Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_27.115132.289ON25125113230.0
KLTH0G10428g2.289ON2512519841e-135
NDAI0G006802.289ON2552547472e-99
CAGL0M06897g2.289ON2482437271e-96
Suva_14.3232.289ON2532437281e-96
NCAS0G03850singletonON2512447235e-96
NCAS0G037702.289ON2512447235e-96
SAKL0E07612g2.289ON2522507211e-95
Smik_14.3072.289ON2462427165e-95
KNAG0H019802.289ON2492447002e-92
YNL024C2.289ON2462436896e-91
Skud_14.3052.289ON2492426853e-90
KLLA0E08295g2.289ON2662456612e-86
KAFR0H032902.289ON2452476541e-85
Ecym_33282.289ON2542446491e-84
ADL212W2.289ON2512516481e-84
Skud_2.4031.325ON4171341633e-12
Smik_2.4141.325ON417931607e-12
KAFR0C042501.325ON3911481599e-12
YBR271W (EFM2)1.325ON4191461563e-11
Suva_4.5321.325ON4161401465e-10
CAGL0I09438g1.325ON4061531403e-09
KNAG0C018001.325ON4211001385e-09
NCAS0B074101.325ON4141511377e-09
NCAS0J021504.352ON3221741359e-09
KLLA0E21539g1.325ON400891369e-09
Kpol_1066.171.325ON4351191351e-08
SAKL0D06798g1.325ON4211131341e-08
NDAI0B047301.325ON4321441342e-08
NDAI0J028604.352ON3471791322e-08
KAFR0E042804.352ON3151731313e-08
TPHA0L003404.352ON3411451314e-08
ZYRO0G20548g1.325ON3971121281e-07
Smik_10.4224.352ON3401721271e-07
TDEL0D019401.325ON4051641271e-07
TPHA0I026501.325ON4211381243e-07
Kwal_47.166354.352ON3222031225e-07
Kwal_14.25501.325ON4181021201e-06
KLTH0H10560g1.325ON4171521201e-06
Suva_12.2204.352ON3371781191e-06
TBLA0D052001.325ON3991501154e-06
Skud_10.3524.352ON3362251128e-06
AER240W1.325ON3901241129e-06
Ecym_55131.325ON396881102e-05
KNAG0B067204.352ON2831451031e-04
YJR129C4.352ON3391361031e-04
CAGL0M00572g4.352ON3271781003e-04
Kpol_1028.814.352ON3361041004e-04
Ecym_11274.352ON320183985e-04
KLLA0B04444g4.352ON308147968e-04
SAKL0G18106g4.352ON335138920.003
ZYRO0B14916g4.352ON298140890.007
TDEL0D006404.352ON327102890.008
CAGL0M09801g6.79ON256180880.009
ZYRO0D14542g6.79ON263235850.018
KLTH0D17996g4.352ON317216860.020
Smik_12.3626.79ON284154820.057
AER161C4.352ON316141800.092
YDR326C (YSP2)5.370ON1438141750.54
Skud_4.5945.370ON1437138750.58
TBLA0B061504.352ON316139730.83
AGL019W8.72ON52356683.2
KNAG0H017601.418ON39174674.5
NDAI0B036802.259ON34644674.7
SAKL0F03960g7.166ON75457674.8
SAKL0A07986g6.79ON270193657.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_27.11513
         (251 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_27.11513 s27 complement(832028..832783) [756 bp, 251 aa] {O...   514   0.0  
KLTH0G10428g Chr7 (883191..883946) [756 bp, 251 aa] {ON} similar...   383   e-135
NDAI0G00680 Chr7 (150212..150979) [768 bp, 255 aa] {ON} Anc_2.28...   292   2e-99
CAGL0M06897g Chr13 complement(702211..702957) [747 bp, 248 aa] {...   284   1e-96
Suva_14.323 Chr14 complement(569944..570705) [762 bp, 253 aa] {O...   285   1e-96
NCAS0G03850 Chr7 (713255..714010) [756 bp, 251 aa] {ON}               283   5e-96
NCAS0G03770 Chr7 complement(694471..695226) [756 bp, 251 aa] {ON...   283   5e-96
SAKL0E07612g Chr5 complement(614835..615593) [759 bp, 252 aa] {O...   282   1e-95
Smik_14.307 Chr14 complement(549501..550241) [741 bp, 246 aa] {O...   280   5e-95
KNAG0H01980 Chr8 complement(348806..349555) [750 bp, 249 aa] {ON...   274   2e-92
YNL024C Chr14 complement(587107..587847) [741 bp, 246 aa] {ON} P...   270   6e-91
Skud_14.305 Chr14 complement(557846..558595) [750 bp, 249 aa] {O...   268   3e-90
KLLA0E08295g Chr5 complement(746166..746966) [801 bp, 266 aa] {O...   259   2e-86
KAFR0H03290 Chr8 complement(626525..627262) [738 bp, 245 aa] {ON...   256   1e-85
Ecym_3328 Chr3 (629428..630192) [765 bp, 254 aa] {ON} similar to...   254   1e-84
ADL212W Chr4 (332487..333242) [756 bp, 251 aa] {ON} Syntenic hom...   254   1e-84
Skud_2.403 Chr2 (713779..715032) [1254 bp, 417 aa] {ON} YBR271W ...    67   3e-12
Smik_2.414 Chr2 (730531..731784) [1254 bp, 417 aa] {ON} YBR271W ...    66   7e-12
KAFR0C04250 Chr3 (844020..845195) [1176 bp, 391 aa] {ON} Anc_1.3...    66   9e-12
YBR271W Chr2 (744852..746111) [1260 bp, 419 aa] {ON}  EFM2S-aden...    65   3e-11
Suva_4.532 Chr4 (916493..917743) [1251 bp, 416 aa] {ON} YBR271W ...    61   5e-10
CAGL0I09438g Chr9 (904886..906106) [1221 bp, 406 aa] {ON} simila...    59   3e-09
KNAG0C01800 Chr3 (352309..353574) [1266 bp, 421 aa] {ON} Anc_1.3...    58   5e-09
NCAS0B07410 Chr2 complement(1401275..1402519) [1245 bp, 414 aa] ...    57   7e-09
NCAS0J02150 Chr10 complement(415802..416770) [969 bp, 322 aa] {O...    57   9e-09
KLLA0E21539g Chr5 complement(1923103..1924305) [1203 bp, 400 aa]...    57   9e-09
Kpol_1066.17 s1066 complement(28462..29769) [1308 bp, 435 aa] {O...    57   1e-08
SAKL0D06798g Chr4 complement(564525..565790) [1266 bp, 421 aa] {...    56   1e-08
NDAI0B04730 Chr2 complement(1171595..1172893) [1299 bp, 432 aa] ...    56   2e-08
NDAI0J02860 Chr10 complement(713765..714808) [1044 bp, 347 aa] {...    55   2e-08
KAFR0E04280 Chr5 complement(864926..865873) [948 bp, 315 aa] {ON...    55   3e-08
TPHA0L00340 Chr12 (45910..46935) [1026 bp, 341 aa] {ON} Anc_4.35...    55   4e-08
ZYRO0G20548g Chr7 complement(1693797..1694990) [1194 bp, 397 aa]...    54   1e-07
Smik_10.422 Chr10 complement(653045..654067) [1023 bp, 340 aa] {...    54   1e-07
TDEL0D01940 Chr4 (376261..377478) [1218 bp, 405 aa] {ON} Anc_1.3...    54   1e-07
TPHA0I02650 Chr9 complement(580125..581390) [1266 bp, 421 aa] {O...    52   3e-07
Kwal_47.16635 s47 complement(37749..38717) [969 bp, 322 aa] {ON}...    52   5e-07
Kwal_14.2550 s14 complement(809874..811130) [1257 bp, 418 aa] {O...    51   1e-06
KLTH0H10560g Chr8 complement(912880..914133) [1254 bp, 417 aa] {...    51   1e-06
Suva_12.220 Chr12 complement(343489..344502) [1014 bp, 337 aa] {...    50   1e-06
TBLA0D05200 Chr4 complement(1278210..1279409) [1200 bp, 399 aa] ...    49   4e-06
Skud_10.352 Chr10 complement(622581..623591) [1011 bp, 336 aa] {...    48   8e-06
AER240W Chr5 (1080474..1081646) [1173 bp, 390 aa] {ON} Non-synte...    48   9e-06
Ecym_5513 Chr5 (1042019..1043209) [1191 bp, 396 aa] {ON} similar...    47   2e-05
KNAG0B06720 Chr2 complement(1329424..1330275) [852 bp, 283 aa] {...    44   1e-04
YJR129C Chr10 complement(664000..665019) [1020 bp, 339 aa] {ON} ...    44   1e-04
CAGL0M00572g Chr13 (68018..69001) [984 bp, 327 aa] {ON} similar ...    43   3e-04
Kpol_1028.81 s1028 (182083..183093) [1011 bp, 336 aa] {ON} (1820...    43   4e-04
Ecym_1127 Chr1 (260356..261318) [963 bp, 320 aa] {ON} similar to...    42   5e-04
KLLA0B04444g Chr2 (395811..396737) [927 bp, 308 aa] {ON} similar...    42   8e-04
SAKL0G18106g Chr7 complement(1569137..1570144) [1008 bp, 335 aa]...    40   0.003
ZYRO0B14916g Chr2 complement(1217570..1218466) [897 bp, 298 aa] ...    39   0.007
TDEL0D00640 Chr4 (113100..114083) [984 bp, 327 aa] {ON} Anc_4.35...    39   0.008
CAGL0M09801g Chr13 complement(970260..971030) [771 bp, 256 aa] {...    39   0.009
ZYRO0D14542g Chr4 (1231299..1232090) [792 bp, 263 aa] {ON} simil...    37   0.018
KLTH0D17996g Chr4 (1490856..1491809) [954 bp, 317 aa] {ON} simil...    38   0.020
Smik_12.362 Chr12 (645535..646389) [855 bp, 284 aa] {ON} YLR285W...    36   0.057
AER161C Chr5 complement(942007..942957) [951 bp, 316 aa] {ON} Sy...    35   0.092
YDR326C Chr4 complement(1120609..1124925) [4317 bp, 1438 aa] {ON...    33   0.54 
Skud_4.594 Chr4 complement(1056682..1060995) [4314 bp, 1437 aa] ...    33   0.58 
TBLA0B06150 Chr2 (1451595..1452545) [951 bp, 316 aa] {ON} Anc_4....    33   0.83 
AGL019W Chr7 (686017..687588) [1572 bp, 523 aa] {ON} Syntenic ho...    31   3.2  
KNAG0H01760 Chr8 (314375..315550) [1176 bp, 391 aa] {ON} Anc_1.4...    30   4.5  
NDAI0B03680 Chr2 complement(922452..923492) [1041 bp, 346 aa] {O...    30   4.7  
SAKL0F03960g Chr6 complement(317042..319306) [2265 bp, 754 aa] {...    30   4.8  
SAKL0A07986g Chr1 complement(707624..708436) [813 bp, 270 aa] {O...    30   7.5  

>Kwal_27.11513 s27 complement(832028..832783) [756 bp, 251 aa] {ON}
           YNL024C - Hypothetical ORF [contig 27] FULL
          Length = 251

 Score =  514 bits (1323), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 251/251 (100%), Positives = 251/251 (100%)

Query: 1   MTELLDFTTQFIDLVPSRPVEHLGDSDLSFGGQVEPALKIHEDGGENGCGGKLWVAGELL 60
           MTELLDFTTQFIDLVPSRPVEHLGDSDLSFGGQVEPALKIHEDGGENGCGGKLWVAGELL
Sbjct: 1   MTELLDFTTQFIDLVPSRPVEHLGDSDLSFGGQVEPALKIHEDGGENGCGGKLWVAGELL 60

Query: 61  CDYLLENSDAKGILSKRMVEMDVKAPFLNILELGSGTGLVGLCAGSVAQLHGDRTKVYIT 120
           CDYLLENSDAKGILSKRMVEMDVKAPFLNILELGSGTGLVGLCAGSVAQLHGDRTKVYIT
Sbjct: 61  CDYLLENSDAKGILSKRMVEMDVKAPFLNILELGSGTGLVGLCAGSVAQLHGDRTKVYIT 120

Query: 121 DIDRLVGLMETNVNLNHLAETVSVEILSWGEPLKEKFGPDAKADKVDLVLAADCVYLETA 180
           DIDRLVGLMETNVNLNHLAETVSVEILSWGEPLKEKFGPDAKADKVDLVLAADCVYLETA
Sbjct: 121 DIDRLVGLMETNVNLNHLAETVSVEILSWGEPLKEKFGPDAKADKVDLVLAADCVYLETA 180

Query: 181 FPLLEKTLLDLTEGDTPPAVLMSYRKRRKADKNFFRLIRKNFKIVPITNFIRYDYYLKKQ 240
           FPLLEKTLLDLTEGDTPPAVLMSYRKRRKADKNFFRLIRKNFKIVPITNFIRYDYYLKKQ
Sbjct: 181 FPLLEKTLLDLTEGDTPPAVLMSYRKRRKADKNFFRLIRKNFKIVPITNFIRYDYYLKKQ 240

Query: 241 THLFQLVRIPK 251
           THLFQLVRIPK
Sbjct: 241 THLFQLVRIPK 251

>KLTH0G10428g Chr7 (883191..883946) [756 bp, 251 aa] {ON} similar to
           uniprot|P53970 Saccharomyces cerevisiae YNL024C Putative
           S-adenosylmethionine-dependent methyltransferase of the
           seven beta-strand family
          Length = 251

 Score =  383 bits (984), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 186/251 (74%), Positives = 215/251 (85%)

Query: 1   MTELLDFTTQFIDLVPSRPVEHLGDSDLSFGGQVEPALKIHEDGGENGCGGKLWVAGELL 60
           M ELLDFT QF DLVPSRP+EH GDSDL+FGG++ PALKIHEDGGE+GCGGKLW+AGELL
Sbjct: 1   MAELLDFTAQFTDLVPSRPLEHFGDSDLTFGGRIFPALKIHEDGGESGCGGKLWIAGELL 60

Query: 61  CDYLLENSDAKGILSKRMVEMDVKAPFLNILELGSGTGLVGLCAGSVAQLHGDRTKVYIT 120
           C+YLLENSD  GILSK+M  +    PF+NILELGSGTGLVGLCAGS+A+ +G   KV+IT
Sbjct: 61  CEYLLENSDDNGILSKQMNLLGRDKPFVNILELGSGTGLVGLCAGSLARANGGNAKVHIT 120

Query: 121 DIDRLVGLMETNVNLNHLAETVSVEILSWGEPLKEKFGPDAKADKVDLVLAADCVYLETA 180
           DID+LV LME NV LN LA  VS E L WGEPLK +FGPDA ++K DLVLAADCVYLETA
Sbjct: 121 DIDQLVRLMEGNVELNGLASVVSAEKLWWGEPLKYEFGPDAISNKTDLVLAADCVYLETA 180

Query: 181 FPLLEKTLLDLTEGDTPPAVLMSYRKRRKADKNFFRLIRKNFKIVPITNFIRYDYYLKKQ 240
           FPLLEKTLLDLT+G+TPP VLMSYRKRRKAD+ FF+ IRKNFK+VPIT+F R D +LK++
Sbjct: 181 FPLLEKTLLDLTKGETPPVVLMSYRKRRKADRIFFKAIRKNFKVVPITSFDRCDDFLKQR 240

Query: 241 THLFQLVRIPK 251
           THLFQL+R+ K
Sbjct: 241 THLFQLIRVQK 251

>NDAI0G00680 Chr7 (150212..150979) [768 bp, 255 aa] {ON} Anc_2.289
           YNL024C
          Length = 255

 Score =  292 bits (747), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 149/254 (58%), Positives = 190/254 (74%), Gaps = 16/254 (6%)

Query: 7   FTTQFIDLVPSRPVEHLGDSDLSFGGQVEPALKIHEDGGENGCGGKLWVAGELLCDYLLE 66
           F + F DLV +RP+EHLG+SDLSFGG+++  LKIHEDGGE+GCGGK+W+AGELLC+++LE
Sbjct: 5   FGSGFDDLVVARPLEHLGNSDLSFGGRLKNPLKIHEDGGESGCGGKVWIAGELLCEFILE 64

Query: 67  NSDAKGILSKRMVEMDVKAPFLNILELGSGTGLVGLCAGSVAQ--LHGDRTKVYITDIDR 124
            S++  +L+           F  I+ELGSGTGLVGLC G + +   H D    YITDID+
Sbjct: 65  KSNSDDLLNGWASN---SKQFRKIVELGSGTGLVGLCIGLLEKNNFHKD-IDAYITDIDQ 120

Query: 125 LVGLMETNVNLNHLAETVSVEILSWGEPLKEKFGP-----DAKAD-----KVDLVLAADC 174
           +V LM+ N+ LN +   VS E L WGEPL++ F P     D + D     KVDL+LAADC
Sbjct: 121 IVPLMKQNIQLNGIENEVSAEELWWGEPLRKTFAPSEHSRDKEEDFREEKKVDLILAADC 180

Query: 175 VYLETAFPLLEKTLLDLTEGDTPPAVLMSYRKRRKADKNFFRLIRKNFKIVPITNFIRYD 234
           VYLE AFPLLEKTLLDLTEG+TPP +LM+YRKRRKADK+FF+ I+KNF IV I +F +Y+
Sbjct: 181 VYLEKAFPLLEKTLLDLTEGETPPTILMAYRKRRKADKHFFQKIKKNFDIVEIKDFEKYE 240

Query: 235 YYLKKQTHLFQLVR 248
           YYLK++THLFQL+R
Sbjct: 241 YYLKQRTHLFQLIR 254

>CAGL0M06897g Chr13 complement(702211..702957) [747 bp, 248 aa] {ON}
           similar to uniprot|P53970 Saccharomyces cerevisiae
           YNL024c
          Length = 248

 Score =  284 bits (727), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 148/243 (60%), Positives = 177/243 (72%), Gaps = 7/243 (2%)

Query: 11  FIDLVPSRPVEHLGDSDLSFGGQVEPALKIHEDGGENGCGGKLWVAGELLCDYLLENSDA 70
           F DL+ SRPVEH+G SDL+F G + P LKI+EDGGE+GCGGK+W+AGELLC+++LE S  
Sbjct: 7   FGDLIESRPVEHMGQSDLTFNGMLVPGLKIYEDGGESGCGGKVWIAGELLCEFILEKS-R 65

Query: 71  KGILSKRMVEMDVKAPFLNILELGSGTGLVGLCAGSVAQLHGDR-TKVYITDIDRLVGLM 129
            G L K  +  D    F N+LELGSGTGLVGLC G V +    R  K YITDID+LV LM
Sbjct: 66  DGELLKDWINDD-SVSFGNVLELGSGTGLVGLCVGLVTKKQSQRMVKTYITDIDQLVPLM 124

Query: 130 ETNVNLNHLAETVSVEILSWGEPLKEKFGP----DAKADKVDLVLAADCVYLETAFPLLE 185
           E NV LN + + V  + L WGE L  +F P     A    +DLVLAADCVYLE AFPLLE
Sbjct: 125 EKNVELNLIDQQVFAKELLWGEALPIEFAPVKTGHATTSSLDLVLAADCVYLEKAFPLLE 184

Query: 186 KTLLDLTEGDTPPAVLMSYRKRRKADKNFFRLIRKNFKIVPITNFIRYDYYLKKQTHLFQ 245
           KTLLDLTE D PP +LM+YRKRRKADK+FF+ IRKNF ++ I +F  YD YLK++THLFQ
Sbjct: 185 KTLLDLTECDNPPVILMAYRKRRKADKHFFQKIRKNFNVIVINDFKNYDQYLKQRTHLFQ 244

Query: 246 LVR 248
           LVR
Sbjct: 245 LVR 247

>Suva_14.323 Chr14 complement(569944..570705) [762 bp, 253 aa] {ON}
           YNL024C (REAL)
          Length = 253

 Score =  285 bits (728), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 148/243 (60%), Positives = 182/243 (74%), Gaps = 10/243 (4%)

Query: 11  FIDLVPSRPVEHLGDSDLSFGGQVEPALKIHEDGGENGCGGKLWVAGELLCDYLLENSDA 70
           F DLV  R  EH G +DLSFGG++ PALKI EDGGE+GCGGK+W+AGELLC+Y+LE SD 
Sbjct: 8   FEDLVVPRLKEHFGQTDLSFGGKLLPALKICEDGGESGCGGKVWIAGELLCEYILEKSDD 67

Query: 71  KGILSKRMVEMDVKAPFLNILELGSGTGLVGLCAGSVAQ--LHGDRTKVYITDIDRLVGL 128
             +LS+ + E   K PF+ +LELGSGTGLVGLC G + +   H D TKVY+TDIDRLV L
Sbjct: 68  H-LLSETVHE---KRPFMKVLELGSGTGLVGLCVGLLEKNKFH-DNTKVYVTDIDRLVPL 122

Query: 129 METNVNLNHLAETVSVEILSWGEPLKEKFGP---DAKADKVDLVLAADCVYLETAFPLLE 185
           ME N+ L+ +   V    L WGEPL   F P   D + + VDLVLAADCVYLE AFPLLE
Sbjct: 123 MERNIELDKVQYEVLARELWWGEPLSGDFSPQEGDLQVNNVDLVLAADCVYLEKAFPLLE 182

Query: 186 KTLLDLTEGDTPPAVLMSYRKRRKADKNFFRLIRKNFKIVPITNFIRYDYYLKKQTHLFQ 245
           KTLLDLT   +PP +LM+Y+KRRKADK FF  I++NF ++ I +FI++DYYLK++THLFQ
Sbjct: 183 KTLLDLTNCISPPVILMAYKKRRKADKQFFNKIKRNFDVLEIKDFIKFDYYLKQKTHLFQ 242

Query: 246 LVR 248
           LVR
Sbjct: 243 LVR 245

>NCAS0G03850 Chr7 (713255..714010) [756 bp, 251 aa] {ON}
          Length = 251

 Score =  283 bits (723), Expect = 5e-96,   Method: Compositional matrix adjust.
 Identities = 144/244 (59%), Positives = 181/244 (74%), Gaps = 8/244 (3%)

Query: 11  FIDLVPSRPVEHLGDSDLSFGGQVEPALKIHEDGGENGCGGKLWVAGELLCDYLLENSDA 70
           F  LV  RPVEHLG+SDLSFGG++   LKIHEDGGE+GCGGK+W+AGELLCD++LE S  
Sbjct: 8   FEGLVVPRPVEHLGNSDLSFGGKLRSPLKIHEDGGESGCGGKVWIAGELLCDFILEKSGT 67

Query: 71  KGILSKRMVEMDVKAPFLNILELGSGTGLVGLCAGSVAQLHGDRT-KVYITDIDRLVGLM 129
           + +L+K     D +  F N+LELGSGTGLVGLC G + +    +   V+ITDID+LV LM
Sbjct: 68  EDLLNK--WPHDGERRFRNVLELGSGTGLVGLCVGLLEKNRFHKNIGVHITDIDQLVPLM 125

Query: 130 ETNVNLNHLAETVSVEILSWGEPLKEKFGPDA-----KADKVDLVLAADCVYLETAFPLL 184
           + N+ LN +++ V  E L WGEPL E F P       K + VDL+LAADCVYLE AFPLL
Sbjct: 126 QRNIELNGVSKEVVAEGLWWGEPLLESFAPSTVDNLPKTNVVDLILAADCVYLEDAFPLL 185

Query: 185 EKTLLDLTEGDTPPAVLMSYRKRRKADKNFFRLIRKNFKIVPITNFIRYDYYLKKQTHLF 244
           E+TLLDLTE +TPP +LMSYRKRRKADK+FF  I+KNF ++ + +F +Y+ YLK +THLF
Sbjct: 186 ERTLLDLTESETPPVILMSYRKRRKADKHFFNKIKKNFDVIEVKDFTKYEMYLKMRTHLF 245

Query: 245 QLVR 248
           QL R
Sbjct: 246 QLAR 249

>NCAS0G03770 Chr7 complement(694471..695226) [756 bp, 251 aa] {ON}
           Anc_2.289 YNL024C
          Length = 251

 Score =  283 bits (723), Expect = 5e-96,   Method: Compositional matrix adjust.
 Identities = 144/244 (59%), Positives = 181/244 (74%), Gaps = 8/244 (3%)

Query: 11  FIDLVPSRPVEHLGDSDLSFGGQVEPALKIHEDGGENGCGGKLWVAGELLCDYLLENSDA 70
           F  LV  RPVEHLG+SDLSFGG++   LKIHEDGGE+GCGGK+W+AGELLCD++LE S  
Sbjct: 8   FEGLVVPRPVEHLGNSDLSFGGKLRSPLKIHEDGGESGCGGKVWIAGELLCDFILEKSGT 67

Query: 71  KGILSKRMVEMDVKAPFLNILELGSGTGLVGLCAGSVAQLHGDRT-KVYITDIDRLVGLM 129
           + +L+K     D +  F N+LELGSGTGLVGLC G + +    +   V+ITDID+LV LM
Sbjct: 68  EDLLNK--WPHDGERRFRNVLELGSGTGLVGLCVGLLEKNRFHKNIGVHITDIDQLVPLM 125

Query: 130 ETNVNLNHLAETVSVEILSWGEPLKEKFGPDA-----KADKVDLVLAADCVYLETAFPLL 184
           + N+ LN +++ V  E L WGEPL E F P       K + VDL+LAADCVYLE AFPLL
Sbjct: 126 QRNIELNGVSKEVVAEGLWWGEPLLESFAPSTVDNLPKTNVVDLILAADCVYLEDAFPLL 185

Query: 185 EKTLLDLTEGDTPPAVLMSYRKRRKADKNFFRLIRKNFKIVPITNFIRYDYYLKKQTHLF 244
           E+TLLDLTE +TPP +LMSYRKRRKADK+FF  I+KNF ++ + +F +Y+ YLK +THLF
Sbjct: 186 ERTLLDLTESETPPVILMSYRKRRKADKHFFNKIKKNFDVIEVKDFTKYEMYLKMRTHLF 245

Query: 245 QLVR 248
           QL R
Sbjct: 246 QLAR 249

>SAKL0E07612g Chr5 complement(614835..615593) [759 bp, 252 aa] {ON}
           similar to uniprot|P53970 Saccharomyces cerevisiae
           YNL024C Putative S-adenosylmethionine-dependent
           methyltransferase of the seven beta-strand family
          Length = 252

 Score =  282 bits (721), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 149/250 (59%), Positives = 189/250 (75%), Gaps = 3/250 (1%)

Query: 1   MTELLDFTTQFIDLVPSRPVEHLGDSDLSFGGQVEPALKIHEDGGENGCGGKLWVAGELL 60
           M ++L FT  F DLVPSRP EHLGDSDLSFGG++ P LKIHEDGGE+GCGGK+W+AGELL
Sbjct: 1   MEDVLQFTACFNDLVPSRPTEHLGDSDLSFGGKLSPPLKIHEDGGESGCGGKVWIAGELL 60

Query: 61  CDYLLENSDAKGILSKRMVEMDVKAPFLNILELGSGTGLVGLCAGSVAQLHGDR-TKVYI 119
           C++LLE SD +G+ S+   +   ++P   I+ELGSGTGLVGLC G + + +  +   +Y+
Sbjct: 61  CEFLLEKSDQQGLFSQWNSDTRFQSPIKKIVELGSGTGLVGLCLGLLNKQNKLKDVDIYV 120

Query: 120 TDIDRLVGLMETNVNLNHLAETVSVEILSWGEPLKEKFGPD-AKADKVDLVLAADCVYLE 178
           TDID+LV LM+ N+ LN L      E L WGEPLK +F P  +   +VDL+LAADCVYLE
Sbjct: 121 TDIDQLVTLMDRNIKLNELEHVFPKE-LWWGEPLKPEFAPTRSNQRQVDLILAADCVYLE 179

Query: 179 TAFPLLEKTLLDLTEGDTPPAVLMSYRKRRKADKNFFRLIRKNFKIVPITNFIRYDYYLK 238
            AFPLLE TLLDLT    PP +LMSY+KRRKADK+FF+ I+KNF ++ I  F R+D+YLK
Sbjct: 180 KAFPLLEVTLLDLTSCKDPPIILMSYKKRRKADKHFFKQIKKNFDVLEINEFTRFDHYLK 239

Query: 239 KQTHLFQLVR 248
           ++THLFQLVR
Sbjct: 240 QKTHLFQLVR 249

>Smik_14.307 Chr14 complement(549501..550241) [741 bp, 246 aa] {ON}
           YNL024C (REAL)
          Length = 246

 Score =  280 bits (716), Expect = 5e-95,   Method: Compositional matrix adjust.
 Identities = 143/242 (59%), Positives = 183/242 (75%), Gaps = 8/242 (3%)

Query: 11  FIDLVPSRPVEHLGDSDLSFGGQVEPALKIHEDGGENGCGGKLWVAGELLCDYLLENSDA 70
           F DLV  RP EHLG +DLSF G++ PALKI EDGGE+GCGGK+W+AGELLC+Y+LE S  
Sbjct: 8   FGDLVVPRPKEHLGQTDLSFSGKLLPALKICEDGGESGCGGKVWIAGELLCEYILEKS-V 66

Query: 71  KGILSKRMVEMDVKAPFLNILELGSGTGLVGLCAGSVAQ-LHGDRTKVYITDIDRLVGLM 129
             +LSK    +D K  F  +LELGSGTGLVGLC G + + ++ D TKVY+TDID+LV L+
Sbjct: 67  DHLLSK---TVDGKKRFKKVLELGSGTGLVGLCVGLLEKNVYHDGTKVYVTDIDKLVPLL 123

Query: 130 ETNVNLNHLAETVSVEILSWGEPLKEKFGP---DAKADKVDLVLAADCVYLETAFPLLEK 186
           + N+ L+ +   V    L WGEPL   F P   D + + VDLVLAADCVYLE AFPLLEK
Sbjct: 124 KRNIELDKVQYEVLARELCWGEPLSADFSPQEGDLQTNNVDLVLAADCVYLEKAFPLLEK 183

Query: 187 TLLDLTEGDTPPAVLMSYRKRRKADKNFFRLIRKNFKIVPITNFIRYDYYLKKQTHLFQL 246
           TLLDLT+  +PP +LM+Y+KRRKADK+FF  I++NF ++ I+NF ++DYYLK++THLFQL
Sbjct: 184 TLLDLTDCVSPPVILMAYKKRRKADKHFFNKIKRNFDVLEISNFSKFDYYLKQRTHLFQL 243

Query: 247 VR 248
           +R
Sbjct: 244 IR 245

>KNAG0H01980 Chr8 complement(348806..349555) [750 bp, 249 aa] {ON}
           Anc_2.289 YNL024C
          Length = 249

 Score =  274 bits (700), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 140/244 (57%), Positives = 171/244 (70%), Gaps = 7/244 (2%)

Query: 10  QFIDLVPSRPVEHLGDSDLSFGGQVEPALKIHEDGGENGCGGKLWVAGELLCDYLLENSD 69
            F DLV +RP+EH G  D+SFGG++ PAL+IHEDGGE+GCGGK+WVAGELLCDY++E SD
Sbjct: 7   SFGDLVVARPIEHCGSHDMSFGGRLNPALQIHEDGGESGCGGKVWVAGELLCDYIVEKSD 66

Query: 70  AKGILSKRMVEMDVKAPFLNILELGSGTGLVGLCAGSV-AQLHGDRTKVYITDIDRLVGL 128
              +L+    +      F NI+ELGSGTGLVGLC   +  Q      KV ITDID+LV L
Sbjct: 67  EDDLLANW--DTSKVQKFRNIIELGSGTGLVGLCVALLEKQFFHKGIKVTITDIDQLVPL 124

Query: 129 METNVNLNHLAETVSVEILSWGEPLKEKFGPDA----KADKVDLVLAADCVYLETAFPLL 184
           M+ N+ LN +   +  E L WGEPL   F P +    K   VDL+LAADCVYLE AFPLL
Sbjct: 125 MQKNIELNCVNTEMIAEELWWGEPLSGAFAPHSEGLSKVTSVDLILAADCVYLEKAFPLL 184

Query: 185 EKTLLDLTEGDTPPAVLMSYRKRRKADKNFFRLIRKNFKIVPITNFIRYDYYLKKQTHLF 244
           EKTLLDLT    PP +LM+YRKRR ADK FFR I K+F +  IT+F  YD YLK++THLF
Sbjct: 185 EKTLLDLTNCSKPPVILMAYRKRRNADKRFFRKIGKHFTVREITDFSTYDQYLKQRTHLF 244

Query: 245 QLVR 248
           +L+R
Sbjct: 245 ELIR 248

>YNL024C Chr14 complement(587107..587847) [741 bp, 246 aa] {ON}
           Putative methyltransferase; has seven beta-strand
           methyltransferase motif; green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm; despite
           similarity to methyltransferases, null mutant does not
           display alterations in lysine methylation pattern
          Length = 246

 Score =  270 bits (689), Expect = 6e-91,   Method: Compositional matrix adjust.
 Identities = 140/243 (57%), Positives = 180/243 (74%), Gaps = 10/243 (4%)

Query: 11  FIDLVPSRPVEHLGDSDLSFGGQVEPALKIHEDGGENGCGGKLWVAGELLCDYLLENSDA 70
           F DLV  RP EHLG +DLSFGG++ PALKI EDGGE+GCGGK+W+AGELLC+Y+LE S  
Sbjct: 8   FGDLVVPRPKEHLGQTDLSFGGKLLPALKICEDGGESGCGGKVWIAGELLCEYILEKS-V 66

Query: 71  KGILSKRMVEMDVKAPFLNILELGSGTGLVGLCAGSVAQ--LHGDRTKVYITDIDRLVGL 128
             +LSK +   +    F  +LELGSGTGLVGLC G + +   H D TKVY+TDID+L+ L
Sbjct: 67  DHLLSKTV---NGTKQFKKVLELGSGTGLVGLCVGLLEKNTFH-DGTKVYVTDIDKLIPL 122

Query: 129 METNVNLNHLAETVSVEILSWGEPLKEKFGPDA---KADKVDLVLAADCVYLETAFPLLE 185
           ++ N+ L+ +   V    L WGEPL   F P     +A+ VDLVLAADCVYLE AFPLLE
Sbjct: 123 LKRNIELDEVQYEVLARELWWGEPLSADFSPQEGAMQANNVDLVLAADCVYLEEAFPLLE 182

Query: 186 KTLLDLTEGDTPPAVLMSYRKRRKADKNFFRLIRKNFKIVPITNFIRYDYYLKKQTHLFQ 245
           KTLLDLT    PP +LM+Y+KRRKADK+FF  I++NF ++ IT+F ++++YLK++THLFQ
Sbjct: 183 KTLLDLTHCINPPVILMAYKKRRKADKHFFNKIKRNFDVLEITDFSKFEHYLKERTHLFQ 242

Query: 246 LVR 248
           L+R
Sbjct: 243 LIR 245

>Skud_14.305 Chr14 complement(557846..558595) [750 bp, 249 aa] {ON}
           YNL024C (REAL)
          Length = 249

 Score =  268 bits (685), Expect = 3e-90,   Method: Compositional matrix adjust.
 Identities = 138/242 (57%), Positives = 178/242 (73%), Gaps = 8/242 (3%)

Query: 11  FIDLVPSRPVEHLGDSDLSFGGQVEPALKIHEDGGENGCGGKLWVAGELLCDYLLENSDA 70
           F DLV  R  EHLG +DLSFGG++ PALKI EDGGE+GCGGK+W+AGELLC+Y+LE S  
Sbjct: 8   FEDLVVPRATEHLGQTDLSFGGKLLPALKICEDGGESGCGGKVWIAGELLCEYILEKS-L 66

Query: 71  KGILSKRMVEMDVKAPFLNILELGSGTGLVGLCAGSVAQ-LHGDRTKVYITDIDRLVGLM 129
             +LS+       +  F  +LELGSGTGLVGLC G + +    D +KVY+TDID+LV L+
Sbjct: 67  HHLLSE---ATHGRRQFKKVLELGSGTGLVGLCVGLLEKNTFHDGSKVYVTDIDKLVPLL 123

Query: 130 ETNVNLNHLAETVSVEILSWGEPLKEKFGP---DAKADKVDLVLAADCVYLETAFPLLEK 186
           E N+ L+ +   V    L WGEPL   F P   D + + VDLVLAADCVYLE AFPLLE+
Sbjct: 124 ERNIELDKVQYEVLARELWWGEPLSVDFSPQEGDLQTNNVDLVLAADCVYLEKAFPLLER 183

Query: 187 TLLDLTEGDTPPAVLMSYRKRRKADKNFFRLIRKNFKIVPITNFIRYDYYLKKQTHLFQL 246
           TLLDLT   +PP +LM+Y+KRRKADK+FF  I++NF ++ IT+F ++D+YLK++THLFQL
Sbjct: 184 TLLDLTNCISPPVILMAYKKRRKADKHFFSKIKRNFDVLEITDFSKFDHYLKQRTHLFQL 243

Query: 247 VR 248
           +R
Sbjct: 244 IR 245

>KLLA0E08295g Chr5 complement(746166..746966) [801 bp, 266 aa] {ON}
           similar to uniprot|P53970 Saccharomyces cerevisiae
           YNL024C Putative S-adenosylmethionine-dependent
           methyltransferase of the seven beta-strand family
          Length = 266

 Score =  259 bits (661), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 142/245 (57%), Positives = 187/245 (76%), Gaps = 13/245 (5%)

Query: 7   FTTQFIDLVPSRPVEHLGDSDLSFGGQVEPALKIHEDGGENGCGGKLWVAGELLCDYLLE 66
           F++ F +LVP+RP+EHLG  D+SF G++   L I+EDGGE+GCGGK+W+AGELLC+Y+LE
Sbjct: 30  FSSCFEELVPARPIEHLGKIDMSFNGKLPSPLIINEDGGESGCGGKVWIAGELLCEYILE 89

Query: 67  NSDAKGILSKRMVEMDVKAPFLNILELGSGTGLVGLCAGSVAQL--HGDRTKVYITDIDR 124
            SD + +LS    + +  +    +LELGSGTGLVGLC G + Q   + DR +VYI+DID+
Sbjct: 90  KSDKEHLLSHLFPDGNCNS----VLELGSGTGLVGLCVGLMDQANEYSDR-EVYISDIDQ 144

Query: 125 LVGLMETNVNLNHLAETVSVEILSWGEPLKEKFGPDAKADK-VDLVLAADCVYLETAFPL 183
           L+GLME+N+ +N L + V  E+L WG PL     PD    K VDLVLAADCVYLE AFPL
Sbjct: 145 LLGLMESNIQVNGLDDKVHAEVLWWGNPL-----PDVFVKKPVDLVLAADCVYLEAAFPL 199

Query: 184 LEKTLLDLTEGDTPPAVLMSYRKRRKADKNFFRLIRKNFKIVPITNFIRYDYYLKKQTHL 243
           LEKTLL+LT+G+  P +LM+Y+KRRKADK+FF+ I+KNFKIV I +FI +D YLK++THL
Sbjct: 200 LEKTLLELTDGENVPIILMAYKKRRKADKHFFQKIKKNFKIVEIRDFINFDKYLKQRTHL 259

Query: 244 FQLVR 248
           FQL+R
Sbjct: 260 FQLMR 264

>KAFR0H03290 Chr8 complement(626525..627262) [738 bp, 245 aa] {ON}
           Anc_2.289 YNL024C
          Length = 245

 Score =  256 bits (654), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 130/247 (52%), Positives = 172/247 (69%), Gaps = 17/247 (6%)

Query: 10  QFIDLVPSRPVEHLGDSDLSFGGQVEPALKIHEDGGENGCGGKLWVAGELLCDYLLENSD 69
           +++ L+ +RP+EHLG +DLSF GQ+ PA+KI+EDGG +GCGGK+W+AGELLC+YL+E SD
Sbjct: 7   EYVGLIDTRPIEHLGSADLSFDGQLSPAMKIYEDGGASGCGGKVWIAGELLCEYLIEKSD 66

Query: 70  AKGILSKRMVEMDVKAPFLNILELGSGTGLVGLCAGSV--AQLHGDRTKVYITDIDRLVG 127
           ++ +L    ++        NILELGSGTGLVG+C G +   + H D  KV ITDI  LV 
Sbjct: 67  SENLLCDGSIK--------NILELGSGTGLVGICVGLMEKQRFHKD-IKVSITDIGGLVP 117

Query: 128 LMETNVNLNHLAETVSVEILSWGEPLKEKF------GPDAKADKVDLVLAADCVYLETAF 181
           LME N+ LN +A+    + L WG+ L  ++      G       VDLV+AADCVY E AF
Sbjct: 118 LMERNILLNKIADATVAKELMWGQQLPSEYMTTSVDGNCDNVSNVDLVVAADCVYAEKAF 177

Query: 182 PLLEKTLLDLTEGDTPPAVLMSYRKRRKADKNFFRLIRKNFKIVPITNFIRYDYYLKKQT 241
           PLLEK LLDLT  D PP +LM+YRKRRKADK FF  IRKNF ++ I +F  ++ Y+K++T
Sbjct: 178 PLLEKILLDLTNCDNPPIILMAYRKRRKADKRFFVRIRKNFDVIEIDDFSSHEKYMKQRT 237

Query: 242 HLFQLVR 248
           HLF+L R
Sbjct: 238 HLFELKR 244

>Ecym_3328 Chr3 (629428..630192) [765 bp, 254 aa] {ON} similar to
           Ashbya gossypii ADL212W
          Length = 254

 Score =  254 bits (649), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 138/244 (56%), Positives = 170/244 (69%), Gaps = 7/244 (2%)

Query: 7   FTTQFIDLVPSRPVEHLGDSDLSFGGQVEPALKIHEDGGENGCGGKLWVAGELLCDYLLE 66
           F + F +LVP+ P+EHLG SDLSF G+++P LKI+EDGGE+GCGGK+W+AGELLCD+LLE
Sbjct: 5   FASVFEELVPTPPIEHLGASDLSFQGRLDPPLKIYEDGGESGCGGKVWIAGELLCDFLLE 64

Query: 67  NSDAKGILSKRMVEMDVKAPFLNILELGSGTGLVGLCAGSVAQLHG-DRTKVYITDIDRL 125
            S    +LSK +        F  +LELGSGTGLVGLC G    +H  +   VYITDID L
Sbjct: 65  KSKDGQLLSKFVKN---GKQFNKVLELGSGTGLVGLCIGMHNIMHEVNDMDVYITDIDTL 121

Query: 126 VGLMETNVNLNHLAETVSVEILSWGEPLKEKFGPDAKADKVDLVLAADCVYLETAFPLLE 185
             LM  NV +N+L   V    L WG+ L  +F    K   VDL+LAADCVYLE AFPLLE
Sbjct: 122 CPLMARNVRMNNLEGRVHPRELFWGDELPAEF--RNKDSPVDLILAADCVYLEKAFPLLE 179

Query: 186 KTLLDLTEG-DTPPAVLMSYRKRRKADKNFFRLIRKNFKIVPITNFIRYDYYLKKQTHLF 244
             LL+LT   +  P VLMSYRKRRKADK FF  I+K+F I  +T+F RYD Y+K++TH+F
Sbjct: 180 MKLLELTANQEVQPVVLMSYRKRRKADKKFFLKIKKHFVITELTDFKRYDEYIKQRTHIF 239

Query: 245 QLVR 248
           QLVR
Sbjct: 240 QLVR 243

>ADL212W Chr4 (332487..333242) [756 bp, 251 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL024C
          Length = 251

 Score =  254 bits (648), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 144/251 (57%), Positives = 176/251 (70%), Gaps = 10/251 (3%)

Query: 1   MTELLDFTTQFIDLVPSRPVEHLGDSDLSFGGQVEPALKIHEDGGENGCGGKLWVAGELL 60
           MTE   FT  F DLV  RP+EHLG SDLS+ GQ++P LKIHEDGGE+GCGGK+W+AG LL
Sbjct: 1   MTET--FTAVFEDLVEPRPIEHLGQSDLSYQGQLDPPLKIHEDGGESGCGGKVWIAGNLL 58

Query: 61  CDYLLENSDAKGILSKRMVEMDVKAPFLNILELGSGTGLVGLCAGSVAQLHGDR-TKVYI 119
           C+++LE S    +LS+       +  F NI+ELGSGTGLVGLC G   + +G   T VYI
Sbjct: 59  CEFILEKSKDGRVLSQFP---GYERQFKNIIELGSGTGLVGLCVGLHGKYNGATDTNVYI 115

Query: 120 TDIDRLVGLMETNVNLNHLAETVSVEILSWGEPLKEKFGPDAKADKVDLVLAADCVYLET 179
           TDI+ L  LM+ NV LN L   V    L WGEPL ++F        +DLVLAADCVYLE 
Sbjct: 116 TDIEGLCPLMQKNVELNGLDGMVHPRPLFWGEPLSDEF----TRQPIDLVLAADCVYLEK 171

Query: 180 AFPLLEKTLLDLTEGDTPPAVLMSYRKRRKADKNFFRLIRKNFKIVPITNFIRYDYYLKK 239
           AFPLLEKTLLDLT G++ P VLMSY+KRRKADK FF  I+K F I+ I +F  Y+ Y ++
Sbjct: 172 AFPLLEKTLLDLTAGESQPLVLMSYKKRRKADKKFFIKIKKEFDIIEIKDFKSYEDYRRQ 231

Query: 240 QTHLFQLVRIP 250
           +T+LFQLVR P
Sbjct: 232 RTYLFQLVRKP 242

>Skud_2.403 Chr2 (713779..715032) [1254 bp, 417 aa] {ON} YBR271W
           (REAL)
          Length = 417

 Score = 67.4 bits (163), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 43/134 (32%), Positives = 74/134 (55%), Gaps = 11/134 (8%)

Query: 47  NGCGGKLWVAGELLCDYLLENSDAKGILSKRMVEMDVKAPFLNILELGSGTGLVGLC-AG 105
           +  G K W +  +L   L++     G+     +        + +LELGSGTGLVGL  A 
Sbjct: 216 DNLGWKTWGSSLILSQLLVDYLHTVGV----HITASCNQKKIKVLELGSGTGLVGLSWAS 271

Query: 106 SVAQLHG-DRTKVYITDIDRLVGLMETNVNLNHLAETVSVEILSWGEP--LKEKFGPDAK 162
              +L+G D+ ++++TD+  +V  ++ NV+LN+L + V  EIL W  P    ++FG +  
Sbjct: 272 KWKELYGTDKMEIFVTDLPEIVTNLKKNVSLNNLQDFVQAEILDWTNPQDFIDRFGHE-- 329

Query: 163 ADKVDLVLAADCVY 176
            ++ D++L AD +Y
Sbjct: 330 -NEFDIILVADPIY 342

>Smik_2.414 Chr2 (730531..731784) [1254 bp, 417 aa] {ON} YBR271W
           (REAL)
          Length = 417

 Score = 66.2 bits (160), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 38/93 (40%), Positives = 61/93 (65%), Gaps = 7/93 (7%)

Query: 88  LNILELGSGTGLVGLC-AGSVAQLHG-DRTKVYITDIDRLVGLMETNVNLNHLAETVSVE 145
           + +LELGSGTGLVGL  A    +L+G D T++++TD+  +V  ++ NV+LN+L + V  E
Sbjct: 253 IKVLELGSGTGLVGLSWASKWKELYGIDNTEIFVTDLPDIVTNLKKNVSLNNLQDFVQAE 312

Query: 146 ILSWGEPLK--EKFGPDAKADKVDLVLAADCVY 176
           IL W  P    ++FG +   ++ D++L AD +Y
Sbjct: 313 ILDWTNPQSFIDRFGYE---NEFDIILIADPIY 342

>KAFR0C04250 Chr3 (844020..845195) [1176 bp, 391 aa] {ON} Anc_1.325
           YBR271W
          Length = 391

 Score = 65.9 bits (159), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 48/148 (32%), Positives = 72/148 (48%), Gaps = 27/148 (18%)

Query: 35  EPALKIHEDGGENGCGGKLW----VAGELLCDYLLENSDAKGILSKRMVEMDVKAPFLNI 90
           EP+L        +  G K W    +   +LCD + EN   K    KR            I
Sbjct: 185 EPSL------TNDNLGWKTWGSSLILSNILCDRIDENF-LKSFNGKR------------I 225

Query: 91  LELGSGTGLVGLCAGSVAQLHG--DRTKVYITDIDRLVGLMETNVNLNHLAETVSVEILS 148
           LELGSGTGLVG+   S  +  G  D  ++Y+TD+  +V  +E N+++N LA  V  ++L 
Sbjct: 226 LELGSGTGLVGISVASKLEEIGVLDEYEIYLTDLPEIVTNLEKNISINQLANRVVSDVLD 285

Query: 149 WGEPLKEKFGPDAKADKVDLVLAADCVY 176
           W  P  E F  +    + D++L +D +Y
Sbjct: 286 WTNP--ESFVSNYGDTRFDVLLISDPIY 311

>YBR271W Chr2 (744852..746111) [1260 bp, 419 aa] {ON}
           EFM2S-adenosylmethionine-dependent methyltransferase;
           methylates translation elongation factors EF2 (Eft1p and
           Eft2p) and EF3A (Yef3p); belongs to the seven
           beta-strand family; green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm;
           predicted to be involved in ribosome biogenesis
          Length = 419

 Score = 64.7 bits (156), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 46/146 (31%), Positives = 83/146 (56%), Gaps = 11/146 (7%)

Query: 37  ALKIHEDG-GENGCGGKLWVAGELLCDYLLENSDAKGILSKRMV-EMDVKAPFLNILELG 94
           ++ +HE     +  G K W +  +L   ++++ D     +  M+   D+K   + +LELG
Sbjct: 204 SIPLHEPSLTADNLGWKTWGSSLILSQLVVDHLDYLHTTNVNMLANSDIKQ--IKVLELG 261

Query: 95  SGTGLVGLC-AGSVAQLHG-DRTKVYITDIDRLVGLMETNVNLNHLAETVSVEILSWGEP 152
           +GTGLVGL  A    +L+G +  ++++TD+  +V  ++ NV+LN+L + V  EIL W  P
Sbjct: 262 AGTGLVGLSWALKWKELYGTENIEIFVTDLPEIVTNLKKNVSLNNLGDFVQAEILDWTNP 321

Query: 153 --LKEKFGPDAKADKVDLVLAADCVY 176
               +KFG +   ++ D++L AD +Y
Sbjct: 322 HDFIDKFGHE---NEFDVILIADPIY 344

>Suva_4.532 Chr4 (916493..917743) [1251 bp, 416 aa] {ON} YBR271W
           (REAL)
          Length = 416

 Score = 60.8 bits (146), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 47/140 (33%), Positives = 70/140 (50%), Gaps = 23/140 (16%)

Query: 47  NGCGGKLW----VAGELLCDYLLEN--SDAKGILSKRMVEMDVKAPFLNILELGSGTGLV 100
           +  G K W    +  +LL DYL       A    +KR          + +LELGSGTGLV
Sbjct: 215 DNLGWKTWGSSLILSQLLVDYLHTTGMPPAANCGTKR----------IKVLELGSGTGLV 264

Query: 101 GLC-AGSVAQLHG-DRTKVYITDIDRLVGLMETNVNLNHLAETVSVEILSWGEPLK--EK 156
           GL  A    +L+G    ++Y+TD+  +V  ++ NV LN+L + V  E+L W  P     +
Sbjct: 265 GLSWAAKWKELYGIHNIEIYVTDLPEIVTNLKKNVLLNNLEDFVQAEVLDWTNPQNFINQ 324

Query: 157 FGPDAKADKVDLVLAADCVY 176
           FG +      D++L AD +Y
Sbjct: 325 FGHEM---DFDIILVADPIY 341

>CAGL0I09438g Chr9 (904886..906106) [1221 bp, 406 aa] {ON} similar
           to uniprot|P38347 Saccharomyces cerevisiae YBR271w
          Length = 406

 Score = 58.5 bits (140), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 44/153 (28%), Positives = 76/153 (49%), Gaps = 24/153 (15%)

Query: 33  QVEPALKIHEDG-GENGCGGKLW----VAGELLCDYLLENSDAKGILSKRMVEMDVKAPF 87
            ++  + +HE     +  G K W    + GE++  YL EN  +    S R V        
Sbjct: 193 NLDKTIMLHEPSLTADNLGWKTWGSSLILGEIVVSYL-ENL-SSTFESNRKVRT------ 244

Query: 88  LNILELGSGTGLVGLC--AGSVAQLHGDRTKVYITDIDRLVGLMETNVNLNHLAETVSVE 145
              LELG+GTGLVG+   A    +    +T++Y+TD+  +V  ++ NV +N+L +  + +
Sbjct: 245 ---LELGAGTGLVGIAWAAKWRDKFCNSKTEIYLTDLPEIVDNLKDNVKINNLQDIATAD 301

Query: 146 ILSWGEP--LKEKFGPDAKADKVDLVLAADCVY 176
           +L W  P    EK+G     ++ D ++ AD +Y
Sbjct: 302 VLDWTNPDTFTEKYG----NERFDYIVIADPIY 330

>KNAG0C01800 Chr3 (352309..353574) [1266 bp, 421 aa] {ON} Anc_1.325
           YBR271W
          Length = 421

 Score = 57.8 bits (138), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 36/100 (36%), Positives = 54/100 (54%), Gaps = 9/100 (9%)

Query: 83  VKAPFLNILELGSGTGLVGLC-AGSVAQLHG---DRTKVYITDIDRLVGLMETNVNLNHL 138
           V  P   +LELGSGTGLVG+  A    +L+G      ++Y+TD+  +V  ++ NV LN L
Sbjct: 249 VGHPPFRVLELGSGTGLVGISWACKWRELYGIEDSNLQIYLTDLPEIVDNLKKNVQLNKL 308

Query: 139 AETVSVEILSWGEPLK--EKFGPDAKADKVDLVLAADCVY 176
              V  ++L W  P    E++  +      DL+L AD +Y
Sbjct: 309 EHAVVADVLDWTNPYNFIERYNGEQ---SFDLILVADPIY 345

>NCAS0B07410 Chr2 complement(1401275..1402519) [1245 bp, 414 aa]
           {ON} Anc_1.325 YBR271W
          Length = 414

 Score = 57.4 bits (137), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 47/151 (31%), Positives = 72/151 (47%), Gaps = 21/151 (13%)

Query: 33  QVEPALKIHEDG-GENGCGGKLWVAGELLC----DYLLENSDAKGILSKRMVEMDVKAPF 87
            VE  ++++E     +  G K W A  +L     + L +N D K I   R          
Sbjct: 203 NVEHVIQLYEPSLTADNLGWKTWGASLILSQKVVNLLEKNKDQKHIHPLR---------- 252

Query: 88  LNILELGSGTGLVGLC-AGSVAQLHG-DRTKVYITDIDRLVGLMETNVNLNHLAETVSVE 145
             +LELGSGTGLVG+  A    Q  G +  ++++TD+  +V  ++ NV  N L   V  +
Sbjct: 253 --VLELGSGTGLVGIAWASKWRQSFGTENIEMFVTDLPDIVANLKKNVQTNDLTTFVEAD 310

Query: 146 ILSWGEPLKEKFGPDAKADKVDLVLAADCVY 176
           IL W  P  + F      +K D++L AD +Y
Sbjct: 311 ILDWTNP--DDFIEKHGDEKFDVILVADPIY 339

>NCAS0J02150 Chr10 complement(415802..416770) [969 bp, 322 aa] {ON}
           Anc_4.352
          Length = 322

 Score = 56.6 bits (135), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 50/174 (28%), Positives = 82/174 (47%), Gaps = 24/174 (13%)

Query: 47  NGCGGKLWVAGELLCDYLLENSDAKGILSKRMVEMDVKAPFLNILELGSGTGLVGLCAGS 106
           N  G + W A   L  YL+++ DA       ++  D      NILELG+GTGLV L   S
Sbjct: 120 NTTGFRTWAASVYLSKYLVDHEDA-------LINDDD-----NILELGAGTGLVSLTIAS 167

Query: 107 VAQLHGDR-TKVYITDIDR--LVGLMETNVNLN--HLAETVSVEILSWGEPLKEKFGPDA 161
           + ++  ++  ++Y+TD D   + G M+ N  +N  ++   + ++ L W  P         
Sbjct: 168 MDKMKDNKLRRMYVTDGDSELVSGQMQDNFQMNEVNVDNHIKLQKLWWNSP------DQP 221

Query: 162 KADKVDLVLAADCVYLETAFPLLEKTLLD-LTEGDTPPAVLMSYRKRRKADKNF 214
             ++V++V+ AD  Y  T F  L   L   L E +    ++ S  +  K DK F
Sbjct: 222 IPERVNVVIGADVTYDSTCFTDLCSCLRQCLLESECYKCLIASTIRNVKTDKLF 275

>KLLA0E21539g Chr5 complement(1923103..1924305) [1203 bp, 400 aa]
           {ON} similar to uniprot|P38347 YBR271W Saccharomyces
           cerevisiae Putative S-adenosylmethionine-dependent
           methyltransferase of the seven beta-strand family
          Length = 400

 Score = 57.0 bits (136), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 32/89 (35%), Positives = 55/89 (61%), Gaps = 8/89 (8%)

Query: 90  ILELGSGTGLVGLCAGSVAQLHGDRTKVYITDIDRLVGLMETNVNLNHLAETVSVEILSW 149
           +LELGSGTGLVG+       ++GD   +++TD+  ++  ++ NV LN+L + V+ ++L W
Sbjct: 240 VLELGSGTGLVGISYALTHSINGDSV-IFLTDLPEILPNLQYNVRLNNLND-VTADVLDW 297

Query: 150 GEPLK--EKFGPDAKADKVDLVLAADCVY 176
            +PL   EK+G     +  D ++ AD +Y
Sbjct: 298 TDPLSFTEKYG----NEPFDTIVIADPIY 322

>Kpol_1066.17 s1066 complement(28462..29769) [1308 bp, 435 aa] {ON}
           complement(28462..29769) [1308 nt, 436 aa]
          Length = 435

 Score = 56.6 bits (135), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 36/119 (30%), Positives = 63/119 (52%), Gaps = 17/119 (14%)

Query: 73  ILSKRMVEMDVKAPFLN-------ILELGSGTGLVGLCAGSVAQ-----LHGDR---TKV 117
           ILS++MV       + N       ILELG+GTGLVG+      +      +G+    T++
Sbjct: 242 ILSQKMVNFLNNYKYSNQSDDKLRILELGAGTGLVGISWSCKWKEMMKLTNGNNLPNTEI 301

Query: 118 YITDIDRLVGLMETNVNLNHLAETVSVEILSWGEPLKEKFGPDAKADKVDLVLAADCVY 176
            +TD+  +VG ++ N+++N+L +     +L W  P  + F  +   +K D++L AD +Y
Sbjct: 302 ILTDLPEIVGNLQRNISINNLNDIARASVLDWTNP--KSFIQEYSNEKFDIILVADPIY 358

>SAKL0D06798g Chr4 complement(564525..565790) [1266 bp, 421 aa] {ON}
           similar to uniprot|P38347 YBR271W Saccharomyces
           cerevisiae Putative S-adenosylmethionine-dependent
           methyltransferase of the seven beta-strand family
          Length = 421

 Score = 56.2 bits (134), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 38/113 (33%), Positives = 61/113 (53%), Gaps = 14/113 (12%)

Query: 87  FLNILELGSGTGLVGL---CAGSVAQLHGDRTKVYITDIDRLVGLMETNVNLNHLAE--- 140
            L +LELGSGTGLVG+   C    ++      ++Y+TD+  +V  ++ NV +N+L     
Sbjct: 248 LLRVLELGSGTGLVGITFSCKYKESKTALGSCEMYLTDLPEIVPNLQKNVEINNLNSQSG 307

Query: 141 -TVSVEILSWGEPLK--EKFGPDAKADKVDLVLAADCVYLETAFPLLEKTLLD 190
             V  ++L W  P+   EK+G     DK D++L AD +Y     P+   T++D
Sbjct: 308 LAVCADVLDWTNPVSFTEKYG----DDKFDVILIADPIY-SPQHPVWVVTMID 355

>NDAI0B04730 Chr2 complement(1171595..1172893) [1299 bp, 432 aa]
           {ON} Anc_1.325 YBR271W
          Length = 432

 Score = 56.2 bits (134), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 48/144 (33%), Positives = 73/144 (50%), Gaps = 17/144 (11%)

Query: 35  EPALKIHEDGGENGCGGKLWVAGELLCDYLLENSDAKGILSKRMVEMDVKAPFLNILELG 94
           EP+L   ++ G    G  L ++ EL+ D L  N + K   S R V           LELG
Sbjct: 224 EPSL-TADNLGWKTWGSSLILSQELVND-LETNKNNKKSKSIRRV-----------LELG 270

Query: 95  SGTGLVGLC-AGSVAQLHGDRT-KVYITDIDRLVGLMETNVNLNHLAETVSVEILSWGEP 152
           +GTGLVG+  A    QL+G+ + ++++TD+  +V  +  NV  N L + V  ++L W  P
Sbjct: 271 AGTGLVGIAWACKWRQLYGNESIEMFVTDLPDIVTNLRKNVQNNDLDDFVVADVLDWTNP 330

Query: 153 LKEKFGPDAKADKVDLVLAADCVY 176
             E F      +K D +L AD +Y
Sbjct: 331 --EDFIKKYSDEKFDTILIADPIY 352

>NDAI0J02860 Chr10 complement(713765..714808) [1044 bp, 347 aa] {ON}
           Anc_4.352 YJR129C
          Length = 347

 Score = 55.5 bits (132), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 50/179 (27%), Positives = 79/179 (44%), Gaps = 20/179 (11%)

Query: 44  GGENGCGGKLWVAGELLCDYLLENSDAKGILSKRMVEMDVKAPFLNILELGSGTGLVGLC 103
            G++  G + W     L  +L+ N +      K ++E        +++ELG+GTGLV LC
Sbjct: 136 SGKSTTGFRTWEGAVYLSKFLINNCE------KYLIEK------TDVIELGAGTGLVSLC 183

Query: 104 AGSVAQLHG-DRTKVYITDIDR--LVGLMETNVNLNHLA---ETVSVEILSWGEPLKEKF 157
                   G  R KVY+TD D   +  ++  N  LN++    E V +  L W +P ++  
Sbjct: 184 ILENDLQKGIKRDKVYVTDGDSELVSSILNKNFELNNVNIEDENVILRKLWWNDPNEKIA 243

Query: 158 GPDAKADKVDLVLAADCVYLETAFPLLEKTLLDLTEGDTPPAVLMSYRKRRKADKNFFR 216
           G D    K+ LV+ AD  Y  +  P L   L    + +     ++S   R     NFF 
Sbjct: 244 GEDNG--KIGLVVGADITYDNSVIPDLCACLKQFMDKNRDCKAIISATVRNIDTINFFE 300

>KAFR0E04280 Chr5 complement(864926..865873) [948 bp, 315 aa] {ON}
           Anc_4.352 YJR129C
          Length = 315

 Score = 55.1 bits (131), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 51/173 (29%), Positives = 76/173 (43%), Gaps = 28/173 (16%)

Query: 50  GGKLWVAGELLCDYLLENSDAKGILSKRMVEMDVKAPFLNILELGSGTGLVGLCAGSVAQ 109
           G + W A   LCDY+  N D + +     V           LELG+GTGL  L      +
Sbjct: 116 GFRTWEAASYLCDYI-SNVDTESLNGCSTV-----------LELGAGTGLCSLTLLK-GK 162

Query: 110 LHGDRTKVYITDIDR--LVGLMETNVNLNHL----AETVSVEILSWGEPLKEKFGPDAKA 163
              D  KVY+TD D   + G + +N  LN +     + V ++ L WGE        D+  
Sbjct: 163 FQDDLKKVYVTDGDTELISGQLLSNFKLNEMEHEIGQKVKLQRLLWGE--------DSIP 214

Query: 164 DKVDLVLAADCVYLETAFPLLEKTLLDLTEGDTPPAVLMSYRKRR-KADKNFF 215
           + +D V+ AD  Y +T F  L K L    E ++    L++   R  + D+ F 
Sbjct: 215 NDIDCVIGADVTYDDTLFDDLFKCLRQCFEIESCKMCLIASTIRNVETDRKFL 267

>TPHA0L00340 Chr12 (45910..46935) [1026 bp, 341 aa] {ON} Anc_4.352
           YJR129C
          Length = 341

 Score = 55.1 bits (131), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 48/145 (33%), Positives = 70/145 (48%), Gaps = 26/145 (17%)

Query: 50  GGKLWVAGELLCDYLLENSDAKGILSKRMVEMDVKAPFLNILELGSGTGLVGLCAGSVAQ 109
           G + W A   L  YL++     G   + ++E        N LELGSGTG+V +  G V +
Sbjct: 142 GFRTWEAAVYLTKYLID----LGFPPETVME--------NTLELGSGTGMVSI--GLVKK 187

Query: 110 LHGDRTKVYITDIDR--LVGLMETNVNLNHL--AETVSVEILSWGEPLKEKFGPDAKADK 165
                T +YITD D   L G +  NV LN +  +++V ++ L W E        D   D 
Sbjct: 188 YKDQITTLYITDGDSQLLEGQLSRNVMLNGIDSSDSVKLQKLRWNE--------DHIPDN 239

Query: 166 VDLVLAADCVYLETAFPLLEKTLLD 190
           +DL++AAD  Y  +  P L   +LD
Sbjct: 240 LDLIVAADVTYDSSVIPSLCHCILD 264

>ZYRO0G20548g Chr7 complement(1693797..1694990) [1194 bp, 397 aa]
           {ON} similar to uniprot|P38347 YBR271W Saccharomyces
           cerevisiae Putative S-adenosylmethionine-dependent
           methyltransferase of the seven beta-strand family
          Length = 397

 Score = 53.9 bits (128), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 33/112 (29%), Positives = 62/112 (55%), Gaps = 13/112 (11%)

Query: 73  ILSKRMVEMDVKAPFLN------ILELGSGTGLVGLCA-GSVAQLHGDRT-KVYITDIDR 124
           ILS++++++    P  N      +LELGSGTGL G+       ++HG+   +++ TD+  
Sbjct: 214 ILSQKLIKI---VPHFNPTKLHRVLELGSGTGLAGISWLMKWIEIHGNSNIEMFFTDLQE 270

Query: 125 LVGLMETNVNLNHLAETVSVEILSWGEPLKEKFGPDAKADKVDLVLAADCVY 176
           +V  +  NV +N +++   V+ L W  P  E F     ++K D+++ +D +Y
Sbjct: 271 IVPNLRKNVEINGISDNSVVDTLDWTCP--EDFVDKYSSEKFDIIIVSDPIY 320

>Smik_10.422 Chr10 complement(653045..654067) [1023 bp, 340 aa] {ON}
           YJR129C (REAL)
          Length = 340

 Score = 53.5 bits (127), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 49/172 (28%), Positives = 73/172 (42%), Gaps = 18/172 (10%)

Query: 50  GGKLWVAGELLCDYLLENSDAKGILSKRMVEMDVKAPFLNILELGSGTGLVGLCAGSVAQ 109
           G + W A   + D+L+     +  L++   E D K   LN+LE+G+GTG+V L       
Sbjct: 133 GFRTWEAALYMGDFLINKPLQELALTQEEQEEDKKK--LNVLEIGAGTGIVSLVLSQ--N 188

Query: 110 LHGDRTKVYITDID------RLVGLMETNVNLNHLAETVSVEILSWGEPLKEKFGPDAKA 163
                 K+Y+TD D      +L    E N  L+     +  + L WG         D   
Sbjct: 189 YRNFVNKMYVTDGDSDLVERQLKKNFELNDALSEHKPDIRFQRLWWG--------SDKVP 240

Query: 164 DKVDLVLAADCVYLETAFPLLEKTLLDLTEGDTPPAVLMSYRKRRKADKNFF 215
           D +DLV+ AD  Y  T FP L K L +    +     L+S   R ++    F
Sbjct: 241 DDIDLVVGADVTYDSTIFPELCKCLAECLAINRCKMCLLSATIRSESTDKLF 292

>TDEL0D01940 Chr4 (376261..377478) [1218 bp, 405 aa] {ON} Anc_1.325
           YBR271W
          Length = 405

 Score = 53.5 bits (127), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 44/164 (26%), Positives = 79/164 (48%), Gaps = 11/164 (6%)

Query: 70  AKGILSKRMVEMDVKAPF---LNILELGSGTGLVG---LCAGSVAQLHGDRTKVYITDID 123
           A  ILS++++ +  ++ F     +LELGSGTGL G   LC   V +     T++++TD+ 
Sbjct: 220 ASFILSQKLINVLAESTFNFKPRVLELGSGTGLAGISWLCKW-VQKYGNGHTEIFLTDLP 278

Query: 124 RLVGLMETNVNLNHLAETVSVEILSWGEPLKEKFGPDAKADKVDLVLAADCVYLETAFPL 183
            +V  ++ NV +N +    +V  L W +P    F      D+ D+++ +D +Y      L
Sbjct: 279 VIVANLQKNVEVNKVESFATVSALDWTDPT--DFINSYTDDEFDILIVSDPIYSPNHPEL 336

Query: 184 LEKTLLDLTEGDTPPAVLMSYRKRRKADKNFFR-LIRKN-FKIV 225
           +   +           + +  R R  A++   R L+  N FKI+
Sbjct: 337 VVNMIKKFLSSQGQCYLEIPLRPRYAAERKRLRQLLSDNGFKII 380

>TPHA0I02650 Chr9 complement(580125..581390) [1266 bp, 421 aa] {ON}
           Anc_1.325 YBR271W
          Length = 421

 Score = 52.4 bits (124), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 35/138 (25%), Positives = 64/138 (46%), Gaps = 16/138 (11%)

Query: 47  NGCGGKLWVAGELLCDYLLENSDAKGILSKRMVEMDVKAPFLNILELGSGTGLVGLCAG- 105
           +  G K W +  +L  YL+ N       +K +   +     + +LELG+GTGLVG+  G 
Sbjct: 212 DNLGWKTWGSSLVLSQYLINN------FNKYINVNNCHVRKVRVLELGAGTGLVGISWGC 265

Query: 106 -------SVAQLHGDRTKVYITDIDRLVGLMETNVNLNHLAETVSVEILSWGEPLKEKFG 158
                  S    +    ++++TD+  +   +  NV+ N L++   V++L+W +P    F 
Sbjct: 266 KWKEEVTSAGNENLQNMELFLTDLPEITNNLAKNVSTNELSDFCKVDVLNWTDPT--SFT 323

Query: 159 PDAKADKVDLVLAADCVY 176
                +    +L AD +Y
Sbjct: 324 NTHTEEPFQYILIADPIY 341

>Kwal_47.16635 s47 complement(37749..38717) [969 bp, 322 aa] {ON}
           YJR129C - Hypothetical ORF [contig 376] FULL
          Length = 322

 Score = 51.6 bits (122), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 60/203 (29%), Positives = 87/203 (42%), Gaps = 45/203 (22%)

Query: 1   MTELLDFT-TQFIDLVP-SRPVEHLGD-------SDLSFGGQVEPALKIHEDGGENGCGG 51
           + EL D+   Q++ L+P S P     D       SD++   Q +P L           G 
Sbjct: 80  VVELSDWAFEQYVQLLPLSSPSPTFTDIIRYRFSSDVAVDVQEQPYLLC----ASGTTGF 135

Query: 52  KLWVAGELLCDYLLENSDAKGILSKRMVEMDVKAPFLNILELGSGTGLVGLCAGSVAQLH 111
           + W A   L +YL++N            E   +  F  ILELG+GTGLV L    + Q  
Sbjct: 136 RTWEAALYLAEYLVQNQ-----------EYYAQDRFSRILELGAGTGLVSLVWSQLFQ-- 182

Query: 112 GDRTKVYITDIDRLV--GLMETNVNLNHL----AETVSVEI----LSWGEPLKEKFGPDA 161
               ++Y+TD D  +    +  N  LN++    A T+  +     L WGE +     PD 
Sbjct: 183 ATMKELYVTDGDSTLVEQAIRYNFQLNNVTAAPANTLDCQYKFQRLWWGEDVV----PD- 237

Query: 162 KADKVDLVLAADCVYLETAFPLL 184
               VD+VLAAD  Y  +  P L
Sbjct: 238 ----VDIVLAADVTYDASVVPSL 256

>Kwal_14.2550 s14 complement(809874..811130) [1257 bp, 418 aa] {ON}
           YBR271W - Hypothetical ORF [contig 224] FULL
          Length = 418

 Score = 50.8 bits (120), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 56/102 (54%), Gaps = 22/102 (21%)

Query: 88  LNILELGSGTGLVGLC-------AGSVAQLHGDRTKVYITDIDRLVGLMETNVNLNHLAE 140
           L ILELG+GTGLVG+         GS  +      +V++TD+  +V  ++ NV+LN    
Sbjct: 248 LRILELGAGTGLVGIAFIQKILEVGSTQKF-----RVHLTDLPDIVPNLQKNVDLNKCNR 302

Query: 141 ----TVSVEILSWGEP--LKEKFGPDAKADKVDLVLAADCVY 176
                V+V++L W +P   +EK+G      K D++L AD +Y
Sbjct: 303 EPNVEVAVDVLDWTDPSSFQEKYG----YKKFDVLLIADPIY 340

>KLTH0H10560g Chr8 complement(912880..914133) [1254 bp, 417 aa] {ON}
           similar to uniprot|P38347 YBR271W Saccharomyces
           cerevisiae Putative S-adenosylmethionine-dependent
           methyltransferase of the seven beta-strand family
          Length = 417

 Score = 50.8 bits (120), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 48/152 (31%), Positives = 69/152 (45%), Gaps = 20/152 (13%)

Query: 32  GQVEPALKIHEDG-GENGCGGKLWVAGELLCDYLLENSDAKGILSKRMVEMDVKAPFLNI 90
           G +   +K+HE     +  G K W A  +L   L EN       SK   + D     L I
Sbjct: 198 GGLRTGVKLHEPALTSDNLGLKTWGASLVLARKLCEN------FSKFERQRD-----LRI 246

Query: 91  LELGSGTGLVG--LCAGSVAQLHGDRTKVYITDIDRLVGLMETNVNLNHLAE----TVSV 144
           LELG+GTGLVG  L    +    G    +++TD+  +V  ++ NV +N         V  
Sbjct: 247 LELGAGTGLVGISLVLKMLESNSGHNCSMHLTDLPEIVTNLKENVKINCCNSRSDLKVYA 306

Query: 145 EILSWGEPLKEKFGPDAKADKVDLVLAADCVY 176
           ++L W  P  + F     A K D++L AD VY
Sbjct: 307 DVLDWTNP--DSFEKTYGAHKFDVLLIADPVY 336

>Suva_12.220 Chr12 complement(343489..344502) [1014 bp, 337 aa] {ON}
           YJR129C (REAL)
          Length = 337

 Score = 50.4 bits (119), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 56/178 (31%), Positives = 81/178 (45%), Gaps = 30/178 (16%)

Query: 88  LNILELGSGTGLVGLCAGSVAQLHGDR---TKVYITDIDRLVGLMET----NVNLNHLAE 140
           LN+LE+G+GTG+V     S+  LH  R   +K+Y+TD D    L+ET    N  LN    
Sbjct: 166 LNVLEIGAGTGIV-----SLVLLHKYREYVSKMYVTDGDS--DLVETQLRRNFELNDAWR 218

Query: 141 TVSVEI----LSWGEPLKEKFGPDAKADKVDLVLAADCVYLETAFPLLEKTLLDLTEGDT 196
             S +I    L WG         D   D+V+LV+AAD  Y  T FP L + L +      
Sbjct: 219 EQSPDIRLQRLWWG--------SDRVPDEVNLVVAADVTYDSTIFPELCQCLAECLAMSH 270

Query: 197 PPAVLMSYRKRR-KADKNFFRLIRK---NFKIVPITNFIRYDYYLKKQTHLFQLVRIP 250
               L+S   R    DK F +   K    + +V  T + R      +++ LF+ +  P
Sbjct: 271 CKVCLLSATIRSYSTDKEFAQECHKVGLKYSVVTSTEYDRNSEARMEESLLFKPLIAP 328

>TBLA0D05200 Chr4 complement(1278210..1279409) [1200 bp, 399 aa]
           {ON} Anc_1.325 YBR271W
          Length = 399

 Score = 48.9 bits (115), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 41/150 (27%), Positives = 70/150 (46%), Gaps = 23/150 (15%)

Query: 32  GQVEPALKIHEDG-GENGCGGKLWVAGELLCDYLLENSDAKGILSKRMVEMDVKAPFLNI 90
             +E  +K++E     +  G K W +  +L + +    +  G    R            +
Sbjct: 190 NNLEKTIKLYEPALTSDNLGHKTWGSSLVLANRIPTLENCSGSSKPR------------V 237

Query: 91  LELGSGTGLVGLCAGSVAQLHGDRTKVYITDIDRLVGLMETNVNLNHLAETVSV--EILS 148
           LELGSGTGLVG+          + ++V++TD+  +V  + TN  LN L+   SV  ++L 
Sbjct: 238 LELGSGTGLVGITY--TISHSNEFSQVFLTDLPEIVPNLRTNAKLNDLSTHNSVIADVLD 295

Query: 149 WG--EPLKEKFGPDAKADKVDLVLAADCVY 176
           W   +   EK+G      + D++L AD +Y
Sbjct: 296 WTNHDSFVEKYG----DIQFDIILIADPIY 321

>Skud_10.352 Chr10 complement(622581..623591) [1011 bp, 336 aa] {ON}
           YJR129C (REAL)
          Length = 336

 Score = 47.8 bits (112), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 58/225 (25%), Positives = 96/225 (42%), Gaps = 26/225 (11%)

Query: 2   TELLDF-TTQFIDLVPSRPVEHLGDSDLSFGGQVEPALKIHED----GGENGCGGKLWVA 56
           TE+ D+   ++I+L+ +R  +      + +    +  ++I E        +  G + W A
Sbjct: 80  TEISDYLYEKYIELLSTRKPDPTMKEVVRYRFDEKVKIRIEETPNLISAASTTGFRTWEA 139

Query: 57  GELLCDYLLENSDAKGILSKRMVEMDVKAPFLNILELGSGTGLVGLCAGSVAQLHGDRTK 116
              + D+L+     +  L   M + D K   LN+LE+G+GTG+V L      +   +R  
Sbjct: 140 ALYMGDFLINKPLQQLAL---MQKEDRKK--LNVLEIGAGTGIVSLVLLEKYREFVNR-- 192

Query: 117 VYITDID------RLVGLMETNVNLNHLAETVSVEILSWGEPLKEKFGPDAKADKVDLVL 170
           +Y+TD D      +L    E N  L      V ++ L WG         D   D +DLV+
Sbjct: 193 MYVTDGDSNLVERQLKRNFELNDALCENGPDVKLQRLWWG--------SDRIPDDIDLVV 244

Query: 171 AADCVYLETAFPLLEKTLLDLTEGDTPPAVLMSYRKRRKADKNFF 215
           AAD  Y  T FP L + L +          L+S   R ++    F
Sbjct: 245 AADVTYDSTIFPELCQCLAECLAISRCKMCLLSATIRSESTDKLF 289

>AER240W Chr5 (1080474..1081646) [1173 bp, 390 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YBR271W
          Length = 390

 Score = 47.8 bits (112), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 39/124 (31%), Positives = 64/124 (51%), Gaps = 9/124 (7%)

Query: 65  LENSDAKGILSKRMVEMDVKAPFLNILELGSGTGLVGLCAGSVAQLHGDRTKVYITDIDR 124
           L+   A  +LS+R+     K     +LELG+GTGLVG+ A ++A +  D   V++TD+  
Sbjct: 210 LKTWGASLLLSRRVAGFTGKK---RVLELGAGTGLVGI-AYALANIDAD--DVFVTDLPE 263

Query: 125 LVGLMETNVNLNHLAETVSVEILSWGEPLKEKFGPDAKADKVDLVLAADCVYLETAFPLL 184
           +V  +  N+ LN+L   V   +L W +P    F  +    + D +  AD +Y      LL
Sbjct: 264 IVPNLRHNLALNNLT-NVRASVLDWSDP--TSFLHEHGELQFDAIFVADPIYSPNHPQLL 320

Query: 185 EKTL 188
            +T+
Sbjct: 321 VQTV 324

>Ecym_5513 Chr5 (1042019..1043209) [1191 bp, 396 aa] {ON} similar to
           Ashbya gossypii AER240W
          Length = 396

 Score = 47.0 bits (110), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 49/88 (55%), Gaps = 7/88 (7%)

Query: 90  ILELGSGTGLVGLCAGSVAQLHGDRT-KVYITDIDRLVGLMETNVNLNHLAETVSVEILS 148
           +LELG+GTGLVG+   S A  H   T ++ +TD+  +V  + +N+ LN+L    + E L 
Sbjct: 240 VLELGAGTGLVGI---SYAIAHQASTPQIILTDLPDIVPNLRSNIKLNNLKNVHAAE-LD 295

Query: 149 WGEPLKEKFGPDAKADKVDLVLAADCVY 176
           W +     F      DK D++L +D +Y
Sbjct: 296 WTD--HSTFIAQHGGDKFDMILVSDPIY 321

>KNAG0B06720 Chr2 complement(1329424..1330275) [852 bp, 283 aa] {ON}
           Anc_4.352 YJR129C
          Length = 283

 Score = 44.3 bits (103), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 44/145 (30%), Positives = 63/145 (43%), Gaps = 16/145 (11%)

Query: 70  AKGILSKRMVEMDVKAPFLNILELGSGTGLVGLCAGSVAQLHGDRTKVYITDIDR--LVG 127
           A   LSK +VE         +LELG GTGL  +  G + +      K+Y+TD D   L  
Sbjct: 113 AATSLSKLLVEHRELTRGKTVLELGCGTGLSSITVGVLDEYK----KLYVTDGDTGILSE 168

Query: 128 LMETNVNLNHLAETVSVEILSWGEPLKEKFGPDAKADKVDLVLAADCVYLETAFPLLEKT 187
           +   N++LN +   V  + L W          D     +D+V+ AD  Y  T FP L  T
Sbjct: 169 VTTPNLSLNKVERDVQCQRLVWA-------SEDRVPGDIDVVVGADITYDPTVFPEL-CT 220

Query: 188 LLD--LTEGDTPPAVLMSYRKRRKA 210
            LD  L +     A+L    + R+ 
Sbjct: 221 CLDECLQQPKCQCAILACTERNRET 245

>YJR129C Chr10 complement(664000..665019) [1020 bp, 339 aa] {ON}
           Putative protein of unknown function; predicted
           S-adenosylmethionine-dependent methyltransferase of the
           seven beta-strand family; green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm
          Length = 339

 Score = 44.3 bits (103), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 41/136 (30%), Positives = 62/136 (45%), Gaps = 20/136 (14%)

Query: 88  LNILELGSGTGLVGLCAGSVAQLHGDRTKVYITDIDRLVGLMET----NVNLNHLAET-- 141
           LN+LE+G+GTG+V L    + + H    K+Y+TD D    L+ET    N  LN+      
Sbjct: 168 LNVLEVGAGTGIVSLVI--LQKYHEFVNKMYVTDGDS--NLVETQLKRNFELNNEVRENE 223

Query: 142 --VSVEILSWGEPLKEKFGPDAKADKVDLVLAADCVYLETAFPLLEKTLLDLTEGDTPPA 199
             + ++ L W        G D   + +DLV+ AD  Y  T  P L + L +    D    
Sbjct: 224 PDIKLQRLWW--------GSDRVPEDIDLVVGADVTYDPTILPDLCECLAECLALDRCKL 275

Query: 200 VLMSYRKRRKADKNFF 215
            L+S   R ++    F
Sbjct: 276 CLLSATIRSESTVQLF 291

>CAGL0M00572g Chr13 (68018..69001) [984 bp, 327 aa] {ON} similar to
           uniprot|P47163 Saccharomyces cerevisiae YJR129c
          Length = 327

 Score = 43.1 bits (100), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 51/178 (28%), Positives = 76/178 (42%), Gaps = 18/178 (10%)

Query: 48  GCGGKLWVAGELLCDYLLENSDAKGILSKRMVEMDVKAPFLNILELGSGTGLVGLCAGSV 107
             G + W A   L  YL++   +           +V A    ILELGSGTGLV L     
Sbjct: 129 STGNRTWEAAVYLGLYLIDQCAS-----------NVVAAPSRILELGSGTGLVSLL---Y 174

Query: 108 AQLHG-DRTKVYITDIDRLVGLMETNVNLNHLAETVSVEILSWGEPLKEKFGPDAKADKV 166
            QL+  D+  +   D D +   +  N++LN L   + V+ L WG P     G D + D  
Sbjct: 175 QQLYPFDKLTMTDGDWDVVRKRIPGNLSLNDLKPGLEVKQLVWG-PRDANSG-DNQWD-Y 231

Query: 167 DLVLAADCVYLETAFPLLEKTLLDLTEGDTPPAVLMSYRKRRKADKNFFRLIRKNFKI 224
           DL+L +D  Y +     L + L  L + D     L+    R +A    F    + +K+
Sbjct: 232 DLILGSDLTYDDRILEPLCQALQWLLKTDGSNEALLGATVRNEATTALFEKYMREYKL 289

>Kpol_1028.81 s1028 (182083..183093) [1011 bp, 336 aa] {ON}
           (182083..183093) [1011 nt, 337 aa]
          Length = 336

 Score = 43.1 bits (100), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 39/104 (37%), Positives = 55/104 (52%), Gaps = 14/104 (13%)

Query: 89  NILELGSGTGLVGLCAGSVAQLHGDRTKVYITDID-RLV-GLMETNVNLNHLA--ETVSV 144
           NILELG+GTGLV +  G   Q      K+Y+TD D +LV G +  N N N L+  + V +
Sbjct: 167 NILELGAGTGLVSI--GLCKQYEDSIDKIYVTDGDSQLVEGQLLKNFNENELSHNDRVIL 224

Query: 145 EILSWGEPLKEKFGPDAKADKVDLVLAADCVYLETAFPLLEKTL 188
           + L W          D   D +DL++AAD  Y  +  P L +T+
Sbjct: 225 QKLWWN-------VDDVPLD-LDLIVAADVTYDSSVVPDLCETI 260

>Ecym_1127 Chr1 (260356..261318) [963 bp, 320 aa] {ON} similar to
           Ashbya gossypii AER161C
          Length = 320

 Score = 42.4 bits (98), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 48/183 (26%), Positives = 72/183 (39%), Gaps = 35/183 (19%)

Query: 9   TQFIDLVPSRPVE--HLGDSDLSFGGQVEPALKIHED----GGENGCGGKLWVAGELLCD 62
           T++I L+P +  +  H      +FG   E  + + E           G + W A   LC 
Sbjct: 84  TRYIGLLPLKQQDPTHTDIVRYTFGEDSEIEIDVRETRNLVCASGSTGFRTWEAALYLCH 143

Query: 63  YLLENSDAKGILSKRMVEMDVKAPFLNILELGSGTGLVGLCAGSVAQLHGDRTKVYITDI 122
           YL E+                +  F  +LELG+GTG+V L   +  +L   +   Y TD 
Sbjct: 144 YLCES----------------RPRFGTMLELGAGTGIVSL---TWHKLQSGQFMTYATDG 184

Query: 123 DRLVGLMETNVNLNHLAETV---SVEILSWGEPLKEKFGPDAKADKVDLVLAADCVYLET 179
           D+       N+    L ET     V++      L+          K D++LAAD  Y  T
Sbjct: 185 DK-------NIIGKQLKETFISNGVDLDKGNVHLQRLLWNVDSIPKNDIILAADVTYDHT 237

Query: 180 AFP 182
           A P
Sbjct: 238 AIP 240

>KLLA0B04444g Chr2 (395811..396737) [927 bp, 308 aa] {ON} similar to
           uniprot|P47163 Saccharomyces cerevisiae YJR129C Putative
           S-adenosylmethionine-dependent methyltransferase of the
           seven beta-strand family
          Length = 308

 Score = 41.6 bits (96), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 42/147 (28%), Positives = 62/147 (42%), Gaps = 26/147 (17%)

Query: 50  GGKLWVAGELLCDYLLENSDAKGILSKRMVEMDVKAPFLNILELGSGTGLVGLCAGSVAQ 109
           G + W A   LC Y+ ++    G+       M         LELG GTG++ +    +  
Sbjct: 115 GFRTWEAALFLCHYMTQH---PGLFVTHDSLM---------LELGCGTGIISILYKMIKD 162

Query: 110 LHGD--RTKVYITDID-RLVGLMETNVNLN-HLAETVSVEI----LSWGEPLKEKFGPDA 161
             GD     + +TD D  L+  + TN  LN  L+    V I    L W E     +    
Sbjct: 163 SQGDCKAGTIIVTDGDSNLLQQVSTNFQLNGSLSNDGDVNIGFQRLRWNEDELSNY---- 218

Query: 162 KADKVDLVLAADCVYLETAFPLLEKTL 188
             +++DL+LAAD  Y  +  P L K L
Sbjct: 219 --NEIDLILAADVTYDTSVIPDLVKCL 243

>SAKL0G18106g Chr7 complement(1569137..1570144) [1008 bp, 335 aa]
           {ON} similar to uniprot|P47163 Saccharomyces cerevisiae
           YJR129C Putative S-adenosylmethionine-dependent
           methyltransferase of the seven beta-strand family
          Length = 335

 Score = 40.0 bits (92), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 38/138 (27%), Positives = 59/138 (42%), Gaps = 22/138 (15%)

Query: 50  GGKLWVAGELLCDYLLENSDAKGILSKRMVEMDVKAPFLNILELGSGTGLVGLCAGSVAQ 109
           G + W A   L  +L +NSD         +  ++    + ++ELG+GTG+V +    +  
Sbjct: 142 GFRTWEAALYLSQHLCKNSDE--------IMDELGKDQITVVELGAGTGIVSMTWAKLQ- 192

Query: 110 LHGDRTKVYITDIDR--LVGLMETNVNLNHL-AETVSVEILSWGEPLKEKFGPDAKADKV 166
            H    K+Y+TD D   +   M  N  LN++       + L W          D   D  
Sbjct: 193 -HNRLEKLYVTDGDSSLVENQMHRNAQLNNVGGPKYCFQKLWWNS--------DDVPDN- 242

Query: 167 DLVLAADCVYLETAFPLL 184
           DL+LAAD  Y  +  P L
Sbjct: 243 DLILAADVTYDSSVIPDL 260

>ZYRO0B14916g Chr2 complement(1217570..1218466) [897 bp, 298 aa]
           {ON} weakly similar to uniprot|P47163 Saccharomyces
           cerevisiae YJR129C Putative
           S-adenosylmethionine-dependent methyltransferase of the
           seven beta-strand family
          Length = 298

 Score = 38.9 bits (89), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 41/140 (29%), Positives = 54/140 (38%), Gaps = 32/140 (22%)

Query: 50  GGKLWVAGELLCDYLLENSDAKGILSKRMVEMDVKAPFLNILELGSGTGLVGLCAGSVAQ 109
           G + W A   LC YL                 D       +LE+G+GTGLV     +   
Sbjct: 117 GHRTWEASLYLCQYLFRQ--------------DWLPQVNEVLEIGAGTGLV----STALA 158

Query: 110 LHGDRTKVYITDIDRL-VGLMETNVNLNHLAETVSVEILSWGEPLKEKFGPDAKADKVDL 168
           L G   +V  TD D + V  +    NLN +   +  ++L WG           K  K DL
Sbjct: 159 LAGH--QVTSTDGDPMVVEQLRKTFNLNEV--NIEAQVLEWGL---------QKPPKSDL 205

Query: 169 VLAADCVYLETAFPLLEKTL 188
           V+AAD  Y     P L   L
Sbjct: 206 VVAADVTYDTAVIPSLGNCL 225

>TDEL0D00640 Chr4 (113100..114083) [984 bp, 327 aa] {ON} Anc_4.352
           YJR129C
          Length = 327

 Score = 38.9 bits (89), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 49/102 (48%), Gaps = 14/102 (13%)

Query: 90  ILELGSGTGLVGLCAGSVAQLHGDR-TKVYITDID-RLVGLMETNVNLNHL-AETVSVEI 146
           +LELG+GTG+V   + ++A  +  R  K+Y+TD D  L      N +LN +       E 
Sbjct: 162 VLELGAGTGMV---SATLALTNPGRLDKLYVTDGDWHLTQQARKNFSLNGIETSNTYFEQ 218

Query: 147 LSWGEPLKEKFGPDAKADKVDLVLAADCVYLETAFPLLEKTL 188
           L W E        D    K+D V+AAD  Y  T  P L K +
Sbjct: 219 LRWNE--------DPVPTKLDYVVAADVTYDSTVVPDLCKCI 252

>CAGL0M09801g Chr13 complement(970260..971030) [771 bp, 256 aa] {ON}
           similar to uniprot|Q05874 Saccharomyces cerevisiae
           YLR285w
          Length = 256

 Score = 38.5 bits (88), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 51/180 (28%), Positives = 78/180 (43%), Gaps = 28/180 (15%)

Query: 55  VAGELLCDYLLENSDAKGILSKRMVEMDVKAPFL----NILELGSGTGLVGLCAGSVAQL 110
           V    L  +LL N+   GI + R ++   K P L    N+LELG+ + L  L AG +   
Sbjct: 53  VGSSPLWGHLLWNA---GIYTARHLD---KYPELVSNKNVLELGAASALPSLVAGLIGA- 105

Query: 111 HGDRTKVYITDID--RLVGLMETNVNL---NHLAETVSVEILSWG---EPLKEKFGPDAK 162
                +  +TD     L+  ++ NVN    + L E V VE   WG   +PL      D  
Sbjct: 106 ----KRAVVTDYPDADLMANIQYNVNTIIPDELKENVRVEGYIWGNEYDPLTIHLDGDK- 160

Query: 163 ADKVDLVLAADCVYLETAFPLLEKTLLDLTEGDTPPAVLMSYRKRR--KADKNFFRLIRK 220
             K DL++ +D V+       L +T  DL   +    V+ S  +    +AD  FF   ++
Sbjct: 161 --KFDLIILSDLVFNHNQHDKLLQTTKDLLATNGKALVVFSPHRPHLLEADLQFFETCKE 218

>ZYRO0D14542g Chr4 (1231299..1232090) [792 bp, 263 aa] {ON} similar
           to uniprot|Q05874 Saccharomyces cerevisiae YLR285W NNT1
           Putative nicotinamide N-methyltransferase has a role in
           rDNA silencing and in lifespan determination
          Length = 263

 Score = 37.4 bits (85), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 57/235 (24%), Positives = 87/235 (37%), Gaps = 45/235 (19%)

Query: 13  DLVPSRPVEHLGDSDLSFGGQVEPALKIHEDGGENGCGGKLWVAGELLCDYLLENSDAKG 72
           D +P  P  H  D +  +  +        E   +N       V    L  ++L N+   G
Sbjct: 18  DFLPPPPEAHFADYEREYVSK--------ESDSQNKKVQLRLVGKSPLWGHMLWNA---G 66

Query: 73  ILSKRMVEMDVKAPFL----NILELGSGTGLVGLCAGSVAQLHGDRTKVYITDIDRLVGL 128
           I + + ++   K P L    N+LELG+   L  +  G +        KV  TD      +
Sbjct: 67  IYTAKHLD---KHPGLVKGKNVLELGAAAALPTVVCGLIGA-----NKVVSTDYPEPELI 118

Query: 129 METNVNLNHL------------AETVSVEILSWG---EPLKEKFGPDAKADKVDLVLAAD 173
                N++H                V VE   WG   EP+    G      K DL++ +D
Sbjct: 119 QNIQYNVDHELYGGKPFSQDSNDRKVVVEGYIWGNEYEPILSHTG----GSKFDLIILSD 174

Query: 174 CVYLETAFPLLEKTLLDLTEGDTPPAVLMSYRKRR--KADKNFFRLIRKNFKIVP 226
           CV+  T    L + + DL   D    V+ S  + R    D +FF    K F + P
Sbjct: 175 CVFNHTEHRKLLRCIKDLLANDGKALVVFSPHRPRLLDVDLSFFE-TAKEFGLAP 228

>KLTH0D17996g Chr4 (1490856..1491809) [954 bp, 317 aa] {ON} similar
           to uniprot|P47163 Saccharomyces cerevisiae YJR129C
           Putative S-adenosylmethionine-dependent
           methyltransferase of the seven beta-strand family
          Length = 317

 Score = 37.7 bits (86), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 56/216 (25%), Positives = 82/216 (37%), Gaps = 44/216 (20%)

Query: 10  QFIDLVPSR-PVEHLGD-------SDLSFGGQVEPALKIHEDGGENGCGGKLWVAGELLC 61
           +++DL+P + PV    D        +L+   Q +P L           G + W +   L 
Sbjct: 80  RYVDLLPLKAPVPTFTDIIRYTLNDELAIDVQEQPYLLC----ASGTTGFRTWESALYLS 135

Query: 62  DYLLENSDAKGILSKRMVEMDVKAPFLNILELGSGTGLVGLCAGSVAQLHGDRTKVYITD 121
           +YL EN            E      F   LELG+GTGLV +    +    G   ++ +TD
Sbjct: 136 EYLAEN----------FPEFSA-GKFSRALELGAGTGLVSIAWAKL--FKGYIKELIVTD 182

Query: 122 IDRLVGLMETNVNLN---------HLAETVSVEILSWGEPLKEKFGPDAKADKVDLVLAA 172
            D  +      VN           H       + L WGE        DA   +VD+VLAA
Sbjct: 183 GDSSLVEQAARVNFKLNGIDTRECHGDCAYKFQRLWWGE--------DA-VPEVDIVLAA 233

Query: 173 DCVYLETAFPLLEKTL-LDLTEGDTPPAVLMSYRKR 207
           D  Y  +  P L   L   L++G     V  + R +
Sbjct: 234 DVTYDSSVIPSLTHCLKTALSQGTQFALVAATVRNK 269

>Smik_12.362 Chr12 (645535..646389) [855 bp, 284 aa] {ON} YLR285W
           (REAL)
          Length = 284

 Score = 36.2 bits (82), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 45/154 (29%), Positives = 65/154 (42%), Gaps = 29/154 (18%)

Query: 90  ILELGSGTGLVG-LCAGSVAQLHGDRTKVYITDIDR--LVGLMETNVNLNHLAE--TVSV 144
           +LELG+   L   +CA + AQ+      V  TD     L+  +E N+  N   E   VS 
Sbjct: 108 VLELGAAAALPSVICALNGAQM------VVSTDYPDPDLMENIEYNIKSNVPEEFGNVST 161

Query: 145 EILSWG----------EPLKEKFGPDAKADKVDLVLAADCVYLETAFPLLEKTLLDLTEG 194
           E   WG          E +K   G      K DL++ +D V+  T    L +T  DL   
Sbjct: 162 ENYIWGNDYSPLLAHIEKVKSNIG------KFDLIILSDLVFNHTEHHKLLQTTKDLLAE 215

Query: 195 DTPPAVLMSYRKRR--KADKNFFRLIRKNFKIVP 226
           +    V+ S  + +  K D  FF+L    F +VP
Sbjct: 216 NGKALVVFSPHRPKLLKKDLEFFQLANDEFHLVP 249

>AER161C Chr5 complement(942007..942957) [951 bp, 316 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJR129C
          Length = 316

 Score = 35.4 bits (80), Expect = 0.092,   Method: Compositional matrix adjust.
 Identities = 44/141 (31%), Positives = 56/141 (39%), Gaps = 41/141 (29%)

Query: 50  GGKLWVAGELLCDYLLENSDAKGILSKRMVEMDVKAPFLNILELGSGTGLVGLCAGSVAQ 109
           G + W A   L DYL      + +                 LELG+GTGLV     S+A 
Sbjct: 129 GHRTWEAALYLADYLCRVPLRQSV----------------ALELGAGTGLV-----SLAW 167

Query: 110 LHGD-RTKVYITDIDR--LVGLMETNVNLNHLAET--VSVEILSWGEPLKEKFGPDAKAD 164
           L     +  YITD D   L G +  N+ LN L  +   S+  L W              D
Sbjct: 168 LRSRPESSAYITDGDSALLEGHLAENLALNGLRSSPRASLRRLWW------------NVD 215

Query: 165 KV---DLVLAADCVYLETAFP 182
           +V   D+VLAAD  Y  T  P
Sbjct: 216 EVPQNDIVLAADVTYDSTVLP 236

>YDR326C Chr4 complement(1120609..1124925) [4317 bp, 1438 aa] {ON}
            YSP2Protein involved in programmed cell death; mutant
            shows resistance to cell death induced by amiodarone or
            intracellular acidification
          Length = 1438

 Score = 33.5 bits (75), Expect = 0.54,   Method: Composition-based stats.
 Identities = 35/141 (24%), Positives = 60/141 (42%), Gaps = 25/141 (17%)

Query: 112  GDRTKVYITDIDRLVGLMETNVNLNHLA-----ETVSVEILSWGEPLKEKFGPDAKADKV 166
             D TK+ I++I +++   ++N+N  H A     E   + + + G P+ +   PD +  K 
Sbjct: 1000 ADTTKIMISEIKKILSDEDSNINSKHQASNNESEEEIINLPTIGPPVHDPTEPDFQKGKD 1059

Query: 167  DLVLAADCVYLETAFPLLEKTLLDLTEGDTPPAVLMSYRKRRKADKNFFRLIRKNFKIVP 226
            D V+       +   P+   T+  L  GD       SY K+   ++N       NF +  
Sbjct: 1060 DTVIDE-----KINIPVPLGTVFSLLYGDD-----TSYIKKIIENQN-------NFNVCD 1102

Query: 227  ITNFI---RYDYYLKKQTHLF 244
            I  F+   R   Y KK  + F
Sbjct: 1103 IPKFVNNAREITYTKKLNNSF 1123

>Skud_4.594 Chr4 complement(1056682..1060995) [4314 bp, 1437 aa] {ON}
            YDR326C (REAL)
          Length = 1437

 Score = 33.5 bits (75), Expect = 0.58,   Method: Composition-based stats.
 Identities = 34/138 (24%), Positives = 60/138 (43%), Gaps = 19/138 (13%)

Query: 112  GDRTKVYITDIDRLVGLMETNVNLNHL-----AETVSVEILSWGEPLKEKFGPDAKADKV 166
             D TK  I+++  ++G  ++N+NL H      +E  +V + + G  + +   PD +  K 
Sbjct: 998  ADTTKTMISEVKNILGDEDSNINLKHQSNNSESEGETVNLPTVGPSVHDPTEPDFQKGKD 1057

Query: 167  DLVLAADCVYLETAFPLLEKTLLDLTEGDTPPAVLMSYRKRRKADKNFFRLIRKNFKIVP 226
            D ++  +        P+   T+  L  GD       SY K+   ++N F +      I  
Sbjct: 1058 DTIIDEN-----INIPVPLGTVYSLLYGDD-----TSYIKKIIENQNNFNVC----DIPK 1103

Query: 227  ITNFIRYDYYLKKQTHLF 244
             TN  R   Y+KK  + F
Sbjct: 1104 FTNNTREINYIKKLNNSF 1121

>TBLA0B06150 Chr2 (1451595..1452545) [951 bp, 316 aa] {ON} Anc_4.352
           YJR129C
          Length = 316

 Score = 32.7 bits (73), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 36/139 (25%), Positives = 59/139 (42%), Gaps = 31/139 (22%)

Query: 44  GGENGCGGKLWVAGELLCDYLLENSDAKGILSKRMVEMDVKAPFLNILELGSGTGLVGLC 103
            G    G + W A   +  YLLE+   +G                N++E+G+GTG+V + 
Sbjct: 120 SGNGTTGLRTWEAALYMILYLLEHP-VRG----------------NVVEIGAGTGMVSI- 161

Query: 104 AGSVAQLHGDR-TKVYITDIDRLVG--LMETNVNLNHLAETVSVEI--LSWGEP-LKEKF 157
              + ++ G   + V +TD D  V    +  N  LN + +   V+   + W E  L    
Sbjct: 162 --GIMKMQGQNISSVLVTDGDEYVANKQLPKNFQLNGIVDDTRVKFQKIRWNEDHLVNGD 219

Query: 158 GPDAKADKVDLVLAADCVY 176
           GP+     VD ++ AD  Y
Sbjct: 220 GPN-----VDYLVGADVTY 233

>AGL019W Chr7 (686017..687588) [1572 bp, 523 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL020C (ULP1)
          Length = 523

 Score = 30.8 bits (68), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 25/56 (44%), Gaps = 3/56 (5%)

Query: 72  GILSKRMVEMDVKAPFLNILELGSGTGLVGLCAGSVAQLHGDRTKVYITDIDRLVG 127
           G+L KR+   D+  P       G G+G +G     VAQ    +    +  IDRL+ 
Sbjct: 59  GVLKKRLHSDDINVPQKRSRPAGQGSGFLGALPQKVAQT---KEAALVEKIDRLIA 111

>KNAG0H01760 Chr8 (314375..315550) [1176 bp, 391 aa] {ON} Anc_1.418
           YCL001W-B
          Length = 391

 Score = 30.4 bits (67), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 34/74 (45%), Gaps = 4/74 (5%)

Query: 153 LKEKFGPDAKADKVDLVL----AADCVYLETAFPLLEKTLLDLTEGDTPPAVLMSYRKRR 208
           LKE   P+AKAD   +VL    A  CV   ++  L +K    L +  T   V+    K  
Sbjct: 130 LKEACNPEAKADTAAVVLQEGVAHVCVLTASSTILKQKIEYSLPKKKTSTDVMKFDEKTE 189

Query: 209 KADKNFFRLIRKNF 222
           K  K  +  ++KNF
Sbjct: 190 KFYKAIYEAMKKNF 203

>NDAI0B03680 Chr2 complement(922452..923492) [1041 bp, 346 aa] {ON} 
          Length = 346

 Score = 30.4 bits (67), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 23/44 (52%)

Query: 148 SWGEPLKEKFGPDAKADKVDLVLAADCVYLETAFPLLEKTLLDL 191
           SWG    +       AD+  LVL ++ +Y     P++ +TLLDL
Sbjct: 267 SWGRTFTKLLHTIIPADQNILVLTSETIYQPENLPVIAETLLDL 310

>SAKL0F03960g Chr6 complement(317042..319306) [2265 bp, 754 aa] {ON}
           similar to uniprot|P39518 Saccharomyces cerevisiae
           YER015W FAA2 Long chain fatty acyl-CoA synthetase
           accepts a wider range of acyl chain lengths than Faa1p
           preferring C9:0-C13:0 involved in the activation of
           endogenous pools of fatty acids
          Length = 754

 Score = 30.4 bits (67), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 29/57 (50%), Gaps = 2/57 (3%)

Query: 187 TLLDLTEGDTPPAVLMSYRKRRKADKNFFRLIRKNFKIVPITNFIRYDYYLKKQTHL 243
           TL +L E  T PA     +K  + DK+    +   FK  P+T F+ Y  +LKKQ  L
Sbjct: 14  TLAELVE--TNPAYAQLKQKLSRYDKDSKEYLIALFKEFPLTKFLGYQSFLKKQADL 68

>SAKL0A07986g Chr1 complement(707624..708436) [813 bp, 270 aa] {ON}
           highly similar to uniprot|Q05874 Saccharomyces
           cerevisiae YLR285W NNT1 Putative nicotinamide N-
           methyltransferase has a role in rDNA silencing and in
           lifespan determination
          Length = 270

 Score = 29.6 bits (65), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 46/193 (23%), Positives = 72/193 (37%), Gaps = 37/193 (19%)

Query: 55  VAGELLCDYLLENSDAKGILSKRMVEMDVK-APFLNILELGSGTGLVGLCAGSVAQLHGD 113
           V    L  +LL N+   GI + R ++ ++       +LELG+   L  +  G +      
Sbjct: 52  VGSSPLWGHLLWNA---GIYTGRHLDENIGLVKDKTVLELGAAGALPSIICGLIGA---- 104

Query: 114 RTKVYITDIDRLVGLMETNVNLNHL--------------------AETVSVEILSWG--- 150
            +KV +TD      L     N++H                        V VE   WG   
Sbjct: 105 -SKVVVTDFPDADLLQNIQYNVDHQIYQGNELPADGDDARDQELQRRDVVVEGYIWGNDY 163

Query: 151 EPLKEKFGPDAKADKVDLVLAADCVYLETAFPLLEKTLLDLTEGDTPPAVLMSYRKRR-- 208
           EPL +  G      K DL++ +D V+  +    L  T  DL   D    V+ S  +    
Sbjct: 164 EPLVKHIG---SGKKFDLIILSDLVFNHSEHAKLLNTTKDLLAKDGKALVVFSPHRPWLL 220

Query: 209 KADKNFFRLIRKN 221
            AD  FF   +++
Sbjct: 221 NADLQFFETAKEH 233

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.141    0.415 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 27,692,044
Number of extensions: 1217484
Number of successful extensions: 2617
Number of sequences better than 10.0: 68
Number of HSP's gapped: 2585
Number of HSP's successfully gapped: 68
Length of query: 251
Length of database: 53,481,399
Length adjustment: 107
Effective length of query: 144
Effective length of database: 41,212,137
Effective search space: 5934547728
Effective search space used: 5934547728
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 64 (29.3 bits)