Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_27.115182.288ON95395348430.0
KLTH0G10406g2.288ON96396034630.0
SAKL0E07634g2.288ON97488827310.0
NDAI0G006702.288ON96891526470.0
Suva_14.3242.288ON96888926120.0
YNL023C (FAP1)2.288ON96588926080.0
Skud_14.3062.288ON97092725960.0
Smik_14.3082.288ON96588925900.0
NCAS0G037802.288ON95788625500.0
TDEL0G021902.288ON93689225350.0
KAFR0H033002.288ON96690125070.0
KNAG0H019902.288ON97392525040.0
ZYRO0A01936g2.288ON95389224620.0
TBLA0B059502.288ON99591524310.0
CAGL0M06919g2.288ON95689824060.0
Kpol_1039.452.288ON96890623560.0
TPHA0D015302.288ON96292422780.0
KLLA0E08317g2.288ON92188622480.0
ADL213W2.288ON90889922390.0
Ecym_33272.288ON92691122250.0
CAGL0G07359g5.574ON611106800.74
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_27.11518
         (953 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_27.11518 s27 complement(832986..835847) [2862 bp, 953 aa] {...  1870   0.0  
KLTH0G10406g Chr7 (880042..882933) [2892 bp, 963 aa] {ON} simila...  1338   0.0  
SAKL0E07634g Chr5 complement(616444..619368) [2925 bp, 974 aa] {...  1056   0.0  
NDAI0G00670 Chr7 (146574..149480) [2907 bp, 968 aa] {ON} Anc_2.2...  1024   0.0  
Suva_14.324 Chr14 complement(571146..574052) [2907 bp, 968 aa] {...  1010   0.0  
YNL023C Chr14 complement(588263..591160) [2898 bp, 965 aa] {ON} ...  1009   0.0  
Skud_14.306 Chr14 complement(558943..561855) [2913 bp, 970 aa] {...  1004   0.0  
Smik_14.308 Chr14 complement(550650..553547) [2898 bp, 965 aa] {...  1002   0.0  
NCAS0G03780 Chr7 complement(696877..699750) [2874 bp, 957 aa] {O...   986   0.0  
TDEL0G02190 Chr7 (430157..432967) [2811 bp, 936 aa] {ON} Anc_2.2...   981   0.0  
KAFR0H03300 Chr8 complement(627520..630420) [2901 bp, 966 aa] {O...   970   0.0  
KNAG0H01990 Chr8 complement(349855..352776) [2922 bp, 973 aa] {O...   969   0.0  
ZYRO0A01936g Chr1 (159749..162610) [2862 bp, 953 aa] {ON} simila...   952   0.0  
TBLA0B05950 Chr2 (1404509..1407496) [2988 bp, 995 aa] {ON} Anc_2...   941   0.0  
CAGL0M06919g Chr13 complement(703702..706572) [2871 bp, 956 aa] ...   931   0.0  
Kpol_1039.45 s1039 (135833..138739) [2907 bp, 968 aa] {ON} (1358...   912   0.0  
TPHA0D01530 Chr4 complement(313063..315951) [2889 bp, 962 aa] {O...   882   0.0  
KLLA0E08317g Chr5 complement(747272..750037) [2766 bp, 921 aa] {...   870   0.0  
ADL213W Chr4 (329646..332372) [2727 bp, 908 aa] {ON} Syntenic ho...   867   0.0  
Ecym_3327 Chr3 (626396..629176) [2781 bp, 926 aa] {ON} similar t...   861   0.0  
CAGL0G07359g Chr7 complement(696455..698290) [1836 bp, 611 aa] {...    35   0.74 

>Kwal_27.11518 s27 complement(832986..835847) [2862 bp, 953 aa] {ON}
           YNL023C (FAP1) - Transcription factor homolog;
           similarity to Drosophila melanogaster shuttle craft
           protein; similarity to human NFX1 protein; similarity to
           human DNA-binding protein tenascin [contig 27] FULL
          Length = 953

 Score = 1870 bits (4843), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 918/953 (96%), Positives = 918/953 (96%)

Query: 1   MTSELDSTPDNDLSNGYVLVDAXXXXXXXXXXXXXXIDELEDQPYYEKTVKEIEKGDRYP 60
           MTSELDSTPDNDLSNGYVLVDA              IDELEDQPYYEKTVKEIEKGDRYP
Sbjct: 1   MTSELDSTPDNDLSNGYVLVDASSEESEDFEHVEDEIDELEDQPYYEKTVKEIEKGDRYP 60

Query: 61  CMICTVEMDFTCHMYACPDCYRVFDFECIREWALKSTQKSVSKTWKCPNCYFERKEVPMK 120
           CMICTVEMDFTCHMYACPDCYRVFDFECIREWALKSTQKSVSKTWKCPNCYFERKEVPMK
Sbjct: 61  CMICTVEMDFTCHMYACPDCYRVFDFECIREWALKSTQKSVSKTWKCPNCYFERKEVPMK 120

Query: 121 NRPTCWCGKSVQPEPNPLNPNSCGQTCDAQICEHGCSSICHLGPHPTCMRMVQVKCNCGK 180
           NRPTCWCGKSVQPEPNPLNPNSCGQTCDAQICEHGCSSICHLGPHPTCMRMVQVKCNCGK
Sbjct: 121 NRPTCWCGKSVQPEPNPLNPNSCGQTCDAQICEHGCSSICHLGPHPTCMRMVQVKCNCGK 180

Query: 181 KNKSVFCHEAGKFVDSFICDSPCGLTLPCGIHKCQRKCHSGICGECPESIYGTINCYCKL 240
           KNKSVFCHEAGKFVDSFICDSPCGLTLPCGIHKCQRKCHSGICGECPESIYGTINCYCKL
Sbjct: 181 KNKSVFCHEAGKFVDSFICDSPCGLTLPCGIHKCQRKCHSGICGECPESIYGTINCYCKL 240

Query: 241 ESKPSLKCTEVRIEGRSRDSSGNKWVGAFSCENIRTVEHSCKKHSFAEPCKAPPSISGQV 300
           ESKPSLKCTEVRIEGRSRDSSGNKWVGAFSCENIRTVEHSCKKHSFAEPCKAPPSISGQV
Sbjct: 241 ESKPSLKCTEVRIEGRSRDSSGNKWVGAFSCENIRTVEHSCKKHSFAEPCKAPPSISGQV 300

Query: 301 PCPFSPRTLKTCPCGRSPLREMDVSRSQCTDPIPTCDSVCGKMLRCGKHKCPFKCHTGSC 360
           PCPFSPRTLKTCPCGRSPLREMDVSRSQCTDPIPTCDSVCGKMLRCGKHKCPFKCHTGSC
Sbjct: 301 PCPFSPRTLKTCPCGRSPLREMDVSRSQCTDPIPTCDSVCGKMLRCGKHKCPFKCHTGSC 360

Query: 361 MEECLCTDKVKCSCHARQFIVPCKFQEKARCNTKCEALMSCRRHRCIERCCDGRSLAQSR 420
           MEECLCTDKVKCSCHARQFIVPCKFQEKARCNTKCEALMSCRRHRCIERCCDGRSLAQSR
Sbjct: 361 MEECLCTDKVKCSCHARQFIVPCKFQEKARCNTKCEALMSCRRHRCIERCCDGRSLAQSR 420

Query: 421 EKKVFLTRDKLDESLVEAQHICLKQCNLKLSCGKHFCKRKCHPGNCAPCLESDSNDLVCP 480
           EKKVFLTRDKLDESLVEAQHICLKQCNLKLSCGKHFCKRKCHPGNCAPCLESDSNDLVCP
Sbjct: 421 EKKVFLTRDKLDESLVEAQHICLKQCNLKLSCGKHFCKRKCHPGNCAPCLESDSNDLVCP 480

Query: 481 CGKTVVPAPVRCGTVLPRCLHPCIKTLQGXXXXXXXXXXXXXXXXXXXXXSCTAPVFKSC 540
           CGKTVVPAPVRCGTVLPRCLHPCIKTLQG                     SCTAPVFKSC
Sbjct: 481 CGKTVVPAPVRCGTVLPRCLHPCIKTLQGPAPCGHPPMPHPCHPLEEPCPSCTAPVFKSC 540

Query: 541 KCRKNDKVRTLCFQNDVSCGRVCGKQLAGCQHICQKACHKEGECQTSCKQPCGKTRENCE 600
           KCRKNDKVRTLCFQNDVSCGRVCGKQLAGCQHICQKACHKEGECQTSCKQPCGKTRENCE
Sbjct: 541 KCRKNDKVRTLCFQNDVSCGRVCGKQLAGCQHICQKACHKEGECQTSCKQPCGKTRENCE 600

Query: 601 HRCRALCHSGTPCPDKPCLNLVDIKCNCGHRSTTVTCGANENRAPAEETALECNNDCDVA 660
           HRCRALCHSGTPCPDKPCLNLVDIKCNCGHRSTTVTCGANENRAPAEETALECNNDCDVA
Sbjct: 601 HRCRALCHSGTPCPDKPCLNLVDIKCNCGHRSTTVTCGANENRAPAEETALECNNDCDVA 660

Query: 661 RRHHELMEAFGIKNDANQGSKSLEDLEALAEKVSTFQELLLPFSEATLSIFSKQTTWCTQ 720
           RRHHELMEAFGIKNDANQGSKSLEDLEALAEKVSTFQELLLPFSEATLSIFSKQTTWCTQ
Sbjct: 661 RRHHELMEAFGIKNDANQGSKSLEDLEALAEKVSTFQELLLPFSEATLSIFSKQTTWCTQ 720

Query: 721 IEECLERLMNDKNKPSLHFKPMRPPQRHFIHELGQAYHLYCESQDQEPKRSVFVKKTADS 780
           IEECLERLMNDKNKPSLHFKPMRPPQRHFIHELGQAYHLYCESQDQEPKRSVFVKKTADS
Sbjct: 721 IEECLERLMNDKNKPSLHFKPMRPPQRHFIHELGQAYHLYCESQDQEPKRSVFVKKTADS 780

Query: 781 QRPSISLKVALPLYYSFKSAQREKKLKETERHTTTRIINYAVTDQAQTPPAARFNGLLVQ 840
           QRPSISLKVALPLYYSFKSAQREKKLKETERHTTTRIINYAVTDQAQTPPAARFNGLLVQ
Sbjct: 781 QRPSISLKVALPLYYSFKSAQREKKLKETERHTTTRIINYAVTDQAQTPPAARFNGLLVQ 840

Query: 841 NVLNGINEKAIQESFSEYLKHTLLKDPHYLLLASGDVLVYCDDYSTASVNVENDIERIVG 900
           NVLNGINEKAIQESFSEYLKHTLLKDPHYLLLASGDVLVYCDDYSTASVNVENDIERIVG
Sbjct: 841 NVLNGINEKAIQESFSEYLKHTLLKDPHYLLLASGDVLVYCDDYSTASVNVENDIERIVG 900

Query: 901 HLDHIVKEQLLAEGVYATRVQSFLDDLESSTSDAATSISNSELTTLAQENSEQ 953
           HLDHIVKEQLLAEGVYATRVQSFLDDLESSTSDAATSISNSELTTLAQENSEQ
Sbjct: 901 HLDHIVKEQLLAEGVYATRVQSFLDDLESSTSDAATSISNSELTTLAQENSEQ 953

>KLTH0G10406g Chr7 (880042..882933) [2892 bp, 963 aa] {ON} similar
           to uniprot|P53971 Saccharomyces cerevisiae YNL023C
          Length = 963

 Score = 1338 bits (3463), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 638/960 (66%), Positives = 757/960 (78%), Gaps = 20/960 (2%)

Query: 1   MTSELDSTPDNDLSNGYVLVDAXXXXXXXXXXX------------------XXXIDELED 42
           MTS  D   + +   GYV+V A                                  +  D
Sbjct: 1   MTSGQDQIAEAEFDEGYVVVRADSETSEAFENVGEDLDEQDEQDEQDEQDELDEQGDTYD 60

Query: 43  QPYYEKTVKEIEKGDRYPCMICTVEMDFTCHMYACPDCYRVFDFECIREWALKSTQKSVS 102
           QPYYEKT+KEI KGDRYPCMICTVEMDFTCHMYACP+CYRVFD+ECIREWA+KSTQKSV+
Sbjct: 61  QPYYEKTIKEIAKGDRYPCMICTVEMDFTCHMYACPECYRVFDYECIREWAVKSTQKSVT 120

Query: 103 KTWKCPNCYFERKEVPMKNRPTCWCGKSVQPEPNPLNPNSCGQTCDAQICEHGCSSICHL 162
           KTWKCPNCYFE+K+VP+KNRPTCWCGK++ PEPNPLNPNSCGQTCDA IC HGCSS CHL
Sbjct: 121 KTWKCPNCYFEKKDVPLKNRPTCWCGKNIHPEPNPLNPNSCGQTCDAPICVHGCSSTCHL 180

Query: 163 GPHPTCMRMVQVKCNCGKKNKSVFCHEAGKFVDSFICDSPCGLTLPCGIHKCQRKCHSGI 222
           GPHPTCMRMVQ KC CGKK+K VFC EA K  + F C +PCGLTLPCG+HKCQR+CH+G+
Sbjct: 181 GPHPTCMRMVQTKCRCGKKSKDVFCSEARKHQELFRCGNPCGLTLPCGVHKCQRECHNGV 240

Query: 223 CGECPESIYGTINCYCKLESKPSLKCTEVRIEGRSRDSSGNKWVGAFSCENIRTVEHSCK 282
           CGECPE+I   INCYC LES PS+KC +V+I+ +S+D SG KW+GAF+C  IRTVE+SC+
Sbjct: 241 CGECPETIAKEINCYCGLESLPSIKCQDVKIQSKSQDGSGKKWIGAFACSRIRTVEYSCR 300

Query: 283 KHSFAEPCKAPPSISGQVPCPFSPRTLKTCPCGRSPLREMDVSRSQCTDPIPTCDSVCGK 342
           +HSFAEPCKAPPSI+G++PCP+SP+ LKTCPCG +PL  M+  R++CTDPIPTCD+ CGK
Sbjct: 301 EHSFAEPCKAPPSIAGRIPCPYSPKALKTCPCGETPLENMETPRTKCTDPIPTCDATCGK 360

Query: 343 MLRCGKHKCPFKCHTGSCMEECLCTDKVKCSCHARQFIVPCKFQEKARCNTKCEALMSCR 402
           +L CG+H+CPFKCHTG+CME C C+DK+KCSC++R FIVPCKFQ   RCNTKCE+LMSCR
Sbjct: 361 LLSCGRHRCPFKCHTGTCMEICTCSDKIKCSCNSRPFIVPCKFQGPPRCNTKCESLMSCR 420

Query: 403 RHRCIERCCDGRSLAQSREKKVFLTRDKLDESLVEAQHICLKQCNLKLSCGKHFCKRKCH 462
           RHRC ERCCDGRSLAQ REKKVFLTRDKLDESLVEAQHICLK+CNLKLSCG+HFC+RKCH
Sbjct: 421 RHRCAERCCDGRSLAQVREKKVFLTRDKLDESLVEAQHICLKKCNLKLSCGRHFCQRKCH 480

Query: 463 PGNCAPCLESDSNDLVCPCGKTVVPAPVRCGTVLPRCLHPCIKTLQGXXXXXXXXXXXXX 522
           PGNC PCLESDSNDLVCPCGKTV PAPVRCGTVLP C +PCIKTLQG             
Sbjct: 481 PGNCPPCLESDSNDLVCPCGKTVAPAPVRCGTVLPPCRNPCIKTLQGPLDCGHPPMPHAC 540

Query: 523 XXXXXXXXSCTAPVFKSCKCRKNDKVRTLCFQNDVSCGRVCGKQLAGCQHICQKACHKEG 582
                   SCTAPVFK CKC KN KVRTLCFQN+VSCGRVCGKQL  C H C K CH+EG
Sbjct: 541 HSLDEPCPSCTAPVFKQCKCGKNKKVRTLCFQNNVSCGRVCGKQLVSCHHSCTKTCHREG 600

Query: 583 ECQTSCKQPCGKTRENCEHRCRALCHSGTPCPDKPCLNLVDIKCNCGHRSTTVTCGANEN 642
           ECQ+ CKQ CG +R NC H CR  CH+G+PCPD PC   V++KC CGHRS+  TC A+E 
Sbjct: 601 ECQSICKQVCGISRSNCSHICRFKCHTGSPCPDVPCNVTVEVKCGCGHRSSFATCAAHEG 660

Query: 643 RAPAEETALECNNDCDVARRHHELMEAFGIKNDANQGSKSLEDLEALAEKVSTFQELLLP 702
           + PA++  LEC  DC  ARR  ELMEAFG+  +  Q ++ + DL ALAEKV+TFQEL+LP
Sbjct: 661 QDPADQRPLECTEDCAAARRRLELMEAFGMNTETVQPTEGIVDLAALAEKVTTFQELMLP 720

Query: 703 FSEATLSIFSKQTTWCTQIEECLERLMNDKNKPSLHFKPMRPPQRHFIHELGQAYHLYCE 762
           F+EA+LSIF+KQ+ WC+QIEE L RLM+D +KPSLHFKPM+PPQRHFIHEL QAY LYCE
Sbjct: 721 FTEASLSIFAKQSNWCSQIEEHLNRLMSDISKPSLHFKPMKPPQRHFIHELAQAYKLYCE 780

Query: 763 SQDQEPKRSVFVKKTADSQRPSISLKVALPLYYSFKSAQREKKLKETERHTTTRIINYAV 822
           SQD+EPKRSV+VKKT DS++PS+SLK ALPLY SFK+AQ+E+KLKE ER TTTRI+NY  
Sbjct: 781 SQDKEPKRSVYVKKTVDSRKPSLSLKEALPLYQSFKNAQKERKLKELERSTTTRILNYTS 840

Query: 823 TDQAQTPPAARFNGLLVQNVLNGINEKAIQESFSEYLKHTLLKDPHYLLLASGDVLVYCD 882
           T ++ +PP A+ NGLL+Q V  G +EK I+  F++YLKHTL+KDP+YL L SGDV+V+ +
Sbjct: 841 TGES-SPPVAQINGLLIQKVFEGTDEKTIEACFADYLKHTLIKDPNYLKLDSGDVMVFAE 899

Query: 883 DYSTASVNVENDIERIVGHLDHIVKEQLLAEGVYATRVQSFLDDLESSTSDAATSISNSE 942
           +Y+TAS+NVE DI R+VGHLD I K+  LAEGV   RV+  + + E++ SD ++     E
Sbjct: 900 NYATASINVERDINRVVGHLDLIAKDSFLAEGVTVCRVEQVMAE-ETNRSDESSVAEAPE 958

>SAKL0E07634g Chr5 complement(616444..619368) [2925 bp, 974 aa] {ON}
           similar to uniprot|P53971 Saccharomyces cerevisiae
           YNL023C
          Length = 974

 Score = 1056 bits (2731), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 504/888 (56%), Positives = 638/888 (71%), Gaps = 5/888 (0%)

Query: 44  PYYEKTVKEIEKGDRYPCMICTVEMDFTCHMYACPDCYRVFDFECIREWALKSTQKSVSK 103
           PYYEKT+ EI+KGD Y CMICT+EMD+TCHMYACP+CYRV+D ECIREWALKS+QKS+ K
Sbjct: 49  PYYEKTIHEIQKGDSYACMICTMEMDYTCHMYACPECYRVYDHECIREWALKSSQKSLDK 108

Query: 104 TWKCPNCYFERKEVPMKNRPTCWCGKSVQPEPNPLNPNSCGQTCDAQICEHGCSSICHLG 163
           TWKCPNCY+   E+P+KNR TCWCGK V PE NP++PNSCGQTC+A IC HGCS  CHLG
Sbjct: 109 TWKCPNCYYVNSEIPVKNRHTCWCGKVVHPESNPIDPNSCGQTCNAPICSHGCSKPCHLG 168

Query: 164 PHPTCMRMVQVKCNCGKKNKSVFCHEAGKFVDSFICDSPCGLTLPCGIHKCQRKCHSGIC 223
           PHP CMR  +VKC CGK  K +FC+++ +   S+ C  PC L LPCG+HKCQRKCHSG C
Sbjct: 169 PHPECMRTTKVKCLCGKHTKDMFCYQSEEEKASYQCGEPCNLLLPCGVHKCQRKCHSGPC 228

Query: 224 GECPESIYGTINCYCKLESKPSLKCTEVRIEGRSRDSSGNKWVGAFSCENIRTVEHSCKK 283
           G C E+I G I CYC +E++  + C +V+   +S++ SG  W+G FSC ++R+VE+SC  
Sbjct: 229 GNCEETISGKIMCYCGMETREQIICKDVKSVAKSKNKSGEIWIGVFSCAHLRSVEYSCGH 288

Query: 284 HSFAEPCKAPPSISGQVPCPFSPRTLKTCPCGRSPLREMDVSRSQCTDPIPTCDSVCGKM 343
           HSF E C APP+ SG++ CPFSPR LKTCPCG +PL+ ++  R +CTDPIPTC++ C K 
Sbjct: 289 HSFQESCTAPPTNSGELACPFSPRLLKTCPCGSTPLKLLEAPRKKCTDPIPTCENRCNKP 348

Query: 344 LRCGKHKCPFKCHTGSCMEECLCTDKVKCSCHARQFIVPCKFQEKARCNTKCEALMSCRR 403
           L+CGKH CPF CH G CM+ C+  DKV CSCH++ F+VPC+F ++A CNTKCE+LMSCRR
Sbjct: 349 LKCGKHSCPFVCHDGPCMDPCVSVDKVSCSCHSKSFLVPCQFHDEAHCNTKCESLMSCRR 408

Query: 404 HRCIERCCDGRSLAQSREKKVFLTRDKLDESLVEAQHICLKQCNLKLSCGKHFCKRKCHP 463
           HRC ERCC GRSLA  REK +FL RD+LDESLVEAQHICLK CNLKLSCG H+C+RKCHP
Sbjct: 409 HRCTERCCSGRSLAIKREKTIFLARDRLDESLVEAQHICLKPCNLKLSCGIHYCRRKCHP 468

Query: 464 GNCAPCLESDSNDLVCPCGKTVVPAPVRCGTVLPRCLHPCIKTLQGXXXXXXXXXXXXXX 523
           G C+PCLESDSNDL CPCGKTVVPAPVRCGT LP C HPCIKTLQ               
Sbjct: 469 GKCSPCLESDSNDLSCPCGKTVVPAPVRCGTKLPPCRHPCIKTLQADTVCGHPPMPHECH 528

Query: 524 XXXXXXXSCTAPVFKSCKCRKNDKVRTLCFQNDVSCGRVCGKQLAGCQHICQKACHKEGE 583
                   CTAP++K CKC K +KVRTLCFQNDVSCG++CG  L  C H C++ CH+ G+
Sbjct: 529 SLEQPCPQCTAPIYKKCKCNKVEKVRTLCFQNDVSCGKICGLPLKNCSHTCKRTCHEPGQ 588

Query: 584 CQTSCKQPCGKTRENCEHRCRALCHSGTPCPDKPCLNLVDIKCNCGHRSTTVTCGANENR 643
           CQT CKQ CG  R+ CEH+C A CH G  CPD+ C   V + C+CG + + + C A+ ++
Sbjct: 589 CQTICKQICGLPRKFCEHKCFARCHPGKDCPDEACQVKVKVTCSCGRKESILPCDAHADQ 648

Query: 644 APAE-ETALECNNDCDVARRHHELMEAFGIKNDANQGSKSLEDLEALAEKVSTFQELLLP 702
             ++    L C++ C+ ++RH  LMEAFGIK    + +  +E+L  L E   +F EL LP
Sbjct: 649 PSSKLLITLPCDDKCEESKRHRMLMEAFGIK---EKLTAPVEELRDLVESAKSFDELHLP 705

Query: 703 FSEATLSIFSKQTTWCTQIEECLERLMNDKNKPSLHFKPMRPPQRHFIHELGQAYHLYCE 762
           F+E+TLS++SKQ  WC QIE  L +LM D  + SLHFKPM+ PQR FIHEL  AY LY E
Sbjct: 706 FTESTLSVYSKQRAWCNQIESFLSKLMRDVTRTSLHFKPMKLPQRRFIHELANAYALYSE 765

Query: 763 SQDQEPKRSVFVKKTAD-SQRPSISLKVALPLYYSFKSAQREKKLKETERHTTTRIINYA 821
           SQD+EPKRSVFVKK  + S  P + L  ALPLY+SFK  Q+E+K+KE E+ TT R+ NY 
Sbjct: 766 SQDREPKRSVFVKKVENKSHIPLLCLGEALPLYHSFKQLQKERKVKELEKSTTRRLFNYT 825

Query: 822 VTDQAQTPPAARFNGLLVQNVLNGINEKAIQESFSEYLKHTLLKDPHYLLLASGDVLVYC 881
           V D    P  A FN  LV+ V  G+ +  + +  +EYL+ TL+++P Y  L +GD L+Y 
Sbjct: 826 VDDANDVPHNAEFNCFLVKGVAPGVTKDELSDCLAEYLQFTLIQNPSYQTLENGDFLIYP 885

Query: 882 DDYSTASVNVENDIERIVGHLDHIVKEQLLAEGVYATRVQSFLDDLES 929
           +D+ + S NVENDI+R+  ++  I KE+ ++EGV   ++   L    S
Sbjct: 886 EDHMSISENVENDIKRLAPYISSICKEKQISEGVKLYKIDENLKTFTS 933

>NDAI0G00670 Chr7 (146574..149480) [2907 bp, 968 aa] {ON} Anc_2.288
           YNL023C
          Length = 968

 Score = 1024 bits (2647), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 499/915 (54%), Positives = 634/915 (69%), Gaps = 18/915 (1%)

Query: 41  EDQPYYEKTVKEIEKGDRYPCMICTVEMDFTCHMYACPDCYRVFDFECIREWALKSTQKS 100
           ED  YYE+T++EI KGD Y CMICTVEMD+TC MYAC +CYRVFD++CIREWA+KST+K+
Sbjct: 56  EDMKYYERTIQEIAKGDSYVCMICTVEMDYTCQMYACKECYRVFDYDCIREWAVKSTEKT 115

Query: 101 VSKTWKCPNCYFERKEVPMKNRPTCWCGKSVQPEPNPLNPNSCGQTCDAQICEHGCSSIC 160
           V + WKCPNCY   K+VP KNR TCWCGK V PE NPLNPNSCGQTC+A+IC HGC++IC
Sbjct: 116 VDRIWKCPNCYHVNKKVPPKNRSTCWCGKVVNPEANPLNPNSCGQTCNAKICVHGCTNIC 175

Query: 161 HLGPHPTCMRMVQVKCNCGKKNKSVFCHEAGKFVDS--FICDSPCGLTLPCGIHKCQRKC 218
           HLGPHP C RM+ + C CGK  K +FC+++  F  +  F C   CGL L CGIHKC+RKC
Sbjct: 176 HLGPHPECTRMLSITCRCGKHTKDIFCYQSKTFKGNSKFQCKDECGLPLSCGIHKCKRKC 235

Query: 219 HSGICGECPESI------YGTINCYCKLESKPSLKCTEVRI---EGRSRDSSGNKWVGAF 269
           HSG+CG CPE +         + CYC  E++ S+KC +++I      S D+ GNKW+G F
Sbjct: 236 HSGLCGVCPERLEVNEENAWILKCYCGSETQKSMKCKDIKIPESAKYSSDAEGNKWIGVF 295

Query: 270 SCENIRTVEHSCKKHSFAEPCKAPPSISGQVPCPFSPRTLKTCPCGRSPLREMDVSRSQC 329
           +C+ IRTV++ C KHSF E C APP++S + PCP+SP+ LKTCPCG++PL+++   R+ C
Sbjct: 296 ACKEIRTVQYDCDKHSFIERCIAPPTLSMEKPCPYSPKLLKTCPCGKTPLQKLAKPRTLC 355

Query: 330 TDPIPTCDSVCGKMLRCGKHKCPFKCHTGSCMEECLCTDKVKCSCHARQFIVPCKFQEKA 389
           TDPIPTC+S C K L+CGKHKCPFKCHTG+CM+ CL  +  KCSC  + F+VPC+F    
Sbjct: 356 TDPIPTCESHCNKPLKCGKHKCPFKCHTGACMDPCLQIETRKCSCEQQSFLVPCQFTGSP 415

Query: 390 RCNTKCEALMSCRRHRCIERCCDGRSLAQSREKKVFLTRDKLDESLVEAQHICLKQCNLK 449
            CN KCE+LMSCRRHRC+ERCC GR  A+ R+K +F ++D +DE+LVEA+HICLK+CNL 
Sbjct: 416 HCNIKCESLMSCRRHRCLERCCSGRPAAEKRKKTLFRSQDLMDETLVEAEHICLKECNLL 475

Query: 450 LSCGKHFCKRKCHPGNCAPCLESDSNDLVCPCGKTVVPAPVRCGTVLPRCLHPCIKTLQG 509
           LSCG H C+RKCHPG C PCLESDSNDLVCPCGKT+V APVRCGT LP C   CIK ++ 
Sbjct: 476 LSCGIHRCQRKCHPGKCPPCLESDSNDLVCPCGKTIVEAPVRCGTKLPPCPFQCIKVVRN 535

Query: 510 XXXXXXXXXXXXXXXXXXXXXSCTAPVFKSCKCRKNDKVRTLCFQNDVSCGRVCGKQLAG 569
                                 CTAPVFK CKC K  +VRTLCFQNDVSCG++CG  L  
Sbjct: 536 EYPCGHTPMPHTCHPLDEPCPPCTAPVFKPCKCGKVKEVRTLCFQNDVSCGKICGLPLKD 595

Query: 570 CQHICQKACHKEGECQTSCKQPCGKTRENCEHRCRALCHSGTPCPDKPCLNLVDIKCNCG 629
           C H C K CH  G+CQT CKQ CGK R NC+H C   CH  T CPD PC     + C CG
Sbjct: 596 CPHKCMKRCHIPGDCQTKCKQICGKRRINCDHTCSRPCHGNTECPDVPCTVSAKVTCECG 655

Query: 630 HRSTTVTCGANENRAPA-EETALECNNDCDVARRHHELMEAFGIKNDANQGSK-SLEDLE 687
            R T VTCGA  N A A   T LEC+ +C++  RH +L EAFGIK   +  +    E L+
Sbjct: 656 RRETYVTCGAMSNIASAVTTTILECDEECEMLERHRQLKEAFGIKEIISSSTDLEFERLK 715

Query: 688 ALAEKVSTFQELLLPFSEATLSIFSKQTTWCTQIEECLERLMNDKNKPSLHFKPMRPPQR 747
            +      F+EL LPF+EATLSIFS+Q  WC QIEE + + M+DK++PSLHFKPMRPPQR
Sbjct: 716 DIVPTAIAFEELQLPFTEATLSIFSRQERWCQQIEEIINKFMDDKSRPSLHFKPMRPPQR 775

Query: 748 HFIHELGQAYHLYCESQDQEPKRSVFVKKTADSQRPSISLKVALPLYYSFKSAQREKKLK 807
           HFIHEL +AY+LYCESQD EPKRSVF+KK   S +PS SL   LPLY +FK  ++E+KL+
Sbjct: 776 HFIHELSKAYNLYCESQDPEPKRSVFIKKNTTSSKPSFSLSKVLPLYQTFKELEKERKLQ 835

Query: 808 ETERHTTTRIINYAVTDQAQTPPAARFNGLLVQNVLNGINEKAIQESFSEYLKHTLLKDP 867
           E E  T+ R++N  V +       A  NG L++++  G   + ++  F +YLK TL+K+P
Sbjct: 836 EFEARTSKRLVNVEVPEGPTDNYIAEANGFLIKDLSPGTTVEDLERIFGQYLKSTLIKNP 895

Query: 868 HYLLLASGDV-LVYCDDYSTASVNVENDIERIVGHLDHIVKEQLLAEGVYATRVQSFLDD 926
            YL+L  G   ++Y +DY T + NVE D + +VGH D + K+  ++EGV   ++    DD
Sbjct: 896 QYLVLQDGKSGVIYPEDYPTITANVERDFKSLVGHFDVLAKDTFISEGVELCKI----DD 951

Query: 927 LESSTSDAATSISNS 941
           + S+   A  +I  S
Sbjct: 952 VLSTERLATPAIDES 966

>Suva_14.324 Chr14 complement(571146..574052) [2907 bp, 968 aa] {ON}
           YNL023C (REAL)
          Length = 968

 Score = 1010 bits (2612), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 494/889 (55%), Positives = 613/889 (68%), Gaps = 14/889 (1%)

Query: 41  EDQPYYEKTVKEIEKGDRYPCMICTVEMDFTCHMYACPDCYRVFDFECIREWALKSTQKS 100
           +D  YYE+ ++EI KGD Y CMICTVEMD+TC M+AC  CYRVFD+ CIREWALKST+K+
Sbjct: 52  DDMQYYERAIQEIAKGDSYICMICTVEMDYTCQMFACKKCYRVFDYACIREWALKSTEKT 111

Query: 101 VSKTWKCPNCYFERKEVPMKNRPTCWCGKSVQPEPNPLNPNSCGQTCDAQICEHGCSSIC 160
           V K WKCPNCY   K+VP +NRPTCWCGK V P+ NPL+PNSCGQTC+A  C HGCS IC
Sbjct: 112 VDKIWKCPNCYHIGKKVPTRNRPTCWCGKVVNPDHNPLDPNSCGQTCNAPTCVHGCSKIC 171

Query: 161 HLGPHPTCMRMVQVKCNCGKKNKSVFCHEAGKFVDSFICDSPCGLTLPCGIHKCQRKCHS 220
           HLGPHP C R V++KC CGK +KS+FC+++      F C   CGL L CGIHKC++KCHS
Sbjct: 172 HLGPHPECTRTVEIKCRCGKHSKSIFCYQSKAMKKHFDCQEECGLPLSCGIHKCKKKCHS 231

Query: 221 GICGECPESIYGT------INCYCKLESKPSLKCTEVRI--EGRS-RDSSGNKWVGAFSC 271
           G+CG CPE I         I CYC + SK S+KC EV     GRS +D SGN+W+G F+C
Sbjct: 232 GLCGPCPELIMSEDKAMDWIKCYCGIHSKDSIKCCEVNFPKSGRSSKDESGNEWIGVFAC 291

Query: 272 ENIRTVEHSCKKHSFAEPCKAPPSISGQVPCPFSPRTLKTCPCGRSPLREMDVSRSQCTD 331
           ++IRTV+++C KHSF EPC +PP+++G+  CPF P  LKTCPCGR+ L E+   R  CTD
Sbjct: 292 KDIRTVDYACHKHSFIEPCISPPTVNGKKTCPFLPSLLKTCPCGRTALEELTKPRKHCTD 351

Query: 332 PIPTCDSVCGKMLRCGKHKCPFKCHTGSCMEECLCTDKVKCSCHARQFIVPCKFQEKARC 391
           PIPTC S C K L+CGKH CPF CH G+CM+ CL TD VKC+C    F+VPC FQEK  C
Sbjct: 352 PIPTCSSRCSKPLKCGKHSCPFICHDGACMDPCLQTDSVKCACEQSTFLVPCGFQEKPHC 411

Query: 392 NTKCEALMSCRRHRCIERCCDGRSLAQSREKKVFLTRDKLDESLVEAQHICLKQCNLKLS 451
           N KCE+LMSCRRHRCI+RCC GR  A  R+K++F ++D +DESLVEAQHICLK CNL LS
Sbjct: 412 NIKCESLMSCRRHRCIDRCCSGRPSALERKKRIFRSQDLMDESLVEAQHICLKPCNLTLS 471

Query: 452 CGKHFCKRKCHPGNCAPCLESDSNDLVCPCGKTVVPAPVRCGTVLPRCLHPCIKTLQGXX 511
           CG H C+RKCHPG C PCLESDSNDLVCPCGKTV+PAPVRCGT LP C + CIK ++G  
Sbjct: 472 CGIHKCQRKCHPGKCPPCLESDSNDLVCPCGKTVIPAPVRCGTKLPLCNYACIKVVRGES 531

Query: 512 XXXXXXXXXXXXXXXXXXXSCTAPVFKSCKCRKNDKVRTLCFQNDVSCGRVCGKQLAGCQ 571
                               CT  VFK CKC K DKVRT+CFQ DVSCG  CGK L+GC 
Sbjct: 532 ECGHKPMPHTCHPLDLACPPCTETVFKPCKCGKKDKVRTVCFQTDVSCGTTCGKPLSGCH 591

Query: 572 HICQKACHKEGECQTSCKQPCGKTRENCEHRCRALCHSGTPCPDKPCLNLVDIKCNCGHR 631
           H CQK CH    CQ  CKQ C + R NC+H C   CH  + CPD PC +LV I C CG  
Sbjct: 592 HTCQKTCHLPENCQKVCKQICRQKRPNCDHACPKPCHGRSECPDLPCASLVKITCKCGRI 651

Query: 632 STTVTCGANENRAPAEET-ALECNNDCDVARRHHELMEAFGIKNDANQGSKS-LEDLEAL 689
              V CGA  N     E   L+CN +C+  +R  EL EAFGI  ++N+ + + L+ L+ L
Sbjct: 652 EKKVACGAKSNVVSVTEAPQLDCNEECEALKRLKELREAFGISEESNESTNNELDTLKKL 711

Query: 690 AEKVSTFQELLLPFSEATLSIFSKQTTWCTQIEECLERLMNDKNKPSLHFKPMRPPQRHF 749
               +TF+EL LPF+E  LS+++KQ  WC QIE  + +LM+DK + SLHFKPMRPPQRHF
Sbjct: 712 VSVATTFEELQLPFTETVLSVYAKQEGWCLQIENIVNKLMSDKTRSSLHFKPMRPPQRHF 771

Query: 750 IHELGQAYHLYCESQDQEPKRSVFVKK--TADSQRPSISLKVALPLYYSFKSAQREKKLK 807
           I EL +AY+LY ESQD+EP RSVF+KK   + S RP +SL  A PLY SFK  Q+E+K++
Sbjct: 772 IRELAKAYNLYSESQDREPMRSVFIKKEDNSKSSRPILSLAEAFPLYESFKELQKERKIQ 831

Query: 808 ETERHTTTRIINYAVTDQAQTPPAARFNGLLVQNVLNGINEKAIQESFSEYLKHTLLKDP 867
           E +  TT ++IN+ V D       A+ NG LVQ ++NG +   ++  F  +LKHTL+  P
Sbjct: 832 EFQARTTAKLINFEVRDAEPKVELAKNNGFLVQKLVNGNDVDDLRRFFEPHLKHTLVVKP 891

Query: 868 HYLLLASGD-VLVYCDDYSTASVNVENDIERIVGHLDHIVKEQLLAEGV 915
            YL++  G   LVY ++Y   SVN E D++ +VGH D + KE  LA+ +
Sbjct: 892 QYLIIDDGKTALVYPENYQEVSVNTERDMDILVGHFDFMAKEAFLADSI 940

>YNL023C Chr14 complement(588263..591160) [2898 bp, 965 aa] {ON}
           FAP1Protein that binds to Fpr1p, conferring rapamycin
           resistance by competing with rapamycin for Fpr1p
           binding; accumulates in the nucleus upon treatment of
           cells with rapamycin; has similarity to D. melanogaster
           shuttle craft and human NFX1
          Length = 965

 Score = 1009 bits (2608), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 494/889 (55%), Positives = 609/889 (68%), Gaps = 14/889 (1%)

Query: 41  EDQPYYEKTVKEIEKGDRYPCMICTVEMDFTCHMYACPDCYRVFDFECIREWALKSTQKS 100
           +D  YYE+ ++EI  GD Y CMICTVEMD+TC M+AC  CYRVFD+ CIREWALKST+K+
Sbjct: 48  DDMQYYERAIQEISSGDSYVCMICTVEMDYTCQMFACKRCYRVFDYGCIREWALKSTEKT 107

Query: 101 VSKTWKCPNCYFERKEVPMKNRPTCWCGKSVQPEPNPLNPNSCGQTCDAQICEHGCSSIC 160
           V + WKCPNCY+  K VP+KNRPTCWCGK V P+PNPL+PNSCGQTC+A  C HGCS IC
Sbjct: 108 VDRIWKCPNCYYVSKRVPVKNRPTCWCGKVVNPDPNPLDPNSCGQTCNASTCMHGCSKIC 167

Query: 161 HLGPHPTCMRMVQVKCNCGKKNKSVFCHEAGKFVDSFICDSPCGLTLPCGIHKCQRKCHS 220
           HLGPHP C RMV++ C+CGK +KS+FC+++     +F C   CGL L C IH C++KCH 
Sbjct: 168 HLGPHPECTRMVEIMCHCGKHSKSIFCYQSKVMKKNFNCQEVCGLPLSCSIHTCKKKCHP 227

Query: 221 GICGECPESIYGT------INCYCKLESKPSLKCTEVRI--EGRS-RDSSGNKWVGAFSC 271
           G+CG CPE I         I CYC   ++ ++KC+E +    G+S +D +GN+W+G F+C
Sbjct: 228 GLCGPCPEMIISKDSPKKQIKCYCGNHTRANIKCSETKFPKSGKSSKDENGNRWIGVFAC 287

Query: 272 ENIRTVEHSCKKHSFAEPCKAPPSISGQVPCPFSPRTLKTCPCGRSPLREMDVSRSQCTD 331
            + R V++SC+KHSF E C +PP+I+G+  CPF P +LKTCPCGR+ L E+   R  C D
Sbjct: 288 ADNRVVDYSCRKHSFIESCISPPTINGEKACPFLPSSLKTCPCGRTALEELTKPRKHCDD 347

Query: 332 PIPTCDSVCGKMLRCGKHKCPFKCHTGSCMEECLCTDKVKCSCHARQFIVPCKFQEKARC 391
           PIPTCDS CGK L+CGKH CPF CH  +CME CL  D VKC+C    F VPC FQ + RC
Sbjct: 348 PIPTCDSRCGKPLKCGKHSCPFTCHDKACMEPCLQIDSVKCACEQSTFSVPCGFQGRPRC 407

Query: 392 NTKCEALMSCRRHRCIERCCDGRSLAQSREKKVFLTRDKLDESLVEAQHICLKQCNLKLS 451
           N KCE+LMSCRRHRC +RCC GR  A  R+K +F T+D LDESLVEA+HICLK CNL LS
Sbjct: 408 NIKCESLMSCRRHRCTDRCCSGRPSAIRRKKNLFRTQDLLDESLVEAKHICLKPCNLTLS 467

Query: 452 CGKHFCKRKCHPGNCAPCLESDSNDLVCPCGKTVVPAPVRCGTVLPRCLHPCIKTLQGXX 511
           CG H C+RKCHPG C PCLESDSNDLVCPCG TVVPAPVRCGT LP C HPCIK ++G  
Sbjct: 468 CGIHKCQRKCHPGKCPPCLESDSNDLVCPCGNTVVPAPVRCGTKLPTCNHPCIKVVRGES 527

Query: 512 XXXXXXXXXXXXXXXXXXXSCTAPVFKSCKCRKNDKVRTLCFQNDVSCGRVCGKQLAGCQ 571
                               CT  VFK CKC K  KVRT+CFQ DVSCG  CG  L+ C 
Sbjct: 528 TCGHKPMPHTCHSLDVSCPPCTETVFKPCKCGKKTKVRTVCFQTDVSCGIKCGIPLSYCY 587

Query: 572 HICQKACHKEGECQTSCKQPCGKTRENCEHRCRALCHSGTPCPDKPCLNLVDIKCNCGHR 631
           H CQK CH  G CQ  CKQ CG+ R NC H C   CH  T CPD PC  LV I C CG  
Sbjct: 588 HTCQKTCHLPGNCQKVCKQTCGQKRLNCNHECPKPCHGKTECPDLPCATLVKIYCKCGRI 647

Query: 632 STTVTCGANENRAPAEETA-LECNNDCDVARRHHELMEAFGIKNDANQ-GSKSLEDLEAL 689
             +VTCGA  +R    E++ L+CN +C+  +R  EL EAFGIK + N   S  L+ L+ L
Sbjct: 648 KKSVTCGAKSDRVSVTESSVLDCNEECEALKRLKELKEAFGIKEETNNFTSNELDALKKL 707

Query: 690 AEKVSTFQELLLPFSEATLSIFSKQTTWCTQIEECLERLMNDKNKPSLHFKPMRPPQRHF 749
               +TF+EL LPF+EA LS++SKQ  WC+QIE  L +LM+DK + SLHFKPMRPPQRHF
Sbjct: 708 VSVATTFEELQLPFTEAALSVYSKQERWCSQIEAILNKLMDDKTRSSLHFKPMRPPQRHF 767

Query: 750 IHELGQAYHLYCESQDQEPKRSVFVKK--TADSQRPSISLKVALPLYYSFKSAQREKKLK 807
           I EL +AY LY ESQD+EP RSVF+KK     S +P +SL  A PLY SFK  Q+E+K +
Sbjct: 768 IRELAKAYGLYSESQDREPMRSVFIKKEDNGASNKPVLSLAEAYPLYESFKQLQKERKAQ 827

Query: 808 ETERHTTTRIINYAVTDQAQTPPAARFNGLLVQNVLNGINEKAIQESFSEYLKHTLLKDP 867
           E +  TT ++IN+ V D       A+ NG LVQN++ G   + ++  F  +LKHTL+ +P
Sbjct: 828 EFQARTTAKLINFEVQDTEPKVEVAKKNGFLVQNLVAGNTAEDLRRFFEPHLKHTLVVNP 887

Query: 868 HYLLLASGD-VLVYCDDYSTASVNVENDIERIVGHLDHIVKEQLLAEGV 915
            YL+L  G   LVY ++Y TASVN E D+E +VGH D + KE  LA+ +
Sbjct: 888 QYLILDDGKTALVYPENYETASVNTERDMELLVGHFDFMAKEAFLADSI 936

>Skud_14.306 Chr14 complement(558943..561855) [2913 bp, 970 aa] {ON}
           YNL023C (REAL)
          Length = 970

 Score = 1004 bits (2596), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 502/927 (54%), Positives = 629/927 (67%), Gaps = 22/927 (2%)

Query: 11  NDLSNGYVL-VDAXXXXXXXXXXXXXXIDELEDQPYYEKTVKEIEKGDRYPCMICTVEMD 69
           + LSNG+VL V+                D+L+   YYE+ ++EI KGD Y CMICTVEMD
Sbjct: 25  HSLSNGHVLSVEDSSEQLSSYEFEEESDDDLQ---YYERAIQEIAKGDSYICMICTVEMD 81

Query: 70  FTCHMYACPDCYRVFDFECIREWALKSTQKSVSKTWKCPNCYFERKEVPMKNRPTCWCGK 129
           +TC M+AC  CYRVFD+ CIREWALKST+K+V K WKCPNCY   K+VP +NRPTCWCG 
Sbjct: 82  YTCQMFACKKCYRVFDYACIREWALKSTEKTVDKIWKCPNCYHVGKKVPTRNRPTCWCGN 141

Query: 130 SVQPEPNPLNPNSCGQTCDAQICEHGCSSICHLGPHPTCMRMVQVKCNCGKKNKSVFCHE 189
            V P+PN L+PNSCGQTC+A  C HGC  ICHLGPHP C RMV++KC+CG+ +K++FC++
Sbjct: 142 VVNPDPNQLDPNSCGQTCNAPTCVHGCFKICHLGPHPECTRMVEIKCHCGRHSKTIFCYQ 201

Query: 190 AGKFVDSFICDSPCGLTLPCGIHKCQRKCHSGICGECPESIYG------TINCYCKLESK 243
           +      F C   CGL+L CG+HKC++KCHSG+CG CPE I         I CYC    +
Sbjct: 202 SKAMRRRFNCQEECGLSLSCGVHKCKKKCHSGLCGSCPEFIINDDSSKKQIKCYCGNHIQ 261

Query: 244 PSLKCTEVRI--EGR-SRDSSGNKWVGAFSCENIRTVEHSCKKHSFAEPCKAPPSISGQV 300
            S+KC+E R    GR S+D SGN+W G F+C +IRTV+++C KHSF EPC +PP+ISGQ 
Sbjct: 262 NSIKCSEARFPKSGRTSKDESGNEWAGVFACADIRTVDYACHKHSFIEPCLSPPTISGQK 321

Query: 301 PCPFSPRTLKTCPCGRSPLREMDVSRSQCTDPIPTCDSVCGKMLRCGKHKCPFKCHTGSC 360
            CPF P  LKTCPCGR+ L E+   R  C DPIPTC+S C K L+CGKH CPF CH G+C
Sbjct: 322 TCPFLPSLLKTCPCGRTALEELTKPRKHCHDPIPTCNSRCSKPLKCGKHLCPFTCHDGAC 381

Query: 361 MEECLCTDKVKCSCHARQFIVPCKFQEKARCNTKCEALMSCRRHRCIERCCDGRSLAQSR 420
           M+ CL  D   CSC    F +PC FQE  RCN KCE+LMSCRRHRCI+RCC GR  A  R
Sbjct: 382 MDPCLQIDSANCSCEQSTFSIPCGFQESPRCNIKCESLMSCRRHRCIDRCCSGRPSAIRR 441

Query: 421 EKKVFLTRDKLDESLVEAQHICLKQCNLKLSCGKHFCKRKCHPGNCAPCLESDSNDLVCP 480
           +K  F ++D LDESLVEA+HICLK CNL LSCG H C+RKCHPG C PCLESDSNDL+C 
Sbjct: 442 KKSFFRSQDLLDESLVEAKHICLKPCNLTLSCGLHKCQRKCHPGKCPPCLESDSNDLICA 501

Query: 481 CGKTVVPAPVRCGTVLPRCLHPCIKTLQGXXXXXXXXXXXXXXXXXXXXXSCTAPVFKSC 540
           CGKTVVPAPVRCGT LP C HPCIK ++G                      CT  VFK C
Sbjct: 502 CGKTVVPAPVRCGTKLPTCNHPCIKVVRGESWCGHKPMPHTCHPSNISCPPCTETVFKPC 561

Query: 541 KCRKNDKVRTLCFQNDVSCGRVCGKQLAGCQHICQKACHKEGECQTSCKQPCGKTRENCE 600
           +C K DKVRT+CFQ DVSCG  CG  L+GC H CQK CH  G+CQ  CKQ CG+ R +C 
Sbjct: 562 RCGKKDKVRTVCFQADVSCGTSCGIPLSGCYHTCQKTCHLLGKCQKVCKQICGQKRLDCI 621

Query: 601 HRCRALCHSGTPCPDKPCLNLVDIKCNCGHRSTTVTCGANENRAPA-EETALECNNDCDV 659
           H C   CH  T CPD PC  LV I C CG    ++TC A  +       + L+CN +C+ 
Sbjct: 622 HTCPKPCHGKTECPDLPCAALVKITCECGRIKKSITCSAKRDTVSVITSSILDCNEECET 681

Query: 660 ARRHHELMEAFGIKNDANQGSKSLEDLEALAEKVS---TFQELLLPFSEATLSIFSKQTT 716
            +R  EL EAFG+    N   ++  +L+AL+E VS   TF+EL LPF+EATLS++SKQ  
Sbjct: 682 LKRLKELREAFGVSEGPNNVIRN--ELDALSELVSVAKTFEELQLPFTEATLSVYSKQER 739

Query: 717 WCTQIEECLERLMNDKNKPSLHFKPMRPPQRHFIHELGQAYHLYCESQDQEPKRSVFVKK 776
           WC QIE  L +LM+ + + SLHFKPMRPPQRHFIHE+ +AY+LY ESQD+EP RSVF+KK
Sbjct: 740 WCLQIEGILNKLMDSEIRSSLHFKPMRPPQRHFIHEMAKAYNLYAESQDREPMRSVFIKK 799

Query: 777 TAD--SQRPSISLKVALPLYYSFKSAQREKKLKETERHTTTRIINYAVTDQAQTPPAARF 834
             +  S++P +SL  A PLY SFK +Q+E+KL+E +  TT ++IN+ V D      AA+ 
Sbjct: 800 EDNCTSKKPVLSLAEAYPLYESFKQSQKERKLQEFQARTTAKLINFEVQDAESKIEAAKN 859

Query: 835 NGLLVQNVLNGINEKAIQESFSEYLKHTLLKDPHYLLL-ASGDVLVYCDDYSTASVNVEN 893
           NG LVQN+++G   + ++  F  +LKHTL+ +P YL+L  S   L+Y ++Y TASVN E 
Sbjct: 860 NGFLVQNLVSGNTVEDLKRFFEPHLKHTLVANPQYLILDDSRSALIYPENYETASVNTER 919

Query: 894 DIERIVGHLDHIVKEQLLAEGVYATRV 920
           D+E +VGH D + KE  LA+ ++   V
Sbjct: 920 DMELLVGHFDFMAKEAFLADSIHLCSV 946

>Smik_14.308 Chr14 complement(550650..553547) [2898 bp, 965 aa] {ON}
           YNL023C (REAL)
          Length = 965

 Score = 1002 bits (2590), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 493/889 (55%), Positives = 609/889 (68%), Gaps = 14/889 (1%)

Query: 41  EDQPYYEKTVKEIEKGDRYPCMICTVEMDFTCHMYACPDCYRVFDFECIREWALKSTQKS 100
           +D  YYE++++EI KGD Y CMICTVEMD+TC M+AC  CYRVFD+ CIREWA+KST+K+
Sbjct: 48  DDMQYYERSIQEISKGDSYICMICTVEMDYTCQMFACKRCYRVFDYGCIREWAIKSTEKT 107

Query: 101 VSKTWKCPNCYFERKEVPMKNRPTCWCGKSVQPEPNPLNPNSCGQTCDAQICEHGCSSIC 160
           V + WKCPNCY   K+VP  NRPTCWCGK V P+PNPL+PNSCGQTC A IC HGCS  C
Sbjct: 108 VDRIWKCPNCYHVGKKVPANNRPTCWCGKVVNPDPNPLDPNSCGQTCSAPICIHGCSKTC 167

Query: 161 HLGPHPTCMRMVQVKCNCGKKNKSVFCHEAGKFVDSFICDSPCGLTLPCGIHKCQRKCHS 220
           HLGPHP C RMV++ C+CGK ++S+FC+++     +F C   CGL L C +H C+RKCH+
Sbjct: 168 HLGPHPECTRMVEIMCHCGKHSQSIFCYQSKAMKKNFKCQEECGLPLSCSVHNCKRKCHT 227

Query: 221 GICGECPESIYG------TINCYCKLESKPSLKCTEVRI--EGRS-RDSSGNKWVGAFSC 271
           G+CG CPE I         I CYC   S+ S+KC+E R    GRS +D +GN+W+G F+C
Sbjct: 228 GLCGPCPELITSKDSTEEQIKCYCGNHSRASIKCSEARFPKSGRSSKDGNGNEWIGVFAC 287

Query: 272 ENIRTVEHSCKKHSFAEPCKAPPSISGQVPCPFSPRTLKTCPCGRSPLREMDVSRSQCTD 331
            +IRTV+ SC+KHSF EPC +PPS++G+  CPF P  LKTCPCGR+ L E+   R  C D
Sbjct: 288 TDIRTVDFSCRKHSFIEPCLSPPSVNGRKVCPFLPSLLKTCPCGRTALDELTKPRKHCDD 347

Query: 332 PIPTCDSVCGKMLRCGKHKCPFKCHTGSCMEECLCTDKVKCSCHARQFIVPCKFQEKARC 391
           PIPTC+S C K L+CGKH CPF CH  +CM+ CL  D  KC+C    F VPC FQ + RC
Sbjct: 348 PIPTCNSRCSKPLKCGKHSCPFICHDLACMDPCLQIDSAKCACEQSTFSVPCGFQGRPRC 407

Query: 392 NTKCEALMSCRRHRCIERCCDGRSLAQSREKKVFLTRDKLDESLVEAQHICLKQCNLKLS 451
           N KCE+LMSCRRHRC +RCC GR  A  R K  F ++D LDESLVEA+HICLK CNL LS
Sbjct: 408 NIKCESLMSCRRHRCTDRCCSGRPSAVKRRKNFFRSQDLLDESLVEAKHICLKPCNLTLS 467

Query: 452 CGKHFCKRKCHPGNCAPCLESDSNDLVCPCGKTVVPAPVRCGTVLPRCLHPCIKTLQGXX 511
           CG H C+RKCHPG C PCLESDSNDL+CPCGKTVVPAPVRCGT LP C HPCIK ++G  
Sbjct: 468 CGIHKCQRKCHPGKCPPCLESDSNDLICPCGKTVVPAPVRCGTELPVCNHPCIKVVRGES 527

Query: 512 XXXXXXXXXXXXXXXXXXXSCTAPVFKSCKCRKNDKVRTLCFQNDVSCGRVCGKQLAGCQ 571
                               CT  VFK CKC K DKVRT+CFQ DVSCG  CG  L  C+
Sbjct: 528 SCGHKPMPHTCHPLGVPCPPCTETVFKPCKCGKKDKVRTVCFQKDVSCGTKCGLLLHFCR 587

Query: 572 HICQKACHKEGECQTSCKQPCGKTRENCEHRCRALCHSGTPCPDKPCLNLVDIKCNCGHR 631
           H CQK CH  G CQ  CKQ CG  R +C H C   CH  T CPD PC  LV I C CG  
Sbjct: 588 HTCQKTCHLPGNCQKVCKQICGHERLSCRHTCPKPCHGKTECPDLPCPTLVKITCKCGRN 647

Query: 632 STTVTCGANENRAPAEETA-LECNNDCDVARRHHELMEAFGIKNDANQ-GSKSLEDLEAL 689
             +VTC A     PA E++ L+C+ +C+  +R  EL EAFGIK ++N   S  L+ L+ L
Sbjct: 648 EKSVTCSAKSGVVPANESSVLDCDEECEALKRLKELREAFGIKEESNNVTSNELDALKKL 707

Query: 690 AEKVSTFQELLLPFSEATLSIFSKQTTWCTQIEECLERLMNDKNKPSLHFKPMRPPQRHF 749
               +TF+EL LPF+E TLS++SKQ  WC+QIE  L +LM+DK + SLHFKPMRPPQRHF
Sbjct: 708 VSVATTFEELHLPFTETTLSVYSKQERWCSQIEVILNKLMDDKTRSSLHFKPMRPPQRHF 767

Query: 750 IHELGQAYHLYCESQDQEPKRSVFVKK--TADSQRPSISLKVALPLYYSFKSAQREKKLK 807
           I EL +AY LY ESQD+EP RSVF+KK     S +P +SL  ALPLY SFK  Q+E+K++
Sbjct: 768 IRELAKAYGLYSESQDREPMRSVFIKKEDNGTSNKPVLSLGEALPLYESFKQLQKERKVQ 827

Query: 808 ETERHTTTRIINYAVTDQAQTPPAARFNGLLVQNVLNGINEKAIQESFSEYLKHTLLKDP 867
           E +  TT ++IN+ V D       A+ NG LV+N++ G   + ++  F  +LKHTL+ +P
Sbjct: 828 EFQSRTTAKLINFEVQDAQPKVEVAKNNGFLVRNLVTGNTVEDLKRFFEPHLKHTLVVNP 887

Query: 868 HYLLLASGD-VLVYCDDYSTASVNVENDIERIVGHLDHIVKEQLLAEGV 915
            YL+L  G   LVY ++Y TASVN E D+E +VGH D + KE  LA+ +
Sbjct: 888 QYLILDDGKTALVYPENYETASVNTERDMELLVGHFDFMAKEAFLADSI 936

>NCAS0G03780 Chr7 complement(696877..699750) [2874 bp, 957 aa] {ON} 
          Length = 957

 Score =  986 bits (2550), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 497/886 (56%), Positives = 624/886 (70%), Gaps = 16/886 (1%)

Query: 45  YYEKTVKEIEKGDRYPCMICTVEMDFTCHMYACPDCYRVFDFECIREWALKSTQKSVSKT 104
           YYE+ ++EI KGD Y CMICTVEMD+TC MYAC  CYRVFD+ECIREWALKST+K+V + 
Sbjct: 52  YYERAIQEIAKGDSYVCMICTVEMDYTCQMYACKQCYRVFDYECIREWALKSTEKTVDRI 111

Query: 105 WKCPNCYFERKEVPMKNRPTCWCGKSVQPEPNPLNPNSCGQTCDAQICEHGCSSICHLGP 164
           WKCPNCY   K+VP KNRPTCWCGK V PEPNPLNPNSCGQTC+A  C HGCS ICHLGP
Sbjct: 112 WKCPNCYHVNKKVPPKNRPTCWCGKVVNPEPNPLNPNSCGQTCNAHTCVHGCSKICHLGP 171

Query: 165 HPTCMRMVQVKCNCGKKNKSVFCHEAG--KFVDSFICDSPCGLTLPCGIHKCQRKCHSGI 222
           HP C R++ +KC CGK  K + C+++   +  D F CD PCGL L CG+H+CQ+KCHSG+
Sbjct: 172 HPECTRIITIKCRCGKHTKDISCYQSSLLRGKDKFQCDEPCGLPLACGLHRCQKKCHSGL 231

Query: 223 CGECPESIY------GTINCYCKLESKPSLKCTEVRI---EGRSRDSSGNKWVGAFSCEN 273
           CG CPE +         I CYC  + + ++KC +V +      S++  G KWVG F C+N
Sbjct: 232 CGICPEILNTKEYLDAHIRCYCGSQDRDTIKCRDVHVPLSASLSQNLKGEKWVGVFKCDN 291

Query: 274 IRTVEHSCKKHSFAEPCKAPPSISGQVPCPFSPRTLKTCPCGRSPLREMDVSRSQCTDPI 333
           IR V++ C +HSF E C APP+I G  PCPFSP+ LKTCPCG++PL+E+  SR +CTDPI
Sbjct: 292 IRNVDYKCHEHSFVEQCIAPPTIDGTKPCPFSPKLLKTCPCGKTPLKELVESRKKCTDPI 351

Query: 334 PTCDSVCGKMLRCGKHKCPFKCHTGSCMEECLCTDKVKCSCHARQFIVPCKFQEKARCNT 393
           PTCDS CGK L+CG+H CPF CH G CM+ CL  DK KCSC+ + F+VPC+F +  +C T
Sbjct: 352 PTCDSRCGKPLKCGRHTCPFICHVGPCMDPCLQIDKKKCSCNQQSFLVPCQFHQDPQCTT 411

Query: 394 KCEALMSCRRHRCIERCCDGRSLAQSREKKVFLTRDKLDESLVEAQHICLKQCNLKLSCG 453
           KCE+LMSCRRHRC ERCC GR  A++R+K++F ++D +DESLVE QHICLK+CNL LSCG
Sbjct: 412 KCESLMSCRRHRCTERCCAGRPRAEARKKRLFRSQDLMDESLVEPQHICLKECNLMLSCG 471

Query: 454 KHFCKRKCHPGNCAPCLESDSNDLVCPCGKTVVPAPVRCGTVLPRCLHPCIKTLQGXXXX 513
           KH C+RKCHPG C PCLESDSNDLVCPCG+T++ APVRCGT LP C +PCIK ++G    
Sbjct: 472 KHKCQRKCHPGKCPPCLESDSNDLVCPCGRTIIEAPVRCGTKLPPCPYPCIKVVRGEYPC 531

Query: 514 XXXXXXXXXXXXXXXXXSCTAPVFKSCKCRKNDKVRTLCFQNDVSCGRVCGKQLAGCQHI 573
                             CTA VFK CKC K DKVRTLCFQNDVSCG++CG  L  C H 
Sbjct: 532 GHTPMPHTCHPLNEPCPPCTASVFKPCKCGKVDKVRTLCFQNDVSCGKICGLPLENCNHT 591

Query: 574 CQKACHKEGECQTSCKQPCGKTRENCEHRCRALCHSGTPCPDKPCLNLVDIKCNCGHRST 633
           CQK CH  GECQ +CKQ C K R NCEH C   CH  T CPD PC   + I C CG + T
Sbjct: 592 CQKRCHLLGECQKTCKQICKKKRINCEHTCLKPCHGKTDCPDIPCSVSIKITCECGRKET 651

Query: 634 TVTCGANEN-RAPAEETALECNNDCDVARRHHELMEAFGIKNDANQGSKSLEDLEALAEK 692
            VTCGA     + A +T +EC+ +C++  RH +L EAFGI +     S  +E L+ LA+ 
Sbjct: 652 YVTCGATSTIPSAATKTHIECDEECELLERHRQLKEAFGIVDSNRSTSLEVEKLKDLAKV 711

Query: 693 VSTFQELLLPFSEATLSIFSKQTTWCTQIEECLERLMNDKNKPSLHFKPMRPPQRHFIHE 752
            +TF+EL LP++E TLSI++KQ  WC QIEE L +LM+DK +PSLHFKPMRPPQRHFI E
Sbjct: 712 ATTFEELQLPYNETTLSIYAKQEKWCDQIEEILNKLMDDKARPSLHFKPMRPPQRHFIQE 771

Query: 753 LGQAYHLYCESQDQEPKRSVFVKKTAD--SQRPSISLKVALPLYYSFKSAQREKKLKETE 810
             ++++LY E+QD+EPKRSVFVKK  D  S +P ISL  ALPLY +FK  ++E+KLKE E
Sbjct: 772 FAKSFNLYAEAQDREPKRSVFVKKEEDGSSSKPIISLHDALPLYQTFKELEKERKLKEFE 831

Query: 811 RHTTTRIINYAVTDQAQTPPAARFNGLLVQNVLNGINEKAIQESFSEYLKHTLLKDPHYL 870
             TTTR+IN     Q      A+++G L++ +  G   + +Q  F ++L  TL+ +P YL
Sbjct: 832 ARTTTRLINVEAP-QEDNVYHAKYSGFLIKKISPGTTVEDLQRIFGQFLTSTLIVNPQYL 890

Query: 871 LLASG-DVLVYCDDYSTASVNVENDIERIVGHLDHIVKEQLLAEGV 915
           ++  G D L+Y ++Y   S  VE D+E +VGH D I KE  +A+GV
Sbjct: 891 IIQDGKDALIYPENYQEMSAGVERDLETLVGHFDFISKENFIADGV 936

>TDEL0G02190 Chr7 (430157..432967) [2811 bp, 936 aa] {ON} Anc_2.288
           YNL023C
          Length = 936

 Score =  981 bits (2535), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 484/892 (54%), Positives = 611/892 (68%), Gaps = 14/892 (1%)

Query: 37  IDELEDQPYYEKTVKEIEKGDRYPCMICTVEMDFTCHMYACPDCYRVFDFECIREWALKS 96
           + +  D  YYE+ V+EI  GDRY CMICTVEMD+TC MYAC  CYRVFD+ECIREWALKS
Sbjct: 32  VRDEHDMAYYERAVQEIALGDRYVCMICTVEMDYTCKMYACEGCYRVFDYECIREWALKS 91

Query: 97  TQKSVSKTWKCPNCYFERKEVPMKNRPTCWCGKSVQPEPNPLNPNSCGQTCDAQICEHGC 156
           T+K++ + WKCPNCY   K VP KNRPTCWCGK+V P+PNPL+PNSCGQTCDA IC HGC
Sbjct: 92  TEKTLDRVWKCPNCYKVNKRVPAKNRPTCWCGKTVNPDPNPLDPNSCGQTCDAPICPHGC 151

Query: 157 SSICHLGPHPTCMRMVQVKCNCGKKNKSVFCHE--AGKFVDSFICDSPCGLTLPCGIHKC 214
           S  CHLGPHP C+R +  KC CGK  +  FC++  + K    F C+  CGL L CGIHKC
Sbjct: 152 SKQCHLGPHPDCVRTITTKCQCGKHTRETFCYQTISMKGKSQFQCNEVCGLPLACGIHKC 211

Query: 215 QRKCHSGICGECPESIYGT-----INCYCKLESKPSLKCTEVRIEGR-SRDSSGNKWVGA 268
           +R CHSGICG CP  +        I CYC LE + S KC +VR+    S+D  G+ W+GA
Sbjct: 212 ERLCHSGICGPCPAVLNAKSNKLKIRCYCGLEHRDSFKCKDVRVASDLSKDGKGDSWIGA 271

Query: 269 FSCENIRTVEHSCKKHSFAEPCKAPPSISGQVPCPFSPRTLKTCPCGRSPLREMDVSRSQ 328
           F C  IR +E++C++HSF E C+  PSISG++ CPFSP+ LKTCPCGR+ L+ +   R  
Sbjct: 272 FGCSGIRKIEYACREHSFVEKCQPSPSISGKIACPFSPKLLKTCPCGRTSLKVLAEPRKS 331

Query: 329 CTDPIPTCDSVCGKMLRCGKHKCPFKCHTGSCMEECLCTDKVKCSCHARQFIVPCKFQEK 388
           CT PIP CDS CGK L CG+H CPF CH G CM+ C+  + V+CSCH   + VPC+F+E+
Sbjct: 332 CTSPIPNCDSTCGKKLACGRHTCPFTCHDGPCMDPCIQIETVRCSCHKNLYSVPCQFKEQ 391

Query: 389 ARCNTKCEALMSCRRHRCIERCCDGRSLAQSREKKVFLTRDKLDESLVEAQHICLKQCNL 448
            RC+TKCE+LMSCRRHRC ERCC GR  A+ R K    +R+ +DES VE++HICLK CNL
Sbjct: 392 PRCDTKCESLMSCRRHRCTERCCCGRPFAERRRKTPLSSRELMDESSVESEHICLKDCNL 451

Query: 449 KLSCGKHFCKRKCHPGNCAPCLESDSNDLVCPCGKTVVPAPVRCGTVLPRCLHPCIKTLQ 508
            LSCG H C+RKCHPG C PCLESDSNDLVCPCGKTVV APVRCGT LP C +PCI+ +Q
Sbjct: 452 TLSCGCHKCQRKCHPGKCPPCLESDSNDLVCPCGKTVVEAPVRCGTRLPPCHYPCIRVIQ 511

Query: 509 GXXXXXXXXXXXXXXXXXXXXXSCTAPVFKSCKCRKNDKVRTLCFQNDVSCGRVCGKQLA 568
                                 SCTAPVFK CKC K DKVRTLCFQNDVSCG  CGK L 
Sbjct: 512 NAYKCGHKPMPHTCHPLNEPCPSCTAPVFKPCKCGKKDKVRTLCFQNDVSCGTTCGKPLD 571

Query: 569 GCQHICQKACHKEGECQTSCKQPCGKTRENCEHRCRALCHSGTPCPDKPCLNLVDIKCNC 628
            C H+CQK+CH  GECQ  CKQ C + R  C+H+CR +CH    CPD PC   V IKC C
Sbjct: 572 NCPHMCQKSCHIPGECQKKCKQICNRKRIYCDHKCRLICHGNDKCPDIPCPLSVKIKCEC 631

Query: 629 GHRSTTVTCGAN-ENRAPAEETALECNNDCDVARRHHELMEAFGIKNDANQGSKS-LEDL 686
             + + +TCGAN E  + A  T L C+ +C+  +RH +L EAFGI N ++  S+S    L
Sbjct: 632 EVKESFITCGANSETPSKATTTILPCDEECERHKRHLQLREAFGISNFSDNPSRSKTASL 691

Query: 687 EALAEKVSTFQELLLPFSEATLSIFSKQTTWCTQIEECLERLMNDKNKPSLHFKPMRPPQ 746
           E LA   ++F+EL LPFSE  L  F+KQ  WCTQIE  L   M+++ K SLHFKPMRP Q
Sbjct: 692 ENLAAVANSFEELELPFSEPALGTFAKQEAWCTQIENVLNSFMDNEEKTSLHFKPMRPAQ 751

Query: 747 RHFIHELGQAYHLYCESQDQEPKRSVFVKK--TADSQRPSISLKVALPLYYSFKSAQREK 804
           RHFIHEL ++Y+LY ESQD+EPKRSVFVKK     S +P I LK +LP+Y  FK  ++EK
Sbjct: 752 RHFIHELAKSYNLYVESQDREPKRSVFVKKQDNGGSCKPVIQLKDSLPIYQFFKENEKEK 811

Query: 805 KLKETERHTTTRIINYAVTDQAQTPPAARFNGLLVQNVLNGINEKAIQESFSEYLKHTLL 864
           K +  E  TTT  +N+   ++ Q    A+ N   ++NV  G  ++ ++  F+++LK TL+
Sbjct: 812 KAQRFEAQTTTEFVNFIPKEEPQL-ERAKNNAFKLKNVSTGTTKEDLERIFADHLKPTLV 870

Query: 865 KDPHYLLL-ASGDVLVYCDDYSTASVNVENDIERIVGHLDHIVKEQLLAEGV 915
           K+P + +  ++ + L+Y +DY+  SVNVE D+E +VGH D++ KE  + +G+
Sbjct: 871 KNPQFKIQDSTKNGLIYPEDYAEISVNVERDLEALVGHFDYLCKESFIGDGI 922

>KAFR0H03300 Chr8 complement(627520..630420) [2901 bp, 966 aa] {ON}
           Anc_2.288 YNL023C
          Length = 966

 Score =  970 bits (2507), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 472/901 (52%), Positives = 608/901 (67%), Gaps = 14/901 (1%)

Query: 37  IDELEDQPYYEKTVKEIEKGDRYPCMICTVEMDFTCHMYACPDCYRVFDFECIREWALKS 96
           + + +D  YYE+ ++EI  GD Y CMICTVEMD+TC MYAC  C R+FD++CIREWALKS
Sbjct: 47  LSDNDDMMYYERAIQEIAAGDSYICMICTVEMDYTCKMYACKKCCRIFDYDCIREWALKS 106

Query: 97  TQKSVSKTWKCPNCYFERKEVPMKNRPTCWCGKSVQPEPNPLNPNSCGQTCDAQICEHGC 156
           T+K+  + WKCPNCY   K+VP KNR TCWCGK V PE NPLNPNSCGQTC+A +C HGC
Sbjct: 107 TEKTKERIWKCPNCYHVNKKVPTKNRATCWCGKVVNPEKNPLNPNSCGQTCNAPVCIHGC 166

Query: 157 SSICHLGPHPTCMRMVQVKCNCGKKNKSVFCHEA---GKFVDSFICDSPCGLTLPCGIHK 213
           S ICHLGPHP C+R + +KC+CGK  + + C ++       + F C+  CGL L CGIH 
Sbjct: 167 SKICHLGPHPECLRTITMKCDCGKHERQISCFQSKSQSGRRNRFSCEEECGLPLSCGIHT 226

Query: 214 CQRKCHSGICGECPESIY------GTINCYCKLESKPSLKCTEVRIEGR-SRDSSGNKWV 266
           C++KCHSG+CG CPE +        TI CYC LE+K S  C +V+     SRD+ GNKWV
Sbjct: 227 CKKKCHSGLCGSCPELLEVNEEKCATIKCYCGLETKKSFPCKDVKAPTTLSRDAEGNKWV 286

Query: 267 GAFSCENIRTVEHSCKKHSFAEPCKAPPSISGQVPCPFSPRTLKTCPCGRSPLREMDVSR 326
           G FSC  IR VE+SC+KHSF E C APP++SG   CPFSP  LKTCPCGR+PL  +   R
Sbjct: 287 GVFSCNKIRNVEYSCQKHSFVESCVAPPTVSGTKQCPFSPNLLKTCPCGRTPLNALSKPR 346

Query: 327 SQCTDPIPTCDSVCGKMLRCGKHKCPFKCHTGSCMEECLCTDKVKCSCHARQFIVPCKFQ 386
            +CTDP+PTC++ C K L+CGKH+CPF CH G CM+ C+  DK  CSCH   F+ PC+F+
Sbjct: 347 LKCTDPVPTCEACCNKPLKCGKHRCPFTCHNGPCMDPCIQIDKKPCSCHQSFFLTPCQFE 406

Query: 387 EKARCNTKCEALMSCRRHRCIERCCDGRSLAQSREKKVFLTRDKLDESLVEAQHICLKQC 446
            +  CN KCE+LMSCRRHRC ERCC GR LA+ R+K +F + D  DE+LVEAQH+CLK+C
Sbjct: 407 GEPHCNIKCESLMSCRRHRCTERCCSGRPLAEKRKKTLFRSSDINDETLVEAQHVCLKEC 466

Query: 447 NLKLSCGKHFCKRKCHPGNCAPCLESDSNDLVCPCGKTVVPAPVRCGTVLPRCLHPCIKT 506
           NL LSCGKH C+RKCHPG C PCLESDSNDLVCPCGKTVV APVRCGT L  CL PCIK 
Sbjct: 467 NLMLSCGKHRCQRKCHPGKCPPCLESDSNDLVCPCGKTVVEAPVRCGTKLSPCLFPCIKV 526

Query: 507 LQGXXXXXXXXXXXXXXXXXXXXXSCTAPVFKSCKCRKNDKVRTLCFQNDVSCGRVCGKQ 566
           ++                       CTA VFK CKC K DKVRT+CFQ DVSCG++CG  
Sbjct: 527 IRNESVCGHPPVPHSCHPLDQPCPPCTATVFKPCKCGKRDKVRTVCFQKDVSCGKICGLP 586

Query: 567 LAGCQHICQKACHKEGECQTSCKQPCGKTRENCEHRCRALCHSGTPCPDKPCLNLVDIKC 626
           L  C H CQK CH  GECQ  CKQ C K R NC H C   CH  T C D PC     I C
Sbjct: 587 LLTCHHKCQKVCHPNGECQVKCKQVCRKKRVNCVHECLKSCHGSTECSDSPCPVSTKISC 646

Query: 627 NCGHRSTTVTCGANEN-RAPAEETALECNNDCDVARRHHELMEAFGIKNDANQGSKSLED 685
            CG R + VTC A     + A  T L+CN +C+V +RH EL EAFGI       +   E 
Sbjct: 647 PCGRRESYVTCNATSTIDSAALITRLDCNEECEVVKRHRELREAFGIVEKEEPENLGTER 706

Query: 686 LEALAEKVSTFQELLLPFSEATLSIFSKQTTWCTQIEECLERLMNDKNKPSLHFKPMRPP 745
           L++ A+  + + +L LP++E  L  ++KQ  WC QIEE L + M+D ++PSLHFKPMRPP
Sbjct: 707 LQSFAQSATNYDDLQLPYTEPALVAYTKQPNWCEQIEELLIKFMDDNSRPSLHFKPMRPP 766

Query: 746 QRHFIHELGQAYHLYCESQDQEPKRSVFVKKTAD--SQRPSISLKVALPLYYSFKSAQRE 803
           QR+FIHE+ +A++LY ESQD+EPKRSVF+KK  D  S +P++ L   LP+Y +FK  ++E
Sbjct: 767 QRYFIHEIAKAFNLYAESQDREPKRSVFLKKNDDGTSLKPALRLSDVLPVYQNFKKLEKE 826

Query: 804 KKLKETERHTTTRIINYAVTDQAQTPPAARFNGLLVQNVLNGINEKAIQESFSEYLKHTL 863
           +K K+ E  TT R++N  + D  +       NGL+++N+ NGI  + + E F+++ K TL
Sbjct: 827 RKAKQFEARTTARLMNITLDDTLEERKKFENNGLIIKNLSNGITLEFLSEFFNKFFKSTL 886

Query: 864 LKDPHYLLLASGDVLVYCDDYSTASVNVENDIERIVGHLDHIVKEQLLAEGVYATRVQSF 923
           +K+P YL++ +   L+Y + ++  +  V ND++ +VGH + IVKE+L+ + V    +++ 
Sbjct: 887 IKNPQYLIIENNG-LIYPESHNEITQGVYNDLDMLVGHFNVIVKEELIGDSVEMCNIENE 945

Query: 924 L 924
           L
Sbjct: 946 L 946

>KNAG0H01990 Chr8 complement(349855..352776) [2922 bp, 973 aa] {ON}
           Anc_2.288 YNL023C
          Length = 973

 Score =  969 bits (2504), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 474/925 (51%), Positives = 620/925 (67%), Gaps = 20/925 (2%)

Query: 38  DELEDQPYYEKTVKEIEKGDRYPCMICTVEMDFTCHMYACPDCYRVFDFECIREWALKST 97
           +E +D PYYE+ V+EI KGD Y CMICTVEMD+TC M+AC  CYRVFD++C+REWA+KST
Sbjct: 46  EEDQDLPYYERAVREIAKGDLYTCMICTVEMDYTCKMFACRKCYRVFDYDCVREWAIKST 105

Query: 98  QKSVSKTWKCPNCYFERKEVPMKNRPTCWCGKSVQPEPNPLNPNSCGQTCDAQICEHGCS 157
            K+V + WKCPNCY   K+VP KNRPTCWCGK V PEPNPL+PNSCGQTCDA+IC HGCS
Sbjct: 106 DKTVDRIWKCPNCYLVNKKVPTKNRPTCWCGKVVNPEPNPLDPNSCGQTCDAKICIHGCS 165

Query: 158 SICHLGPHPTCMRMVQVKCNCGKKNKSVFCHE--AGKFVDSFICDSPCGLTLPCGIHKCQ 215
            ICHLGPHP C+R   VKC CGK  K + C E    +  + F C+ PC   LPCGIH+CQ
Sbjct: 166 KICHLGPHPECLRTTSVKCRCGKATKEIPCFETKGRRGRNLFQCNEPCNSLLPCGIHRCQ 225

Query: 216 RKCHSGICGECPESIYG------TINCYCKLESKPSLKCTEVRIEGR-SRDSSGNKWVGA 268
           + CHSG+CG CPE++        +I+CYC   ++ S+KC +V + GR S++++G++W+G 
Sbjct: 226 KICHSGLCGSCPENLTVKEGDDVSISCYCGQHTRNSIKCKDVNVTGRKSKNANGDEWIGV 285

Query: 269 FSCENIRTVEHSCKKHSFAEPCKAPPSISGQVPCPFSPRTLKTCPCGRSPLREMDVSRSQ 328
           ++C++IR+VE+SC++HSF E C APP+++G   CPFSP+ LKTC CG++PL+ +  +R +
Sbjct: 286 YACKDIRSVEYSCRQHSFFEECIAPPTVTGTKRCPFSPKYLKTCSCGKTPLQALGKARRR 345

Query: 329 CTDPIPTCDSVCGKMLRCGKHKCPFKCHTGSCMEECLCTDKVKCSCHARQFIVPCKFQEK 388
           C DPIP C+S C K+L+CGKH CPF+CH G CM+ C+  DKVKC+C    F+VPC FQ  
Sbjct: 346 CIDPIPHCESRCDKLLKCGKHTCPFQCHDGPCMDPCIQIDKVKCACERNTFLVPCGFQGA 405

Query: 389 ARCNTKCEALMSCRRHRCIERCCDGRSLAQSREKKVFLTRDKLDESLVEAQHICLKQCNL 448
             C  KCE+L+SCRRH+C ERCC GR  A+ R K     +D  DE+L+EA+H+CLK CNL
Sbjct: 406 PHCQLKCESLLSCRRHKCAERCCSGRPAAEERRKNSSRFQDVNDETLMEAEHVCLKACNL 465

Query: 449 KLSCGKHFCKRKCHPGNCAPCLESDSNDLVCPCGKTVVPAPVRCGTVLPRCLHPCIKTLQ 508
            LSCG+H C+RKCHPG C PCLESDSNDLVCPCGKT+VPAPVRCGT LP C HPCIK ++
Sbjct: 466 TLSCGQHQCQRKCHPGKCPPCLESDSNDLVCPCGKTIVPAPVRCGTKLPSCRHPCIKVVE 525

Query: 509 GXXXXXXXXXXXXXXXXXXXXXSCTAPVFKSCKCRKNDKVRTLCFQNDVSCGRVCGKQLA 568
           G                      CTA VFK CKC KN +VRT+CFQ DVSCG+ CGK L 
Sbjct: 526 GISECGHKPIPHACHPLDQPCPPCTATVFKPCKCGKNSRVRTICFQKDVSCGQTCGKPLP 585

Query: 569 GCQHICQKACHKEGECQTSCKQPCGKTRENCEHRCRALCHSGTPCPDKPCLNLVDIKCNC 628
            C H CQK CH  G+CQ +CKQ C K   NC H+CR  CH    CPD  C+ LV I+C C
Sbjct: 586 NCHHFCQKTCHLPGQCQATCKQVCNKPPVNCAHKCRKSCHGRLTCPDILCIALVKIRCPC 645

Query: 629 GHRSTTVTCGANENRAPAEETA-LECNNDCDVARRHHELMEAFGIKNDANQGSKSLED-- 685
           G +   VTCGA    + +  T  LEC+ +C+   RH +L EAFGI +    GS   E   
Sbjct: 646 GRKEVEVTCGATSTLSSSLFTERLECDEECEAYTRHRQLKEAFGITDKVANGSAMKEKEG 705

Query: 686 --LEALAEKVSTFQELLLPFSEATLSIFSKQTTWCTQIEECLERLMNDKNKPSLHFKPMR 743
             LE LA K +TF+EL  PF+E+T+S + +Q  WC +IEE L   M+++ K SLHFKPM+
Sbjct: 706 TRLEGLASKATTFEELQFPFTESTISTYIRQNKWCGEIEETLNNFMDNEGKSSLHFKPMK 765

Query: 744 PPQRHFIHELGQAYHLYCESQDQEPKRSVFVKKTAD--SQRPSISLKVALPLYYSFKSAQ 801
           PPQR FI EL +AY+LY E+QD EPKRSVFVKK  D  S +P  SL    PLY SFK  +
Sbjct: 766 PPQRLFIRELAKAYNLYSEAQDPEPKRSVFVKKNDDGSSAKPIFSLSEIAPLYQSFKLLE 825

Query: 802 REKKLKETERHTTTRIINYAVTDQAQTPP--AARFNGLLVQNVLNGINEKAIQESFSEYL 859
           +E+K+++    TTT +IN  + D   T    + + N  L++N+  G   + ++  F +Y+
Sbjct: 826 KERKMQDFLAKTTTHLINVKLNDDVATGAQHSGQNNAFLIKNISAGTTLQDLKNLFGKYM 885

Query: 860 KHTLLKDPHYLLLA-SGDVLVYCDDYSTASVNVENDIERIVGHLDHIVKEQLLAEGVYAT 918
           + TL+++P Y  L      +VY +DY T S N  ND+E +VGH++ IV +  LA+     
Sbjct: 886 EKTLIRNPQYQELPEENSAIVYPEDYRTISANAVNDMENLVGHINFIVNDAFLADSAELC 945

Query: 919 RVQSFLDDLESSTSDAATSISNSEL 943
              S L + E S +D +  +   E+
Sbjct: 946 DASSKLPE-EISENDISERLETPEV 969

>ZYRO0A01936g Chr1 (159749..162610) [2862 bp, 953 aa] {ON} similar
           to uniprot|P53971 Saccharomyces cerevisiae YNL023C
          Length = 953

 Score =  952 bits (2462), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 466/892 (52%), Positives = 606/892 (67%), Gaps = 17/892 (1%)

Query: 45  YYEKTVKEIEKGDRYPCMICTVEMDFTCHMYACPDCYRVFDFECIREWALKSTQKSVSKT 104
           YYE+ VKEI +GD Y CMICTVEMD+TC M+AC  CYRVFD++CIREWALKST +++ KT
Sbjct: 58  YYERAVKEIARGDTYVCMICTVEMDYTCKMFACSKCYRVFDYDCIREWALKSTGRTMDKT 117

Query: 105 WKCPNCYFERKEVPMKNRPTCWCGKSVQPEPNPLNPNSCGQTCDAQICEHGCSSICHLGP 164
           WKCPNC  E  +VP K+RPTCWCGK V P+PNPL+PNSCGQTCDA ICEHGCS +CHLGP
Sbjct: 118 WKCPNCLDESNKVPRKSRPTCWCGKVVNPDPNPLDPNSCGQTCDAPICEHGCSKVCHLGP 177

Query: 165 HPTCMRMVQVKCNCGKKNKSVFCHEAGKFVDS-FICDSPCGLTLPCGIHKCQRKCHSGIC 223
           HP C R++ +KC CG+  + V C E G   +  F C+  CGL LPCG+HKC +KCHSG+C
Sbjct: 178 HPECTRIISIKCKCGRHTRDVRCSEVGSGRNQQFTCEESCGLLLPCGVHKCSKKCHSGLC 237

Query: 224 GECPESIY------GTINCYCKLESKPSLKCTEVRIEGR-SRDSSGNKWVGAFSCENIRT 276
           G C E+++        I CYC L   PS++C +VR+  R S D  GN W+G F C+++R 
Sbjct: 238 GGCNETLHSKPDKGAVIKCYCGLHESPSIRCGDVRVADRDSVDDQGNGWIGVFRCKDVRV 297

Query: 277 VEHSCKKHSFAEPCKAPPSISGQVPCPFSPRTLKTCPCGRSPLREMDVSRSQCTDPIPTC 336
           VE++C +HSF E CK  PS+  Q+ CPFSP  L++CPCGR+PL ++  +R +CTD IPTC
Sbjct: 298 VEYACGQHSFVESCKPAPSLPKQIGCPFSPNVLRSCPCGRTPLNKLGQARVKCTDHIPTC 357

Query: 337 DSVCGKMLRCGKHKCPFKCHTGSCMEECLCTDKVKCSCHARQFIVPCKFQEKARCNTKCE 396
           +S CGK L CGKH CP+KCH G CM+ C+  +K  C C AR F+VPC+F+E  RCNTKCE
Sbjct: 358 ESKCGKKLACGKHTCPYKCHEGDCMDPCVQFEKTNCLCEARSFLVPCQFREDPRCNTKCE 417

Query: 397 ALMSCRRHRCIERCCDGRSLAQSREKKVFLTRDKLDESLVEAQHICLKQCNLKLSCGKHF 456
           +LMSCRRHRC E+CC G+  A+ R+K  F +R+ LDESLVEA+H+CLK CNL L+CG+H 
Sbjct: 418 SLMSCRRHRCTEKCCSGKPGAERRKKTPFTSRELLDESLVEAEHVCLKSCNLTLTCGRHK 477

Query: 457 CKRKCHPGNCAPCLESDSNDLVCPCGKTVVPAPVRCGTVLPRCLHPCIKTLQGXXXXXXX 516
           C+RKCHPG C PCLESD NDLVCPCGKTVV APVRCGT LP C + CI  ++        
Sbjct: 478 CQRKCHPGRCPPCLESDPNDLVCPCGKTVVEAPVRCGTKLPPCPYSCISVVRDGYPCGHT 537

Query: 517 XXXXXXXXXXXXXXSCTAPVFKSCKCRKNDKVRTLCFQNDVSCGRVCGKQLAGCQHICQK 576
                          CTA V K CKC K   VRTLCFQ DVSCG++C K L  C+H CQK
Sbjct: 538 PMPHLCHPPEEKCPPCTANVKKPCKCGKKSDVRTLCFQQDVSCGQICNKPLGSCRHTCQK 597

Query: 577 ACHKEGECQTSCKQPCGKTRENCEHRCRALCHSGTPCPDKPCLNLVDIKCNCGHRSTTVT 636
            CH +G CQ  C+Q CGK R NC+H+C   CH G PCPD PC   V IKC CG + +T  
Sbjct: 598 KCH-DGGCQVKCRQICGKKRVNCDHKCPKPCHGGEPCPDFPCPFSVVIKCACGRKESTEP 656

Query: 637 CGANENRAPAEET-ALECNNDCDVARRHHELMEAFGIKNDANQGSKSLEDLEALAEKVST 695
           CG N     A  T  L C+ +C+  +R  +L +A G+K +   G  S+E+  + A   S 
Sbjct: 657 CGTNSQTLSASVTRELSCDEECERVKRCAQLKDALGLKEN---GDSSVENTVSNALVASN 713

Query: 696 FQELLLPFSEATLSIFSKQTTWCTQIEECLERLMNDKNKPSLHFKPMRPPQRHFIHELGQ 755
           F+EL LPF E  L+I+S+Q  +C  IE  L   ++D+ K SLHFKPM+P QRHF+HEL +
Sbjct: 714 FEELGLPFRETVLAIYSRQQRYCDNIESVLNNFIDDEKKSSLHFKPMKPAQRHFVHELAK 773

Query: 756 AYHLYCESQDQEPKRSVFVKK--TADSQRPSISLKVALPLYYSFKSAQREKKLKETERHT 813
           AY LY ESQD EPKRSV+VKK    +S +PSI+L+ ALP+Y +FK  ++E K++  E   
Sbjct: 774 AYKLYSESQDPEPKRSVYVKKELNGESNKPSITLQEALPIYQAFKQREKETKIRRYEMQN 833

Query: 814 TTRIINYAVTDQAQTPPAARFNGLLVQNVLNGINEKAIQESFSEYLKHTLLKDPHYLLLA 873
            T ++N+ V     T   A++NG L++N+ +G N + +Q  + E+LK TL+++P Y  L 
Sbjct: 834 VTNLVNF-VPKFEPTVELAKYNGFLIRNLTDGTNGEDLQRIYGEHLKPTLVRNPVYKALP 892

Query: 874 SGDV-LVYCDDYSTASVNVENDIERIVGHLDHIVKEQLLAEGVYATRVQSFL 924
             ++ L++ + YS  +VN E D+ER+VGH D I KE  + +GV   +V  +L
Sbjct: 893 DRNIALIFPESYSDVTVNTECDMERLVGHFDFICKEMFIGDGVELCQVGEYL 944

>TBLA0B05950 Chr2 (1404509..1407496) [2988 bp, 995 aa] {ON}
           Anc_2.288 YNL023C
          Length = 995

 Score =  941 bits (2431), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 473/915 (51%), Positives = 602/915 (65%), Gaps = 19/915 (2%)

Query: 41  EDQPYYEKTVKEIEKGDRYPCMICTVEMDFTCHMYACPDCYRVFDFECIREWALKSTQKS 100
           ED  YYE+ V+EI KGD Y CMICTVEMD TC MYAC  CYRVFD++CIREWALKSTQK+
Sbjct: 67  EDLMYYERAVREIAKGDSYQCMICTVEMDHTCKMYACRHCYRVFDYDCIREWALKSTQKT 126

Query: 101 VSKTWKCPNCYFERKEVPMKNRPTCWCGKSVQPEPNPLNPNSCGQTCDAQICEHGCSSIC 160
           V KTWKCPNCY   K+VP+K+RPTCWCGK V P+PNPL+PNSCGQTC+A IC H C   C
Sbjct: 127 VDKTWKCPNCYHSSKKVPLKDRPTCWCGKVVNPDPNPLDPNSCGQTCNANICPHKCLKQC 186

Query: 161 HLGPHPTCMRMVQVKCNCGKKNKSVFCHEAGKFVDSFICDSPCGLTLPCGIHKCQRKCHS 220
           HLG HP C +++++ C CG++ K ++CHE+ +    F CD  CGLTLPCGIHKC+RKCHS
Sbjct: 187 HLGSHPECTQLLKITCRCGRETKDIYCHESRRQKSIFHCDQECGLTLPCGIHKCRRKCHS 246

Query: 221 GICGECPE-----SIYGTINCYCKLESKPSLKCTEVRIEGR---SRDSSGNKWVGAFSCE 272
           G+CG CPE     ++ G I CYC L S   + C +V        SR+    +WVG F C+
Sbjct: 247 GLCGSCPELLIDENVSGKIKCYCGLHSLKEMNCKDVAFPSSGKISRNQEDKEWVGIFDCK 306

Query: 273 NIRTVEHSCKKHSFAEPCKAPPSISGQVPCPFSPRTLKTCPCGRSPLREMDVSRSQCTDP 332
            +R+V ++C +H F E C APP++   V CPFSP  LKTCPCG++ L++MD  R++CTDP
Sbjct: 307 EMRSVSYTCNEHVFVEGCIAPPTLPSTVVCPFSPNLLKTCPCGKTALQDMDCERTKCTDP 366

Query: 333 IPTCDSVCGKMLRCGKHKCPFKCHTGSCMEECLCTDKVKCSCHARQFIVPCKFQEKARCN 392
           IPTCD+VC K+L+CGKH+CPF CHTG CM+ C+  DK+ C+C  R F+VPC+F+ K  C 
Sbjct: 367 IPTCDNVCNKILKCGKHRCPFTCHTGKCMDPCIQIDKMDCACERRTFLVPCQFKGKPVCK 426

Query: 393 TKCEALMSCRRHRCIERCCDGRSLAQSREKKVFLTRDKLDESLVEAQHICLKQCNLKLSC 452
            KCE+LMSCRRHRC+E CC GR  A+ R+K +  + D+ DE+LVEA+H+CLK CNLKLSC
Sbjct: 427 FKCESLMSCRRHRCMEYCCSGRPYAERRKKTILRSSDRNDETLVEAEHVCLKDCNLKLSC 486

Query: 453 GKHFCKRKCHPGNCAPCLESDSNDLVCPCGKTVVPAPVRCGTVLPRCLHPCIKTLQGXXX 512
           G H C+RKCHPG C PCLESDSNDLVCPCGKTV+PAPVRCGT LP C +PCIK ++G   
Sbjct: 487 GIHTCQRKCHPGPCPPCLESDSNDLVCPCGKTVIPAPVRCGTTLPPCKYPCIKVIRGESD 546

Query: 513 XXXXXXXXXXXXXXXXXXSCTAPVFKSCKCRKNDKVRTLCFQNDVSCGRVCGKQLAGCQH 572
                              CTAPVFK CKC K DKVRT+CFQ DVSCG  CG  L  C H
Sbjct: 547 CGHKPMPHSCHSLDQPCPVCTAPVFKPCKCGKKDKVRTMCFQEDVSCGLPCGLPLKDCYH 606

Query: 573 ICQKACHKEGECQTSCKQPCGKTRENCEHRCRALCHSGTPCPDKPCLNLVDIKCNCGHRS 632
            CQK CH  GECQ +C Q C   R NC H C   CH   PCPD PC   V + C+CG R 
Sbjct: 607 KCQKRCHLPGECQNTCIQICNAKRSNCSHGCTQRCHKNAPCPDIPCTVPVTVVCDCGRRK 666

Query: 633 TTVTCGANENRAPAEETA-LECNNDCDVARRHHELMEAFGIKNDA--NQGSKSLEDLEAL 689
               C +         T+ LEC+ +C +  R  EL  AFGI N    ++ S ++E ++  
Sbjct: 667 LVKPCSSTSTIDSVTITSHLECDEECMLLLRRMELKAAFGIVNGLGDDKTSVAIERIQNR 726

Query: 690 AEKVSTFQELLLPFSEATLSIFSKQTTWCTQIEECLERLMNDKNKPSLHFKPMRPPQRHF 749
                 ++EL LPF EA L++++KQ  WC+QIE  L + M++K K SLHFK M+ PQR F
Sbjct: 727 ISVAKAYEELELPFVEAVLTVYAKQPKWCSQIEGILNKFMDEKLKSSLHFKHMKAPQRSF 786

Query: 750 IHELGQAYHLYCESQDQEPKRSVFVKKTAD--SQRPSISLKVALPLYYSFKSAQREKKLK 807
           +H L  AY +Y ESQD EP RSVFVKK  +  S +P ++L+ ALPLY SFK  Q+EKK +
Sbjct: 787 VHNLADAYKIYSESQDPEPVRSVFVKKLTNGTSSKPILTLEEALPLYESFKEVQKEKKKQ 846

Query: 808 ETERHTTTRIINYAVTDQAQTPPAARFNGLLVQNVLNGINEKAIQESFSEYLKHTLLKDP 867
           E E  T   +IN     Q Q   A ++NG L++N++ G  E+ ++  F E LK TL+KDP
Sbjct: 847 EYEARTHKTLINVEAETQTQQ-SATKYNGFLIKNLVKGTTEEDLERIFGESLKPTLVKDP 905

Query: 868 HYLLLASGDVLVYC-DDYSTASVNVENDIERIVGHLDHIVKEQLLAEGVYATRVQSFL-- 924
            YL++        C  DY+  S+NVE D+E+++G  D + KE  + + V    +   L  
Sbjct: 906 QYLVMDESHHGFICPADYAEISINVERDMEQLIGFFDSLCKEHFIGDIVELCNIDEALLQ 965

Query: 925 --DDLESSTSDAATS 937
              DLE S  +  TS
Sbjct: 966 ENVDLEDSEEEKLTS 980

>CAGL0M06919g Chr13 complement(703702..706572) [2871 bp, 956 aa]
           {ON} similar to uniprot|P53971 Saccharomyces cerevisiae
           YNL023c FAP1
          Length = 956

 Score =  931 bits (2406), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 472/898 (52%), Positives = 592/898 (65%), Gaps = 14/898 (1%)

Query: 41  EDQPYYEKTVKEIEKGDRYPCMICTVEMDFTCHMYACPDCYRVFDFECIREWALKSTQKS 100
           +D  YYEK V+EI KGD Y C+ICTVE+D+TC +YAC  CYRV+D+ECIREWA KST K 
Sbjct: 57  KDMAYYEKAVQEIVKGDSYSCLICTVELDYTCKLYACEKCYRVYDYECIREWAEKSTSKR 116

Query: 101 VSKTWKCPNCYFERKEVPMKNRPTCWCGKSVQPEPNPLNPNSCGQTCDAQICEHGCSSIC 160
             K W CPNC++ +K +P KNRPTCWCG+ V PEPNPLNPNSCGQTC+A+IC HGCS IC
Sbjct: 117 TDKLWACPNCFYTKKAIPKKNRPTCWCGEQVNPEPNPLNPNSCGQTCNAKICSHGCSQIC 176

Query: 161 HLGPHPTCMRMVQVKCNCGKKNKSVFCHEAGKFVDSFICDSPCGLTLPCGIHKCQRKCHS 220
           HLGPH  C RM+ +KC+CGK  K + C +   +   F C++ C   LPCGIHKC RKCH+
Sbjct: 177 HLGPHQECTRMMSIKCSCGKVTKDIVCFQRRLYSKGFNCETVCDKLLPCGIHKCNRKCHT 236

Query: 221 GICGECPESIYG-----TINCYCKLESKPSLKCTEVRIEGR---SRDSSGNKWVGAFSCE 272
           G+CG CPE+I        I CYC   SK  +KC +VR       S+D  G +W+G F C+
Sbjct: 237 GLCGSCPETIISKNTNMKIRCYCGQTSKDKIKCKDVRFPANAAYSKDDKGQRWIGVFMCD 296

Query: 273 NIRTVEHSCKKHSFAEPCKAPPSISGQVPCPFSPRTLKTCPCGRSPLREMDVSRSQCTDP 332
            IR V + C +HSF E CKAPPSISG++ C FSP+ LKTCPCG++ L ++   RS+CTD 
Sbjct: 297 KIRKVPYECGEHSFYEKCKAPPSISGRLICEFSPKKLKTCPCGKNELTDLSKPRSKCTDA 356

Query: 333 IPTCDSVCGKMLRCGKHKCPFKCHTGSCMEECLCTDKVKCSCHARQFIVPCKFQEKARCN 392
           IPTC  VCGKML+CGKHKCPF CH G CM+ C   +KV+C+C  +QF +PC F + ARCN
Sbjct: 357 IPTCGQVCGKMLKCGKHKCPFACHLGDCMDPCTQIEKVRCACEQKQFTIPCGFNDHARCN 416

Query: 393 TKCEALMSCRRHRCIERCCDGRSLAQSREKKVFL-TRDKLDESLVEAQHICLKQCNLKLS 451
            KCE+LMSCRRHRC ERCC GR LA+ R K + +  RD  DES +E  HICLK CNL LS
Sbjct: 417 LKCESLMSCRRHRCTERCCAGRPLAERRRKTMKINVRDLADESTIEPIHICLKDCNLTLS 476

Query: 452 CGKHFCKRKCHPGNCAPCLESDSNDLVCPCGKTVVPAPVRCGTVLPRCLHPCIKTLQGXX 511
           CG H C RKCH G C PCLESDSNDLVCPCGKT+V APVRCGT LP C +PCI+ ++G  
Sbjct: 477 CGIHKCNRKCHAGKCPPCLESDSNDLVCPCGKTIVEAPVRCGTKLPNCPYPCIRVVRGET 536

Query: 512 XXXXXXXXXXXXXXXXXXXSCTAPVFKSCKCRKNDKVRTLCFQNDVSCGRVCGKQLAGCQ 571
                               CTA VFK CKC K  +VRT+CF  DVSCG+VCG++L  C 
Sbjct: 537 DCGHSPMPHECHPPDIPCPDCTATVFKPCKCGKEQRVRTVCFMKDVSCGKVCGERLQTCY 596

Query: 572 HICQKACHKEGECQTSCKQPCGKTRENCEHRCRALCHSGTPCPDKPCLNLVDIKCNCGHR 631
           H CQK CH+ G CQT CKQ C   R  C HRC   CH    CPD PC  LV I C CG  
Sbjct: 597 HKCQKKCHEPGACQTVCKQTCNMPRLYCNHRCPKPCHKFEECPDIPCTALVKITCPCGRI 656

Query: 632 STTVTCGA-NENRAPAEETALECNNDCDVARRHHELMEAFGIKND-ANQGSKSLEDLEAL 689
              VTCG  ++N+   + T + C+ +C V +RH +L EAFGI +   N  ++ +  LE +
Sbjct: 657 EKEVTCGVYSKNKEAQDSTRIVCDEECAVLQRHMQLKEAFGIVDKPQNTHNEEMARLEQV 716

Query: 690 AEKVSTFQELLLPFSEATLSIFSKQTTWCTQIEECLERLMNDKNKPSLHFKPMRPPQRHF 749
               STF +L LPF+E  ++ + +   WCT IE  L +L++D N+ SLHFKPMRPPQR+F
Sbjct: 717 ISTASTFADLDLPFTEPVITTYIRHENWCTDIENTLNKLIDDNNRTSLHFKPMRPPQRYF 776

Query: 750 IHELGQAYHLYCESQDQEPKRSVFVKKTAD--SQRPSISLKVALPLYYSFKSAQREKKLK 807
           I EL +AY+LY ESQD EP RSVFVKK  D  S +P +S+  A PLY S+K  ++EKK  
Sbjct: 777 IRELAKAYNLYSESQDPEPNRSVFVKKNLDGSSTKPILSISEAAPLYQSYKKLEKEKKQA 836

Query: 808 ETERHTTTRIINYAVTDQAQTPPAARFNGLLVQNVLNGINEKAIQESFSEYLKHTLLKDP 867
             E  TTTR+IN+      +   AARFNG LV NV    +   +Q  F+ YLK TL+ +P
Sbjct: 837 NFESMTTTRLINFTPEMSPELESAARFNGFLVTNVGEFTSTDDLQNLFAPYLKSTLVVEP 896

Query: 868 HYLLLAS-GDVLVYCDDYSTASVNVENDIERIVGHLDHIVKEQLLAEGVYATRVQSFL 924
            + +L      ++Y + Y   S+NVE D+E +V H D ++KE LLA GV    +++ L
Sbjct: 897 QFQILPERKQAVIYPNKYKEISINVERDMETLVQHFDFLIKESLLAGGVELCNIENVL 954

>Kpol_1039.45 s1039 (135833..138739) [2907 bp, 968 aa] {ON}
           (135833..138739) [2907 nt, 969 aa]
          Length = 968

 Score =  912 bits (2356), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 462/906 (50%), Positives = 589/906 (65%), Gaps = 9/906 (0%)

Query: 41  EDQPYYEKTVKEIEKGDRYPCMICTVEMDFTCHMYACPDCYRVFDFECIREWALKSTQKS 100
           ED  +YE+ +K+I KGD Y CMICT+E+D T  MYAC  CYRVFD++CIREWA+KS+QKS
Sbjct: 64  EDLMHYERAIKDIAKGDFYTCMICTIELDSTSKMYACSHCYRVFDYDCIREWAVKSSQKS 123

Query: 101 VSKTWKCPNCYFERKEVPMKNRPTCWCGKSVQPEPNPLNPNSCGQTCDAQICEHGCSSIC 160
           + K WKCPNC     ++P++NRPTCWCGK+V P+PNP  PNSCGQTC+A+ C H CS  C
Sbjct: 124 LDKVWKCPNCNHTSNKIPLQNRPTCWCGKTVNPDPNPFYPNSCGQTCNAKSCIHRCSHFC 183

Query: 161 HLGPHPTCMRMVQVKCNCGKKNKSVFCH--EAGKFVDS-FICDSPCGLTLPCGIHKCQRK 217
           HLGPHP C R   + C CGK  K VFC+  + GK  +  F C   C +TL CGIHKC R 
Sbjct: 184 HLGPHPQCHRTTTIHCECGKHTKDVFCYLLDHGKNRNKKFNCGEKCNMTLSCGIHKCSRV 243

Query: 218 CHSGICGECPESIYGTINCYCKLESKPSLKCTEVRIEG---RSRDSSGNKWVGAFSCENI 274
           CHSG CG CPE I   +NCYC   +   ++C+ V+I     +S+D  GN W+G F C  I
Sbjct: 244 CHSGSCGPCPELITKKVNCYCGSTTMDKIRCSNVKIHDSGKKSKDQEGNTWIGVFKCNKI 303

Query: 275 RTVEHSCKKHSFAEPCKAPPSISGQVPCPFSPRTLKTCPCGRSPLREMDVSRSQCTDPIP 334
           RTVE++CK HSF E C +PP+ISG   CP+SP+ LKTCPCG++ L + +  R +CTDPI 
Sbjct: 304 RTVEYACKNHSFFETCTSPPTISGTKICPYSPKLLKTCPCGKTNLDDFENKRQKCTDPIS 363

Query: 335 TCDSVCGKMLRCGKHKCPFKCHTGSCMEECLCTDKVKCSCHARQFIVPCKFQEKARCNTK 394
           TC++ C K L+CGKHKCPF CH G CM+ C   +  KCSC+ ++F VPC+F EK RCN K
Sbjct: 364 TCENRCDKPLKCGKHKCPFTCHNGPCMDPCTQIELRKCSCNYKEFSVPCQFHEKPRCNMK 423

Query: 395 CEALMSCRRHRCIERCCDGRSLAQSREKKVFLTRDKLDESLVEAQHICLKQCNLKLSCGK 454
           CE+LMSCRRHRC  RCC G+ +A  R+K +F   D LDESLVEA+HICLK CNLKLSCG 
Sbjct: 424 CESLMSCRRHRCTRRCCSGKPMADKRKKMLFSQADLLDESLVEAEHICLKDCNLKLSCGI 483

Query: 455 HFCKRKCHPGNCAPCLESDSNDLVCPCGKTVVPAPVRCGTVLPRCLHPCIKTLQGXXXXX 514
           H C RKCH G C PCLESDS+DLVCPCGKTVV APVRCGT LP C+ PCIK ++G     
Sbjct: 484 HNCTRKCHAGKCPPCLESDSSDLVCPCGKTVVEAPVRCGTKLPECIFPCIKYIEGSYPCG 543

Query: 515 XXXXXXXXXXXXXXXXSCTAPVFKSCKCRKNDKVRTLCFQNDVSCGRVCGKQLAGCQHIC 574
                            CT  VFK CKC K  K + LCFQ   SCG++C K+L GC H C
Sbjct: 544 HKPGNHYCHPADIPCPPCTEVVFKPCKCGKEQKAKALCFQETASCGKLCEKKLDGCHHYC 603

Query: 575 QKACHKEGECQTSCKQPCGKTRENCEHRCRALCHSGTPCPDKPCLNLVDIKCNCGHRSTT 634
           Q  CH  GECQ  C Q C K R NC H C   CH  + CPD PC    ++ C CG R   
Sbjct: 604 QLKCHLPGECQKKCTQICNKRRVNCSHTCDQKCHGDSNCPDIPCKVKCEVYCGCGRRKEL 663

Query: 635 VTCGANENRAPAEET-ALECNNDCDVARRHHELMEAFGIKNDANQGSKSLEDLEALAEKV 693
           + CGA       E T  L C++ C   +R  EL  AFG+K+ +      LE L+ + EKV
Sbjct: 664 LLCGATSTTQSVELTKVLPCDDACLKYQRLEELRNAFGMKSSSEDPESELERLKKIVEKV 723

Query: 694 STFQELLLPFSEATLSIFSKQTTWCTQIEECLERLMNDKNKPSLHFKPMRPPQRHFIHEL 753
           ++++EL LPFSE  LS++SKQT WC QIEE + + +NDKNKPSLHFKPM  PQR+FIH L
Sbjct: 724 TSYEELELPFSETVLSVYSKQTNWCNQIEELINKFVNDKNKPSLHFKPMPAPQRNFIHAL 783

Query: 754 GQAYHLYCESQDQEPKRSVFVKKTADSQRPSISLKVALPLYYSFKSAQREKKLKETERHT 813
            +AY +Y ESQD+EPKRSV++KK   ++ P+ISL+ ALPLY S+K  ++E+K++  E   
Sbjct: 784 VEAYEMYSESQDREPKRSVYLKKNKYTRIPNISLEEALPLYQSYKKIEKERKVQSFESKK 843

Query: 814 TTRIINYAVTDQAQTPPAARFNGLLVQNVLNGINEKAIQESFSEYLKHTLLKDPHYLLLA 873
               +NY   +++ T P  ++NG L++ +  G     +   F  +LK TL+KD  Y +L 
Sbjct: 844 NVTYLNYQPPERSLT-PDVKYNGFLIKGITFGTTTDDLNTLFGVHLKPTLIKDAQYSILP 902

Query: 874 SG-DVLVYCDDYSTASVNVENDIERIVGHLDHIVKEQLLAEGVYATRVQSFLDDLESSTS 932
            G   +VY  DY T S NVE DIE + GH D++ KE +L E V    +   L    +  S
Sbjct: 903 DGKSAIVYPKDYLTISENVERDIESLAGHFDYMTKEAMLGESVEMCNITDILQTESAEPS 962

Query: 933 DAATSI 938
           +  T++
Sbjct: 963 EETTTV 968

>TPHA0D01530 Chr4 complement(313063..315951) [2889 bp, 962 aa] {ON}
           Anc_2.288 YNL023C
          Length = 962

 Score =  882 bits (2278), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 429/924 (46%), Positives = 601/924 (65%), Gaps = 23/924 (2%)

Query: 38  DELEDQPYYEKTVKEIEKGDRYPCMICTVEMDFTCHMYACPDCYRVFDFECIREWALKST 97
           DE +   YYE+T+++I KGDRY CMICT+EMD+TC MYAC  CYRVFD+ECI+EWA KS 
Sbjct: 40  DEDDGLVYYEQTIRDISKGDRYTCMICTIEMDYTCKMYACQSCYRVFDYECIQEWAEKSA 99

Query: 98  QKSVSKTWKCPNCYFERKEVPMKNRPTCWCGKSVQPEPNPLNPNSCGQTCDAQICEHGCS 157
            K++ K WKCPNC    K++P++NRPTCWCGK + P+PN L+PNSCGQTC+ + C HGC 
Sbjct: 100 SKTIDKVWKCPNCSHSSKQIPLRNRPTCWCGKVINPDPNELSPNSCGQTCNKKTCVHGCK 159

Query: 158 SICHLGPHPTCMRMVQVKCNCGKKNKSVFCHEAGKFV--DSFICDSPCGLTLPCGIHKCQ 215
           + CHLGPH  C  +  +KC CG+  K +FCH+  K    + + C+  C L L CG+HKC+
Sbjct: 160 NFCHLGPHGECSVITTLKCKCGRNEKDIFCHQLKKSNKNNVYQCNEVCQLPLACGVHKCK 219

Query: 216 RKCHSGICGECPESIYG------------TINCYCKLESKPSLKCTEVRIEGR-SRDSSG 262
           R CHSG+CG CPE +                 CYC   SK  + C ++ I G  S++S G
Sbjct: 220 RVCHSGLCGACPEILSSEQIQSVESNENRKFKCYCGENSKNEIMCKKLAITGTFSKNSEG 279

Query: 263 NKWVGAFSCENIRTVEHSCKKHSFAEPCKAPPSISGQVPCPFSPRTLKTCPCGRSPLREM 322
           +KW+G F+C+  R V ++C +HSF EPC+A  SISG+  CP++P+ L +CPCG++ L+++
Sbjct: 280 DKWIGTFACKTRRIVFYACNEHSFIEPCQAQLSISGKKICPYTPKLLNSCPCGKTSLKQL 339

Query: 323 DVSRSQCTDPIPTCDSVCGKMLRCGKHKCPFKCHTGSCMEECLCTDKVKCSCHARQFIVP 382
              R +CTDPIPTC++ CGK L+CGKH CP+ CH GSCM+ C+  +   CSC  + F+VP
Sbjct: 340 AQKRKKCTDPIPTCENRCGKALKCGKHTCPYICHNGSCMDPCIQLEVTNCSCLQKHFLVP 399

Query: 383 CKFQEKARCNTKCEALMSCRRHRCIERCCDGRSLAQSREKKVFLTRDKL-DESLVEAQHI 441
           C F++  +C  KCE+LMSCRRHRC ++CC G+  A  R KK+ LTR++L DESLVEA HI
Sbjct: 400 CNFEQTPKCTFKCESLMSCRRHRCPKKCCTGKPEADKR-KKMLLTREELNDESLVEAVHI 458

Query: 442 CLKQCNLKLSCGKHFCKRKCHPGNCAPCLESDSNDLVCPCGKTVVPAPVRCGTVLPRCLH 501
           CLK+CNLKLSCG H C RKCHPG C  CL SDSNDLVCPCGKTV+ APVRCG+ LP C  
Sbjct: 459 CLKECNLKLSCGIHDCTRKCHPGRCPSCLISDSNDLVCPCGKTVIEAPVRCGSKLPPCPF 518

Query: 502 PCIKTLQGXXXXXXXXXXXXXXXXXXXXXSCTAPVFKSCKCRKNDKVRTLCFQNDVSCGR 561
            CIK ++                       CTA V + CKC K+  V+ +CFQ   SCG 
Sbjct: 519 ECIKVIERSYPCGHKPPPHQCHPSTEPCPPCTAVVERPCKCGKHHAVKAVCFQEFGSCGE 578

Query: 562 VCGKQLAGCQHICQKACHKEGECQTSCKQPCGKTRENCEHRCRALCHSGTPCPDKPCLNL 621
           +C K+L  C H CQ  CH+ G+CQ SCKQ C K R NC H+C++ CH  +PCPD PC  +
Sbjct: 579 ICNKELENCHHKCQYKCHEIGQCQKSCKQVCNKDRANCNHQCKSKCHGSSPCPDVPCNEV 638

Query: 622 VDIKCNCGHRSTTVTCGANENRAPAEETALECNNDCDVARRHHELMEAFGIKNDANQGSK 681
             + C CG +     C A  + + A    L C+ DC+   RH +L +AFG  +  +  +K
Sbjct: 639 TKVSCKCGRKQEYRKCYATLDNSSASIELLPCDEDCEAHARHLQLRDAFGYDSSLDTSNK 698

Query: 682 SLEDLEALAEKVSTFQELLLPFSEATLSIFSKQTTWCTQIEECLERLMNDKNKPSLHFKP 741
           +++D+++L EKVST++EL LP+ ++ +S +SKQ  WC+QIE+ L + + DK K +LHFKP
Sbjct: 699 NIQDIQSLMEKVSTYEELRLPYPQSVISTYSKQIKWCSQIEDILRKFVLDKAKNNLHFKP 758

Query: 742 MRPPQRHFIHELGQAYHLYCESQDQEPKRSVFVKKTADSQRPSISLKVALPLYYSFKSAQ 801
           M+P QRHF+ EL  +++LY ESQD EPKRSVFVK+  D++ P+ISL+  LPL+  FK  +
Sbjct: 759 MKPAQRHFVRELSTSFNLYSESQDPEPKRSVFVKRKVDTRIPNISLEEVLPLWTGFKKLE 818

Query: 802 REKKLKETERHTTTRIINYAVTDQAQTPPAARFNGLLVQNVLNGINEKAIQESFSEYLKH 861
           +E+K++  E  +  + INY    +     +   NG  ++ +  GI E+ + E F + LK 
Sbjct: 819 KERKIQHFESTSQRKYINYE-PKEVIVKSSNDTNGFFIKKISPGITEEDLSEVFGKALKS 877

Query: 862 TLLKDPHYLLL-ASGDVLVYCDDYSTASVNVENDIERIVGHLDHIVKEQLLAEGVYATRV 920
           TL+K+  Y +L  S D ++Y + Y++ + +V  D+E +VGH D I KE L+ + +    V
Sbjct: 878 TLIKNVCYKILPESSDAIIYPEQYNSITESVHQDLEVLVGHFDFIGKEALIFDSIMLCNV 937

Query: 921 QSFLDDL----ESSTSDAATSISN 940
           + +++ +    ++     +TS SN
Sbjct: 938 EGYINQISDCTDTDKEKDSTSTSN 961

>KLLA0E08317g Chr5 complement(747272..750037) [2766 bp, 921 aa] {ON}
           similar to uniprot|P53971 Saccharomyces cerevisiae
           YNL023C
          Length = 921

 Score =  870 bits (2248), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 429/886 (48%), Positives = 564/886 (63%), Gaps = 8/886 (0%)

Query: 44  PYYEKTVKEIEKGDRYPCMICTVEMDFTCHMYACPDCYRVFDFECIREWALKSTQKSVSK 103
           PYYE+TVKEI+ GD+Y CMICTVE+D TC MYAC  CYRVFD+EC+REWALKST K++ K
Sbjct: 33  PYYEQTVKEIKDGDQYVCMICTVELDSTCRMYACDSCYRVFDYECVREWALKSTNKTLDK 92

Query: 104 TWKCPNCYFERKEVPMKNRPTCWCGKSVQPEPNPLNPNSCGQTCDAQICEHGCSSICHLG 163
           +WKCPNCY    ++P + R TCWCGK V P+ N L+PNSCGQTC+A  C HGCS +CHLG
Sbjct: 93  SWKCPNCYKINHKIPKQKRSTCWCGKVVNPDVNELDPNSCGQTCNAYSCVHGCSKVCHLG 152

Query: 164 PHPTCMRMVQVKCNCGKKNKSVFCHEAGKFVDSFICDSPCGLTLPCGIHKCQRKCHSGIC 223
           PHP C+  VQ+KC CGK  K + C  +    +S+ C   CGL LPCG H CQ+ CH+G C
Sbjct: 153 PHPECLIPVQIKCKCGKHCKQIPCSRSKVLGNSYNCGDVCGLLLPCGKHTCQKTCHTGFC 212

Query: 224 GECPESIYGTINCYCKLESKPSLKCTEVRIEGRSRDSSGNKWVGAFSCENIRTVEHSCKK 283
           G C   I   + CYC  + K  ++C+++R+   S+D SG KW+G +SC  +RT+ +SC  
Sbjct: 213 GPCESIIKTELPCYCGSDVKSGIQCSDLRVLDYSKDVSGKKWIGVYSCGEVRTLHYSCDH 272

Query: 284 HSFAEPCKAPPSISGQVPCPFSPRTLKTCPCGRSPLREMDVSRSQCTDPIPTCDSVCGKM 343
           H++ E C AP  I    PCPFSP+TLKTCPCG++ L+E+D  R +CTD IPTC +VCGK 
Sbjct: 273 HTYVEQCLAPAGIDRSRPCPFSPKTLKTCPCGKTMLKELDKPRRKCTDTIPTCSNVCGKQ 332

Query: 344 LRCGKHKCPFKCHTGSCMEECLCTDKVKCSCHARQFIVPCKFQEKARCNTKCEALMSCRR 403
           L CGKH CPF CHTG CM+ CL   K  C+CH++ F+ PC+  +  RCN KCE+ MSCRR
Sbjct: 333 LSCGKHTCPFSCHTGDCMDPCLIITKTPCTCHSKTFLTPCQLHDTPRCNIKCESNMSCRR 392

Query: 404 HRCIERCCDGRSLAQSREKKVFLTRDKLDESLVEAQHICLKQCNLKLSCGKHFCKRKCHP 463
           H+C+E CC G+  A+ REK +FL RD  +E+LVE +H+CLKQCNLKLSCG H C  KCHP
Sbjct: 393 HKCMEICCSGKPAAKKREKTLFLKRDLNNETLVEPEHVCLKQCNLKLSCGIHDCTWKCHP 452

Query: 464 GNCAPCLESDSNDLVCPCGKTVVPAPVRCGTVLPRCLHPCIKTLQGXXXXXXXXXXXXXX 523
           G C PCLESD NDLVCPCGKTVVPAPVRCGT LP C +PCIK  +G              
Sbjct: 453 GKCPPCLESDPNDLVCPCGKTVVPAPVRCGTKLPPCPNPCIKISEGPAPCGHRVGPHKCH 512

Query: 524 XXXXXXXSCTAPVFKSCKCRKNDKVRTLCFQND--VSCGRVCGKQLAGCQHICQKACHKE 581
                   CTA V K C+C K   +RTLC   D  V+CG  CG  LA C H CQK CH E
Sbjct: 513 PAGTDCPPCTANVIKKCRCYKKHDMRTLCLVPDSQVACGTECGLPLATCHHKCQKKCHVE 572

Query: 582 GECQTSCKQPCGKTRENCEHRCRALCHSGTPCPDKPCLNLVDIKCNCGHRSTTVTCGANE 641
           GEC+  C +PCG  R  C H C+  CH  +PCP+K C   V I C+C  R+  V CGA  
Sbjct: 573 GECEIKCAKPCGLKRSLCGHLCKEKCHGNSPCPEKVCHEKVVITCDCNRRTKQVECGATH 632

Query: 642 NRAPAEET-ALECNNDCDVARRHHELMEAFGIKNDANQGSKSLEDLEALAEKVSTFQELL 700
           +     ET  L C+ +C   +RH ELMEAFG+        + LE +  +A+K   F +L 
Sbjct: 633 DTQSRSETEKLPCDEECAKLQRHMELMEAFGMNEKPKNTKEQLESIVLVAKK---FDDLN 689

Query: 701 LPFSEATLSIFSKQTTWCTQIEECLERLMNDKNKPSLHFKPMRPPQRHFIHELGQAYHLY 760
           +P+SE  L+++ KQ  WC QI    ++ + D  K SLH KPMR PQR FI EL  AY LY
Sbjct: 690 MPYSELVLNVYKKQVNWCDQICAVFDKFIEDTQKLSLHLKPMRVPQRQFIKELASAYALY 749

Query: 761 CESQDQEPKRSVFVKKT-ADSQRPSISLKVALPLYYSFKSAQREKKLKETERHTTTRIIN 819
            ESQD+EP RSV++KK  + S++P ++LK A  LY  FK+ ++E+  +      T  +IN
Sbjct: 750 SESQDREPNRSVYLKKIQSQSKKPELTLKDASELYQLFKTLEKERMQEHYSTKVTKTLIN 809

Query: 820 YAVTDQAQTPPAARFNGLLVQNVLNGINEKAIQESFSEYLKHTLLKDPHYLLLAS-GDVL 878
              ++     P    N +++  V +      I+    ++LK+TL+K P Y  L     VL
Sbjct: 810 IPASETPLPAPYEGPNAIVISGVFDSSQIDNIEPLVHDFLKYTLVKTPQYRFLKDLNSVL 869

Query: 879 VYCDDYSTASVNVENDIERIVGHLDHIVKEQLLAEGVYATRVQSFL 924
           ++ ++YS  + N  +D+E+++  +   +++Q+LA GV   +V   L
Sbjct: 870 IFPENYSGITKNTASDMEKVIPFIKTALQDQMLATGVEMCQVDENL 915

>ADL213W Chr4 (329646..332372) [2727 bp, 908 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL023C (FAP1)
          Length = 908

 Score =  867 bits (2239), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 430/899 (47%), Positives = 571/899 (63%), Gaps = 9/899 (1%)

Query: 39  ELEDQPYYEKTVKEIEKGDRYPCMICTVEMDFTCHMYACPDCYRVFDFECIREWALKSTQ 98
           +LE  PYYE+TV E+  G+ Y C+ICTVEMD +C MYAC  CYRV+D+ECIR WALK+T 
Sbjct: 12  KLEGIPYYEQTVLELRDGETYQCLICTVEMDASCPMYACHQCYRVYDYECIRRWALKATS 71

Query: 99  KSVSKTWKCPNCYFERKEVPMKNRPTCWCGKSVQPEPNPLNPNSCGQTCDAQICEHGCSS 158
            +V +TWKCPNCY   ++VP KNR TCWCGK V  +PN +NPNSCGQTC A IC+HGCS 
Sbjct: 72  TTVDRTWKCPNCYHVNRKVPPKNRHTCWCGKQVNLDPNYINPNSCGQTCGAPICQHGCSK 131

Query: 159 ICHLGPHPTCMRMVQVKCNCGKKNKSVFCHEAGKFVDSFICDSPCGLTLPCGIHKCQRKC 218
           +CHLGPH  CM  +  KC CGK  + + C+EA     +F CD PCGL +PCGIHKC+R C
Sbjct: 132 LCHLGPHEECMVRIDFKCRCGKLTEEIPCYEAKAAKRNFSCDQPCGLPMPCGIHKCERVC 191

Query: 219 HSGICGECPESIYGTINCYCKLESKPSLKCTEVRIEGRSRDSSGNKWVGAFSCENIRTVE 278
           H+G CG C E I G I CYC L ++  + C+EV +  RS+ S    W+GAF+C+ +R V 
Sbjct: 192 HNGPCGPCKEEIAGDIKCYCGLTTRNKMVCSEVSVVARSKVSKYKSWIGAFACDRMREVP 251

Query: 279 HSCKKHSFAEPCKAPPSISGQVPCPFSPRTLKTCPCGRSPLREMDVSRSQCTDPIPTCDS 338
           +SC KHSF E C APPS+  + PCP+SP    TCPCG++ L E+  +R+ CTD I +C  
Sbjct: 252 YSCGKHSFHEKCIAPPSLPKRTPCPYSPENCTTCPCGKTQLAELGSTRTACTDHISSCGK 311

Query: 339 VCGKMLRCGKHKCPFKCHTGSCMEECLCTDKVKCSCHARQFIVPCKFQEKARCNTKCEAL 398
           VCGK L CG H CP  CH G+CM+ CL   + KC+C  R+F+VPC+F     C  KCE+L
Sbjct: 312 VCGKQLSCGNHTCPMTCHDGNCMDPCLVITEQKCACEQRRFLVPCQFPHSPSCTAKCESL 371

Query: 399 MSCRRHRCIERCCDGRSLAQSREKKVFLTRDKLDESLVEAQHICLKQCNLKLSCGKHFCK 458
           MSCRRHRC ERCC GR  +  R  +        DES VEAQH+CLK CN  L CG H C 
Sbjct: 372 MSCRRHRCAERCCSGRPHSVKRNSRR-RRESPDDESEVEAQHVCLKDCNRVLLCGIHMCN 430

Query: 459 RKCHPGNCAPCLESDSNDLVCPCGKTVVPAPVRCGTVLPRCLHPCIKTLQGXXXXXXXXX 518
            KCH G C PCLESDSNDL+CPCGKT+VPAPVRCGT LPRC HPC  +L           
Sbjct: 431 YKCHAGKCPPCLESDSNDLICPCGKTIVPAPVRCGTKLPRCTHPCRNSLLDTWPCGHSPP 490

Query: 519 XXXXXXXXXXXXSCTAPVFKSCKCRKNDKVRTLCFQNDVSCGRVCGKQLAGCQHICQKAC 578
                        CT  V K+C+C KN+ +RT C+ +DVSC R C K L+ C H CQ  C
Sbjct: 491 SHNCHPLDEPCPPCTITVKKTCRCGKNE-IRTFCYNDDVSCSRPCKKPLSYCNHFCQVPC 549

Query: 579 HKEGECQTSCKQPCGKTRENCEHRCRALCHSGTPCPDKPCLNLVDIKCNCGHRSTTVTCG 638
           H +G+CQ +CKQ CG  R+ CEH C+A CH  T CP+ PC     I C+CGH+S+T  C 
Sbjct: 550 HSDGQCQQTCKQACGLPRKACEHVCKAKCHGHTACPESPCTEKKTITCSCGHKSSTKICS 609

Query: 639 --ANENRAPAEETALECNNDCDVARRHHELMEAFGIKNDANQGSKSLEDLEALAEKVSTF 696
             A ++        L C+ DC   +RH +LM AFG+     + +   ++   LA++  +F
Sbjct: 610 EYAGKDDGIGASQHLSCDEDCAKFQRHQQLMRAFGV---VEKATSEEDEALLLAQRSQSF 666

Query: 697 QELLLPFSEATLSIFSKQTTWCTQIEECLERLMNDKNKPSLHFKPMRPPQRHFIHELGQA 756
            +L LPF+E  LS+F+KQ+ WCTQIE+ L +LM+D +  +LHFKPMR  QR F+HEL  +
Sbjct: 667 DDLHLPFTEYVLSVFTKQSQWCTQIEQYLIKLMDDSSPKALHFKPMRAAQRRFVHELSSS 726

Query: 757 YHLYCESQDQEPKRSVFVKKTADSQRPSISLKVALPLYYSFKSAQREKKLKETERHTTTR 816
           + LY ESQD EPKRSV+VKKT  S+ P+I L  A PLY SFK  +RE K   +E   T +
Sbjct: 727 FGLYSESQDPEPKRSVYVKKTGISRVPAIGLSKAAPLYTSFKKLEREFK-ANSESAVTKK 785

Query: 817 IINYAVTDQAQTPPAARFNGLLVQNVLNGINEKAIQESFSEYLKHTLLKDPHYLLLASGD 876
           +++  + D  ++   A  N +L+  + +  +E A+++ F++Y   TLL  P Y++  + +
Sbjct: 786 LVSVHIDDSPESQHDAAINAILLSGLTSFASESALRDCFADYFSQTLLNCPQYVVRGT-E 844

Query: 877 VLVYCDDYSTASVNVENDIERIVGHLDHIVKEQLLAEGVYATRVQSFLDDLESSTSDAA 935
             ++  DY + S N E D+ ++ G+   + +EQ L   +   ++ S L+ + S  S AA
Sbjct: 845 GYIFPTDYLSLSANAEKDLTKLAGYFRLLFQEQNLWTDISTCKLDSNLNRIGSCESPAA 903

>Ecym_3327 Chr3 (626396..629176) [2781 bp, 926 aa] {ON} similar to
           Ashbya gossypii ADL213W
          Length = 926

 Score =  861 bits (2225), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 431/911 (47%), Positives = 564/911 (61%), Gaps = 8/911 (0%)

Query: 37  IDELEDQ--PYYEKTVKEIEKGDRYPCMICTVEMDFTCHMYACPDCYRVFDFECIREWAL 94
           + E +D   PYYEK +K+I+ G  Y C+ICTVE+D TC MYAC +CYRV+D+ECI EWA 
Sbjct: 20  LSEADDDGLPYYEKAIKDIQNGYLYQCLICTVEIDSTCRMYACSNCYRVYDYECIMEWAK 79

Query: 95  KSTQKSVSKTWKCPNCYFERKEVPMKNRPTCWCGKSVQPEPNPLNPNSCGQTCDAQICEH 154
           KS+++S   TWKCPNCY    +V  K R TCWCGK + PE N   PNSCGQTC A IC+H
Sbjct: 80  KSSKRSADSTWKCPNCYHSYNKVLPKKRSTCWCGKQINPEKNATYPNSCGQTCGASICKH 139

Query: 155 GCSSICHLGPHPTCMRMVQVKCNCGKKNKSVFCHEAGKFVDSFICDSPCGLTLPCGIHKC 214
           GC+S CHLGPHP CM  V +KC CGK  + + C++         C  PCGL LPCG+H C
Sbjct: 140 GCASTCHLGPHPKCMVPVGLKCKCGKITEQISCYQTKAVKPKLSCKLPCGLPLPCGVHTC 199

Query: 215 QRKCHSGICGECPESIYGTINCYCKLESKPSLKCTEVRIEGRSRDSSGNKWVGAFSCENI 274
           Q+ CHSG CG C   + G   CYC      S+ C +V +   SR     KW+G FSC+NI
Sbjct: 200 QKICHSGPCGRCNTVMSGKFKCYCGSNHLDSIICKDVAVTKMSRSGKHKKWIGVFSCKNI 259

Query: 275 RTVEHSCKKHSFAEPCKAPPSISGQVPCPFSPRTLKTCPCGRSPLREMDVSRSQCTDPIP 334
           R V + CK+HSF E CK  PS   ++ CP+SP   KTC CG + L +M   R +CTDPIP
Sbjct: 260 REVRYRCKEHSFNESCKPSPSPDARIQCPYSPNICKTCCCGNTTLIDMQQKREKCTDPIP 319

Query: 335 TCDSVCGKMLRCGKHKCPFKCHTGSCMEECLCTDKVKCSCHARQFIVPCKFQEKARCNTK 394
           TCD  CGK L CGKH CP  CH G CM+ CL  ++ KCSC  R F+ PC+F  K  CN K
Sbjct: 320 TCDQRCGKPLSCGKHTCPMTCHPGKCMDPCLQIEERKCSCQERTFLTPCQFDGKPSCNIK 379

Query: 395 CEALMSCRRHRCIERCCDGRSLAQSREKKVFLTRDKLDESLVEAQHICLKQCNLKLSCGK 454
           CE LMSCRRHRCI+RCC G+ LA +R   +    DK DESL+EA+HIC K CN KLSCG 
Sbjct: 380 CENLMSCRRHRCIKRCCSGKPLALARSSTITPWLDKNDESLIEAEHICFKNCNRKLSCGL 439

Query: 455 HFCKRKCHPGNCAPCLESDSNDLVCPCGKTVVPAPVRCGTVLPRCLHPCIKTLQGXXXXX 514
           H C  KCHPG C PCLESDSNDLVCPCGK+V+ APVRCGTV P C +PCI TL+G     
Sbjct: 440 HHCTNKCHPGKCPPCLESDSNDLVCPCGKSVILAPVRCGTVRPNCNYPCINTLRGSMPCG 499

Query: 515 XXXXXXXXXXXXXXXXSCTAPVFKSCKCRKNDKVRTLCFQNDVSCGRVCGKQLAGCQHIC 574
                            CTA V+K CKC K    RT+CFQND+SCGR C  +L  C H+C
Sbjct: 500 HRAPFHKCHPSTEDCPPCTAFVYKPCKCGKLTAARTICFQNDISCGRKCAAKLTNCHHLC 559

Query: 575 QKACHKEGECQTSCKQPCGKTRENCEHRCRALCHSGTPCPDKPCLNLVDIKCNCGHRSTT 634
           QK CH  GEC  +C + CG  R  CEH C A CH    CPD PCL  V + C CG RS  
Sbjct: 560 QKQCHPPGECPNTCTEVCGLKRSACEHLCTANCHGDEICPDVPCLEEVVVSCGCGRRSLK 619

Query: 635 VTCGANENRAPAEET-ALECNNDCDVARRHHELMEAFGIKNDANQGSKSLEDLEALAEKV 693
           V CGA +++  A  T +L C++DC   ++H  L++        N   K+     ++  K 
Sbjct: 620 VPCGAYKDKESATATQSLLCDDDCAKVQKHQMLLQTLRSSESTN---KAEHGSSSVINKP 676

Query: 694 STFQELLLPFSEATLSIFSKQTTWCTQIEECLERLMNDKNKPSLHFKPMRPPQRHFIHEL 753
           +++++L LP+SE  + +FSKQ TWC  I++ L RL+ DK++ SLHFKPM+ PQR F+HEL
Sbjct: 677 TSYEDLGLPYSEQMMCVFSKQATWCKNIQDSLIRLLEDKSRKSLHFKPMKAPQRQFVHEL 736

Query: 754 GQAYHLYCESQDQEPKRSVFVKKTADSQRPSISLKVALPLYYSFKSAQREKKLKETERHT 813
            +A+ LY ESQD+EPKRSVFVK    S+ P+I L  AL LY   K+ Q+E++  E + +T
Sbjct: 737 SKAFGLYSESQDREPKRSVFVKILKTSKIPAIGLSEALLLYQRMKTFQKERRDLELQHNT 796

Query: 814 TTRIINYAVTDQAQTPPA-ARFNGLLVQNVLNGINEKAIQESFSEYLKHTLLKDPHYLLL 872
           T  +I+  + D + +    A  N +L+  V   +  + I+  F E LK TLLKDP + L+
Sbjct: 797 TKILISIPIDDGSDSKTLEASCNAILITGVPRTVTVENIKACFDECLKQTLLKDPQFRLI 856

Query: 873 ASGDVLVYCDDYSTASVNVENDIERIVGHLDHIVKEQLLAEGVYATRVQSFLDDLESSTS 932
            S +  +Y  ++   S NVE DI+R+V +  H+ + + +   V A ++ +  +    + +
Sbjct: 857 NS-NAYIYPSNFLEISANVETDIQRLVPYFSHVCERKQIGYNVSAHKLTADFNKTSQALN 915

Query: 933 DAATSISNSEL 943
           ++  S  + + 
Sbjct: 916 NSFISTEDPDF 926

>CAGL0G07359g Chr7 complement(696455..698290) [1836 bp, 611 aa] {ON}
           similar to uniprot|P32500 Saccharomyces cerevisiae
           YML031w NDC1 nuclear envelope protein
          Length = 611

 Score = 35.4 bits (80), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 26/106 (24%), Positives = 50/106 (47%), Gaps = 10/106 (9%)

Query: 659 VARRHHELMEAFGIKNDANQGSKSLEDLEALAE-KVSTFQELLLPFSEA-------TLSI 710
           VAR+++  +++FG +ND       +  L++L    V T   +L+              SI
Sbjct: 76  VARKNYMHVQSFGYRNDITYVLGQVFSLKSLIFLAVYTMASVLVGLVLGGSVNISPAESI 135

Query: 711 FSKQTTWCTQ-IEECLERLMNDKNKPSLHFKP-MRPPQRHFIHELG 754
           +S+  TWC       ++ ++ D+++ S  F    +PPQ +   +LG
Sbjct: 136 YSRLLTWCVLPFFYTVQHILFDRDRLSFSFDSQFQPPQEYITSKLG 181

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.134    0.440 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 97,495,071
Number of extensions: 4111915
Number of successful extensions: 10862
Number of sequences better than 10.0: 70
Number of HSP's gapped: 9975
Number of HSP's successfully gapped: 77
Length of query: 953
Length of database: 53,481,399
Length adjustment: 119
Effective length of query: 834
Effective length of database: 39,836,145
Effective search space: 33223344930
Effective search space used: 33223344930
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 71 (32.0 bits)