Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_27.115092.290ON26126111851e-166
KLTH0G10450g2.290ON26126110321e-142
SAKL0E07590g2.290ON2602348481e-114
Ecym_33292.290ON2582347791e-104
TDEL0G022002.290ON2612327551e-100
NCAS0B062402.290ON2602327531e-100
TBLA0B059602.290ON2662347265e-96
Skud_9.802.290ON2642367231e-95
Kpol_1003.402.290ON2612327161e-94
ZYRO0A01958g2.290ON2632327161e-94
Smik_9.862.290ON2642367118e-94
YIL093C (RSM25)2.290ON2642367082e-93
KLLA0E08273g2.290ON2612307056e-93
KAFR0J013502.290ON2642336919e-91
Suva_9.1062.290ON2642366874e-90
CAGL0D04158g2.290ON2722336623e-86
TPHA0C034202.290ON2682376571e-85
NDAI0B035402.290ON2612356535e-85
KNAG0A054102.290ON2662326441e-83
ADL211C2.290ON2251796001e-77
SAKL0H19514gna 1ON50635702.1
Smik_8.1605.376ON103875658.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_27.11509
         (261 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_27.11509 s27 (831150..831935) [786 bp, 261 aa] {ON} YIL093C...   461   e-166
KLTH0G10450g Chr7 complement(884037..884822) [786 bp, 261 aa] {O...   402   e-142
SAKL0E07590g Chr5 (613875..614657) [783 bp, 260 aa] {ON} similar...   331   e-114
Ecym_3329 Chr3 complement(630346..631122) [777 bp, 258 aa] {ON} ...   304   e-104
TDEL0G02200 Chr7 complement(433032..433817) [786 bp, 261 aa] {ON...   295   e-100
NCAS0B06240 Chr2 (1178232..1179014) [783 bp, 260 aa] {ON} Anc_2....   294   e-100
TBLA0B05960 Chr2 complement(1408779..1409579) [801 bp, 266 aa] {...   284   5e-96
Skud_9.80 Chr9 complement(164635..165429) [795 bp, 264 aa] {ON} ...   283   1e-95
Kpol_1003.40 s1003 complement(97903..98688) [786 bp, 261 aa] {ON...   280   1e-94
ZYRO0A01958g Chr1 complement(162742..163533) [792 bp, 263 aa] {O...   280   1e-94
Smik_9.86 Chr9 complement(167101..167895) [795 bp, 264 aa] {ON} ...   278   8e-94
YIL093C Chr9 complement(187990..188784) [795 bp, 264 aa] {ON}  R...   277   2e-93
KLLA0E08273g Chr5 (745145..745930) [786 bp, 261 aa] {ON} similar...   276   6e-93
KAFR0J01350 Chr10 (247931..248725) [795 bp, 264 aa] {ON} Anc_2.2...   270   9e-91
Suva_9.106 Chr9 complement(182086..182880) [795 bp, 264 aa] {ON}...   269   4e-90
CAGL0D04158g Chr4 complement(410309..411127) [819 bp, 272 aa] {O...   259   3e-86
TPHA0C03420 Chr3 complement(750353..751159) [807 bp, 268 aa] {ON...   257   1e-85
NDAI0B03540 Chr2 (890148..890933) [786 bp, 261 aa] {ON} Anc_2.29...   256   5e-85
KNAG0A05410 Chr1 (798238..799038) [801 bp, 266 aa] {ON} Anc_2.29...   252   1e-83
ADL211C Chr4 complement(333418..334095) [678 bp, 225 aa] {ON} Sy...   235   1e-77
SAKL0H19514g Chr8 complement(1719913..1721433) [1521 bp, 506 aa]...    32   2.1  
Smik_8.160 Chr8 complement(245207..248323) [3117 bp, 1038 aa] {O...    30   8.5  

>Kwal_27.11509 s27 (831150..831935) [786 bp, 261 aa] {ON} YIL093C
           (RSM25) - mitochondrial ribosome small subunit component
           [contig 27] FULL
          Length = 261

 Score =  461 bits (1185), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 230/261 (88%), Positives = 230/261 (88%)

Query: 1   MKVQQNAVNVLERTSSYLRAGILKKTPAWYEVVAQIPPSKRFVREPRLVNPSTNDEIAKL 60
           MKVQQNAVNVLERTSSYLRAGILKKTPAWYEVVAQIPPSKRFVREPRLVNPSTNDEIAKL
Sbjct: 1   MKVQQNAVNVLERTSSYLRAGILKKTPAWYEVVAQIPPSKRFVREPRLVNPSTNDEIAKL 60

Query: 61  SEFRESYNFENRSYKTRASRGDKQVSGNKLYKAPKLKYAEDKLRELFFEQHPWELSRPKM 120
           SEFRESYNFENRSYKTRASRGDKQVSGNKLYKAPKLKYAEDKLRELFFEQHPWELSRPKM
Sbjct: 61  SEFRESYNFENRSYKTRASRGDKQVSGNKLYKAPKLKYAEDKLRELFFEQHPWELSRPKM 120

Query: 121 LVENSGIQDYDWSTLQQLGKPLDGESVVQRTLYLLKSKKHQELLAAYDQARFEFYRLRIX 180
           LVENSGIQDYDWSTLQQLGKPLDGESVVQRTLYLLKSKKHQELLAAYDQARFEFYRLRI 
Sbjct: 121 LVENSGIQDYDWSTLQQLGKPLDGESVVQRTLYLLKSKKHQELLAAYDQARFEFYRLRIQ 180

Query: 181 XXXXXXXXXXXXXMLGSVFGPSAIDFGLKKEQKIIDVWKQKAIDQSELLSARNTXXXXXX 240
                        MLGSVFGPSAIDFGLKKEQKIIDVWKQKAIDQSELLSARNT      
Sbjct: 181 EEVQNQVAQEEAEMLGSVFGPSAIDFGLKKEQKIIDVWKQKAIDQSELLSARNTNPSESW 240

Query: 241 XXXXXXXXXXXKVQETEEIKL 261
                      KVQETEEIKL
Sbjct: 241 SSSPSSQDNDSKVQETEEIKL 261

>KLTH0G10450g Chr7 complement(884037..884822) [786 bp, 261 aa] {ON}
           similar to uniprot|P40496 Saccharomyces cerevisiae
           YIL093C RSM25 Mitochondrial ribosomal protein of the
           small subunit
          Length = 261

 Score =  402 bits (1032), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 193/261 (73%), Positives = 216/261 (82%)

Query: 1   MKVQQNAVNVLERTSSYLRAGILKKTPAWYEVVAQIPPSKRFVREPRLVNPSTNDEIAKL 60
           MKVQQNAVNVLERTSSYL+AG+LKKTPAWY+VVA +PPSKRFVREPRLVNPSTN E AKL
Sbjct: 1   MKVQQNAVNVLERTSSYLKAGLLKKTPAWYDVVAFVPPSKRFVREPRLVNPSTNKETAKL 60

Query: 61  SEFRESYNFENRSYKTRASRGDKQVSGNKLYKAPKLKYAEDKLRELFFEQHPWELSRPKM 120
           SEF E Y+ ENRSYKTRASR ++QVSG+KL+ APKLKYAEDKLRE+F+EQHPWELSRPKM
Sbjct: 61  SEFAEQYSVENRSYKTRASRSERQVSGSKLFAAPKLKYAEDKLREVFYEQHPWELSRPKM 120

Query: 121 LVENSGIQDYDWSTLQQLGKPLDGESVVQRTLYLLKSKKHQELLAAYDQARFEFYRLRIX 180
           LVENSG  DYDWST+QQLGKPLDGESVVQRTLYLL++K HQELLAAYDQARFEFYRLRI 
Sbjct: 121 LVENSGTHDYDWSTIQQLGKPLDGESVVQRTLYLLRTKAHQELLAAYDQARFEFYRLRIQ 180

Query: 181 XXXXXXXXXXXXXMLGSVFGPSAIDFGLKKEQKIIDVWKQKAIDQSELLSARNTXXXXXX 240
                        M GSVFGPSAIDFGL+KEQKIIDVWKQKAIDQ+E++SARN       
Sbjct: 181 EEVQNQVAQEEAEMFGSVFGPSAIDFGLEKEQKIIDVWKQKAIDQTEVMSARNINPSESW 240

Query: 241 XXXXXXXXXXXKVQETEEIKL 261
                      K ++T+E++L
Sbjct: 241 SAQESQPQSDAKAEDTKELQL 261

>SAKL0E07590g Chr5 (613875..614657) [783 bp, 260 aa] {ON} similar to
           uniprot|P40496 Saccharomyces cerevisiae YIL093C RSM25
           Mitochondrial ribosomal protein of the small subunit
          Length = 260

 Score =  331 bits (848), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 153/234 (65%), Positives = 187/234 (79%)

Query: 1   MKVQQNAVNVLERTSSYLRAGILKKTPAWYEVVAQIPPSKRFVREPRLVNPSTNDEIAKL 60
           MKVQ NAVN+LERTS+YLRAG+L K PAWY VVA +PPSK F REP++ NPS N  IA L
Sbjct: 1   MKVQTNAVNLLERTSAYLRAGLLTKAPAWYNVVASVPPSKSFAREPKITNPSNNKNIASL 60

Query: 61  SEFRESYNFENRSYKTRASRGDKQVSGNKLYKAPKLKYAEDKLRELFFEQHPWELSRPKM 120
           SE+ E+   +N +YKTR S  D++VS NKLYKAPKL YAEDKLRELF++QHPWELSRPK+
Sbjct: 61  SEYSETVGIKNGTYKTRQSGSDRKVSFNKLYKAPKLNYAEDKLRELFYQQHPWELSRPKV 120

Query: 121 LVENSGIQDYDWSTLQQLGKPLDGESVVQRTLYLLKSKKHQELLAAYDQARFEFYRLRIX 180
           L+EN+G + YDWST+QQLGKPLDGESVVQRTLYLLK KK   L+ AYDQARFEFYR+R+ 
Sbjct: 121 LIENTGEESYDWSTIQQLGKPLDGESVVQRTLYLLKEKKQLTLVNAYDQARFEFYRVRVQ 180

Query: 181 XXXXXXXXXXXXXMLGSVFGPSAIDFGLKKEQKIIDVWKQKAIDQSELLSARNT 234
                        M GSVFG S+I++GL+KEQK+I+ WK+KAI Q+EL++AR++
Sbjct: 181 QEIHEQVAQEEAEMFGSVFGSSSIEYGLEKEQKVIETWKKKAIQQTELMAARSS 234

>Ecym_3329 Chr3 complement(630346..631122) [777 bp, 258 aa] {ON}
           similar to Ashbya gossypii ADL211C
          Length = 258

 Score =  304 bits (779), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 141/234 (60%), Positives = 182/234 (77%)

Query: 1   MKVQQNAVNVLERTSSYLRAGILKKTPAWYEVVAQIPPSKRFVREPRLVNPSTNDEIAKL 60
           MK+Q NA N+LERTSS+LR G+L +TP WY+V+ + PPS +F R+P+LVNPST    AKL
Sbjct: 1   MKIQTNATNILERTSSFLRVGLLARTPVWYDVIVKSPPSTKFARQPKLVNPSTGAYTAKL 60

Query: 61  SEFRESYNFENRSYKTRASRGDKQVSGNKLYKAPKLKYAEDKLRELFFEQHPWELSRPKM 120
            EF ++ N  + +YKTRA++ +K+VS + +Y+APKL Y EDKLR LF++QHPWELSRPK+
Sbjct: 61  REFSDNRNSSSGTYKTRANKHEKRVSTSAVYRAPKLYYFEDKLRSLFYKQHPWELSRPKI 120

Query: 121 LVENSGIQDYDWSTLQQLGKPLDGESVVQRTLYLLKSKKHQELLAAYDQARFEFYRLRIX 180
           LVEN G + +DWS +QQLGKPLDGESVVQRTLYLL S +H  L+ AYDQARFEFYRLR+ 
Sbjct: 121 LVENQGDEKHDWSRIQQLGKPLDGESVVQRTLYLLGSGEHTNLIDAYDQARFEFYRLRMQ 180

Query: 181 XXXXXXXXXXXXXMLGSVFGPSAIDFGLKKEQKIIDVWKQKAIDQSELLSARNT 234
                        MLGSVFGPSA++FGL+KEQ++ID WK+KA+ Q EL+SA+ +
Sbjct: 181 QELEEQVAQEEAGMLGSVFGPSAVEFGLRKEQEVIDDWKKKALKQVELMSAKRS 234

>TDEL0G02200 Chr7 complement(433032..433817) [786 bp, 261 aa] {ON}
           Anc_2.290 YIL093C
          Length = 261

 Score =  295 bits (755), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 137/232 (59%), Positives = 182/232 (78%), Gaps = 1/232 (0%)

Query: 1   MKVQQNAVNVLERTSSYLRAGILKKTPAWYEVVAQIPPSKRFVREPRLVNPSTNDEIAKL 60
           MK+Q NAVNVLERTS+YLR+G+L+ TPAWY+VVA IPP  +F REPRL+NPS   ++A L
Sbjct: 1   MKIQTNAVNVLERTSAYLRSGLLRNTPAWYDVVASIPPKTKFTREPRLINPSNMKKLAHL 60

Query: 61  SEFRESYNFENRSYKTRASRGDKQVSGNKLYKAPKLKYAEDKLRELFFEQHPWELSRPKM 120
            +  +  N +   +KTRAS  DK+++  KLY+APKLK+ ED+LRE+F++QHPWELSRPK+
Sbjct: 61  KDHADEPNAKG-FFKTRASTLDKKINNAKLYRAPKLKFVEDQLREVFYKQHPWELSRPKV 119

Query: 121 LVENSGIQDYDWSTLQQLGKPLDGESVVQRTLYLLKSKKHQELLAAYDQARFEFYRLRIX 180
           LVEN   +++DWS +QQL KPLDGESV+QRTL+LLK+ + + L  AYDQARFEFYRLR+ 
Sbjct: 120 LVENDAEEEFDWSHIQQLEKPLDGESVIQRTLFLLKNNEGKSLTEAYDQARFEFYRLRMQ 179

Query: 181 XXXXXXXXXXXXXMLGSVFGPSAIDFGLKKEQKIIDVWKQKAIDQSELLSAR 232
                        M GS++GPSAIDFG+++EQK ID+WKQKAI++++LL+AR
Sbjct: 180 QEVEQQVAQEESEMFGSIYGPSAIDFGVQQEQKFIDIWKQKAIEETDLLAAR 231

>NCAS0B06240 Chr2 (1178232..1179014) [783 bp, 260 aa] {ON} Anc_2.290
           YIL093C
          Length = 260

 Score =  294 bits (753), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 140/232 (60%), Positives = 184/232 (79%), Gaps = 2/232 (0%)

Query: 1   MKVQQNAVNVLERTSSYLRAGILKKTPAWYEVVAQIPPSKRFVREPRLVNPSTNDEIAKL 60
           M+VQ NA+N++ERTS+YL++G+LK TPAWYEVVA+IPP+K+F REPRL+NPSTN+++A L
Sbjct: 1   MRVQTNAINIVERTSAYLKSGLLKNTPAWYEVVAKIPPTKKFTREPRLINPSTNEDLAVL 60

Query: 61  SEFRESYNFENRSYKTRASRGDKQVSGNKLYKAPKLKYAEDKLRELFFEQHPWELSRPKM 120
            + RE+ N +   YKTR ++ D++V+ NKLYK PKL+Y ED+LR LFF+QHPWELSRPK+
Sbjct: 61  RDNREAVN-KKGFYKTRPNKLDRKVNSNKLYKPPKLQYVEDQLRTLFFDQHPWELSRPKI 119

Query: 121 LVENSGIQDYDWSTLQQLGKPLDGESVVQRTLYLLKSKKHQELLAAYDQARFEFYRLRIX 180
           LVENS  + +DWS +QQLGKPLDGESVVQRT+YLLK+ K  +++ AY+QARFEFYR RI 
Sbjct: 120 LVENSLEERFDWSHIQQLGKPLDGESVVQRTMYLLKTDK-MDMITAYNQARFEFYRFRIQ 178

Query: 181 XXXXXXXXXXXXXMLGSVFGPSAIDFGLKKEQKIIDVWKQKAIDQSELLSAR 232
                        M GSVF  S IDFG++KEQK+I  WK+KA  ++EL++AR
Sbjct: 179 QEVEEQVAQEEAEMFGSVFNQSMIDFGIEKEQKVIQQWKKKAEQETELVAAR 230

>TBLA0B05960 Chr2 complement(1408779..1409579) [801 bp, 266 aa] {ON}
           Anc_2.290 YIL093C
          Length = 266

 Score =  284 bits (726), Expect = 5e-96,   Method: Compositional matrix adjust.
 Identities = 132/234 (56%), Positives = 175/234 (74%)

Query: 1   MKVQQNAVNVLERTSSYLRAGILKKTPAWYEVVAQIPPSKRFVREPRLVNPSTNDEIAKL 60
           MK+QQNAVNVLERTS+YL+AG++KK P WY+VVA  PPSK+F REP+ +NPSTN    + 
Sbjct: 1   MKIQQNAVNVLERTSAYLQAGMIKKPPVWYDVVAATPPSKKFTREPKFINPSTNKRTVEF 60

Query: 61  SEFRESYNFENRSYKTRASRGDKQVSGNKLYKAPKLKYAEDKLRELFFEQHPWELSRPKM 120
              ++  N     YKTRA+  DK+ + + LYK PKL Y EDKLR+LF+EQHPWEL+RPK+
Sbjct: 61  KPLKDYLNRTTGLYKTRANSIDKKNAVSSLYKIPKLTYIEDKLRKLFYEQHPWELTRPKI 120

Query: 121 LVENSGIQDYDWSTLQQLGKPLDGESVVQRTLYLLKSKKHQELLAAYDQARFEFYRLRIX 180
           ++EN G   YDWS L QLGKPLDGESVVQRTL+LLK+K+H++L+ AY+QARFEFYRLR+ 
Sbjct: 121 VMENHGEVTYDWSRLLQLGKPLDGESVVQRTLFLLKTKEHRKLIDAYNQARFEFYRLRMA 180

Query: 181 XXXXXXXXXXXXXMLGSVFGPSAIDFGLKKEQKIIDVWKQKAIDQSELLSARNT 234
                        M G+VFG + I+FG++KEQ++ID WK +AI ++E+  A+ +
Sbjct: 181 EEIQEQVAQEESEMFGAVFGSTTIEFGIEKEQEMIDSWKVEAIKETEINEAKRS 234

>Skud_9.80 Chr9 complement(164635..165429) [795 bp, 264 aa] {ON}
           YIL093C (REAL)
          Length = 264

 Score =  283 bits (723), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 131/236 (55%), Positives = 180/236 (76%), Gaps = 2/236 (0%)

Query: 1   MKVQQNAVNVLERTSSYLRAGILKKTPAWYEVVAQIPPSKRFVREPRLVNPSTNDEIAKL 60
           MK+Q NAVNVL+RTS+YL++G+LK+TPAWY VVA IPPS +F REPR  NPS  D I +L
Sbjct: 1   MKIQTNAVNVLQRTSAYLKSGLLKETPAWYNVVASIPPSTKFTREPRFNNPSNGDTIGEL 60

Query: 61  SEFRE-SYNFENRSYKTRASRGDKQVSGNKLYKAPKLKYAEDKLRELFFEQHPWELSRPK 119
            +  +  +  +N  YKTR +  DK+VS  KLYK PKL Y ED+LR LF++QHPWELSRPK
Sbjct: 61  DDVTQRQHANKNGLYKTRPNTNDKRVSVKKLYKPPKLTYVEDRLRALFYKQHPWELSRPK 120

Query: 120 MLVENS-GIQDYDWSTLQQLGKPLDGESVVQRTLYLLKSKKHQELLAAYDQARFEFYRLR 178
           +LVEN  G +DYDW  + QLGKPLDGESVVQRT++LLK+K++++++ AYD AR+EFY LR
Sbjct: 121 ILVENEIGDEDYDWGRMLQLGKPLDGESVVQRTMHLLKTKQYEDMVEAYDSARYEFYALR 180

Query: 179 IXXXXXXXXXXXXXXMLGSVFGPSAIDFGLKKEQKIIDVWKQKAIDQSELLSARNT 234
           +              M GS+FG SAI+ G++KEQ+++DVW++K I+++EL++A+++
Sbjct: 181 MQEETQQQVALEEAEMFGSIFGVSAIEHGIQKEQEVLDVWEKKVIEETELMAAKSS 236

>Kpol_1003.40 s1003 complement(97903..98688) [786 bp, 261 aa] {ON}
           complement(97903..98688) [786 nt, 262 aa]
          Length = 261

 Score =  280 bits (716), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 134/232 (57%), Positives = 173/232 (74%), Gaps = 1/232 (0%)

Query: 1   MKVQQNAVNVLERTSSYLRAGILKKTPAWYEVVAQIPPSKRFVREPRLVNPSTNDEIAKL 60
           MK+Q+NAVNVLERTS+YLRAG+L K PAWY VVA +PP K+F R P+L NPS ND I   
Sbjct: 1   MKIQKNAVNVLERTSAYLRAGLLTKQPAWYNVVASVPPLKKFERVPKLTNPS-NDRINGQ 59

Query: 61  SEFRESYNFENRSYKTRASRGDKQVSGNKLYKAPKLKYAEDKLRELFFEQHPWELSRPKM 120
               +S    N  +KTR +  D+  +  +LY A KL Y ED+LRE+F++QHPWELSRPK+
Sbjct: 60  LHSLDSSAGNNGMFKTRYTAKDRSNASKQLYSASKLTYIEDQLREIFYKQHPWELSRPKI 119

Query: 121 LVENSGIQDYDWSTLQQLGKPLDGESVVQRTLYLLKSKKHQELLAAYDQARFEFYRLRIX 180
           L+EN+G + YDWS +QQ+GKPLDGESVVQRTLYL+K+K+   L+ AYD AR+EFYRLR+ 
Sbjct: 120 LIENNGDEKYDWSHMQQIGKPLDGESVVQRTLYLMKNKEAPSLVLAYDMARYEFYRLRMQ 179

Query: 181 XXXXXXXXXXXXXMLGSVFGPSAIDFGLKKEQKIIDVWKQKAIDQSELLSAR 232
                        M GSVFGPSAI++G++KEQK+ID WK+KAI Q+E+++AR
Sbjct: 180 QHIEEQVAQEEAEMFGSVFGPSAIEYGIQKEQKVIDTWKRKAIIQTEIMAAR 231

>ZYRO0A01958g Chr1 complement(162742..163533) [792 bp, 263 aa] {ON}
           similar to uniprot|P40496 Saccharomyces cerevisiae
           YIL093C RSM25 Mitochondrial ribosomal protein of the
           small subunit
          Length = 263

 Score =  280 bits (716), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 131/232 (56%), Positives = 175/232 (75%), Gaps = 1/232 (0%)

Query: 1   MKVQQNAVNVLERTSSYLRAGILKKTPAWYEVVAQIPPSKRFVREPRLVNPSTNDEIAKL 60
           MK+Q NAVNVLERTS+YLR+G+L++TPAWY+VVA +PP+ +F RE R +NPST  +  + 
Sbjct: 1   MKLQTNAVNVLERTSAYLRSGLLRETPAWYQVVASVPPTTKFTREARFINPSTGKKTVQW 60

Query: 61  SEFRESYNFENRSYKTRASRGDKQVSGNKLYKAPKLKYAEDKLRELFFEQHPWELSRPKM 120
            EF E  N +   YKTR S  D++   ++LYKAPKL++ ED+LRE+F++QHPWE SRPKM
Sbjct: 61  KEFDEGINRKG-FYKTRNSSFDRKPMDSRLYKAPKLQFLEDQLREVFYQQHPWEFSRPKM 119

Query: 121 LVENSGIQDYDWSTLQQLGKPLDGESVVQRTLYLLKSKKHQELLAAYDQARFEFYRLRIX 180
           LVEN   +++DWS + QLGKPLDGESVVQRT+YLL+      ++ AYD+ RFEFYRLR+ 
Sbjct: 120 LVENEINENFDWSYMSQLGKPLDGESVVQRTIYLLQKDPELGIIDAYDRTRFEFYRLRMQ 179

Query: 181 XXXXXXXXXXXXXMLGSVFGPSAIDFGLKKEQKIIDVWKQKAIDQSELLSAR 232
                        M GSVF  SAID+G+++EQ++IDVWKQKAI+++ELL+AR
Sbjct: 180 EEIEQQVAQEEAEMFGSVFSSSAIDYGVEQEQRVIDVWKQKAIEETELLAAR 231

>Smik_9.86 Chr9 complement(167101..167895) [795 bp, 264 aa] {ON}
           YIL093C (REAL)
          Length = 264

 Score =  278 bits (711), Expect = 8e-94,   Method: Compositional matrix adjust.
 Identities = 128/236 (54%), Positives = 175/236 (74%), Gaps = 2/236 (0%)

Query: 1   MKVQQNAVNVLERTSSYLRAGILKKTPAWYEVVAQIPPSKRFVREPRLVNPSTNDEIAKL 60
           MK+Q NAVNVL+RTS+YL++G+LK TPAWY VVA IPPS +F REP   NPS    I +L
Sbjct: 1   MKIQTNAVNVLQRTSAYLKSGLLKDTPAWYNVVASIPPSTKFTREPHFENPSNGHTIGRL 60

Query: 61  SEFRES-YNFENRSYKTRASRGDKQVSGNKLYKAPKLKYAEDKLRELFFEQHPWELSRPK 119
            +  E+ +   N  YKTR +  DK++   KLYK PKL Y ED+LR LF++QHPWELSRPK
Sbjct: 61  VDVIENQHTNSNGLYKTRPNTNDKRIGVKKLYKPPKLTYVEDRLRTLFYKQHPWELSRPK 120

Query: 120 MLVENS-GIQDYDWSTLQQLGKPLDGESVVQRTLYLLKSKKHQELLAAYDQARFEFYRLR 178
           +LVEN  G +DYDWS + QLGKPLDGESV+QRT+YLLK+K+++  + AYD AR+EFY LR
Sbjct: 121 ILVENEIGDEDYDWSHMLQLGKPLDGESVIQRTMYLLKTKQYENTVEAYDHARYEFYALR 180

Query: 179 IXXXXXXXXXXXXXXMLGSVFGPSAIDFGLKKEQKIIDVWKQKAIDQSELLSARNT 234
           +              M GS+FG SAI+ G++KEQ+++++W++K I+++EL++AR++
Sbjct: 181 MQEETQQQVALEEAEMFGSIFGKSAIEHGIQKEQEVLNIWEKKVIEETELMAARSS 236

>YIL093C Chr9 complement(187990..188784) [795 bp, 264 aa] {ON}
           RSM25Mitochondrial ribosomal protein of the small
           subunit
          Length = 264

 Score =  277 bits (708), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 126/236 (53%), Positives = 177/236 (75%), Gaps = 2/236 (0%)

Query: 1   MKVQQNAVNVLERTSSYLRAGILKKTPAWYEVVAQIPPSKRFVREPRLVNPSTNDEIAKL 60
           MK+Q NAVNVL+RTS+YL++G+LK+TPAWY VVA IPPS +F REPR  NPS    I KL
Sbjct: 1   MKIQTNAVNVLQRTSAYLKSGLLKETPAWYNVVASIPPSTKFTREPRFKNPSNGHIIGKL 60

Query: 61  SEFRESYNFENRS-YKTRASRGDKQVSGNKLYKAPKLKYAEDKLRELFFEQHPWELSRPK 119
            +  E  +  N+  YKTR +  DK+V   +LY+ PKL Y ED+LR LF++QHPWELSRPK
Sbjct: 61  VDVTEQPHANNKGLYKTRPNSSDKRVGVKRLYRPPKLTYVEDRLRSLFYKQHPWELSRPK 120

Query: 120 MLVENS-GIQDYDWSTLQQLGKPLDGESVVQRTLYLLKSKKHQELLAAYDQARFEFYRLR 178
           +LVEN  G ++YDWS + Q+G+PLDGESV+QRT+YL+K+K++ +++ AYD AR+EFY LR
Sbjct: 121 ILVENEIGDENYDWSHMLQIGRPLDGESVIQRTMYLIKTKQYGDMVEAYDHARYEFYALR 180

Query: 179 IXXXXXXXXXXXXXXMLGSVFGPSAIDFGLKKEQKIIDVWKQKAIDQSELLSARNT 234
           +              M GS+FG SAI+ G++KEQ+++DVW++K ++++EL++AR +
Sbjct: 181 MQEETEQQVALEEAEMFGSLFGVSAIEHGIQKEQEVLDVWEKKVVEETELMAARTS 236

>KLLA0E08273g Chr5 (745145..745930) [786 bp, 261 aa] {ON} similar to
           uniprot|P40496 Saccharomyces cerevisiae YIL093C RSM25
           Mitochondrial ribosomal protein of the small subunit
          Length = 261

 Score =  276 bits (705), Expect = 6e-93,   Method: Compositional matrix adjust.
 Identities = 133/230 (57%), Positives = 172/230 (74%), Gaps = 1/230 (0%)

Query: 1   MKVQQNAVNVLERTSSYLRAGILKKTPAWYEVVAQIPPSKRFVREPRLVNPSTNDEIAKL 60
           MKVQQ AVNVLERTS+YL++GILKKTPAWY V+A++PP+K+F R P+L +P        L
Sbjct: 1   MKVQQEAVNVLERTSAYLKSGILKKTPAWYNVIAKVPPTKKFARTPQLTHPMNGKSRTAL 60

Query: 61  SEFRESYNFENRSYKTRASRGDKQVSGNKLYKAPKLKYAEDKLRELFFEQHPWELSRPKM 120
            ++       +  YKTR +  +K+   +KLY++PKL Y EDKLR+LFF+QHPWELSRPK+
Sbjct: 61  PDYSNWKANSSGLYKTRPNSLEKKDGASKLYQSPKLVYIEDKLRKLFFQQHPWELSRPKI 120

Query: 121 LVENS-GIQDYDWSTLQQLGKPLDGESVVQRTLYLLKSKKHQELLAAYDQARFEFYRLRI 179
           LVEN+   Q+YDWS +QQLGKPLDGESVVQRTL+LLKS + +EL+ AYDQARFEFYRLRI
Sbjct: 121 LVENTLETQEYDWSHIQQLGKPLDGESVVQRTLFLLKSGEKKELIDAYDQARFEFYRLRI 180

Query: 180 XXXXXXXXXXXXXXMLGSVFGPSAIDFGLKKEQKIIDVWKQKAIDQSELL 229
                         M GSVF  ++I++G+ KEQK+ID WK+KA+ Q+EL+
Sbjct: 181 QQEIQDQVAQEEAEMFGSVFHTTSIEYGIAKEQKVIDTWKRKALQQAELM 230

>KAFR0J01350 Chr10 (247931..248725) [795 bp, 264 aa] {ON} Anc_2.290
           YIL093C
          Length = 264

 Score =  270 bits (691), Expect = 9e-91,   Method: Compositional matrix adjust.
 Identities = 123/233 (52%), Positives = 172/233 (73%), Gaps = 2/233 (0%)

Query: 1   MKVQQNAVNVLERTSSYLRAGILKKTPAWYEVVAQIPPSKRFVREPRLVNPSTNDEIAKL 60
           MK+Q NA N+LERTS+YL+AG+L+  PA+Y+V+AQ+PPS +F REP+LVNPST  +  + 
Sbjct: 1   MKIQTNATNILERTSAYLQAGLLRNAPAFYDVIAQVPPSTKFTREPKLVNPSTGQDRTRF 60

Query: 61  SEFRESYNFENRSYKTRASRGDKQVSGNKLYKAPKLKYAEDKLRELFFEQHPWELSRPKM 120
            E  +  N+    YKTR +  D+  S ++LYKA +LKY ED LR+LF++QHPWELSRPK+
Sbjct: 61  RELTDKVNWRGL-YKTRYAASDRHASVSRLYKASRLKYLEDDLRQLFYDQHPWELSRPKI 119

Query: 121 LVENS-GIQDYDWSTLQQLGKPLDGESVVQRTLYLLKSKKHQELLAAYDQARFEFYRLRI 179
           ++EN+      DWS +QQLGKP+DGESVVQRTL+L+K+KKH  L   YDQARFEFY++R+
Sbjct: 120 VIENNIDNSSLDWSNIQQLGKPVDGESVVQRTLFLMKNKKHDNLADCYDQARFEFYQVRM 179

Query: 180 XXXXXXXXXXXXXXMLGSVFGPSAIDFGLKKEQKIIDVWKQKAIDQSELLSAR 232
                         M GS+FGP+A+++G+++EQ +I  WKQ+AI ++ELL A+
Sbjct: 180 QRDSEEQIATEEAAMFGSIFGPTALEYGIQREQDVIAKWKQRAIRETELLDAK 232

>Suva_9.106 Chr9 complement(182086..182880) [795 bp, 264 aa] {ON}
           YIL093C (REAL)
          Length = 264

 Score =  269 bits (687), Expect = 4e-90,   Method: Compositional matrix adjust.
 Identities = 127/236 (53%), Positives = 175/236 (74%), Gaps = 2/236 (0%)

Query: 1   MKVQQNAVNVLERTSSYLRAGILKKTPAWYEVVAQIPPSKRFVREPRLVNPSTNDEIAKL 60
           MK+Q NAVNVL+RTS+YL++G+LK TPAWY VVA IPPS +F REPR  NPS    I KL
Sbjct: 1   MKIQTNAVNVLQRTSAYLKSGLLKDTPAWYNVVASIPPSTKFTREPRFKNPSNGRIIGKL 60

Query: 61  SEFRESYNFE-NRSYKTRASRGDKQVSGNKLYKAPKLKYAEDKLRELFFEQHPWELSRPK 119
            +  E      N  YKTR +  D++V   KLYK PKL Y ED+LR LF++QHPWELSRPK
Sbjct: 61  VDVTERQQANANGLYKTRPNPNDRRVGVKKLYKPPKLTYVEDRLRVLFYKQHPWELSRPK 120

Query: 120 MLVENS-GIQDYDWSTLQQLGKPLDGESVVQRTLYLLKSKKHQELLAAYDQARFEFYRLR 178
           +LVEN  G ++YDWS + QLGK LDGESV+QRT++LLK++++++++ AYD AR+EFY LR
Sbjct: 121 ILVENEVGDENYDWSHMLQLGKVLDGESVIQRTMHLLKTQQYKDMVEAYDHARYEFYALR 180

Query: 179 IXXXXXXXXXXXXXXMLGSVFGPSAIDFGLKKEQKIIDVWKQKAIDQSELLSARNT 234
           +              M GS+FG S+I+ G++KEQ+++DVW++K I+++EL++AR++
Sbjct: 181 MEEETQQQVALEEAEMFGSIFGVSSIEHGIQKEQEVLDVWEKKVIEETELMAARSS 236

>CAGL0D04158g Chr4 complement(410309..411127) [819 bp, 272 aa] {ON}
           similar to uniprot|P40496 Saccharomyces cerevisiae
           YIL093c RSM25
          Length = 272

 Score =  259 bits (662), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 127/233 (54%), Positives = 168/233 (72%), Gaps = 2/233 (0%)

Query: 1   MKVQQNAVNVLERTSSYLRAGILKKTPAWYEVVAQIPPSKRFVREPRLVNPSTNDEIAKL 60
           MK+Q NAVNVLERTS+YLR G++K+TPAWY VVA IPP  +F REP  +NPST+ ++++L
Sbjct: 1   MKIQTNAVNVLERTSAYLRTGVIKETPAWYNVVASIPPVTKFTREPHKINPSTDKKVSEL 60

Query: 61  SEFR-ESYNFENRSYKTRASRGDKQVSGNKLYKAPKLKYAEDKLRELFFEQHPWELSRPK 119
            +   ES N  N  YKTR +  +++V+  ++YK PKL Y EDK+R LF++QHPWEL+RPK
Sbjct: 61  KDPDLESVN-RNGLYKTRFNALERKVANKQIYKPPKLVYLEDKIRTLFYKQHPWELARPK 119

Query: 120 MLVENSGIQDYDWSTLQQLGKPLDGESVVQRTLYLLKSKKHQELLAAYDQARFEFYRLRI 179
           ++ EN    + DW  + QLG+PLDGE+VVQRTLYLLK+K+   +  AYDQAR EFYRLR+
Sbjct: 120 IVSENEINTNPDWKNMLQLGQPLDGENVVQRTLYLLKTKEQSNITDAYDQARLEFYRLRM 179

Query: 180 XXXXXXXXXXXXXXMLGSVFGPSAIDFGLKKEQKIIDVWKQKAIDQSELLSAR 232
                         M GSVFGPS I+ G+ KEQ++I+ WK+ A  QSELLSA+
Sbjct: 180 QQELEEQVAAEEAEMFGSVFGPSTIEHGVTKEQQVIEKWKRDAELQSELLSAK 232

>TPHA0C03420 Chr3 complement(750353..751159) [807 bp, 268 aa] {ON}
           Anc_2.290 YIL093C
          Length = 268

 Score =  257 bits (657), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 126/237 (53%), Positives = 166/237 (70%), Gaps = 3/237 (1%)

Query: 1   MKVQQNAVNVLERTSSYLRAGILKKTPAWYEVVAQIPPSKRFVREPRLVNPSTNDEIAKL 60
           MK+QQNAVNVLERTSSYLR+G+L K PAWY VVA+IPPSK+F R P+  NPS N ++ +L
Sbjct: 1   MKIQQNAVNVLERTSSYLRSGLLTKQPAWYNVVAEIPPSKKFERTPKFTNPSNNKKLNEL 60

Query: 61  SEFRESYNFENRS---YKTRASRGDKQVSGNKLYKAPKLKYAEDKLRELFFEQHPWELSR 117
               E    +      +K+R ++ DK+ S   +YK  KL Y ED+LRE+F+ QHPWELSR
Sbjct: 61  RIIDERLVSDRNGTFLFKSRYNKLDKKSSSKNVYKPAKLSYIEDQLREVFYIQHPWELSR 120

Query: 118 PKMLVENSGIQDYDWSTLQQLGKPLDGESVVQRTLYLLKSKKHQELLAAYDQARFEFYRL 177
           PK++VEN+G + YDWS +QQLGK LDGE+VVQR +YL+K K          +AR+EFYR+
Sbjct: 121 PKIVVENNGDETYDWSHIQQLGKALDGENVVQRAMYLMKKKLIMIFQKHTIKARYEFYRV 180

Query: 178 RIXXXXXXXXXXXXXXMLGSVFGPSAIDFGLKKEQKIIDVWKQKAIDQSELLSARNT 234
           R+              M GSVFGPS I+FG+ +EQK+IDVWK+KAI ++EL+ A+ T
Sbjct: 181 RMQSEIEEQVAQEEAEMFGSVFGPSTIEFGMDQEQKVIDVWKRKAIAETELMEAKRT 237

>NDAI0B03540 Chr2 (890148..890933) [786 bp, 261 aa] {ON} Anc_2.290
           YIL093C
          Length = 261

 Score =  256 bits (653), Expect = 5e-85,   Method: Compositional matrix adjust.
 Identities = 124/235 (52%), Positives = 170/235 (72%), Gaps = 3/235 (1%)

Query: 1   MKVQQNAVNVLERTSSYLRAGILKKTPAWYEVVAQIPPSKRFVREPRLVNPSTNDEIAKL 60
           MK+Q NAVN++ERTS+YL +G+L+ TPAWY+VVA IPP+K+F REP++ NP+T       
Sbjct: 1   MKIQTNAVNLVERTSAYLSSGLLQNTPAWYDVVASIPPTKKFTREPKITNPTTGRNKTFF 60

Query: 61  SEFRESYNFENRS-YKTRASRGDKQVSGNKLYKAPKLKYAEDKLRELFFEQHPWELSRPK 119
            + R   N  N+  YKTR ++ D++ S N LYK PKL Y ED+LR LFFEQHPWELSRPK
Sbjct: 61  KDDRIRVN--NKGLYKTRMNQMDRKDSANNLYKPPKLIYLEDRLRSLFFEQHPWELSRPK 118

Query: 120 MLVENSGIQDYDWSTLQQLGKPLDGESVVQRTLYLLKSKKHQELLAAYDQARFEFYRLRI 179
           +L+ENS  +++DWS +QQ  K LDGESVVQRTLYLLK++    +L AY++ARFEFYRLRI
Sbjct: 119 ILIENSLEENFDWSHIQQWEKQLDGESVVQRTLYLLKNEPGINMLQAYNKARFEFYRLRI 178

Query: 180 XXXXXXXXXXXXXXMLGSVFGPSAIDFGLKKEQKIIDVWKQKAIDQSELLSARNT 234
                         M GS+F  ++ + G++KEQK+I+ WK+KAI +++L+  R++
Sbjct: 179 QQDISQQVAQEEAEMFGSIFRQTSFEHGIEKEQKVIEQWKKKAIQETQLMEVRSS 233

>KNAG0A05410 Chr1 (798238..799038) [801 bp, 266 aa] {ON} Anc_2.290
           YIL093C
          Length = 266

 Score =  252 bits (644), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 122/232 (52%), Positives = 159/232 (68%)

Query: 1   MKVQQNAVNVLERTSSYLRAGILKKTPAWYEVVAQIPPSKRFVREPRLVNPSTNDEIAKL 60
           MK+Q NAVN+LERTS++L +G+++K PAWY VVA  PP K+F R+P  VNPST      L
Sbjct: 1   MKIQTNAVNILERTSAFLESGVIQKVPAWYNVVAANPPKKKFERKPIFVNPSTGKARVNL 60

Query: 61  SEFRESYNFENRSYKTRASRGDKQVSGNKLYKAPKLKYAEDKLRELFFEQHPWELSRPKM 120
             F +S    +  YKTR S  DKQVS N LY+ PKL Y ED+LR+LF++QHPWE SRP +
Sbjct: 61  KSFLDSKRNAHEIYKTRYSMADKQVSHNALYRPPKLVYLEDQLRQLFYDQHPWERSRPMI 120

Query: 121 LVENSGIQDYDWSTLQQLGKPLDGESVVQRTLYLLKSKKHQELLAAYDQARFEFYRLRIX 180
           L+EN+    +DWS +QQLGK LDGESVVQR L+LL+      L  AYD+ARFEFYR+R+ 
Sbjct: 121 LIENNVTPKFDWSRIQQLGKRLDGESVVQRALFLLEGGHCDSLSTAYDKARFEFYRIRMQ 180

Query: 181 XXXXXXXXXXXXXMLGSVFGPSAIDFGLKKEQKIIDVWKQKAIDQSELLSAR 232
                        M GSV+  SAI+FGL+KE K+I+ WK++ I ++E + AR
Sbjct: 181 QELEEQISQEEAAMYGSVYTQSAIEFGLEKEGKVIETWKRRVIKETEAMLAR 232

>ADL211C Chr4 complement(333418..334095) [678 bp, 225 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL093C
           (RSM25)
          Length = 225

 Score =  235 bits (600), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 113/179 (63%), Positives = 138/179 (77%), Gaps = 2/179 (1%)

Query: 1   MKVQQNAVNVLERTSSYLRAGILKKTPAWYEVVAQIPPSKRFVREPRLVNPSTNDEIAKL 60
           MK+Q NAVNVL+RTS YL+AG+LKKTPAWY VVA+IPP  +F REP+L +P +     +L
Sbjct: 1   MKIQTNAVNVLDRTSFYLQAGLLKKTPAWYNVVARIPPVTKFAREPKLHDPVSGKYKGEL 60

Query: 61  SEFRESYNFENRSYKTRASRGDKQVSGNKLYKAPKLKYAEDKLRELFFEQHPWELSRPKM 120
               +  N    +YKTRA   D+Q +   ++K  KL++ EDKLR LFF+QHPWELSRPK+
Sbjct: 61  DIMTDRLNRNTETYKTRAGSSDRQTAA--VHKPSKLRFIEDKLRSLFFQQHPWELSRPKV 118

Query: 121 LVENSGIQDYDWSTLQQLGKPLDGESVVQRTLYLLKSKKHQELLAAYDQARFEFYRLRI 179
           LVEN G + YDWS + QLGKPLDGESVVQRTLYLLKS  H+E+LAAYDQARFEFYRLR+
Sbjct: 119 LVENMGNEQYDWSRMLQLGKPLDGESVVQRTLYLLKSGAHREMLAAYDQARFEFYRLRM 177

>SAKL0H19514g Chr8 complement(1719913..1721433) [1521 bp, 506 aa]
          {ON} similar to uniprot|P38067 Saccharomyces cerevisiae
          YBR006w UGA2 succinate semialdehyde dehydrogenase
          involved in the utilization of gamma-aminobutyrate
          (GABA) as a nitrogen source
          Length = 506

 Score = 31.6 bits (70), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 23/35 (65%), Gaps = 5/35 (14%)

Query: 48 LVNPSTNDEIAKLS-----EFRESYNFENRSYKTR 77
          L+NPST +EIA+++     E+  + NF  +S+KT 
Sbjct: 47 LINPSTQEEIAQIANCGVGEYNNAINFAQQSFKTH 81

>Smik_8.160 Chr8 complement(245207..248323) [3117 bp, 1038 aa] {ON}
           YHR082C (REAL)
          Length = 1038

 Score = 29.6 bits (65), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 20/75 (26%), Positives = 34/75 (45%), Gaps = 9/75 (12%)

Query: 36  IPPSKRFVREPRLVNPSTNDEIAKLSEFRESYNFENRSYKTRASRGDKQVSGNKLYKAPK 95
           +PPS   V  P    P ++     + EF++ +NF N + K R+     Q + N  +K P 
Sbjct: 380 VPPSSAPVSLPT---PISSSNKQHMPEFKKDFNFNNVNEKKRSDISQYQNTANNFFKKPS 436

Query: 96  LKYAEDKLRELFFEQ 110
            +      ++ FF Q
Sbjct: 437 TQ------QQKFFSQ 445

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.132    0.373 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 23,779,550
Number of extensions: 938234
Number of successful extensions: 2806
Number of sequences better than 10.0: 32
Number of HSP's gapped: 2861
Number of HSP's successfully gapped: 32
Length of query: 261
Length of database: 53,481,399
Length adjustment: 107
Effective length of query: 154
Effective length of database: 41,212,137
Effective search space: 6346669098
Effective search space used: 6346669098
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 64 (29.3 bits)