Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_27.115032.292ON72772733200.0
KLTH0G10494g2.292ON74756126500.0
SAKL0E07546g2.292ON71856323440.0
YIL091C (UTP25)2.292ON72156322410.0
Suva_9.1082.292ON72256322250.0
Smik_9.882.292ON72456322200.0
Skud_9.822.292ON72256322160.0
KLLA0E08229g2.292ON70456222130.0
KAFR0J013402.292ON72856421980.0
NCAS0B062302.292ON72356621770.0
KNAG0A054002.292ON72158021690.0
TBLA0B059702.292ON71956421650.0
Ecym_33312.292ON70856521630.0
NDAI0B035302.292ON73956621640.0
TDEL0G022202.292ON71056221590.0
ZYRO0A02002g2.292ON70956321510.0
ADL209C2.292ON70456421450.0
Kpol_1039.462.292ON70456321340.0
CAGL0D04180g2.292ON70057121140.0
TPHA0D015202.292ON71656220890.0
Skud_4.5058.469ON604155790.75
Smik_4.4908.469ON587159761.7
Kwal_26.71637.88ON622105761.9
NDAI0H024607.88ON62176707.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_27.11503
         (727 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_27.11503 s27 (828115..830298) [2184 bp, 727 aa] {ON} YIL091...  1283   0.0  
KLTH0G10494g Chr7 complement(885735..887978) [2244 bp, 747 aa] {...  1025   0.0  
SAKL0E07546g Chr5 (610979..613135) [2157 bp, 718 aa] {ON} simila...   907   0.0  
YIL091C Chr9 complement(191030..193195) [2166 bp, 721 aa] {ON}  ...   867   0.0  
Suva_9.108 Chr9 complement(185226..187394) [2169 bp, 722 aa] {ON...   861   0.0  
Smik_9.88 Chr9 complement(170163..172337) [2175 bp, 724 aa] {ON}...   859   0.0  
Skud_9.82 Chr9 complement(167750..169918) [2169 bp, 722 aa] {ON}...   858   0.0  
KLLA0E08229g Chr5 (742066..744180) [2115 bp, 704 aa] {ON} simila...   857   0.0  
KAFR0J01340 Chr10 (245485..247671) [2187 bp, 728 aa] {ON} Anc_2....   851   0.0  
NCAS0B06230 Chr2 (1175844..1178015) [2172 bp, 723 aa] {ON} Anc_2...   843   0.0  
KNAG0A05400 Chr1 (795728..797893) [2166 bp, 721 aa] {ON} Anc_2.2...   840   0.0  
TBLA0B05970 Chr2 complement(1410055..1412214) [2160 bp, 719 aa] ...   838   0.0  
Ecym_3331 Chr3 complement(631944..634070) [2127 bp, 708 aa] {ON}...   837   0.0  
NDAI0B03530 Chr2 (887479..889698) [2220 bp, 739 aa] {ON} Anc_2.2...   838   0.0  
TDEL0G02220 Chr7 complement(434650..436782) [2133 bp, 710 aa] {O...   836   0.0  
ZYRO0A02002g Chr1 complement(164386..166515) [2130 bp, 709 aa] {...   833   0.0  
ADL209C Chr4 complement(334817..336931) [2115 bp, 704 aa] {ON} S...   830   0.0  
Kpol_1039.46 s1039 complement(138925..141039) [2115 bp, 704 aa] ...   826   0.0  
CAGL0D04180g Chr4 complement(411498..413600) [2103 bp, 700 aa] {...   818   0.0  
TPHA0D01520 Chr4 (310797..312947) [2151 bp, 716 aa] {ON} Anc_2.2...   809   0.0  
Skud_4.505 Chr4 complement(903103..904917) [1815 bp, 604 aa] {ON...    35   0.75 
Smik_4.490 Chr4 complement(893394..895157) [1764 bp, 587 aa] {ON...    34   1.7  
Kwal_26.7163 s26 (243008..244876) [1869 bp, 622 aa] {ON} YAL016W...    34   1.9  
NDAI0H02460 Chr8 complement(594568..596433) [1866 bp, 621 aa] {O...    32   7.8  

>Kwal_27.11503 s27 (828115..830298) [2184 bp, 727 aa] {ON} YIL091C -
           Protein required for cell viability [contig 27] FULL
          Length = 727

 Score = 1283 bits (3320), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 639/727 (87%), Positives = 639/727 (87%)

Query: 1   MSSSKRRYTDHDRHDGEKFTKGGRKQLRSIRKASRYDSKKXXXXXXXXXXXXXXXXXXXX 60
           MSSSKRRYTDHDRHDGEKFTKGGRKQLRSIRKASRYDSKK                    
Sbjct: 1   MSSSKRRYTDHDRHDGEKFTKGGRKQLRSIRKASRYDSKKPEDEPVETPEEEINEVEDVH 60

Query: 61  XXRTEVSRKQESNGEAYAALLTLLKAEHGTGKKKVKAXXXXXXXXXXXXXXXXXXXXXXX 120
             RTEVSRKQESNGEAYAALLTLLKAEHGTGKKKVKA                       
Sbjct: 61  EERTEVSRKQESNGEAYAALLTLLKAEHGTGKKKVKAGPQGEGSGESQISEISPEAEQDE 120

Query: 121 XXXXXXXXXXXXXXXXXXHLXXXXXXXXXXXXXXXXXXXXXXXXXSDPLEAHFNSVPEKD 180
                             HL                         SDPLEAHFNSVPEKD
Sbjct: 121 EEEEEEEEETAIENGLAEHLDSDGDEAAEIGDEEDDNNGDQDENASDPLEAHFNSVPEKD 180

Query: 181 TDALDQAFKTKQVRYRSSKIKISKNEEFIYSRPDLNLESRTPIQVPQGTQSLSPYFIKQR 240
           TDALDQAFKTKQVRYRSSKIKISKNEEFIYSRPDLNLESRTPIQVPQGTQSLSPYFIKQR
Sbjct: 181 TDALDQAFKTKQVRYRSSKIKISKNEEFIYSRPDLNLESRTPIQVPQGTQSLSPYFIKQR 240

Query: 241 LKIQNDLLDSKNNLTPLQKKIVDPIFQYQDLLYEYENYDQETEYRDLYALHALDHIYKTR 300
           LKIQNDLLDSKNNLTPLQKKIVDPIFQYQDLLYEYENYDQETEYRDLYALHALDHIYKTR
Sbjct: 241 LKIQNDLLDSKNNLTPLQKKIVDPIFQYQDLLYEYENYDQETEYRDLYALHALDHIYKTR 300

Query: 301 DRILKNNQRLQDNPDQEVLDQGFTRPKVLIVVPTRDVAYSVLSKIIEKSGLDQVDKKSKF 360
           DRILKNNQRLQDNPDQEVLDQGFTRPKVLIVVPTRDVAYSVLSKIIEKSGLDQVDKKSKF
Sbjct: 301 DRILKNNQRLQDNPDQEVLDQGFTRPKVLIVVPTRDVAYSVLSKIIEKSGLDQVDKKSKF 360

Query: 361 RDQFYQDSLPPKYKPKSFQQVFKGNTNDFFVLGAKFTRKTIKLYSNFYQSDIIVCSPLGI 420
           RDQFYQDSLPPKYKPKSFQQVFKGNTNDFFVLGAKFTRKTIKLYSNFYQSDIIVCSPLGI
Sbjct: 361 RDQFYQDSLPPKYKPKSFQQVFKGNTNDFFVLGAKFTRKTIKLYSNFYQSDIIVCSPLGI 420

Query: 421 QLILENTDKKKRQDDFLSSIELLVIDQLHSIEFQNVLHLTSIFEHINKIPQQQHDADFSR 480
           QLILENTDKKKRQDDFLSSIELLVIDQLHSIEFQNVLHLTSIFEHINKIPQQQHDADFSR
Sbjct: 421 QLILENTDKKKRQDDFLSSIELLVIDQLHSIEFQNVLHLTSIFEHINKIPQQQHDADFSR 480

Query: 481 IKMWYINDQAKLFRQTLIFTRHSTPFANSLINGKCRNYAGRWKNHTIVGAEKSSLSQLGM 540
           IKMWYINDQAKLFRQTLIFTRHSTPFANSLINGKCRNYAGRWKNHTIVGAEKSSLSQLGM
Sbjct: 481 IKMWYINDQAKLFRQTLIFTRHSTPFANSLINGKCRNYAGRWKNHTIVGAEKSSLSQLGM 540

Query: 541 RTRLVFQRFDVAGGAATDEPDFRFKHFCSVIVPNIVQSTGYEDGILLYIPDYTDFIRVRN 600
           RTRLVFQRFDVAGGAATDEPDFRFKHFCSVIVPNIVQSTGYEDGILLYIPDYTDFIRVRN
Sbjct: 541 RTRLVFQRFDVAGGAATDEPDFRFKHFCSVIVPNIVQSTGYEDGILLYIPDYTDFIRVRN 600

Query: 601 YLREKTTILFGDISEYSEQRQLTANRALFQQGRVKVLLYTERLHHFRRYEIKGVKTVIFY 660
           YLREKTTILFGDISEYSEQRQLTANRALFQQGRVKVLLYTERLHHFRRYEIKGVKTVIFY
Sbjct: 601 YLREKTTILFGDISEYSEQRQLTANRALFQQGRVKVLLYTERLHHFRRYEIKGVKTVIFY 660

Query: 661 KPPTNPEFFEETVRYLAKSAFLGVADLNISVVRCLYSKLDGLALERIVGTERAAILTHGP 720
           KPPTNPEFFEETVRYLAKSAFLGVADLNISVVRCLYSKLDGLALERIVGTERAAILTHGP
Sbjct: 661 KPPTNPEFFEETVRYLAKSAFLGVADLNISVVRCLYSKLDGLALERIVGTERAAILTHGP 720

Query: 721 NETYEFK 727
           NETYEFK
Sbjct: 721 NETYEFK 727

>KLTH0G10494g Chr7 complement(885735..887978) [2244 bp, 747 aa] {ON}
           similar to uniprot|P40498 Saccharomyces cerevisiae
           YIL091C Protein required for cell viability
          Length = 747

 Score = 1025 bits (2650), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 477/561 (85%), Positives = 524/561 (93%)

Query: 167 DPLEAHFNSVPEKDTDALDQAFKTKQVRYRSSKIKISKNEEFIYSRPDLNLESRTPIQVP 226
           D LE HFNSV EKDT+ALD AFK K+VRYRS K+ + KN+EFIYSRP L  E  + +  P
Sbjct: 187 DTLEIHFNSVSEKDTNALDAAFKAKEVRYRSCKLHVDKNQEFIYSRPTLVNEPASAVSAP 246

Query: 227 QGTQSLSPYFIKQRLKIQNDLLDSKNNLTPLQKKIVDPIFQYQDLLYEYENYDQETEYRD 286
            G+QSL+ YFIKQRLKIQNDLLDS++ LTPLQK+IVDP+FQYQDLLYEYE+YD+ETEYRD
Sbjct: 247 DGSQSLNSYFIKQRLKIQNDLLDSQDKLTPLQKQIVDPMFQYQDLLYEYEDYDKETEYRD 306

Query: 287 LYALHALDHIYKTRDRILKNNQRLQDNPDQEVLDQGFTRPKVLIVVPTRDVAYSVLSKII 346
           LYALH L+HIYKTRDRILKNNQRLQ+NPDQE+LDQGFTRPKVLIV PTRD AY +LSKII
Sbjct: 307 LYALHVLNHIYKTRDRILKNNQRLQENPDQELLDQGFTRPKVLIVAPTRDAAYDILSKII 366

Query: 347 EKSGLDQVDKKSKFRDQFYQDSLPPKYKPKSFQQVFKGNTNDFFVLGAKFTRKTIKLYSN 406
           +KSGLDQVDKK+KF+DQF+Q++LPP YKPKSFQQ+FKGNTNDFFVLGAKFTRKTIKLYSN
Sbjct: 367 QKSGLDQVDKKAKFKDQFFQEALPPSYKPKSFQQLFKGNTNDFFVLGAKFTRKTIKLYSN 426

Query: 407 FYQSDIIVCSPLGIQLILENTDKKKRQDDFLSSIELLVIDQLHSIEFQNVLHLTSIFEHI 466
           FYQSDII+CSPLGIQLILENTDKKKRQDDFLSSIELLV+DQLHSIEFQN+LHLTSIFEHI
Sbjct: 427 FYQSDIIICSPLGIQLILENTDKKKRQDDFLSSIELLVVDQLHSIEFQNMLHLTSIFEHI 486

Query: 467 NKIPQQQHDADFSRIKMWYINDQAKLFRQTLIFTRHSTPFANSLINGKCRNYAGRWKNHT 526
           NKIPQQQHDADFSRIKMWYINDQAKLFRQTLIFT+ S+PFANSLINGKCRNYAGRWKNH 
Sbjct: 487 NKIPQQQHDADFSRIKMWYINDQAKLFRQTLIFTKFSSPFANSLINGKCRNYAGRWKNHR 546

Query: 527 IVGAEKSSLSQLGMRTRLVFQRFDVAGGAATDEPDFRFKHFCSVIVPNIVQSTGYEDGIL 586
           ++  E SSL QLGMRTRL+FQRFD+ G + ++EPD RFKHFCSVIVPNIV+STGYEDGIL
Sbjct: 547 VIFPENSSLGQLGMRTRLIFQRFDLVGKSVSEEPDSRFKHFCSVIVPNIVKSTGYEDGIL 606

Query: 587 LYIPDYTDFIRVRNYLREKTTILFGDISEYSEQRQLTANRALFQQGRVKVLLYTERLHHF 646
           LYIPDYTDF+RVRNYLREKTTILFGDI+EYSEQRQLT+NRA+FQQGRVKVLLYTERLHHF
Sbjct: 607 LYIPDYTDFVRVRNYLREKTTILFGDINEYSEQRQLTSNRAMFQQGRVKVLLYTERLHHF 666

Query: 647 RRYEIKGVKTVIFYKPPTNPEFFEETVRYLAKSAFLGVADLNISVVRCLYSKLDGLALER 706
           RRYEIKGVKTVIFYKPPTNPEFFEE  RYL KSAFLG+ADLNISVVRCL+SKLDGL+LER
Sbjct: 667 RRYEIKGVKTVIFYKPPTNPEFFEEVARYLGKSAFLGLADLNISVVRCLFSKLDGLSLER 726

Query: 707 IVGTERAAILTHGPNETYEFK 727
           IVGTERAA+LTHGPNETYEFK
Sbjct: 727 IVGTERAAVLTHGPNETYEFK 747

 Score = 52.4 bits (124), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 36/91 (39%), Positives = 45/91 (49%), Gaps = 2/91 (2%)

Query: 1  MSSSKRRYTDHDRHDGEKFTKGGRKQLRSIRKAS--RYDSKKXXXXXXXXXXXXXXXXXX 58
          MSS KR  +     +  + +K GRKQLR+IRKAS  R    +                  
Sbjct: 1  MSSLKRSSSAIKGSNEYRSSKSGRKQLRTIRKASGPRRGLAEESANEENNGSETEAEDKL 60

Query: 59 XXXXRTEVSRKQESNGEAYAALLTLLKAEHG 89
                E ++ Q + GEAYAALLTLLKAEHG
Sbjct: 61 AAPELNEPAQDQRAGGEAYAALLTLLKAEHG 91

>SAKL0E07546g Chr5 (610979..613135) [2157 bp, 718 aa] {ON} similar
           to uniprot|P40498 Saccharomyces cerevisiae YIL091C
           Protein required for cell viability
          Length = 718

 Score =  907 bits (2344), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 417/563 (74%), Positives = 497/563 (88%), Gaps = 1/563 (0%)

Query: 166 SDPLEAHFNSVPEKDTDALDQAFKTKQVRYRSSKIKISKNEEFIYSRPDLNLESRTPIQV 225
           +D  E HFN+V E     L  AF+ K++RY+S K+ ++++E FIYSRP +  E  + +  
Sbjct: 156 ADSFELHFNNVSELQATKLASAFRDKKIRYKSVKVPVNEDEFFIYSRPTVEGEDGSSVVA 215

Query: 226 PQGTQSLSPYFIKQRLKIQNDLLDSKNN-LTPLQKKIVDPIFQYQDLLYEYENYDQETEY 284
           P   +SL  YFIKQ+LKIQN+LLD K   L PLQK +VDP+FQYQDLLYEY +Y+QE EY
Sbjct: 216 PSCKKSLHSYFIKQKLKIQNNLLDDKKEALAPLQKNLVDPMFQYQDLLYEYRSYEQEEEY 275

Query: 285 RDLYALHALDHIYKTRDRILKNNQRLQDNPDQEVLDQGFTRPKVLIVVPTRDVAYSVLSK 344
           RDLYALH L+H+YKTRDRIL+N+Q+LQDN DQE+LDQGFTRPKVLIVVPTRDVAY +++K
Sbjct: 276 RDLYALHVLNHVYKTRDRILRNSQKLQDNSDQELLDQGFTRPKVLIVVPTRDVAYQIVTK 335

Query: 345 IIEKSGLDQVDKKSKFRDQFYQDSLPPKYKPKSFQQVFKGNTNDFFVLGAKFTRKTIKLY 404
           IIEKSGLDQVDK+ KF+DQF+  SLPP  KPKSF+ +FKGNTNDFFVLGAKFTRKT+KLY
Sbjct: 336 IIEKSGLDQVDKRGKFQDQFFDASLPPSSKPKSFKHIFKGNTNDFFVLGAKFTRKTLKLY 395

Query: 405 SNFYQSDIIVCSPLGIQLILENTDKKKRQDDFLSSIELLVIDQLHSIEFQNVLHLTSIFE 464
           SNFYQSD+I CSPLGIQLILENTDKKKRQDDFLSSIEL+VIDQLHSIE+QN+ H+T+IF+
Sbjct: 396 SNFYQSDVIFCSPLGIQLILENTDKKKRQDDFLSSIELMVIDQLHSIEYQNLSHITTIFQ 455

Query: 465 HINKIPQQQHDADFSRIKMWYINDQAKLFRQTLIFTRHSTPFANSLINGKCRNYAGRWKN 524
           HINKIPQQQHDADFSRI+MWYIN+QA LFRQT++FT++++PFANSLINGKCRN+AGRWKN
Sbjct: 456 HINKIPQQQHDADFSRIRMWYINEQATLFRQTMVFTKYASPFANSLINGKCRNHAGRWKN 515

Query: 525 HTIVGAEKSSLSQLGMRTRLVFQRFDVAGGAATDEPDFRFKHFCSVIVPNIVQSTGYEDG 584
           H IV  EKSS++QLG++ R +FQRFD+ GG+A DEPD+RFK F SVI+ +I++STGYEDG
Sbjct: 516 HNIVLPEKSSINQLGLKVRQIFQRFDLVGGSAMDEPDYRFKFFTSVIIASIIKSTGYEDG 575

Query: 585 ILLYIPDYTDFIRVRNYLREKTTILFGDISEYSEQRQLTANRALFQQGRVKVLLYTERLH 644
           ILLYIPDYTD++RVRN+LREKTT+LFGDI+EYSEQ+QLT+NRALFQQG+VKVLLYTERLH
Sbjct: 576 ILLYIPDYTDYVRVRNHLREKTTLLFGDINEYSEQKQLTSNRALFQQGKVKVLLYTERLH 635

Query: 645 HFRRYEIKGVKTVIFYKPPTNPEFFEETVRYLAKSAFLGVADLNISVVRCLYSKLDGLAL 704
           HFRRYEIKGVK+VIFYKPPTNPEF+ E VRY+ KSAFLG ADLNIS VRC+Y KLDGL+L
Sbjct: 636 HFRRYEIKGVKSVIFYKPPTNPEFYREVVRYIGKSAFLGSADLNISTVRCVYCKLDGLSL 695

Query: 705 ERIVGTERAAILTHGPNETYEFK 727
           ER+VGT+RAA+LTHG NE YEFK
Sbjct: 696 ERVVGTKRAAVLTHGQNEIYEFK 718

>YIL091C Chr9 complement(191030..193195) [2166 bp, 721 aa] {ON}
           UTP25Nucleolar protein required for 35S pre-RNA
           processing and 40S ribosomal subunit biogenesis
          Length = 721

 Score =  867 bits (2241), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 402/563 (71%), Positives = 484/563 (85%), Gaps = 3/563 (0%)

Query: 167 DPLEAHFNSVPEKDTDALDQAFKTKQVRYRSSKIKISKNEEFIYSRPDLNLESRTPIQVP 226
           DP E+HFN VPEK  D L  AFKTK V+Y+S K  +S +E +IY++P + +     ++ P
Sbjct: 160 DPFESHFNQVPEKFVDKLSNAFKTKSVKYKSVKGSLSDSESYIYAKP-VVIGEEALVESP 218

Query: 227 QGTQSLSPYFIKQRLKIQNDLLDSKNN-LTPLQKKIVDPIFQYQDLLYEYENYDQ-ETEY 284
             + S+  YF+KQRLK+QN LLD K + LT LQKK+VDP+FQY+D+LYEY++Y++ E EY
Sbjct: 219 YRSSSIYSYFLKQRLKVQNGLLDKKTDPLTALQKKLVDPMFQYKDILYEYDSYEKDEDEY 278

Query: 285 RDLYALHALDHIYKTRDRILKNNQRLQDNPDQEVLDQGFTRPKVLIVVPTRDVAYSVLSK 344
           RDLYALH L+HIYKTRDRILKNNQRLQDNPD E LDQGFTRPKVLIVVPTR+VAY V+ K
Sbjct: 279 RDLYALHVLNHIYKTRDRILKNNQRLQDNPDTEHLDQGFTRPKVLIVVPTREVAYRVVDK 338

Query: 345 IIEKSGLDQVDKKSKFRDQFYQDSLPPKYKPKSFQQVFKGNTNDFFVLGAKFTRKTIKLY 404
           II KSG+DQVDKK KF DQF  DSLPPK KPKSFQ +F+GNTNDFFV+G KFTRK IKLY
Sbjct: 339 IISKSGIDQVDKKGKFYDQFRDDSLPPKSKPKSFQHIFRGNTNDFFVVGLKFTRKAIKLY 398

Query: 405 SNFYQSDIIVCSPLGIQLILENTDKKKRQDDFLSSIELLVIDQLHSIEFQNVLHLTSIFE 464
           SNFYQSDIIVCSPLGIQ+ILENTDKKKRQDDFLSSIEL+VIDQLHSIE+QN+ H+ +IF+
Sbjct: 399 SNFYQSDIIVCSPLGIQMILENTDKKKRQDDFLSSIELMVIDQLHSIEYQNISHIFTIFD 458

Query: 465 HINKIPQQQHDADFSRIKMWYINDQAKLFRQTLIFTRHSTPFANSLINGKCRNYAGRWKN 524
           H+NKIP QQH+ADFSRI+MWYIN+QAKLFRQT++FT++ +P ANSLING+CRN AGRWKN
Sbjct: 459 HLNKIPDQQHEADFSRIRMWYINEQAKLFRQTMVFTKYISPAANSLINGRCRNMAGRWKN 518

Query: 525 HTIVGAEKSSLSQLGMRTRLVFQRFDVAGGAATDEPDFRFKHFCSVIVPNIVQSTGYEDG 584
           H ++G+E SS+ Q G++ R +FQRFD+ G +  +EPD+RFK F SVI+P IV+STGYEDG
Sbjct: 519 HKVIGSENSSIGQSGLKIRQIFQRFDIIGNSIIEEPDYRFKFFTSVIIPGIVKSTGYEDG 578

Query: 585 ILLYIPDYTDFIRVRNYLREKTTILFGDISEYSEQRQLTANRALFQQGRVKVLLYTERLH 644
           IL+YIPDYTDFIR+RNY++EKTTILFGDI+EYS QRQL ANR+LFQQGR+KV+LYTERLH
Sbjct: 579 ILIYIPDYTDFIRIRNYMKEKTTILFGDINEYSSQRQLNANRSLFQQGRLKVMLYTERLH 638

Query: 645 HFRRYEIKGVKTVIFYKPPTNPEFFEETVRYLAKSAFLGVADLNISVVRCLYSKLDGLAL 704
           H+RRYEIKGVK+V+FYKPP NPEF+ E VR++ K+AFLG  DLNIS VRC+YSKLDGL+L
Sbjct: 639 HYRRYEIKGVKSVVFYKPPNNPEFYNEVVRFIGKNAFLGNTDLNISTVRCIYSKLDGLSL 698

Query: 705 ERIVGTERAAILTHGPNETYEFK 727
           ERIVGT+RAA+L+H   E YEFK
Sbjct: 699 ERIVGTKRAAVLSHAQKEIYEFK 721

>Suva_9.108 Chr9 complement(185226..187394) [2169 bp, 722 aa] {ON}
           YIL091C (REAL)
          Length = 722

 Score =  861 bits (2225), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 402/563 (71%), Positives = 480/563 (85%), Gaps = 3/563 (0%)

Query: 167 DPLEAHFNSVPEKDTDALDQAFKTKQVRYRSSKIKISKNEEFIYSRPDLNLESRTPIQVP 226
           DP E+HFN V EK  D +  AFK   ++Y+S K  +  +E  IYS+P +N +  TP++ P
Sbjct: 161 DPFESHFNQVSEKYVDDVSNAFKANNIKYKSVKSPLGDDESCIYSKPVVNGDE-TPVERP 219

Query: 227 QGTQSLSPYFIKQRLKIQNDLLDSK-NNLTPLQKKIVDPIFQYQDLLYEYENYDQ-ETEY 284
             + S+  YF+KQRLKIQN LLD K + LT LQKK+VDP+FQY+D+LYEY++Y++ E EY
Sbjct: 220 YKSSSIYSYFLKQRLKIQNGLLDKKIDPLTSLQKKLVDPMFQYKDILYEYDSYEKDEDEY 279

Query: 285 RDLYALHALDHIYKTRDRILKNNQRLQDNPDQEVLDQGFTRPKVLIVVPTRDVAYSVLSK 344
           RDLY LHAL+HIYKTRDRILKNNQRLQDNPD E LDQGFTRPKVLIVVPTRD AY V+ K
Sbjct: 280 RDLYTLHALNHIYKTRDRILKNNQRLQDNPDTEHLDQGFTRPKVLIVVPTRDAAYHVVDK 339

Query: 345 IIEKSGLDQVDKKSKFRDQFYQDSLPPKYKPKSFQQVFKGNTNDFFVLGAKFTRKTIKLY 404
           II+KSG+DQVDKK KF DQF  DSLPP  KPKSFQ +F+GNT+DFFV+G KFTRK IKLY
Sbjct: 340 IIKKSGIDQVDKKGKFYDQFRDDSLPPSSKPKSFQHIFRGNTSDFFVVGLKFTRKAIKLY 399

Query: 405 SNFYQSDIIVCSPLGIQLILENTDKKKRQDDFLSSIELLVIDQLHSIEFQNVLHLTSIFE 464
           SNFYQSDIIVCSPLGIQ+ILENTDKKKRQDDFLSSIEL+VIDQLHSIE+QN+ H+ +IF+
Sbjct: 400 SNFYQSDIIVCSPLGIQMILENTDKKKRQDDFLSSIELMVIDQLHSIEYQNISHIFTIFD 459

Query: 465 HINKIPQQQHDADFSRIKMWYINDQAKLFRQTLIFTRHSTPFANSLINGKCRNYAGRWKN 524
           HINKIP QQH+ADFSRI+MWYIN+QAKL RQT++FT++ +P ANSLING+CRN AGRWKN
Sbjct: 460 HINKIPDQQHEADFSRIRMWYINEQAKLLRQTMVFTKYISPAANSLINGRCRNLAGRWKN 519

Query: 525 HTIVGAEKSSLSQLGMRTRLVFQRFDVAGGAATDEPDFRFKHFCSVIVPNIVQSTGYEDG 584
           H ++ +E SS+ QLG++ R +FQRFD+ G +  +EPD+RFK F SVI+P+IV+STGYEDG
Sbjct: 520 HKVIESETSSIGQLGLKIRQIFQRFDIIGNSIIEEPDYRFKFFTSVIIPSIVKSTGYEDG 579

Query: 585 ILLYIPDYTDFIRVRNYLREKTTILFGDISEYSEQRQLTANRALFQQGRVKVLLYTERLH 644
           IL+YIPDYTDFIR+RNY++EKTTILFGDI+EYS Q+QL ANR+LFQQGRVKVLLYTERLH
Sbjct: 580 ILIYIPDYTDFIRIRNYMKEKTTILFGDINEYSSQKQLNANRSLFQQGRVKVLLYTERLH 639

Query: 645 HFRRYEIKGVKTVIFYKPPTNPEFFEETVRYLAKSAFLGVADLNISVVRCLYSKLDGLAL 704
           H+RRYEIKGVK VIFYKPP NPEF+ ETVRY+ K+AFLG  DLNIS VRC+YSKLDGL+L
Sbjct: 640 HYRRYEIKGVKNVIFYKPPNNPEFYNETVRYIGKNAFLGNTDLNISTVRCVYSKLDGLSL 699

Query: 705 ERIVGTERAAILTHGPNETYEFK 727
           ERIVGT+RA +L+H   E YEFK
Sbjct: 700 ERIVGTKRAGVLSHAQKEVYEFK 722

>Smik_9.88 Chr9 complement(170163..172337) [2175 bp, 724 aa] {ON}
           YIL091C (REAL)
          Length = 724

 Score =  859 bits (2220), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 395/563 (70%), Positives = 484/563 (85%), Gaps = 3/563 (0%)

Query: 167 DPLEAHFNSVPEKDTDALDQAFKTKQVRYRSSKIKISKNEEFIYSRPDLNLESRTPIQVP 226
           DP E+HFN V EK  D L  AFK+K ++Y+S K  +  +E +IY++P + +     ++ P
Sbjct: 163 DPFESHFNQVSEKYVDDLSNAFKSKSIKYKSVKASLGDDESYIYAKPFM-VGEEALVESP 221

Query: 227 QGTQSLSPYFIKQRLKIQNDLLDSK-NNLTPLQKKIVDPIFQYQDLLYEYENYDQ-ETEY 284
             + S+  YF+KQRLK+QN LLD K + LT +QKK++DP+FQY+D+LYEY++Y++ E+EY
Sbjct: 222 YRSSSIYSYFLKQRLKVQNGLLDKKIDPLTCMQKKLIDPMFQYKDILYEYDSYEKDESEY 281

Query: 285 RDLYALHALDHIYKTRDRILKNNQRLQDNPDQEVLDQGFTRPKVLIVVPTRDVAYSVLSK 344
           RDLYALH L+HIYKTRDRILKNNQRLQDNPD E LDQGFTRPKVLIVVPTR+VAY V+ K
Sbjct: 282 RDLYALHVLNHIYKTRDRILKNNQRLQDNPDTEHLDQGFTRPKVLIVVPTREVAYRVVDK 341

Query: 345 IIEKSGLDQVDKKSKFRDQFYQDSLPPKYKPKSFQQVFKGNTNDFFVLGAKFTRKTIKLY 404
           II KSG+DQVDKK KF DQF  DSLPP+ KPKSFQ +FKGNT+DFFV+G KFTRK IKLY
Sbjct: 342 IISKSGIDQVDKKGKFYDQFRDDSLPPESKPKSFQHIFKGNTSDFFVVGLKFTRKAIKLY 401

Query: 405 SNFYQSDIIVCSPLGIQLILENTDKKKRQDDFLSSIELLVIDQLHSIEFQNVLHLTSIFE 464
           SNFYQSDII+CSPLGIQ+ILENTDKKKRQDDFLSSIEL+VIDQLHSIE+QN+ H+ +IF+
Sbjct: 402 SNFYQSDIIICSPLGIQMILENTDKKKRQDDFLSSIELMVIDQLHSIEYQNISHIFTIFD 461

Query: 465 HINKIPQQQHDADFSRIKMWYINDQAKLFRQTLIFTRHSTPFANSLINGKCRNYAGRWKN 524
           HINKIP QQH+ADFSRI+MWYIN+QAKLFRQT++FT++ +P ANSLING+C N AGRWKN
Sbjct: 462 HINKIPDQQHEADFSRIRMWYINEQAKLFRQTMVFTKYISPAANSLINGRCCNMAGRWKN 521

Query: 525 HTIVGAEKSSLSQLGMRTRLVFQRFDVAGGAATDEPDFRFKHFCSVIVPNIVQSTGYEDG 584
           H ++G+E SS+ QLG++ R +FQRFD+ G +  +EPD+RFK F SVI+P+IV+S GYEDG
Sbjct: 522 HKVIGSESSSIGQLGLKVRQIFQRFDIIGNSIIEEPDYRFKFFTSVIIPSIVKSVGYEDG 581

Query: 585 ILLYIPDYTDFIRVRNYLREKTTILFGDISEYSEQRQLTANRALFQQGRVKVLLYTERLH 644
           IL+YIPDYTDFIR+RNY++EKTTILFGDI+EYS QRQL ANR+LFQQGR+KV+LYTERLH
Sbjct: 582 ILVYIPDYTDFIRIRNYMKEKTTILFGDINEYSNQRQLNANRSLFQQGRLKVMLYTERLH 641

Query: 645 HFRRYEIKGVKTVIFYKPPTNPEFFEETVRYLAKSAFLGVADLNISVVRCLYSKLDGLAL 704
           H+RRYEIKGVK+V+FYKPP NPEF+ ETVR++ K+AFLG  DLNIS VRC+YSKLDGL+L
Sbjct: 642 HYRRYEIKGVKSVVFYKPPNNPEFYNETVRFIGKNAFLGNTDLNISTVRCIYSKLDGLSL 701

Query: 705 ERIVGTERAAILTHGPNETYEFK 727
           ERIVGT+RAA+L+H   E YEFK
Sbjct: 702 ERIVGTKRAAVLSHAQKEVYEFK 724

>Skud_9.82 Chr9 complement(167750..169918) [2169 bp, 722 aa] {ON}
           YIL091C (REAL)
          Length = 722

 Score =  858 bits (2216), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 395/563 (70%), Positives = 480/563 (85%), Gaps = 3/563 (0%)

Query: 167 DPLEAHFNSVPEKDTDALDQAFKTKQVRYRSSKIKISKNEEFIYSRPDLNLESRTPIQVP 226
           DP E+HFN VPEKD D L  AFK+K +RY+S K  ++ +E +IY++P + +   + ++ P
Sbjct: 161 DPFESHFNQVPEKDVDDLSNAFKSKNIRYKSVKAPLNGDESYIYAQP-VVVGEESSVESP 219

Query: 227 QGTQSLSPYFIKQRLKIQNDLLDSK-NNLTPLQKKIVDPIFQYQDLLYEYENYDQ-ETEY 284
             + S+  YF+KQRLKIQN L D K + L  LQ+K+VDP+FQY+D+LYEY++Y++ E EY
Sbjct: 220 YKSSSIYSYFLKQRLKIQNGLQDKKIDPLNALQRKLVDPMFQYKDILYEYDSYEKDEDEY 279

Query: 285 RDLYALHALDHIYKTRDRILKNNQRLQDNPDQEVLDQGFTRPKVLIVVPTRDVAYSVLSK 344
           RDLY LH L+HIYKTRDRILKNNQRLQDNPD E LDQGFTRPKVLIVVPTRDVAY V+ K
Sbjct: 280 RDLYTLHVLNHIYKTRDRILKNNQRLQDNPDTEHLDQGFTRPKVLIVVPTRDVAYRVVDK 339

Query: 345 IIEKSGLDQVDKKSKFRDQFYQDSLPPKYKPKSFQQVFKGNTNDFFVLGAKFTRKTIKLY 404
           II KSG+DQVDKK KF DQF  DSLPPK KP+SFQ +FKGNTNDFFV+G KFTRK IKLY
Sbjct: 340 IISKSGIDQVDKKGKFYDQFRDDSLPPKSKPRSFQHIFKGNTNDFFVVGLKFTRKAIKLY 399

Query: 405 SNFYQSDIIVCSPLGIQLILENTDKKKRQDDFLSSIELLVIDQLHSIEFQNVLHLTSIFE 464
           SNFYQSDIIVCSPLGIQ+ILENTDKKKRQDDFLSSIE++VIDQLHSIE+QN+ H+ +IF+
Sbjct: 400 SNFYQSDIIVCSPLGIQMILENTDKKKRQDDFLSSIEIMVIDQLHSIEYQNISHILTIFD 459

Query: 465 HINKIPQQQHDADFSRIKMWYINDQAKLFRQTLIFTRHSTPFANSLINGKCRNYAGRWKN 524
           H+NKIP QQH+ADFSRI+MWYIN+QAK FRQT++FT++ +P  NSLING+CRN AGRWKN
Sbjct: 460 HLNKIPDQQHEADFSRIRMWYINEQAKFFRQTMVFTKYISPTVNSLINGRCRNMAGRWKN 519

Query: 525 HTIVGAEKSSLSQLGMRTRLVFQRFDVAGGAATDEPDFRFKHFCSVIVPNIVQSTGYEDG 584
           H  +G E SS+ QLG++ R +FQRFD  G +  +EPD+RFK F SV++P+IV+STGYEDG
Sbjct: 520 HRTIGPETSSIGQLGLKIRQIFQRFDTIGNSIVEEPDYRFKFFTSVMIPSIVKSTGYEDG 579

Query: 585 ILLYIPDYTDFIRVRNYLREKTTILFGDISEYSEQRQLTANRALFQQGRVKVLLYTERLH 644
           IL+YIPDYTDFIR+RNY++EKTTILFGDI+EYS QRQL ANR+LFQQGR+KV+LYTERLH
Sbjct: 580 ILIYIPDYTDFIRIRNYMKEKTTILFGDINEYSSQRQLNANRSLFQQGRLKVMLYTERLH 639

Query: 645 HFRRYEIKGVKTVIFYKPPTNPEFFEETVRYLAKSAFLGVADLNISVVRCLYSKLDGLAL 704
           H+RRY+IKGVK+VIFYKPP NPEF+ ETVR++ K+AF G  DLNIS VRC+YSKLDG++L
Sbjct: 640 HYRRYDIKGVKSVIFYKPPNNPEFYSETVRFIGKNAFSGNTDLNISTVRCIYSKLDGISL 699

Query: 705 ERIVGTERAAILTHGPNETYEFK 727
           ERIVGT+RAA+L+H   E YEFK
Sbjct: 700 ERIVGTKRAAVLSHAQKEVYEFK 722

>KLLA0E08229g Chr5 (742066..744180) [2115 bp, 704 aa] {ON} similar
           to uniprot|P40498 Saccharomyces cerevisiae YIL091C
           Protein required for cell viability
          Length = 704

 Score =  857 bits (2213), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 391/562 (69%), Positives = 483/562 (85%), Gaps = 3/562 (0%)

Query: 166 SDPLEAHFNSVPEKDTDALDQAFKTKQVRYRSSKIKISKNEEFIYSRPDLNLESRTPIQV 225
           SDP E+HF+   E    A D+ FK K V+Y+SSK  +S+ E  IYS+P L+ E   P++ 
Sbjct: 146 SDPFESHFSKYSESRLYAFDKGFKDKTVKYKSSKTDVSEEESLIYSKPCLDDEEVLPVK- 204

Query: 226 PQGTQSLSPYFIKQRLKIQNDLLDSKNNLTPLQKKIVDPIFQYQDLLYEYENYDQETEYR 285
             G Q+LS YFIKQ+LK+ ND  ++   LT +QK++VDP+FQY+D+LYEY++Y  E +YR
Sbjct: 205 --GKQTLSSYFIKQKLKLANDFQNNGLPLTEIQKELVDPMFQYKDMLYEYDDYADEDQYR 262

Query: 286 DLYALHALDHIYKTRDRILKNNQRLQDNPDQEVLDQGFTRPKVLIVVPTRDVAYSVLSKI 345
           DLY+LHAL+H+YKTRDRILKNNQ+LQ+N D+E+LDQGFTRPKVLIVVPTRD A+ ++ KI
Sbjct: 263 DLYSLHALNHVYKTRDRILKNNQKLQENNDEELLDQGFTRPKVLIVVPTRDAAHKIVRKI 322

Query: 346 IEKSGLDQVDKKSKFRDQFYQDSLPPKYKPKSFQQVFKGNTNDFFVLGAKFTRKTIKLYS 405
           +EKSGLDQ DKKSKF DQF++DSLPP  KPKSFQ +F+GNTNDFFVLG KFTRK++K+YS
Sbjct: 323 MEKSGLDQFDKKSKFEDQFFEDSLPPTSKPKSFQHIFQGNTNDFFVLGLKFTRKSLKIYS 382

Query: 406 NFYQSDIIVCSPLGIQLILENTDKKKRQDDFLSSIELLVIDQLHSIEFQNVLHLTSIFEH 465
           NFYQSDII+CSPLGIQLILENTDKKKRQDDFLSSIE+++IDQLHSIE+QN +H+T+IF+H
Sbjct: 383 NFYQSDIIICSPLGIQLILENTDKKKRQDDFLSSIEVMIIDQLHSIEYQNAMHVTTIFQH 442

Query: 466 INKIPQQQHDADFSRIKMWYINDQAKLFRQTLIFTRHSTPFANSLINGKCRNYAGRWKNH 525
           INKIP+QQ +ADFSRI+MWYIN+QAK FRQT++FT++ +PFANS++NGKCRN AGRWKNH
Sbjct: 443 INKIPEQQREADFSRIRMWYINEQAKFFRQTIVFTKYISPFANSILNGKCRNLAGRWKNH 502

Query: 526 TIVGAEKSSLSQLGMRTRLVFQRFDVAGGAATDEPDFRFKHFCSVIVPNIVQSTGYEDGI 585
             +  E+SS+ QLG++ R +FQRFD+AGG A DEPD+RFK F SVIVP+IV+STGYEDGI
Sbjct: 503 RKIKPEQSSIGQLGLKVRQIFQRFDLAGGTALDEPDYRFKFFTSVIVPSIVKSTGYEDGI 562

Query: 586 LLYIPDYTDFIRVRNYLREKTTILFGDISEYSEQRQLTANRALFQQGRVKVLLYTERLHH 645
           LLYIPDYTDFIRVRNYL+EKTTI+FG+I+EYS Q+QLT+NRA FQ G+VKVLLYTERLHH
Sbjct: 563 LLYIPDYTDFIRVRNYLKEKTTIIFGEINEYSNQKQLTSNRARFQHGKVKVLLYTERLHH 622

Query: 646 FRRYEIKGVKTVIFYKPPTNPEFFEETVRYLAKSAFLGVADLNISVVRCLYSKLDGLALE 705
           FRRYEIK VK+VIFYKPP NPEF+ E VR + K+ FLG  D+NIS VRC+YSK+DGL+LE
Sbjct: 623 FRRYEIKNVKSVIFYKPPGNPEFYSEVVRNIGKNVFLGNCDINISTVRCIYSKMDGLSLE 682

Query: 706 RIVGTERAAILTHGPNETYEFK 727
           R+VG++RAA+L HG NE YEFK
Sbjct: 683 RVVGSKRAAVLAHGQNEVYEFK 704

 Score = 34.3 bits (77), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 25/72 (34%), Positives = 31/72 (43%), Gaps = 6/72 (8%)

Query: 21 KGGRKQLRSIRKAS----RYDSKKXXXXXXXXXXXXXXXXXXXXXXRTEVSRKQESNGEA 76
          K GRKQLR I +A     RYD +                         E    ++  G+A
Sbjct: 9  KSGRKQLREITRAGQKRVRYDDEATVADLTPDNESDSDNAEPSVAAERE--DVEQHRGQA 66

Query: 77 YAALLTLLKAEH 88
          Y ALLTLLK+EH
Sbjct: 67 YNALLTLLKSEH 78

>KAFR0J01340 Chr10 (245485..247671) [2187 bp, 728 aa] {ON} Anc_2.292
           YIL091C
          Length = 728

 Score =  851 bits (2198), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 389/564 (68%), Positives = 481/564 (85%), Gaps = 3/564 (0%)

Query: 167 DPLEAHFNSVPEKDTDALDQAFKTKQVRYRSSKIKISKNEEFIYSRPDLNL-ESRTPIQV 225
           DP E HFNSV EK TD LD +FK   ++Y+S+K+ IS++E  I+S+P +   E  +P+++
Sbjct: 165 DPFETHFNSVDEKFTDKLDVSFKNNDIKYKSTKLPISEDEYAIFSKPVIKSDEIESPVEL 224

Query: 226 PQGTQSLSPYFIKQRLKIQNDLLDSK-NNLTPLQKKIVDPIFQYQDLLYEYENYDQ-ETE 283
                S+  YF+KQRLK+QN+L+D K + LTPLQK++VDP+FQY+D+LY+Y++Y + E E
Sbjct: 225 SVNKSSIHSYFLKQRLKMQNNLMDPKVDPLTPLQKQLVDPMFQYKDILYQYDSYGKDEDE 284

Query: 284 YRDLYALHALDHIYKTRDRILKNNQRLQDNPDQEVLDQGFTRPKVLIVVPTRDVAYSVLS 343
           YRDLY+LH L+H+YKTRD+ILKNNQRLQDN D E LDQGFTRPKVLIVVPTRD AY V+ 
Sbjct: 285 YRDLYSLHVLNHLYKTRDKILKNNQRLQDNNDTECLDQGFTRPKVLIVVPTRDTAYQVIE 344

Query: 344 KIIEKSGLDQVDKKSKFRDQFYQDSLPPKYKPKSFQQVFKGNTNDFFVLGAKFTRKTIKL 403
           KII KSG+DQVDKK KF+DQF++DSLPP  KPKSFQ +FKGNTNDFFVLG KFTRK IKL
Sbjct: 345 KIIAKSGIDQVDKKGKFKDQFFEDSLPPSSKPKSFQDIFKGNTNDFFVLGVKFTRKAIKL 404

Query: 404 YSNFYQSDIIVCSPLGIQLILENTDKKKRQDDFLSSIELLVIDQLHSIEFQNVLHLTSIF 463
           YSNFYQSDII+CSPLGIQ+ILENTDKKKRQDDFLSSIEL++IDQLHSIE+QN+ HL +I 
Sbjct: 405 YSNFYQSDIIICSPLGIQMILENTDKKKRQDDFLSSIELMIIDQLHSIEYQNISHLFTIC 464

Query: 464 EHINKIPQQQHDADFSRIKMWYINDQAKLFRQTLIFTRHSTPFANSLINGKCRNYAGRWK 523
            HINKIPQ+QHDADFSR++MWYINDQAKLFRQT++FT++ +P ANSL+NGKC+N++GRWK
Sbjct: 465 NHINKIPQEQHDADFSRVRMWYINDQAKLFRQTMLFTKYISPMANSLLNGKCQNWSGRWK 524

Query: 524 NHTIVGAEKSSLSQLGMRTRLVFQRFDVAGGAATDEPDFRFKHFCSVIVPNIVQSTGYED 583
           NH ++    SS+S++G++ R +FQRF+   G+  DEPD+RFK F SV VPNIV++TGYED
Sbjct: 525 NHKVISTNSSSISKVGIKIRQIFQRFETVNGSVVDEPDYRFKFFTSVTVPNIVKTTGYED 584

Query: 584 GILLYIPDYTDFIRVRNYLREKTTILFGDISEYSEQRQLTANRALFQQGRVKVLLYTERL 643
           G L+YIP+YTD+IRVRNYL++KTTILFGDI+EYS+Q+QL +NR+LFQQGRVKVLLYTERL
Sbjct: 585 GTLIYIPEYTDYIRVRNYLKDKTTILFGDINEYSDQKQLNSNRSLFQQGRVKVLLYTERL 644

Query: 644 HHFRRYEIKGVKTVIFYKPPTNPEFFEETVRYLAKSAFLGVADLNISVVRCLYSKLDGLA 703
           HH+RRYEIKGVK V+FY+PP NPEF+ E VRY+ K+AFLG  DLNIS VRCLYSKLD L+
Sbjct: 645 HHYRRYEIKGVKNVVFYQPPKNPEFYTEVVRYIGKNAFLGNTDLNISTVRCLYSKLDALS 704

Query: 704 LERIVGTERAAILTHGPNETYEFK 727
           LE IVG++RA +L H  NE YEFK
Sbjct: 705 LENIVGSKRAGVLCHAQNEVYEFK 728

>NCAS0B06230 Chr2 (1175844..1178015) [2172 bp, 723 aa] {ON}
           Anc_2.292 YIL091C
          Length = 723

 Score =  843 bits (2177), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 391/566 (69%), Positives = 477/566 (84%), Gaps = 6/566 (1%)

Query: 167 DPLEAHFNSVPEKDTDALDQAFKTKQVRYRSSKIKISKNEEFIYSRPDLNLESRTPIQ-- 224
           DP E+HFN V EK  D L+ AF T  V+Y+S+K  I  N+  I S P +  +  T  +  
Sbjct: 159 DPFESHFNQVSEKTADDLNTAFNTGSVKYKSTKSVIGDNKTVISSIPTIIGKENTEEEKD 218

Query: 225 -VPQGTQSLSPYFIKQRLKIQNDLLDSKNN-LTPLQKKIVDPIFQYQDLLYEYENYDQ-E 281
             P+ + S+  YF+KQRL++ ND+LDSK + L PLQK++VDP+FQY+D+L EY +Y++ E
Sbjct: 219 SAPKSS-SIHSYFLKQRLRVANDMLDSKKDPLGPLQKELVDPMFQYRDILCEYSSYEKDE 277

Query: 282 TEYRDLYALHALDHIYKTRDRILKNNQRLQDNPDQEVLDQGFTRPKVLIVVPTRDVAYSV 341
            EYRDLYALHAL+H+YKTRDRILK+N RLQDN D E  DQGFTRPKVLIVVPTRD AY V
Sbjct: 278 DEYRDLYALHALNHVYKTRDRILKDNGRLQDNSDTEYFDQGFTRPKVLIVVPTRDTAYEV 337

Query: 342 LSKIIEKSGLDQVDKKSKFRDQFYQDSLPPKYKPKSFQQVFKGNTNDFFVLGAKFTRKTI 401
           +SKII KSGLDQVDKK KF DQF+ ++LPP  KPKSFQ +FKGNTNDFFVLG KFTRK I
Sbjct: 338 ISKIISKSGLDQVDKKGKFNDQFHDETLPPSSKPKSFQHIFKGNTNDFFVLGVKFTRKAI 397

Query: 402 KLYSNFYQSDIIVCSPLGIQLILENTDKKKRQDDFLSSIELLVIDQLHSIEFQNVLHLTS 461
           KLYSNFYQSDIIVCSPLG+Q+I+ENTDKK RQDDFLSSIE+L+IDQLHSIE+QN+ H+ +
Sbjct: 398 KLYSNFYQSDIIVCSPLGMQMIVENTDKKNRQDDFLSSIEVLIIDQLHSIEYQNLAHVFT 457

Query: 462 IFEHINKIPQQQHDADFSRIKMWYINDQAKLFRQTLIFTRHSTPFANSLINGKCRNYAGR 521
           IF+H+NKIP+QQH+ADFSRI+MWYINDQA+LFRQT+IFT++ TP AN+LIN +CRN+AGR
Sbjct: 458 IFDHLNKIPEQQHEADFSRIRMWYINDQARLFRQTMIFTKYVTPAANALINNRCRNWAGR 517

Query: 522 WKNHTIVGAEKSSLSQLGMRTRLVFQRFDVAGGAATDEPDFRFKHFCSVIVPNIVQSTGY 581
           WKNH I+  E S++SQLG++ +  FQRFD+ GG+  DEPD+RFKHF SVI+P+IV+ST Y
Sbjct: 518 WKNHEIIEPEASAISQLGLKVKQTFQRFDMMGGSVIDEPDYRFKHFSSVIIPSIVKSTSY 577

Query: 582 EDGILLYIPDYTDFIRVRNYLREKTTILFGDISEYSEQRQLTANRALFQQGRVKVLLYTE 641
            DGIL+YIPDYTD++R+RNYL+EKTT+LFGDI+EYSEQR+L +NR+LFQQGRVKVLLYTE
Sbjct: 578 SDGILIYIPDYTDYVRIRNYLKEKTTLLFGDINEYSEQRELNSNRSLFQQGRVKVLLYTE 637

Query: 642 RLHHFRRYEIKGVKTVIFYKPPTNPEFFEETVRYLAKSAFLGVADLNISVVRCLYSKLDG 701
           RLHH+RRYE+KGVK+V+FYKPPTNPEF+ E VRY+ KSAFLG ADLNIS VR LY KLDG
Sbjct: 638 RLHHYRRYELKGVKSVVFYKPPTNPEFYNEVVRYIGKSAFLGNADLNISTVRTLYCKLDG 697

Query: 702 LALERIVGTERAAILTHGPNETYEFK 727
           L+LERIVG++RA IL H  NE YEF+
Sbjct: 698 LSLERIVGSKRAGILCHAQNEVYEFQ 723

>KNAG0A05400 Chr1 (795728..797893) [2166 bp, 721 aa] {ON} Anc_2.292
           YIL091C
          Length = 721

 Score =  840 bits (2169), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 392/580 (67%), Positives = 478/580 (82%), Gaps = 29/580 (5%)

Query: 167 DPLEAHFNSVPEKDTDALDQAFKTKQVRYRSSKIKISK-----NEEFIYSRPDLNLESRT 221
           DP E+HFN  PE + + LD AFK+KQ++YRS K++ +K     +E  IYS P        
Sbjct: 152 DPFESHFNQFPETEINTLDAAFKSKQLQYRSVKLQPAKVTKVKDEYLIYSEP-------- 203

Query: 222 PIQVPQGTQ------------SLSPYFIKQRLKIQNDLLDSK-NNLTPLQKKIVDPIFQY 268
              VP G Q            S+  YF+K+RLKIQNDLL++K +NL  +QK++VDP+FQY
Sbjct: 204 --TVPGGKQLSKKLIESNTKCSIGSYFLKKRLKIQNDLLENKPDNLASIQKELVDPMFQY 261

Query: 269 QDLLYEYENYDQ-ETEYRDLYALHALDHIYKTRDRILKNNQRLQDNPDQEVLDQGFTRPK 327
           +D+LYEYENY + E EYR LYALHAL+H+YKTRDRILKNNQRLQ+N D E LDQGFTRPK
Sbjct: 262 KDILYEYENYGKSEDEYRQLYALHALNHVYKTRDRILKNNQRLQENSDTECLDQGFTRPK 321

Query: 328 VLIVVPTRDVAYSVLSKIIEKSGLDQVDKKSKFRDQFYQDSLPPKYKPKSFQQVFKGNTN 387
           VLI+ PTRD AYS+++ II KSG+DQVDK+ KF+DQFY+DSLPP  KPKSFQ +FKGNTN
Sbjct: 322 VLIIAPTRDTAYSIVTTIINKSGIDQVDKRGKFKDQFYEDSLPPSSKPKSFQSIFKGNTN 381

Query: 388 DFFVLGAKFTRKTIKLYSNFYQSDIIVCSPLGIQLILENTDKKKRQDDFLSSIELLVIDQ 447
           DFFVLG KFTRK IKLYSNFYQSDIIVCSPLG+Q+I+ENTDKKKRQDDFLSSIE+ +IDQ
Sbjct: 382 DFFVLGMKFTRKAIKLYSNFYQSDIIVCSPLGLQMIVENTDKKKRQDDFLSSIEITIIDQ 441

Query: 448 LHSIEFQNVLHLTSIFEHINKIPQQQHDADFSRIKMWYINDQAKLFRQTLIFTRHSTPFA 507
           LHSIE+QN+ HL +IFEH+N IP +QHDADFSRI+MWYINDQA+ FRQT++FT++ +P A
Sbjct: 442 LHSIEYQNISHLYTIFEHLNNIPDEQHDADFSRIRMWYINDQARFFRQTMVFTKYISPTA 501

Query: 508 NSLINGKCRNYAGRWKNHTIVGAEKSSLSQLGMRTRLVFQRFDVAGGAATDEPDFRFKHF 567
           NS+INGKCRN++GRWKNH IV  E S + +L +R R +FQRF+V GG+  DEPD+RFK F
Sbjct: 502 NSIINGKCRNWSGRWKNHRIVSNEASHIGKLSLRVRQIFQRFEVTGGSIVDEPDYRFKFF 561

Query: 568 CSVIVPNIVQSTGYEDGILLYIPDYTDFIRVRNYLREKTTILFGDISEYSEQRQLTANRA 627
            SVI+P I++STGYEDGIL+YIP+YTD++RVRNYL+EKT ILFGDI+EYS Q+QLTANR+
Sbjct: 562 TSVIIPGILKSTGYEDGILIYIPEYTDYVRVRNYLKEKTRILFGDINEYSSQKQLTANRS 621

Query: 628 LFQQGRVKVLLYTERLHHFRRYEIKGVKTVIFYKPPTNPEFFEETVRYLAKSAFLGVADL 687
           LFQQGR+KVLLYTERLHH+RRYEIKGVK+VIFYKPP++PEF+ E VR + ++AFLG  DL
Sbjct: 622 LFQQGRLKVLLYTERLHHYRRYEIKGVKSVIFYKPPSDPEFYTEVVRNIGRNAFLGNTDL 681

Query: 688 NISVVRCLYSKLDGLALERIVGTERAAILTHGPNETYEFK 727
           NIS VRC+YSKLD LALE +VGT+RA +L HG NE YEFK
Sbjct: 682 NISTVRCIYSKLDALALENVVGTQRAGVLCHGQNEIYEFK 721

>TBLA0B05970 Chr2 complement(1410055..1412214) [2160 bp, 719 aa]
           {ON} Anc_2.292 YIL091C
          Length = 719

 Score =  838 bits (2165), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 388/564 (68%), Positives = 476/564 (84%), Gaps = 2/564 (0%)

Query: 166 SDPLEAHFNSVPEKDTDALDQAFKTKQVRYRSSKIKISKNEEFIYSRPDLNLESRTPIQV 225
           SDP ++HFN   E+ T+    AFK KQ++YRS K KI++ E  IYS P +  + +T ++ 
Sbjct: 156 SDPFDSHFNQPTEQFTNKFADAFKNKQIKYRSIKYKINEYESSIYSEPRILEDEQTKVKS 215

Query: 226 PQGTQSLSPYFIKQRLKIQNDLLD-SKNNLTPLQKKIVDPIFQYQDLLYEYENYDQ-ETE 283
           P    S+  Y +K+RLKI NDLLD + NNLT +QK++VDP+FQY+D+LYEY NY + E E
Sbjct: 216 PVLKSSIHSYALKKRLKINNDLLDPAVNNLTTIQKELVDPMFQYKDILYEYGNYGKDEEE 275

Query: 284 YRDLYALHALDHIYKTRDRILKNNQRLQDNPDQEVLDQGFTRPKVLIVVPTRDVAYSVLS 343
           YR LY LH L+HIYKTRDRILKNN ++QDNPD E LDQGFTRPKVLIV PTRD  YS+++
Sbjct: 276 YRSLYCLHVLNHIYKTRDRILKNNSKVQDNPDAEFLDQGFTRPKVLIVAPTRDAGYSIVN 335

Query: 344 KIIEKSGLDQVDKKSKFRDQFYQDSLPPKYKPKSFQQVFKGNTNDFFVLGAKFTRKTIKL 403
           +II+KSG+DQ+DKKSKFRDQFY++SL P  KPKSFQ VFKGN+ND+FVLG KFTRK IKL
Sbjct: 336 EIIKKSGIDQIDKKSKFRDQFYEESLLPASKPKSFQAVFKGNSNDYFVLGIKFTRKAIKL 395

Query: 404 YSNFYQSDIIVCSPLGIQLILENTDKKKRQDDFLSSIELLVIDQLHSIEFQNVLHLTSIF 463
           YSNFYQSDIIVCSPLG+ +ILENTDKKKRQDDFLSSIEL++IDQLHS+EFQN+ H+TSIF
Sbjct: 396 YSNFYQSDIIVCSPLGLHMILENTDKKKRQDDFLSSIELMIIDQLHSMEFQNISHVTSIF 455

Query: 464 EHINKIPQQQHDADFSRIKMWYINDQAKLFRQTLIFTRHSTPFANSLINGKCRNYAGRWK 523
           EHINKIP++QHD DFSRIKMWYINDQAKLFRQT+IFT++ +P AN  +NGKC+N++GRWK
Sbjct: 456 EHINKIPKEQHDTDFSRIKMWYINDQAKLFRQTMIFTKYISPSANFFLNGKCQNWSGRWK 515

Query: 524 NHTIVGAEKSSLSQLGMRTRLVFQRFDVAGGAATDEPDFRFKHFCSVIVPNIVQSTGYED 583
           NH ++   +SS+ QLG+R + +F RFD+ GG+  DEPD+RFK+F SVIV +I +ST YED
Sbjct: 516 NHKMITPNESSIGQLGLRVKQMFHRFDIIGGSIVDEPDYRFKYFTSVIVQSITKSTSYED 575

Query: 584 GILLYIPDYTDFIRVRNYLREKTTILFGDISEYSEQRQLTANRALFQQGRVKVLLYTERL 643
           G+L+YI DYTD++RVRNYL+EKTTILFGDI+EYS+Q+Q+ +NRALFQQ RVKVLLYTERL
Sbjct: 576 GMLIYITDYTDYVRVRNYLKEKTTILFGDINEYSDQKQVNSNRALFQQRRVKVLLYTERL 635

Query: 644 HHFRRYEIKGVKTVIFYKPPTNPEFFEETVRYLAKSAFLGVADLNISVVRCLYSKLDGLA 703
           HHFRRYEIKGVK ++FYK PTNPEF+ E VRY+ K+AF G  D+NIS VR +YSKLDGLA
Sbjct: 636 HHFRRYEIKGVKNIVFYKAPTNPEFYNEVVRYIGKNAFTGNTDINISNVRTIYSKLDGLA 695

Query: 704 LERIVGTERAAILTHGPNETYEFK 727
           LERI+GT+RAA+LTHG NETYEFK
Sbjct: 696 LERIMGTKRAAVLTHGQNETYEFK 719

>Ecym_3331 Chr3 complement(631944..634070) [2127 bp, 708 aa] {ON}
           similar to Ashbya gossypii ADL209C
          Length = 708

 Score =  837 bits (2163), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 395/565 (69%), Positives = 478/565 (84%), Gaps = 4/565 (0%)

Query: 167 DPLEAHFNSVPEKDTDALDQAFKTKQVRYRSSKIK-ISKNEEFIYSRPDL-NLESRTPIQ 224
           DP E HFN + E DT+ LD AFK K V+Y S+K+  +  NE FI+S+P +  L+    + 
Sbjct: 144 DPFEYHFNQISEMDTNKLDAAFKEKTVQYESTKLPYMHDNEGFIFSKPVIEGLKGSDAVN 203

Query: 225 -VPQGTQSLSPYFIKQRLKIQNDLLDSKNN-LTPLQKKIVDPIFQYQDLLYEYENYDQET 282
             P    ++  YF+K++LK+ N LLD K   LTPL K +VDPIFQY+DLL+EYE++ QET
Sbjct: 204 DTPVCKGNIHSYFMKKKLKVHNGLLDDKKKPLTPLSKTLVDPIFQYRDLLFEYEDFSQET 263

Query: 283 EYRDLYALHALDHIYKTRDRILKNNQRLQDNPDQEVLDQGFTRPKVLIVVPTRDVAYSVL 342
           EYRDLY LH L+HIYKTRDRILKNN +LQ+N DQE+LDQGFTRPKVL+V PTR+ AY ++
Sbjct: 264 EYRDLYTLHILNHIYKTRDRILKNNHKLQENDDQELLDQGFTRPKVLVVAPTRNTAYDII 323

Query: 343 SKIIEKSGLDQVDKKSKFRDQFYQDSLPPKYKPKSFQQVFKGNTNDFFVLGAKFTRKTIK 402
            KII+KSGLDQVDKKSKF+DQFY+DSLPP  KPKSFQ VFKGNTNDFFVLG KFTRKT+K
Sbjct: 324 EKIIDKSGLDQVDKKSKFKDQFYEDSLPPTSKPKSFQHVFKGNTNDFFVLGMKFTRKTLK 383

Query: 403 LYSNFYQSDIIVCSPLGIQLILENTDKKKRQDDFLSSIELLVIDQLHSIEFQNVLHLTSI 462
           LYSNFYQSD+IVCSPLGIQLILENTDKKKRQDDFLSSIE+LV+DQLHS+EFQN  H+ SI
Sbjct: 384 LYSNFYQSDVIVCSPLGIQLILENTDKKKRQDDFLSSIEMLVVDQLHSLEFQNPAHVLSI 443

Query: 463 FEHINKIPQQQHDADFSRIKMWYINDQAKLFRQTLIFTRHSTPFANSLINGKCRNYAGRW 522
           F+HINKIPQ+QHD+DFSRI+MWYINDQA+LFRQTLIFT++ +PFANSLINGKC N++GR+
Sbjct: 444 FQHINKIPQKQHDSDFSRIRMWYINDQARLFRQTLIFTKYVSPFANSLINGKCCNWSGRF 503

Query: 523 KNHTIVGAEKSSLSQLGMRTRLVFQRFDVAGGAATDEPDFRFKHFCSVIVPNIVQSTGYE 582
           KN   +  EKS+++QLG++ R VF RFD+  G++ DEPD+RFK F SV VP I +STGYE
Sbjct: 504 KNRRYISPEKSAINQLGLKVRQVFHRFDLFTGSSVDEPDYRFKFFTSVTVPIIQKSTGYE 563

Query: 583 DGILLYIPDYTDFIRVRNYLREKTTILFGDISEYSEQRQLTANRALFQQGRVKVLLYTER 642
           DGILLYIPDYTDF+RVRNY +++T ILFG+I+EYS+QRQ+T+NRALFQQG+VKVLLYTER
Sbjct: 564 DGILLYIPDYTDFLRVRNYFKDQTRILFGEITEYSDQRQVTSNRALFQQGKVKVLLYTER 623

Query: 643 LHHFRRYEIKGVKTVIFYKPPTNPEFFEETVRYLAKSAFLGVADLNISVVRCLYSKLDGL 702
           LHHFRRY+IKGVK+VIFYKPP+NPEF++E +R + K+AFLG ADLNIS VRC Y KLD L
Sbjct: 624 LHHFRRYQIKGVKSVIFYKPPSNPEFYQELIRCIGKNAFLGNADLNISTVRCTYCKLDSL 683

Query: 703 ALERIVGTERAAILTHGPNETYEFK 727
           +LERIVG++RAA+LT   NE YEFK
Sbjct: 684 SLERIVGSKRAAVLTRSQNEIYEFK 708

>NDAI0B03530 Chr2 (887479..889698) [2220 bp, 739 aa] {ON} Anc_2.292
           YIL091C
          Length = 739

 Score =  838 bits (2164), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 391/566 (69%), Positives = 478/566 (84%), Gaps = 6/566 (1%)

Query: 167 DPLEAHFNSVPEKDTDALDQAFKTKQVRYRSSKIKISKNEEFIYSRPDL---NLESRTPI 223
           DP E+HFN   E+  D L  AF++++++Y+++KI I  +   I S+P +    LE+    
Sbjct: 175 DPFESHFNKPTEQFVDKLHAAFESREIKYKATKIVIDDSHSVISSKPTIFGEELETNRLS 234

Query: 224 QVPQGTQSLSPYFIKQRLKIQNDLLDSK-NNLTPLQKKIVDPIFQYQDLLYEYENYDQ-E 281
               G QS+  YFIKQRLKIQN+LL+ K + LTPLQK+++DP+FQY+D+LYEY++Y + E
Sbjct: 235 SSKHG-QSIFSYFIKQRLKIQNNLLNPKVDPLTPLQKELLDPMFQYKDILYEYDSYGKDE 293

Query: 282 TEYRDLYALHALDHIYKTRDRILKNNQRLQDNPDQEVLDQGFTRPKVLIVVPTRDVAYSV 341
            EYRDLYALHAL+H+YKTRDRILKNNQRLQDN D E LDQGFTRPKVLIVVPTRD AY V
Sbjct: 294 DEYRDLYALHALNHVYKTRDRILKNNQRLQDNTDTEYLDQGFTRPKVLIVVPTRDTAYEV 353

Query: 342 LSKIIEKSGLDQVDKKSKFRDQFYQDSLPPKYKPKSFQQVFKGNTNDFFVLGAKFTRKTI 401
             KII+KSGLDQVDKK KF DQF  DSLPP  KPKSFQQ+FKGNTNDFFVLG KFTRK I
Sbjct: 354 TDKIIKKSGLDQVDKKGKFYDQFKDDSLPPSSKPKSFQQIFKGNTNDFFVLGLKFTRKAI 413

Query: 402 KLYSNFYQSDIIVCSPLGIQLILENTDKKKRQDDFLSSIELLVIDQLHSIEFQNVLHLTS 461
           KLYSNFYQSDIIVCSPLG+Q+I+ENTDKKKRQDDFLSSIELL++DQLHS+E+QN+ H+ +
Sbjct: 414 KLYSNFYQSDIIVCSPLGMQMIVENTDKKKRQDDFLSSIELLIVDQLHSLEYQNLAHIFT 473

Query: 462 IFEHINKIPQQQHDADFSRIKMWYINDQAKLFRQTLIFTRHSTPFANSLINGKCRNYAGR 521
           IF+H+NKIP +QHDADFSRI+MWYINDQAKLFRQT++FT++ +P AN++IN +CRN+ GR
Sbjct: 474 IFDHLNKIPTEQHDADFSRIRMWYINDQAKLFRQTMVFTKYVSPAANAIINNRCRNWEGR 533

Query: 522 WKNHTIVGAEKSSLSQLGMRTRLVFQRFDVAGGAATDEPDFRFKHFCSVIVPNIVQSTGY 581
           WKNH IV  E SS+ +LG++ + +FQRFD+ GG+  DEPD+RFKHF SVI+P+IV+ST Y
Sbjct: 534 WKNHKIVAPEVSSIGKLGLKIKQIFQRFDIMGGSIVDEPDYRFKHFTSVIIPSIVKSTSY 593

Query: 582 EDGILLYIPDYTDFIRVRNYLREKTTILFGDISEYSEQRQLTANRALFQQGRVKVLLYTE 641
           +DGIL+YIPDYTD++R+RNYL+EKT ILFGDI+EYSEQR+L +NR+L QQGRVKVLLYTE
Sbjct: 594 DDGILIYIPDYTDYVRIRNYLKEKTRILFGDINEYSEQRELNSNRSLLQQGRVKVLLYTE 653

Query: 642 RLHHFRRYEIKGVKTVIFYKPPTNPEFFEETVRYLAKSAFLGVADLNISVVRCLYSKLDG 701
           RLHH+RRYEIKGVK+V+FYKPPTNPEF+ E VR++ K+AFLG  DLNIS VR +Y KLDG
Sbjct: 654 RLHHYRRYEIKGVKSVVFYKPPTNPEFYNEVVRFIGKNAFLGNTDLNISTVRTVYCKLDG 713

Query: 702 LALERIVGTERAAILTHGPNETYEFK 727
           L+LERIVGT+RA IL H  NE YEFK
Sbjct: 714 LSLERIVGTKRAGILCHAQNEVYEFK 739

>TDEL0G02220 Chr7 complement(434650..436782) [2133 bp, 710 aa] {ON}
           Anc_2.292 YIL091C
          Length = 710

 Score =  836 bits (2159), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 384/562 (68%), Positives = 467/562 (83%), Gaps = 3/562 (0%)

Query: 167 DPLEAHFNSVPEKDTDALDQAFKTKQVRYRSSKIKISKNEEFIYSRPDLNLESRTPIQVP 226
           D  ++HFN VPE   D LD AFK +Q++Y+S+K+ I +NE  +YS+P L  +    +++P
Sbjct: 151 DTFDSHFNQVPENVVDKLDAAFKERQLKYKSAKVPIGENESMVYSKPLLLEDQSKKLEIP 210

Query: 227 QGTQSLSPYFIKQRLKIQNDLLDSKNNLTPLQKKIVDPIFQYQDLLYEYENYDQ-ETEYR 285
              +SL  Y  KQRLKIQNDL     NLT  Q+ +VDP+ QY DLLYEY +Y++ E EYR
Sbjct: 211 SRHESLKSYVFKQRLKIQNDL--EHENLTSTQRTLVDPMLQYNDLLYEYNSYEKDEDEYR 268

Query: 286 DLYALHALDHIYKTRDRILKNNQRLQDNPDQEVLDQGFTRPKVLIVVPTRDVAYSVLSKI 345
           DLYALH L+H+YKTRD+ILKNNQR+ DNPD + LDQGFTRPKVLIVVPTRD AY VL KI
Sbjct: 269 DLYALHVLNHVYKTRDKILKNNQRISDNPDADYLDQGFTRPKVLIVVPTRDTAYQVLEKI 328

Query: 346 IEKSGLDQVDKKSKFRDQFYQDSLPPKYKPKSFQQVFKGNTNDFFVLGAKFTRKTIKLYS 405
           I+KSG+DQ+DKK KFRDQF+++SLPP  KPKSFQ VFKGNTNDFFVLG KFTRK IKLYS
Sbjct: 329 IDKSGIDQIDKKGKFRDQFFEESLPPSSKPKSFQHVFKGNTNDFFVLGVKFTRKAIKLYS 388

Query: 406 NFYQSDIIVCSPLGIQLILENTDKKKRQDDFLSSIELLVIDQLHSIEFQNVLHLTSIFEH 465
           NFYQSDII+CSPLGIQLILENTDKKKRQDDFLSSIE+ + DQLHSIE+QNV H+ +IF+H
Sbjct: 389 NFYQSDIIICSPLGIQLILENTDKKKRQDDFLSSIEISIFDQLHSIEYQNVSHVMTIFDH 448

Query: 466 INKIPQQQHDADFSRIKMWYINDQAKLFRQTLIFTRHSTPFANSLINGKCRNYAGRWKNH 525
           +N IPQ+QHD DF R+++WYIN+QAKLFRQT+IFT++ +P AN+LIN KC+N  GRWKNH
Sbjct: 449 LNLIPQEQHDTDFGRVRLWYINEQAKLFRQTMIFTKYVSPTANALINNKCQNMTGRWKNH 508

Query: 526 TIVGAEKSSLSQLGMRTRLVFQRFDVAGGAATDEPDFRFKHFCSVIVPNIVQSTGYEDGI 585
             +   +SS+ +LG++ R +FQR D+   +  +E DFRFK F SVI+P+I++STGYEDGI
Sbjct: 509 HFIEPNQSSIGKLGLKVRQIFQRIDLGAASILEESDFRFKFFTSVIIPSIIKSTGYEDGI 568

Query: 586 LLYIPDYTDFIRVRNYLREKTTILFGDISEYSEQRQLTANRALFQQGRVKVLLYTERLHH 645
           L+YIPDY DFIRVRNY++EKTTI+FGDI+EYS Q+QL +NRALFQQGR KVLLYTERLHH
Sbjct: 569 LVYIPDYADFIRVRNYMKEKTTIIFGDINEYSNQKQLNSNRALFQQGRAKVLLYTERLHH 628

Query: 646 FRRYEIKGVKTVIFYKPPTNPEFFEETVRYLAKSAFLGVADLNISVVRCLYSKLDGLALE 705
           FRRYEIKGVK+V+FY+PPTNPEF+ E VR++AKSA LG  DLNIS VR +YSKLDG++LE
Sbjct: 629 FRRYEIKGVKSVVFYQPPTNPEFYSEVVRFIAKSAALGTTDLNISTVRTIYSKLDGISLE 688

Query: 706 RIVGTERAAILTHGPNETYEFK 727
           RIVGT+RAAILTHG NE YEFK
Sbjct: 689 RIVGTKRAAILTHGQNEVYEFK 710

>ZYRO0A02002g Chr1 complement(164386..166515) [2130 bp, 709 aa] {ON}
           similar to uniprot|P40498 Saccharomyces cerevisiae
           YIL091C Protein required for cell viability
          Length = 709

 Score =  833 bits (2151), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 395/563 (70%), Positives = 473/563 (84%), Gaps = 7/563 (1%)

Query: 168 PLEAHFNSVPEKDTDALDQAFKTKQVRYRSSKIKISKNEEFIYSRPDLNLESRT-PIQVP 226
           P E+HFN   E   D+LD+A+K K++  +S KI++  +E  IY++    L  +    ++P
Sbjct: 151 PFESHFNMQSES-IDSLDEAWKQKKIVNKSGKIRVDDDESLIYTK---TLAGKGQEFELP 206

Query: 227 QGTQSLSPYFIKQRLKIQNDLLDSKNN-LTPLQKKIVDPIFQYQDLLYEYENYDQ-ETEY 284
                LS Y +K++LKIQN+LL+S+++ LTPLQ+KIVDPIFQY+DLLYEYE+Y+Q E EY
Sbjct: 207 SHKGHLSSYPLKRKLKIQNNLLESQDDVLTPLQRKIVDPIFQYRDLLYEYEDYEQDEDEY 266

Query: 285 RDLYALHALDHIYKTRDRILKNNQRLQDNPDQEVLDQGFTRPKVLIVVPTRDVAYSVLSK 344
           RDLY LH L+HIYKTRDRILK+NQRL  NPD E LDQGFTRPKVLIV PTRD AY ++SK
Sbjct: 267 RDLYVLHVLNHIYKTRDRILKDNQRLATNPDGEFLDQGFTRPKVLIVAPTRDTAYQIVSK 326

Query: 345 IIEKSGLDQVDKKSKFRDQFYQDSLPPKYKPKSFQQVFKGNTNDFFVLGAKFTRKTIKLY 404
           +IEKSGLDQVDKKSK RDQF++D LPP  KPKSF+  FKGNTNDFFVLG KFTRK I+LY
Sbjct: 327 VIEKSGLDQVDKKSKLRDQFFEDVLPPSSKPKSFRHTFKGNTNDFFVLGVKFTRKAIRLY 386

Query: 405 SNFYQSDIIVCSPLGIQLILENTDKKKRQDDFLSSIELLVIDQLHSIEFQNVLHLTSIFE 464
           SNFYQSD+IVCSPLG+QLILENTD+KKRQDDFLSSIEL++IDQL+SIEFQNV HL +IF 
Sbjct: 387 SNFYQSDLIVCSPLGLQLILENTDRKKRQDDFLSSIELMIIDQLNSIEFQNVSHLFTIFA 446

Query: 465 HINKIPQQQHDADFSRIKMWYINDQAKLFRQTLIFTRHSTPFANSLINGKCRNYAGRWKN 524
           H+NKIP++QHD DF R++MWYIN+QAKL RQTLIFTR+ TP AN L+NGKCRN  GRWKN
Sbjct: 447 HMNKIPKEQHDTDFGRVRMWYINEQAKLLRQTLIFTRYVTPTANFLLNGKCRNIGGRWKN 506

Query: 525 HTIVGAEKSSLSQLGMRTRLVFQRFDVAGGAATDEPDFRFKHFCSVIVPNIVQSTGYEDG 584
           H  +  E+SS+S+LG R R +FQR D+ G +  DEPD+RF+ F SVIVP+I +STGYEDG
Sbjct: 507 HHQITGEQSSVSKLGFRVRQIFQRVDLGGASVVDEPDYRFRFFTSVIVPSITKSTGYEDG 566

Query: 585 ILLYIPDYTDFIRVRNYLREKTTILFGDISEYSEQRQLTANRALFQQGRVKVLLYTERLH 644
           ILLYIPDY DFIRVRNYL++KTTILFGDI+EYS+ RQLT+ R+LFQQGR+KVLLYTERLH
Sbjct: 567 ILLYIPDYADFIRVRNYLKDKTTILFGDINEYSDVRQLTSTRSLFQQGRIKVLLYTERLH 626

Query: 645 HFRRYEIKGVKTVIFYKPPTNPEFFEETVRYLAKSAFLGVADLNISVVRCLYSKLDGLAL 704
           HFRRYEIKGVK+VIFY+PP+NPEF+ E VRY+ KSAFLG  DLNIS VRC+YSKLDGLAL
Sbjct: 627 HFRRYEIKGVKSVIFYQPPSNPEFYNEVVRYIGKSAFLGDTDLNISTVRCVYSKLDGLAL 686

Query: 705 ERIVGTERAAILTHGPNETYEFK 727
           ERIV ++RAA+LTHG NE YEFK
Sbjct: 687 ERIVSSKRAAVLTHGQNEIYEFK 709

 Score = 36.2 bits (82), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 30/86 (34%), Positives = 40/86 (46%), Gaps = 5/86 (5%)

Query: 5  KRRYTDHDRHDGEKFTKGGRKQLRSIRKASRYDSK--KXXXXXXXXXXXXXXXXXXXXXX 62
          KR     D  DG +  K GRK LRSIR+A R D +  +                      
Sbjct: 3  KRTGNGTDAIDGSR--KRGRKDLRSIRRA-RNDKEPVEEPEIPVASEEDGELSEDSEEDA 59

Query: 63 RTEVSRKQESNGEAYAALLTLLKAEH 88
            EV  +++S  +AY ALLT+LK+EH
Sbjct: 60 TNEVQEQEDSKEKAYGALLTILKSEH 85

>ADL209C Chr4 complement(334817..336931) [2115 bp, 704 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL091C
          Length = 704

 Score =  830 bits (2145), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 389/564 (68%), Positives = 472/564 (83%), Gaps = 6/564 (1%)

Query: 167 DPLEAHFNSVPEKDTDALDQAFKTKQVRYRSSKIKISKNEEFIYSRPDLNLE-SRTPIQV 225
           D  + HFN V   D   LD AFK  + +YR  K +    EE +YS+P  + E +  P++V
Sbjct: 144 DHFDVHFNRVSAADVAQLDAAFKNGRAQYRVQK-EARGEEEILYSKPVASSEGTEGPVRV 202

Query: 226 PQGTQSLSPYFIKQRLKIQNDLL--DSKNNLTPLQKKIVDPIFQYQDLLYEYENYDQETE 283
           P   +SL  Y IKQRL++ N L   D +  LTP QK ++DP+FQYQD+LYEYE YD+E E
Sbjct: 203 P--ARSLRGYAIKQRLRMHNGLTADDPEKPLTPQQKVLLDPMFQYQDILYEYEGYDRERE 260

Query: 284 YRDLYALHALDHIYKTRDRILKNNQRLQDNPDQEVLDQGFTRPKVLIVVPTRDVAYSVLS 343
           YR+LY LH L+H+YKTRDRILKNNQ+LQDNPDQE+LDQGFTRPK L+VVPTR  AY V+ 
Sbjct: 261 YRELYTLHILNHVYKTRDRILKNNQKLQDNPDQELLDQGFTRPKALVVVPTRATAYDVVD 320

Query: 344 KIIEKSGLDQVDKKSKFRDQFYQDSLPPKYKPKSFQQVFKGNTNDFFVLGAKFTRKTIKL 403
            ++++SG++QVDKKSKF+DQFY  SLPP  KPKSFQ VFKGNTNDFFVLG KFTRK I+L
Sbjct: 321 LLLQQSGIEQVDKKSKFKDQFYDPSLPPASKPKSFQHVFKGNTNDFFVLGMKFTRKAIRL 380

Query: 404 YSNFYQSDIIVCSPLGIQLILENTDKKKRQDDFLSSIELLVIDQLHSIEFQNVLHLTSIF 463
           YSNFYQSD+IVCSPLG+QLI+ENTDKKKRQDDFLSSIE++V+DQLHSIEFQN+ H+++IF
Sbjct: 381 YSNFYQSDVIVCSPLGLQLIIENTDKKKRQDDFLSSIEVMVLDQLHSIEFQNIAHVSNIF 440

Query: 464 EHINKIPQQQHDADFSRIKMWYINDQAKLFRQTLIFTRHSTPFANSLINGKCRNYAGRWK 523
            HINKIPQQQ DADFSRI+MWYI DQAKLFRQT++FTR+ +PFAN+L+N KC N+AGR K
Sbjct: 441 AHINKIPQQQRDADFSRIRMWYIEDQAKLFRQTMVFTRYISPFANALLNRKCANWAGRVK 500

Query: 524 NHTIVGAEKSSLSQLGMRTRLVFQRFDVAGGAATDEPDFRFKHFCSVIVPNIVQSTGYED 583
           +H +V AEKS + QLG++ R +FQRF+V GG+  DEPDFRFK F SV+VP I ++TGY+ 
Sbjct: 501 SHRVVSAEKSVIGQLGLKLRQIFQRFEVLGGSTVDEPDFRFKFFTSVVVPGIEKTTGYDS 560

Query: 584 GILLYIPDYTDFIRVRNYLREKTTILFGDISEYSEQRQLTANRALFQQGRVKVLLYTERL 643
           GILLYIP+YTDFIRVRNYL++KT ILFGDI+EYS+QRQLT+NRALFQ GR+KVLLYTERL
Sbjct: 561 GILLYIPEYTDFIRVRNYLKDKTRILFGDINEYSDQRQLTSNRALFQLGRIKVLLYTERL 620

Query: 644 HHFRRYEIKGVKTVIFYKPPTNPEFFEETVRYLAKSAFLGVADLNISVVRCLYSKLDGLA 703
           HHFRR+E+KGVK+VI YKPP+NPEF++E +RY+ KSAFLGVADLNI+ VRCLYSK+D LA
Sbjct: 621 HHFRRFELKGVKSVILYKPPSNPEFYQELLRYIGKSAFLGVADLNIATVRCLYSKMDSLA 680

Query: 704 LERIVGTERAAILTHGPNETYEFK 727
           LERIVGT+RAA+LTHG NE YEFK
Sbjct: 681 LERIVGTKRAAVLTHGQNEVYEFK 704

>Kpol_1039.46 s1039 complement(138925..141039) [2115 bp, 704 aa]
           {ON} complement(138925..141039) [2115 nt, 705 aa]
          Length = 704

 Score =  826 bits (2134), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/563 (67%), Positives = 471/563 (83%), Gaps = 2/563 (0%)

Query: 167 DPLEAHFNSVPEKDTDALDQAFKTKQVRYRSSKIKISKNEEFIYSRPDLNLESRTPIQVP 226
           D  E+HFN V +   D +   FK KQ++Y+S K  + K E  I+ +P L  +    I  P
Sbjct: 142 DTFESHFNDVSQDLVDDISAGFKDKQIKYKSMKYSLDKKESAIFGKPLLLTQQDETIDNP 201

Query: 227 QGTQSLSPYFIKQRLKIQNDLLDS-KNNLTPLQKKIVDPIFQYQDLLYEYENYDQ-ETEY 284
             T S   YFIKQRLKIQNDLLDS K NLTPL+KK++DP+FQY+D+L EY NY+  E EY
Sbjct: 202 VLTSSYDSYFIKQRLKIQNDLLDSSKENLTPLKKKLLDPMFQYKDVLCEYTNYENDEKEY 261

Query: 285 RDLYALHALDHIYKTRDRILKNNQRLQDNPDQEVLDQGFTRPKVLIVVPTRDVAYSVLSK 344
           R+LY+LH L+HIYKTRD+ILK+NQRLQ+N D E LDQGFTRPKVLIVVPTRD AY V+  
Sbjct: 262 RELYSLHVLNHIYKTRDKILKDNQRLQENDDLECLDQGFTRPKVLIVVPTRDTAYQVVET 321

Query: 345 IIEKSGLDQVDKKSKFRDQFYQDSLPPKYKPKSFQQVFKGNTNDFFVLGAKFTRKTIKLY 404
           IIEKSGLDQ+DKK KF+DQF+ DSLPP  KPKSF+ VFKGNTNDFFVLG KFTRK IKLY
Sbjct: 322 IIEKSGLDQIDKKGKFKDQFFDDSLPPTSKPKSFRHVFKGNTNDFFVLGMKFTRKAIKLY 381

Query: 405 SNFYQSDIIVCSPLGIQLILENTDKKKRQDDFLSSIELLVIDQLHSIEFQNVLHLTSIFE 464
           SNFYQSDII+CSPLGIQ+ILENTDKKKRQDDFLSSIE++++DQLHSIE+QN+ H+ +I E
Sbjct: 382 SNFYQSDIIICSPLGIQMILENTDKKKRQDDFLSSIEVMIVDQLHSIEYQNISHVYTILE 441

Query: 465 HINKIPQQQHDADFSRIKMWYINDQAKLFRQTLIFTRHSTPFANSLINGKCRNYAGRWKN 524
           HINKIPQQQ +ADFSRI+MWYINDQAK  RQT++FTR+ +P AN++INGKC N AGRWKN
Sbjct: 442 HINKIPQQQREADFSRIRMWYINDQAKFLRQTMLFTRYISPTANAIINGKCHNMAGRWKN 501

Query: 525 HTIVGAEKSSLSQLGMRTRLVFQRFDVAGGAATDEPDFRFKHFCSVIVPNIVQSTGYEDG 584
           + I+ +E SS+ QLG++ + +FQRFD+ GG   DE D+RFK+F SV++ NIV+STGYEDG
Sbjct: 502 NQIISSEDSSIGQLGIKIKQIFQRFDLVGGTVVDESDYRFKYFTSVVMQNIVKSTGYEDG 561

Query: 585 ILLYIPDYTDFIRVRNYLREKTTILFGDISEYSEQRQLTANRALFQQGRVKVLLYTERLH 644
           IL+YIP+YTD++R+RNY++EKTTILF +I+EYS Q+QL +NR++FQQGR KVLLYTERLH
Sbjct: 562 ILVYIPEYTDYMRLRNYMKEKTTILFSEINEYSTQKQLDSNRSMFQQGRTKVLLYTERLH 621

Query: 645 HFRRYEIKGVKTVIFYKPPTNPEFFEETVRYLAKSAFLGVADLNISVVRCLYSKLDGLAL 704
           H+RRYE+KG+K+VIFYKPPTNPEF+ E +R+ AK+AFLG +D+NIS +R +YSKLDGLAL
Sbjct: 622 HYRRYELKGIKSVIFYKPPTNPEFYNEVIRFTAKNAFLGKSDINISTIRTVYSKLDGLAL 681

Query: 705 ERIVGTERAAILTHGPNETYEFK 727
           +RIVG++RAAIL HG NE+Y+FK
Sbjct: 682 QRIVGSKRAAILCHGQNESYDFK 704

>CAGL0D04180g Chr4 complement(411498..413600) [2103 bp, 700 aa] {ON}
           similar to uniprot|P40498 Saccharomyces cerevisiae
           YIL091c
          Length = 700

 Score =  818 bits (2114), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 382/571 (66%), Positives = 471/571 (82%), Gaps = 12/571 (2%)

Query: 167 DPLEAHFNSV-PEKDTDALDQAFKTKQVRYRSSKIKISK------NEEFIYSRPDLNLES 219
           DP + HFN     K  +AL  A K  ++RY+S K+K+         E+ I+S P   +E 
Sbjct: 132 DPFDTHFNGEEAAKHGEALGNALKDNKLRYKSIKLKVGSADEDQVQEDAIFSVP--YIEG 189

Query: 220 RTP-IQVPQGTQSLSPYFIKQRLKIQNDLLDSKNN-LTPLQKKIVDPIFQYQDLLYEYEN 277
            TP I+ P+   SLS YF+K+RL+IQN+LLD+++N LT LQ+KIVDP+ QY+D+LYEY+ 
Sbjct: 190 ETPKIEDPKLKCSLSSYFLKKRLRIQNNLLDTESNALTDLQRKIVDPMMQYKDILYEYDT 249

Query: 278 YDQ-ETEYRDLYALHALDHIYKTRDRILKNNQRLQDNPDQEVLDQGFTRPKVLIVVPTRD 336
           Y + E EYRDLY LH L+H+YKTRD+I+KNNQ+LQDNPD E LDQGFTRPKVLI+ PTRD
Sbjct: 250 YGKDEDEYRDLYTLHVLNHVYKTRDKIIKNNQKLQDNPDSEFLDQGFTRPKVLIIAPTRD 309

Query: 337 VAYSVLSKIIEKSGLDQVDKKSKFRDQFYQDSLPPKYKPKSFQQVFKGNTNDFFVLGAKF 396
            AY +++K+IEKSGLDQVDKK KFRDQFY  S PP  KPKSFQ +FKGNTND+FVLG KF
Sbjct: 310 SAYQIVTKLIEKSGLDQVDKKGKFRDQFYDPSFPPSSKPKSFQHIFKGNTNDYFVLGVKF 369

Query: 397 TRKTIKLYSNFYQSDIIVCSPLGIQLILENTDKKKRQDDFLSSIELLVIDQLHSIEFQNV 456
           TRK IKLYSNFYQSDIIVCSPLG+Q+I+ENTDKKKRQDDFLSS+E+ +IDQ HSIE+QN 
Sbjct: 370 TRKAIKLYSNFYQSDIIVCSPLGLQMIVENTDKKKRQDDFLSSVEVTIIDQFHSIEYQNY 429

Query: 457 LHLTSIFEHINKIPQQQHDADFSRIKMWYINDQAKLFRQTLIFTRHSTPFANSLINGKCR 516
            HL +IF+H+NKIPQ+QHDADFSRI+MWYINDQAK FRQT+IFT++ +P ANSL+N KCR
Sbjct: 430 THLFTIFDHLNKIPQEQHDADFSRIRMWYINDQAKFFRQTMIFTKYISPVANSLLNIKCR 489

Query: 517 NYAGRWKNHTIVGAEKSSLSQLGMRTRLVFQRFDVAGGAATDEPDFRFKHFCSVIVPNIV 576
           N  GRWKNH IV +E SS+  +G++ R +FQRF+V G +  DEPD+RFK F SV++ NI 
Sbjct: 490 NLEGRWKNHKIVSSEDSSVGTVGLKVRQIFQRFNVLGNSVADEPDYRFKFFTSVVISNIT 549

Query: 577 QSTGYEDGILLYIPDYTDFIRVRNYLREKTTILFGDISEYSEQRQLTANRALFQQGRVKV 636
           +STGY+DG L+YIP+Y+D++RVRNY++EKT+ILFGDI+EYSEQR LT+NR LF QGR+KV
Sbjct: 550 KSTGYDDGTLIYIPEYSDYVRVRNYMKEKTSILFGDINEYSEQRSLTSNRTLFNQGRLKV 609

Query: 637 LLYTERLHHFRRYEIKGVKTVIFYKPPTNPEFFEETVRYLAKSAFLGVADLNISVVRCLY 696
           LLYTERLHHFRRYE+KGVK V+FYKPP++PEF++E VRY+ K+ FLG ADLNIS VRC Y
Sbjct: 610 LLYTERLHHFRRYELKGVKNVVFYKPPSDPEFYKEVVRYIGKTVFLGDADLNISTVRCCY 669

Query: 697 SKLDGLALERIVGTERAAILTHGPNETYEFK 727
           SKLDGLALE+IVGT+R  +LTHG NETYEFK
Sbjct: 670 SKLDGLALEKIVGTKRTGVLTHGQNETYEFK 700

 Score = 35.0 bits (79), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 32/75 (42%)

Query: 21 KGGRKQLRSIRKASRYDSKKXXXXXXXXXXXXXXXXXXXXXXRTEVSRKQESNGEAYAAL 80
          K GRK+LRSIR+A R   +                         +   K++   + Y AL
Sbjct: 3  KRGRKELRSIRRAKRTKIEPEADAGVESSGSVLEAGPAVEEKVQDDGEKEDDKEQVYNAL 62

Query: 81 LTLLKAEHGTGKKKV 95
          LT+LK+EH   K K 
Sbjct: 63 LTILKSEHKEDKVKT 77

>TPHA0D01520 Chr4 (310797..312947) [2151 bp, 716 aa] {ON} Anc_2.292
           YIL091C
          Length = 716

 Score =  809 bits (2089), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 367/562 (65%), Positives = 471/562 (83%), Gaps = 3/562 (0%)

Query: 169 LEAHFNSVPEKDTDALDQAFKTKQVRYRSSKIKISKNEE--FIYSRPDLNLESRTPIQVP 226
            + HFN VPE   D +   F  K+++Y S KI++  +E+  FIYS+P ++  ++  ++ P
Sbjct: 155 FDIHFNQVPENVVDKISNGFDNKKIKYVSKKIQLPHHEKDFFIYSKPIVDDGNKHKVESP 214

Query: 227 QGTQSLSPYFIKQRLKIQNDLLDSKNNLTPLQKKIVDPIFQYQDLLYEYENY-DQETEYR 285
               SL  YFIK+RL+I N+LLD K+NLT LQK +VDP+FQY D+L+EYENY   E EYR
Sbjct: 215 IKKSSLDSYFIKKRLEITNNLLDGKDNLTKLQKSLVDPMFQYVDILHEYENYGSDEQEYR 274

Query: 286 DLYALHALDHIYKTRDRILKNNQRLQDNPDQEVLDQGFTRPKVLIVVPTRDVAYSVLSKI 345
           +LY LH L+H+YKTRD++LK+NQRLQ+N + E LDQGFTRPKVLIVVPTRD AY+V+  I
Sbjct: 275 ELYTLHILNHLYKTRDKVLKDNQRLQENNESEFLDQGFTRPKVLIVVPTRDTAYNVVETI 334

Query: 346 IEKSGLDQVDKKSKFRDQFYQDSLPPKYKPKSFQQVFKGNTNDFFVLGAKFTRKTIKLYS 405
           I KSGLDQV+KK KF+ QF++DSLPP  KPKSFQ +FKGNTNDFFVLG KFTRK +KLYS
Sbjct: 335 IRKSGLDQVEKKGKFKSQFFEDSLPPSSKPKSFQSIFKGNTNDFFVLGLKFTRKALKLYS 394

Query: 406 NFYQSDIIVCSPLGIQLILENTDKKKRQDDFLSSIELLVIDQLHSIEFQNVLHLTSIFEH 465
           NFYQSD+I+CSPLG+ +I ENTDKKK+QDDFLSSIE+ ++DQLHS+E+QN+ H+ +IFEH
Sbjct: 395 NFYQSDVIICSPLGLHMITENTDKKKKQDDFLSSIEITILDQLHSMEYQNISHIMNIFEH 454

Query: 466 INKIPQQQHDADFSRIKMWYINDQAKLFRQTLIFTRHSTPFANSLINGKCRNYAGRWKNH 525
           +NKIP++QHDADFSRI+MWYINDQA+LFRQT+IFT++ +P AN++INGKCRN AGRW+N 
Sbjct: 455 LNKIPREQHDADFSRIRMWYINDQARLFRQTMIFTKYVSPTANAMINGKCRNIAGRWRNK 514

Query: 526 TIVGAEKSSLSQLGMRTRLVFQRFDVAGGAATDEPDFRFKHFCSVIVPNIVQSTGYEDGI 585
             + +E+SSL +LG++ R +FQRFD+ GG   DEPDFRFK F SV++ +I++STGYEDGI
Sbjct: 515 IQLTSEESSLGKLGLKIRQIFQRFDLVGGTLADEPDFRFKFFVSVVMNSILKSTGYEDGI 574

Query: 586 LLYIPDYTDFIRVRNYLREKTTILFGDISEYSEQRQLTANRALFQQGRVKVLLYTERLHH 645
           L+YIP+Y+D++RVRNY++EKTT+LFGDI+EYS+QR+L +NR+LFQQGRVKVLLYTERLHH
Sbjct: 575 LVYIPNYSDYMRVRNYMKEKTTLLFGDINEYSDQRELNSNRSLFQQGRVKVLLYTERLHH 634

Query: 646 FRRYEIKGVKTVIFYKPPTNPEFFEETVRYLAKSAFLGVADLNISVVRCLYSKLDGLALE 705
           +RRYEIKGVK+VIFY PPTNPEF+ E VR++ K+AFLG  D+NI+ VR +YSKLD L+LE
Sbjct: 635 YRRYEIKGVKSVIFYGPPTNPEFYNEVVRFIGKNAFLGNVDINIATVRMVYSKLDSLSLE 694

Query: 706 RIVGTERAAILTHGPNETYEFK 727
           RIVGT+RAA+L+   NE YEFK
Sbjct: 695 RIVGTQRAAVLSRAENEVYEFK 716

>Skud_4.505 Chr4 complement(903103..904917) [1815 bp, 604 aa] {ON}
           YDR243C (REAL)
          Length = 604

 Score = 35.0 bits (79), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 41/155 (26%), Positives = 68/155 (43%), Gaps = 40/155 (25%)

Query: 494 RQTLIFTRHSTPFANSLINGKCRNYAGRWKNHTIVGAEKSSLSQLGMRTRLVFQRFDVAG 553
           RQTL+FT   TP    +  G  R        +  +G +  S         L+ Q  + A 
Sbjct: 388 RQTLMFTATMTPVIEKIAAGYMRKPV-----YATIGVDTGS-------EPLIQQIVEYA- 434

Query: 554 GAATDEPDFRFKHFCSVIVPNIVQSTGYEDGILLYIPDYTDFIRVRNYLRE--------K 605
               D  + +FK   S++       T YE  I+++I    ++ +  ++L E        +
Sbjct: 435 ----DNEEQKFKKLKSIV-------TKYEPPIIIFI----NYKQTADWLAERFQKETNMR 479

Query: 606 TTILFGDISEYSEQRQLTANRALFQQGRVKVLLYT 640
            TIL G  S+  EQR+ +    LF+ GRV+V++ T
Sbjct: 480 VTILHG--SKSQEQREHSLQ--LFRSGRVQVMIAT 510

>Smik_4.490 Chr4 complement(893394..895157) [1764 bp, 587 aa] {ON}
           YDR243C (REAL)
          Length = 587

 Score = 33.9 bits (76), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 41/159 (25%), Positives = 69/159 (43%), Gaps = 32/159 (20%)

Query: 486 INDQAKLFRQTLIFTRHSTPFANSLINGKCRNYAGRWKNHTIVGAEKSSLSQLGMRTRLV 545
           +N  +   RQTL+FT   TP    +  G  R        +  +G +  S         L+
Sbjct: 363 VNVDSATNRQTLMFTATMTPVIEKIAAGYMRKPV-----YATIGLDTGS-------EPLI 410

Query: 546 FQRFDVAGGAATDEPDFRFKHFCSVIVPNIVQSTGYEDGILLYI--PDYTDFI--RVRNY 601
            Q  + A     D  + +FK   SV++        YE  I+++I      D++  R +  
Sbjct: 411 RQVVEYA-----DNEEEKFKKLKSVVIK-------YESPIIIFINYKQTADWLAERFQTE 458

Query: 602 LREKTTILFGDISEYSEQRQLTANRALFQQGRVKVLLYT 640
              K TIL G  S+  EQR+ +    LF+ G+V++++ T
Sbjct: 459 TNMKVTILHG--SKSQEQREHSLQ--LFRTGKVQIMIAT 493

>Kwal_26.7163 s26 (243008..244876) [1869 bp, 622 aa] {ON} YAL016W
           (TPD3) - protein phosphatase 2A regulatory subunit A
           [contig 47] FULL
          Length = 622

 Score = 33.9 bits (76), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 30/105 (28%), Positives = 47/105 (44%), Gaps = 9/105 (8%)

Query: 395 KFTRKTIKLYSNFYQSDIIVCS-------PLGIQLILENTDKKKRQD-DFLSSI-ELLVI 445
           KF ++ + LY    Q D  +         P+ I L+ +N D     D D++S + + +V 
Sbjct: 177 KFRKELLALYLQLVQDDTPMVRRAAGKNLPVLIDLLTQNPDLSTSDDWDYISGMFQKIVS 236

Query: 446 DQLHSIEFQNVLHLTSIFEHINKIPQQQHDADFSRIKMWYINDQA 490
           D   S++F  V  L SI +  NK     H  D  R  +  I D+A
Sbjct: 237 DTQDSVKFLAVDVLVSILKFFNKKNDTTHSKDLLRSAIQLITDEA 281

>NDAI0H02460 Chr8 complement(594568..596433) [1866 bp, 621 aa] {ON}
           Anc_7.88 YAL016W
          Length = 621

 Score = 31.6 bits (70), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 39/76 (51%), Gaps = 2/76 (2%)

Query: 417 PLGIQLILENTDKKKRQD-DFLSSI-ELLVIDQLHSIEFQNVLHLTSIFEHINKIPQQQH 474
           P  + L++EN D    QD +F+S+I + ++ D   S++F  V  L SI +  N    Q H
Sbjct: 202 PTLVDLLVENADLSTNQDWEFISNIFQNIINDNQDSVKFLGVDCLISIAKFFNAKNDQTH 261

Query: 475 DADFSRIKMWYINDQA 490
             +     +  IND+A
Sbjct: 262 SQELLNSAIKLINDEA 277

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.136    0.390 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 70,723,880
Number of extensions: 3135206
Number of successful extensions: 9573
Number of sequences better than 10.0: 45
Number of HSP's gapped: 9893
Number of HSP's successfully gapped: 54
Length of query: 727
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 610
Effective length of database: 40,065,477
Effective search space: 24439940970
Effective search space used: 24439940970
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 69 (31.2 bits)