGWQTFQETGKALPDETIDILRNQCQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYANV 120

Query: 121 RPVKSVLSQEKPIDMVIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISEVATRNIANI 180
           RPVKSVL QE+P+DM+IVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISE AT+NIANI
Sbjct: 121 RPVKSVLPQERPVDMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATKNIANI 180

Query: 181 ALEIALQRQKVNGSATLTVTHKSNVLSQSDGLFREICRQVYESNQDKFGSINYNEQIVDS 240
           ALEIALQRQKVNG ATLTVTHKSNVLSQSDGLFRE+CRQVYESN+DKFGSI YNEQIVDS
Sbjct: 181 ALEIALQRQKVNGEATLTVTHKSNVLSQSDGLFREVCRQVYESNKDKFGSIKYNEQIVDS 240

Query: 241 MVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGFDFVVGEPCHGSAPD 300
           MVYR+FREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGFDFVVGEPCHGSAPD
Sbjct: 241 MVYRMFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGFDFVVGEPCHGSAPD 300

Query: 301 IAGKGISNPVATIRSTALMLEFMGHPEAAQDIHKAVDANLRDNTVKTPDLGGKSTTQQVV 360
           IAGKGISNPVATIRSTALMLEFMGHPEAAQDIHKAVDANLRDN++KTPDLGGKSTTQQVV
Sbjct: 301 IAGKGISNPVATIRSTALMLEFMGHPEAAQDIHKAVDANLRDNSIKTPDLGGKSTTQQVV 360

Query: 361 DDVLSRM 367
           +DVLSRM
Sbjct: 361 EDVLSRM 367

>SAKL0E07656g Chr5 (620028..621134) [1107 bp, 368 aa] {ON} highly
           similar to uniprot|P40495 Saccharomyces cerevisiae
           YIL094C LYS12 Homo-isocitrate dehydrogenase an
           NAD-linked mitochondrial enzyme required for the fourth
           step in the biosynthesis of lysine in which homo-
           isocitrate is oxidatively decarboxylated to alpha-
           ketoadipate
          Length = 368

 Score =  667 bits (1720), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/368 (86%), Positives = 347/368 (94%), Gaps = 1/368 (0%)

Query: 1   MLRTSFNQLARRSYTSATKSLTIGLIPGDGIGREVIPAGKLVLENLSSKHGLKFNFIDLE 60
           MLR++ +Q ARRSY SA K LTIGLIPGDGIG+EVIPAGKLVLENLSSKH LKFNFIDL+
Sbjct: 1   MLRSTVSQFARRSYASAAKPLTIGLIPGDGIGKEVIPAGKLVLENLSSKHNLKFNFIDLQ 60

Query: 61  AGWQTFLDTGKALPDETIDILKNECQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYANV 120
           AGWQTFLDTGKALPDETI+ILK++CQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYANV
Sbjct: 61  AGWQTFLDTGKALPDETIEILKSDCQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYANV 120

Query: 121 RPVKSVL-SQEKPIDMVIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISEVATRNIAN 179
           RPVKSV  + ++P+DM+IVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISE AT +IA 
Sbjct: 121 RPVKSVQGTNDRPVDMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATTDIAK 180

Query: 180 IALEIALQRQKVNGSATLTVTHKSNVLSQSDGLFREICRQVYESNQDKFGSINYNEQIVD 239
           IALEI+LQR K NG ATLTVTHKSNVLSQSDGLFRE+C+ VYESN++++G+I YNEQIVD
Sbjct: 181 IALEISLQRLKANGKATLTVTHKSNVLSQSDGLFREVCKNVYESNKERYGAIGYNEQIVD 240

Query: 240 SMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGFDFVVGEPCHGSAP 299
           SMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVG DF+VGEPCHGSAP
Sbjct: 241 SMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGHDFIVGEPCHGSAP 300

Query: 300 DIAGKGISNPVATIRSTALMLEFMGHPEAAQDIHKAVDANLRDNTVKTPDLGGKSTTQQV 359
           DIAGKGISNP+ATIRSTALMLEFMG+ EAAQDIHKAVD N+R+N +KTPDLGGKSTTQQV
Sbjct: 301 DIAGKGISNPIATIRSTALMLEFMGYTEAAQDIHKAVDTNIRENQIKTPDLGGKSTTQQV 360

Query: 360 VDDVLSRM 367
           VDD+LS+M
Sbjct: 361 VDDILSKM 368

>NCAS0B06250 Chr2 (1179360..1180481) [1122 bp, 373 aa] {ON}
           Anc_2.287
          Length = 373

 Score =  620 bits (1599), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/373 (79%), Positives = 342/373 (91%), Gaps = 6/373 (1%)

Query: 1   MLRTSFNQLAR---RSYTSAT--KSLTIGLIPGDGIGREVIPAGKLVLENLSSKHGLKFN 55
           MLRT+ ++ A    R+Y +    K+LTIGLIPGDGIG+EVIPAGK VLENL+SKHGLKF+
Sbjct: 1   MLRTAASRFATSTCRTYATNALRKNLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLKFD 60

Query: 56  FIDLEAGWQTFLDTGKALPDETIDILKNECQGALFGAVQSPTNKVEGYSSPIVALRKKLG 115
           FIDL+AG+QTFLDTGKALPDET+ +LK++CQGALFGAVQSPT KVEGYSSPIVALRK++G
Sbjct: 61  FIDLQAGFQTFLDTGKALPDETVQVLKSQCQGALFGAVQSPTTKVEGYSSPIVALRKEMG 120

Query: 116 LYANVRPVKSVL-SQEKPIDMVIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISEVAT 174
           L+ANVRPVKSV  ++++P+DMVIVRENTEDLYIK EKTYID+ TGTRVAEA KRISE+AT
Sbjct: 121 LFANVRPVKSVSGTKDRPVDMVIVRENTEDLYIKIEKTYIDKATGTRVAEATKRISEIAT 180

Query: 175 RNIANIALEIALQRQKVNGSATLTVTHKSNVLSQSDGLFREICRQVYESNQDKFGSINYN 234
           R IA IAL+IALQR KVNG ATLTVTHKSNVLSQSDGLFREIC+ VYESN+DK+GSI YN
Sbjct: 181 RRIATIALDIALQRLKVNGKATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGSITYN 240

Query: 235 EQIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGFDFVVGEPC 294
           EQIVDSMVYR+FREP+CFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVG + V+GEPC
Sbjct: 241 EQIVDSMVYRMFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPC 300

Query: 295 HGSAPDIAGKGISNPVATIRSTALMLEFMGHPEAAQDIHKAVDANLRDNTVKTPDLGGKS 354
           HGSAPDIAGKGI+NP+ATIRSTALMLEF+GH +AAQDIH+AV+AN+R+N +KTPDLGG S
Sbjct: 301 HGSAPDIAGKGIANPIATIRSTALMLEFLGHNDAAQDIHRAVEANMRENKIKTPDLGGNS 360

Query: 355 TTQQVVDDVLSRM 367
           TTQQV +DVL+R+
Sbjct: 361 TTQQVTEDVLARL 373

>TDEL0G02180 Chr7 complement(428789..429898) [1110 bp, 369 aa] {ON}
           Anc_2.287 YIL094C
          Length = 369

 Score =  618 bits (1593), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/369 (79%), Positives = 336/369 (91%), Gaps = 2/369 (0%)

Query: 1   MLRTSFNQLA-RRSYTSATKSLTIGLIPGDGIGREVIPAGKLVLENLSSKHGLKFNFIDL 59
           MLR++  +LA RR+Y SA KS+ IGLIPGDGIG+EVIPAGK VLENLS KHGL F+FIDL
Sbjct: 1   MLRSAIGRLATRRAYASAPKSMVIGLIPGDGIGKEVIPAGKQVLENLSGKHGLNFDFIDL 60

Query: 60  EAGWQTFLDTGKALPDETIDILKNECQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYAN 119
           +AGW TF +TGKALP++T+ +LKN+CQGALFGAVQSPT KVEGYSSPIVALRK+LGLYAN
Sbjct: 61  QAGWGTFQETGKALPEQTVQVLKNQCQGALFGAVQSPTTKVEGYSSPIVALRKELGLYAN 120

Query: 120 VRPVKSVL-SQEKPIDMVIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISEVATRNIA 178
           VRPVKSV  ++++P+DMVIVRENTEDLYIK EKTY+D+ TGTRVAEA KRISEVATR IA
Sbjct: 121 VRPVKSVEGTKDRPVDMVIVRENTEDLYIKLEKTYVDKATGTRVAEATKRISEVATRRIA 180

Query: 179 NIALEIALQRQKVNGSATLTVTHKSNVLSQSDGLFREICRQVYESNQDKFGSINYNEQIV 238
            IAL+IALQR K NG ATLTVTHKSNVLSQSDGLFREIC+ VYESN+DK+G + YNEQIV
Sbjct: 181 TIALDIALQRLKTNGHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQVAYNEQIV 240

Query: 239 DSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGFDFVVGEPCHGSA 298
           DSMVYR+FREPECFDV+VAPNLYGDILSDGAAALVGSLGVVPSANVG + V+GEPCHGSA
Sbjct: 241 DSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCHGSA 300

Query: 299 PDIAGKGISNPVATIRSTALMLEFMGHPEAAQDIHKAVDANLRDNTVKTPDLGGKSTTQQ 358
           PDIAGKGISNP+ATIRST LMLEF+GH + AQDI++AVDANLR++ VKTPDLGG STTQQ
Sbjct: 301 PDIAGKGISNPIATIRSTGLMLEFLGHNKPAQDIYRAVDANLREDKVKTPDLGGNSTTQQ 360

Query: 359 VVDDVLSRM 367
           VV+D+LS++
Sbjct: 361 VVEDILSKL 369

>Suva_9.105 Chr9 complement(180626..181741) [1116 bp, 371 aa] {ON}
           YIL094C (REAL)
          Length = 371

 Score =  610 bits (1573), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/353 (83%), Positives = 327/353 (92%), Gaps = 1/353 (0%)

Query: 16  SATKSLTIGLIPGDGIGREVIPAGKLVLENLSSKHGLKFNFIDLEAGWQTFLDTGKALPD 75
           +A KSLTIGLIPGDGIG+EVIPAGK +LENL+SKHGL FNFIDL AG+QTF +TGKALPD
Sbjct: 19  AARKSLTIGLIPGDGIGKEVIPAGKQILENLNSKHGLSFNFIDLYAGFQTFQETGKALPD 78

Query: 76  ETIDILKNECQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYANVRPVKSVL-SQEKPID 134
           ETI +LK++CQGALFGAVQSPT KVEGYSSPIVALR+++GLYANVRPVKSV  +++KPID
Sbjct: 79  ETIKVLKDQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLYANVRPVKSVEGTKDKPID 138

Query: 135 MVIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISEVATRNIANIALEIALQRQKVNGS 194
           MVIVRENTEDLYIK EKTYID+ TGTRVA+AIKRISEVATR IA IAL+IALQR +  G 
Sbjct: 139 MVIVRENTEDLYIKIEKTYIDKATGTRVADAIKRISEVATRRIAKIALDIALQRLQTRGE 198

Query: 195 ATLTVTHKSNVLSQSDGLFREICRQVYESNQDKFGSINYNEQIVDSMVYRLFREPECFDV 254
           ATLTVTHKSNVLSQSDGLFREIC+ VYESN+DK+G I YNEQIVDSMVYRLFREP+CFDV
Sbjct: 199 ATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQIKYNEQIVDSMVYRLFREPQCFDV 258

Query: 255 IVAPNLYGDILSDGAAALVGSLGVVPSANVGFDFVVGEPCHGSAPDIAGKGISNPVATIR 314
           IVAPNLYGDILSDGAAALVGSLGVVPSANVG D V+GEPCHGSAPDIAGKGI+NP+ATIR
Sbjct: 259 IVAPNLYGDILSDGAAALVGSLGVVPSANVGPDIVIGEPCHGSAPDIAGKGIANPIATIR 318

Query: 315 STALMLEFMGHPEAAQDIHKAVDANLRDNTVKTPDLGGKSTTQQVVDDVLSRM 367
           STALMLEF+GH +AAQDI+KAVDANLR+  + TPDLGGK++TQQVVDDVLSR+
Sbjct: 319 STALMLEFLGHNDAAQDIYKAVDANLREGAITTPDLGGKASTQQVVDDVLSRL 371

>KLLA0E08339g Chr5 (750670..751779) [1110 bp, 369 aa] {ON} highly
           similar to uniprot|P40495 Saccharomyces cerevisiae
           YIL094C LYS12 Homo-isocitrate dehydrogenase an
           NAD-linked mitochondrial enzyme required for the fourth
           step in the biosynthesis of lysine in which homo-
           isocitrate is oxidatively decarboxylated to alpha-
           ketoadipate
          Length = 369

 Score =  607 bits (1566), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/368 (77%), Positives = 334/368 (90%), Gaps = 1/368 (0%)

Query: 1   MLRTSFNQLARRSYTSATKSLTIGLIPGDGIGREVIPAGKLVLENLSSKHGLKFNFIDLE 60
           M+RT F QL+RR+Y S  K+LTIGLIPGDGIG+EVIPAGK +LE+L+ K+GL F FIDL+
Sbjct: 1   MMRTRFIQLSRRAYASNAKNLTIGLIPGDGIGKEVIPAGKKILESLNPKYGLSFKFIDLQ 60

Query: 61  AGWQTFLDTGKALPDETIDILKNECQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYANV 120
           AGW+TF +TGKALPDETIDILKN+C+GALFGAVQSPT KVEGYSSPIVALRK LGL+ANV
Sbjct: 61  AGWETFQNTGKALPDETIDILKNQCEGALFGAVQSPTTKVEGYSSPIVALRKNLGLFANV 120

Query: 121 RPVKSV-LSQEKPIDMVIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISEVATRNIAN 179
           RPVKSV  ++++ +D+VIVRENTEDLYIK EK+YIDE TGTRVA+A KRI+E+AT+NIA 
Sbjct: 121 RPVKSVDGTKDRKVDLVIVRENTEDLYIKLEKSYIDEATGTRVADATKRITEIATKNIAT 180

Query: 180 IALEIALQRQKVNGSATLTVTHKSNVLSQSDGLFREICRQVYESNQDKFGSINYNEQIVD 239
           IAL+IA QR + NG ATLTVTHKSNVLSQSDGLFRE+CR+ YE+N+DK+G + YNEQIVD
Sbjct: 181 IALQIAQQRLEQNGHATLTVTHKSNVLSQSDGLFREVCRETYEANKDKYGGVQYNEQIVD 240

Query: 240 SMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGFDFVVGEPCHGSAP 299
           SMVYR+FREPECFDV+VAPNLYGDILSDGAAALVGSLGVVPSANVG + V+GEPCHGSAP
Sbjct: 241 SMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPNIVIGEPCHGSAP 300

Query: 300 DIAGKGISNPVATIRSTALMLEFMGHPEAAQDIHKAVDANLRDNTVKTPDLGGKSTTQQV 359
           DIAGKGISNP+ATIRSTALMLEF+G+PE A+DIHKAVDAN+R+    TPDLGG STTQQV
Sbjct: 301 DIAGKGISNPIATIRSTALMLEFLGYPEPAKDIHKAVDANIREGKYLTPDLGGNSTTQQV 360

Query: 360 VDDVLSRM 367
           ++DVLS++
Sbjct: 361 LEDVLSKL 368

>NDAI0B03550 Chr2 (891508..892626) [1119 bp, 372 aa] {ON} Anc_2.287
           YIL094C
          Length = 372

 Score =  607 bits (1566), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/372 (79%), Positives = 336/372 (90%), Gaps = 5/372 (1%)

Query: 1   MLRTSFNQLAR-RSYTSAT--KSLTIGLIPGDGIGREVIPAGKLVLENLSSKHGLKFNFI 57
           MLRT+ ++LA  R Y +    K+LTIGLIPGDGIG+EVIPAGK VL+NL+SKHGL F+FI
Sbjct: 1   MLRTTASRLATCRGYATNAIRKNLTIGLIPGDGIGKEVIPAGKQVLQNLNSKHGLNFDFI 60

Query: 58  DLEAGWQTFLDTGKALPDETIDILKNECQGALFGAVQSPTNKVEGYSSPIVALRKKLGLY 117
           DL+AG+QTFLDTGKALPDETI +LKN+CQGALFGAVQSPT KVEGYSSPIVALRK++GLY
Sbjct: 61  DLQAGFQTFLDTGKALPDETIQVLKNQCQGALFGAVQSPTTKVEGYSSPIVALRKEMGLY 120

Query: 118 ANVRPVKSVL-SQEKPIDMVIVRENTED-LYIKTEKTYIDEKTGTRVAEAIKRISEVATR 175
           ANVRPVKSV  + +KP+DMVIVRENT   + IK E+TYID  TGTRVAEA KRISE+ATR
Sbjct: 121 ANVRPVKSVEGTTDKPVDMVIVRENTRRFINIKLERTYIDRATGTRVAEATKRISEIATR 180

Query: 176 NIANIALEIALQRQKVNGSATLTVTHKSNVLSQSDGLFREICRQVYESNQDKFGSINYNE 235
            IA IAL+IALQR K NG ATLTVTHKSNVLSQSDGLFREIC+ VYESN+DK+G INYNE
Sbjct: 181 RIATIALDIALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQINYNE 240

Query: 236 QIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGFDFVVGEPCH 295
           QIVDSMVYR+FREP+CFDV+VAPNLYGDILSDGAAALVGSLGVVPSANVG + V+GEPCH
Sbjct: 241 QIVDSMVYRMFREPQCFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCH 300

Query: 296 GSAPDIAGKGISNPVATIRSTALMLEFMGHPEAAQDIHKAVDANLRDNTVKTPDLGGKST 355
           GSAPDIAGKGISNP+ATIRSTALMLEF+GH EAAQDIH+AV+ANL++N VKTPDLGGKST
Sbjct: 301 GSAPDIAGKGISNPIATIRSTALMLEFLGHNEAAQDIHRAVEANLKENKVKTPDLGGKST 360

Query: 356 TQQVVDDVLSRM 367
           TQ+V +DVL+R+
Sbjct: 361 TQEVTEDVLARL 372

>YIL094C Chr9 complement(186517..187632) [1116 bp, 371 aa] {ON}
           LYS12Homo-isocitrate dehydrogenase, an NAD-linked
           mitochondrial enzyme required for the fourth step in the
           biosynthesis of lysine, in which homo-isocitrate is
           oxidatively decarboxylated to alpha-ketoadipate
          Length = 371

 Score =  607 bits (1566), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/353 (82%), Positives = 327/353 (92%), Gaps = 1/353 (0%)

Query: 16  SATKSLTIGLIPGDGIGREVIPAGKLVLENLSSKHGLKFNFIDLEAGWQTFLDTGKALPD 75
           +A KSLTIGLIPGDGIG+EVIPAGK VLENL+SKHGL FNFIDL AG+QTF +TGKALPD
Sbjct: 19  AARKSLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLSFNFIDLYAGFQTFQETGKALPD 78

Query: 76  ETIDILKNECQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYANVRPVKSVLSQE-KPID 134
           ET+ +LK +CQGALFGAVQSPT KVEGYSSPIVALR+++GL+ANVRPVKSV  ++ KPID
Sbjct: 79  ETVKVLKEQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLFANVRPVKSVEGEKGKPID 138

Query: 135 MVIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISEVATRNIANIALEIALQRQKVNGS 194
           MVIVRENTEDLYIK EKTYID+ TGTRVA+A KRISE+ATR IA IAL+IAL+R +  G 
Sbjct: 139 MVIVRENTEDLYIKIEKTYIDKATGTRVADATKRISEIATRRIATIALDIALKRLQTRGQ 198

Query: 195 ATLTVTHKSNVLSQSDGLFREICRQVYESNQDKFGSINYNEQIVDSMVYRLFREPECFDV 254
           ATLTVTHKSNVLSQSDGLFREIC++VYESN+DK+G I YNEQIVDSMVYRLFREP+CFDV
Sbjct: 199 ATLTVTHKSNVLSQSDGLFREICKEVYESNKDKYGQIKYNEQIVDSMVYRLFREPQCFDV 258

Query: 255 IVAPNLYGDILSDGAAALVGSLGVVPSANVGFDFVVGEPCHGSAPDIAGKGISNPVATIR 314
           IVAPNLYGDILSDGAAALVGSLGVVPSANVG + V+GEPCHGSAPDIAGKGI+NP+ATIR
Sbjct: 259 IVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCHGSAPDIAGKGIANPIATIR 318

Query: 315 STALMLEFMGHPEAAQDIHKAVDANLRDNTVKTPDLGGKSTTQQVVDDVLSRM 367
           STALMLEF+GH EAAQDI+KAVDANLR+ ++KTPDLGGK++TQQVVDDVLSR+
Sbjct: 319 STALMLEFLGHNEAAQDIYKAVDANLREGSIKTPDLGGKASTQQVVDDVLSRL 371

>KNAG0A05420 Chr1 (799521..800639) [1119 bp, 372 aa] {ON} 
          Length = 372

 Score =  605 bits (1561), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/371 (78%), Positives = 332/371 (89%), Gaps = 4/371 (1%)

Query: 1   MLRTSFNQLAR---RSYTSATKSLTIGLIPGDGIGREVIPAGKLVLENLSSKHGLKFNFI 57
           MLR++ N+LA     +  +A KSLTIGLIPGDGIG+EVIPAGK VL++L+ KHGL F+FI
Sbjct: 2   MLRSAANKLAGCRGLATNAARKSLTIGLIPGDGIGKEVIPAGKQVLQSLNPKHGLNFDFI 61

Query: 58  DLEAGWQTFLDTGKALPDETIDILKNECQGALFGAVQSPTNKVEGYSSPIVALRKKLGLY 117
           DL+AG+QTF DTGKALPDET+ ILK +CQGALFGAVQSPT KVEGYSSPIVALRK +GLY
Sbjct: 62  DLQAGFQTFQDTGKALPDETVQILKEKCQGALFGAVQSPTTKVEGYSSPIVALRKAMGLY 121

Query: 118 ANVRPVKSVL-SQEKPIDMVIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISEVATRN 176
           AN+RPVKSV  S E+P+DM+IVRENTEDLYIK EKTYID+ TGTRVAEA KRISE+AT+ 
Sbjct: 122 ANIRPVKSVEGSNERPVDMIIVRENTEDLYIKIEKTYIDKATGTRVAEATKRISEIATQR 181

Query: 177 IANIALEIALQRQKVNGSATLTVTHKSNVLSQSDGLFREICRQVYESNQDKFGSINYNEQ 236
           IA IAL+IALQR + NG ATLTVTHKSNVLSQSDGLFRE+CR++YE+N+DK+  I YNEQ
Sbjct: 182 IATIALDIALQRLQNNGKATLTVTHKSNVLSQSDGLFREVCREMYEANKDKYAGITYNEQ 241

Query: 237 IVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGFDFVVGEPCHG 296
           IVDSMVYR+FREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVG + V+GEPCHG
Sbjct: 242 IVDSMVYRMFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCHG 301

Query: 297 SAPDIAGKGISNPVATIRSTALMLEFMGHPEAAQDIHKAVDANLRDNTVKTPDLGGKSTT 356
           SAPDIAGKGI+NP+ATIRSTALMLEF+GH EAAQDIHKAVDANLRD  VKT DLGG +TT
Sbjct: 302 SAPDIAGKGIANPIATIRSTALMLEFLGHNEAAQDIHKAVDANLRDGLVKTADLGGNATT 361

Query: 357 QQVVDDVLSRM 367
           Q VVDD+L+R+
Sbjct: 362 QNVVDDILARL 372

>Smik_9.85 Chr9 complement(165648..166763) [1116 bp, 371 aa] {ON}
           YIL094C (REAL)
          Length = 371

 Score =  602 bits (1553), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/371 (78%), Positives = 333/371 (89%), Gaps = 4/371 (1%)

Query: 1   MLRTSFNQLAR---RSYTSATKSLTIGLIPGDGIGREVIPAGKLVLENLSSKHGLKFNFI 57
           MLR+   +L+     +  +A KSLTIGLIPGDGIG+EVIPAGK VLENL+SKHGL FNFI
Sbjct: 1   MLRSVATRLSTCRGLATNAARKSLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLSFNFI 60

Query: 58  DLEAGWQTFLDTGKALPDETIDILKNECQGALFGAVQSPTNKVEGYSSPIVALRKKLGLY 117
           DL AG+QTF +TGKALPDET+ +LK +CQGALFGAVQSPT KVEGYSSPIVALR+++GL+
Sbjct: 61  DLYAGFQTFQETGKALPDETVKVLKEQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLF 120

Query: 118 ANVRPVKSVLS-QEKPIDMVIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISEVATRN 176
           ANVRPVKSV   ++KPIDMVIVRENTEDLYIK EKTYID+ TGTRVA+A KRISE+ATR 
Sbjct: 121 ANVRPVKSVEGGKDKPIDMVIVRENTEDLYIKIEKTYIDKATGTRVADATKRISEIATRR 180

Query: 177 IANIALEIALQRQKVNGSATLTVTHKSNVLSQSDGLFREICRQVYESNQDKFGSINYNEQ 236
           IA IA++IAL+R +  G ATLTVTHKSNVLSQSDGLFREIC++VYESN+DK+G I YNEQ
Sbjct: 181 IATIAMDIALKRLQTRGEATLTVTHKSNVLSQSDGLFREICKEVYESNKDKYGQIKYNEQ 240

Query: 237 IVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGFDFVVGEPCHG 296
           IVDSMVYRLFREP+CFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVG + V+GEPCHG
Sbjct: 241 IVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCHG 300

Query: 297 SAPDIAGKGISNPVATIRSTALMLEFMGHPEAAQDIHKAVDANLRDNTVKTPDLGGKSTT 356
           SAPDIAGKGI+NP+ATIRSTALMLEF+GH  AAQDI+KAVDANLR+  +KTPDLGGK++T
Sbjct: 301 SAPDIAGKGIANPIATIRSTALMLEFLGHNNAAQDIYKAVDANLREGAIKTPDLGGKAST 360

Query: 357 QQVVDDVLSRM 367
           QQVV+DVLSR+
Sbjct: 361 QQVVEDVLSRL 371

>ZYRO0A01914g Chr1 complement(158403..159509) [1107 bp, 368 aa] {ON}
           highly similar to uniprot|P40495 Saccharomyces
           cerevisiae YIL094C LYS12 Homo-isocitrate dehydrogenase
           an NAD-linked mitochondrial enzyme required for the
           fourth step in the biosynthesis of lysine in which homo-
           isocitrate is oxidatively decarboxylated to alpha-
           ketoadipate
          Length = 368

 Score =  602 bits (1552), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/368 (78%), Positives = 324/368 (88%), Gaps = 1/368 (0%)

Query: 1   MLRTSFNQLARRSYTSATKSLTIGLIPGDGIGREVIPAGKLVLENLSSKHGLKFNFIDLE 60
           M R+S  ++A R   SA KS+ IGLIPGDGIG+EVIPAGK VLE L SKHGL+F+FIDL+
Sbjct: 1   MFRSSVAKVAARRAYSAPKSMKIGLIPGDGIGKEVIPAGKQVLEALGSKHGLQFDFIDLK 60

Query: 61  AGWQTFLDTGKALPDETIDILKNECQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYANV 120
           AGW+ F   GKALPD+T+ +LK +CQGALFGAVQSPT KV GYSSPIVALRK+LGLYANV
Sbjct: 61  AGWEAFQQQGKALPDDTVKVLKEQCQGALFGAVQSPTTKVAGYSSPIVALRKELGLYANV 120

Query: 121 RPVKSV-LSQEKPIDMVIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISEVATRNIAN 179
           RPVKSV    ++ +DM+IVRENTEDLYIKTEKTY+DE TGTRVAEAIKRISEVATR IA 
Sbjct: 121 RPVKSVEKGNDRNVDMIIVRENTEDLYIKTEKTYVDEATGTRVAEAIKRISEVATRKIAT 180

Query: 180 IALEIALQRQKVNGSATLTVTHKSNVLSQSDGLFREICRQVYESNQDKFGSINYNEQIVD 239
           IAL+I+LQR K  G ATLTVTHKSNVLSQSDGLFREIC+ VYE N+DK+G + YNEQIVD
Sbjct: 181 IALDISLQRLKSRGHATLTVTHKSNVLSQSDGLFREICKDVYEKNKDKYGEVKYNEQIVD 240

Query: 240 SMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGFDFVVGEPCHGSAP 299
           SMVYR+FREPECFDV+VAPNLYGDILSDGAAALVGSLGVVPSANVG + V+GEPCHGSAP
Sbjct: 241 SMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCHGSAP 300

Query: 300 DIAGKGISNPVATIRSTALMLEFMGHPEAAQDIHKAVDANLRDNTVKTPDLGGKSTTQQV 359
           DIAGKGISNP+ATIRSTALMLEF+GHPE AQDI+KAVDANL    V TPDLGGK+TTQQV
Sbjct: 301 DIAGKGISNPIATIRSTALMLEFLGHPEPAQDIYKAVDANLIKGDVNTPDLGGKATTQQV 360

Query: 360 VDDVLSRM 367
           VDD+LS++
Sbjct: 361 VDDILSKI 368

>Skud_9.79 Chr9 complement(163173..164288) [1116 bp, 371 aa] {ON}
           YIL094C (REAL)
          Length = 371

 Score =  602 bits (1552), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/353 (81%), Positives = 325/353 (92%), Gaps = 1/353 (0%)

Query: 16  SATKSLTIGLIPGDGIGREVIPAGKLVLENLSSKHGLKFNFIDLEAGWQTFLDTGKALPD 75
           +A KSLTIGLIPGDGIG+EVIPAGK VLENL+SKHGL FNFIDL AG+QTF +TGKALPD
Sbjct: 19  AARKSLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLSFNFIDLYAGFQTFQETGKALPD 78

Query: 76  ETIDILKNECQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYANVRPVKSVL-SQEKPID 134
           ET+++LK +CQGALFGAVQSPT KVEGYSSPIVALR+++GL+ANVRPVKSV  S+ KPID
Sbjct: 79  ETVNVLKKQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLFANVRPVKSVEGSRNKPID 138

Query: 135 MVIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISEVATRNIANIALEIALQRQKVNGS 194
           MVIVRENTEDLYIK EKTYID+ TGTRVA+A KRISE+ATR IA IAL+IAL+R +  G 
Sbjct: 139 MVIVRENTEDLYIKIEKTYIDKATGTRVADATKRISEIATRRIATIALDIALKRLQTRGE 198

Query: 195 ATLTVTHKSNVLSQSDGLFREICRQVYESNQDKFGSINYNEQIVDSMVYRLFREPECFDV 254
           ATLTVTHKSNVLSQ+DGLFREIC++VYESN+DK+G I YNEQIVDSMVYRLFREP+CFDV
Sbjct: 199 ATLTVTHKSNVLSQTDGLFREICKEVYESNKDKYGQIKYNEQIVDSMVYRLFREPQCFDV 258

Query: 255 IVAPNLYGDILSDGAAALVGSLGVVPSANVGFDFVVGEPCHGSAPDIAGKGISNPVATIR 314
           IVAPNLYGDILSDGAAALVGSLGVVPSANVG + V+GEPCHGSAPDIAGKGI+NP+ATIR
Sbjct: 259 IVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCHGSAPDIAGKGIANPIATIR 318

Query: 315 STALMLEFMGHPEAAQDIHKAVDANLRDNTVKTPDLGGKSTTQQVVDDVLSRM 367
           STALMLEF+GH  AAQDI+KAVDANLR+  + TPDLGGK++TQQVVDDVLSR+
Sbjct: 319 STALMLEFLGHNGAAQDIYKAVDANLREGAITTPDLGGKASTQQVVDDVLSRL 371

>CAGL0G02585g Chr7 (238931..240049) [1119 bp, 372 aa] {ON} highly
           similar to uniprot|P40495 Saccharomyces cerevisiae
           YIL094c LYS12 homo-isocitrate dehydrogenase
          Length = 372

 Score =  591 bits (1523), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/372 (76%), Positives = 328/372 (88%), Gaps = 5/372 (1%)

Query: 1   MLRTSFNQL-ARRSYTS---ATKSLTIGLIPGDGIGREVIPAGKLVLENLSSKHGLKFNF 56
           MLR S  +L A R ++S   A K+LTIGLIPGDGIG+EVIPAGK +LE +  K  L F F
Sbjct: 1   MLRGSATRLTAMRGFSSTRLAQKALTIGLIPGDGIGKEVIPAGKQILEKVGPKFDLDFKF 60

Query: 57  IDLEAGWQTFLDTGKALPDETIDILKNECQGALFGAVQSPTNKVEGYSSPIVALRKKLGL 116
           IDL AGW+TF +TGKALPDET+++L+ +CQGALFGAVQSPT KVEGYSSPIVALRK +GL
Sbjct: 61  IDLHAGWETFQNTGKALPDETVEVLRRDCQGALFGAVQSPTTKVEGYSSPIVALRKAMGL 120

Query: 117 YANVRPVKSVL-SQEKPIDMVIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISEVATR 175
           +ANVRPVK+V  + ++P+DMVIVRENTEDLYIK EKTY D  TGTRVAEA KRISEVATR
Sbjct: 121 FANVRPVKAVEGTNDRPVDMVIVRENTEDLYIKIEKTYTDPATGTRVAEATKRISEVATR 180

Query: 176 NIANIALEIALQRQKVNGSATLTVTHKSNVLSQSDGLFREICRQVYESNQDKFGSINYNE 235
            IA IAL+IALQR +  G ATLTVTHKSNVLSQSDGLFREIC+ VYESN+DK+G I YNE
Sbjct: 181 RIATIALDIALQRLQSRGHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGKIQYNE 240

Query: 236 QIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGFDFVVGEPCH 295
           QIVDSMVYR+FREPECFDV+VAPNLYGDILSDGAAALVGSLGVVPSANVG + V+GEPCH
Sbjct: 241 QIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCH 300

Query: 296 GSAPDIAGKGISNPVATIRSTALMLEFMGHPEAAQDIHKAVDANLRDNTVKTPDLGGKST 355
           GSAPDIAG+GI+NP+ATIRSTALMLEF+G+PEAAQ I+KAVD+N+R+N +KTPDLGGKST
Sbjct: 301 GSAPDIAGRGIANPIATIRSTALMLEFLGYPEAAQPIYKAVDSNIRENQIKTPDLGGKST 360

Query: 356 TQQVVDDVLSRM 367
           TQQVVDD+LS++
Sbjct: 361 TQQVVDDILSKI 372

>KAFR0J01360 Chr10 (249197..250318) [1122 bp, 373 aa] {ON} Anc_2.287
           YIL094C
          Length = 373

 Score =  587 bits (1514), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/372 (76%), Positives = 323/372 (86%), Gaps = 6/372 (1%)

Query: 1   MLRTSFNQLARRSYTSA---TKSLTIGLIPGDGIGREVIPAGKLVLENLSSKHGLKFNFI 57
           MLR+   + A   + S     KSLTIGLIPGDGIG+EVIPAGK VL+NLSS+HGL FNFI
Sbjct: 1   MLRSVVTKSATIRHLSTKGINKSLTIGLIPGDGIGKEVIPAGKQVLQNLSSRHGLNFNFI 60

Query: 58  DLEAGWQTFLDTGKALPDETIDILKNECQGALFGAVQSPTNKVEGYSSPIVALRKKLGLY 117
           DLEAG+QTFLDTGKALPDET+ +LK +CQG LFGAVQSPT +V+ YSSPIVALRK+L LY
Sbjct: 61  DLEAGFQTFLDTGKALPDETVKVLKEQCQGVLFGAVQSPTTRVDNYSSPIVALRKELQLY 120

Query: 118 ANVRPVKSVLSQE--KPIDMVIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISEVATR 175
           AN+RPVKSV      KP+DMVIVRENTEDLYIK EK+Y D+  G RVAEA KRI+EVATR
Sbjct: 121 ANIRPVKSVAGAHSGKPVDMVIVRENTEDLYIKIEKSYKDQ-NGMRVAEATKRITEVATR 179

Query: 176 NIANIALEIALQRQKVNGSATLTVTHKSNVLSQSDGLFREICRQVYESNQDKFGSINYNE 235
            IA IAL++ALQR K NG ATLTVTHKSNVLSQSDGLFREIC+ VY++N+DK+  INYNE
Sbjct: 180 KIAKIALDVALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYQANKDKYAGINYNE 239

Query: 236 QIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGFDFVVGEPCH 295
           QI+DSMVYR+FREPE FDVIVAPNLYGDILSDGAAALVGSLGVVPSANVG D V+GEPCH
Sbjct: 240 QIIDSMVYRMFREPEYFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPDIVMGEPCH 299

Query: 296 GSAPDIAGKGISNPVATIRSTALMLEFMGHPEAAQDIHKAVDANLRDNTVKTPDLGGKST 355
           GSAPDIAGKGI+NP+ATIRSTALMLEF+GH EAAQDIHKAV++N+R+N +KTPDLGG S+
Sbjct: 300 GSAPDIAGKGIANPIATIRSTALMLEFLGHKEAAQDIHKAVESNMRENKIKTPDLGGNSS 359

Query: 356 TQQVVDDVLSRM 367
           TQ VVDDVL ++
Sbjct: 360 TQNVVDDVLEKL 371

>Kpol_1003.39 s1003 complement(96083..97195) [1113 bp, 370 aa] {ON}
           complement(96083..97195) [1113 nt, 371 aa]
          Length = 370

 Score =  580 bits (1494), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/370 (75%), Positives = 320/370 (86%), Gaps = 3/370 (0%)

Query: 1   MLRTS-FNQLARRSYTSATKS-LTIGLIPGDGIGREVIPAGKLVLENLSSKHGLKFNFID 58
           MLR   +   ARR+  +  +S LTIGLIPGDGIG+EVIPAGK VLE +  K+ + F FID
Sbjct: 1   MLRNGVYRACARRTVVNGARSNLTIGLIPGDGIGKEVIPAGKKVLETIGDKYSIDFKFID 60

Query: 59  LEAGWQTFLDTGKALPDETIDILKNECQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYA 118
           L AGWQTFLDTGKALPDET+ ILK +CQGALFGAVQSPT KVEGYSSPIVALRK+LGLYA
Sbjct: 61  LHAGWQTFLDTGKALPDETVSILKQQCQGALFGAVQSPTTKVEGYSSPIVALRKQLGLYA 120

Query: 119 NVRPVKSVL-SQEKPIDMVIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISEVATRNI 177
           N+RPVKSV  + ++P+DMVIVRENTEDLYIK E+TYIDE TGT+VAEA KRISEVATR I
Sbjct: 121 NIRPVKSVSGTNDRPVDMVIVRENTEDLYIKEERTYIDEATGTKVAEATKRISEVATRKI 180

Query: 178 ANIALEIALQRQKVNGSATLTVTHKSNVLSQSDGLFREICRQVYESNQDKFGSINYNEQI 237
           A IAL+IALQR K  G ATLTVTHKSNVLSQSDGLFRE+CR VYE N+D +G+++YNEQI
Sbjct: 181 AKIALDIALQRLKNTGKATLTVTHKSNVLSQSDGLFREVCRDVYEKNKDLYGNVSYNEQI 240

Query: 238 VDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGFDFVVGEPCHGS 297
           VDSMVYR+FREPECFDV+VAPNLYGDILSDGAAALVGSLGVVPSANVG D ++GEPCHGS
Sbjct: 241 VDSMVYRIFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPDIIIGEPCHGS 300

Query: 298 APDIAGKGISNPVATIRSTALMLEFMGHPEAAQDIHKAVDANLRDNTVKTPDLGGKSTTQ 357
           APDI+G+GISNPVATIRS ALML+F+G+ EAA+DI  AVD N+R   +KTPDLGG S+T 
Sbjct: 301 APDISGQGISNPVATIRSAALMLQFLGYNEAAKDIQNAVDENIRSGKIKTPDLGGDSSTT 360

Query: 358 QVVDDVLSRM 367
           +V DD+LS++
Sbjct: 361 EVTDDILSKL 370

>TBLA0B05940 Chr2 complement(1402869..1403978) [1110 bp, 369 aa]
           {ON} Anc_2.287 YIL094C
          Length = 369

 Score =  578 bits (1491), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/369 (75%), Positives = 321/369 (86%), Gaps = 2/369 (0%)

Query: 1   MLRTSFNQLARRSY-TSATKSLTIGLIPGDGIGREVIPAGKLVLENLSSKHGLKFNFIDL 59
           MLRTS  Q +  +   S+ K+LTIGLIPGDGIG+EVIPAGK VL+NL+ KHGL F FIDL
Sbjct: 1   MLRTSVRQFSVSARNASSLKTLTIGLIPGDGIGKEVIPAGKQVLQNLNKKHGLAFEFIDL 60

Query: 60  EAGWQTFLDTGKALPDETIDILKNECQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYAN 119
           +AG+QTFLDTG ALP +T+DILKN+CQGALFGAVQSPT KVEGYSSPIV LRK+LGL+AN
Sbjct: 61  QAGYQTFLDTGAALPRDTVDILKNKCQGALFGAVQSPTTKVEGYSSPIVQLRKELGLFAN 120

Query: 120 VRPVKSVLSQE-KPIDMVIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISEVATRNIA 178
           VRPVK+V   + KPID+VIVRENTEDLYIK EKTY D K G+R+AEA KRI+E AT+ IA
Sbjct: 121 VRPVKTVEGTDAKPIDLVIVRENTEDLYIKIEKTYTDPKDGSRIAEATKRITETATKRIA 180

Query: 179 NIALEIALQRQKVNGSATLTVTHKSNVLSQSDGLFREICRQVYESNQDKFGSINYNEQIV 238
             AL+IALQR K  GSATLTVTHKSNVLSQSDGLFRE+C++VYESN+  +  + YNEQIV
Sbjct: 181 KTALDIALQRLKTKGSATLTVTHKSNVLSQSDGLFREVCKEVYESNKSLYSGVAYNEQIV 240

Query: 239 DSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGFDFVVGEPCHGSA 298
           DSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLG+VPSANVG + V+GEPCHGSA
Sbjct: 241 DSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGLVPSANVGPNIVIGEPCHGSA 300

Query: 299 PDIAGKGISNPVATIRSTALMLEFMGHPEAAQDIHKAVDANLRDNTVKTPDLGGKSTTQQ 358
           PDIAGKGI+NP+ATIRSTA MLE++G+   AQDI+KAVDAN+RDN +KT DLGG STTQQ
Sbjct: 301 PDIAGKGIANPIATIRSTAQMLEYLGYSNPAQDIYKAVDANIRDNKIKTADLGGDSTTQQ 360

Query: 359 VVDDVLSRM 367
           V+DD+L ++
Sbjct: 361 VIDDILGKL 369

>TPHA0C03410 Chr3 complement(748639..749754) [1116 bp, 371 aa] {ON}
           Anc_2.287 YIL094C
          Length = 371

 Score =  574 bits (1479), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/371 (75%), Positives = 322/371 (86%), Gaps = 4/371 (1%)

Query: 1   MLRTS-FNQLARRSYTSATK--SLTIGLIPGDGIGREVIPAGKLVLENLSSKHGLKFNFI 57
           MLR S +N+  +R+  + +K  +LTIGLIPGDGIG+EVIP+G+ VLE +  KHGL FNFI
Sbjct: 1   MLRRSVYNRQFQRTIGNISKKSNLTIGLIPGDGIGKEVIPSGRQVLETIGPKHGLTFNFI 60

Query: 58  DLEAGWQTFLDTGKALPDETIDILKNECQGALFGAVQSPTNKVEGYSSPIVALRKKLGLY 117
           DL+AGWQTFLDTGKALP ET+  L+  C GALFGAVQSPT KVEGYSSPIVALRK+LGLY
Sbjct: 61  DLQAGWQTFLDTGKALPVETVKTLRENCDGALFGAVQSPTTKVEGYSSPIVALRKELGLY 120

Query: 118 ANVRPVKSVLSQ-EKPIDMVIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISEVATRN 176
           AN+RPVKSV +   K +DMVIVRENTEDLYIK EKTYIDEKTGTRVA+A KRISEVATR 
Sbjct: 121 ANIRPVKSVDTPGNKKVDMVIVRENTEDLYIKLEKTYIDEKTGTRVADATKRISEVATRR 180

Query: 177 IANIALEIALQRQKVNGSATLTVTHKSNVLSQSDGLFREICRQVYESNQDKFGSINYNEQ 236
           IA IAL+IALQR K NG+  LTVTHKSNVLSQSDGLFRE+C++V+ESN+  +  I YNEQ
Sbjct: 181 IAKIALDIALQRLKNNGNVQLTVTHKSNVLSQSDGLFREVCKEVFESNKTLYSDIQYNEQ 240

Query: 237 IVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGFDFVVGEPCHG 296
           I+DSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVG   V+GEPCHG
Sbjct: 241 IIDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPGIVIGEPCHG 300

Query: 297 SAPDIAGKGISNPVATIRSTALMLEFMGHPEAAQDIHKAVDANLRDNTVKTPDLGGKSTT 356
           SAPDIAGKGISNP+ATIRSTALMLEF+GH +AAQDI  AVD+NLR++ +KTPDLGGK++T
Sbjct: 301 SAPDIAGKGISNPIATIRSTALMLEFLGHSQAAQDIQTAVDSNLREDKIKTPDLGGKNST 360

Query: 357 QQVVDDVLSRM 367
             VV+DV+ R+
Sbjct: 361 SDVVNDVIRRL 371

>Ecym_3326 Chr3 complement(624805..625905) [1101 bp, 366 aa] {ON}
           similar to Ashbya gossypii ADL214C
          Length = 366

 Score =  569 bits (1466), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 273/368 (74%), Positives = 321/368 (87%), Gaps = 3/368 (0%)

Query: 1   MLRTSFNQLARRSYTSATKSLTIGLIPGDGIGREVIPAGKLVLENLSSKHGLKFNFIDLE 60
           MLR    QL+ R+Y + +KS TIGLIPGDGIG+EVIP G+ VLE +  K+G+ F +IDL+
Sbjct: 1   MLRVGRGQLSTRTYVT-SKSFTIGLIPGDGIGKEVIPVGRKVLEKIGPKYGVDFKYIDLQ 59

Query: 61  AGWQTFLDTGKALPDETIDILKNECQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYANV 120
           AGWQTFLDTGKALPD+T++ L+N CQGALFGAVQSPT KV+GYSSPIVALRK LGLYAN+
Sbjct: 60  AGWQTFLDTGKALPDDTVEQLRNNCQGALFGAVQSPTTKVQGYSSPIVALRKALGLYANI 119

Query: 121 RPVKSV-LSQEKPIDMVIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISEVATRNIAN 179
           RPVKSV  + ++P+D+VI RENTEDLYIK+E+TYID++TG RVAEAIKRISE ATRNIAN
Sbjct: 120 RPVKSVDGTGDRPVDLVIARENTEDLYIKSERTYIDKETGGRVAEAIKRISEHATRNIAN 179

Query: 180 IALEIALQRQKVNGSATLTVTHKSNVLSQSDGLFREICRQVYESNQDKFGSINYNEQIVD 239
           IALEIALQR K  G ATLTVTHKSNVLSQSDGLFREIC+ VY+SN+ KF ++ YNEQIVD
Sbjct: 180 IALEIALQRLKEKGHATLTVTHKSNVLSQSDGLFREICKSVYQSNK-KFANVQYNEQIVD 238

Query: 240 SMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGFDFVVGEPCHGSAP 299
           SMVYRLF+EP+CFDVIVAPNLYGDILSDGAAALVGSLGVVPS NVG + V+GEPCHGSAP
Sbjct: 239 SMVYRLFKEPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSVNVGPNIVIGEPCHGSAP 298

Query: 300 DIAGKGISNPVATIRSTALMLEFMGHPEAAQDIHKAVDANLRDNTVKTPDLGGKSTTQQV 359
           DI G+GI+NP+ATIRS AL+LEF+G PEAA+ I K VD N+R+N +KTPDLGG ST +QV
Sbjct: 299 DIVGQGIANPIATIRSAALLLEFLGLPEAARHIEKVVDENIRENKIKTPDLGGNSTGEQV 358

Query: 360 VDDVLSRM 367
            +D+LSR+
Sbjct: 359 ANDILSRI 366

>ADL214C Chr4 complement(328094..329197) [1104 bp, 367 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL094C
           (LYS12)
          Length = 367

 Score =  543 bits (1399), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 249/367 (67%), Positives = 310/367 (84%)

Query: 1   MLRTSFNQLARRSYTSATKSLTIGLIPGDGIGREVIPAGKLVLENLSSKHGLKFNFIDLE 60
           M R+S   L  ++  + +K+LTIGLIPGDGIG+EVIPAG+ VLE +  KH ++F++  L+
Sbjct: 1   MHRSSATSLIHKATYATSKTLTIGLIPGDGIGKEVIPAGQRVLEAIGKKHDIRFSYEHLD 60

Query: 61  AGWQTFLDTGKALPDETIDILKNECQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYANV 120
           AGWQTFL+TG ALP  T++ L+  CQGALFGAVQSPT KVEGYSSPIVALR++LGLYAN+
Sbjct: 61  AGWQTFLETGNALPGATVEALRERCQGALFGAVQSPTTKVEGYSSPIVALRRQLGLYANI 120

Query: 121 RPVKSVLSQEKPIDMVIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISEVATRNIANI 180
           RPVKSV    +P+D+VIVRENTEDLY++ E+TY+D  TG RVAEAIKRISE AT  IA I
Sbjct: 121 RPVKSVSGTGQPVDLVIVRENTEDLYVQQERTYVDAATGKRVAEAIKRISEPATERIAEI 180

Query: 181 ALEIALQRQKVNGSATLTVTHKSNVLSQSDGLFREICRQVYESNQDKFGSINYNEQIVDS 240
           +L +ALQRQ++ G   LTVTHKSNVLSQ+DGLF+E+CR+VYE+N+  +GSI YNEQIVDS
Sbjct: 181 SLRLALQRQRMGGRGALTVTHKSNVLSQTDGLFKEVCREVYEANKKSYGSIEYNEQIVDS 240

Query: 241 MVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGFDFVVGEPCHGSAPD 300
           MVYRLF+EP CFDV+VAPNLYGD+LSDGAAALVGSLG+VPS NVG + ++GEPCHGSAPD
Sbjct: 241 MVYRLFKEPHCFDVVVAPNLYGDLLSDGAAALVGSLGLVPSVNVGNNIIIGEPCHGSAPD 300

Query: 301 IAGKGISNPVATIRSTALMLEFMGHPEAAQDIHKAVDANLRDNTVKTPDLGGKSTTQQVV 360
           IAG+GI+NP+ATIRS +LML+F+G  EAA DI +AV  NL+D  V +PDLGGK+TTQ+V+
Sbjct: 301 IAGRGIANPIATIRSVSLMLQFLGLEEAASDIDQAVTGNLKDRQVVSPDLGGKNTTQEVL 360

Query: 361 DDVLSRM 367
           DD+L+R+
Sbjct: 361 DDILARI 367

>KLLA0E03125g Chr5 (288825..289931) [1107 bp, 368 aa] {ON} highly
           similar to uniprot|P28241 Saccharomyces cerevisiae
           YOR136W IDH2 Subunit of mitochondrial NAD( )- dependent
           isocitrate dehydrogenase which catalyzes the oxidation
           of isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 368

 Score =  176 bits (447), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 123/359 (34%), Positives = 194/359 (54%), Gaps = 32/359 (8%)

Query: 18  TKSLTIGLIPGDGIGREVIPAGKLVLENLSSKHGLKFNFIDLEAGWQTFLDTGKALPDET 77
           T   T+  I GDG+G E+  + K +    ++K  +++   D+      F++    +PD  
Sbjct: 33  TGKYTVSFIEGDGVGPEISKSVKAIFS--AAKVPIEWESCDVSP---IFVNGLTTIPDPA 87

Query: 78  IDILKNECQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYANVRPVKSV---LSQEKPID 134
           +  + N+   AL G + +P  K  G+ S  + LRK  GL+ANVRP KS+    +  + ++
Sbjct: 88  VASI-NKNLIALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSIEGYKTTYENVN 144

Query: 135 MVIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISEVATRNIANIALEIA--LQRQKVN 192
           +V++RENTE  Y     + I+      V ++IK I++ A+  +   A E A  + R KV 
Sbjct: 145 LVLIRENTEGEY-----SGIEHVVAPGVVQSIKLITQDASERVIRYAFEYARAVDRSKV- 198

Query: 193 GSATLTVTHKSNVLSQSDGLFREICRQVYESNQDKFGSINYNEQIVDSMVYRLFREPECF 252
                 V HKS +   +DGLF ++ +++      ++  I    +++D+ V +  + PE +
Sbjct: 199 -----LVVHKSTIQRLADGLFVDVAKKL----SSEYPDIELQTELLDNTVLKTVQHPEAY 249

Query: 253 D--VIVAPNLYGDILSDGAAAL-VGSLGVVPSANVGFDFVVGEPCHGSAPDIAGKGISNP 309
           D  V+V PNLYGDILSD  + L  GSLG+ PSAN+G    + E  HGSAPDIAG+  +NP
Sbjct: 250 DDVVVVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHTVSIFEAVHGSAPDIAGQNKANP 309

Query: 310 VATIRSTALMLEFMGHPEAAQDIHKAVDANL-RDNTVKTPDLGGKSTTQQVVDDVLSRM 367
            A + S+ +ML  MG  E A  I KAV   +  D   +T DLGG ++T    D V+ R+
Sbjct: 310 TALLLSSVMMLNHMGLTEHADKIEKAVLTTIASDAKNRTGDLGGSASTSSFTDAVIERL 368

>KLTH0F15048g Chr6 complement(1232566..1233672) [1107 bp, 368 aa]
           {ON} highly similar to uniprot|P28241 Saccharomyces
           cerevisiae YOR136W IDH2 Subunit of mitochondrial NAD( )-
           dependent isocitrate dehydrogenase which catalyzes the
           oxidation of isocitrate to alpha-ketoglutarate in the
           TCA cycle
          Length = 368

 Score =  175 bits (444), Expect = 7e-51,   Method: Compositional matrix adjust.
 Identities = 127/360 (35%), Positives = 190/360 (52%), Gaps = 32/360 (8%)

Query: 17  ATKSLTIGLIPGDGIGREVIPAGKLVLENLSSKHGLKFNFIDLEAGWQTFLDTGKALPDE 76
           AT   T+  I GDG+G E+  A K +    ++K  +++   D+      F++    +P  
Sbjct: 32  ATGKYTVSFIEGDGVGPEISKAVKDIFA--AAKAPIQWESCDVSP---LFINGLTTIPQP 86

Query: 77  TIDILKNECQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYANVRPVKSVLSQEKP---I 133
             D + N+   AL G + +P  K  G+ S  + LRK  GL+ANVRP KSV   +     +
Sbjct: 87  AQDSI-NKNLIALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSVQGYKTAYDNV 143

Query: 134 DMVIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISEVATRNIANIALEIA--LQRQKV 191
           D+V++RENTE  Y     + I+      V ++IK I++ A+  +   A E A  ++R KV
Sbjct: 144 DLVLIRENTEGEY-----SGIEHVVSPGVVQSIKLITQDASERVIRYAFEYARAVERPKV 198

Query: 192 NGSATLTVTHKSNVLSQSDGLFREICRQVYESNQDKFGSINYNEQIVDSMVYRLFREPEC 251
                  V HKS +   +DGLF  +  Q+ +   D    I    +++D+ V    R+P  
Sbjct: 199 ------VVVHKSTIQRLADGLFVSVAEQLSKEYPD----IELQTELIDNTVLHTVRDPTK 248

Query: 252 FD--VIVAPNLYGDILSDGAAAL-VGSLGVVPSANVGFDFVVGEPCHGSAPDIAGKGISN 308
           +   V+V PNLYGDILSD  + L  GSLG+ PSAN+G    + E  HGSAPDIAG+  +N
Sbjct: 249 YSDVVVVCPNLYGDILSDMNSGLSAGSLGLTPSANIGHKVSIFEAVHGSAPDIAGQNKAN 308

Query: 309 PVATIRSTALMLEFMGHPEAAQDIHKAVDANLRDNT-VKTPDLGGKSTTQQVVDDVLSRM 367
           P A + S+ +ML  MG  E A  I KAV   +      +T DLGG ++T    + V+SR+
Sbjct: 309 PTALLLSSVMMLNHMGLTEHADKIEKAVFTTIAAGPESRTGDLGGSASTSSFAEAVISRL 368

>ADL223W Chr4 (312893..313981) [1089 bp, 362 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL037C (IDH1)
          Length = 362

 Score =  174 bits (440), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 120/380 (31%), Positives = 196/380 (51%), Gaps = 34/380 (8%)

Query: 1   MLRTSFNQLARRSYTSATKSL---------TIGLIPGDGIGREVIPAGKLVLENLSSKHG 51
           M R + + + +R Y +  + L         T+ LIPGDGIG+EV  +   + E  +    
Sbjct: 1   MFRNTLSHITKRGYAAGREQLLPKKYGGRYTVTLIPGDGIGKEVTDSVVQIFEAENVP-- 58

Query: 52  LKFNFIDLEAGWQTFLDTGKALPDETIDILKNECQGALFGAVQSPTNKVEGYSSPIVALR 111
                +D E+   + L+       + ++ LK    G L G   +P ++  G+ S  VA R
Sbjct: 59  -----VDWESVELSALEENHEGVQKAVESLKRNKVG-LKGIWHTPADQT-GHGSLNVAFR 111

Query: 112 KKLGLYANVRPVKS---VLSQEKPIDMVIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKR 168
           K+L ++ANV   KS   V ++ + +D+VI+RENTE  Y     + ++ ++   V E++K 
Sbjct: 112 KQLDIFANVALFKSFPGVKTKLQDVDLVIIRENTEGEY-----SGLEHESVPGVVESLKI 166

Query: 169 ISEVATRNIANIALEIALQRQKVNGSATLTVTHKSNVLSQSDGLFREICRQVYESNQDKF 228
           +++  +  IA  A + AL+    N    +   HK+N++   DGLFR     V E    ++
Sbjct: 167 MTKAKSERIARFAFDFALK----NNRKAVCAVHKANIMKLGDGLFRN---TVSEIGAKEY 219

Query: 229 GSINYNEQIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGFDF 288
             +N +  IVD+   +   +P  FDV+V PNLYG IL +  AAL+G  G+VP AN G ++
Sbjct: 220 PEVNVSSIIVDNASMQAVAKPHQFDVLVTPNLYGSILGNIGAALIGGPGLVPGANFGREY 279

Query: 289 VVGEP-CHGSAPDIAGKGISNPVATIRSTALMLEFMGHPEAAQDIHKAVDANLRDNTVKT 347
            V EP C     DI G+ ++NP A I S+ LML  +G  E A  I +A    + +    T
Sbjct: 280 AVFEPGCRHVGLDIKGQDVANPTAMILSSTLMLRHLGLNEYADRISRATYETIAEGKRTT 339

Query: 348 PDLGGKSTTQQVVDDVLSRM 367
            D+GG +TT +  + V+ ++
Sbjct: 340 KDIGGTATTTEFTNAVIDKL 359

>Ecym_2313 Chr2 complement(610493..611605) [1113 bp, 370 aa] {ON}
           similar to Ashbya gossypii AFR137C
          Length = 370

 Score =  172 bits (437), Expect = 8e-50,   Method: Compositional matrix adjust.
 Identities = 123/357 (34%), Positives = 188/357 (52%), Gaps = 28/357 (7%)

Query: 18  TKSLTIGLIPGDGIGREVIPAGKLVLENLSSKHGLKFNFIDLEAGWQTFLDTGKALPDET 77
           T   T+  I GDGIG E+  + K +    ++K  +++ + D+      F++    +PD  
Sbjct: 35  TGKYTVSFIEGDGIGPEISQSVKDIFS--AAKVPVEWEYCDVTP---IFINGLTTIPDPA 89

Query: 78  IDILKNECQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYANVRPVKSV---LSQEKPID 134
           +  + N+   AL G + +P  K  G+ S  + LRK  GL+ANVRP KS+    +  + +D
Sbjct: 90  VQSI-NKNLVALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSIEGFKTTYENVD 146

Query: 135 MVIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISEVATRNIANIALEIALQRQKVNGS 194
           +V++RENTE  Y     + I+      V ++IK I+  A+  +   A E A    +  G 
Sbjct: 147 LVLIRENTEGEY-----SGIEHVVSPGVVQSIKLITRDASERVIRYAFEYA----RAVGR 197

Query: 195 ATLTVTHKSNVLSQSDGLFREICRQVYESNQDKFGSINYNEQIVDSMVYRLFREPECFD- 253
             + V HKS +   +DGLF  + ++V +   D    I    +++D+ V  +  +PE +  
Sbjct: 198 PKVVVVHKSTIQRLADGLFVNVAQEVGKEYPD----IELQPELIDNTVLNVVSKPEKYSD 253

Query: 254 -VIVAPNLYGDILSDGAAAL-VGSLGVVPSANVGFDFVVGEPCHGSAPDIAGKGISNPVA 311
            V V PNLYGDILSD  + L  GSLG+ PSAN+G    + E  HGSAPDIAG+  +NP A
Sbjct: 254 SVAVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHTVSIFEAVHGSAPDIAGQNCANPTA 313

Query: 312 TIRSTALMLEFMGHPEAAQDIHKAVDANL-RDNTVKTPDLGGKSTTQQVVDDVLSRM 367
            + S+ +ML  MG  E A  I  AV A +  D   +T DL G +TT      V+ R+
Sbjct: 314 LLLSSVMMLNHMGLHEHADQIESAVLATVASDKKNRTADLAGTATTSSFTKAVIERL 370

>Kwal_55.21273 s55 complement(762121..763227) [1107 bp, 368 aa] {ON}
           YOR136W (IDH2) - NAD+-dependent isocitrate dehydrogenase
           [contig 130] FULL
          Length = 368

 Score =  171 bits (432), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 124/360 (34%), Positives = 191/360 (53%), Gaps = 32/360 (8%)

Query: 17  ATKSLTIGLIPGDGIGREVIPAGKLVLENLSSKHGLKFNFIDLEAGWQTFLDTGKALPDE 76
           AT   T+  I GDG+G E+  A K +    ++K  +++   D+      F++    +P  
Sbjct: 32  ATGKYTVSFIEGDGVGPEISKAVKDIFA--AAKAPIQWETCDVTP---LFINGLTTIPQP 86

Query: 77  TIDILKNECQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYANVRPVKSVLSQEKP---I 133
             D + N+   AL G + +P  K  G+ S  + LRK  GL+ANVRP KS+   +     +
Sbjct: 87  AQDSI-NKNLIALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSIQGFKTAYDNV 143

Query: 134 DMVIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISEVATRNIANIALEIA--LQRQKV 191
           D+V++RENTE  Y     + I+      V ++IK I++ A+  +   A E A  ++R KV
Sbjct: 144 DLVLIRENTEGEY-----SGIEHVVAPGVVQSIKLITQDASERVIRYAFEYARAVERPKV 198

Query: 192 NGSATLTVTHKSNVLSQSDGLFREICRQVYESNQDKFGSINYNEQIVDSMVYRLFREPEC 251
                  V HKS +   +DGLF  +  ++ +   D    I    +++D+ V    R+P  
Sbjct: 199 ------LVVHKSTIQRLADGLFVSVAEKLAKEYPD----IELQTELIDNTVLHTVRDPLK 248

Query: 252 FD--VIVAPNLYGDILSDGAAAL-VGSLGVVPSANVGFDFVVGEPCHGSAPDIAGKGISN 308
           +   V+V PNLYGDILSD  + L  GSLG+ PSAN+G +  + E  HGSAPDIAG+  +N
Sbjct: 249 YSDVVVVCPNLYGDILSDMNSGLSAGSLGLTPSANIGHEVSIFEAVHGSAPDIAGQNKAN 308

Query: 309 PVATIRSTALMLEFMGHPEAAQDIHKAVDANLRDNTV-KTPDLGGKSTTQQVVDDVLSRM 367
           P A + S+ +ML  MG  E A  I KAV + +      +T DL G ++T    + V+SR+
Sbjct: 309 PTALLLSSVMMLNHMGLTEHADKIEKAVFSTIASGPENRTGDLAGSASTSSFAEAVISRL 368

>Ecym_3316 Chr3 (608744..609832) [1089 bp, 362 aa] {ON} similar to
           Ashbya gossypii ADL223W
          Length = 362

 Score =  168 bits (426), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 120/380 (31%), Positives = 197/380 (51%), Gaps = 34/380 (8%)

Query: 1   MLRTSFNQLARRSYTSATKSL---------TIGLIPGDGIGREVIPAGKLVLENLSSKHG 51
           MLR +F Q+++R +  A+  L         T+ LIPGDG+G+EV  +   + E  +    
Sbjct: 1   MLRNTFVQISKRRFALASGQLLPKKYGGRYTVTLIPGDGVGKEVTDSVVNIFEAENVP-- 58

Query: 52  LKFNFIDLEAGWQTFLDTGKALPDETIDILKNECQGALFGAVQSPTNKVEGYSSPIVALR 111
                ID E+   + L+       + ++ LK    G L G   +P ++  G+ S  VA R
Sbjct: 59  -----IDWESVELSGLEENMEGVQKAVESLKRNKVG-LKGIWSTPADQT-GHGSLNVAFR 111

Query: 112 KKLGLYANVRPVKS---VLSQEKPIDMVIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKR 168
           K+L ++ANV   KS   V ++ K +D+VI+RENTE  Y     + ++ ++   V E++K 
Sbjct: 112 KQLDIFANVALFKSFPGVKTKLKDVDLVIIRENTEGEY-----SGLEHESVPGVVESLKI 166

Query: 169 ISEVATRNIANIALEIALQRQKVNGSATLTVTHKSNVLSQSDGLFREICRQVYESNQDKF 228
           +++  +  IA  A + AL+    N   ++   HK+N++   DGLFR    ++      ++
Sbjct: 167 MTKAKSERIARFAFDFALK----NNRRSVCAVHKANIMKLGDGLFRNTVNEI---GAKEY 219

Query: 229 GSINYNEQIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGFDF 288
             +     IVD+   +   +P  FDV+V PNLYG IL +  AAL+GS G+VP AN G ++
Sbjct: 220 PELEVKSIIVDNASMQAVAKPHQFDVLVTPNLYGSILGNVGAALIGSPGLVPGANFGREY 279

Query: 289 VVGEP-CHGSAPDIAGKGISNPVATIRSTALMLEFMGHPEAAQDIHKAVDANLRDNTVKT 347
            V EP       DI G+ ++NP A I S+ LML  +G  + A  I KA    + +    T
Sbjct: 280 AVFEPGSRHVGLDIKGQDVANPTAMILSSTLMLRHLGLNDYADRISKATYEVIAEGKHTT 339

Query: 348 PDLGGKSTTQQVVDDVLSRM 367
            D+GG ++T Q    ++ ++
Sbjct: 340 KDIGGHASTTQFTKAIVDKL 359

>TPHA0J02770 Chr10 (617727..618857) [1131 bp, 376 aa] {ON} Anc_2.278
           YNL037C
          Length = 376

 Score =  169 bits (427), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 125/366 (34%), Positives = 188/366 (51%), Gaps = 40/366 (10%)

Query: 15  TSATKSLTIGLIPGDGIGREVIPAGKLVLENLSSKHGLKFNFIDLEAGWQ------TFLD 68
           T+++ + T+  I GDG+G E+  + K +           F+  ++   WQ       F++
Sbjct: 38  TNSSGTYTVPFIEGDGVGPEISKSVKDI-----------FSAANVPIQWQPCDVGPIFVN 86

Query: 69  TGKALPDETIDILKNECQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYANVRPVKSV-- 126
               +P+  +  +K E   AL G + +P  K  G+ S  + LRK   L+ANVRP KSV  
Sbjct: 87  GLTTIPEPAVKAIK-ESLVALKGPLATPVGK--GHRSLNLTLRKTFDLFANVRPAKSVPN 143

Query: 127 -LSQEKPIDMVIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISEVATRNIANIALEIA 185
             S  + +D+V++RENTE  Y     + I+      V ++IK I+  A+  +   A E A
Sbjct: 144 YKSTYENVDLVLIRENTEGEY-----SGIEHIVTPGVVQSIKLITREASEKVIRYAYEYA 198

Query: 186 LQRQKVNGSATLTVTHKSNVLSQSDGLFREICRQVYESNQDKFGSINYNEQIVDSMVYRL 245
           +      G   L V HKS +    DGLF +I  ++    Q ++ SI    QI+D+ V  +
Sbjct: 199 IAV----GRPRLIVVHKSTIQRLGDGLFVQIANEL----QSEYPSIKLETQILDNTVLNV 250

Query: 246 FREPECFD--VIVAPNLYGDILSDGAAAL-VGSLGVVPSANVGFDFVVGEPCHGSAPDIA 302
              P  +   V V PNLYGDILSD  + L  GSLG+ PSAN+G    + E  HGSAPDIA
Sbjct: 251 VSNPTLYKDAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGDKVSIFEAVHGSAPDIA 310

Query: 303 GKGISNPVATIRSTALMLEFMGHPEAAQDIHKAVDANLRDNT-VKTPDLGGKSTTQQVVD 361
           G+  +NP A + S+ +ML  MG  E A  I  AV + +      +T DLGG +TT    +
Sbjct: 311 GQNKANPTALLLSSVMMLNHMGLEEHASRIENAVLSTIASGPESRTGDLGGSATTSSFTE 370

Query: 362 DVLSRM 367
            V+ ++
Sbjct: 371 CVIKKL 376

>Suva_8.188 Chr8 (335409..336518) [1110 bp, 369 aa] {ON} YOR136W
           (REAL)
          Length = 369

 Score =  167 bits (424), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 129/397 (32%), Positives = 193/397 (48%), Gaps = 58/397 (14%)

Query: 1   MLRTSFNQLARRSYTSATKSLTIG----------------LIPGDGIGREVIPAGKLVLE 44
           MLR +F +   R + S  K  +IG                 I GDGIG E+  + K +  
Sbjct: 1   MLRNTFLRNTSRRFLSTVKQPSIGRYTGKPDPSTGRYTVSFIEGDGIGPEISKSVKKI-- 58

Query: 45  NLSSKHGLKFNFIDLEAGWQ------TFLDTGKALPDETI-DILKNECQGALFGAVQSPT 97
                    F+  D+   W+       F++    +PD  +  I KN    AL G + +P 
Sbjct: 59  ---------FSAADVPINWEFCDVNPIFVNGLTTIPDPAVQSITKNLV--ALKGPLATPI 107

Query: 98  NKVEGYSSPIVALRKKLGLYANVRPVKSV---LSQEKPIDMVIVRENTEDLYIKTEKTYI 154
            K  G+ S  + LRK  GL+ANVRP KS+    +  + +D+V++RENTE  Y     + I
Sbjct: 108 GK--GHRSLNLTLRKTFGLFANVRPAKSIEGFKTTYENVDLVLIRENTEGEY-----SGI 160

Query: 155 DEKTGTRVAEAIKRISEVATRNIANIALEIALQRQKVNGSATLTVTHKSNVLSQSDGLFR 214
           +      V ++IK I+  A+  +   A E A    +  G   + V HKS +   +DGLF 
Sbjct: 161 EHIVCPGVVQSIKLITREASERVIRYAFEYA----RAIGRPRIIVVHKSTIQRLADGLFV 216

Query: 215 EICRQVYESNQDKFGSINYNEQIVDSMVYRLFREPECFD--VIVAPNLYGDILSDGAAAL 272
            + +++ +   D    I +  +++D+ V  +   P  +   V V PNLYGDILSD  + L
Sbjct: 217 NVAKELSKEYPD----ITFETELIDNKVLNVVTNPSAYTNAVSVCPNLYGDILSDLNSGL 272

Query: 273 -VGSLGVVPSANVGFDFVVGEPCHGSAPDIAGKGISNPVATIRSTALMLEFMGHPEAAQD 331
             GSLG+ PSAN+G    + E  HGSAPDIAGK  +NP A + S+ +ML  MG    A  
Sbjct: 273 SAGSLGLTPSANIGHKVSIFEAVHGSAPDIAGKDKANPTALLLSSVMMLNHMGLTSHADQ 332

Query: 332 IHKAVDANLRDNTV-KTPDLGGKSTTQQVVDDVLSRM 367
           I  AV + +      +T DL G +TT    + V+ R+
Sbjct: 333 IQNAVLSTIASGPENRTGDLAGTATTSSFTEAVIKRL 369

>CAGL0I07227g Chr9 complement(696605..697711) [1107 bp, 368 aa] {ON}
           highly similar to uniprot|P28241 Saccharomyces
           cerevisiae YOR136w IDH2 isocitrate dehydrogenase
          Length = 368

 Score =  167 bits (424), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 120/364 (32%), Positives = 183/364 (50%), Gaps = 40/364 (10%)

Query: 17  ATKSLTIGLIPGDGIGREVIPAGKLVLENLSSKHGLKFNFIDLEAGWQT------FLDTG 70
           +T   T+  I GDGIG E+  + K +           F   D+   W+T      F++  
Sbjct: 32  STGKFTVSFIEGDGIGPEISSSVKRI-----------FQAADVPVEWETCDVTPIFVNGL 80

Query: 71  KALPDETIDILKNECQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYANVRPVKSV---L 127
             +PD  +  + N+   AL G + +P  K  G+ S  + LRK   L+ANVRP KS+    
Sbjct: 81  TTIPDPAVQSI-NKNLVALKGPLATPIGK--GHRSLNLTLRKTFNLFANVRPAKSIEGFK 137

Query: 128 SQEKPIDMVIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISEVATRNIANIALEIALQ 187
           +  + +D+V++RENTE  Y     + I+      V ++IK I+  A+  +   A E A  
Sbjct: 138 TTYENVDLVLIRENTEGEY-----SGIEHLVSPGVVQSIKLITRDASERVIRYAYEYA-- 190

Query: 188 RQKVNGSATLTVTHKSNVLSQSDGLFREICRQVYESNQDKFGSINYNEQIVDSMVYRLFR 247
             +  G   L V HKS +   +DGLF  + +++     D    I    +++D+    +  
Sbjct: 191 --RAIGRPRLIVVHKSTIQRLADGLFVNVAKELAAEYPD----IQLETELIDNTCLNVVS 244

Query: 248 EPECFD--VIVAPNLYGDILSDGAAAL-VGSLGVVPSANVGFDFVVGEPCHGSAPDIAGK 304
            P  +   V V PNLYGDILSD  + L  GSLG+ PSAN+G    + E  HGSAPDIAG+
Sbjct: 245 NPSSYTDAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHKVSIFEAVHGSAPDIAGQ 304

Query: 305 GISNPVATIRSTALMLEFMGHPEAAQDIHKAVDANLRDNT-VKTPDLGGKSTTQQVVDDV 363
             +NP A + S+ +ML  MG  E A  I KAV   +   +  +T DLGG ++T    D +
Sbjct: 305 NKANPTALLLSSVMMLNHMGMTEHADRIEKAVLGTIAGGSEYRTGDLGGSASTTSFTDAI 364

Query: 364 LSRM 367
           + ++
Sbjct: 365 IKKL 368

>NDAI0C01410 Chr3 complement(295178..296287) [1110 bp, 369 aa] {ON}
           Anc_5.473
          Length = 369

 Score =  167 bits (423), Expect = 9e-48,   Method: Compositional matrix adjust.
 Identities = 121/358 (33%), Positives = 188/358 (52%), Gaps = 28/358 (7%)

Query: 17  ATKSLTIGLIPGDGIGREVIPAGKLVLENLSSKHGLKFNFIDLEAGWQTFLDTGKALPDE 76
           +T   T+  I GDGIG E+  + K + +  ++K  + +   D+      F++    +P+ 
Sbjct: 33  STGKFTVSFIEGDGIGPEISQSVKQIFD--AAKVPIDWEPCDVSP---LFINGLTTIPEP 87

Query: 77  TIDILKNECQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYANVRPVKSVLSQEK---PI 133
            +  + N+   AL G + +P  K  G+ S  + LRK  GL+ANVRP KS+   +     +
Sbjct: 88  AVQSI-NKNLVALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSIEGFKTIYDNV 144

Query: 134 DMVIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISEVATRNIANIALEIALQRQKVNG 193
           D+VI+RENTE  Y     + I+      V ++IK I+  A+  +   A E A    +  G
Sbjct: 145 DLVIIRENTEGEY-----SGIEHVVTPGVVQSIKLITRDASERVIRYAYEYA----RAIG 195

Query: 194 SATLTVTHKSNVLSQSDGLFREICRQVYESNQDKFGSINYNEQIVDSMVYRLFREPECFD 253
              + V HKS +   +DGLF ++ +++ +   D    I    +++D+ V  +   P  + 
Sbjct: 196 RPRVIVVHKSTIQRLADGLFVDVAKELSQEYPD----IQLETELIDNTVLNVVSNPSSYS 251

Query: 254 --VIVAPNLYGDILSDGAAAL-VGSLGVVPSANVGFDFVVGEPCHGSAPDIAGKGISNPV 310
             V V PNLYGDILSD  + L  GSLG+ PSAN+G +  + E  HGSAPDIAG+  +NP 
Sbjct: 252 NAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHEVSIFEAVHGSAPDIAGQNKANPT 311

Query: 311 ATIRSTALMLEFMGHPEAAQDIHKAVDANLRDNTV-KTPDLGGKSTTQQVVDDVLSRM 367
           A + S+ +ML  MG    A  I KAV + +      +T DL GK+TT    D V+ R+
Sbjct: 312 ALLLSSVMMLNHMGLNNHADKIEKAVLSTIASGPEGRTGDLAGKATTSSFTDAVIGRL 369

>NCAS0H02250 Chr8 (441692..442960) [1269 bp, 422 aa] {ON} Anc_5.473
          Length = 422

 Score =  168 bits (426), Expect = 9e-48,   Method: Compositional matrix adjust.
 Identities = 121/364 (33%), Positives = 185/364 (50%), Gaps = 40/364 (10%)

Query: 17  ATKSLTIGLIPGDGIGREVIPAGKLVLENLSSKHGLKFNFIDLEAGWQT------FLDTG 70
           +T   T+  I GDGIG E+  + K +           F+   +   W+T      F+D  
Sbjct: 86  STGKYTVSFIEGDGIGPEISNSVKQI-----------FSAAKVPIEWETCDVTPLFIDGL 134

Query: 71  KALPDETIDILKNECQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYANVRPVKSV--LS 128
             +P+  +  + N+   AL G + +P  K  G+ S  + LRK  GL+ANVRP +SV    
Sbjct: 135 TTIPEPAVQSI-NKNLVALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPARSVKGFK 191

Query: 129 QEKP-IDMVIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISEVATRNIANIALEIALQ 187
              P +D+V++RENTE  Y     + I+      V ++IK I+  A+  +   A E    
Sbjct: 192 TTYPNVDLVLIRENTEGEY-----SGIEHVVTPGVVQSIKLITREASERVIRYAFEYC-- 244

Query: 188 RQKVNGSATLTVTHKSNVLSQSDGLFREICRQVYESNQDKFGSINYNEQIVDSMVYRLFR 247
             +  G   L V HKS +   SDGLF  + +++ +   D    I +  +++D+ V ++  
Sbjct: 245 --RAIGRPRLVVVHKSTIQRLSDGLFVNVAKELSKEYPD----IQFETELIDNTVLKVVS 298

Query: 248 EPECFD--VIVAPNLYGDILSDGAAAL-VGSLGVVPSANVGFDFVVGEPCHGSAPDIAGK 304
            P  +   V V PNLYGDILSD  + L  GSLG+ PS N+G +  + E  HGSAPDIAGK
Sbjct: 299 NPSSYTDAVSVCPNLYGDILSDLNSGLSAGSLGLTPSGNIGNEISIFEAVHGSAPDIAGK 358

Query: 305 GISNPVATIRSTALMLEFMGHPEAAQDIHKAVDANLRDNT-VKTPDLGGKSTTQQVVDDV 363
            ++NP A + S+ +ML  MG  + A  I  AV + +      +T DL G +TT    D V
Sbjct: 359 NMANPTALLLSSVMMLNHMGLSKHADQIENAVLSTIASGPESRTGDLAGTATTSTFTDAV 418

Query: 364 LSRM 367
           + ++
Sbjct: 419 IKKL 422

>Smik_14.290 Chr14 (528131..529213) [1083 bp, 360 aa] {ON} YNL037C
           (REAL)
          Length = 360

 Score =  166 bits (420), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 117/351 (33%), Positives = 193/351 (54%), Gaps = 26/351 (7%)

Query: 21  LTIGLIPGDGIGREVIPAGKLVLENLSSKHGLKFNFIDLEAGWQTFLDTGKALPDETIDI 80
            T+ LIPGDG+G+E+  + K + E  + K  + +  ++++   QT    G     E ++ 
Sbjct: 29  FTVTLIPGDGVGKEITDSVKTIFE--AEKIPVDWETVNIK---QTDHKEGVY---EAVES 80

Query: 81  LKNECQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYANV---RPVKSVLSQEKPIDMVI 137
           LK    G L G   +P ++  G+ S  VALRK+L +YANV   + +K V ++   ID+++
Sbjct: 81  LKRNKIG-LKGLWHTPADQT-GHGSLNVALRKQLDIYANVALFKSLKGVKTRIPDIDLIV 138

Query: 138 VRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISEVATRNIANIALEIALQRQKVNGSATL 197
           +RENTE      E + ++ ++   V E++K ++   T  IA  A + A   +K N  A +
Sbjct: 139 IRENTEG-----EFSGLEHESVPGVVESLKIMTRPKTERIARFAFDFA---KKYNRKA-V 189

Query: 198 TVTHKSNVLSQSDGLFREICRQVYESNQDKFGSINYNEQIVDSMVYRLFREPECFDVIVA 257
           T  HK+N++   DGLFR I  ++    Q ++  I+ +  IVD+   +   +P  FDV+V 
Sbjct: 190 TAVHKANIMKLGDGLFRNIITEI---GQKEYPDIDVSSIIVDNASMQAVAKPHQFDVLVT 246

Query: 258 PNLYGDILSDGAAALVGSLGVVPSANVGFDFVVGEP-CHGSAPDIAGKGISNPVATIRST 316
           P++YG IL +  AAL+G  G+V  AN G D+ V EP       DI G+ ++NP A I S+
Sbjct: 247 PSMYGTILGNIGAALIGGPGLVAGANFGRDYAVFEPGSRHVGLDIKGQNVANPTAMILSS 306

Query: 317 ALMLEFMGHPEAAQDIHKAVDANLRDNTVKTPDLGGKSTTQQVVDDVLSRM 367
            LML  +G  E A  I KAV   + +    T D+GG S+T    +++++++
Sbjct: 307 VLMLNHLGLNEYATRISKAVHETIAEGKHTTKDIGGSSSTTDFTNEIINKL 357

>Kpol_543.8 s543 (21411..22517) [1107 bp, 368 aa] {ON}
           (21411..22517) [1107 nt, 369 aa]
          Length = 368

 Score =  166 bits (421), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 117/358 (32%), Positives = 187/358 (52%), Gaps = 28/358 (7%)

Query: 17  ATKSLTIGLIPGDGIGREVIPAGKLVLENLSSKHGLKFNFIDLEAGWQTFLDTGKALPDE 76
           AT   T+  I GDG+G E+  + K +     S   +   ++  + G   F++    +P+ 
Sbjct: 32  ATGKFTVPFIEGDGVGPEISESVKKIF----SAAKVPIEWVPCDVG-PIFVNGQTTIPEP 86

Query: 77  TIDILKNECQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYANVRPVKSV---LSQEKPI 133
            ++++ N+   AL G + +P  K  G+ S  + LRK   L+ANVRP +S+    S  + +
Sbjct: 87  AVELI-NKHLIALKGPLATPIGK--GHRSLNLTLRKTFNLFANVRPARSIPNYKSTYENV 143

Query: 134 DMVIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISEVATRNIANIALEIALQRQKVNG 193
           D+V++RENTE  Y     + I+      V ++IK I+  AT  +   A E      +  G
Sbjct: 144 DLVLIRENTEGEY-----SGIEHVITPGVIQSIKLITREATERVVRYAFEYT----QAIG 194

Query: 194 SATLTVTHKSNVLSQSDGLFREICRQVYESNQDKFGSINYNEQIVDSMVYRLFREPECFD 253
              L V HKS +   +DGLF ++  ++      ++  I    +I+D  +  +  +PE + 
Sbjct: 195 RPRLLVIHKSTIQRMADGLFVKVAEEL----ASEYPDIKLETEIIDKSILNVVSKPELYS 250

Query: 254 --VIVAPNLYGDILSDGAAAL-VGSLGVVPSANVGFDFVVGEPCHGSAPDIAGKGISNPV 310
             V V PNLYGDILSD  + L  GSLG+ PSAN+G    + E  HGSAPDIAG+  +NP 
Sbjct: 251 DAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGDKVSIFEAVHGSAPDIAGQNKANPT 310

Query: 311 ATIRSTALMLEFMGHPEAAQDIHKAVDANLRDNTV-KTPDLGGKSTTQQVVDDVLSRM 367
           A + S+ +ML+ MG  E A  I  AV   +   +  +T DL G ++T    ++V+ R+
Sbjct: 311 ALLLSSVMMLKHMGLDEHANKIENAVLTTIASGSENRTADLSGTASTSSFTEEVIQRL 368

>TBLA0B02240 Chr2 complement(524111..525232) [1122 bp, 373 aa] {ON}
           Anc_5.473 YOR136W
          Length = 373

 Score =  166 bits (421), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 117/358 (32%), Positives = 189/358 (52%), Gaps = 28/358 (7%)

Query: 17  ATKSLTIGLIPGDGIGREVIPAGKLVLENLSSKHGLKFNFIDLEAGWQTFLDTGKALPDE 76
           +T   T+  I GDG+G E+  + K + +  +++  + + + D+       L T   +P+ 
Sbjct: 37  STGRFTVPFIEGDGVGPEISKSVKDIFK--AAQVPVDWEYCDVSPLLINGLTT---IPEP 91

Query: 77  TIDILKNECQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYANVRPVKSVLSQE---KPI 133
            +  + N+ + AL G + +P  K  G+ S  + LRK  GL+ANVRP +S+   E   K +
Sbjct: 92  AVQQI-NKHKIALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPARSIRGYETTYKNV 148

Query: 134 DMVIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISEVATRNIANIALEIALQRQKVNG 193
           D+V++RENTE  Y     + I+      V ++IK I+  A+  +   A E A    +  G
Sbjct: 149 DLVLIRENTEGEY-----SGIEHVVAPGVVQSIKLITRDASERVIRYAYEYA----RAIG 199

Query: 194 SATLTVTHKSNVLSQSDGLFREICRQVYESNQDKFGSINYNEQIVDSMVYRLFREPECFD 253
              L V HKS +   +DGLF  I +++      +F  I    +++D+ V  + R+P  + 
Sbjct: 200 RPRLVVVHKSTIQKLADGLFVNIAKEL----APEFPDIKLETELIDNTVLNVVRDPPSYT 255

Query: 254 --VIVAPNLYGDILSDGAAAL-VGSLGVVPSANVGFDFVVGEPCHGSAPDIAGKGISNPV 310
             V V PNLYGDILSD  + L  GSLG+ PSAN+G +  + E  HGSAPDIAG+  +NP 
Sbjct: 256 DAVTVCPNLYGDILSDLNSGLSAGSLGLTPSANIGNEVSIFEAVHGSAPDIAGQNKANPT 315

Query: 311 ATIRSTALMLEFMGHPEAAQDIHKAVDANLRDNTV-KTPDLGGKSTTQQVVDDVLSRM 367
           A + S+ +ML +MG    +  I  A+   +   +  +T DL G +TT    + V+  +
Sbjct: 316 ALLLSSCMMLNYMGLESYSNKIENAILNTIASGSENRTGDLAGTATTSSFTESVIKNL 373

>SAKL0G03520g Chr7 (290768..291877) [1110 bp, 369 aa] {ON} highly
           similar to uniprot|P28241 Saccharomyces cerevisiae
           YOR136W IDH2 Subunit of mitochondrial NAD( )- dependent
           isocitrate dehydrogenase which catalyzes the oxidation
           of isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 369

 Score =  166 bits (419), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 127/396 (32%), Positives = 196/396 (49%), Gaps = 56/396 (14%)

Query: 1   MLRTS-FNQLARRSYTS---------------ATKSLTIGLIPGDGIGREVIPAGKLVLE 44
           MLR+    QL RR  +S               +T   T+  I GDG+G E+  + K +  
Sbjct: 1   MLRSQVLRQLPRRFLSSKKQPSIGRFTGKPNPSTGKYTVSFIEGDGVGPEISKSVKDI-- 58

Query: 45  NLSSKHGLKFNFIDLEAGWQT------FLDTGKALPDETIDILKNECQGALFGAVQSPTN 98
                    F   ++   W++      F++    +P   +D + N+   AL G + +P  
Sbjct: 59  ---------FAAAEVPVEWESCDVTPLFINGLTTIPQPAVDSI-NKNLIALKGPLATPIG 108

Query: 99  KVEGYSSPIVALRKKLGLYANVRPVKSV---LSQEKPIDMVIVRENTEDLYIKTEKTYID 155
           K  G+ S  + LRK  GL+ANVRP KSV    +  + +D+V++RENTE  Y     + I+
Sbjct: 109 K--GHRSLNLTLRKTFGLFANVRPAKSVEGFKTTYENVDLVLIRENTEGEY-----SGIE 161

Query: 156 EKTGTRVAEAIKRISEVATRNIANIALEIALQRQKVNGSATLTVTHKSNVLSQSDGLFRE 215
                 V ++IK I+  A+  +   A E A    +  G   + V HKS +   +DGLF +
Sbjct: 162 HVVSPGVVQSIKLITRDASERVIRYAFEYA----RAVGRPKVMVVHKSTIQRLADGLFVD 217

Query: 216 ICRQVYESNQDKFGSINYNEQIVDSMVYRLFREPECF--DVIVAPNLYGDILSDGAAAL- 272
           + +++      ++  I    Q++D+ V  +   P  +   V V PNLYGDILSD  + L 
Sbjct: 218 VAKEL----SSEYPDIQLQLQLLDNTVLNVVSNPGAYADTVSVCPNLYGDILSDLNSGLS 273

Query: 273 VGSLGVVPSANVGFDFVVGEPCHGSAPDIAGKGISNPVATIRSTALMLEFMGHPEAAQDI 332
            GSLG+ PSAN+G    + E  HGSAPDIAG+  +NP A + S+ +ML  MG  E A  I
Sbjct: 274 AGSLGLTPSANIGHKVSIFEAVHGSAPDIAGQNKANPTALLLSSVMMLNHMGLYEKADSI 333

Query: 333 HKAVDANLRDNTV-KTPDLGGKSTTQQVVDDVLSRM 367
            KAV + +      +T DL G ++T    + V+ R+
Sbjct: 334 EKAVLSTIASGPENRTADLAGSASTSSFTEAVIKRL 369

>KAFR0B06370 Chr2 complement(1317952..1319088) [1137 bp, 378 aa]
           {ON} Anc_5.473 YOR136W
          Length = 378

 Score =  166 bits (419), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 122/364 (33%), Positives = 183/364 (50%), Gaps = 38/364 (10%)

Query: 17  ATKSLTIGLIPGDGIGREVIPAGKLVLENLSSKHGLKFNFIDLEAGWQT------FLDTG 70
           AT   T+  I GDGIG E+  + K + +  S           +   W+T       +D  
Sbjct: 40  ATGKYTVSFIEGDGIGPEISRSVKDIFQAAS-----------VPITWETCDVSPILVDGL 88

Query: 71  KALPDETIDILKNECQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYANVRPVKSVL--- 127
             +PDE +  +     G L G + +P  K  G+ S  + LRK   L+ANVRP KSV    
Sbjct: 89  TTIPDEAVKSINKNLVG-LKGPLATPIGK--GHRSLNLTLRKTFNLFANVRPAKSVRGFK 145

Query: 128 SQEKPIDMVIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISEVATRNIANIALEIALQ 187
           +    +D+V++RENTE  Y     + I+      V ++IK I+  A+  +   A E A  
Sbjct: 146 TTYDNVDLVLIRENTEGEY-----SGIEHVVTPGVVQSIKLITRDASERVIRYAFEYA-- 198

Query: 188 RQKVNGSATLTVTHKSNVLSQSDGLFREICRQVYESNQDKFGSINYNEQIVDSMVYRLFR 247
             K  G   + V HKS +   SDGLF  + +++ +  +  F +I  + +++D+ V  +  
Sbjct: 199 --KAIGRPKVIVVHKSTIQRLSDGLFVNVAKELQK--EKNFQNIELDTELIDNTVLNVVM 254

Query: 248 EPECFD--VIVAPNLYGDILSDGAAAL-VGSLGVVPSANVGFDFVVGEPCHGSAPDIAGK 304
            P  +   V V PNLYGDILSD  + L  GSLG+ PSAN+G    + E  HGSAPDIAG+
Sbjct: 255 NPSKYSDAVFVCPNLYGDILSDLNSGLSAGSLGLTPSANIGDKISIFEAVHGSAPDIAGQ 314

Query: 305 GISNPVATIRSTALMLEFMGHPEAAQDIHKAVDANLRDNTV-KTPDLGGKSTTQQVVDDV 363
             +NP A + S+ +ML  MG  E    I  AV   +  ++  +T DLGG +TT    + V
Sbjct: 315 NKANPTALLLSSVMMLHHMGLNEYGDKIENAVLKTIAASSKNRTGDLGGTATTTSFTEAV 374

Query: 364 LSRM 367
           +  +
Sbjct: 375 IDNL 378

>Skud_14.293 Chr14 (538202..539287) [1086 bp, 361 aa] {ON} YNL037C
           (REAL)
          Length = 361

 Score =  165 bits (418), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 117/351 (33%), Positives = 194/351 (55%), Gaps = 26/351 (7%)

Query: 21  LTIGLIPGDGIGREVIPAGKLVLENLSSKHGLKFNFIDLEAGWQTFLDTGKALPDETIDI 80
            T+ LIPGDG+G+E+  + + + E  + +  + +  I+++   QT    G     E ++ 
Sbjct: 29  FTVTLIPGDGVGKEITDSVRTIFE--AERIPVDWETINIK---QTDHKEGVY---EAVES 80

Query: 81  LKNECQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYANV---RPVKSVLSQEKPIDMVI 137
           LK    G L G   +P ++  G+ S  VALRK+L +YANV   + +K V ++   ID+++
Sbjct: 81  LKRNKIG-LKGLWHTPADQT-GHGSLNVALRKQLDIYANVALFKSLKGVKTRIPDIDLIV 138

Query: 138 VRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISEVATRNIANIALEIALQRQKVNGSATL 197
           +RENTE      E + ++ ++   V E++K +++  T  IA  A + A   +K N  A +
Sbjct: 139 IRENTEG-----EFSGLEHESVPGVVESLKVMTKPKTERIARFAFDFA---KKYNRKA-V 189

Query: 198 TVTHKSNVLSQSDGLFREICRQVYESNQDKFGSINYNEQIVDSMVYRLFREPECFDVIVA 257
           T  HK+N++   DGLFR I  ++    Q ++  I+ +  IVD+   +   +P  FDV+V 
Sbjct: 190 TAVHKANIMKLGDGLFRNIITEI---GQTEYPDIDVSSIIVDNASMQAVAKPHQFDVLVT 246

Query: 258 PNLYGDILSDGAAALVGSLGVVPSANVGFDFVVGEP-CHGSAPDIAGKGISNPVATIRST 316
           P++YG IL +  AAL+G  G+V  AN G D+ V EP       DI G+ ++NP A I S+
Sbjct: 247 PSMYGTILGNIGAALIGGPGLVAGANFGRDYAVFEPGSRHVGLDIKGQNVANPTAMILSS 306

Query: 317 ALMLEFMGHPEAAQDIHKAVDANLRDNTVKTPDLGGKSTTQQVVDDVLSRM 367
            LML  +G  E A  I KAV   + +    T D+GG S+T    ++V++++
Sbjct: 307 VLMLNHLGLNENATRISKAVHETIAEGKHTTRDIGGSSSTTDFTNEVINKL 357

>Smik_15.316 Chr15 (541618..542727) [1110 bp, 369 aa] {ON} YOR136W
           (REAL)
          Length = 369

 Score =  165 bits (418), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 127/391 (32%), Positives = 195/391 (49%), Gaps = 46/391 (11%)

Query: 1   MLRTSFNQLARRSYTSATKSLTIG----------------LIPGDGIGREVIPAGKLVLE 44
           MLR +F +   R + +  K  +IG                 I GDGIG E+  + K +  
Sbjct: 1   MLRNTFFRNTSRRFLATVKQPSIGKYTGKPNPSTGKYTVSFIEGDGIGPEISKSVKKIFS 60

Query: 45  NLSSKHGLKFNFIDLEAGWQTFLDTGKALPDETI-DILKNECQGALFGAVQSPTNKVEGY 103
             ++   +++ F D+      F++    +PD  +  I KN    AL G + +P  K  G+
Sbjct: 61  --AANVPIEWEFCDVNP---IFVNGLTTIPDPAVQSITKNLV--ALKGPLATPIGK--GH 111

Query: 104 SSPIVALRKKLGLYANVRPVKSV---LSQEKPIDMVIVRENTEDLYIKTEKTYIDEKTGT 160
            S  + LRK  GL+ANVRP KSV    +  + +D+V++RENTE  Y     + I+     
Sbjct: 112 RSLNLTLRKTFGLFANVRPAKSVEGFKTTYENVDLVLIRENTEGEY-----SGIEHIVCP 166

Query: 161 RVAEAIKRISEVATRNIANIALEIALQRQKVNGSATLTVTHKSNVLSQSDGLFREICRQV 220
            V ++IK I+  A+  +   A E A    +  G   + V HKS +   +DGLF  + +++
Sbjct: 167 GVVQSIKLITRDASERVIRYAFEYA----RAIGRPRVIVVHKSTIQRLADGLFVNVAKEL 222

Query: 221 YESNQDKFGSINYNEQIVDSMVYRLFREPECFD--VIVAPNLYGDILSDGAAAL-VGSLG 277
            +   D    I    +++D+ V ++   P  +   V V PNLYGDILSD  + L  GSLG
Sbjct: 223 SKEYPD----ITLETELIDNSVLKVVTNPSAYTNAVSVCPNLYGDILSDLNSGLSAGSLG 278

Query: 278 VVPSANVGFDFVVGEPCHGSAPDIAGKGISNPVATIRSTALMLEFMGHPEAAQDIHKAVD 337
           + PSAN+G    + E  HGSAPDIAG+  +NP A + S+ +ML  MG    A  I  AV 
Sbjct: 279 LTPSANIGHKISIFEAVHGSAPDIAGQDKANPTALLLSSVMMLNHMGLTNYADQIQNAVL 338

Query: 338 ANLRDNTV-KTPDLGGKSTTQQVVDDVLSRM 367
           + +      +T DL G +TT    + V+ R+
Sbjct: 339 STIASGPENRTGDLAGAATTSSFTEAVIKRL 369

>AFR137C Chr6 complement(685586..686689) [1104 bp, 367 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR136W
           (IDH2)
          Length = 367

 Score =  165 bits (418), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 128/390 (32%), Positives = 196/390 (50%), Gaps = 46/390 (11%)

Query: 1   MLRTSFNQLARRSYTS--------------ATKSLTIGLIPGDGIGREVIPAGKLVLENL 46
           MLR    Q +RR   S              A    T+  I GDG+G E+  + K +    
Sbjct: 1   MLRQKLFQGSRRWLASVRQPSIGRYAGKPNAAGKYTVSFIEGDGVGPEISQSVKDIFSAA 60

Query: 47  SSKHGLKFNFIDLEAGWQTFLDTGKALPDETIDILKNECQGALFGAVQSPTNKVEGYSSP 106
           S    +++ + D+       L T   +P+  +  + N+   AL G + +P  K  G+ S 
Sbjct: 61  SVP--VEWEYCDVTPLLVNGLTT---IPEPAVASI-NKNLVALKGPLATPIGK--GHRSL 112

Query: 107 IVALRKKLGLYANVRPVKSVLSQEKP---IDMVIVRENTEDLYIKTEKTYIDEKTGTRVA 163
            + LRK  GL+ANVRP KS+   +     +D+V++RENTE  Y     + I+      V 
Sbjct: 113 NLTLRKTFGLFANVRPAKSIEGYKTTYSDVDLVLIRENTEGEY-----SGIEHVVSPGVV 167

Query: 164 EAIKRISEVATRNIANIALEIALQRQKVNGSATLTVTHKSNVLSQSDGLFREICRQVYES 223
           ++IK I+  A+  +   A E A    +  G   + V HKS +   +DGLF  + +++   
Sbjct: 168 QSIKLITREASERVIRYAFEYA----RTVGRPKVVVVHKSTIQRLADGLFVNVAQELGRE 223

Query: 224 NQDKFGSINYNEQIVDSMVYRLFREPECFDVIVA--PNLYGDILSDGAAAL-VGSLGVVP 280
             D    I    +++D+ V  +  +PE +  +VA  PNLYGDILSD  + L  GSLG+ P
Sbjct: 224 YPD----IELQTELLDNTVLNVVTKPEAYKDVVAVCPNLYGDILSDLNSGLSAGSLGLTP 279

Query: 281 SANVGFDFVVGEPCHGSAPDIAGKGISNPVATIRSTALMLEFMGHPEAAQDIHKAVDANL 340
           SAN+G    + E  HGSAPDIAG+  +NP A + S+ +ML  MG  E A  I KAV + +
Sbjct: 280 SANIGHQVSIFEAVHGSAPDIAGQNRANPTALLLSSVMMLNHMGLHEHAGRIEKAVLSTI 339

Query: 341 ---RDNTVKTPDLGGKSTTQQVVDDVLSRM 367
              R+N  +T DL G ++T    + V+ R+
Sbjct: 340 ASSREN--RTADLAGTASTSSFTNAVIERL 367

>TPHA0D01560 Chr4 complement(321751..322833) [1083 bp, 360 aa] {ON}
           Anc_2.278 YNL037C
          Length = 360

 Score =  164 bits (416), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 122/377 (32%), Positives = 197/377 (52%), Gaps = 43/377 (11%)

Query: 9   LARRSYTSATKS-----------LTIGLIPGDGIGREVIPAGKLVLENLSSKHGLKFNFI 57
           +++RS  S TK+            T+ LIPGDGIG+EV  +    +  + +  GL  +  
Sbjct: 6   VSKRSIASFTKNHNIVPKKYGGRYTVTLIPGDGIGKEVTDS----VVKIFASQGLPID-- 59

Query: 58  DLEAGWQTFLDTGKALPDET---IDILKNECQGALFGAVQSPTNKVEGYSSPIVALRKKL 114
                W+     G +  +E    ++ LK    G L G   +  ++  GY S  VALRK+L
Sbjct: 60  -----WERIDVPGMSNENEVKKAVESLKRNKIG-LKGIWHTSADQT-GYGSLNVALRKQL 112

Query: 115 GLYANV---RPVKSVLSQEKPIDMVIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISE 171
            ++ANV   + +K V ++   +D+V++RENTE  Y     + ++ ++   V E++K I++
Sbjct: 113 DIFANVAIFKSLKGVKTKIPDVDLVVIRENTEGEY-----SGLEHESVPGVVESLKIITK 167

Query: 172 VATRNIANIALEIALQRQKVNGSATLTVTHKSNVLSQSDGLFREICRQVYESNQDKFGSI 231
             T  IA  A + AL+    N  +T+T  HK+N++  SDGLF+    +V E    ++  I
Sbjct: 168 PKTERIARFAFDFALE----NNRSTVTAVHKANIMKLSDGLFKNTVAEVGEK---EYPDI 220

Query: 232 NYNEQIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGFDFVVG 291
             N  IVD+   +   +P  FDV+V P++YG IL +  AAL+G  G++P AN G +  V 
Sbjct: 221 KVNTIIVDNASMQAVAKPHQFDVMVTPSMYGTILGNIGAALIGGPGLIPGANYGREHAVF 280

Query: 292 EP-CHGSAPDIAGKGISNPVATIRSTALMLEFMGHPEAAQDIHKAVDANLRDNTVKTPDL 350
           EP       DI  + I+NP A I S  LML  +G  E ++ I  AV A + +    T D+
Sbjct: 281 EPGSRHVGLDIENQNIANPTAMILSATLMLNQLGLREESKRISNAVYAVIEEGKTTTKDI 340

Query: 351 GGKSTTQQVVDDVLSRM 367
           GG ++T +  D V+ ++
Sbjct: 341 GGNASTTEFTDAVIDKL 357

>Skud_15.300 Chr15 (534346..535455) [1110 bp, 369 aa] {ON} YOR136W
           (REAL)
          Length = 369

 Score =  164 bits (415), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 120/364 (32%), Positives = 184/364 (50%), Gaps = 40/364 (10%)

Query: 17  ATKSLTIGLIPGDGIGREVIPAGKLVLENLSSKHGLKFNFIDLEAGWQT------FLDTG 70
           +T   T+  I GDGIG E+  + K +           FN  ++   W++      F++  
Sbjct: 33  STGRYTVSFIEGDGIGPEISKSVKKI-----------FNAANVPIEWESCDVNPIFVNGL 81

Query: 71  KALPDETIDILKNECQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYANVRPVKSV---L 127
             +PD  +  + N    AL G + +P  K  G+ S  + LRK  GL+ANVRP KSV    
Sbjct: 82  TTIPDAAVQSITNNLI-ALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSVEGFK 138

Query: 128 SQEKPIDMVIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISEVATRNIANIALEIALQ 187
           +  + +D+V++RENTE  Y     + I+      V ++IK I+  A+  +   A E A  
Sbjct: 139 TTYENVDLVLIRENTEGEY-----SGIEHIVCPGVVQSIKLITRDASERVIRYAFEYA-- 191

Query: 188 RQKVNGSATLTVTHKSNVLSQSDGLFREICRQVYESNQDKFGSINYNEQIVDSMVYRLFR 247
             +  G   + V HKS +   +DGLF  + +++ +   D    I    +++D+ V ++  
Sbjct: 192 --RAIGRPRVIVVHKSTIQRLADGLFVNVAKELSKEYPD----IILETELIDNSVLKVVT 245

Query: 248 EPECFD--VIVAPNLYGDILSDGAAAL-VGSLGVVPSANVGFDFVVGEPCHGSAPDIAGK 304
            P  +   V V PNLYGDILSD  + L  GSLG+ PSAN+G    + E  HGSAPDIAG+
Sbjct: 246 NPSAYTNAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHKISIFEAVHGSAPDIAGQ 305

Query: 305 GISNPVATIRSTALMLEFMGHPEAAQDIHKAVDANLRDNTV-KTPDLGGKSTTQQVVDDV 363
             +NP A + S+ +ML  MG    A  I  AV + +      +T DL G +TT    + V
Sbjct: 306 DKANPTALLLSSVMMLNHMGLTNHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEAV 365

Query: 364 LSRM 367
           + R+
Sbjct: 366 IKRL 369

>YNL037C Chr14 complement(557920..559002) [1083 bp, 360 aa] {ON}
           IDH1Subunit of mitochondrial NAD(+)-dependent isocitrate
           dehydrogenase, which catalyzes the oxidation of
           isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 360

 Score =  164 bits (414), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 113/351 (32%), Positives = 191/351 (54%), Gaps = 26/351 (7%)

Query: 21  LTIGLIPGDGIGREVIPAGKLVLENLSSKHGLKFNFIDLEAGWQTFLDTGKALPDETIDI 80
            T+ LIPGDG+G+E+  + + + E  +    + +  I+++   QT    G     E ++ 
Sbjct: 29  FTVTLIPGDGVGKEITDSVRTIFE--AENIPIDWETINIK---QTDHKEGVY---EAVES 80

Query: 81  LKNECQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYANV---RPVKSVLSQEKPIDMVI 137
           LK    G L G   +P ++  G+ S  VALRK+L +YANV   + +K V ++   ID+++
Sbjct: 81  LKRNKIG-LKGLWHTPADQT-GHGSLNVALRKQLDIYANVALFKSLKGVKTRIPDIDLIV 138

Query: 138 VRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISEVATRNIANIALEIALQRQKVNGSATL 197
           +RENTE      E + ++ ++   V E++K ++   T  IA  A + A +  +     ++
Sbjct: 139 IRENTEG-----EFSGLEHESVPGVVESLKVMTRPKTERIARFAFDFAKKYNR----KSV 189

Query: 198 TVTHKSNVLSQSDGLFREICRQVYESNQDKFGSINYNEQIVDSMVYRLFREPECFDVIVA 257
           T  HK+N++   DGLFR I  ++    Q ++  I+ +  IVD+   +   +P  FDV+V 
Sbjct: 190 TAVHKANIMKLGDGLFRNIITEI---GQKEYPDIDVSSIIVDNASMQAVAKPHQFDVLVT 246

Query: 258 PNLYGDILSDGAAALVGSLGVVPSANVGFDFVVGEP-CHGSAPDIAGKGISNPVATIRST 316
           P++YG IL +  AAL+G  G+V  AN G D+ V EP       DI G+ ++NP A I S+
Sbjct: 247 PSMYGTILGNIGAALIGGPGLVAGANFGRDYAVFEPGSRHVGLDIKGQNVANPTAMILSS 306

Query: 317 ALMLEFMGHPEAAQDIHKAVDANLRDNTVKTPDLGGKSTTQQVVDDVLSRM 367
            LML  +G  E A  I KAV   + +    T D+GG S+T    +++++++
Sbjct: 307 TLMLNHLGLNEYATRISKAVHETIAEGKHTTRDIGGSSSTTDFTNEIINKL 357

>KNAG0B04070 Chr2 complement(778658..779779) [1122 bp, 373 aa] {ON}
           Anc_5.473 YOR136W
          Length = 373

 Score =  164 bits (414), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 118/358 (32%), Positives = 187/358 (52%), Gaps = 28/358 (7%)

Query: 17  ATKSLTIGLIPGDGIGREVIPAGKLVLENLSSKHGLKFNFIDLEAGWQTFLDTGKALPDE 76
           AT    +  I GDGIG E+  + K + +  +++  + + F D+      F++    +PD 
Sbjct: 37  ATGKFDVSFIEGDGIGPEISQSVKDIFK--AAEVPINWEFCDVT---PIFVNGLTTIPDP 91

Query: 77  TIDILKNECQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYANVRPVKSV---LSQEKPI 133
            +  + N+   AL G + +P  K  G+ S  + LRK   L+ANVRP KS+    +    +
Sbjct: 92  AVASI-NKNLIALKGPLATPIGK--GHRSLNLTLRKTFNLFANVRPAKSIEGFKTTYSDV 148

Query: 134 DMVIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISEVATRNIANIALEIALQRQKVNG 193
           D+V++RENTE  Y     + I+      V ++IK I+  A+  +   A E A    K  G
Sbjct: 149 DLVLIRENTEGEY-----SGIEHVVAPGVVQSIKLITRDASERVIRYAFEYA----KAIG 199

Query: 194 SATLTVTHKSNVLSQSDGLFREICRQVYESNQDKFGSINYNEQIVDSMVYRLFREPECFD 253
              + V HKS +   +DGLF  + +++      ++  I    +++D+ V  +   P  + 
Sbjct: 200 RPRVVVVHKSTIQRLADGLFVNVAKEL----SKEYPEIKLETELIDNTVLNVVSNPAGYT 255

Query: 254 --VIVAPNLYGDILSDGAAAL-VGSLGVVPSANVGFDFVVGEPCHGSAPDIAGKGISNPV 310
             V V PNLYGDILSD  + L  GSLG+ PSAN+G +  + E  HGSAPDIAG+  +NP 
Sbjct: 256 DAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGNEISIFEAVHGSAPDIAGQNKANPT 315

Query: 311 ATIRSTALMLEFMGHPEAAQDIHKAVDANLRDNTV-KTPDLGGKSTTQQVVDDVLSRM 367
           A + S+ +ML  MG  + A  I +AV   +  ++  +T DLGG +TT    D V+  +
Sbjct: 316 ALLLSSVMMLNHMGLVDQASRIERAVLTTIASSSKNRTGDLGGSATTSSFTDAVIKNL 373

>SAKL0E07876g Chr5 complement(635705..636790) [1086 bp, 361 aa] {ON}
           highly similar to uniprot|P28834 Saccharomyces
           cerevisiae YNL037C IDH1 Subunit of mitochondrial NAD( )-
           dependent isocitrate dehydrogenase which catalyzes the
           oxidation of isocitrate to alpha-ketoglutarate in the
           TCA cycle
          Length = 361

 Score =  163 bits (412), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 122/380 (32%), Positives = 192/380 (50%), Gaps = 35/380 (9%)

Query: 1   MLRTSFNQLARRSYTSATKSL---------TIGLIPGDGIGREVIPAGKLVLENLSSKHG 51
           M R +F    R   T AT+ L         T+ LIPGDG+G+EV  +   + E  +    
Sbjct: 1   MFRNTFAVSKRSLATVATEQLLPKKYGGRYTVTLIPGDGVGKEVTDSVVSIFEAENVP-- 58

Query: 52  LKFNFIDLEAGWQTFLDTGKALPDETIDILKNECQGALFGAVQSPTNKVEGYSSPIVALR 111
                ID E    T +D+ + +      + +N+    L G   +P ++  G+ S  VA R
Sbjct: 59  -----IDWETINITGVDSEEGVQKAVESLKRNKI--GLKGIWHTPADQT-GHGSLNVAFR 110

Query: 112 KKLGLYANV---RPVKSVLSQEKPIDMVIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKR 168
           K+L ++ANV   + V  V ++   ID+V++RENTE  Y     + ++ ++   V E++K 
Sbjct: 111 KQLDIFANVALFKNVPGVKTKLSNIDLVVIRENTEGEY-----SGLEHESVPGVVESLKI 165

Query: 169 ISEVATRNIANIALEIALQRQKVNGSATLTVTHKSNVLSQSDGLFREICRQVYESNQDKF 228
           I++  +  IA  A + AL+    N   ++   HK+N++   DGLFR    +V  S   ++
Sbjct: 166 ITKAKSERIARFAFDFALK----NNRKSVCAVHKANIMKLGDGLFRNTVNEVGAS---EY 218

Query: 229 GSINYNEQIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGFDF 288
             I+    IVD+   +   +P  FDV+V PNLYG IL +  AAL+G  G+VP AN G ++
Sbjct: 219 PEIDVKNIIVDNASMQAVAKPHQFDVLVTPNLYGSILGNIGAALIGGPGLVPGANFGREY 278

Query: 289 VVGEP-CHGSAPDIAGKGISNPVATIRSTALMLEFMGHPEAAQDIHKAVDANLRDNTVKT 347
            V EP       DI GK ++NP A I S+ LML  +G    A  I KA    + +    T
Sbjct: 279 AVFEPGSRHVGLDIKGKDLANPTAMILSSTLMLRHLGLNGYADRISKATYDVIAEGKHTT 338

Query: 348 PDLGGKSTTQQVVDDVLSRM 367
            D+GG S+T +    V+ ++
Sbjct: 339 KDIGGSSSTTEFTKSVIDKL 358

>KLTH0G10186g Chr7 (863151..864233) [1083 bp, 360 aa] {ON} highly
           similar to uniprot|P28834 Saccharomyces cerevisiae
           YNL037C IDH1 Subunit of mitochondrial NAD( )- dependent
           isocitrate dehydrogenase which catalyzes the oxidation
           of isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 360

 Score =  163 bits (412), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 120/380 (31%), Positives = 195/380 (51%), Gaps = 36/380 (9%)

Query: 1   MLRTSFNQLARRSYTSATKSL---------TIGLIPGDGIGREVIPAGKLVLENLSSKHG 51
           MLR  F  +++RS  +  + L         T+ LIPGDG+G+EV  +   + E+ +    
Sbjct: 1   MLRNGFG-ISKRSLATVAEQLLPKKYGGRYTVTLIPGDGVGKEVTDSVVSIFESENVP-- 57

Query: 52  LKFNFIDLEAGWQTFLDTGKALPDETIDILKNECQGALFGAVQSPTNKVEGYSSPIVALR 111
                ID E    + LD  + +  + +D LK    G L G   +P+++  G+ S  VALR
Sbjct: 58  -----IDWETVEISGLDNEEGV-QKAVDSLKRNKVG-LKGIWHTPSDQT-GHGSLNVALR 109

Query: 112 KKLGLYANV---RPVKSVLSQEKPIDMVIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKR 168
           K+L ++ANV   + V  V S+   +D+V++RENTE  Y     + ++ ++   V E++K 
Sbjct: 110 KQLDIFANVALFKTVPGVPSRHSNVDLVVIRENTEGEY-----SGLEHESVPGVVESLKI 164

Query: 169 ISEVATRNIANIALEIALQRQKVNGSATLTVTHKSNVLSQSDGLFREICRQVYESNQDKF 228
           +++  +  I   A + AL+    N   ++   HK+N++   DGLFR    ++      ++
Sbjct: 165 MTKAKSDRIGRFAFDFALK----NNRKSVCAVHKANIMKLGDGLFRNCINEI---GAKEY 217

Query: 229 GSINYNEQIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGFDF 288
             I     IVD+   +   +P  FDV+V PNLYG IL +  AAL+G  G+VP AN G +F
Sbjct: 218 PEIEVKNIIVDNASMQAVAKPHQFDVLVTPNLYGSILGNIGAALIGGPGLVPGANFGREF 277

Query: 289 VVGEP-CHGSAPDIAGKGISNPVATIRSTALMLEFMGHPEAAQDIHKAVDANLRDNTVKT 347
            V EP       DI G+ ++NP A I S+ALML  +G    A  I KA    + +    T
Sbjct: 278 AVFEPGSRHVGLDIKGQNVANPTAMILSSALMLRHLGLNSYADRISKATYDVIAEAKNTT 337

Query: 348 PDLGGKSTTQQVVDDVLSRM 367
            D+GG ++T      ++ ++
Sbjct: 338 KDIGGSASTTDFTQAIIEKL 357

>Kwal_23.5012 s23 (964254..965339) [1086 bp, 361 aa] {ON} YNL037C
           (IDH1) - alpha-4-beta-4 subunit of mitochondrial
           isocitrate dehydrogenase 1 [contig 7] FULL
          Length = 361

 Score =  162 bits (411), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 117/380 (30%), Positives = 194/380 (51%), Gaps = 35/380 (9%)

Query: 1   MLRTSFNQLARRSYTSATKSL---------TIGLIPGDGIGREVIPAGKLVLENLSSKHG 51
           MLR+      R   T A + L         T+ LIPGDG+G+EV  +   + E+ +    
Sbjct: 1   MLRSGLGVSKRSLATMAAEQLLPKKYGGRYTVTLIPGDGVGKEVTDSVVSIFESENIP-- 58

Query: 52  LKFNFIDLEAGWQTFLDTGKALPDETIDILKNECQGALFGAVQSPTNKVEGYSSPIVALR 111
                ID E    + LD  + +      + +N+    L G   +P+++  G+ S  VALR
Sbjct: 59  -----IDWETVEISGLDNQEGVQKAVESLKRNKV--GLKGIWHTPSDQT-GHGSLNVALR 110

Query: 112 KKLGLYANV---RPVKSVLSQEKPIDMVIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKR 168
           K+L ++ANV   + V  V S+   +DMV++RENTE  Y     + ++ ++   V E++K 
Sbjct: 111 KQLDIFANVALFKSVPGVPSRHSNVDMVVIRENTEGEY-----SGLEHESVPGVVESLKI 165

Query: 169 ISEVATRNIANIALEIALQRQKVNGSATLTVTHKSNVLSQSDGLFREICRQVYESNQDKF 228
           +++  +  I   A + A++    N   ++   HK+N++   DGLFR    +V      ++
Sbjct: 166 MTKAKSERIGRFAFDFAVK----NNRKSVCAVHKANIMKLGDGLFRNCINEV---GAKEY 218

Query: 229 GSINYNEQIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGFDF 288
             I+    IVD+   +   +P  FDV+V PNLYG IL +  AAL+G  G+VP AN G ++
Sbjct: 219 PEIDVKNIIVDNASMQAVAKPHQFDVLVTPNLYGSILGNIGAALIGGPGLVPGANFGREY 278

Query: 289 VVGEP-CHGSAPDIAGKGISNPVATIRSTALMLEFMGHPEAAQDIHKAVDANLRDNTVKT 347
            V EP       DI G+ ++NP A I S++LML  +G    A  I KA    + +    T
Sbjct: 279 AVFEPGSRHVGLDIKGQNVANPTAMILSSSLMLRHLGLNAYADRISKATYDVIAEAKTTT 338

Query: 348 PDLGGKSTTQQVVDDVLSRM 367
            D+GG ++T +  + ++S++
Sbjct: 339 QDIGGSASTTEFTEAIISKL 358

>TPHA0E01480 Chr5 complement(300222..301355) [1134 bp, 377 aa] {ON}
           Anc_5.473 YOR136W
          Length = 377

 Score =  162 bits (410), Expect = 9e-46,   Method: Compositional matrix adjust.
 Identities = 114/357 (31%), Positives = 189/357 (52%), Gaps = 29/357 (8%)

Query: 18  TKSLTIGLIPGDGIGREVIPAGKLVLENLSSKHGLKFNFIDLEAGWQTFLDTGKALPDET 77
           T + T+  I GDG+G E+  + + + +       +  ++++ + G    ++    +P   
Sbjct: 42  TGNYTVPFIEGDGVGPEISKSVRTIFK----AAKVPIDWVNCDIG-PLLINGETTIPQTA 96

Query: 78  IDILKNECQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYANVRPVKSV---LSQEKPID 134
           +D + N    AL G + +P    +G+ S  + LRK  GL+ANVRP KS+    S  + +D
Sbjct: 97  VDQINNSLI-ALKGPLATPVG--QGHRSINLTLRKTFGLFANVRPAKSIPNLASTYENVD 153

Query: 135 MVIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISEVATRNIANIALEIALQRQKVNGS 194
           ++++RENTE  Y     + I+ +    V ++IK I+  A+  +    ++ A +  +  G 
Sbjct: 154 LIVIRENTEGEY-----SGIEHEIVPGVVQSIKLITRKASEKV----IKYAFEYTRSIGR 204

Query: 195 ATLTVTHKSNVLSQSDGLFREICRQVYESNQDKFGSINYNEQIVDSMVYRLFREPECF-- 252
           + L V HK+ +  + DGLF +  +++     DK+  +N   +++D+ V      PE +  
Sbjct: 205 SNLIVVHKATIQRRGDGLFVQTAQEM----ADKYPDVNLKLELIDNTVLNCIMNPEKYAD 260

Query: 253 DVIVAPNLYGDILSDGAAAL-VGSLGVVPSANVGFDFVVGEPCHGSAPDIAGKGISNPVA 311
            V V PNLYGDILSD  + L  GSLG+ PSAN+G + V+ E  HGSAPDIAG+  +NP A
Sbjct: 261 SVSVCPNLYGDILSDLNSGLSTGSLGLTPSANIG-ETVLYEAVHGSAPDIAGQDKANPTA 319

Query: 312 TIRSTALMLEFMGHPEAAQDIHKAVDANLRDNT-VKTPDLGGKSTTQQVVDDVLSRM 367
            + S+ +ML  MG  + A  I  AV   +      +T DLGG +TT      V+  +
Sbjct: 320 LLLSSVMMLNHMGLQKYADMIETAVLTTITSGKEFRTADLGGSATTTSFTKAVIENL 376

>YOR136W Chr15 (580250..581359) [1110 bp, 369 aa] {ON}  IDH2Subunit
           of mitochondrial NAD(+)-dependent isocitrate
           dehydrogenase, which catalyzes the oxidation of
           isocitrate to alpha-ketoglutarate in the TCA cycle;
           phosphorylated
          Length = 369

 Score =  162 bits (409), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 125/397 (31%), Positives = 194/397 (48%), Gaps = 58/397 (14%)

Query: 1   MLRTSFNQLARRSYTSATKSLTIG----------------LIPGDGIGREVIPAGKLVLE 44
           MLR +F +   R + +  K  +IG                 I GDGIG E+  + K +  
Sbjct: 1   MLRNTFFRNTSRRFLATVKQPSIGRYTGKPNPSTGKYTVSFIEGDGIGPEISKSVKKI-- 58

Query: 45  NLSSKHGLKFNFIDLEAGWQT------FLDTGKALPDETI-DILKNECQGALFGAVQSPT 97
                    F+  ++   W++      F++    +PD  +  I KN    AL G + +P 
Sbjct: 59  ---------FSAANVPIEWESCDVSPIFVNGLTTIPDPAVQSITKNLV--ALKGPLATPI 107

Query: 98  NKVEGYSSPIVALRKKLGLYANVRPVKSV---LSQEKPIDMVIVRENTEDLYIKTEKTYI 154
            K  G+ S  + LRK  GL+ANVRP KS+    +  + +D+V++RENTE  Y     + I
Sbjct: 108 GK--GHRSLNLTLRKTFGLFANVRPAKSIEGFKTTYENVDLVLIRENTEGEY-----SGI 160

Query: 155 DEKTGTRVAEAIKRISEVATRNIANIALEIALQRQKVNGSATLTVTHKSNVLSQSDGLFR 214
           +      V ++IK I+  A+  +   A E A    +  G   + V HKS +   +DGLF 
Sbjct: 161 EHIVCPGVVQSIKLITRDASERVIRYAFEYA----RAIGRPRVIVVHKSTIQRLADGLFV 216

Query: 215 EICRQVYESNQDKFGSINYNEQIVDSMVYRLFREPECFD--VIVAPNLYGDILSDGAAAL 272
            + +++ +   D    +    +++D+ V ++   P  +   V V PNLYGDILSD  + L
Sbjct: 217 NVAKELSKEYPD----LTLETELIDNSVLKVVTNPSAYTDAVSVCPNLYGDILSDLNSGL 272

Query: 273 -VGSLGVVPSANVGFDFVVGEPCHGSAPDIAGKGISNPVATIRSTALMLEFMGHPEAAQD 331
             GSLG+ PSAN+G    + E  HGSAPDIAG+  +NP A + S+ +ML  MG    A  
Sbjct: 273 SAGSLGLTPSANIGHKISIFEAVHGSAPDIAGQDKANPTALLLSSVMMLNHMGLTNHADQ 332

Query: 332 IHKAVDANLRDNTV-KTPDLGGKSTTQQVVDDVLSRM 367
           I  AV + +      +T DL G +TT    + V+ R+
Sbjct: 333 IQNAVLSTIASGPENRTGDLAGTATTSSFTEAVIKRL 369

>KLLA0F04103g Chr6 (389159..390244) [1086 bp, 361 aa] {ON}
           uniprot|O94229 Kluyveromyces lactis KLLA0F04103g IDH1
           Isocitrate dehydrogenase subunit 1
          Length = 361

 Score =  159 bits (401), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 113/350 (32%), Positives = 187/350 (53%), Gaps = 26/350 (7%)

Query: 22  TIGLIPGDGIGREVIPAGKLVLENLSSKHGLKFNFIDLEAGWQTFLDTGKALPDETIDIL 81
           T+ LIPGDG+G+EV  +   + EN +    + +  ID+ +G +   +  +A     ++ L
Sbjct: 31  TVTLIPGDGVGKEVTDSVVKIFENENIP--IDWETIDI-SGLENTENVQRA-----VESL 82

Query: 82  KNECQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYANVRPVKS---VLSQEKPIDMVIV 138
           K    G L G   +P ++  G+ S  VALRK+L ++ANV   KS   V ++   IDMVI+
Sbjct: 83  KRNKVG-LKGIWHTPADQT-GHGSLNVALRKQLDIFANVALFKSIPGVKTRLNNIDMVII 140

Query: 139 RENTEDLYIKTEKTYIDEKTGTRVAEAIKRISEVATRNIANIALEIALQRQKVNGSATLT 198
           RENTE  Y     + ++ ++   V E++K ++   +  IA  A + AL+    N   ++ 
Sbjct: 141 RENTEGEY-----SGLEHESVPGVVESLKIMTRAKSERIARFAFDFALK----NNRKSVC 191

Query: 199 VTHKSNVLSQSDGLFREICRQVYESNQDKFGSINYNEQIVDSMVYRLFREPECFDVIVAP 258
             HK+N++   DGLFR    ++     +++  ++    IVD+   +   +P  FDV+V P
Sbjct: 192 AVHKANIMKLGDGLFRNTVNEI---GANEYPELDVKNIIVDNASMQAVAKPHQFDVLVTP 248

Query: 259 NLYGDILSDGAAALVGSLGVVPSANVGFDFVVGEP-CHGSAPDIAGKGISNPVATIRSTA 317
           NLYG IL +  +AL+G  G+VP AN G ++ V EP       DI G+ ++NP A I S+ 
Sbjct: 249 NLYGSILGNIGSALIGGPGLVPGANFGREYAVFEPGSRHVGLDIKGQNVANPTAMILSST 308

Query: 318 LMLEFMGHPEAAQDIHKAVDANLRDNTVKTPDLGGKSTTQQVVDDVLSRM 367
           LML  +G    A  I KA    + +    T D+GG ++T +  + V+ ++
Sbjct: 309 LMLRHLGLNAYADRISKATYDVISEGKSTTRDIGGSASTSEFTNAVIEKL 358

>TDEL0A03370 Chr1 (599855..600970) [1116 bp, 371 aa] {ON} Anc_5.473
           YOR136W
          Length = 371

 Score =  159 bits (402), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 118/363 (32%), Positives = 180/363 (49%), Gaps = 40/363 (11%)

Query: 18  TKSLTIGLIPGDGIGREVIPAGKLVLENLSSKHGLKFNFIDLEAGWQT------FLDTGK 71
           T   T+  I GDG+G E+  + K +           F    +   W++       ++   
Sbjct: 36  TGKYTVSFIEGDGVGPEISKSVKDI-----------FAAAKVPIVWESCPVTPLLVNGVT 84

Query: 72  ALPDETIDILKNECQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYANVRPVKSV---LS 128
            +P++  + + N    AL G + +P  K  G+ S  + LRK  GL+ANVRP KSV    +
Sbjct: 85  TIPEQAQESI-NRNLVALKGPLATPIGK--GHRSMNLTLRKTFGLFANVRPAKSVEGFKT 141

Query: 129 QEKPIDMVIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISEVATRNIANIALEIALQR 188
             + +D+V++RENTE  Y   E   +       V ++IK I+  A+  +   A E A   
Sbjct: 142 TYEDVDLVLIRENTEGEYAGIEHVIVPG-----VVQSIKLITREASERVIRYAYEYA--- 193

Query: 189 QKVNGSATLTVTHKSNVLSQSDGLFREICRQVYESNQDKFGSINYNEQIVDSMVYRLFRE 248
            +  G   L V HKS +   +DGLF  + +++      +F  I    +++D+ V  +   
Sbjct: 194 -RAVGRPKLVVVHKSTIQRLADGLFVTVAKEL----AHEFPDIQLQTELIDNTVLNVVSN 248

Query: 249 PECFD--VIVAPNLYGDILSDGAAAL-VGSLGVVPSANVGFDFVVGEPCHGSAPDIAGKG 305
           P  +   V V PNLYGDILSD  + L  GSLG+ PS N+G    + E  HGSAPDIAG+ 
Sbjct: 249 PSKYSDVVYVCPNLYGDILSDLNSGLSAGSLGLTPSGNIGHKVSIFEAVHGSAPDIAGQN 308

Query: 306 ISNPVATIRSTALMLEFMGHPEAAQDIHKAVDANLRDNT-VKTPDLGGKSTTQQVVDDVL 364
            +NP A + S+ +ML  MG  E A  I KAV   +      +T DL G ++T    + V+
Sbjct: 309 KANPTALLLSSVMMLNHMGLFEHASKIEKAVLTTIAAGPESRTGDLAGSASTSSFTEAVI 368

Query: 365 SRM 367
           SR+
Sbjct: 369 SRL 371

>Kpol_1039.35 s1039 complement(108102..109181) [1080 bp, 359 aa]
           {ON} complement(108102..109181) [1080 nt, 360 aa]
          Length = 359

 Score =  158 bits (399), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 117/378 (30%), Positives = 192/378 (50%), Gaps = 42/378 (11%)

Query: 7   NQLARRSYTSATKS-----------LTIGLIPGDGIGREVIPAGKLVLENLSSKHGLKFN 55
           N +++R++TS                T+ L+PGDG+GRE+  +   + E           
Sbjct: 4   NLISKRAFTSIASRENIIPKKYGGRYTVTLLPGDGVGREITDSVVSIFEAE--------- 54

Query: 56  FIDLEAGWQTFLDTGKALPD--ETIDILKNECQGALFGAVQSPTNKVEGYSSPIVALRKK 113
             +L   W+    +G    D    ++ LK    G L G   +  +  +G++S  VALRK+
Sbjct: 55  --NLPIDWERVELSGLEQEDVHTAVESLKRNKIG-LKGIWHTSADH-DGHTSWNVALRKE 110

Query: 114 LGLYANV---RPVKSVLSQEKPIDMVIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRIS 170
           L +YANV   +  K V ++   +D+VI+RENTE  Y     + ++ ++   V E++K ++
Sbjct: 111 LDIYANVAIFKSFKGVDTRIPDVDLVIIRENTEGEY-----SGLEHESVPGVVESLKIMT 165

Query: 171 EVATRNIANIALEIALQRQKVNGSATLTVTHKSNVLSQSDGLFREICRQVYESNQDKFGS 230
              T  IA  A + A++  +     ++T  HK+N++   DGLFR +   V E    ++  
Sbjct: 166 AQKTERIARFAFDYAMKYNR----KSVTAVHKANIMKLGDGLFRNL---VTEIGAKEYPE 218

Query: 231 INYNEQIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGFDFVV 290
           +  +  IVD+   +   +P  FDV+VAP++YG IL +  AAL+G  G+VP AN G D+ V
Sbjct: 219 VGVSSIIVDNASMQAVAKPHQFDVMVAPSMYGTILGNIGAALIGGPGLVPGANYGRDYAV 278

Query: 291 GEP-CHGSAPDIAGKGISNPVATIRSTALMLEFMGHPEAAQDIHKAVDANLRDNTVKTPD 349
            EP       DI  + I+NP A I S  LML  +G    A  I KAV   + +    T D
Sbjct: 279 FEPGSRHVGLDIENQNIANPTAMILSATLMLNHLGFRNDAARISKAVHEVIAEGKTTTRD 338

Query: 350 LGGKSTTQQVVDDVLSRM 367
           +GG +TT +  + V++++
Sbjct: 339 IGGSATTTEFTNAVIAKL 356

>TBLA0C01500 Chr3 complement(347212..348309) [1098 bp, 365 aa] {ON}
           Anc_1.402 YCL018W
          Length = 365

 Score =  158 bits (400), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 125/368 (33%), Positives = 191/368 (51%), Gaps = 39/368 (10%)

Query: 23  IGLIPGDGIGREVIPAGKLVLENLSSK-HGLKFNFIDLEAGWQTFLDTGKALPDETIDIL 81
           I ++PGD +G+E++     VL+ +  K HG+KFNF     G      TG  LPDET++  
Sbjct: 7   IVVLPGDHVGQEIVEEAVKVLKIVEEKRHGVKFNFQYHLIGGDAIDKTGDPLPDETLEAA 66

Query: 82  KNECQGALFGAVQSP---TNKVEGYSSPIVALRKKLGLYANVRPVK---------SVLSQ 129
           K +    L GAV  P   T KV      ++ +RK+LGLY N+RP K         S L +
Sbjct: 67  K-QSDAVLLGAVGGPKWGTGKVRPEQG-LLKIRKELGLYGNLRPCKFISDKLIGLSPLKE 124

Query: 130 E--KPIDMVIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISEVATRNIANIALEIALQ 187
           E  K  D V+VRE    +Y    +    E  G+ VA   ++ S    + I  +A  ++LQ
Sbjct: 125 EVCKGTDFVVVRELVGGIYFGERQ----EDDGSGVAWDSEKYSIEEVKRITKMAAFLSLQ 180

Query: 188 RQKVNGSATLTVTHKSNVLSQSDGLFREICRQVYESNQDKFGSINYNEQIVDSMVYRLFR 247
               +    +    K+NVL+ S      + R   +    +F ++    Q++DS    L +
Sbjct: 181 N---DPPLPIWSLDKANVLASS-----RLWRAAVDETIAEFPNLKVQHQLIDSAAMMLVK 232

Query: 248 EPECFD-VIVAPNLYGDILSDGAAALVGSLGVVPSANVGF------DFVVGEPCHGSAPD 300
            P   + +I+  N++GDI+SD A+ + GSLG++PSA++         F + EPCHGSAPD
Sbjct: 233 NPTQLNGIILTNNMFGDIISDEASVIPGSLGLLPSASLASLPDKNKAFGLYEPCHGSAPD 292

Query: 301 IAGKGISNPVATIRSTALMLEF-MGHPEAAQDIHKAVDANLRDNTVKTPDLGGKSTTQQV 359
           +A +G  NPVATI S A+ML+  +   +  + I +AV   L D  ++T DLGG STT ++
Sbjct: 293 LA-RGKVNPVATILSAAMMLKLSLDMVQEGEAIERAVSVVL-DRGIRTADLGGNSTTSEL 350

Query: 360 VDDVLSRM 367
            D V   +
Sbjct: 351 GDAVAQEL 358

>Kpol_440.12 s440 (32084..33190) [1107 bp, 368 aa] {ON}
           (32084..33190) [1107 nt, 369 aa]
          Length = 368

 Score =  158 bits (399), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 113/357 (31%), Positives = 189/357 (52%), Gaps = 28/357 (7%)

Query: 18  TKSLTIGLIPGDGIGREVIPAGKLVLENLSSKHGLKFNFIDLEAGWQTFLDTGKALPDET 77
           T   T+  I GDG+G E+  + K +    ++K  +++   D+      F++    +PD  
Sbjct: 33  TGKYTVPFIEGDGVGPEISKSVKDIFA--AAKVPIEWEPCDV---GPIFVNGLTTIPDAA 87

Query: 78  IDILKNECQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYANVRPVKSVLSQE---KPID 134
           +  + N+   AL G + +P  K  G+ S  + LRK   L+ANVRP +SV + +   + +D
Sbjct: 88  VQSI-NKHLVALKGPLATPIGK--GHRSLNLTLRKTFNLFANVRPARSVPNYKTTYQNVD 144

Query: 135 MVIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISEVATRNIANIALEIALQRQKVNGS 194
           +V++RENTE  Y     + I+      V ++IK I++ A+  +    +  A +  +  G 
Sbjct: 145 LVLIRENTEGEY-----SGIEHVISPGVIQSIKLITKDASERV----IRYAFEYTRAIGR 195

Query: 195 ATLTVTHKSNVLSQSDGLFREICRQVYESNQDKFGSINYNEQIVDSMVYRLFREPECFD- 253
             L V HKS +   +DGLF  + +++      ++  I    +++D+ +  +   PE +  
Sbjct: 196 PRLVVVHKSTIQRMADGLFVNVAKEL----ASEYPDIELQTELIDNTILNVVTHPESYTD 251

Query: 254 -VIVAPNLYGDILSDGAAAL-VGSLGVVPSANVGFDFVVGEPCHGSAPDIAGKGISNPVA 311
            V V PNLYGDILSD  + L  GSLG+ PSAN+G    + E  HGSAPDIAG+  +NP A
Sbjct: 252 AVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGDKVSIFEAVHGSAPDIAGQNKANPTA 311

Query: 312 TIRSTALMLEFMGHPEAAQDIHKAVDANLRDNTV-KTPDLGGKSTTQQVVDDVLSRM 367
            + S+ +ML  MG  E A  I  A+ + +   +  +T DL G +TT    + V++++
Sbjct: 312 LLLSSVMMLNHMGLNEHATKIENAILSTIASGSENRTGDLAGTATTSSFTEAVINKL 368

>NDAI0B03590 Chr2 complement(901108..902187) [1080 bp, 359 aa] {ON}
           Anc_2.278
          Length = 359

 Score =  156 bits (395), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 109/355 (30%), Positives = 190/355 (53%), Gaps = 34/355 (9%)

Query: 21  LTIGLIPGDGIGREVIPAGKLVLENLSSKHGLKFNFIDLEAGWQTF----LDTGKALPDE 76
            T+ L+PGDG+G+E+  +   V+    S+        ++   W+T     LD  + +   
Sbjct: 28  FTVTLLPGDGVGKEITDS---VVSIFKSE--------NVPIDWETVDISGLDHTEGV-KA 75

Query: 77  TIDILKNECQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYANV---RPVKSVLSQEKPI 133
            +D LK    G L G   +P ++V G+ S  VA RK+L +YANV   + ++ V ++   +
Sbjct: 76  AVDSLKRNKIG-LKGIWHTPADQV-GHGSLNVAFRKQLDIYANVAIFKSIEGVKTKIPNV 133

Query: 134 DMVIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISEVATRNIANIALEIALQRQKVNG 193
           D+V++RENTE  Y     + ++ ++   V E++K I++  +  IA  A + A    K N 
Sbjct: 134 DLVVIRENTEGEY-----SGLEHESVPGVVESLKIITKSKSERIARFAFDFA----KRNN 184

Query: 194 SATLTVTHKSNVLSQSDGLFREICRQVYESNQDKFGSINYNEQIVDSMVYRLFREPECFD 253
             ++T  HK+N++  SDGLFR    ++ E   +++  I  +  IVD+   +   +P  FD
Sbjct: 185 RKSVTAVHKANIMKLSDGLFRNTVSKIGE---EEYPEIQTSSIIVDNASMQAVAKPHQFD 241

Query: 254 VIVAPNLYGDILSDGAAALVGSLGVVPSANVGFDFVVGEP-CHGSAPDIAGKGISNPVAT 312
           V+V P++YG I+ +  AAL+G  G+VP  N G D+ V EP       DI G+ ++NP A 
Sbjct: 242 VMVTPSMYGTIVGNIGAALIGGPGLVPGVNYGRDYAVFEPGSRHVGLDIKGQNVANPTAM 301

Query: 313 IRSTALMLEFMGHPEAAQDIHKAVDANLRDNTVKTPDLGGKSTTQQVVDDVLSRM 367
           + S  L+L+ +G  ++A  I  AV   + +    T D+GG ++T +    V++++
Sbjct: 302 LLSATLLLDHLGLEKSANRIKSAVYDVIAEGKATTQDIGGSASTTEFTQAVINKL 356

>TDEL0C03840 Chr3 complement(673007..674092) [1086 bp, 361 aa] {ON}
           Anc_2.278 YNL037C
          Length = 361

 Score =  156 bits (395), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 128/383 (33%), Positives = 196/383 (51%), Gaps = 41/383 (10%)

Query: 1   MLRTSFNQLARRSYTSATKSL--------TIGLIPGDGIGREVIPAGKLVLE--NLSSKH 50
           MLR++  +    S  +A K L         + LIPGDG+G+EV  +   + E  NL    
Sbjct: 1   MLRSAVGKRMFASVAAAEKVLPKKYGGRFVVTLIPGDGVGKEVTDSVVSIFEAENLP--- 57

Query: 51  GLKFNFIDLEAGWQTFLDTGKALPDETIDILKNECQGALFGAVQSPTNKVEGYSSPIVAL 110
            + ++ +D+       LD  + +    +D LK    G L G   +      G  S  VAL
Sbjct: 58  -IDWDRVDISG-----LDHEEGV-QAAVDSLKRNKIG-LKGIWHTSAADQAGKGSLNVAL 109

Query: 111 RKKLGLYANVRPVKSV--LSQEKP-IDMVIVRENTEDLYIKTEKTYIDEKTGTRVAEAIK 167
           RK+L +YANV   KSV  +  + P +D+V++RENTE  Y     + ++ ++   V E++K
Sbjct: 110 RKELDIYANVALFKSVPGVKTKIPNVDLVVIRENTEGEY-----SGLEHESVPGVVESLK 164

Query: 168 RISEVATRNIANIALEIALQRQKVNGSATLTVTHKSNVLSQSDGLFREICRQVYESNQD- 226
            ++E  T  IA  A + A   +K N  A +T  HK+N++   DGLFR +  +V E     
Sbjct: 165 IMTEDKTERIARFAFDFA---KKYNRHA-VTAVHKANIMKLGDGLFRNVVTRVGEQEYPD 220

Query: 227 -KFGSINYNEQIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVG 285
            K GSI     IVD+   +   +P  FDV+V P++YG IL +  AAL+G  G+V  AN G
Sbjct: 221 VKVGSI-----IVDNASMQTVAKPHQFDVLVTPSMYGTILGNIGAALIGGPGLVAGANYG 275

Query: 286 FDFVVGEP-CHGSAPDIAGKGISNPVATIRSTALMLEFMGHPEAAQDIHKAVDANLRDNT 344
            ++ V EP       DI  K I+NP A I S +LML+ +G   +A  I  AV   + +  
Sbjct: 276 REYAVFEPGSRHVGLDIKDKNIANPTAMILSASLMLDHLGLSTSATKISNAVHQVIAEGK 335

Query: 345 VKTPDLGGKSTTQQVVDDVLSRM 367
             TPD+GG ++T +    V+ ++
Sbjct: 336 STTPDIGGSASTTEFTQAVIEKL 358

>NCAS0B06290 Chr2 complement(1186838..1187917) [1080 bp, 359 aa]
           {ON} Anc_2.278
          Length = 359

 Score =  155 bits (392), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 112/353 (31%), Positives = 190/353 (53%), Gaps = 31/353 (8%)

Query: 21  LTIGLIPGDGIGREVIPAGKLVL--ENLSSKHGLKFNFIDLEAGWQTFLDTGKALPDETI 78
           +T+ L+PGDG+G+E+  +   +   EN+          ID E    + LD    + +  +
Sbjct: 29  MTVTLLPGDGVGKEITDSVVSIFQAENVP---------IDWETVDISQLDHEDGV-NAAV 78

Query: 79  DILKNECQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYANVRPVKSV--LSQEKP-IDM 135
           + LK    G L G   +  ++V G+ S  VA RK+L +YANV   KS+  +  + P +D+
Sbjct: 79  ESLKRNKIG-LKGIWHTSADQV-GHGSLNVAFRKQLDIYANVAFCKSIPGVKTKIPNVDL 136

Query: 136 VIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISEVATRNIANIALEIALQRQKVNGSA 195
           VI+RENTE  Y     + ++ ++   V E++K +++V +  IA  A + A++  +     
Sbjct: 137 VIIRENTEGEY-----SGLEHESVPGVVESLKIVTKVNSERIAKFAFDFAMRHDR----K 187

Query: 196 TLTVTHKSNVLSQSDGLFREICRQVYESNQDKFGSINYNEQIVDSMVYRLFREPECFDVI 255
            +T  HK+N++  SDGLFR    +V E+    +  I  +  IVD+   +   +P  FDV+
Sbjct: 188 MVTAVHKANIMKLSDGLFRNTVARVGEA----YPQIKNDSIIVDNASMQAVAKPHQFDVM 243

Query: 256 VAPNLYGDILSDGAAALVGSLGVVPSANVGFDFVVGEP-CHGSAPDIAGKGISNPVATIR 314
           V P++YG IL +  AAL+G  G+VP  N G ++ V EP       DI G+ ++NP A I 
Sbjct: 244 VTPSMYGTILGNIGAALIGGPGLVPGVNYGREYAVFEPGSRHVGLDIKGQNVANPTAMIL 303

Query: 315 STALMLEFMGHPEAAQDIHKAVDANLRDNTVKTPDLGGKSTTQQVVDDVLSRM 367
           S+ L+L+ +G  + A  I KAV   +++    T D+GG ++T +    V+ ++
Sbjct: 304 SSTLLLQHLGLNDTASRISKAVYDVIKEGNATTKDIGGNASTTEFTKAVIDKL 356

>ZYRO0D11220g Chr4 (946652..947758) [1107 bp, 368 aa] {ON} highly
           similar to uniprot|P28241 Saccharomyces cerevisiae
           YOR136W IDH2 Subunit of mitochondrial NAD( )- dependent
           isocitrate dehydrogenase which catalyzes the oxidation
           of isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 368

 Score =  155 bits (392), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 118/357 (33%), Positives = 182/357 (50%), Gaps = 28/357 (7%)

Query: 18  TKSLTIGLIPGDGIGREVIPAGKLVLENLSSKHGLKFNFIDLEAGWQTFLDTGKALPDET 77
           T +  +  I GDGIG E+  + K +    ++K  + F  + ++      ++   ++P+E 
Sbjct: 33  TGNYKVSFIEGDGIGPEISKSVKDIFA--AAKVPVDFESVVVKP---ILVNGVTSIPEEA 87

Query: 78  IDILKNECQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYANVRPVKSVLSQEKPID--- 134
              + N    AL G + +P  K  G+ S  + LRK  GL+AN+RP KSV   +   D   
Sbjct: 88  QKSI-NTNLVALKGPLATPVGK--GHRSMNLTLRKTFGLFANLRPAKSVEGFKTIYDNVN 144

Query: 135 MVIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISEVATRNIANIALEIALQRQKVNGS 194
           +V++RENTE  Y   E   +       V ++IK I+  A+  +   A E A   ++    
Sbjct: 145 LVLIRENTEGEYAGIEHAIVPG-----VVQSIKLITREASERVIRFAYEYARAAER---- 195

Query: 195 ATLTVTHKSNVLSQSDGLFREICRQVYESNQDKFGSINYNEQIVDSMVYRLFREPECFD- 253
             L V HKS +   SDGLF ++ +++    Q +F  I    +++D+ V     +P  +  
Sbjct: 196 PRLIVVHKSTIQRLSDGLFVDVAKEL----QSEFPDIKLETELIDNAVLNTVTDPTKYSD 251

Query: 254 -VIVAPNLYGDILSDGAAAL-VGSLGVVPSANVGFDFVVGEPCHGSAPDIAGKGISNPVA 311
            V V PNLYGDILSD  + L  GSLG+ PS N+G    + E  HGSAPDIAGK  +NP A
Sbjct: 252 AVSVCPNLYGDILSDMNSGLSAGSLGLTPSGNIGHKVSIFEAVHGSAPDIAGKDKANPTA 311

Query: 312 TIRSTALMLEFMGHPEAAQDIHKAVDANLRDNT-VKTPDLGGKSTTQQVVDDVLSRM 367
            + S+ +ML  MG  E A  I KAV   +      +T DL G ++T    + V+ ++
Sbjct: 312 LLLSSVMMLHHMGLHEHASQIEKAVLTTIAAGPESRTGDLKGSASTSSFTEAVIKKL 368

>KAFR0J01410 Chr10 complement(256693..257745) [1053 bp, 350 aa] {ON}
           Anc_2.278 YNL037C
          Length = 350

 Score =  154 bits (390), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 122/381 (32%), Positives = 198/381 (51%), Gaps = 49/381 (12%)

Query: 1   MLRTSFNQLARRSYTSATKS-----LTIGLIPGDGIGREVIPAGKLVL--ENLSSKHGLK 53
           MLR   N L RRS ++ +         I LIPG+GIG+EV  + + +   ENL     + 
Sbjct: 1   MLR---NTLLRRSISTISPKKYGGRFQITLIPGNGIGKEVTDSVRSIFQAENLP----ID 53

Query: 54  FNFIDLEA---GWQTFLDTGKALPDETIDILKNECQGALFGAVQSPTNKVEGYSSPIVAL 110
           +  +++E+   G +T +D+          I +N+   AL G   S  + ++G  S  VAL
Sbjct: 54  WEIVNIESHRDGIKTAVDS----------IKRNKI--ALKGIWSS--DPIDG--SLNVAL 97

Query: 111 RKKLGLYANVRPVKS---VLSQEKPIDMVIVRENTEDLYIKTEKTYIDEKTGTRVAEAIK 167
           RK+L ++ANV   KS   V ++   +D+V++RENTE  +   E   +D      V E++K
Sbjct: 98  RKQLDIFANVAIFKSFDNVNTRIPNVDLVVIRENTEGEFSGLEHESVDG-----VVESLK 152

Query: 168 RISEVATRNIANIALEIALQRQKVNGSATLTVTHKSNVLSQSDGLFREICRQVYESNQDK 227
            +++  T  IA  A + A +  + +    +T  HK+N++   DGLF+ I   +     ++
Sbjct: 153 IVTKPKTERIARFAFDFAKKHNRNH----VTAVHKANIMKLGDGLFKNIVAHI---GNNE 205

Query: 228 FGSINYNEQIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGFD 287
           +  I  +  IVD+   +   +P  FDV+V+P++YG IL +  AAL+G  G+VP AN G D
Sbjct: 206 YPEIKNSSIIVDNASMQAVAKPHQFDVLVSPSMYGTILGNIGAALIGGPGLVPGANFGRD 265

Query: 288 FVVGEP-CHGSAPDIAGKGISNPVATIRSTALMLEFMGHPEAAQDIHKAVDANLRDNTVK 346
           + V EP       DI G+ ++NP A I S   ML  +G    A+ I  AV   +   T  
Sbjct: 266 YAVFEPGSRHVGLDIKGQNVANPTAMILSATWMLRHLGLTSPAERITNAVKHVIAQGTTV 325

Query: 347 TPDLGGKSTTQQVVDDVLSRM 367
           T D+GG ++T +  D V++ +
Sbjct: 326 TKDIGGTASTTEFTDAVINEL 346

>CAGL0G02673g Chr7 complement(246455..247531) [1077 bp, 358 aa] {ON}
           highly similar to uniprot|P28834 Saccharomyces
           cerevisiae YNL037c IDH1 or uniprot|P28241 Saccharomyces
           cerevisiae YOR136w IDH2
          Length = 358

 Score =  147 bits (371), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 113/379 (29%), Positives = 190/379 (50%), Gaps = 42/379 (11%)

Query: 6   FNQLARRSYTSATKSL----------TIGLIPGDGIGREVIPAGKLVLENLSSKHGLKFN 55
           F  + RR   S  K L          T+ LIPGDG+G+E+  +   + E           
Sbjct: 2   FRTVQRRGMASMAKELVLPKKYGGRYTVTLIPGDGVGKEITDSVVSIFEAE--------- 52

Query: 56  FIDLEAGWQTF-LDTGKALPD--ETIDILKNECQGALFGAVQSPTNKVEGYSSPIVALRK 112
             ++   W+   + T   + D  + ++ LK    G     +   +  +  + S  VALRK
Sbjct: 53  --NIPVDWERVDISTSDNIQDVSQAVESLKRNKIG--LKGIWHTSADIADHGSFNVALRK 108

Query: 113 KLGLYANVRPVKSV--LSQEKP-IDMVIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRI 169
           +L ++A+V   KSV  +  + P +D+V++RENTE  Y     + ++ ++   V E++K I
Sbjct: 109 QLDMFAHVAFFKSVPGVKTKIPNVDLVVIRENTEGEY-----SGLEHESVPGVVESLKII 163

Query: 170 SEVATRNIANIALEIALQRQKVNGSATLTVTHKSNVLSQSDGLFREICRQVYESNQDKFG 229
           ++  +  IA  A + A   +K N  +   V HK+N++   DGLFR     V E   +++ 
Sbjct: 164 TKAKSERIARFAFDFA---KKYNRKSVCAV-HKANIMKMGDGLFRN---TVTEIGANEYP 216

Query: 230 SINYNEQIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGFDFV 289
            I  +  IVD+   +   +P  FDV+V P++YG I+ +  AAL+G  G+V  A+ G +  
Sbjct: 217 DIQTSSIIVDNASMQAVAKPHQFDVMVTPSMYGTIIGNIGAALIGGPGLVAGAHYGREHA 276

Query: 290 VGEP-CHGSAPDIAGKGISNPVATIRSTALMLEFMGHPEAAQDIHKAVDANLRDNTVKTP 348
           V EP       DI GK ++NP A I S+ LML+ +G  E+A+ I KA    +    V T 
Sbjct: 277 VFEPGSQHVGLDIKGKNVANPTAMILSSTLMLQHLGLTESAKRIAKATHDVISLGQVTTK 336

Query: 349 DLGGKSTTQQVVDDVLSRM 367
           D+GG ++T +  + ++ R+
Sbjct: 337 DIGGSASTTEFTEAIIKRL 355

>TDEL0B06000 Chr2 (1060828..1061916) [1089 bp, 362 aa] {ON}
           Anc_1.402 YCL018W
          Length = 362

 Score =  147 bits (371), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 126/367 (34%), Positives = 190/367 (51%), Gaps = 38/367 (10%)

Query: 20  SLTIGLIPGDGIGREVIPAGKLVLENLSS-KHGLKFNFIDLEAGWQTFLDTGKALPDETI 78
           S  I ++PGD +G+E+      VL+ +S  +    FNF     G      TG  LPDE +
Sbjct: 2   SKNIVVLPGDHVGQEITEEAIKVLKAISEVRPNATFNFQHHLIGGAAIDATGVPLPDEAL 61

Query: 79  DILKNECQGALFGAVQSPTNKVEGYSSP---IVALRKKLGLYANVRP---VKSVLSQEKP 132
           +  K +    L GAV  P     G   P   ++ +RK+L LYAN+RP       L +  P
Sbjct: 62  EASK-KADAVLLGAVGGPKWGT-GAVRPEQGLLKIRKELQLYANLRPCNFASDSLLELSP 119

Query: 133 I--------DMVIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISEVATRNIANIALEI 184
           +        D V+VRE    +Y    K    E  G  VA   ++ S    + I  +A  +
Sbjct: 120 LKAQYAQGTDFVVVRELVGGIYFGERK----EDEGDGVAWDSEQYSVPEVQRITRMAAFL 175

Query: 185 ALQRQKVNGSATLTVTHKSNVLSQSDGLFREICRQVYESNQDKFGSINYNEQIVDSMVYR 244
           ALQ    N    +    K+NVL+ S  L+R   + V ++ +++F +++ N Q++DS    
Sbjct: 176 ALQH---NPPLPIWSLDKANVLASSR-LWR---KTVEKTIKEEFPTLSVNHQLIDSAAMI 228

Query: 245 LFREPECFD-VIVAPNLYGDILSDGAAALVGSLGVVPSANVG------FDFVVGEPCHGS 297
           L + P   + +I+  N++GDI+SD A+ + GSLG++PSA++         F + EPCHGS
Sbjct: 229 LVKNPTQLNGIIITSNMFGDIISDEASVIPGSLGLLPSASLASLPDTNTAFGLYEPCHGS 288

Query: 298 APDIAGKGISNPVATIRSTALMLEF-MGHPEAAQDIHKAVDANLRDNTVKTPDLGGKSTT 356
           APD+A KG  NPVATI S A+ML+  +   E    I KAV   L D+ ++T DLGG ++T
Sbjct: 289 APDLA-KGKVNPVATILSAAMMLKLSLNMVEEGVAIEKAVKKVL-DDGIRTGDLGGSNST 346

Query: 357 QQVVDDV 363
            +V D V
Sbjct: 347 SEVGDAV 353

>KNAG0A05280 Chr1 (780448..781533) [1086 bp, 361 aa] {ON} 
          Length = 361

 Score =  147 bits (371), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 108/354 (30%), Positives = 175/354 (49%), Gaps = 33/354 (9%)

Query: 22  TIGLIPGDGIGREVIPAGKLVLENLSSKHGLKFNFIDLEAGWQTF----LDTGKALPDET 77
           T+ L+PGDG+G+E   +   V           FN  ++   W+      LD  + +    
Sbjct: 28  TVTLLPGDGVGKECTDSVVSV-----------FNAENIPIDWEIVNISGLDHKEGVAAAV 76

Query: 78  IDILKNECQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYANV---RPVKSVLSQEKPID 134
             + +N+    L G   +      G+ S  VA RK+L +YANV   + +K V +    +D
Sbjct: 77  QSLRRNKI--GLKGLWHTSNADQSGHGSLNVAFRKQLDIYANVAVFKSLKGVKTMIPDVD 134

Query: 135 MVIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISEVATRNIANIALEIALQRQKVNGS 194
           +V++RENTE  +   E   ++      V E++K  +   T  IA  A   A   QK NG 
Sbjct: 135 LVVIRENTEGEFSGLEHESVEG-----VVESLKVTTLPKTERIARFAFNYA---QK-NGR 185

Query: 195 ATLTVTHKSNVLSQSDGLFREICRQVYESNQDKFGSINYNEQIVDSMVYRLFREPECFDV 254
             +   HK+N++   DGLFR     + E    ++  I  +  IVD+   +   +P  FDV
Sbjct: 186 KAVCAVHKANIMKLGDGLFRNTVTSIGEK---EYPDIETSSIIVDNASMQAVAKPHQFDV 242

Query: 255 IVAPNLYGDILSDGAAALVGSLGVVPSANVGFDFVVGEP-CHGSAPDIAGKGISNPVATI 313
           +V P++YG I+ +  AAL+G  G+V  AN G ++ V EP       DI G+ I+NP A +
Sbjct: 243 LVTPSMYGTIIGNIGAALIGGPGLVAGANFGREYAVFEPGSRHVGLDIKGQNIANPTAML 302

Query: 314 RSTALMLEFMGHPEAAQDIHKAVDANLRDNTVKTPDLGGKSTTQQVVDDVLSRM 367
            S+ALML  +G  ++ + I  AV   + +  V+T D+GG +TT +    V+ ++
Sbjct: 303 LSSALMLNHLGLTKSGKRISDAVREVIAEGDVRTKDIGGDATTTEFTQAVIEKL 356

>TBLA0B06910 Chr2 (1634845..1635942) [1098 bp, 365 aa] {ON} 
          Length = 365

 Score =  147 bits (370), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 106/352 (30%), Positives = 181/352 (51%), Gaps = 30/352 (8%)

Query: 22  TIGLIPGDGIGREVIPAGKLVLENLSSKHGLKFNFIDLEAGWQTFLDTGKALPDETIDIL 81
           T+ LIPGDG+G+EV  +   +           FN  +L   W+  +D      +E ++  
Sbjct: 35  TVTLIPGDGVGKEVTDSVVSI-----------FNAENLPIDWER-VDISGLDHEEGVEAA 82

Query: 82  KNECQGALFG--AVQSPTNKVEGYSSPIVALRKKLGLYANVRPVKS---VLSQEKPIDMV 136
            N  +    G   +   +     + S  VALRK+L +YANV   K+   V ++   +D+V
Sbjct: 83  VNSLKRNKIGLKGIWHTSAGQSDHGSLNVALRKQLDIYANVAHFKTLPGVKTRIPDVDLV 142

Query: 137 IVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISEVATRNIANIALEIALQRQKVNGSAT 196
           I+RENTE  Y     + ++ ++   V E++K I++  +  IA  A + A +  +      
Sbjct: 143 IIRENTEGEY-----SGLEHESVPGVVESLKIITKEKSERIARFAFDFAKRFDR----KL 193

Query: 197 LTVTHKSNVLSQSDGLFREICRQVYESNQDKFGSINYNEQIVDSMVYRLFREPECFDVIV 256
           +T  HK+N++   DGLFR     + E+   ++  I  +  IVD+   +   +P  FDV+V
Sbjct: 194 VTAVHKANIMKLGDGLFRNSVTSIGET---EYPDIKVSSIIVDNASMQSVAKPHQFDVLV 250

Query: 257 APNLYGDILSDGAAALVGSLGVVPSANVGFDFVVGEP-CHGSAPDIAGKGISNPVATIRS 315
            P++YG IL +  AAL+G  G+VP AN G +  V EP       DI G+ ++NP A I S
Sbjct: 251 TPSMYGTILGNIGAALIGGPGLVPGANYGTECAVFEPGSRHVGLDIKGQNVANPTAMILS 310

Query: 316 TALMLEFMGHPEAAQDIHKAVDANLRDNTVKTPDLGGKSTTQQVVDDVLSRM 367
           + L+L+ +G    A+ I  AV   + +  V T D+GG ++T +  ++++ ++
Sbjct: 311 STLLLKHLGLNNEAKKIEDAVYKTIAEGKVTTRDIGGSASTTEFTNEIIKKL 362

>KLLA0D04906g Chr4 (420903..421991) [1089 bp, 362 aa] {ON} highly
           similar to uniprot|P04173 Saccharomyces cerevisiae
           YCL018W LEU2 Beta-isopropylmalate dehydrogenase
           catalyzes the third step in the leucine biosynthesis
           pathway
          Length = 362

 Score =  146 bits (368), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 124/367 (33%), Positives = 188/367 (51%), Gaps = 38/367 (10%)

Query: 20  SLTIGLIPGDGIGREVIPAGKLVLENLSS-KHGLKFNFIDLEAGWQTFLDTGKALPDETI 78
           S  I ++PGD +G+EV      VL  ++  +  +KFNF     G      TG  LPDE +
Sbjct: 2   SKNIVVLPGDHVGKEVTDEAIKVLNAIAEVRPEIKFNFQHHLIGGAAIDATGTPLPDEAL 61

Query: 79  DILKNECQGALFGAVQSPTNKVEGYSSP---IVALRKKLGLYANVRPVKSV------LSQ 129
           +  K +    L GAV  P     G   P   ++ +RK+LGLYAN+RP          LS 
Sbjct: 62  EASK-KADAVLLGAVGGPKWGT-GAVRPEQGLLKIRKELGLYANLRPCNFASDSLLDLSP 119

Query: 130 EKP-----IDMVIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISEVATRNIANIALEI 184
            KP      D V+VRE    +Y    K    E  G  VA   ++ S    + I  +A  +
Sbjct: 120 LKPEYAKGTDFVVVRELVGGIYFGERK----EDEGDGVAWDSEKYSVPEVQRITRMAAFL 175

Query: 185 ALQRQKVNGSATLTVTHKSNVLSQSDGLFREICRQVYESNQDKFGSINYNEQIVDSMVYR 244
           ALQ+   N    +    K+NVL+ S  L+R   + V E+ + +F  +    Q++DS    
Sbjct: 176 ALQQ---NPPLPIWSLDKANVLASSR-LWR---KTVEETIKTEFPQLTVQHQLIDSAAMI 228

Query: 245 LFREPECFD-VIVAPNLYGDILSDGAAALVGSLGVVPSANVGF------DFVVGEPCHGS 297
           L + P   + V++  N++GDI+SD A+ + GSLG++PSA++         F + EPCHGS
Sbjct: 229 LVKSPTKLNGVVITNNMFGDIISDEASVIPGSLGLLPSASLASLPDTNKAFGLYEPCHGS 288

Query: 298 APDIAGKGISNPVATIRSTALMLEF-MGHPEAAQDIHKAVDANLRDNTVKTPDLGGKSTT 356
           APD+    + NP+ATI S A+ML+  +   E  + + +AV  N+ D  V+T DLGG ++T
Sbjct: 289 APDLPANKV-NPIATILSAAMMLKLSLDLVEEGRALEEAVR-NVLDAGVRTGDLGGSNST 346

Query: 357 QQVVDDV 363
            +V D +
Sbjct: 347 TEVGDAI 353

>Skud_3.43 Chr3 (70293..71387) [1095 bp, 364 aa] {ON} YCL018W (REAL)
          Length = 364

 Score =  146 bits (368), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 125/371 (33%), Positives = 191/371 (51%), Gaps = 40/371 (10%)

Query: 16  SATKSLTIGLIPGDGIGREVIPAGKLVLENLSS-KHGLKFNFIDLEAGWQTFLDTGKALP 74
           SA K + +  +PGD +G+E+      VL+ +S  +  +KF+F +   G      TG  LP
Sbjct: 2   SAPKKIVV--LPGDHVGQEITAEAIKVLKAISDVRSNVKFDFENHLIGGAAIDATGVPLP 59

Query: 75  DETIDILKNECQGALFGAVQSPTNKVEGYSSP---IVALRKKLGLYANVRPVKSV----- 126
           DE ++  K +    L GAV  P     G   P   ++ +RK+L LYAN+RP         
Sbjct: 60  DEALEASK-KADAVLLGAVGGPKWGT-GSVRPEQGLLKIRKELQLYANLRPCNFASESLL 117

Query: 127 -LSQEKP-----IDMVIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISEVATRNIANI 180
            LS  KP      D V+VRE    +Y    K    E  G  VA   ++ +    + I  +
Sbjct: 118 DLSPIKPQFAKGTDFVVVRELVGGIYFGERK----EDDGDGVAWDCEQYTVPEVQRITRM 173

Query: 181 ALEIALQRQKVNGSATLTVTHKSNVLSQSDGLFREICRQVYESNQDKFGSINYNEQIVDS 240
           A  +ALQ +       +    K+NVL+ S  L+R   + V E+ +++F ++    Q++DS
Sbjct: 174 AAFMALQHEP---PLPIWSLDKANVLASSR-LWR---KTVEETIKNEFPTLKVQHQLIDS 226

Query: 241 MVYRLFREPECFD-VIVAPNLYGDILSDGAAALVGSLGVVPSANVG------FDFVVGEP 293
               L + P   + +I+  N++GDI+SD A+ + GSLG++PSA++         F + EP
Sbjct: 227 AAMILVKNPTHLNGIIITSNMFGDIISDEASVIPGSLGLLPSASLASLPDKNTAFGLYEP 286

Query: 294 CHGSAPDIAGKGISNPVATIRSTALMLEF-MGHPEAAQDIHKAVDANLRDNTVKTPDLGG 352
           CHGSAPD+  K   NPVATI S A+ML+  +  PE  + I  AV   L D  ++T DLGG
Sbjct: 287 CHGSAPDLP-KNKVNPVATILSAAMMLKLSLNLPEEGKAIEDAVKRVL-DAGIRTGDLGG 344

Query: 353 KSTTQQVVDDV 363
            ++T +V D V
Sbjct: 345 SNSTTEVGDAV 355

>YCL018W Chr3 (91324..92418) [1095 bp, 364 aa] {ON}
           LEU2Beta-isopropylmalate dehydrogenase (IMDH), catalyzes
           the third step in the leucine biosynthesis pathway
          Length = 364

 Score =  145 bits (366), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 124/371 (33%), Positives = 191/371 (51%), Gaps = 40/371 (10%)

Query: 16  SATKSLTIGLIPGDGIGREVIPAGKLVLENLSS-KHGLKFNFIDLEAGWQTFLDTGKALP 74
           SA K + +  +PGD +G+E+      VL+ +S  +  +KF+F +   G      TG  LP
Sbjct: 2   SAPKKIVV--LPGDHVGQEITAEAIKVLKAISDVRSNVKFDFENHLIGGAAIDATGVPLP 59

Query: 75  DETIDILKNECQGALFGAVQSPTNKVEGYSSP---IVALRKKLGLYANVRPVKSV----- 126
           DE ++  K +    L GAV  P     G   P   ++ +RK+L LYAN+RP         
Sbjct: 60  DEALEASK-KADAVLLGAVGGPKWGT-GSVRPEQGLLKIRKELQLYANLRPCNFASDSLL 117

Query: 127 -LSQEKP-----IDMVIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISEVATRNIANI 180
            LS  KP      D V+VRE    +Y    K    E  G  VA   ++ +    + I  +
Sbjct: 118 DLSPIKPQFAKGTDFVVVRELVGGIYFGKRK----EDDGDGVAWDSEQYTVPEVQRITRM 173

Query: 181 ALEIALQRQKVNGSATLTVTHKSNVLSQSDGLFREICRQVYESNQDKFGSINYNEQIVDS 240
           A  +ALQ +       +    K+NVL+ S  L+R   + V E+ +++F ++    Q++DS
Sbjct: 174 AAFMALQHEP---PLPIWSLDKANVLASSR-LWR---KTVEETIKNEFPTLKVQHQLIDS 226

Query: 241 MVYRLFREPECFD-VIVAPNLYGDILSDGAAALVGSLGVVPSANVG------FDFVVGEP 293
               L + P   + +I+  N++GDI+SD A+ + GSLG++PSA++         F + EP
Sbjct: 227 AAMILVKNPTHLNGIIITSNMFGDIISDEASVIPGSLGLLPSASLASLPDKNTAFGLYEP 286

Query: 294 CHGSAPDIAGKGISNPVATIRSTALMLEF-MGHPEAAQDIHKAVDANLRDNTVKTPDLGG 352
           CHGSAPD+  K   NP+ATI S A+ML+  +  PE  + I  AV   L D  ++T DLGG
Sbjct: 287 CHGSAPDLP-KNKVNPIATILSAAMMLKLSLNLPEEGKAIEDAVKKVL-DAGIRTGDLGG 344

Query: 353 KSTTQQVVDDV 363
            ++T +V D V
Sbjct: 345 SNSTTEVGDAV 355

>Ecym_1296 Chr1 (602530..603621) [1092 bp, 363 aa] {ON} similar to
           Ashbya gossypii AAL012C
          Length = 363

 Score =  144 bits (364), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 124/371 (33%), Positives = 191/371 (51%), Gaps = 40/371 (10%)

Query: 16  SATKSLTIGLIPGDGIGREVIPAGKLVLENLS-SKHGLKFNFIDLEAGWQTFLDTGKALP 74
           S+TK + +  +PGD IG+EVI     VL  +  ++  + F F     G      TG  L 
Sbjct: 2   SSTKKVVV--LPGDYIGQEVIAETIKVLNAIQEARPSINFEFEYHLIGGAAINATGAPLS 59

Query: 75  DETIDILKNECQGALFGAVQSPTNKVEGYSSP---IVALRKKLGLYANVRPVKSV----- 126
           D+TI+  K      L GAV  P     G   P   ++A+RK+LGLYAN+RP   +     
Sbjct: 60  DKTIEAAK-AADAVLLGAVGGPEWD-SGAVRPEQGLLAIRKELGLYANLRPCSFISKSLL 117

Query: 127 -LSQEKP-----IDMVIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISEVATRNIANI 180
            LS  KP      D VI+RE    +Y    K    E  G  VA   ++ +      I  +
Sbjct: 118 GLSPLKPEIAQGTDFVILRELVGGIYFGERK----EDDGDGVAWDSEKYTVSEVERITRM 173

Query: 181 ALEIALQRQKVNGSATLTVTHKSNVLSQSDGLFREICRQVYESNQDKFGSINYNEQIVDS 240
              +ALQ    +    L    K+NVL+ S  L+R   R V E+ + +F  ++   Q++DS
Sbjct: 174 GAFLALQH---DPPLPLWSFDKANVLASSR-LWR---RTVNETIKREFPQLSVQHQLIDS 226

Query: 241 MVYRLFREPECFD-VIVAPNLYGDILSDGAAALVGSLGVVPSANVGFD------FVVGEP 293
               + + P  F+ +++  N++GDI+SD A+ + GSLG++PSA++  +      F + EP
Sbjct: 227 AAMIMIKNPRKFNGIVITSNIFGDIISDAASVIPGSLGLLPSASLASEPDKNNAFGLYEP 286

Query: 294 CHGSAPDIAGKGISNPVATIRSTALMLEF-MGHPEAAQDIHKAVDANLRDNTVKTPDLGG 352
           CHGSAPD+  KG +NP+A I S A+ML+  +   +  + I  AV   + ++ ++T DLGG
Sbjct: 287 CHGSAPDLE-KGQANPIACILSAAMMLKLSLNMVDEGKAIENAVK-QVIESGIRTGDLGG 344

Query: 353 KSTTQQVVDDV 363
            +TT +V D V
Sbjct: 345 NNTTTEVGDAV 355

>AAL012C Chr1 complement(320148..321266) [1119 bp, 372 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YCL018W
           (LEU2)
          Length = 372

 Score =  144 bits (363), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 128/368 (34%), Positives = 189/368 (51%), Gaps = 46/368 (12%)

Query: 23  IGLIPGDGIGREVIPAGKLVL----ENLSSKHGLKFNFIDLEAGWQTFLDTGKALPDETI 78
           I ++PGD IGREV+     VL    ++LS  H   F+F     G      TG ALPDE +
Sbjct: 7   IVVLPGDHIGREVVEEAVKVLGAVEQSLSDVH---FDFQYHLVGGAAIDATGSALPDEAL 63

Query: 79  DILKNECQGALFGAVQSPTNKVEGYSSP---IVALRKKLGLYANVRPVKSV------LSQ 129
              K E    L GAV  P  +  G   P   ++ LR++LG+YAN+RP          LS 
Sbjct: 64  GAAK-EADAVLLGAVGGPKWQ-GGAVRPEQGLLKLRQELGVYANLRPCNFAADSLLELSP 121

Query: 130 EKP-----IDMVIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISEVATRNIANIALEI 184
            +P      D+++VRE     Y         E  G  VA    + +    + IA +A  +
Sbjct: 122 LRPEIARDTDIMVVRELLGGSYFGERH----EDEGDGVAWDTDKYTVKEVQRIARMAGFL 177

Query: 185 ALQRQKVNGSATLTVTHKSNVLSQSDGLFREICRQVYESNQDKFGSINYNEQIVDSMVYR 244
           ALQ        +L    K+NVL+ S  L+R   + V E+ Q +F ++    Q++DS    
Sbjct: 178 ALQHDPPLPVWSLD---KANVLASSR-LWR---KTVEETFQSEFPNVQLQHQLIDSAAMI 230

Query: 245 LFREPECFD-VIVAPNLYGDILSDGAAALVGSLGVVPSANVG------FDFVVGEPCHGS 297
           L + P  F+ V+V  N++GDI+SD A+ + GSLG++PSA++         F + EPCHGS
Sbjct: 231 LVKNPRAFNGVVVTSNMFGDIISDEASVIPGSLGLLPSASLASLPDSKSAFGLYEPCHGS 290

Query: 298 APDI-AGKGISNPVATIRSTALMLEF-MGHPEAAQDIHKAVDANLRDNTVKTPDLGGKST 355
           APD+ AGK  +NP+  I S A+ML+  +    A + + +AV   L D+ V+T DL G S+
Sbjct: 291 APDLPAGK--ANPIGCILSAAMMLKLSLNMVAAGEAVEQAVQEVL-DSGVRTGDLLGSSS 347

Query: 356 TQQVVDDV 363
           T +V D +
Sbjct: 348 TSEVGDAI 355

>Kpol_1048.63 s1048 (182096..183190) [1095 bp, 364 aa] {ON}
           (182096..183190) [1095 nt, 365 aa]
          Length = 364

 Score =  143 bits (360), Expect = 9e-39,   Method: Compositional matrix adjust.
 Identities = 123/365 (33%), Positives = 186/365 (50%), Gaps = 39/365 (10%)

Query: 23  IGLIPGDGIGREVIPAGKLVLENL--SSKHGLKFNFIDLEAGWQTFLDTGKALPDETIDI 80
           I ++PGD +G E++     VLE +  SS  G+KF F     G  +   TG  LPDE +D 
Sbjct: 6   IVVLPGDHVGEEIVDEAIKVLEAVASSSSKGIKFEFQRHLIGGASIDATGTPLPDEALDA 65

Query: 81  LKNECQGALFGAVQSPTNKVEGYSSP---IVALRKKLGLYANVRPVK---------SVLS 128
            KN     L GAV  P     G   P   ++ +RK+L LYAN+RP           S L 
Sbjct: 66  AKN-SDAVLLGAVGGPKWGT-GDVRPEQGLLKIRKELQLYANLRPCNFVSDSLLGLSPLK 123

Query: 129 QE--KPIDMVIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISEVATRNIANIALEIAL 186
           +E  K  D  +VRE    +Y    K    E  G   A   ++ +    + I  +A  +AL
Sbjct: 124 EEIAKGTDFTVVRELVGGIYFGDRK----EDDGDGSAWDCEKYTIPEVQRITRMAAFLAL 179

Query: 187 QRQKVNGSATLTVTHKSNVLSQSDGLFREICRQVYESNQDKFGSINYNEQIVDSMVYRLF 246
           Q    +    +    K+NVL+ S  L+R   + V E+ +++F ++    Q++DS    L 
Sbjct: 180 QH---DPPLPIWSLDKANVLASSR-LWR---KTVEETIKNEFPNLKVQHQLIDSAAMILV 232

Query: 247 REPECFD-VIVAPNLYGDILSDGAAALVGSLGVVPSANVG------FDFVVGEPCHGSAP 299
           + P   + +I+  N++GDI+SD A+ + GSLG++PSA++         F + EPCHGSAP
Sbjct: 233 KSPRQLNGIIITNNMFGDIISDEASVIPGSLGLLPSASLASLPDTNTAFGLYEPCHGSAP 292

Query: 300 DIAGKGISNPVATIRSTALMLEF-MGHPEAAQDIHKAVDANLRDNTVKTPDLGGKSTTQQ 358
           D+  KG  NP+ATI S A+ML+  +   +    I +AV   L D  ++T DL G ++T +
Sbjct: 293 DLP-KGKVNPIATILSAAMMLKLSLNLVDEGIAIEQAVKQVL-DAGIRTADLKGSNSTSE 350

Query: 359 VVDDV 363
           V D V
Sbjct: 351 VGDAV 355

>Smik_3.66 Chr3 (89718..90812) [1095 bp, 364 aa] {ON} YCL018W (REAL)
          Length = 364

 Score =  143 bits (360), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 123/371 (33%), Positives = 190/371 (51%), Gaps = 40/371 (10%)

Query: 16  SATKSLTIGLIPGDGIGREVIPAGKLVLENLSS-KHGLKFNFIDLEAGWQTFLDTGKALP 74
           SA K + +  +PGD +G+E+      VL+ +S  +  + F+F +   G      TG  LP
Sbjct: 2   SAPKKIVV--LPGDHVGQEITAEAIKVLKAISEVRSDVNFDFENHLIGGAAIDATGVPLP 59

Query: 75  DETIDILKNECQGALFGAVQSPTNKVEGYSSP---IVALRKKLGLYANVRPVKSV----- 126
           DE ++  K +    L GAV  P     G   P   ++ +RK+L LYAN+RP         
Sbjct: 60  DEALEASK-KADAVLLGAVGGPKWGT-GSVRPEQGLLKIRKELQLYANLRPCNFASDSLL 117

Query: 127 -LSQEKP-----IDMVIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISEVATRNIANI 180
            LS  KP      D V+VRE    +Y    K    E  G  VA   ++ +    + I  +
Sbjct: 118 DLSPIKPQFAKGTDFVVVRELVGGIYFGKRK----EDDGDGVAWDSEQYTVPEVQRITRM 173

Query: 181 ALEIALQRQKVNGSATLTVTHKSNVLSQSDGLFREICRQVYESNQDKFGSINYNEQIVDS 240
           A  +ALQ +       +    K+NVL+ S  L+R   + V E+ +++F ++    Q++DS
Sbjct: 174 AAFMALQHEP---PLPIWSLDKANVLASSR-LWR---KTVEETIKNEFPTLKVQHQLIDS 226

Query: 241 MVYRLFREPECFD-VIVAPNLYGDILSDGAAALVGSLGVVPSANVG------FDFVVGEP 293
               L + P   + +I+  N++GDI+SD A+ + GSLG++PSA++         F + EP
Sbjct: 227 AAMILVKNPTHLNGIIITSNMFGDIISDEASVIPGSLGLLPSASLASLPDKNTAFGLYEP 286

Query: 294 CHGSAPDIAGKGISNPVATIRSTALMLEF-MGHPEAAQDIHKAVDANLRDNTVKTPDLGG 352
           CHGSAPD+  K   NP+ATI S A+ML+  +  PE  + I  AV   L D  ++T DLGG
Sbjct: 287 CHGSAPDLP-KNKVNPIATILSAAMMLKLSLNLPEEGKAIEDAVKKVL-DAGIRTGDLGG 344

Query: 353 KSTTQQVVDDV 363
            ++T +V D V
Sbjct: 345 SNSTTEVGDAV 355

>KLTH0H12188g Chr8 (1039347..1040441) [1095 bp, 364 aa] {ON} highly
           similar to uniprot|P04173 Saccharomyces cerevisiae
           YCL018W LEU2 Beta-isopropylmalate dehydrogenase
           catalyzes the third step in the leucine biosynthesis
           pathway
          Length = 364

 Score =  143 bits (360), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 123/371 (33%), Positives = 192/371 (51%), Gaps = 40/371 (10%)

Query: 16  SATKSLTIGLIPGDGIGREVIPAGKLVLENLSS-KHGLKFNFIDLEAGWQTFLDTGKALP 74
           SA K + +  +PGD +G+E+      VL+ +S  +  +KF F     G      TG+ LP
Sbjct: 2   SAPKKIVV--LPGDHVGQEITDEAIKVLKAISEVRSSVKFEFQQHLIGGAAIDATGEPLP 59

Query: 75  DETIDILKNECQGALFGAVQSPTNKVEGYSSP---IVALRKKLGLYANVRPV----KSVL 127
           D +++  K +    L GAV  P     G   P   ++ +RK+L LYAN+RP     +S+L
Sbjct: 60  DASLEAAK-KADAVLLGAVGGPKWGT-GAVRPEQGLLKIRKELQLYANLRPCNFASESLL 117

Query: 128 -------SQEKPIDMVIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISEVATRNIANI 180
                     +  D V+VRE    +Y    K    E  G  VA   ++ S    + I  +
Sbjct: 118 DLSPLKAEHARGTDFVVVRELVGGIYFGERK----EDEGDGVAWDSEKYSVPEVQRITRM 173

Query: 181 ALEIALQRQKVNGSATLTVTHKSNVLSQSDGLFREICRQVYESNQDKFGSINYNEQIVDS 240
           A  +ALQ    N    +    K+NVL+ S  L+R   + V E+ +++F ++    Q++DS
Sbjct: 174 AAFLALQH---NPPLPVWSLDKANVLASSR-LWR---KTVEETIKNEFPTLTVQHQLIDS 226

Query: 241 MVYRLFREPECFD-VIVAPNLYGDILSDGAAALVGSLGVVPSANVG------FDFVVGEP 293
               + + P   + VI+  N++GDI+SD A+ + GSLG++PSA++         F + EP
Sbjct: 227 AAMIMVKNPTQLNGVIITNNMFGDIISDEASVIPGSLGLLPSASLASLPDTNTAFGLYEP 286

Query: 294 CHGSAPDIAGKGISNPVATIRSTALMLEF-MGHPEAAQDIHKAVDANLRDNTVKTPDLGG 352
           CHGSAPD+  KG  NP+ATI S A+MLE  +   E    + +AV   L D+ ++T DL G
Sbjct: 287 CHGSAPDLE-KGKVNPIATILSAAMMLELSLDMFEEGTAVEEAVRRVL-DSGIRTGDLRG 344

Query: 353 KSTTQQVVDDV 363
            ++TQ+V D V
Sbjct: 345 SNSTQEVGDAV 355

>KNAG0I01280 Chr9 complement(245603..246946) [1344 bp, 447 aa] {ON}
           Anc_1.402 YCL018W
          Length = 447

 Score =  144 bits (363), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 125/364 (34%), Positives = 187/364 (51%), Gaps = 38/364 (10%)

Query: 23  IGLIPGDGIGREVIPAGKLVLENLSS-KHGLKFNFIDLEAGWQTFLDTGKALPDETIDIL 81
           I ++PGD +G+E+      VL  +SS +  + F+F     G      TG  LPDE ++  
Sbjct: 90  IVVLPGDHVGQEITEEAIKVLNAISSVRPNVNFDFQHHLIGGAAIDATGVPLPDEALEAS 149

Query: 82  KNECQGALFGAVQSPTNKVEGYSSP---IVALRKKLGLYANVRPVKSV------LSQEKP 132
           K +    L GAV  P     G   P   ++ +RK+L LYAN+RP          LS  KP
Sbjct: 150 K-KADAVLLGAVGGPKWGT-GSVRPEQGLLKIRKELQLYANLRPCNFASDSLLDLSPLKP 207

Query: 133 -----IDMVIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISEVATRNIANIALEIALQ 187
                 D+ IVRE    +Y    K    E  G  VA   ++ S    + I  +A  +ALQ
Sbjct: 208 EIVKGTDICIVRELVGGIYFGERK----EDEGDGVAWDSEKYSVSEVQRITRMAGFLALQ 263

Query: 188 RQKVNGSATLTVTHKSNVLSQSDGLFREICRQVYESNQDKFGSINYNEQIVDSMVYRLFR 247
               N    +    K+NVL+ S  L+R   + V E+ +++F ++    Q++DS    L +
Sbjct: 264 H---NPPLPVWSLDKANVLASSR-LWR---KTVEETIKNEFPTLTVQHQLIDSAAMILVK 316

Query: 248 EPECFD-VIVAPNLYGDILSDGAAALVGSLGVVPSANVG------FDFVVGEPCHGSAPD 300
            P   + V++A N++GDI+SD A+ + GSLG++PSA++         F + EPCHGSAPD
Sbjct: 317 NPTHLNGVVIANNMFGDIISDEASVIPGSLGLLPSASLASLPDTNTAFGLYEPCHGSAPD 376

Query: 301 IAGKGISNPVATIRSTALMLEF-MGHPEAAQDIHKAVDANLRDNTVKTPDLGGKSTTQQV 359
           +  KG  NPVATI S A+ML+  +   E    + KAV   L D+ V+T DL G ++T +V
Sbjct: 377 LP-KGKVNPVATILSVAMMLKLSLNMTEEGIAVEKAVKQVL-DSGVRTADLRGSNSTSEV 434

Query: 360 VDDV 363
            D +
Sbjct: 435 GDAI 438

>ZYRO0D02838g Chr4 (223132..224217) [1086 bp, 361 aa] {ON} similar
           to uniprot|P28834 Saccharomyces cerevisiae YNL037C IDH1
           Subunit of mitochondrial NAD( )-dependent isocitrate
           dehydrogenase which catalyzes the oxidation of
           isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 361

 Score =  142 bits (358), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 106/352 (30%), Positives = 180/352 (51%), Gaps = 29/352 (8%)

Query: 22  TIGLIPGDGIGREVIPAGKLVL--ENLSSKHGLKFNFIDLEAGWQTFLDTGKALPDETID 79
           T+ LIPGDG+G+EV  +   +   EN+     + ++ +D+       +D  + +      
Sbjct: 30  TVTLIPGDGVGKEVTDSVVSIFKAENVP----VDWDRVDISG-----VDRAEDVKSAVES 80

Query: 80  ILKNECQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYANVRPVKSVLSQEKPI---DMV 136
           + +N     L G   +      G+ S  VALRK+L +YANV   KS+   +  I   D+V
Sbjct: 81  LKRNRI--GLKGIWHTSPADQAGHGSLNVALRKELDIYANVARFKSIPGVQVKIPDVDLV 138

Query: 137 IVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISEVATRNIANIALEIALQRQKVNGSAT 196
           ++RENTE      E + ++ ++   V E++K +++     IA  A + A    K N    
Sbjct: 139 VIRENTEG-----EFSGLEHESVPGVVESLKIMTQDNIERIARFAFDYA----KKNDRKQ 189

Query: 197 LTVTHKSNVLSQSDGLFREICRQVYESNQDKFGSINYNEQIVDSMVYRLFREPECFDVIV 256
           +   HK+N++   DGLF+ + ++V E    ++  +     IVD+   +    P  FDV+V
Sbjct: 190 VVAVHKANIMKMGDGLFKNLVQEVGEK---EYPELQVGNIIVDNASMQTVANPHQFDVLV 246

Query: 257 APNLYGDILSDGAAALVGSLGVVPSANVGFDFVVGEP-CHGSAPDIAGKGISNPVATIRS 315
            P++YG IL +  AAL+G  G+V  AN G D  + EP       DI G+ ++NP A I S
Sbjct: 247 TPSMYGTILGNIGAALIGGPGLVAGANYGRDVALFEPGSRHVGLDIKGQNVANPTAMILS 306

Query: 316 TALMLEFMGHPEAAQDIHKAVDANLRDNTVKTPDLGGKSTTQQVVDDVLSRM 367
           + L+L  +G   +A  I KAV A + +    T D+GG ++T +  + V++++
Sbjct: 307 SVLLLNHLGLNTSADRISKAVHAVIAEGKSVTRDIGGTASTTEFTEAVINKL 358

>NDAI0G04230 Chr7 complement(1015689..1016780) [1092 bp, 363 aa]
           {ON} Anc_1.402
          Length = 363

 Score =  141 bits (355), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 120/364 (32%), Positives = 186/364 (51%), Gaps = 38/364 (10%)

Query: 23  IGLIPGDGIGREVIPAGKLVLENLSS-KHGLKFNFIDLEAGWQTFLDTGKALPDETIDIL 81
           I ++PGD +G E+      VL+ ++   + + F+F     G      TG  LPDE ++  
Sbjct: 6   IVVLPGDHVGEEITAEAVKVLKAIAEVDNSINFDFQYHLIGGAAIDATGVPLPDEALEAS 65

Query: 82  KNECQGALFGAVQSPTNKVEGYSSP---IVALRKKLGLYANVRPVKSV------LSQEKP 132
           KN     L GAV  P     G   P   ++ +RK+LGLYAN+RP          LS  +P
Sbjct: 66  KN-SDAVLLGAVGGPKWGT-GAVRPEQGLLKIRKELGLYANLRPCNFASESLLGLSPLRP 123

Query: 133 -----IDMVIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISEVATRNIANIALEIALQ 187
                 D ++VRE    +Y    K    E  G  VA   ++ S    + I  +A  +ALQ
Sbjct: 124 EIAKGTDFMVVRELVGGIYFGKRK----EDEGDGVAWDSEQYSVPEVQRITRMAAFLALQ 179

Query: 188 RQKVNGSATLTVTHKSNVLSQSDGLFREICRQVYESNQDKFGSINYNEQIVDSMVYRLFR 247
               N    +    K+NVL+ S  L+R   + V E+ +++F ++    Q++DS    L +
Sbjct: 180 H---NPPLPIWSLDKANVLASSR-LWR---KTVEETIKNEFPTLTVQNQLIDSAAMILVK 232

Query: 248 EPECFD-VIVAPNLYGDILSDGAAALVGSLGVVPSANVG------FDFVVGEPCHGSAPD 300
            P   + +I+  N++GDI+SD A+ + GSLG++PSA++         F + EPCHGSAPD
Sbjct: 233 NPTQLNGIIITSNMFGDIISDEASVIPGSLGLLPSASLASLPDTNTAFGLYEPCHGSAPD 292

Query: 301 IAGKGISNPVATIRSTALMLEF-MGHPEAAQDIHKAVDANLRDNTVKTPDLGGKSTTQQV 359
           +  KG  NP+ATI S A+ML+  +   +    I +AV   L D  ++T DLGG ++T +V
Sbjct: 293 LP-KGKVNPIATILSAAMMLKLSLNLVKQGDAIEEAVKKVL-DAGIRTGDLGGSNSTTEV 350

Query: 360 VDDV 363
            D +
Sbjct: 351 GDAI 354

>Kwal_0.225 s0 (111017..112111) [1095 bp, 364 aa] {ON} YCL018W
           (LEU2) - beta-IPM (isopropylmalate) dehydrogenase
           [contig 82] FULL
          Length = 364

 Score =  140 bits (354), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 129/377 (34%), Positives = 192/377 (50%), Gaps = 44/377 (11%)

Query: 16  SATKSLTIGLIPGDGIGREVIPAGKLVLENLSSKHGLK-FNFIDLEAGWQTFLDTGKALP 74
           S TK + +  +PGD +G+E+      VL+ +S     K F F     G      TG+ LP
Sbjct: 2   STTKKIVV--LPGDHVGQEITEEAVKVLKAISEVRPEKQFEFQYHLIGGAAIDATGEPLP 59

Query: 75  DETIDILKNECQGALFGAVQSPTNKVEGYSSP---IVALRKKLGLYANVRPVKSV----- 126
           D +++  K +    L GAV  P     G   P   ++ +RK+L LYAN+RP         
Sbjct: 60  DASLEAAK-KSDAVLLGAVGGPKWGT-GAVRPEQGLLKIRKELQLYANLRPCNFASESLL 117

Query: 127 -LSQEKP-----IDMVIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISEVATRNIANI 180
            LS  KP      D V+VRE    +Y    K    E TG  VA   ++ S    + I  +
Sbjct: 118 DLSPLKPECARGTDFVVVRELVGGIYFGERK----EDTGDGVAWDSEQYSVPEVQRITRM 173

Query: 181 ALEIALQRQKVNGSATLTVTH--KSNVLSQSDGLFREICRQVYESNQDKFGSINYNEQIV 238
           A  +ALQ      S  L V    K+NVL+ S  L+R   + V E+ +++F ++    Q++
Sbjct: 174 AAFLALQH-----SPPLPVWSLDKANVLASSR-LWR---KTVEETIKNEFPTLTVQHQLI 224

Query: 239 DSMVYRLFREPECFD-VIVAPNLYGDILSDGAAALVGSLGVVPSANVG------FDFVVG 291
           DS    L + P   + VI+  N++GDI+SD A+ + GSLG++PSA++         F + 
Sbjct: 225 DSAAMILVKNPTQLNGVIITNNMFGDIISDEASVIPGSLGLLPSASLASLPDSNTAFGLY 284

Query: 292 EPCHGSAPDIAGKGISNPVATIRSTALMLEF-MGHPEAAQDIHKAVDANLRDNTVKTPDL 350
           EPCHGSAPD+  KG  NP+ATI S A+ML+  +   E    + +AV   L D+ V+T DL
Sbjct: 285 EPCHGSAPDLP-KGKVNPIATILSAAMMLKLSLDMFEEGAAVEEAVRKVL-DSGVRTADL 342

Query: 351 GGKSTTQQVVDDVLSRM 367
            G STT +V + V+  +
Sbjct: 343 KGTSTTSEVGEAVVKAL 359

>CAGL0H03795g Chr8 (356535..357632) [1098 bp, 365 aa] {ON}
          Length = 365

 Score =  138 bits (347), Expect = 8e-37,   Method: Compositional matrix adjust.
 Identities = 125/366 (34%), Positives = 185/366 (50%), Gaps = 39/366 (10%)

Query: 22  TIGLIPGDGIGREVIPAGKLVLENLSSKHGLKFNF-IDLEAGWQTFLD-TGKALPDETID 79
           TI ++PGD +G+E+      VL  +      K NF  D        +D TG  LPDE ++
Sbjct: 6   TIVVLPGDHVGQEITEEAIKVLNAIQECRPDKVNFKFDHHLIGGAAIDATGVPLPDEALE 65

Query: 80  ILKNECQGALFGAVQSPTNKVEGYSSP---IVALRKKLGLYANVRPVKSV------LSQE 130
             K +    L GAV  P     G   P   ++ +RK+L LYAN+RP          LS  
Sbjct: 66  ASK-KADAVLLGAVGGPKWGT-GAVRPEQGLLKIRKELQLYANLRPCNFASDSLLDLSPL 123

Query: 131 KP-----IDMVIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISEVATRNIANIALEIA 185
           KP      D V+VRE    +Y    K    E  G  VA   ++ S    + I  +A  +A
Sbjct: 124 KPEIARGTDFVVVRELVGGIYFGERK----EDEGDGVAWDSEKYSVPEVQRITRMAAFMA 179

Query: 186 LQRQKVNGSATLTVTHKSNVLSQSDGLFREICRQVYESNQDKFGSINYNEQIVDSMVYRL 245
           LQ    N    +    K+NVL+ S  L+R   + V E+ +++F  +    Q++DS    L
Sbjct: 180 LQH---NPPLPIWSLDKANVLASSR-LWR---KTVEETIKNEFPQLTVQHQLIDSAAMIL 232

Query: 246 FREPECFD-VIVAPNLYGDILSDGAAALVGSLGVVPSANVG------FDFVVGEPCHGSA 298
            + P   + +I+  N++GDI+SD A+ + GSLG++PSA++         F + EPCHGSA
Sbjct: 233 VKNPTHLNGIIITNNMFGDIISDEASVIPGSLGLLPSASLASLPDKNTAFGLYEPCHGSA 292

Query: 299 PDIAGKGISNPVATIRSTALMLEF-MGHPEAAQDIHKAVDANLRDNTVKTPDLGGKSTTQ 357
           PD+  KG  NPVATI S A+ML+  +   E  + I +AV   L D+ ++T DL G ++T 
Sbjct: 293 PDLP-KGKVNPVATILSAAMMLKLSLDLFEEGEIIEQAVKKVL-DSGIRTADLKGTNSTT 350

Query: 358 QVVDDV 363
           +V D V
Sbjct: 351 EVGDAV 356

>Suva_3.3 Chr3 (1464..2558) [1095 bp, 364 aa] {ON} YCL018W (REAL)
          Length = 364

 Score =  137 bits (344), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 123/371 (33%), Positives = 187/371 (50%), Gaps = 40/371 (10%)

Query: 16  SATKSLTIGLIPGDGIGREVIPAGKLVLENLSS-KHGLKFNFIDLEAGWQTFLDTGKALP 74
           S TK + +  +PGD +G+E+      VL+ +S  +  +KF+F     G      TG  L 
Sbjct: 2   STTKKIVV--LPGDHVGQEITEEAIKVLKAISEVRPNVKFDFEYHLIGGAAIDATGVPLT 59

Query: 75  DETIDILKNECQGALFGAVQSPTNKVEGYSSP---IVALRKKLGLYANVRPVKSV----- 126
           DE ++  K +    L GAV  P     G   P   ++ +RK+L LYAN+RP         
Sbjct: 60  DEALEASK-KADAVLLGAVGGPKWGT-GSVRPEQGLLKIRKELQLYANLRPCNFASESLL 117

Query: 127 -LSQEKP-----IDMVIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISEVATRNIANI 180
            LS  KP      D V+VRE    +Y    K    E  G  VA   ++ +    + I  +
Sbjct: 118 ELSPIKPQFARGTDFVVVRELVGGIYFGKRK----EDDGDGVAWDSEQYTVPEVQRITRM 173

Query: 181 ALEIALQRQKVNGSATLTVTHKSNVLSQSDGLFREICRQVYESNQDKFGSINYNEQIVDS 240
           A  +ALQ Q       +    K+NVL+ S  L+R   + V E+ +++F ++    Q++DS
Sbjct: 174 AAFMALQHQP---PLPIWSLDKANVLASSR-LWR---KTVEETIKNEFPTLKVQHQLIDS 226

Query: 241 MVYRLFREPECFD-VIVAPNLYGDILSDGAAALVGSLGVVPSANVG------FDFVVGEP 293
               L + P   + +I+  N++GDI+SD A+ + GSLG++PSA++         F + EP
Sbjct: 227 AAMILVKNPTQLNGIIITSNMFGDIISDEASCIPGSLGLLPSASLASLPDKNTAFGLYEP 286

Query: 294 CHGSAPDIAGKGISNPVATIRSTALMLEF-MGHPEAAQDIHKAVDANLRDNTVKTPDLGG 352
           CHGSAPD+  K   NP+ATI S A+ML+  +      Q I  AV   L D  ++T DLGG
Sbjct: 287 CHGSAPDLP-KNKVNPIATILSAAMMLKLSLNMTAEGQAIEDAVKKVL-DAGIRTGDLGG 344

Query: 353 KSTTQQVVDDV 363
            ++T +V D V
Sbjct: 345 SNSTIEVGDAV 355

>ZYRO0E04796g Chr5 (362881..363969) [1089 bp, 362 aa] {ON}
           uniprot|Q96WI0 Zygosaccharomyces rouxii LEU2 3-
           isopropylmalate dehydrogenase
          Length = 362

 Score =  135 bits (340), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 123/367 (33%), Positives = 185/367 (50%), Gaps = 38/367 (10%)

Query: 20  SLTIGLIPGDGIGREVIPAGKLVLENLSS-KHGLKFNFIDLEAGWQTFLDTGKALPDETI 78
           S  I ++PGD  G+E+      VLE +S      KFNF     G      TG  LPD+ +
Sbjct: 2   SKNIVVLPGDHAGQEIAQEAIKVLEAISEVSPEAKFNFQHHLIGGAAIDATGSPLPDDAL 61

Query: 79  DILKNECQGALFGAVQSPTNKVEGYSSP---IVALRKKLGLYANVRPVKSV------LSQ 129
              K      L GAV  P     G   P   ++ +RK+L LYAN+RP          LS 
Sbjct: 62  AAAKKADA-VLLGAVGGPKWGT-GSVRPEQGLLKIRKELQLYANLRPCNFASESLLDLSP 119

Query: 130 EKP-----IDMVIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISEVATRNIANIALEI 184
            KP      D V+VRE    +Y    K    E  G  VA   ++ ++   + +  +A  +
Sbjct: 120 LKPQHAKGTDFVVVRELVGGIYFGERK----EDEGDGVAWDSEKYTKPEVQRLTRMAAFL 175

Query: 185 ALQRQKVNGSATLTVTHKSNVLSQSDGLFREICRQVYESNQDKFGSINYNEQIVDSMVYR 244
           ALQ    N    +    K+NVL+ S  L+R   + V E+ +++F  +  N Q++DS    
Sbjct: 176 ALQH---NPPLPIWSLDKANVLASSR-LWR---KTVEETIKNEFPQLKLNHQLIDSAAMI 228

Query: 245 LFREPECFD-VIVAPNLYGDILSDGAAALVGSLGVVPSANVGF------DFVVGEPCHGS 297
           L + P   + +++  NL+GDI+SD A+ + GSLG++PSA++         F + EPCHGS
Sbjct: 229 LVKSPTQLNGIVLTSNLFGDIISDEASVIPGSLGLLPSASLASLPDTNEAFGLYEPCHGS 288

Query: 298 APDIAGKGISNPVATIRSTALMLEF-MGHPEAAQDIHKAVDANLRDNTVKTPDLGGKSTT 356
           APD+  KG  NP+A I S A+ML+  +   +  + + KAV   L D+ V+T DLGG ++T
Sbjct: 289 APDLP-KGKVNPIAMILSAAMMLKLSLNLSKEGEAVEKAVKQVL-DSGVRTGDLGGSNST 346

Query: 357 QQVVDDV 363
            +V D +
Sbjct: 347 SEVGDAI 353

>Suva_14.302 Chr14 (546468..547370) [903 bp, 300 aa] {ON} YNL037C
           (REAL)
          Length = 300

 Score =  133 bits (335), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 102/320 (31%), Positives = 168/320 (52%), Gaps = 45/320 (14%)

Query: 9   LARRSYTSATK-----------SLTIGLIPGDGIGREVIPAGKLVLENLSSKHGLKFNFI 57
           +A+RS  +A +             T+ LIPGDG+G+EV  + K + E             
Sbjct: 6   IAKRSLATAAQVEHILPKKYGGRFTVTLIPGDGVGKEVTDSVKTIFEAE----------- 54

Query: 58  DLEAGWQTF----LDTGKALPDETIDILKNECQGALFGAVQSPTNKVEGYSSPIVALRKK 113
           ++   W+T      D  + + +E ++ L+    G L G   +P ++  G+ S  VALRK+
Sbjct: 55  NIPIDWETINIKQTDHKEGV-NEAVESLRRNKIG-LKGLWHTPADQT-GHGSLNVALRKQ 111

Query: 114 LGLYANV---RPVKSVLSQEKPIDMVIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRIS 170
           L +YANV   + +K V ++   ID++++RENTE      E + ++ ++   V E++K ++
Sbjct: 112 LDIYANVALFKSLKGVKTRIPDIDLIVIRENTEG-----EFSGLEHESVPGVVESLKIMT 166

Query: 171 EVATRNIANIALEIALQRQKVNGSATLTVTHKSNVLSQSDGLFREICRQVYESNQDKFGS 230
           +  T  IA  A + A   +K N  A +T  HK+N++   DGLFR I   + E  Q ++  
Sbjct: 167 KPKTERIARFAFDFA---KKYNRKA-VTAVHKANIMKLGDGLFRNI---ITEIGQKEYPD 219

Query: 231 INYNEQIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGFDFVV 290
           I+ +  IVD+   +   +P  FDV+V P++YG IL +  AAL+G  G+V  AN G D+ V
Sbjct: 220 IDVSSIIVDNASMQAVAKPHQFDVLVTPSMYGTILGNIGAALIGGPGLVAGANFGRDYAV 279

Query: 291 GEP-CHGSAPDIAGKGISNP 309
            EP       DI G+ ++NP
Sbjct: 280 FEPGSRHVGLDIKGQNVANP 299

>SAKL0D08690g Chr4 complement(723302..724396) [1095 bp, 364 aa] {ON}
           highly similar to uniprot|P04173 Saccharomyces
           cerevisiae YCL018W LEU2 Beta-isopropylmalate
           dehydrogenase catalyzes the third step in the leucine
           biosynthesis pathway
          Length = 364

 Score =  132 bits (333), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 122/372 (32%), Positives = 191/372 (51%), Gaps = 40/372 (10%)

Query: 16  SATKSLTIGLIPGDGIGREVIPAGKLVLENLSS-KHGLKFNFIDLEAGWQTFLDTGKALP 74
           SA K + +  +PGD +G+E+      VL+ +S  +  +KF++     G      TG  LP
Sbjct: 2   SAPKKIVV--LPGDHVGQEITAEAIRVLDAISEVRPDVKFDYQYHLIGGAAIDATGVPLP 59

Query: 75  DETIDILKNECQGALFGAVQSP---TNKVEGYSSPIVALRKKLGLYANVRPVKSV----- 126
           DE +D  K      L GAV  P   T +V      ++ +RK+L LYAN+RP         
Sbjct: 60  DEALDAAKKADA-VLLGAVGGPKWGTGQVRPEQG-LLKIRKELQLYANLRPCNFASDSLL 117

Query: 127 -LSQEKP-----IDMVIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISEVATRNIANI 180
            LS  KP      D V+VRE    +Y    K    E  G  VA   ++ S    + I  +
Sbjct: 118 DLSPLKPEYAKGTDFVVVRELVGGIYFGERK----EDEGDGVAWDSEKYSVPEVQRITRM 173

Query: 181 ALEIALQRQKVNGSATLTVTHKSNVLSQSDGLFREICRQVYESNQDKFGSINYNEQIVDS 240
           A  +ALQ+   N    +    K+NVL+ S  L+R   + V E+ +++F ++    Q++DS
Sbjct: 174 AAFLALQQ---NPPLPIWSLDKANVLASSR-LWR---KTVEETIKNEFPTLTVQHQLIDS 226

Query: 241 MVYRLFREPECFD-VIVAPNLYGDILSDGAAALVGSLGVVPSANVG------FDFVVGEP 293
               L + P   + +++  N++GDI+SD A+ + GSLG++PSA++         F + EP
Sbjct: 227 AAMILVKSPTKLNGIVITSNMFGDIISDEASVIPGSLGLLPSASLASLPDSNTAFGLYEP 286

Query: 294 CHGSAPDIAGKGISNPVATIRSTALMLEF-MGHPEAAQDIHKAVDANLRDNTVKTPDLGG 352
           CHGSAPD+  K   NP+ATI S A+ML+  +   E    + +AV   L D  ++T DL G
Sbjct: 287 CHGSAPDLP-KNKVNPIATILSAAMMLKLSLNLVEEGNAVEEAVRRVL-DAGIRTADLRG 344

Query: 353 KSTTQQVVDDVL 364
           +++T +V D V+
Sbjct: 345 ENSTSEVGDAVV 356

>NCAS0C04870 Chr3 complement(993177..994274) [1098 bp, 365 aa] {ON}
           Anc_1.402
          Length = 365

 Score =  132 bits (332), Expect = 9e-35,   Method: Compositional matrix adjust.
 Identities = 123/374 (32%), Positives = 188/374 (50%), Gaps = 45/374 (12%)

Query: 16  SATKSLTIGLIPGDGIGREVIPAGKLVLENL----SSKHGLKFNFIDLEAGWQTFLDTGK 71
           S TK + +  +PGD +G E+      VL+ +    SSK  +KF+F     G       G 
Sbjct: 2   STTKKIVV--LPGDHVGGEITEEAIKVLKAIEQVESSK--VKFDFQYHLIGGAAIDAAGV 57

Query: 72  ALPDETIDILKNECQGALFGAVQSPTNKVEGYSSP---IVALRKKLGLYANVRPVKSV-- 126
            L DE ++  K +    L GAV  P     G   P   ++ +RK+LGLYAN+RP      
Sbjct: 58  PLTDEALEASK-KADAVLLGAVGGPKWGT-GAVRPEQGLLKIRKELGLYANLRPCNFASE 115

Query: 127 ----LSQEKP-----IDMVIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISEVATRNI 177
               LS  +P      D ++VRE    +Y    K    E  G  VA   ++ S      I
Sbjct: 116 PLLGLSPLRPEIAKGTDFMVVRELVGGIYFGERK----EDDGDGVAWDSEKYSVPEVERI 171

Query: 178 ANIALEIALQRQKVNGSATLTVTHKSNVLSQSDGLFREICRQVYESNQDKFGSINYNEQI 237
             +A  +ALQ    N    +    K+NVL+ S  L+R   + V  + +++F ++    Q+
Sbjct: 172 TRMAAFLALQH---NPPLPIWSLDKANVLASSR-LWR---KTVEATIKNEFPTLTVQNQL 224

Query: 238 VDSMVYRLFREPECFD-VIVAPNLYGDILSDGAAALVGSLGVVPSANVG------FDFVV 290
           +DS    L + P   + +I+  N++GDI+SD A+ + GSLG++PSA++         F +
Sbjct: 225 IDSAAMILVKNPTQLNGIIITSNMFGDIISDEASVIPGSLGLLPSASLASLPDSNTAFGL 284

Query: 291 GEPCHGSAPDIAGKGISNPVATIRSTALMLEF-MGHPEAAQDIHKAVDANLRDNTVKTPD 349
            EPCHGSAPD+  K   NPVATI S A+ML+  +   +  + + +AV   L D  V+T D
Sbjct: 285 YEPCHGSAPDLP-KNKVNPVATILSAAMMLKLSLNMVKEGEAVEEAVRRVL-DAGVRTGD 342

Query: 350 LGGKSTTQQVVDDV 363
           LGG ++TQ+V D +
Sbjct: 343 LGGSNSTQEVGDAI 356

>KAFR0I02200 Chr9 (449737..450834) [1098 bp, 365 aa] {ON} Anc_1.402
           YCL018W
          Length = 365

 Score =  131 bits (330), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 119/369 (32%), Positives = 186/369 (50%), Gaps = 44/369 (11%)

Query: 16  SATKSLTIGLIPGDGIGREVIPAGKLVLE---NLSSKHGLKFNFIDLEAGWQTFLDTGKA 72
           S+ K++T+   PGD IG E++     VL+    +S     K+N+  +  G      TG+ 
Sbjct: 2   SSVKNITV--FPGDHIGTEIVRETVKVLDAIAEVSPNVSFKYNYQLI--GGAAIDATGEP 57

Query: 73  LPDETIDILKNECQGALFGAVQSPTNKVEGYSSP---IVALRKKLGLYANVRP---VKSV 126
           L DE + + KN     L GAV  P     G   P   ++ +RK+LG+YAN+RP   V   
Sbjct: 58  LTDEALQVAKN-SDAILLGAVGGPKWG-HGLVRPEQGLLKIRKELGVYANLRPCQFVSET 115

Query: 127 LSQEKPI--------DMVIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISEVATRNIA 178
           L    P+        D VIVRE    +Y    +   D+     VA   +  S    + I 
Sbjct: 116 LLDLSPLKREIVQGTDFVIVRELVGGIYFGERQEAGDDG----VAWDKESYSVPEIQRIT 171

Query: 179 NIALEIALQRQKVNGSATLTVTHKSNVLSQSDGLFREICRQVYESNQDKFGSINYNEQIV 238
            +A  +ALQ    N    +    K+NVL+ S  L+R   + V E+ +++F ++  N  ++
Sbjct: 172 RMAAFLALQH---NPPLPVWSLDKANVLATSR-LWR---KTVEETIKNEFPTLTINHHLI 224

Query: 239 DSMVYRLFREPECFD-VIVAPNLYGDILSDGAAALVGSLGVVPSANVGF------DFVVG 291
           DS    L + P   + V++  N++GDI+SD A+ + GSLG++PSA++           + 
Sbjct: 225 DSAAMTLVQNPTKLNGVVITTNMFGDIISDEASVIPGSLGLLPSASLASLPDKNDALGLY 284

Query: 292 EPCHGSAPDIAGKGISNPVATIRSTALMLEF-MGHPEAAQDIHKAVDANLRDNTVKTPDL 350
           EPCHGSAPD+     +NP+ATI S A+M +  +   +    I +AV   + D  +KT DL
Sbjct: 285 EPCHGSAPDLPADH-ANPIATILSAAMMCKLSLNLTKEGNAIEEAVKRTI-DAGIKTGDL 342

Query: 351 GGKSTTQQV 359
           GGK+TT +V
Sbjct: 343 GGKNTTTEV 351

>TPHA0B03730 Chr2 complement(878199..879296) [1098 bp, 365 aa] {ON}
           Anc_1.402 YCL018W
          Length = 365

 Score =  127 bits (319), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 119/367 (32%), Positives = 179/367 (48%), Gaps = 43/367 (11%)

Query: 23  IGLIPGDGIGREVIPAGKLVLENLSS--KHGLKFNFIDLEAGWQTFLDTGKALPDETIDI 80
           I ++PGD +G EV      +L+ +     + +KFNF     G      TG  LPDE+++ 
Sbjct: 7   IVVLPGDHVGGEVTEEAVKILKAIEEVRNNKVKFNFEYHLIGGAAIDATGNPLPDESLEA 66

Query: 81  LKNECQGALFGAVQSPTNKVEGYSSP---IVALRKKLGLYANVRPVK---------SVLS 128
            K      L GAV  P     G   P   ++ +RK+L LYAN+RP           S L 
Sbjct: 67  SK-RADAVLLGAVGGPKWGT-GSVRPEQGLLKIRKELQLYANLRPCNFASDSLLDLSPLK 124

Query: 129 QE--KPIDMVIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISEVATRNIANIALEIAL 186
           ++  K  D  +VRE    +Y    K    E  G  VA   ++ S    + I  +A  +A+
Sbjct: 125 EKYAKGTDFTVVRELVGGIYFGKRK----EDDGDGVAWDSEQYSVPEVQRITRMAAFLAM 180

Query: 187 QRQKVNGSATLTVTHKSNVLSQSDGLFREICRQVYESNQDKFGSINYNEQIVDSMVYRLF 246
           Q    N    +    K+NVL+ S  L+R   + V E+ Q++F S+  + Q++DS    L 
Sbjct: 181 QH---NPPLPIWSLDKANVLASSR-LWR---KTVEETIQNEFPSLKVSHQLIDSAAMILV 233

Query: 247 REPECFD-VIVAPNLYGDILSDGAAALVG--------SLGVVPSANVGFDFVVGEPCHGS 297
           + P   + +I+  N++GDI+SD A+ + G        SL  +P  N  F     EPCHGS
Sbjct: 234 KNPTQLNGIIITNNMFGDIISDEASVIPGSLGLLPSASLSSLPDTNSAFGLY--EPCHGS 291

Query: 298 APDIAGKGISNPVATIRSTALMLEF-MGHPEAAQDIHKAVDANLRDNTVKTPDLGGKSTT 356
           APD+  KG  NP+ TI S A+ML+  +   E    + +AV   L DN ++T DLGG ++T
Sbjct: 292 APDLP-KGKVNPIGTILSVAMMLKLSLNLKEEGIAVEEAVRRVL-DNNIRTADLGGSNST 349

Query: 357 QQVVDDV 363
             + D V
Sbjct: 350 SDIGDAV 356

>CAGL0D00770g Chr4 (95715..96986) [1272 bp, 423 aa] {ON} highly
           similar to uniprot|P21954 Saccharomyces cerevisiae
           YDL066w IDP1 isocitrate dehydrogenase or uniprot|P41939
           Saccharomyces cerevisiae YLR174w IDP2 or uniprot|P53982
           Saccharomyces cerevisiae YNL009w IDP3
          Length = 423

 Score = 59.3 bits (142), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 78/302 (25%), Positives = 131/302 (43%), Gaps = 53/302 (17%)

Query: 100 VEGYSSPIVALRKKLGLYANVRPVKSVLSQEKPIDMVIVRENTEDLYIK-------TEKT 152
           V G+  PI+  R   G             Q K  D VI  +   +L  K        E  
Sbjct: 133 VPGWEKPIIIGRHAHG------------DQYKATDAVIPGQGKLELVYKPNGDASKAEVM 180

Query: 153 YIDEKTGTRVAEAIKRISEVATRNIANIALEIALQRQKVNGSATLTVTHKSNVLSQSDGL 212
            + +  G  VA A+    E + R  A+ + ++ALQ+ K+N    L ++ K+ +L + DG 
Sbjct: 181 EVYDYKGPGVALAMYNTDE-SIRGFAHSSFKLALQK-KLN----LFLSTKNTILKKYDGR 234

Query: 213 FREICRQVYESN-QDKFGSIN--YNEQIVDSMVYRLFREPECFDVIVAPNLYGDILSDGA 269
           F++I ++VY+S  + KF  +N  Y  +++D MV ++ +    F ++   N  GD+ SD  
Sbjct: 235 FKDIFQEVYDSEYKQKFAELNITYEHRLIDDMVAQMIKSKGGF-IMALKNYDGDVQSDIV 293

Query: 270 AALVGSLGVVPSANVGFD--FVVGEPCHGS----------APDIAGKGISNPVATIRSTA 317
           A   GSLG++ S  +  D      E  HG+            + +   I++  A  R  A
Sbjct: 294 AQGFGSLGLMTSILITPDGKTFESEAAHGTVTRHYRKHQQGEETSTNSIASIFAWTRGLA 353

Query: 318 LMLEFMGHPEA---AQDIHKAVDANLRDNTVKTPDLG---GKS------TTQQVVDDVLS 365
              E  G P+    A  +  A    ++ + + T DL    GK+      TT + +D V  
Sbjct: 354 KRGELDGTPDVVRFANILESATLNTVQQDGIMTKDLALACGKTDRASYVTTTEFLDAVEK 413

Query: 366 RM 367
           R+
Sbjct: 414 RL 415

>KLTH0D14476g Chr4 complement(1184813..1186075) [1263 bp, 420 aa]
           {ON} highly similar to uniprot|P21954 Saccharomyces
           cerevisiae YDL066W IDP1 Mitochondrial NADP-specific
           isocitrate dehydrogenase catalyzes the oxidation of
           isocitrate to alpha-ketoglutarate not required for
           mitochondrial respiration and may function to divert
           alpha- ketoglutarate to biosynthetic processes
          Length = 420

 Score = 59.3 bits (142), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 66/244 (27%), Positives = 109/244 (44%), Gaps = 37/244 (15%)

Query: 153 YIDEKTGTRVAEAIKRISEVATRNIANIALEIALQRQKVNGSATLTVTHKSNVLSQSDGL 212
           ++ +  G  VA A+    E + R  A+ +  +AL +Q       L +  K+ +L Q DG 
Sbjct: 178 HVHDFEGAGVALAMYNTDE-SIRGFAHASFRLALSKQ-----LNLFLATKNTILKQYDGR 231

Query: 213 FREICRQVYESN-QDKF--GSINYNEQIVDSMVYRLFREPECFDVIVAPNLYGDILSDGA 269
           F+++ +Q+Y++  ++ F    I+Y  +++D MV ++ +    F V+   N  GD+ SD  
Sbjct: 232 FKDLFQQLYDAEYREAFERAGISYEHRLIDDMVAQMIKSRGGF-VLALKNYDGDVQSDIV 290

Query: 270 AALVGSLGVVPSANVGFD--FVVGEPCHGS----------APDIAGKGISNPVATIRSTA 317
           A   GSLG++ S  +  D      E  HG+            + +   I++  A  R  A
Sbjct: 291 AQGFGSLGLMSSVLITPDGNAFESEAAHGTVTRHFRLHQQGKETSTNSIASIFAWTRGLA 350

Query: 318 LMLEFMGHPEAAQDIHKAVDANLR---DNTVKTPDLG---GKS------TTQ---QVVDD 362
              +  G P  A   H    A LR   D+ + T DL    GK+      TT    Q V+D
Sbjct: 351 RRADLDGTPAVADFAHALEGATLRTVQDDAIMTKDLALACGKTDRTAYVTTDEFLQAVED 410

Query: 363 VLSR 366
            L R
Sbjct: 411 RLQR 414

>KAFR0H03160 Chr8 complement(602807..604072) [1266 bp, 421 aa] {ON}
           Anc_1.396 YLR174W
          Length = 421

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 57/204 (27%), Positives = 93/204 (45%), Gaps = 17/204 (8%)

Query: 100 VEGYSSPIVALRKKLGLYANVRPVKSVLSQEKPIDMVIVRENTEDLYIKTEKTYIDEKTG 159
           V  +  PI+  R   G       V  +  +E  + ++   ++T    I T+    D   G
Sbjct: 122 VRHWEKPIIIGRHAFGDQYKATDV-VIPEEEGKLKLIFQPKDTNKPAIATDVFEFDGDGG 180

Query: 160 TRVAEAIKRISEVATRNIANIALEIALQRQKVNGSATLTVTHKSNVLSQSDGLFREICRQ 219
             +A    R S    +  A  + E+AL+R+       L  T K+ VL + DG F++I ++
Sbjct: 181 VALAMYNTRKS---IKGFARASFEMALKRK-----MPLFFTTKNTVLKRYDGKFKDIFQE 232

Query: 220 VYESNQ----DKFGSINYNEQIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGS 275
           +YES+     D+ G I Y  +++D MV ++ +    F +I   N  GD+ SD  A   GS
Sbjct: 233 MYESDYKVQFDEIG-ILYEHRLIDDMVAQMLKSTGGF-IIAMKNYDGDVQSDIVAQGFGS 290

Query: 276 LGVVPSANVGFD--FVVGEPCHGS 297
           LG++ S  V  D      E  HG+
Sbjct: 291 LGLMTSMLVAPDGKTFESEAAHGT 314

>Kwal_23.4210 s23 (619516..620784) [1269 bp, 422 aa] {ON} YDL066W
           (IDP1) - Mitochondrial form of NADP-specific isocitrate
           dehydrogenase [contig 1] FULL
          Length = 422

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 79/296 (26%), Positives = 134/296 (45%), Gaps = 39/296 (13%)

Query: 100 VEGYSSPIVALRKKLGLYANVRPVKSVLSQEKPIDMVIVRENTEDLYIKTEKTYIDEKTG 159
           V G+  PI+  R   G     R   +++  EK   + +V    +    K  + +  + TG
Sbjct: 129 VPGWQKPIIIGRHAHG--DQYRATDAII--EKAGKLELVHRPADGSEPKILQVHEFKGTG 184

Query: 160 TR-VAEAIKRISEVATRNIANIALEIALQRQKVNGSATLTVTHKSNVLSQSDGLFREICR 218
            R VA A+    E + R  A+ + ++AL ++       L ++ K+ +L Q DG F++I +
Sbjct: 185 ARGVALAMYNTDE-SIRGFAHASFKLALSKR-----LNLFMSTKNTILKQYDGRFKDIFQ 238

Query: 219 QVY-ESNQDKFGS--INYNEQIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGS 275
           +VY +  Q +F    I+Y  +++D MV ++ +    F V+   N  GD+LSD  A   GS
Sbjct: 239 EVYAQEYQTQFRDEGISYEHRLIDDMVAQMIKSRGGF-VMALKNYDGDVLSDIVAQGFGS 297

Query: 276 LGVVPSANVGFD--FVVGEPCHGSAP-----DIAGKGIS-NPVATIRSTALML----EFM 323
           LG++ S  V  D      E  HG+          GK  S N +A+I + +  L    E  
Sbjct: 298 LGLMTSMLVTPDGKTFESEAAHGTVTRHFRQHQQGKETSTNSIASIFAWSRGLGKRGELD 357

Query: 324 GHP---EAAQDIHKAVDANLRDNTVKTPDLG---------GKSTTQQVVDDVLSRM 367
           G P   E A+ +  A    ++ + + T DL             TT + +D V +R+
Sbjct: 358 GTPDVVEFARKLEAATIETVQQHGIMTKDLALACGNANRDAYVTTNEFLDAVEARL 413

>Ecym_1306 Chr1 complement(619565..620812) [1248 bp, 415 aa] {ON}
           similar to Ashbya gossypii AAL022W
          Length = 415

 Score = 57.0 bits (136), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 63/213 (29%), Positives = 94/213 (44%), Gaps = 35/213 (16%)

Query: 100 VEGYSSPIVALRKKLGLYANVRPVKSVLSQEKPIDMVIVRENTEDLYIKT----EKTYID 155
           V G+  PI+  R   G             Q K  D+VI  E T  L  K+    E   ID
Sbjct: 121 VSGWKEPIIIGRHAFG------------DQYKATDVVIPGEGTLKLVFKSKDGDESKDID 168

Query: 156 ------EKTGTRVAEAIKRISEVATRNIANIALEIALQRQKVNGSATLTVTHKSNVLSQS 209
                  K G  VA ++   +E  T   A  + E+AL+R+       L  T K+ +L + 
Sbjct: 169 LDVFEFPKDGG-VAMSMYNTAESIT-GFAKSSFELALERK-----MPLYSTTKNTILKKY 221

Query: 210 DGLFREICRQVYESN-QDKFGSIN--YNEQIVDSMVYRLFREPECFDVIVAPNLYGDILS 266
           DG F++I   +YE   + KF ++   Y  +++D MV ++ +    F +I   N  GD+ S
Sbjct: 222 DGQFKDIFEGMYEREYKQKFEAVGIWYEHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVQS 280

Query: 267 DGAAALVGSLGVVPSANVGFD--FVVGEPCHGS 297
           D  A   GSLG++ S  V  D      E  HG+
Sbjct: 281 DIVAQGFGSLGLMTSVLVSPDGKTFESEAAHGT 313

>SAKL0D08426g Chr4 (705189..706424) [1236 bp, 411 aa] {ON} highly
           similar to uniprot|P41939 Saccharomyces cerevisiae
           YLR174W IDP2 Cytosolic NADP-specific isocitrate
           dehydrogenase catalyzes oxidation of isocitrate to
           alpha- ketoglutarate levels are elevated during growth
           on non- fermentable carbon sources and reduced during
           growth on glucose
          Length = 411

 Score = 56.2 bits (134), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 66/233 (28%), Positives = 106/233 (45%), Gaps = 34/233 (14%)

Query: 162 VAEAIKRISEVATRNIANIALEIALQRQKVNGSATLTVTHKSNVLSQSDGLFREICRQVY 221
           VA A+   +E  T   A  + E+AL+R+       L  T K+ +L + DG F++I   +Y
Sbjct: 178 VAMAMYNTTESIT-GFAKASFELALERK-----LPLYSTTKNTILKRYDGKFKDIFESMY 231

Query: 222 ESN-QDKFGSIN--YNEQIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGV 278
            S+ QDKF  I   Y  +++D MV ++ +    + +I   N  GD+ SD  A   GSLG+
Sbjct: 232 ASDYQDKFEVIGIWYEHRLIDDMVAQMLKSKGGY-IIAMKNYDGDVESDIVAQGFGSLGL 290

Query: 279 VPSANVGFD--FVVGEPCHGSAP-----DIAGKGIS-NPVATIRSTALMLEFMGH----P 326
           + S  V  D      E  HG+          GK  S N +A+I + +  +   G     P
Sbjct: 291 MSSVLVTPDGKTFESEAAHGTVTRHYRQHQQGKETSTNSIASIFAWSRGIIQRGKIDETP 350

Query: 327 EA---AQDIHKAVDANLRDNTVKTPDL---------GGKSTTQQVVDDVLSRM 367
           E     Q +  A    ++++ + T DL         G   TT++ +D V  R+
Sbjct: 351 EVVKFGQLLEDATTNTVQEDGIMTKDLALILGKTDRGSYVTTEEFIDAVEKRL 403

>KLTH0H12012g Chr8 (1026586..1027827) [1242 bp, 413 aa] {ON} highly
           similar to uniprot|P41939 Saccharomyces cerevisiae
           YLR174W IDP2 Cytosolic NADP-specific isocitrate
           dehydrogenase catalyzes oxidation of isocitrate to
           alpha- ketoglutarate levels are elevated during growth
           on non- fermentable carbon sources and reduced during
           growth on glucose
          Length = 413

 Score = 55.8 bits (133), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 63/233 (27%), Positives = 104/233 (44%), Gaps = 34/233 (14%)

Query: 162 VAEAIKRISEVATRNIANIALEIALQRQKVNGSATLTVTHKSNVLSQSDGLFREICRQVY 221
           VA A+   +E + R  A  + E+ALQR+       L  T K+ +L + DG F++    +Y
Sbjct: 180 VALAMYNTTE-SIRGFARASFELALQRK-----MPLYSTTKNTILKRYDGRFKDEFEAMY 233

Query: 222 ESN-QDKF--GSINYNEQIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGV 278
           E+  +++F    I Y  +++D MV ++ +    F VI   N  GD+ SD  A   GSLG+
Sbjct: 234 EAEYRERFERAGIWYEHRLIDDMVAQMLKSAGGF-VIAMKNYDGDVQSDIVAQGFGSLGL 292

Query: 279 VPSANVGFD--FVVGEPCHGS----------APDIAGKGISNPVATIRSTALMLEFMGHP 326
           + S  V  D      E  HG+            + +   I++  A  R         G P
Sbjct: 293 MTSVLVTPDGRAFESEAAHGTVTRHFRLHQQGKETSTNSIASIFAWTRGLLQRGRLDGTP 352

Query: 327 EA---AQDIHKAVDANLRDNTVKTPDLG---GKS------TTQQVVDDVLSRM 367
           E    A+ +  A  A + ++ + T DL    G++      TT+  +D V  R+
Sbjct: 353 EVEGFARALETATVATVNEDGIMTKDLALMLGRTDRASYVTTEDFIDAVEQRL 405

>TBLA0C01290 Chr3 complement(283624..284880) [1257 bp, 418 aa] {ON}
           Anc_1.396 YLR174W
          Length = 418

 Score = 55.8 bits (133), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 36/109 (33%), Positives = 59/109 (54%), Gaps = 9/109 (8%)

Query: 176 NIANIALEIALQRQKVNGSATLTVTHKSNVLSQSDGLFREICRQVY-ESNQDKFGSIN-- 232
           + A  + E AL+R+       L  T K+ +L Q DG F++I  ++Y +  +DKF  +N  
Sbjct: 197 DFAKASFEFALERK-----IPLYSTTKNTILKQYDGKFKDIFEEMYAKEYEDKFKVLNIW 251

Query: 233 YNEQIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPS 281
           Y  +++D MV ++ +    F +I   N  GD+ SD  A   GSLG++ S
Sbjct: 252 YEHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVESDVVAQGFGSLGLMTS 299

>TDEL0E01160 Chr5 (234217..235488) [1272 bp, 423 aa] {ON} Anc_4.254
           YDL066W
          Length = 423

 Score = 55.5 bits (132), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 68/276 (24%), Positives = 123/276 (44%), Gaps = 43/276 (15%)

Query: 100 VEGYSSPIVALRKKLGLYANVRPVKSVLSQEKPIDMVIVRENTEDLYIKTE------KTY 153
           V G+  PI+     +G +A+         Q K  D +I      +L  K E      K  
Sbjct: 134 VPGWEKPII-----IGRHAHA-------DQYKATDAIIPGPGKLELVYKPEDGSEPTKLE 181

Query: 154 IDEKTGTRVAEAIKRISEVATRNIANIALEIALQRQKVNGSATLTVTHKSNVLSQSDGLF 213
           + +  G  VA A+    E + R  A+ + ++AL + K+N    L ++ K+ +L + DG F
Sbjct: 182 VYDYKGAGVALAMYNTDE-SIRGFAHASFKLALNK-KLN----LFLSTKNTILKKYDGRF 235

Query: 214 REICRQVYES---NQDKFGSINYNEQIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAA 270
           ++I ++++++    Q +  +I+Y  +++D MV ++ +    F ++   N  GD+ SD  A
Sbjct: 236 KDIFQEIFDAEYKTQFEAANISYEHRLIDDMVAQMIKSKGGF-IMALKNYDGDVQSDIVA 294

Query: 271 ALVGSLGVVPSANVGFD--FVVGEPCHGS----------APDIAGKGISNPVATIRSTAL 318
              GSLG++ S  V  D      E  HG+            + +   I++  A  R  A 
Sbjct: 295 QGFGSLGLMTSVLVTPDGKTFESEAAHGTVTRHYRQYQQGKETSTNSIASIFAWTRGLAK 354

Query: 319 MLEFMGHPEA---AQDIHKAVDANLRDNTVKTPDLG 351
             E  G PE    A  +  A    ++++ + T DL 
Sbjct: 355 RGELDGTPEVTKFANLLESATLNTVQEDGIMTKDLA 390

>TPHA0B03660 Chr2 (863280..864548) [1269 bp, 422 aa] {ON} Anc_1.396
           YLR174W
          Length = 422

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 39/126 (30%), Positives = 64/126 (50%), Gaps = 11/126 (8%)

Query: 177 IANIALEIALQRQKVNGSATLTVTHKSNVLSQSDGLFREICRQVY-ESNQDKFGSIN--Y 233
            A  + E AL+R+       L  T K+ +L + DG F++I   +Y E  ++KF ++N  Y
Sbjct: 203 FARSSFEFALERK-----LPLYSTTKNTILKKYDGQFKDIFESMYKEEYEEKFKALNIWY 257

Query: 234 NEQIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGFD--FVVG 291
             +++D MV ++ +    F +I   N  GD+ SD  A   GSLG++ S  +  D      
Sbjct: 258 EHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSVLISDDGKTFES 316

Query: 292 EPCHGS 297
           E  HG+
Sbjct: 317 EAAHGT 322

>Kwal_0.191 s0 (98033..99268) [1236 bp, 411 aa] {ON} YLR174W (IDP2)
           - Cytosolic form of NADP-dependent isocitrate
           dehydrogenase [contig 82] FULL
          Length = 411

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 62/211 (29%), Positives = 92/211 (43%), Gaps = 33/211 (15%)

Query: 100 VEGYSSPIVALRKKLGLYANVRPVKSVLSQEKPIDMVIVRENTEDLYIKTEKTYIDEK-- 157
           V  +S PIV  R   G             Q K  DMV+  E    L  K++    D +  
Sbjct: 121 VPQWSKPIVIGRHAFG------------DQYKASDMVVKGEGDLKLVFKSKNGDNDSELD 168

Query: 158 ------TGTRVAEAIKRISEVATRNIANIALEIALQRQKVNGSATLTVTHKSNVLSQSDG 211
                 TG  VA A+   SE +    A  + E+ALQR+       L  T K+ +L + DG
Sbjct: 169 VFHFPPTGG-VALAMYNTSE-SIAGFARASFELALQRR-----MPLYSTTKNTILKKYDG 221

Query: 212 LFREICRQVYESN-QDKFGS--INYNEQIVDSMVYRLFREPECFDVIVAPNLYGDILSDG 268
            F+++   +Y +  Q +F    I Y  +++D MV ++ +    F +I   N  GD+ SD 
Sbjct: 222 KFKDVFEAMYAAEYQSRFEELGIWYEHRLIDDMVAQMLKSTGGF-IIAMKNYDGDVQSDI 280

Query: 269 AAALVGSLGVVPSANVGFD--FVVGEPCHGS 297
            A   GSLG++ S  V  D      E  HG+
Sbjct: 281 VAQGFGSLGLMTSVLVTPDGKTFESEAAHGT 311

>Kpol_1055.78 s1055 (207889..209172) [1284 bp, 427 aa] {ON}
           (207889..209172) [1284 nt, 428 aa]
          Length = 427

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 67/235 (28%), Positives = 115/235 (48%), Gaps = 38/235 (16%)

Query: 162 VAEAIKRISEVATRNIANIALEIALQRQKVNGSATLTVTHKSNVLSQSDGLFREICRQVY 221
           VA A+    E + R  A+ + ++A     +N    L ++ K+ +L + DG F++I +++Y
Sbjct: 189 VALAMYNTDE-SIRGFAHSSFKLA-----INKKLNLFLSTKNTILKKYDGRFKDIFQEIY 242

Query: 222 ESN-QDKFGS--INYNEQIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGV 278
           ES+ + +F +  I+Y  +++D MV ++ +    F ++   N  GD+ SD  A   GSLG+
Sbjct: 243 ESDYKSQFENLGISYEHRLIDDMVAQMIKSKGGF-IMALKNYDGDVQSDIVAQGFGSLGL 301

Query: 279 VPSANVGFD--FVVGEPCHGSAPDI-----AGKGIS-NPVATIRSTALMLEFMGHPEAAQ 330
           + S  V  D      E  HG+          GK  S N +A+I + +  L   G  ++  
Sbjct: 302 MTSVLVTPDGKTFESEAAHGTVTRHYRQYEQGKETSTNSIASIFAWSRGLAKRGELDSTP 361

Query: 331 DIHKAVDANLRD----NTVK-----TPDLG---GKS------TTQQVVDDVLSRM 367
           D+ K   ANL +    NTV+     T DL    GK+      TT + +D V +R+
Sbjct: 362 DVIKF--ANLLESATLNTVQQDGIMTKDLALACGKTERSAYVTTDEFLDAVATRL 414

>Kpol_1048.70 s1048 complement(198298..199557) [1260 bp, 419 aa]
           {ON} complement(198298..199557) [1260 nt, 420 aa]
          Length = 419

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 58/216 (26%), Positives = 94/216 (43%), Gaps = 38/216 (17%)

Query: 100 VEGYSSPIVALRKKLGLYANVRPVKSVLSQEKPIDMVIVRENTEDLYIKTEKTYIDEKTG 159
           V G+  PI+  R   G             Q K  DMVI  +N + + +K   T  D KT 
Sbjct: 121 VPGWEKPIIIGRHAYG------------DQYKAADMVIPEDNNKGI-VKLVYTSDDGKTN 167

Query: 160 TR-------------VAEAIKRISEVATRNIANIALEIALQRQKVNGSATLTVTHKSNVL 206
                          +A  +   +  + +  A+ + E AL++        L  T K+ +L
Sbjct: 168 IELPVHQFDGNDDGGIALGMFNTTR-SIKGFAHSSFEFALEK-----GLPLYSTTKNTIL 221

Query: 207 SQSDGLFREICRQVYESN-QDKFGS--INYNEQIVDSMVYRLFREPECFDVIVAPNLYGD 263
            + DG +++I   +YE + +DKF +  I Y  +++D MV ++ +    F VI   N  GD
Sbjct: 222 KKYDGQYKDIFNDMYEKDYKDKFEAKGIWYEHRLIDDMVAQMLKSKGGF-VIAMKNYDGD 280

Query: 264 ILSDGAAALVGSLGVVPSANVGFD--FVVGEPCHGS 297
           + SD  A   GSLG++ S  +  D      E  HG+
Sbjct: 281 VQSDVVAQGFGSLGLMSSILISDDGKTFESEAAHGT 316

>KLLA0B03355g Chr2 (303444..304733) [1290 bp, 429 aa] {ON} highly
           similar to uniprot|P21954 Saccharomyces cerevisiae
           YDL066W IDP1 Mitochondrial NADP-specific isocitrate
           dehydrogenase catalyzes the oxidation of isocitrate to
           alpha-ketoglutarate not required for mitochondrial
           respiration and may function to divert alpha-
           ketoglutarate to biosynthetic processes
          Length = 429

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 57/205 (27%), Positives = 102/205 (49%), Gaps = 22/205 (10%)

Query: 100 VEGYSSPIVALRKKLGLYANVRPVKSV-LSQEKPIDMVIVRENTEDLYIKTEKTYIDEKT 158
           V G+  PIV     +G +A+    K+  L    P  + +V + T+    KT + Y  +  
Sbjct: 140 VPGWEKPIV-----IGRHAHGDQYKATDLVVPGPGKLELVYKPTDGSETKTLEVY--DYK 192

Query: 159 GTRVAEAIKRISEVATRNIANIALEIALQRQKVNGSATLTVTHKSNVLSQSDGLFREICR 218
           G  +A A+    E + R  A+ + ++A+ + K+N    L ++ K+ +L + DG F++I +
Sbjct: 193 GPGIALAMYNTDE-SIRGFAHASFKLAITK-KLN----LYLSTKNTILKKYDGRFKDIFQ 246

Query: 219 QVYESNQ----DKFGSINYNEQIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVG 274
           ++Y+S      +K G I Y  +++D MV ++ +    F ++   N  GD+ SD  A   G
Sbjct: 247 EIYDSEYKSEFEKLG-IWYEHRLIDDMVAQMIKSKGGF-ILAFKNYDGDVQSDIVAQGFG 304

Query: 275 SLGVVPSANVGFD--FVVGEPCHGS 297
           SLG++ S  V  D      E  HG+
Sbjct: 305 SLGLMTSVLVTPDGKAFESEAAHGT 329

>ZYRO0E05016g Chr5 complement(379654..380889) [1236 bp, 411 aa] {ON}
           highly similar to uniprot|P41939 Saccharomyces
           cerevisiae YLR174W IDP2 Cytosolic NADP-specific
           isocitrate dehydrogenase catalyzes oxidation of
           isocitrate to alpha- ketoglutarate levels are elevated
           during growth on non- fermentable carbon sources and
           reduced during growth on glucose
          Length = 411

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 54/182 (29%), Positives = 84/182 (46%), Gaps = 21/182 (11%)

Query: 129 QEKPIDMVIVRENTEDLYIKTEKTYIDEK-------TGTRVAEAIKRISEVATRNIANIA 181
           Q K  D VI  E    L  K++    D+         G  VA A+   +E +    A  +
Sbjct: 139 QYKATDTVIPDEGELKLVFKSKDGKHDQDLQVFEFPKGGGVAMAMYNTTE-SIEGFAKAS 197

Query: 182 LEIALQRQKVNGSATLTVTHKSNVLSQSDGLFREICRQVYE----SNQDKFGSINYNEQI 237
            E+AL+R++      L  T K+ +L + DG F++I   +YE    S  +K G I Y  ++
Sbjct: 198 FELALERKQ-----PLYSTTKNTILKKYDGKFKDIFEAMYEKEYRSQFEKLG-IWYEHRL 251

Query: 238 VDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGFD--FVVGEPCH 295
           +D MV ++ +    + +I   N  GD+ SD  A   GSLG++ S  V  D      E  H
Sbjct: 252 IDDMVAQMLKSKGGY-IIAMKNYDGDVQSDIVAQGFGSLGLMTSVLVTPDGKTFESEAAH 310

Query: 296 GS 297
           G+
Sbjct: 311 GT 312

>AAL022W Chr1 (302946..304193) [1248 bp, 415 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR174W (IDP2) and
           YNL009W (IDP3)
          Length = 415

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 58/211 (27%), Positives = 89/211 (42%), Gaps = 31/211 (14%)

Query: 100 VEGYSSPIVALRKKLGLYANVRPVKSVLSQEKPIDMVIVRENTEDLYIKTEKTYIDEKTG 159
           V G++ PI+  R   G             Q K  D+VI  E T  L  +++     +   
Sbjct: 121 VPGWNEPIIVGRHAFG------------DQYKATDVVIPGEGTLKLVFESKDGDKSKNLD 168

Query: 160 TRVAEAIKRISEVATR--------NIANIALEIALQRQKVNGSATLTVTHKSNVLSQSDG 211
             V E  K      T           A  + E+ALQR+       L  T K+ +L + DG
Sbjct: 169 LEVFEYPKDGGVAMTMYNTTDSITGFAKSSFELALQRK-----MPLYSTTKNTILKKYDG 223

Query: 212 LFREICRQVYESN-QDKF--GSINYNEQIVDSMVYRLFREPECFDVIVAPNLYGDILSDG 268
            F++I   +Y +  ++KF    I Y  +++D MV ++ +    F +I   N  GD+ SD 
Sbjct: 224 KFKDIFEGMYAAEYKEKFEAAGIWYEHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVQSDI 282

Query: 269 AAALVGSLGVVPSANVGFD--FVVGEPCHGS 297
            A   GSLG++ S  V  D      E  HG+
Sbjct: 283 VAQGFGSLGLMTSVLVSPDGKTFESEAAHGT 313

>CAGL0H03663g Chr8 (337533..338789) [1257 bp, 418 aa] {ON} highly
           similar to uniprot|P41939 Saccharomyces cerevisiae
           YLR174w IDP2 isocitrate dehydrogenase or uniprot|P53982
           Saccharomyces cerevisiae YNL009w IDP3 or uniprot|P21954
           Saccharomyces cerevisiae YDL066w IDP1
          Length = 418

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 48/155 (30%), Positives = 78/155 (50%), Gaps = 14/155 (9%)

Query: 148 KTEKTYIDEKTGTRVAEAIKRISEVATRNIANIALEIALQRQKVNGSATLTVTHKSNVLS 207
           KT K Y  +  G  VA A+    E  T   A  + E+A++R+       L  T K+ +L 
Sbjct: 167 KTIKVYDYKSPG--VALAMYNTDESIT-GFARASFELAIKRK-----LPLFFTTKNTILK 218

Query: 208 QSDGLFREICRQVY-ESNQDKFGS--INYNEQIVDSMVYRLFREPECFDVIVAPNLYGDI 264
           + DG F++I +++Y E  + KF    I+Y  +++D MV ++ +    F +I   N  GD+
Sbjct: 219 KYDGRFKDIFQKMYDEDYKGKFKELGISYEHRLIDDMVAQMIKSKGGF-IIAMKNYDGDV 277

Query: 265 LSDGAAALVGSLGVVPSANVGFDFVV--GEPCHGS 297
            SD  A   GSLG++ S  +  D  +   E  HG+
Sbjct: 278 QSDIVAQGFGSLGLMTSTLLTPDGKIFESEAAHGT 312

>AER061C Chr5 complement(749709..750986) [1278 bp, 425 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL066W
           (IDP1)
          Length = 425

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 54/210 (25%), Positives = 92/210 (43%), Gaps = 32/210 (15%)

Query: 100 VEGYSSPIVALRKKLGLYANVRPVKSVLSQEKPIDMVIVRENTEDLYIKTE------KTY 153
           V G+  PI+  R   G             Q K  D V+    T DL  +          +
Sbjct: 139 VPGWEKPIIIGRHAHG------------DQYKATDAVVPGAGTLDLVFRPADGSAPTSLH 186

Query: 154 IDEKTGTRVAEAIKRISEVATRNIANIALEIALQRQKVNGSATLTVTHKSNVLSQSDGLF 213
           + +  G  VA A+    E + R  A+ +  +AL +Q       L ++ K+ +L Q DG F
Sbjct: 187 VYDFAGPGVALAMYNTEE-SIRGFAHASFRLALAKQ-----LNLFLSTKNTILKQYDGRF 240

Query: 214 REICRQVYESNQ----DKFGSINYNEQIVDSMVYRLFREPECFDVIVAPNLYGDILSDGA 269
           +++  ++Y++      ++ G I Y  +++D MV ++ +    F ++   N  GD+ SD  
Sbjct: 241 KDVFEELYQAQYKAEFERLG-IYYEHRLIDDMVAQMVKSKGGF-IMALKNYDGDVQSDIV 298

Query: 270 AALVGSLGVVPSANVGFD--FVVGEPCHGS 297
           A   GSLG++ S  V  D      E  HG+
Sbjct: 299 AQGFGSLGLMTSVLVTPDGKTFESEAAHGT 328

>SAKL0H02860g Chr8 (280944..282209) [1266 bp, 421 aa] {ON} highly
           similar to uniprot|P21954 Saccharomyces cerevisiae
           YDL066W IDP1 Mitochondrial NADP-specific isocitrate
           dehydrogenase catalyzes the oxidation of isocitrate to
           alpha-ketoglutarate not required for mitochondrial
           respiration and may function to divert alpha-
           ketoglutarate to biosynthetic processes
          Length = 421

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 54/203 (26%), Positives = 98/203 (48%), Gaps = 19/203 (9%)

Query: 100 VEGYSSPIVALRKKLGLYANVRPVKSVLSQEKPIDMVIVRENTEDLYIKTEKTYIDEKTG 159
           V G+  PI+  R   G     +   +V+     +++V   EN  +   K  + Y  +  G
Sbjct: 133 VPGWEKPIIIGRHAHG--DQYKATDAVIPGPGKLELVYKPENGPE---KVMEVY--DYKG 185

Query: 160 TRVAEAIKRISEVATRNIANIALEIALQRQKVNGSATLTVTHKSNVLSQSDGLFREICRQ 219
             VA A+    E + R  A+ + ++AL + K+N    L ++ K+ +L + DG F++I ++
Sbjct: 186 PGVALAMYNTEE-SIRGFAHASFKLALTK-KLN----LYLSTKNTILKKYDGRFKDIFQE 239

Query: 220 VYES---NQDKFGSINYNEQIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSL 276
           +Y++    Q +   I Y  +++D MV ++ +    F ++   N  GD+ SD  A   GSL
Sbjct: 240 LYDAEYKKQFEAAGIYYEHRLIDDMVAQMIKSKGGF-IMALKNYDGDVQSDIVAQGFGSL 298

Query: 277 GVVPSANVGFD--FVVGEPCHGS 297
           G++ S  V  D      E  HG+
Sbjct: 299 GLMTSVLVTPDGKTFESEAAHGT 321

>TPHA0B02210 Chr2 (509945..511246) [1302 bp, 433 aa] {ON} Anc_4.254
           YDL066W
          Length = 433

 Score = 52.8 bits (125), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 49/173 (28%), Positives = 86/173 (49%), Gaps = 19/173 (10%)

Query: 197 LTVTHKSNVLSQSDGLFREICRQVYESN-QDKFGSIN--YNEQIVDSMVYRLFREPECFD 253
           L ++ K+ +L + DG F+++ ++V++S  +DKF ++N  Y  +++D MV ++ +    + 
Sbjct: 229 LFLSTKNTILKKYDGRFKDVFQEVFDSTYKDKFEALNIKYEHRLIDDMVAQMIKSKGGY- 287

Query: 254 VIVAPNLYGDILSDGAAALVGSLGVVPSANVGFD--FVVGEPCHGSAP-----DIAGKGI 306
           ++   N  GD+ SD  A   GSLG++ S  V  D      E  HG+          GK  
Sbjct: 288 IMALKNYDGDVQSDIVAQGFGSLGLMTSILVTPDGKTFESEAAHGTVTRHYRQHQQGKQT 347

Query: 307 S-NPVATI----RSTALMLEFMGHPEA---AQDIHKAVDANLRDNTVKTPDLG 351
           S N +A+I    R  A   E    P+    AQ + KA    ++++ + T DL 
Sbjct: 348 STNSIASIFAWSRGLAKRGELDNTPDVMKFAQTLEKATLDTVQEDGIMTKDLA 400

>NDAI0D04360 Chr4 (1024297..1025571) [1275 bp, 424 aa] {ON}
           Anc_4.254
          Length = 424

 Score = 52.8 bits (125), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 43/144 (29%), Positives = 78/144 (54%), Gaps = 12/144 (8%)

Query: 159 GTRVAEAIKRISEVATRNIANIALEIALQRQKVNGSATLTVTHKSNVLSQSDGLFREICR 218
           G+ VA A+    E +    A+ + ++A+ + K+N    L ++ K+ +L + DG F++I +
Sbjct: 192 GSGVALAMYNTDE-SIEGFAHSSFKLAIDK-KLN----LFLSTKNTILKKYDGRFKDIFQ 245

Query: 219 QVYESN-QDKFG--SINYNEQIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGS 275
            +YE++ + KF   +INY  +++D MV ++ +    F ++   N  GD+ SD  A   GS
Sbjct: 246 SIYETHYKAKFQQLNINYEHRLIDDMVAQMIKSKGGF-IMALKNYDGDVQSDIVAQGFGS 304

Query: 276 LGVVPSANVGFD--FVVGEPCHGS 297
           LG++ S  V  D      E  HG+
Sbjct: 305 LGLMTSILVTPDGKTFESEAAHGT 328

>TDEL0B06100 Chr2 complement(1076365..1077609) [1245 bp, 414 aa]
           {ON} Anc_1.396 YLR174W
          Length = 414

 Score = 52.4 bits (124), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 39/126 (30%), Positives = 63/126 (50%), Gaps = 11/126 (8%)

Query: 177 IANIALEIALQRQKVNGSATLTVTHKSNVLSQSDGLFREICRQVY-ESNQDKFGS--INY 233
            A  + E+AL+R+       L  T K+ +L + DG F+++  Q+Y +  Q +F    I Y
Sbjct: 191 FAKASFELALERK-----LPLYSTTKNTILKKYDGKFKDVFEQMYADQYQSRFEELGIWY 245

Query: 234 NEQIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGFD--FVVG 291
             +++D MV ++ +    F +I   N  GD+ SD  A   GSLG++ S  V  D      
Sbjct: 246 EHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVESDIVAQGFGSLGLMTSVLVTPDGKTFES 304

Query: 292 EPCHGS 297
           E  HG+
Sbjct: 305 EAAHGT 310

>KAFR0I02130 Chr9 (438428..439654) [1227 bp, 408 aa] {ON} Anc_1.396
           YLR174W
          Length = 408

 Score = 52.4 bits (124), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 38/127 (29%), Positives = 64/127 (50%), Gaps = 11/127 (8%)

Query: 176 NIANIALEIALQRQKVNGSATLTVTHKSNVLSQSDGLFREICRQVYESN-QDKFGS--IN 232
           + A  +  +A++R+       L  T K+ +L Q DG F++I + VYE+  ++ F    I 
Sbjct: 189 SFARASFTMAIERK-----LPLYSTTKNTILKQYDGQFKDIFKTVYENEYKETFEELGIW 243

Query: 233 YNEQIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGFD--FVV 290
           Y  +++D MV ++ +    F +I   N  GD+ SD  A   GSLG++ S  +  D     
Sbjct: 244 YEHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSTLIAADGKTFE 302

Query: 291 GEPCHGS 297
            E  HG+
Sbjct: 303 SEAAHGT 309

>Smik_4.169 Chr4 (311244..312530) [1287 bp, 428 aa] {ON} YDL066W
           (REAL)
          Length = 428

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 43/144 (29%), Positives = 78/144 (54%), Gaps = 12/144 (8%)

Query: 159 GTRVAEAIKRISEVATRNIANIALEIALQRQKVNGSATLTVTHKSNVLSQSDGLFREICR 218
           G+ VA A+    E +    A+ + ++A+ + K+N    L ++ K+ +L + DG F++I +
Sbjct: 192 GSGVAMAMYNTDE-SIEGFAHSSFKLAIDK-KLN----LFLSTKNTILKKYDGRFKDIFQ 245

Query: 219 QVYESN-QDKFGS--INYNEQIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGS 275
           +VYE+  + KF +  I+Y  +++D MV ++ +    F ++   N  GD+ SD  A   GS
Sbjct: 246 KVYEAQYKSKFEALGIHYEHRLIDDMVAQMIKSKGGF-IMALKNYDGDVQSDIVAQGFGS 304

Query: 276 LGVVPSANVGFD--FVVGEPCHGS 297
           LG++ S  V  D      E  HG+
Sbjct: 305 LGLMTSILVTPDGKTFESEAAHGT 328

>Skud_4.189 Chr4 (330300..331589) [1290 bp, 429 aa] {ON} YDL066W
           (REAL)
          Length = 429

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 44/145 (30%), Positives = 77/145 (53%), Gaps = 14/145 (9%)

Query: 159 GTRVAEAIKRISEVATRNIANIALEIALQRQKVNGSATLTVTHKSNVLSQSDGLFREICR 218
           G+ VA A+    E +    A+ + ++A+ + K+N    L ++ K+ +L + DG F++I +
Sbjct: 193 GSGVAMAMYNTDE-SIEGFAHSSFKLAIDK-KLN----LFLSTKNTILKKYDGRFKDIFQ 246

Query: 219 QVYE----SNQDKFGSINYNEQIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVG 274
           +VYE    S  +K G I+Y  +++D MV ++ +    F ++   N  GD+ SD  A   G
Sbjct: 247 EVYEAEYKSKFEKLG-IHYEHRLIDDMVAQMIKSKGGF-IMALKNYDGDVQSDIVAQGFG 304

Query: 275 SLGVVPSANVGFD--FVVGEPCHGS 297
           SLG++ S  V  D      E  HG+
Sbjct: 305 SLGLMTSILVTPDGKTFESEAAHGT 329

>YDL066W Chr4 (334835..336121) [1287 bp, 428 aa] {ON}
           IDP1Mitochondrial NADP-specific isocitrate
           dehydrogenase, catalyzes the oxidation of isocitrate to
           alpha-ketoglutarate; not required for mitochondrial
           respiration and may function to divert
           alpha-ketoglutarate to biosynthetic processes
          Length = 428

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 43/144 (29%), Positives = 77/144 (53%), Gaps = 12/144 (8%)

Query: 159 GTRVAEAIKRISEVATRNIANIALEIALQRQKVNGSATLTVTHKSNVLSQSDGLFREICR 218
           G+ VA A+    E +    A+ + ++A+ + K+N    L ++ K+ +L + DG F++I +
Sbjct: 192 GSGVAMAMYNTDE-SIEGFAHSSFKLAIDK-KLN----LFLSTKNTILKKYDGRFKDIFQ 245

Query: 219 QVYESN-QDKFGS--INYNEQIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGS 275
           +VYE+  + KF    I+Y  +++D MV ++ +    F ++   N  GD+ SD  A   GS
Sbjct: 246 EVYEAQYKSKFEQLGIHYEHRLIDDMVAQMIKSKGGF-IMALKNYDGDVQSDIVAQGFGS 304

Query: 276 LGVVPSANVGFD--FVVGEPCHGS 297
           LG++ S  V  D      E  HG+
Sbjct: 305 LGLMTSILVTPDGKTFESEAAHGT 328

>Smik_12.235 Chr12 (451719..452957) [1239 bp, 412 aa] {ON} YLR174W
           (REAL)
          Length = 412

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 59/218 (27%), Positives = 102/218 (46%), Gaps = 33/218 (15%)

Query: 177 IANIALEIALQRQKVNGSATLTVTHKSNVLSQSDGLFREICRQVY-ESNQDKFGS--INY 233
            A  + E+A++R+       L  T K+ +L + DG F+++   +Y ES ++KF S  I Y
Sbjct: 192 FAKASFELAIERK-----LPLYSTTKNTILKKYDGKFKDVFEGMYAESYKEKFESLGIWY 246

Query: 234 NEQIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGFD--FVVG 291
             +++D MV ++ +    + +I   N  GD+ SD  A   GSLG++ S  +  D      
Sbjct: 247 EHRLIDDMVAQMLKSKGGY-IIAMKNYDGDVESDIVAQGFGSLGLMTSVLITPDGKTFES 305

Query: 292 EPCHGSAP-----DIAGKGIS-NPVATIRSTALMLEFMGHPEAAQDIHK-------AVDA 338
           E  HG+          GK  S N +A+I +    +   G  +   D+ K       A   
Sbjct: 306 EAAHGTVTRHFRQHQQGKETSTNSIASIFAWTRGIIQRGKLDNTPDVVKFGQILESATVN 365

Query: 339 NLRDNTVKTPDLG---GKS------TTQQVVDDVLSRM 367
            ++++ + T DL    GK+      TT++ +D V SR+
Sbjct: 366 TVQEDGIMTKDLALILGKTERSAYVTTEEFIDAVESRL 403

>NCAS0A02510 Chr1 complement(476363..477643) [1281 bp, 426 aa] {ON}
           Anc_4.254
          Length = 426

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 61/236 (25%), Positives = 111/236 (47%), Gaps = 34/236 (14%)

Query: 159 GTRVAEAIKRISEVATRNIANIALEIALQRQKVNGSATLTVTHKSNVLSQSDGLFREICR 218
           G+ VA A+    E + R  A+ + ++AL + K+N    L ++ K+ +L + DG F++I +
Sbjct: 190 GSGVALAMYNTDE-SIRGFAHSSFKLALTK-KLN----LFLSTKNTILKKYDGRFKDIFQ 243

Query: 219 QVYESN-QDKFGS--INYNEQIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGS 275
           ++++   + KF +  I+Y  +++D MV ++ +    F ++   N  GD+ SD  A   GS
Sbjct: 244 EIFDMEYKTKFANLGISYEHRLIDDMVAQMIKSKGGF-IMALKNYDGDVQSDIVAQGFGS 302

Query: 276 LGVVPSANVGFD--FVVGEPCHGS----------APDIAGKGISNPVATIRSTALMLEFM 323
           LG++ S  V  D      E  HG+            + +   I++  A  R  A   E  
Sbjct: 303 LGLMTSILVTPDGKTFESEAAHGTVTRHYRKFQKGEETSTNSIASIFAWSRGLAKRGELD 362

Query: 324 GHPEA---AQDIHKAVDANLRDNTVKTPDLG---GKS------TTQQVVDDVLSRM 367
           G P+    A  +  A    ++ + + T DL    GK+      TT + +D V  R+
Sbjct: 363 GTPDVVRFANLLEAATLNTVQQDGIMTKDLALAQGKTDRSSYVTTDEFIDAVEKRL 418

>YLR174W Chr12 (504591..505829) [1239 bp, 412 aa] {ON}
           IDP2Cytosolic NADP-specific isocitrate dehydrogenase,
           catalyzes oxidation of isocitrate to
           alpha-ketoglutarate; levels are elevated during growth
           on non-fermentable carbon sources and reduced during
           growth on glucose
          Length = 412

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 59/218 (27%), Positives = 101/218 (46%), Gaps = 33/218 (15%)

Query: 177 IANIALEIALQRQKVNGSATLTVTHKSNVLSQSDGLFREICRQVY-ESNQDKFGS--INY 233
            A  + E+A++R+       L  T K+ +L + DG F+++   +Y  S ++KF S  I Y
Sbjct: 192 FAKASFELAIERK-----LPLYSTTKNTILKKYDGKFKDVFEAMYARSYKEKFESLGIWY 246

Query: 234 NEQIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGFD--FVVG 291
             +++D MV ++ +    + +I   N  GD+ SD  A   GSLG++ S  +  D      
Sbjct: 247 EHRLIDDMVAQMLKSKGGY-IIAMKNYDGDVESDIVAQGFGSLGLMTSVLITPDGKTFES 305

Query: 292 EPCHGSAP-----DIAGKGIS-NPVATIRSTALMLEFMGHPEAAQDIHK-------AVDA 338
           E  HG+          GK  S N +A+I +    +   G  +   D+ K       A   
Sbjct: 306 EAAHGTVTRHFRQHQQGKETSTNSIASIFAWTRGIIQRGKLDNTPDVVKFGQILESATVN 365

Query: 339 NLRDNTVKTPDLG---GKS------TTQQVVDDVLSRM 367
            ++++ + T DL    GKS      TT++ +D V SR+
Sbjct: 366 TVQEDGIMTKDLALILGKSERSAYVTTEEFIDAVESRL 403

>KLLA0F12342g Chr6 (1137608..1138855) [1248 bp, 415 aa] {ON} highly
           similar to uniprot|P41939 Saccharomyces cerevisiae
           YLR174W IDP2 Cytosolic NADP-specific isocitrate
           dehydrogenase catalyzes oxidation of isocitrate to
           alpha- ketoglutarate levels are elevated during growth
           on non- fermentable carbon sources and reduced during
           growth on glucose
          Length = 415

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 52/203 (25%), Positives = 91/203 (44%), Gaps = 14/203 (6%)

Query: 100 VEGYSSPIVALRKKLGLYANVRPVKSVLSQEKPIDMVIVRENTEDLYIKTEKTYIDEKTG 159
           V  +  PI+  R   G     R    V+     + +V   +++    I+      DE++ 
Sbjct: 121 VTNWEKPIIIGRHAFG--DQYRATDVVIPGAGKLKLVFESDDSNTENIELSVYDFDEESK 178

Query: 160 TRVAEAIKRISEVATRNIANIALEIALQRQKVNGSATLTVTHKSNVLSQSDGLFREICRQ 219
             VA A+    E  T   A+ + ++AL+R        L  T K+ +L + DG F+++   
Sbjct: 179 GGVAMAMYNTLESIT-GFAHASFKMALER-----GLPLYSTTKNTILKKYDGKFKDVFES 232

Query: 220 VYESN-QDKFGS--INYNEQIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSL 276
           +YES  +  F +  I Y  +++D MV ++ +    + +I   N  GD+ SD  A   GSL
Sbjct: 233 LYESQYKSAFEAKGIWYEHRLIDDMVAQMLKSKGGY-IIAMKNYDGDVESDIVAQGFGSL 291

Query: 277 GVVPSANVGFD--FVVGEPCHGS 297
           G++ S  +  D      E  HG+
Sbjct: 292 GLMTSVLITPDGKAFESEAAHGT 314

>NCAS0A08720 Chr1 complement(1722511..1723752) [1242 bp, 413 aa]
           {ON} Anc_1.396
          Length = 413

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 39/130 (30%), Positives = 62/130 (47%), Gaps = 11/130 (8%)

Query: 173 ATRNIANIALEIALQRQKVNGSATLTVTHKSNVLSQSDGLFREICRQVYESN-QDKFGS- 230
           A    A  + ++AL+RQ       L  T K+ +L + DG F+ +   +YE   + +F   
Sbjct: 190 AIEGFARSSFQLALERQ-----LPLYSTTKNTILKKYDGKFKSVFEDMYEREYKQQFEDL 244

Query: 231 -INYNEQIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGFD-- 287
            I Y  +++D MV ++ +    F +I   N  GD+ SD  A   GSLG++ S  V  D  
Sbjct: 245 GIWYEHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSVLVAPDGK 303

Query: 288 FVVGEPCHGS 297
               E  HG+
Sbjct: 304 TFESEAAHGT 313

>Skud_12.239 Chr12 (451342..452580) [1239 bp, 412 aa] {ON} YLR174W
           (REAL)
          Length = 412

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 37/126 (29%), Positives = 64/126 (50%), Gaps = 11/126 (8%)

Query: 177 IANIALEIALQRQKVNGSATLTVTHKSNVLSQSDGLFREICRQVYESN-QDKFGS--INY 233
            A  + E+A++R+       L  T K+ +L + DG F+++   +Y  N ++KF S  I Y
Sbjct: 192 FAKASFELAIERK-----LPLYSTTKNTILKKYDGKFKDVFEAMYAENYKEKFESLGIWY 246

Query: 234 NEQIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGFD--FVVG 291
             +++D MV ++ +    + +I   N  GD+ SD  A   GSLG++ S  +  D      
Sbjct: 247 EHRLIDDMVAQMLKSKGGY-IIAMKNYDGDVESDIVAQGFGSLGLMTSMLITPDGKTFES 305

Query: 292 EPCHGS 297
           E  HG+
Sbjct: 306 EAAHGT 311

>KNAG0H01670 Chr8 (298481..299755) [1275 bp, 424 aa] {ON} Anc_1.396
           YLR174W
          Length = 424

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 38/127 (29%), Positives = 66/127 (51%), Gaps = 11/127 (8%)

Query: 176 NIANIALEIALQRQKVNGSATLTVTHKSNVLSQSDGLFREICRQVYESN-QDKFGS--IN 232
           + A  + E+AL+R+       L    K+ +L + DGLF++I  ++Y+ + + KF    I 
Sbjct: 194 SFAKSSFELALKRK-----LPLFFATKNTILKEYDGLFKDIFEKLYKDHYKTKFEELGIT 248

Query: 233 YNEQIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGFDFVV-- 290
           +  +++D MV ++ +    F ++   N  GD+ SD  A   GSLG++ S  V  D  V  
Sbjct: 249 FEHRLIDDMVAQMLKSNGGF-ILSLKNYDGDVQSDIVAQGFGSLGLMTSMLVTPDDSVFE 307

Query: 291 GEPCHGS 297
            E  HG+
Sbjct: 308 SEAAHGT 314

>KNAG0I01320 Chr9 complement(255478..256716) [1239 bp, 412 aa] {ON}
           Anc_1.396 YLR174W
          Length = 412

 Score = 50.1 bits (118), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 36/126 (28%), Positives = 64/126 (50%), Gaps = 11/126 (8%)

Query: 177 IANIALEIALQRQKVNGSATLTVTHKSNVLSQSDGLFREICRQVYESN-QDKFGS--INY 233
            A  + ++A++R+       L  T K+ +L + DG+F++I   +YE   ++KF    I Y
Sbjct: 195 FAKASFQLAVERK-----MPLYSTTKNTILKKYDGMFKDIFEGMYEREYKEKFEELGIWY 249

Query: 234 NEQIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGFD--FVVG 291
             +++D MV ++ +    + +I   N  GD+ SD  A   GSLG++ S  +  D      
Sbjct: 250 EHRLIDDMVAQMLKSSGGY-IIAMKNYDGDVQSDIVAQGFGSLGLMTSVLITPDGKTFES 308

Query: 292 EPCHGS 297
           E  HG+
Sbjct: 309 EAAHGT 314

>Suva_10.271 Chr10 (476726..477964) [1239 bp, 412 aa] {ON} YLR174W
           (REAL)
          Length = 412

 Score = 50.1 bits (118), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 37/130 (28%), Positives = 66/130 (50%), Gaps = 11/130 (8%)

Query: 173 ATRNIANIALEIALQRQKVNGSATLTVTHKSNVLSQSDGLFREICRQVY-ESNQDKFGS- 230
           + +  A  + E+AL+R+       L  T K+ +L + DG F+++   +Y E  ++KF + 
Sbjct: 188 SIKGFAKASFELALERK-----LPLYSTTKNTILKKYDGKFKDVFEAMYAEVYKEKFEAL 242

Query: 231 -INYNEQIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGFD-- 287
            I Y  +++D MV ++ +    + +I   N  GD+ SD  A   GSLG++ S  +  D  
Sbjct: 243 GIWYEHRLIDDMVAQMLKSKGGY-IIAMKNYDGDVESDIVAQGFGSLGLMTSLLITPDGK 301

Query: 288 FVVGEPCHGS 297
               E  HG+
Sbjct: 302 TFESEAAHGT 311

>Suva_4.184 Chr4 (324382..325671) [1290 bp, 429 aa] {ON} YDL066W
           (REAL)
          Length = 429

 Score = 49.7 bits (117), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 42/144 (29%), Positives = 76/144 (52%), Gaps = 12/144 (8%)

Query: 159 GTRVAEAIKRISEVATRNIANIALEIALQRQKVNGSATLTVTHKSNVLSQSDGLFREICR 218
           G+ VA A+    E +    A+ + ++A+ + K+N    L ++ K+ +L + DG F++I +
Sbjct: 193 GSGVAMAMYNTDE-SIEGFAHSSFKMAIDK-KLN----LFLSTKNTILKKYDGRFKDIFQ 246

Query: 219 QVYESN-QDKFGS--INYNEQIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGS 275
            +YE+  + KF    I+Y  +++D MV ++ +    F ++   N  GD+ SD  A   GS
Sbjct: 247 NIYEAQYKPKFEELGIHYEHRLIDDMVAQMVKSKGGF-IMALKNYDGDVQSDIVAQGFGS 305

Query: 276 LGVVPSANVGFD--FVVGEPCHGS 297
           LG++ S  V  D      E  HG+
Sbjct: 306 LGLMTSILVTPDGKTFESEAAHGT 329

>KAFR0G03260 Chr7 complement(675642..676907) [1266 bp, 421 aa] {ON}
           Anc_4.254 YDL066W
          Length = 421

 Score = 49.3 bits (116), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 44/167 (26%), Positives = 81/167 (48%), Gaps = 17/167 (10%)

Query: 177 IANIALEIALQRQKVNGSATLTVTHKSNVLSQSDGLFREICRQVYESN-QDKFGS--INY 233
            A+ + ++AL + K+N    L +  K+ +L + DG F++I +Q+Y    + KF    I Y
Sbjct: 204 FAHSSFQVALNK-KLN----LFLATKNTILKKYDGRFKDIFQQIYNGQYKAKFEQLGITY 258

Query: 234 NEQIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGFD--FVVG 291
             +++D MV ++ +    F ++   N  GD+ SD  A   GSLG++ S  V  D      
Sbjct: 259 EHRLIDDMVAQMIKSKGGF-IMALKNYDGDVQSDIVAQGFGSLGLMTSILVSPDGKTFES 317

Query: 292 EPCHGSAP------DIAGKGISNPVATIRSTALMLEFMGHPEAAQDI 332
           E  HG+         +  +  +N +A+I + +  L   G  +  +D+
Sbjct: 318 EAAHGTVTRHFRRHQMGEETSTNSIASIFAWSRGLAKRGELDGTKDV 364

>TBLA0A08010 Chr1 (1981576..1982862) [1287 bp, 428 aa] {ON}
           Anc_4.254 YDL066W
          Length = 428

 Score = 48.9 bits (115), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 29/94 (30%), Positives = 53/94 (56%), Gaps = 4/94 (4%)

Query: 191 VNGSATLTVTHKSNVLSQSDGLFREICRQVYESNQDK-FGSIN--YNEQIVDSMVYRLFR 247
           VN +  L +  K+ +L + DG F++I +++YE+   K F  +N  Y  +++D MV ++ +
Sbjct: 216 VNKNMNLFLATKNTILKKYDGRFKDIFQEIYENEYKKEFERLNITYEHRLIDDMVAQMIK 275

Query: 248 EPECFDVIVAPNLYGDILSDGAAALVGSLGVVPS 281
               + ++   N  GD+ SD  A   GSLG++ S
Sbjct: 276 SKGGY-IMALKNYDGDVQSDIVAQGFGSLGLMTS 308

>Skud_14.318 Chr14 (581597..582859) [1263 bp, 420 aa] {ON} YNL009W
           (REAL)
          Length = 420

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 36/126 (28%), Positives = 64/126 (50%), Gaps = 11/126 (8%)

Query: 177 IANIALEIALQRQKVNGSATLTVTHKSNVLSQSDGLFREICRQVYESN-QDKFGS--INY 233
            A  + E+AL+R+       L  T K+ +L   D  F+EI  +++++  ++KF +  I Y
Sbjct: 192 FAKASFELALKRR-----LPLFFTTKNTILKSYDNQFKEIFDKLFDAEYKEKFQALGITY 246

Query: 234 NEQIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGFDFVV--G 291
             +++D MV ++ +    F ++   N  GD+ SD  A   GSLG++ S  +  D      
Sbjct: 247 EHRLIDDMVAQMLKSRGGF-IVAMKNYDGDVQSDIVAQGFGSLGLMTSLLITPDAKTFES 305

Query: 292 EPCHGS 297
           E  HG+
Sbjct: 306 EAAHGT 311

>KNAG0D04410 Chr4 complement(799414..800700) [1287 bp, 428 aa] {ON}
           Anc_4.254 YDL066W
          Length = 428

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 43/176 (24%), Positives = 84/176 (47%), Gaps = 21/176 (11%)

Query: 170 SEVATRNIANIALEIALQRQKVNGSATLTVTHKSNVLSQSDGLFREICRQVYES---NQD 226
           ++ + R  A+ + ++AL ++       L ++ K+ +L + DG F+++ ++++++    Q 
Sbjct: 202 TDESIRGFAHASFKLALSKK-----LDLFLSTKNTILKRYDGRFKDLFQEIFDAEYKQQF 256

Query: 227 KFGSINYNEQIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGF 286
           +   I Y  +++D MV ++ +    F ++   N  GD+ SD  A   GSLG++ S  V  
Sbjct: 257 EESGIQYQHRLIDDMVAQMIKSKGGF-IMALKNYDGDVQSDIVAQGFGSLGLMTSVLVTP 315

Query: 287 D--FVVGEPCHGSAPDIAGK------GISNPVATI----RSTALMLEFMGHPEAAQ 330
           D      E  HG+      K        +NP+A+I    R  A   E  G P+  +
Sbjct: 316 DGKTFESEAAHGTVTRHYRKYQRGEETSTNPIASIFAWTRGIAKRGELDGTPDVVR 371

>YNL009W Chr14 (614821..616083) [1263 bp, 420 aa] {ON}
           IDP3Peroxisomal NADP-dependent isocitrate dehydrogenase,
           catalyzes oxidation of isocitrate to alpha-ketoglutarate
           with the formation of NADP(H+), required for growth on
           unsaturated fatty acids
          Length = 420

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 54/223 (24%), Positives = 97/223 (43%), Gaps = 35/223 (15%)

Query: 173 ATRNIANIALEIALQRQKVNGSATLTVTHKSNVLSQSDGLFREICRQVYESN-QDKFGS- 230
           + +  A  + E+AL+R+       L  T K+ +L   D  F++I   +++   ++KF + 
Sbjct: 188 SIKGFAKASFELALKRK-----LPLFFTTKNTILKNYDNQFKQIFDNLFDKEYKEKFQAL 242

Query: 231 -INYNEQIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGFD-- 287
            I Y  +++D MV ++ +    F +I   N  GD+ SD  A   GSLG++ S  +  D  
Sbjct: 243 KITYEHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSILITPDGK 301

Query: 288 FVVGEPCHGSAPDIAGKG------ISNPVATIRSTALMLEFMGHPEAAQDIHKAVDANLR 341
               E  HG+      K        +N +A+I +    +   G  +   D+ K  +  L 
Sbjct: 302 TFESEAAHGTVTRHFRKHQRGEETSTNSIASIFAWTRAIIQRGKLDNTDDVIKFGNL-LE 360

Query: 342 DNTVKTPDLGGKS-----------------TTQQVVDDVLSRM 367
             T+ T  +GGK                  TT++ +D+V  R+
Sbjct: 361 KATLDTVQVGGKMTKDLALMLGKTNRSSYVTTEEFIDEVAKRL 403

>CAGL0B04917g Chr2 complement(477939..479174) [1236 bp, 411 aa] {ON}
           highly similar to uniprot|P41939 Saccharomyces
           cerevisiae YLR174w IDP2 isocitrate dehydrogenase or
           uniprot|P53982 Saccharomyces cerevisiae YNL009w IDP3 or
           uniprot|P21954 Saccharomyces cerevisiae YDL066w IDP1
          Length = 411

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 36/130 (27%), Positives = 64/130 (49%), Gaps = 11/130 (8%)

Query: 173 ATRNIANIALEIALQRQKVNGSATLTVTHKSNVLSQSDGLFREICRQVYESN-QDKFGS- 230
           + R  A  +  +AL+ +       L  T K+ +L + DG F++    +YE+  +++F + 
Sbjct: 188 SIRGFARASFNMALEHE-----MPLYSTTKNTILKKYDGKFKDTFESMYEAEYKEQFEAK 242

Query: 231 -INYNEQIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGFD-- 287
            I Y  +++D MV ++ +    F +I   N  GD+ SD  A   GSLG++ S  +  D  
Sbjct: 243 GIWYEHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVESDIVAQGFGSLGLMTSVLISPDGK 301

Query: 288 FVVGEPCHGS 297
               E  HG+
Sbjct: 302 TFESEAAHGT 311

>Suva_14.339 Chr14 (594794..596047) [1254 bp, 417 aa] {ON} YNL009W
           (REAL)
          Length = 417

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 35/130 (26%), Positives = 66/130 (50%), Gaps = 11/130 (8%)

Query: 173 ATRNIANIALEIALQRQKVNGSATLTVTHKSNVLSQSDGLFREICRQVYESN-QDKFGS- 230
           + +  A  + E+AL+R+       L  T K+ +L   D  F++I  +++++  +++F + 
Sbjct: 188 SIKGFAKASFELALKRK-----LPLFFTTKNTILKNYDNQFKQIFDKLFDAEYKEQFQAL 242

Query: 231 -INYNEQIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGFD-- 287
            I Y  +++D MV ++ +    F +I   N  GD+ SD  A   GSLG++ S  +  D  
Sbjct: 243 GITYEHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSILITPDGK 301

Query: 288 FVVGEPCHGS 297
               E  HG+
Sbjct: 302 TFESEAAHGT 311

>NCAS0G03620 Chr7 complement(675224..676480) [1257 bp, 418 aa] {ON}
           Anc_1.396
          Length = 418

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 55/196 (28%), Positives = 90/196 (45%), Gaps = 27/196 (13%)

Query: 197 LTVTHKSNVLSQSDGLFREICRQVY----ESNQDKFGSINYNEQIVDSMVYRLFREPECF 252
           L  T K+ +L + DG F++I  ++Y    +   DK G I Y  +++D MV ++ +    F
Sbjct: 211 LYFTTKNTILKKYDGTFKDIFMEMYLNEYKDEFDKLG-IFYEHRLIDDMVAQMLKSKGGF 269

Query: 253 DVIVAPNLYGDILSDGAAALVGSLGVVPSANVGFD--FVVGEPCHGSAP-----DIAGKG 305
            +I   N  GD+ SD  A   GSLG++ S  +  D      E  HG+         AGK 
Sbjct: 270 -IIAMKNYDGDVQSDIVAQGFGSLGLMTSVLITPDGKTFQSEAAHGTVTRHYRLHQAGKP 328

Query: 306 IS-NPVATIRSTALMLEFMGHPEAAQDIHK-------AVDANLRDNTVKTPDL------G 351
            S N +A+I + +  L   G  +   D+ K       +    ++ + + T DL      G
Sbjct: 329 TSTNSIASIFAWSRGLIQRGKLDNNPDLVKFGELLEQSTLDTVQIDGIMTKDLALLIGQG 388

Query: 352 GKSTTQQVVDDVLSRM 367
             +TT+  +D V +RM
Sbjct: 389 KYATTEGFIDAVTNRM 404

>Smik_14.319 Chr14 (573167..574423) [1257 bp, 418 aa] {ON} YLR174W
           (REAL)
          Length = 418

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 38/126 (30%), Positives = 62/126 (49%), Gaps = 11/126 (8%)

Query: 177 IANIALEIALQRQKVNGSATLTVTHKSNVLSQSDGLFREICRQVY-ESNQDKFGS--INY 233
            A  + E+AL+R+       L  T K+ +L   D  F++I   ++ E  ++KF +  I Y
Sbjct: 192 FAKASFELALKRK-----LPLFFTTKNTILKNYDNQFKQIFDGLFNEKYREKFQALGIKY 246

Query: 234 NEQIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGFD--FVVG 291
             +++D MV ++ +    F +I   N  GD+ SD  A   GSLG++ S  V  D      
Sbjct: 247 EHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSILVTPDGKTFES 305

Query: 292 EPCHGS 297
           E  HG+
Sbjct: 306 EAAHGT 311

>ZYRO0B12496g Chr2 complement(1007086..1008354) [1269 bp, 422 aa]
           {ON} highly similar to uniprot|P21954 Saccharomyces
           cerevisiae YDL066W IDP1 Mitochondrial NADP-specific
           isocitrate dehydrogenase catalyzes the oxidation of
           isocitrate to alpha-ketoglutarate not required for
           mitochondrial respiration and may function to divert
           alpha- ketoglutarate to biosynthetic processes
          Length = 422

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 53/205 (25%), Positives = 99/205 (48%), Gaps = 22/205 (10%)

Query: 100 VEGYSSPIVALRKKLGLYANVRPVKSVLSQ-EKPIDMVIVRENTEDLYIKTEKTYIDEKT 158
           V G+  PI+     +G +A+    K+  +   KP  + +V    +     T + Y  +  
Sbjct: 133 VPGWEKPII-----IGRHAHADQYKATDTLVAKPGKLELVHRPEDGSEPTTLEVY--DYK 185

Query: 159 GTRVAEAIKRISEVATRNIANIALEIALQRQKVNGSATLTVTHKSNVLSQSDGLFREICR 218
           G  VA A+    E + R   + + ++AL + K+N    L ++ K+ +L + DG F++I +
Sbjct: 186 GPGVALAMYNTDE-SIRGFGHASFKLALDK-KLN----LYLSTKNTILKKYDGRFKDIFQ 239

Query: 219 QVYESNQ----DKFGSINYNEQIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVG 274
           ++Y++      +K G I Y  +++D MV ++ +    F ++   N  GD+ SD  A   G
Sbjct: 240 ELYDTQYKAEFEKAG-IFYEHRLIDDMVAQMVKSKGGF-IMALKNYDGDVQSDIVAQGFG 297

Query: 275 SLGVVPSANVGFD--FVVGEPCHGS 297
           SLG++ S  +  D      E  HG+
Sbjct: 298 SLGLMTSVLITPDGKTFESEAAHGT 322

>Ecym_3265 Chr3 (504267..505541) [1275 bp, 424 aa] {ON} similar to
           Ashbya gossypii AER061C
          Length = 424

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 32/115 (27%), Positives = 66/115 (57%), Gaps = 9/115 (7%)

Query: 170 SEVATRNIANIALEIALQRQKVNGSATLTVTHKSNVLSQSDGLFREICRQVYESN-QDKF 228
           ++ + R  A+ + ++AL + K+N    L ++ K+ +L   DG F++I +++Y++  + +F
Sbjct: 198 TDESIRGFAHASFKLALTK-KLN----LFLSTKNTILKTYDGRFKDIFQELYDTQYKTEF 252

Query: 229 GS--INYNEQIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPS 281
            +  I Y  +++D MV ++ +    F ++   N  GD+ SD  A   GSLG++ S
Sbjct: 253 ENHGIYYEHRLIDDMVAQMIKSKGGF-IMALKNYDGDVQSDIVAQGFGSLGLMTS 306

>NDAI0G00850 Chr7 (179074..180333) [1260 bp, 419 aa] {ON} Anc_1.396
          Length = 419

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 35/130 (26%), Positives = 64/130 (49%), Gaps = 11/130 (8%)

Query: 173 ATRNIANIALEIALQRQKVNGSATLTVTHKSNVLSQSDGLFREICRQVYESN-QDKFGSI 231
           + +  A  +  +AL+R+       L +  K+ +L + DG F+ I   +Y++  ++KF  +
Sbjct: 191 SIKGFAKASFIMALKRK-----LPLFLATKNTILKKYDGRFKSIFDDMYQNEFKEKFEKL 245

Query: 232 --NYNEQIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGFD-- 287
              Y  +++D MV ++ +    F +I   N  GD+ SD  A   GSLG++ S  +  D  
Sbjct: 246 GLTYEHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSQLITPDGK 304

Query: 288 FVVGEPCHGS 297
               E  HG+
Sbjct: 305 TFQSEAAHGT 314

>NDAI0G05160 Chr7 complement(1250883..1252145) [1263 bp, 420 aa]
           {ON} Anc_1.396
          Length = 420

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 35/122 (28%), Positives = 59/122 (48%), Gaps = 11/122 (9%)

Query: 181 ALEIALQRQKVNGSATLTVTHKSNVLSQSDGLFREICRQVYESNQDKFG---SINYNEQI 237
           + ++AL+R+       L  T K+ +L + DG F++I   +YE    +      I Y  ++
Sbjct: 204 SFKLALERK-----MPLYSTTKNTILKRYDGKFKDIFENMYEEQFREQFEELGIWYEHRL 258

Query: 238 VDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGFD--FVVGEPCH 295
           +D MV ++ +    F +I   N  GD+ SD  A   GSLG++ S  +  D      E  H
Sbjct: 259 IDDMVAQMLKSKGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSVLISSDGKSFESEAAH 317

Query: 296 GS 297
           G+
Sbjct: 318 GT 319

>Suva_14.303 Chr14 (547367..547525) [159 bp, 53 aa] {ON} YNL037C
           (REAL)
          Length = 53

 Score = 33.1 bits (74), Expect = 0.090,   Method: Composition-based stats.
 Identities = 16/50 (32%), Positives = 29/50 (58%)

Query: 318 LMLEFMGHPEAAQDIHKAVDANLRDNTVKTPDLGGKSTTQQVVDDVLSRM 367
           LML  +G  E+A  I KAV   + +    T D+GG S+T    +++++++
Sbjct: 1   LMLNHLGLNESATRISKAVHETIAEGKHTTRDIGGSSSTTDFTNEIINKL 50

>KAFR0G00320 Chr7 complement(101116..103188) [2073 bp, 690 aa] {ON}
           Anc_1.162 YKL179C
          Length = 690

 Score = 32.3 bits (72), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 28/50 (56%)

Query: 86  QGALFGAVQSPTNKVEGYSSPIVALRKKLGLYANVRPVKSVLSQEKPIDM 135
           Q     ++++  N++E Y S + ALR KL  Y++   +KS LS  K I+ 
Sbjct: 309 QSEFDESMKNVKNELESYKSELQALRMKLNNYSDYERLKSELSALKKIEF 358

>Skud_6.15 Chr6 complement(24031..25701) [1671 bp, 556 aa] {ON}
           YHR178W (REAL)
          Length = 556

 Score = 31.2 bits (69), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 18/78 (23%), Positives = 35/78 (44%), Gaps = 4/78 (5%)

Query: 288 FVVGEPCHGSAPDIAGKGISNPVATIRSTALMLEFMGHPE----AAQDIHKAVDANLRDN 343
           F VG P      ++ G+  +N +    S+ +  +++G PE    A Q +  ++  +  D 
Sbjct: 78  FEVGMPFSNVDFELEGENATNQIKRFTSSLVFKKYIGSPEMMLAAIQSVRSSISCSFFDE 137

Query: 344 TVKTPDLGGKSTTQQVVD 361
           T+    L  K  ++Q  D
Sbjct: 138 TIDLSSLEQKIFSKQSSD 155

>Smik_11.51 Chr11 complement(95977..97992) [2016 bp, 671 aa] {ON}
           YKL179C (REAL)
          Length = 671

 Score = 30.4 bits (67), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 40/82 (48%), Gaps = 11/82 (13%)

Query: 77  TIDILKNECQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYANVRPVKSVLSQEKPIDMV 136
           +I  LK +  GA+  +        E Y S +  +R+KL  Y++   +K  LS  K I+  
Sbjct: 307 SISELKEQLNGAIAES--------ESYRSELETVRRKLSNYSDYSTIKEELSALKKIEFG 358

Query: 137 IVRENTEDLYIKTEKTYIDEKT 158
           +   N +D   +T+  Y D+KT
Sbjct: 359 V---NEDDSDNETDSKYNDDKT 377

>CAGL0G07711g Chr7 (732457..734019) [1563 bp, 520 aa] {ON} similar
           to uniprot|P36112 Saccharomyces cerevisiae YKR016w
          Length = 520

 Score = 30.4 bits (67), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 32/61 (52%), Gaps = 9/61 (14%)

Query: 156 EKTGTRVAEAIKRISEVATRN--IANIALEIALQRQKVNGSATLTVTHKSNVLSQSDGLF 213
           +K    + EA+K +++V TRN  +  IA +I + R K+N       +H  N +S  D L 
Sbjct: 306 DKKAENLTEALKHVNKVVTRNEAVKQIAQQIEIIRSKLN-------SHDLNSISLHDDLT 358

Query: 214 R 214
           R
Sbjct: 359 R 359

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.134    0.374 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 35,885,031
Number of extensions: 1511070
Number of successful extensions: 4779
Number of sequences better than 10.0: 145
Number of HSP's gapped: 4569
Number of HSP's successfully gapped: 145
Length of query: 367
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 256
Effective length of database: 40,753,473
Effective search space: 10432889088
Effective search space used: 10432889088
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 66 (30.0 bits)