Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_27.115002.293ON47547522310.0
KLTH0G10516g2.293ON47447420420.0
SAKL0E07524g2.293ON47948215880.0
Suva_9.1092.293ON49148813650.0
Skud_9.832.293ON49148813560.0
Smik_9.892.293ON49148813490.0
TDEL0G022302.293ON48848513440.0
YIL090W (ICE2)2.293ON49148813430.0
KNAG0A053902.293ON49748312941e-175
CAGL0D04202g2.293ON49949412901e-175
ZYRO0A02024g2.293ON48648612881e-174
NCAS0B062202.293ON48649212751e-172
ADL208W2.293ON50250612771e-172
NDAI0B035202.293ON50149712641e-171
KAFR0J013302.293ON49149312401e-167
Ecym_33322.293ON51351512121e-162
KLLA0E08207g2.293ON48647911891e-159
Kpol_1003.422.293ON49048511751e-157
TPHA0C034402.293ON57953710531e-137
TBLA0B069902.293ON5365339601e-124
TBLA0B059802.293ON4934969551e-124
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_27.11500
         (475 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_27.11500 s27 complement(825779..827206) [1428 bp, 475 aa] {...   863   0.0  
KLTH0G10516g Chr7 (889468..890892) [1425 bp, 474 aa] {ON} simila...   791   0.0  
SAKL0E07524g Chr5 complement(609285..610724) [1440 bp, 479 aa] {...   616   0.0  
Suva_9.109 Chr9 (187818..189293) [1476 bp, 491 aa] {ON} YIL090W ...   530   0.0  
Skud_9.83 Chr9 (170322..171797) [1476 bp, 491 aa] {ON} YIL090W (...   526   0.0  
Smik_9.89 Chr9 (172734..174209) [1476 bp, 491 aa] {ON} YIL090W (...   524   0.0  
TDEL0G02230 Chr7 (437121..438587) [1467 bp, 488 aa] {ON} Anc_2.2...   522   0.0  
YIL090W Chr9 (193595..195070) [1476 bp, 491 aa] {ON}  ICE2Integr...   521   0.0  
KNAG0A05390 Chr1 complement(793701..795194) [1494 bp, 497 aa] {O...   503   e-175
CAGL0D04202g Chr4 (414049..415548) [1500 bp, 499 aa] {ON} simila...   501   e-175
ZYRO0A02024g Chr1 (167059..168519) [1461 bp, 486 aa] {ON} simila...   500   e-174
NCAS0B06220 Chr2 complement(1173970..1175430) [1461 bp, 486 aa] ...   495   e-172
ADL208W Chr4 (337118..338626) [1509 bp, 502 aa] {ON} Syntenic ho...   496   e-172
NDAI0B03520 Chr2 complement(885459..886964) [1506 bp, 501 aa] {O...   491   e-171
KAFR0J01330 Chr10 complement(243571..245046) [1476 bp, 491 aa] {...   482   e-167
Ecym_3332 Chr3 (634314..635855) [1542 bp, 513 aa] {ON} similar t...   471   e-162
KLLA0E08207g Chr5 complement(740213..741673) [1461 bp, 486 aa] {...   462   e-159
Kpol_1003.42 s1003 (100704..102176) [1473 bp, 490 aa] {ON} (1007...   457   e-157
TPHA0C03440 Chr3 (752685..754424) [1740 bp, 579 aa] {ON} Anc_2.2...   410   e-137
TBLA0B06990 Chr2 (1649581..1651191) [1611 bp, 536 aa] {ON}            374   e-124
TBLA0B05980 Chr2 (1412745..1414226) [1482 bp, 493 aa] {ON} Anc_2...   372   e-124

>Kwal_27.11500 s27 complement(825779..827206) [1428 bp, 475 aa] {ON}
           YIL090W - Hypothetical ORF [contig 27] FULL
          Length = 475

 Score =  863 bits (2231), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 440/475 (92%), Positives = 440/475 (92%)

Query: 1   MIPRSILQSIRVCLTSFYLLLILITIPIAFQVGGLYCGLSFTVTLFNLYLITTTLKIAAR 60
           MIPRSILQSIRVCLTSFYLLLILITIPIAFQVGGLYCGLSFTVTLFNLYLITTTLKIAAR
Sbjct: 1   MIPRSILQSIRVCLTSFYLLLILITIPIAFQVGGLYCGLSFTVTLFNLYLITTTLKIAAR 60

Query: 61  ARGFAKLASAAYYAQHXXXXXXXXXXXXXXXNDELKHQIDTNTRPDESLIDLLRSSTHSQ 120
           ARGFAKLASAAYYAQH               NDELKHQIDTNTRPDESLIDLLRSSTHSQ
Sbjct: 61  ARGFAKLASAAYYAQHFFIPSLLFLFLSGFSNDELKHQIDTNTRPDESLIDLLRSSTHSQ 120

Query: 121 PWIFXXXXXXXVVRPWQFLLLRSTPYFTLLEGFFTVLGIQAVGETNRWLSRGHGSNVWVI 180
           PWIF       VVRPWQFLLLRSTPYFTLLEGFFTVLGIQAVGETNRWLSRGHGSNVWVI
Sbjct: 121 PWIFYYYYYHYVVRPWQFLLLRSTPYFTLLEGFFTVLGIQAVGETNRWLSRGHGSNVWVI 180

Query: 181 SGLMTSGGVITAALYYLYRIYVTPIWELSVQTASLLGFTFSIVSGLGIFGIVSGRGSTIE 240
           SGLMTSGGVITAALYYLYRIYVTPIWELSVQTASLLGFTFSIVSGLGIFGIVSGRGSTIE
Sbjct: 181 SGLMTSGGVITAALYYLYRIYVTPIWELSVQTASLLGFTFSIVSGLGIFGIVSGRGSTIE 240

Query: 241 SSLFFAYIVRCLYEISPQLATSAMDEISNLVKDTWHNQHRSLRSSDTFLAYYRDIILKNG 300
           SSLFFAYIVRCLYEISPQLATSAMDEISNLVKDTWHNQHRSLRSSDTFLAYYRDIILKNG
Sbjct: 241 SSLFFAYIVRCLYEISPQLATSAMDEISNLVKDTWHNQHRSLRSSDTFLAYYRDIILKNG 300

Query: 301 EMIWDAVLARTNVNVSGAGPVAWISWHRVQPLWKFVKHFTSSVPSSIQEIFLLTLSMARE 360
           EMIWDAVLARTNVNVSGAGPVAWISWHRVQPLWKFVKHFTSSVPSSIQEIFLLTLSMARE
Sbjct: 301 EMIWDAVLARTNVNVSGAGPVAWISWHRVQPLWKFVKHFTSSVPSSIQEIFLLTLSMARE 360

Query: 361 AIAPAVVINLCFRILIFYSATRIIPALQXXXXXXXXXXXXXLYWYSPCIVIAMYTHLIMQ 420
           AIAPAVVINLCFRILIFYSATRIIPALQ             LYWYSPCIVIAMYTHLIMQ
Sbjct: 361 AIAPAVVINLCFRILIFYSATRIIPALQRKHKRRSRRFMRMLYWYSPCIVIAMYTHLIMQ 420

Query: 421 YSGQISNDLCLWGCFPWSPPEGSKVVVDSWGFWNWCNIFCTMAIYASELFGSKSG 475
           YSGQISNDLCLWGCFPWSPPEGSKVVVDSWGFWNWCNIFCTMAIYASELFGSKSG
Sbjct: 421 YSGQISNDLCLWGCFPWSPPEGSKVVVDSWGFWNWCNIFCTMAIYASELFGSKSG 475

>KLTH0G10516g Chr7 (889468..890892) [1425 bp, 474 aa] {ON} similar
           to uniprot|P40499 Saccharomyces cerevisiae YIL090W ICE2
           Integral ER membrane protein with type-III transmembrane
           domains mutations cause defects in cortical ER
           morphology in both the mother and daughter cells
          Length = 474

 Score =  791 bits (2042), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 400/474 (84%), Positives = 416/474 (87%)

Query: 1   MIPRSILQSIRVCLTSFYLLLILITIPIAFQVGGLYCGLSFTVTLFNLYLITTTLKIAAR 60
           M PRS++QS RVCLTSFYLLLILITIPI+FQVGGLYCGLSFTVTLFNLYLITTTLKIAAR
Sbjct: 1   MFPRSVIQSARVCLTSFYLLLILITIPISFQVGGLYCGLSFTVTLFNLYLITTTLKIAAR 60

Query: 61  ARGFAKLASAAYYAQHXXXXXXXXXXXXXXXNDELKHQIDTNTRPDESLIDLLRSSTHSQ 120
           ARG AKLASAAYYAQH               NDELK QIDTNTRPDESLIDLLRS+T SQ
Sbjct: 61  ARGLAKLASAAYYAQHFFIPSLLFLFLSGFSNDELKRQIDTNTRPDESLIDLLRSTTQSQ 120

Query: 121 PWIFXXXXXXXVVRPWQFLLLRSTPYFTLLEGFFTVLGIQAVGETNRWLSRGHGSNVWVI 180
            W+F       VVRPWQF+LLRSTPYFTLLEGFFTVLGIQAVGETNRWLSRG+GSN+WVI
Sbjct: 121 TWVFYYYYYQYVVRPWQFMLLRSTPYFTLLEGFFTVLGIQAVGETNRWLSRGNGSNMWVI 180

Query: 181 SGLMTSGGVITAALYYLYRIYVTPIWELSVQTASLLGFTFSIVSGLGIFGIVSGRGSTIE 240
           SGLM SGGVITAALYYLYRIYVTPIWELSVQTASLLGFTFSIVSGLGI+GIVSGRGSTIE
Sbjct: 181 SGLMASGGVITAALYYLYRIYVTPIWELSVQTASLLGFTFSIVSGLGIYGIVSGRGSTIE 240

Query: 241 SSLFFAYIVRCLYEISPQLATSAMDEISNLVKDTWHNQHRSLRSSDTFLAYYRDIILKNG 300
           SSLFFAYIVRCLYEISPQLATSAMDEI  LVK+TWHNQHRSLRSSDT L YYRDIILKNG
Sbjct: 241 SSLFFAYIVRCLYEISPQLATSAMDEIFTLVKETWHNQHRSLRSSDTLLTYYRDIILKNG 300

Query: 301 EMIWDAVLARTNVNVSGAGPVAWISWHRVQPLWKFVKHFTSSVPSSIQEIFLLTLSMARE 360
           EM+WDA+LARTNVNV  +G   W SW+RVQPLWKFVKHFTSSVPSSIQEIF LTL MARE
Sbjct: 301 EMVWDAILARTNVNVGASGTPVWASWNRVQPLWKFVKHFTSSVPSSIQEIFYLTLEMARE 360

Query: 361 AIAPAVVINLCFRILIFYSATRIIPALQXXXXXXXXXXXXXLYWYSPCIVIAMYTHLIMQ 420
           AIAPAVVINLCFRILIFYSATRIIPALQ             LYWYSPCIVIAMYTHLI+Q
Sbjct: 361 AIAPAVVINLCFRILIFYSATRIIPALQKKHKRRSRRFMRMLYWYSPCIVIAMYTHLILQ 420

Query: 421 YSGQISNDLCLWGCFPWSPPEGSKVVVDSWGFWNWCNIFCTMAIYASELFGSKS 474
           YSGQISNDLCLWGCFPWS P+  KVVVDSWGFWNWCNIFCTMAIYASEL GSKS
Sbjct: 421 YSGQISNDLCLWGCFPWSVPDTPKVVVDSWGFWNWCNIFCTMAIYASELLGSKS 474

>SAKL0E07524g Chr5 complement(609285..610724) [1440 bp, 479 aa] {ON}
           similar to uniprot|P40499 Saccharomyces cerevisiae
           YIL090W ICE2 Integral ER membrane protein with type-III
           transmembrane domains mutations cause defects in
           cortical ER morphology in both the mother and daughter
           cells
          Length = 479

 Score =  616 bits (1588), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/482 (63%), Positives = 362/482 (75%), Gaps = 12/482 (2%)

Query: 1   MIPRSILQSIRVCLTSFYLLLILITIPIAFQVGGLYCGLSFTVTLFNLYLITTTLKIAAR 60
           M+PRS++QSIR CLT+FYLLL+LITIPI+FQVGGLYCGLSFTVTLFNLY +TTTLKI ++
Sbjct: 1   MLPRSLIQSIRGCLTTFYLLLVLITIPISFQVGGLYCGLSFTVTLFNLYFLTTTLKIVSK 60

Query: 61  A--RGFAKLASAAYYAQHXXXXXXXXXXXXXXXNDELKHQIDTNTR-PDESLIDLLRSST 117
              R +  + S  YY QH               NDELK QID +   P ESL++ LR+ +
Sbjct: 61  KYNRLYYSITSFVYYLQHFIIPSLLFLFLSGFNNDELKRQIDGDVNLPRESLVNFLRNKS 120

Query: 118 HSQPWIFXXXXXXXVVRPWQFLLLRSTPYFTLLEGFFTVLGIQAVGETNRWLSRGHGSNV 177
               WIF        V+PWQF+LL STPYFTLLEGFFTVLGIQA+GETN+WL     SN 
Sbjct: 121 GKHSWIFYYYYYKFTVKPWQFVLLHSTPYFTLLEGFFTVLGIQAIGETNKWLRYHKNSNT 180

Query: 178 WVISGLMTSGGVITAALYYLYRIYVTPIWELSVQTASLLGFTFSIVSGLGIFGIVSGRGS 237
           W+I  L+ SGGVIT +LYYLYRIYVTP+WELS+QTASLLGFT SIV GLG++GIVSG+GS
Sbjct: 181 WIIVSLLISGGVITTSLYYLYRIYVTPVWELSIQTASLLGFTLSIVCGLGLYGIVSGKGS 240

Query: 238 TIESSLFFAYIVRCLYEISPQLATSAMDEISNLVKDTWHNQHRSLRSSDTFLAYYRDIIL 297
            IESSLFFAYIVRC+YEISPQLATSAMDEI  +VKDTW  +H+    +D  L+YYR+++L
Sbjct: 241 VIESSLFFAYIVRCIYEISPQLATSAMDEIFKIVKDTWQ-KHQGNLPTDNLLSYYRNVVL 299

Query: 298 KNGEMIWDAVLARTNVNVSGAGPVAWISWHRVQPLWKFVKHFTSSVPSSIQEIFLLTLSM 357
           KNGEMIWDA++ +T         + W+   R+QPLWKF K+FT SVPSSI+EIF +TL M
Sbjct: 300 KNGEMIWDAIVQKTGTTSPSTTQMVWL---RLQPLWKFTKNFTISVPSSIREIFRVTLKM 356

Query: 358 AREAIAPAVVINLCFRILIFYSATRIIPALQXXXX---XXXXXXXXXLYWYSPCIVIAMY 414
           A E++ P VVINL FRIL+FYSATRIIPALQ                +YWYSPCIVIAMY
Sbjct: 357 ATESVTPTVVINLVFRILVFYSATRIIPALQKDDSNGRKSSRRLMRLIYWYSPCIVIAMY 416

Query: 415 THLIMQYSGQISNDLCLWGCFPWSPPE--GSKVVVDSWGFWNWCNIFCTMAIYASELFGS 472
           THLI+QYSG+++NDLCLWGCFPWS      SKVVVD+WGFWNWCN+FCT+AIY  EL G 
Sbjct: 417 THLILQYSGELNNDLCLWGCFPWSHTNDPSSKVVVDAWGFWNWCNVFCTLAIYGLELIGG 476

Query: 473 KS 474
           KS
Sbjct: 477 KS 478

>Suva_9.109 Chr9 (187818..189293) [1476 bp, 491 aa] {ON} YIL090W
           (REAL)
          Length = 491

 Score =  530 bits (1365), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 264/488 (54%), Positives = 339/488 (69%), Gaps = 15/488 (3%)

Query: 2   IPRSILQSIRVCLTSFYLLLILITIPIAFQVGGLYCGLSFTVTLFNLYLITTTLKIAARA 61
           + +S +QS R+C   FYLL  L++IPI+F+VGGL CGLSFTVTLF LY ITTTL + AR 
Sbjct: 4   LSKSFMQSGRICAACFYLLFTLLSIPISFKVGGLECGLSFTVTLFTLYFITTTLNVLARR 63

Query: 62  RG---FAKLASAAYYAQHXXXXXXXXXXXXXXXNDELKHQIDTNTRPDESLIDLLRSSTH 118
            G   +  L S  YY+QH               NDEL + +   +   ES ++ L++S +
Sbjct: 64  NGGRLYIFLTSCLYYSQHFVIASLLFLFLSGFSNDELGNVLKNRSNESESFLEALKNSLN 123

Query: 119 SQP--WIFXXXXXXXVVRPWQFLLLRSTPYFTLLEGFFTVLGIQAVGETNRWLSRGHGSN 176
           S    ++        VV+PWQF+L +STP+FTL EGFFT+L IQAVGETNRWLS    SN
Sbjct: 124 SNQINYVLYYYYYRFVVQPWQFILTKSTPFFTLSEGFFTILAIQAVGETNRWLSNDLNSN 183

Query: 177 VWVISGLMTSGGVITAALYYLYRIYVTPIWELSVQTASLLGFTFSIVSGLGIFGIVSGRG 236
            W+IS L+ SGGVITA+LYYLYRIYVTPIW LS+QTASLLGF  S+V GLG++GIVS RG
Sbjct: 184 TWIISSLLASGGVITASLYYLYRIYVTPIWPLSIQTASLLGFVLSMVCGLGLYGIVSQRG 243

Query: 237 STIESSLFFAYIVRCLYEISPQLATSAMDEISNLVKDTWHNQHRSLRSSDTFLAYYRDII 296
           S IESSLFFAYIVRC+YEISP+LAT+A DEI +L KD W    R+L ++D  L Y+ ++I
Sbjct: 244 SVIESSLFFAYIVRCIYEISPKLATTATDEILDLFKDVWQKHQRNLPTADNLLCYFHNVI 303

Query: 297 LKNGEMIWDAVLARTNVNVSGAGP--VAWISWHRV----QPLWKFVKHFTSSVPSSIQEI 350
           LKN E++W + + R     S      ++ +S+ +V    +P W+F K+FT SVP SI E 
Sbjct: 304 LKNAEVLWGSFIPRRRKTTSDLHEKIISILSFEKVSLISKPFWRFCKNFTFSVPLSINEF 363

Query: 351 FLLTLSMAREAIAPAVVINLCFRILIFYSATRIIPALQXXXXXXXXXX---XXXLYWYSP 407
             +T+ MA E+++PA+VINLCFR+L+FYSATRIIPALQ                LYWYSP
Sbjct: 364 CQVTIKMASESVSPAIVINLCFRVLMFYSATRIIPALQRKNDKQLRKSRRIMKGLYWYSP 423

Query: 408 CIVIAMYTHLIMQYSGQISNDLCLWGCF-PWSPPEGSKVVVDSWGFWNWCNIFCTMAIYA 466
           CI+IAMYTHLI+QYSG++  DLC+WGC   W  P+  +++VDSWGFWNWCNIFCT+ +YA
Sbjct: 424 CILIAMYTHLILQYSGELKKDLCIWGCSEKWFGPDQPEIIVDSWGFWNWCNIFCTILVYA 483

Query: 467 SELFGSKS 474
           +EL GS S
Sbjct: 484 TELVGSGS 491

>Skud_9.83 Chr9 (170322..171797) [1476 bp, 491 aa] {ON} YIL090W
           (REAL)
          Length = 491

 Score =  526 bits (1356), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 263/488 (53%), Positives = 336/488 (68%), Gaps = 15/488 (3%)

Query: 2   IPRSILQSIRVCLTSFYLLLILITIPIAFQVGGLYCGLSFTVTLFNLYLITTTLKIAARA 61
           + +S +QS RVC   FYLL  L++IPI+F+VGGL CGLSFTVTLF LY ITTTL + A+ 
Sbjct: 4   LSKSFMQSGRVCAACFYLLFTLLSIPISFKVGGLECGLSFTVTLFTLYFITTTLNVLAKR 63

Query: 62  RG---FAKLASAAYYAQHXXXXXXXXXXXXXXXNDELKHQIDTNTRPDESLIDLLRSSTH 118
            G   +  L +  YY+QH               NDEL + +   +   ES +D L+ S +
Sbjct: 64  HGGKLYIFLTNCLYYSQHFVIASLLYLFLSGFSNDELGNVLKNRSNESESFLDALKDSLN 123

Query: 119 SQP--WIFXXXXXXXVVRPWQFLLLRSTPYFTLLEGFFTVLGIQAVGETNRWLSRGHGSN 176
           S    ++        VV+PWQF+L +STP+FTL EGFFT+L IQAVGETNRWLS    SN
Sbjct: 124 SNQINYVLYYYYYRFVVQPWQFVLTKSTPFFTLSEGFFTILAIQAVGETNRWLSNDLNSN 183

Query: 177 VWVISGLMTSGGVITAALYYLYRIYVTPIWELSVQTASLLGFTFSIVSGLGIFGIVSGRG 236
            W+IS L+ SGGVITA+LYYLYRIYVTPIW LS+QTASLLGF  S+V GLG++GIVS +G
Sbjct: 184 TWIISSLLASGGVITASLYYLYRIYVTPIWPLSIQTASLLGFVLSMVCGLGLYGIVSQKG 243

Query: 237 STIESSLFFAYIVRCLYEISPQLATSAMDEISNLVKDTWHNQHRSLRSSDTFLAYYRDII 296
           S IESSLFFAYIVRC+YEISP+LAT+A DEI +L KD W    R+L ++D  L Y+ +++
Sbjct: 244 SVIESSLFFAYIVRCIYEISPKLATTATDEILDLFKDVWQKHQRNLPTADNLLCYFHNVV 303

Query: 297 LKNGEMIWDAVLARTNVNVSGAGP--VAWISWHRV----QPLWKFVKHFTSSVPSSIQEI 350
           LKN EM+W + + R            ++ +S+ +V    +P WKF K+FT SVP SI E 
Sbjct: 304 LKNAEMLWGSFIPRGRKKTGDFHDKIISILSFEKVSLISRPFWKFFKNFTFSVPLSINEF 363

Query: 351 FLLTLSMAREAIAPAVVINLCFRILIFYSATRIIPALQXXXXXXXXXX---XXXLYWYSP 407
             +T+ MA E+++PA+VINLCFR+L+FYSATRIIPALQ                LYWYSP
Sbjct: 364 CQVTIKMASESVSPAIVINLCFRVLMFYSATRIIPALQRKNDKQLRKSRRIMRGLYWYSP 423

Query: 408 CIVIAMYTHLIMQYSGQISNDLCLWGCF-PWSPPEGSKVVVDSWGFWNWCNIFCTMAIYA 466
           CI+IAMYTHLI+QYSG++  DLC+WGC   W   E  +++VDSWGFWNWCNIFCT+ +YA
Sbjct: 424 CILIAMYTHLILQYSGELKKDLCIWGCSEKWFGAEQPEIIVDSWGFWNWCNIFCTILVYA 483

Query: 467 SELFGSKS 474
           +EL GS S
Sbjct: 484 TELIGSGS 491

>Smik_9.89 Chr9 (172734..174209) [1476 bp, 491 aa] {ON} YIL090W
           (REAL)
          Length = 491

 Score =  524 bits (1349), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 262/488 (53%), Positives = 336/488 (68%), Gaps = 15/488 (3%)

Query: 2   IPRSILQSIRVCLTSFYLLLILITIPIAFQVGGLYCGLSFTVTLFNLYLITTTLKIAARA 61
           + +S +QS R+C   FYLL  L++IPI+F+VGGL CGLSFTVTLF LY ITTTL + AR 
Sbjct: 4   LSKSFMQSGRICAACFYLLFTLLSIPISFKVGGLECGLSFTVTLFTLYFITTTLNVLARR 63

Query: 62  RG---FAKLASAAYYAQHXXXXXXXXXXXXXXXNDELKHQIDTNTRPDESLIDLLRSSTH 118
            G   +  L S  YY+QH               NDEL + +       ES ++ L++S +
Sbjct: 64  YGGKLYIFLTSCLYYSQHFIIASLLYLFLSGFSNDELGNVLKKRPNESESFLEALKNSLN 123

Query: 119 SQP--WIFXXXXXXXVVRPWQFLLLRSTPYFTLLEGFFTVLGIQAVGETNRWLSRGHGSN 176
           S    ++        VV+PWQF+L +STP+FTL EGFFT+L IQAVGETNRWLS    SN
Sbjct: 124 SNQINYVLYYYYFRFVVQPWQFILTKSTPFFTLSEGFFTILAIQAVGETNRWLSNDLNSN 183

Query: 177 VWVISGLMTSGGVITAALYYLYRIYVTPIWELSVQTASLLGFTFSIVSGLGIFGIVSGRG 236
            W+IS L+ SGGVITA+LYYLYRIYVTPIW LS+QTASLLGF  S+V GLG++GIVS +G
Sbjct: 184 TWIISSLLASGGVITASLYYLYRIYVTPIWPLSIQTASLLGFVLSMVCGLGLYGIVSQKG 243

Query: 237 STIESSLFFAYIVRCLYEISPQLATSAMDEISNLVKDTWHNQHRSLRSSDTFLAYYRDII 296
           S IESSLFFAYIVRC+YEISP+LAT+A DEI +L KD W    R+L ++D  L Y+ ++I
Sbjct: 244 SVIESSLFFAYIVRCIYEISPKLATTATDEILDLFKDVWQKHQRNLPTADNLLCYFHNVI 303

Query: 297 LKNGEMIWDAVLARTNVNVSGAGP--VAWISWHRV----QPLWKFVKHFTSSVPSSIQEI 350
           LKN EM+W + + R            ++ +S+ +V    +P WKF K+FT SVP SI E 
Sbjct: 304 LKNAEMLWGSFIPRGRKKTGDFHDKLISVLSFEKVSLISKPFWKFFKNFTFSVPLSINEF 363

Query: 351 FLLTLSMAREAIAPAVVINLCFRILIFYSATRIIPALQXXXXXXXXXX---XXXLYWYSP 407
             +T+ MA E+++PA+V+NLCFR+L+FYSATRIIPALQ                LYWYSP
Sbjct: 364 CQVTIKMASESVSPAIVVNLCFRVLMFYSATRIIPALQRKNDKQLRKSRRIMKGLYWYSP 423

Query: 408 CIVIAMYTHLIMQYSGQISNDLCLWGCF-PWSPPEGSKVVVDSWGFWNWCNIFCTMAIYA 466
           CI+IAMYTHLI+QYSG++  DLC+WGC   W   +  +++VDSWGFWNWCNIFCT+ +YA
Sbjct: 424 CILIAMYTHLILQYSGELKKDLCIWGCSEKWFGSDQPEIIVDSWGFWNWCNIFCTILVYA 483

Query: 467 SELFGSKS 474
           +EL GS S
Sbjct: 484 TELIGSGS 491

>TDEL0G02230 Chr7 (437121..438587) [1467 bp, 488 aa] {ON} Anc_2.293
           YIL090W
          Length = 488

 Score =  522 bits (1344), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 261/485 (53%), Positives = 338/485 (69%), Gaps = 14/485 (2%)

Query: 2   IPRSILQSIRVCLTSFYLLLILITIPIAFQVGGLYCGLSFTVTLFNLYLITTTLKIAARA 61
           I +S LQ  R+ L  FYLL  L+TIPI+F+VGGLYCGLSFTVTLFNLYLITTTL + A++
Sbjct: 4   ISKSFLQGTRMALAGFYLLSTLVTIPISFKVGGLYCGLSFTVTLFNLYLITTTLSMVAQS 63

Query: 62  RG---FAKLASAAYYAQHXXXXXXXXXXXXXXXNDELKHQIDTNTRPDESLIDLLRSSTH 118
            G   +    +  YY QH               N+EL   ++  ++P++SL+++LR++  
Sbjct: 64  YGNKCYIVGTTFIYYLQHFMIASLLYLFLSGFSNEELTKVLEDGSQPEQSLVNVLRNNVF 123

Query: 119 SQ--PWIFXXXXXXXVVRPWQFLLLRSTPYFTLLEGFFTVLGIQAVGETNRWLSRGHGSN 176
           S    W+        VV+PWQ +L  ST +F L EGFFTVLGIQA+GETNRWL     SN
Sbjct: 124 SNHSSWMLYYYYYRYVVQPWQSVLTHSTAFFALSEGFFTVLGIQAIGETNRWLLDEMNSN 183

Query: 177 VWVISGLMTSGGVITAALYYLYRIYVTPIWELSVQTASLLGFTFSIVSGLGIFGIVSGRG 236
            W+I+ L+TSGGVITA+LYYLYRIYVTPIW LSVQTASLLGFT SIV G+G+FGIVS  G
Sbjct: 184 TWIIASLLTSGGVITASLYYLYRIYVTPIWNLSVQTASLLGFTLSIVCGIGLFGIVSKNG 243

Query: 237 STIESSLFFAYIVRCLYEISPQLATSAMDEISNLVKDTWHNQHRSLRSSDTFLAYYRDII 296
           S IESSLFFAYIVRC+YEISP+LAT+A DEI  ++K  W    ++L +++  L+YY+D++
Sbjct: 244 SVIESSLFFAYIVRCIYEISPKLATTATDEILEVIKVAWQKHQKNLSTTNNLLSYYQDVV 303

Query: 297 LKNGEMIWDAVLARTN----VNVSGAGPVAWISWHRVQPLWKFVKHFTSSVPSSIQEIFL 352
           LKN EM+W++++ RT        +   P+  + WH   P+WKF K F  SVPSSI  +F 
Sbjct: 304 LKNAEMVWESIVLRTKNSDATTFTAIQPLNKL-WHAFTPIWKFFKGFVLSVPSSIGGVFQ 362

Query: 353 LTLSMAREAIAPAVVINLCFRILIFYSATRIIPALQXXXXXXXXXX---XXXLYWYSPCI 409
           +TL +A E+++PA+V+NLCFR+L+FYSATRIIPALQ                LYWYSPCI
Sbjct: 363 VTLKLASESVSPAIVLNLCFRVLVFYSATRIIPALQRKNTRELRKSRRIMNVLYWYSPCI 422

Query: 410 VIAMYTHLIMQYSGQISNDLCLWGCF-PWSPPEGSKVVVDSWGFWNWCNIFCTMAIYASE 468
           +IAMYTHLI+QYSG++++DLCLWGC   W      K+ +++W FWNWCNIF T+ IY SE
Sbjct: 423 LIAMYTHLILQYSGELNSDLCLWGCSEKWFGSGQPKIEINTWVFWNWCNIFWTVLIYGSE 482

Query: 469 LFGSK 473
           L G K
Sbjct: 483 LIGGK 487

>YIL090W Chr9 (193595..195070) [1476 bp, 491 aa] {ON}  ICE2Integral
           ER membrane protein with type-III transmembrane domains;
           required for ER zinc homeostasis; mutations cause
           defects in cortical ER morphology in both the mother and
           daughter cells
          Length = 491

 Score =  521 bits (1343), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 261/488 (53%), Positives = 335/488 (68%), Gaps = 15/488 (3%)

Query: 2   IPRSILQSIRVCLTSFYLLLILITIPIAFQVGGLYCGLSFTVTLFNLYLITTTLKIAARA 61
           + +S +QS R+C   FYLL  L++IPI+F+VGGL CGLSFTVTLF LY ITTTL + AR 
Sbjct: 4   LSKSFMQSGRICAACFYLLFTLLSIPISFKVGGLECGLSFTVTLFTLYFITTTLNVLARR 63

Query: 62  RG---FAKLASAAYYAQHXXXXXXXXXXXXXXXNDELKHQIDTNTRPDESLIDLLRSSTH 118
            G   +    +  YY+QH               NDEL + +       ES ++ L++S +
Sbjct: 64  HGGRLYIFFTNCLYYSQHFIIASLLYLFLSGFSNDELGNVLKNKYNESESFLEALKNSLN 123

Query: 119 SQP--WIFXXXXXXXVVRPWQFLLLRSTPYFTLLEGFFTVLGIQAVGETNRWLSRGHGSN 176
           S    ++        VV+PWQF+L +STP+FTL EGFFT+L IQAVGETNRWLS    SN
Sbjct: 124 SNQINYVLYYYYYRFVVQPWQFVLTKSTPFFTLSEGFFTILAIQAVGETNRWLSNDLNSN 183

Query: 177 VWVISGLMTSGGVITAALYYLYRIYVTPIWELSVQTASLLGFTFSIVSGLGIFGIVSGRG 236
            W+IS L+TSGGVITA+LYYLYRIYVTPIW LS+QTASLLG   S+V GLG++GIVS +G
Sbjct: 184 TWIISSLLTSGGVITASLYYLYRIYVTPIWPLSIQTASLLGLVLSMVCGLGLYGIVSQKG 243

Query: 237 STIESSLFFAYIVRCLYEISPQLATSAMDEISNLVKDTWHNQHRSLRSSDTFLAYYRDII 296
           S IESSLFFAYIVRC+YEISP+LAT+A DEI NL KD W    R+L ++D  L Y+ ++I
Sbjct: 244 SVIESSLFFAYIVRCIYEISPKLATTATDEILNLFKDVWQKHQRNLPTADNLLCYFHNVI 303

Query: 297 LKNGEMIWDAVLARTNVNVSGAGP--VAWISWHRV----QPLWKFVKHFTSSVPSSIQEI 350
           LKN E++W + + R            ++ +S+ +V    +P WKF K+FT SVP SI E 
Sbjct: 304 LKNAEVLWGSFIPRGRKKTGDFHDKLISILSFEKVSLISKPFWKFFKNFTFSVPLSINEF 363

Query: 351 FLLTLSMAREAIAPAVVINLCFRILIFYSATRIIPALQXXXXXXXXXX---XXXLYWYSP 407
             +T+ MA E+++PA+VINLCFR+L+FYSATRIIPALQ                LYWYSP
Sbjct: 364 CQVTIKMASESVSPAIVINLCFRVLMFYSATRIIPALQRKNDKQLRKSRRIMKGLYWYSP 423

Query: 408 CIVIAMYTHLIMQYSGQISNDLCLWGCF-PWSPPEGSKVVVDSWGFWNWCNIFCTMAIYA 466
           CI+IAMYTHLI+QYSG++  DLC+WGC   W   +  +++VDSWGFWNWCNIFCT+ +YA
Sbjct: 424 CILIAMYTHLILQYSGELKKDLCIWGCSEKWFGVDQPEIIVDSWGFWNWCNIFCTILVYA 483

Query: 467 SELFGSKS 474
           +EL GS S
Sbjct: 484 TELIGSGS 491

>KNAG0A05390 Chr1 complement(793701..795194) [1494 bp, 497 aa] {ON}
           Anc_2.293 YIL090W
          Length = 497

 Score =  503 bits (1294), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 257/483 (53%), Positives = 325/483 (67%), Gaps = 15/483 (3%)

Query: 7   LQSIRVCLTSFYLLLILITIPIAFQVGGLYCGLSFTVTLFNLYLITTTLKIAARARG--- 63
           ++  R+C  + YLLL LI+IPI+F+VGGLYCGL+FT TLF LY ++TTL I AR  G   
Sbjct: 10  IRGCRICSGALYLLLTLISIPISFKVGGLYCGLAFTATLFILYFVSTTLSIIARKNGNRI 69

Query: 64  FAKLASAAYYAQHXXXXXXXXXXXXXXXNDELKHQIDTNTRPDESLIDLLRSSTHSQP-- 121
           +  L+S  YY QH               N EL   I+ +  P ESL  +L  S  S    
Sbjct: 70  YIVLSSILYYCQHFIIASLLHLFLSGFSNAELHKIIENDAIPIESLTSILNVSMSSSEAN 129

Query: 122 WIFXXXXXXXVVRPWQFLLLRSTPYFTLLEGFFTVLGIQAVGETNRWLSRGHGSNVWVIS 181
           WIF       VV PW+F+L  STP+FTL EGFFT+L IQA+GETN+WL     SN W+IS
Sbjct: 130 WIFYYYYYKYVVTPWKFVLSHSTPFFTLSEGFFTILAIQAIGETNKWLCYEKNSNAWIIS 189

Query: 182 GLMTSGGVITAALYYLYRIYVTPIWELSVQTASLLGFTFSIVSGLGIFGIVSGRGSTIES 241
            L+TS  VI+AALYYLYRIYVTPIWEL+VQTASLLGF  S+VSGLGI+GIVS  GS IES
Sbjct: 190 SLLTSSAVISAALYYLYRIYVTPIWELTVQTASLLGFVLSLVSGLGIYGIVSDSGSVIES 249

Query: 242 SLFFAYIVRCLYEISPQLATSAMDEISNLVKDTWHNQHRSLRSSDTFLAYYRDIILKNGE 301
           SLFFAYIVRC+YEISP+LAT+A DE+  L KD W  +  +L   +  + YY ++ILKN E
Sbjct: 250 SLFFAYIVRCIYEISPKLATTATDELLELFKDVWQKRQGNLPIRNNLIFYYNNVILKNIE 309

Query: 302 MIWDAVLARTNVNVS-GAGPVAWI--SWHRVQPLWKFVKHFTSSVPSSIQEIFLLTLSMA 358
           M WD  + RT  + +    P   +  +W   +P+WKF K+FT SVP SI+EI L+T  M+
Sbjct: 310 MAWDNFILRTGTSGTFNYNPSLLLNNTWKFCKPIWKFFKNFTLSVPFSIREILLMTWKMS 369

Query: 359 REAIAPAVVINLCFRILIFYSATRIIPALQXXXXXXXXXXXXXL---YWYSPCIVIAMYT 415
            E+++PAVVINLCFRILIFYSATRI+P+LQ             +   YWYSPCI+IAMY 
Sbjct: 370 LESVSPAVVINLCFRILIFYSATRIVPSLQRKDAREQRRSRKVMELVYWYSPCILIAMYA 429

Query: 416 HLIMQYSGQISNDLCLWGC----FPWSPPEGSKVVVDSWGFWNWCNIFCTMAIYASELFG 471
           HLI+QYS ++ N+LCLWGC      ++  +   VVVD+W FWNWCN+FCT+ +YA+EL G
Sbjct: 430 HLILQYSSELKNELCLWGCNNILLGYNTDQNETVVVDAWRFWNWCNVFCTILVYANELIG 489

Query: 472 SKS 474
             +
Sbjct: 490 DTT 492

>CAGL0D04202g Chr4 (414049..415548) [1500 bp, 499 aa] {ON} similar
           to uniprot|P40499 Saccharomyces cerevisiae YIL090w
          Length = 499

 Score =  501 bits (1290), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 251/494 (50%), Positives = 337/494 (68%), Gaps = 22/494 (4%)

Query: 1   MIPRSILQSIRVCLTSFYLLLILITIPIAFQVGGLYCGLSFTVTLFNLYLITTTLKIAAR 60
           +I   + +SIR+   + YL+L L++IPI+F++GGL CGLSFTVTLFNLYLI+TTL + AR
Sbjct: 3   LITEGVQRSIRISSAALYLVLTLVSIPISFKIGGLQCGLSFTVTLFNLYLISTTLSVLAR 62

Query: 61  A---RGFAKLASAAYYAQHXXXXXXXXXXXXXXXNDELKHQID-----TNTRPDESLIDL 112
               RG+    S  YY+QH               N+E    +          PD S +DL
Sbjct: 63  RSCNRGYVFATSILYYSQHLVIAPLLFLFLSGFSNEEFNRFLSPVGSYQELDPDGSFLDL 122

Query: 113 LR-------SSTHSQPWIFXXXXXXXVVRPWQFLLLRSTPYFTLLEGFFTVLGIQAVGET 165
           L+       ++ +S+ W         +V+PWQ+LL  STP+FTLLEGFFT+L IQA+GET
Sbjct: 123 LKHRILMATTAENSKNWTLYYYYFKFIVQPWQWLLSYSTPFFTLLEGFFTILAIQAIGET 182

Query: 166 NRWLSRGHGSNVWVISGLMTSGGVITAALYYLYRIYVTPIWELSVQTASLLGFTFSIVSG 225
           N+WLS    SN W+I+ L+ SGGVIT +LYYLYRIYVTPIW+L++Q+ASLLGF  SIV  
Sbjct: 183 NKWLSYEMNSNTWIITSLLVSGGVITGSLYYLYRIYVTPIWKLTIQSASLLGFVLSIVFC 242

Query: 226 LGIFGIVSGRGSTIESSLFFAYIVRCLYEISPQLATSAMDEISNLVKDTWHNQHRSLRSS 285
           LG++GI+S +GS IESSLFFAYIVRC+YEISP+LAT A +EI +LVKD W    R+L + 
Sbjct: 243 LGLYGIISRKGSVIESSLFFAYIVRCIYEISPKLATRATEEILDLVKDVWQTHQRNLLNR 302

Query: 286 DTFLAYYRDIILKNGEMIWDAVLARTNVNVSGAGPVAWISWHRVQPLWKFVKHFTSSVPS 345
           D  LAYY +++LKN EM+W++ +   + +++    + +  W  V P+WKF K+FT SVPS
Sbjct: 303 DNLLAYYHNVVLKNAEMVWESFILPRSRSLNAMEKIRF--WLDVTPVWKFFKNFTVSVPS 360

Query: 346 SIQEIFLLTLSMAREAIAPAVVINLCFRILIFYSATRIIPALQXXXXXXXXXX---XXXL 402
           SI E+  +T  MA E+++PAV++NLCFRILIFYSATRIIPALQ                L
Sbjct: 361 SIVELVSVTYKMASESLSPAVIVNLCFRILIFYSATRIIPALQRSSYKEQRQSRRILKLL 420

Query: 403 YWYSPCIVIAMYTHLIMQYSGQISNDLCLWGCFP--WSPPEGSKVVVDSWGFWNWCNIFC 460
           YWYSPC++IAMYTHLI+QYSG++  +LCLWGC    +   +  ++V DSW FWNWCNIF 
Sbjct: 421 YWYSPCVLIAMYTHLILQYSGELKRELCLWGCTSNWFGSKDQPRIVTDSWSFWNWCNIFW 480

Query: 461 TMAIYASELFGSKS 474
           T+ +YA+EL G+++
Sbjct: 481 TVLVYANELIGTQA 494

>ZYRO0A02024g Chr1 (167059..168519) [1461 bp, 486 aa] {ON} similar
           to uniprot|P40499 Saccharomyces cerevisiae YIL090W ICE2
           Integral ER membrane protein with type-III transmembrane
           domains mutations cause defects in cortical ER
           morphology in both the mother and daughter cells
          Length = 486

 Score =  500 bits (1288), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 256/486 (52%), Positives = 341/486 (70%), Gaps = 22/486 (4%)

Query: 6   ILQSIRVCLTSFYLLLILITIPIAFQVGGLYCGLSFTVTLFNLYLITTTLKIAAR---AR 62
           ++QS+RV L  FYLL ILITIPI+F+VGGLYCGLSFTVTLFNLY ++TTL +  R   +R
Sbjct: 4   VVQSVRVLLACFYLLSILITIPISFKVGGLYCGLSFTVTLFNLYFMSTTLSLFVRGYASR 63

Query: 63  GFAKLASAAYYAQHXXXXXXXXXXXXXXXNDELKHQIDTNTRPDESLIDLLRS---STHS 119
            +    +  YY+QH               N+EL   +++ ++P++SL+++L+S   S HS
Sbjct: 64  FYVFSTATIYYSQHCIIASLLYLFLSGFSNEELTKILESGSQPEQSLLEVLKSNPFSAHS 123

Query: 120 QPWIFXXXXXXXVVRPWQFLLLRSTPYFTLLEGFFTVLGIQAVGETNRWLSRGHGSNVWV 179
             WI        +V+PWQ++L  ST +F+L EGFFT+L IQAVGE++RWL     SN+W 
Sbjct: 124 N-WILYYYYYCYIVQPWQWILSHSTAFFSLSEGFFTILAIQAVGESHRWLLYEINSNIWN 182

Query: 180 ISGLMTSGGVITAALYYLYRIYVTPIWELSVQTASLLGFTFSIVSGLGIFGIVSGRGSTI 239
           I+ L+ SGGVITAALYYLYRIYVTP+WELS+QTASLLGFT S+V GLG++GIVS  GS I
Sbjct: 183 ITSLLISGGVITAALYYLYRIYVTPVWELSIQTASLLGFTLSLVCGLGLYGIVSKNGSVI 242

Query: 240 ESSLFFAYIVRCLYEISPQLATSAMDEISNLVKDTWHNQHRSLRSSDTFLAYYRDIILKN 299
           ESSLFFAYIVRC+YEISP+LAT+A DEI  + K+ W    R+  S++  L+YY D++L +
Sbjct: 243 ESSLFFAYIVRCIYEISPKLATTATDEILEIFKEAWQKHQRNYSSTNNLLSYYHDVVLDS 302

Query: 300 GEMIWDAVLARTNVNVSGAGPVAWISWHR--------VQPLWKFVKHFTSSVPSSIQEIF 351
            EM+W++++++T   V+ + P    S            +P+  F K+FT SVPSSI+ +F
Sbjct: 303 AEMMWESIVSKT---VTTSDPFYHTSMFPPLRKFTDIFKPVGIFFKNFTISVPSSIEGLF 359

Query: 352 LLTLSMAREAIAPAVVINLCFRILIFYSATRIIPALQXX---XXXXXXXXXXXLYWYSPC 408
            +TL MA ++++PA+V+NL FR+LIFYSAT+IIPALQ                LYWYSPC
Sbjct: 360 QVTLKMASDSVSPAIVVNLFFRVLIFYSATKIIPALQGKGDRQLNKSRRIMNVLYWYSPC 419

Query: 409 IVIAMYTHLIMQYSGQISNDLCLWGCFP-WSPPEGSKVVVDSWGFWNWCNIFCTMAIYAS 467
           I+IAMYTHLI+QYSG+++ DLCLWGC   W     +K+VVDSWGFWNWCNIF T+ +Y S
Sbjct: 420 ILIAMYTHLILQYSGELNRDLCLWGCNSMWFSLNQTKIVVDSWGFWNWCNIFWTILVYGS 479

Query: 468 ELFGSK 473
           EL G K
Sbjct: 480 ELIGGK 485

>NCAS0B06220 Chr2 complement(1173970..1175430) [1461 bp, 486 aa]
           {ON} Anc_2.293 YIL090W
          Length = 486

 Score =  495 bits (1275), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 254/492 (51%), Positives = 329/492 (66%), Gaps = 26/492 (5%)

Query: 1   MIPRSILQSIRVCLTSFYLLLILITIPIAFQVGGLYCGLSFTVTLFNLYLITTTLKIAAR 60
           MI  S ++ IR+C  +FYLL  LI+IPI+F++GGL+CGL+FTV+LF LY ++TTL I AR
Sbjct: 1   MISSSFIRGIRICSATFYLLFTLISIPISFKIGGLHCGLAFTVSLFILYFLSTTLSIWAR 60

Query: 61  ARG---FAKLASAAYYAQHXXXXXXXXXXXXXXXNDELKHQIDTNTRPDESLIDLLRSST 117
             G      L +  YY QH               N++L   +    +P +S+ D+ + + 
Sbjct: 61  KYGSRIHILLTNILYYFQHFIIASLLYLFLSGFSNEQLSSMLRDGNKPIDSIADIFKKNV 120

Query: 118 HSQP---WIFXXXXXXXVVRPWQFLLLRSTPYFTLLEGFFTVLGIQAVGETNRWLSRGHG 174
            S     W+         V+PWQF+L  STP+FTL EGFFT+L IQA+GETN+WL     
Sbjct: 121 ASSTQANWVLYYYYYRFFVQPWQFILSYSTPFFTLSEGFFTILAIQAIGETNKWLVYEIN 180

Query: 175 SNVWVISGLMTSGGVITAALYYLYRIYVTPIWELSVQTASLLGFTFSIVSGLGIFGIVSG 234
           SN WVIS L+ SGGVITA+LYYLYRIYVTPIW+LSVQTASLLGFT S+V GLGI+GIV+ 
Sbjct: 181 SNTWVISSLLASGGVITASLYYLYRIYVTPIWQLSVQTASLLGFTLSLVGGLGIYGIVTD 240

Query: 235 RGSTIESSLFFAYIVRCLYEISPQLATSAMDEISNLVKDTWHNQHRSLRSSDTFLAYYRD 294
           +GS IESS+FFAYIVRC+YEISP+LAT+A +EI  + K+ W     +L S +  L+YY +
Sbjct: 241 KGSVIESSVFFAYIVRCIYEISPKLATTATEEILEVFKEVWQRHQANLTSPNNLLSYYHN 300

Query: 295 IILKNGEMIWDAVLARTNVNVSGAGPVAWISWHRV----QPLWKFVKHFTSSVPSSIQEI 350
           ++LKN E IW++     N  ++        S  RV     P+WK +K FT +VPSSI E+
Sbjct: 301 VVLKNIETIWESFKINDNSFITS------FSTERVITIFMPIWKLLKTFTITVPSSINEL 354

Query: 351 FLLTLSMAREAIAPAVVINLCFRILIFYSATRIIPALQX---XXXXXXXXXXXXLYWYSP 407
             +T  MA E+I+PAV++NLCFR+LIFYSATRIIPALQ                LYWYSP
Sbjct: 355 CFVTYKMACESISPAVIVNLCFRVLIFYSATRIIPALQRRDDNELRKSRRIMKVLYWYSP 414

Query: 408 CIVIAMYTHLIMQYSGQISNDLCLWGC----FPWSPPEGSKVVVDSWGFWNWCNIFCTMA 463
           CI+IAMY HLI+QYSG++ ++LCLWGC    FP   P   K++VDSWGFWNWCNIF T+ 
Sbjct: 415 CILIAMYAHLILQYSGELKDELCLWGCNSKIFPSDQP---KIIVDSWGFWNWCNIFFTIL 471

Query: 464 IYASELFGSKSG 475
           +YASEL G+  G
Sbjct: 472 VYASELIGTTPG 483

>ADL208W Chr4 (337118..338626) [1509 bp, 502 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL090W
          Length = 502

 Score =  496 bits (1277), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 260/506 (51%), Positives = 336/506 (66%), Gaps = 37/506 (7%)

Query: 1   MIPRSILQSIRVCLTSFYLLLILITIPIAFQVGGLYCGLSFTVTLFNLYLITTTLKIAAR 60
           M+P+ +L+S+R  L SFYL L+LIT+PI+FQ+GGLYCGLSFTVTLF LY +TTTLKI A 
Sbjct: 1   MVPKGLLRSLRFALASFYLFLVLITVPISFQIGGLYCGLSFTVTLFILYFVTTTLKITAA 60

Query: 61  ARG--FAKLASAAYYAQHXXXXXXXXXXXXXXXNDELKHQI--------------DTNTR 104
            RG  +  +AS  YY QH               ND+L+ ++              D N  
Sbjct: 61  TRGDEWKHIASTLYYLQHFLMPSILFLFLSGFNNDQLQKKLVGSDPKGARGGFIFDGNM- 119

Query: 105 PDESLIDLLRSSTHSQPWIFXXXXXXXVVRPWQFLLLRSTPYFTLLEGFFTVLGIQAVGE 164
            +ESL+ LL  S   +  +        VVRPWQ++LL +TP FTL EGFFTVL IQ +GE
Sbjct: 120 -NESLLQLLGRSRDDRATMAYLHYYRYVVRPWQYMLLHATPCFTLTEGFFTVLAIQVIGE 178

Query: 165 TNRWLSRGHGSNVWVISGLMTSGGVITAALYYLYRIYVTPIWELSVQTASLLGFTFSIVS 224
           T RWL     S  WVIS LM SG VIT ++YYLYRIYVTPIW LSV TA+LLGFT S+V 
Sbjct: 179 TGRWLRYKRNSTAWVISSLMVSGVVITTSMYYLYRIYVTPIWPLSVHTATLLGFTLSLVF 238

Query: 225 GLGIFGIVSGRGSTIESSLFFAYIVRCLYEISPQLATSAMDEISNLVKDTWHNQHRSLRS 284
           GLG++GI+SG+GS IESSLFFAY+V C+YEISPQLA +AM EI  +V +TW  Q  +L  
Sbjct: 239 GLGLYGIISGKGSAIESSLFFAYMVHCIYEISPQLALTAMSEIFQVVHNTWQMQQGTL-P 297

Query: 285 SDTFLAYYRDIILKNGEMIWDAVLART----NVNVSGAGPVAWIS----------WHRVQ 330
            ++ LAYY++ IL N E +WD +L +     +V +  A     +           W++ Q
Sbjct: 298 KNSLLAYYKNFIL-NAENLWDVLLKKAFLLHSVELDQAPSSVVVKDALVLVQQQWWNKSQ 356

Query: 331 PLWKFVKHFTSSVPSSIQEIFLLTLSMAREAIAPAVVINLCFRILIFYSATRIIPALQXX 390
            LW F K+F++ +P SI EIF++TL +ARE+I  AVV NL FR+++FYSATRIIPALQ  
Sbjct: 357 QLWSFTKNFSAGIPRSIHEIFIVTLGLARESINAAVVSNLVFRVIVFYSATRIIPALQRA 416

Query: 391 X-XXXXXXXXXXLYWYSPCIVIAMYTHLIMQYSGQISNDLCLWGCFPWSPPEGSKV--VV 447
                       +YWYSPCIVIAMYTH+I++YSG+++N+LC+WGCFPW   E ++   VV
Sbjct: 417 TGGTQSRKLMRIIYWYSPCIVIAMYTHMILRYSGELNNELCIWGCFPWLQSEANRDRWVV 476

Query: 448 DSWGFWNWCNIFCTMAIYASELFGSK 473
           D+WGFWNWCN+F T+ IYA EL GS+
Sbjct: 477 DAWGFWNWCNLFFTLLIYAVELIGSR 502

>NDAI0B03520 Chr2 complement(885459..886964) [1506 bp, 501 aa] {ON}
           Anc_2.293 YIL090W
          Length = 501

 Score =  491 bits (1264), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 253/497 (50%), Positives = 338/497 (68%), Gaps = 24/497 (4%)

Query: 1   MIPRSILQSIRVCLTSFYLLLILITIPIAFQVGGLYCGLSFTVTLFNLYLITTTLKIAAR 60
           MI  S ++ +R    +FYLL  LI+IPI+F++GGL CGL+FT TLF +Y ++TTL + AR
Sbjct: 1   MISSSFMRGVRTFSAAFYLLFTLISIPISFKIGGLQCGLAFTATLFTIYFLSTTLSLLAR 60

Query: 61  ARG--FAK-LASAAYYAQHXXXXXXXXXXXXXXXNDELKHQIDTNTRPDESLIDLLR--- 114
             G  F+  L    YY+QH               +++L   +  +T+  + + D++R   
Sbjct: 61  KYGSNFSIFLTGFLYYSQHLIIASLLYLFLSGFSHEDLTIPLSDDTQKVDIISDVVRRNL 120

Query: 115 SSTHSQPWIFXXXXXXXVVRPWQFLLLRSTPYFTLLEGFFTVLGIQAVGETNRWLSRGHG 174
           SST+S  W          V+PW++LL  STP+FTL EGFFT+L IQAVGETN+WL     
Sbjct: 121 SSTNSN-WNLYHNYYTFFVQPWKYLLSYSTPFFTLSEGFFTILAIQAVGETNKWLVNEIN 179

Query: 175 SNVWVISGLMTSGGVITAALYYLYRIYVTPIWELSVQTASLLGFTFSIVSGLGIFGIVSG 234
           SN W+IS L+TSGGVITA+LYYLYRIYVTPIW+LS+QTASLLGFT S+V GLG++GIV+ 
Sbjct: 180 SNTWIISSLLTSGGVITASLYYLYRIYVTPIWQLSIQTASLLGFTLSLVGGLGLYGIVTE 239

Query: 235 RGSTIESSLFFAYIVRCLYEISPQLATSAMDEISNLVKDTWHNQHRSLRSSDTFLAYYRD 294
           +GS IESSLFFAYIVRC+YEISP+LAT+A DEI  + K+ W     +L ++D  L YY +
Sbjct: 240 KGSVIESSLFFAYIVRCIYEISPKLATTATDEILEIFKEVWQRHQGNLPTTDNLLFYYNN 299

Query: 295 IILKNGEMIWDAVLARTNVN-VSGAGPVAW------------ISWHRVQPLWKFVKHFTS 341
            +L++ +M+W+ ++++ N N  +   P ++            +     +P+WK  K+FT 
Sbjct: 300 FVLRHIDMLWELLVSKINQNDPNNTLPSSFNINFLTTFLSKDLLLRICKPIWKLFKNFTV 359

Query: 342 SVPSSIQEIFLLTLSMAREAIAPAVVINLCFRILIFYSATRIIPALQ---XXXXXXXXXX 398
           SVPSSI E+ L+T  MARE+++PAVVINLCFR+LIFYSATRIIPALQ             
Sbjct: 360 SVPSSISELVLVTYQMARESVSPAVVINLCFRVLIFYSATRIIPALQRRNDSELKKSRRI 419

Query: 399 XXXLYWYSPCIVIAMYTHLIMQYSGQISNDLCLWGC-FPWSPPEGSKVVVDSWGFWNWCN 457
              LYWYSPC++IAMYTHLI+QYSG++  DLCLWGC   W  P   +++VDSWGFWNWCN
Sbjct: 420 MKILYWYSPCVLIAMYTHLILQYSGELKKDLCLWGCNLKWLIPNQPELIVDSWGFWNWCN 479

Query: 458 IFCTMAIYASELFGSKS 474
           IF T+ IYASELFG+ +
Sbjct: 480 IFFTIIIYASELFGTTA 496

>KAFR0J01330 Chr10 complement(243571..245046) [1476 bp, 491 aa] {ON}
           Anc_2.293 YIL090W
          Length = 491

 Score =  482 bits (1240), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 255/493 (51%), Positives = 323/493 (65%), Gaps = 23/493 (4%)

Query: 1   MIPRSILQSIRVCLTSFYLLLILITIPIAFQVGGLYCGLSFTVTLFNLYLITTTLKIAAR 60
           ++ +SI++ +R+   +FYLL  LI+IP++F++GG++CGLSFTVTLF  Y ++TTL I AR
Sbjct: 3   LLSKSIIRGLRIFSGTFYLLFTLISIPMSFKIGGMHCGLSFTVTLFIAYFLSTTLSILAR 62

Query: 61  ARG---FAKLASAAYYAQHXXXXXXXXXXXXXXXNDELKHQIDTNTRPDESLI---DLLR 114
             G   +  L S  YY QH               NDEL   +   T   E L+   DL+ 
Sbjct: 63  QSGSRFYIVLTSLIYYCQHLIIASLLYFFLSGFSNDELHRVLKDGTEKIEVLVANQDLMV 122

Query: 115 SSTHSQPWIFXXXXXXXVVRPWQFLLLRSTPYFTLLEGFFTVLGIQAVGETNRWLSRGHG 174
           S ++   W+        VV+PW+F+L  STP+F L EGFFT+L IQA+GETNRWLS    
Sbjct: 123 SESN---WLLYCYYYSYVVKPWKFVLSYSTPFFALAEGFFTILAIQAIGETNRWLSDEKN 179

Query: 175 SNVWVISGLMTSGGVITAALYYLYRIYVTPIWELSVQTASLLGFTFSIVSGLGIFGIVSG 234
           SN W+IS L+ S GV+TA+LYYLYRIYVTPIWELS QTA+LLG   S+  GLGI GI+S 
Sbjct: 180 SNSWIISSLLASSGVVTASLYYLYRIYVTPIWELSAQTATLLGCVLSLTFGLGIHGIISE 239

Query: 235 RGSTIESSLFFAYIVRCLYEISPQLATSAMDEISNLVKDTWHNQHRSLRSSDTFLAYYRD 294
           RGS +ESSLFFAYIVRC+YEISP+LAT+A DEI  L K+ W      L  +D  L YYR 
Sbjct: 240 RGSVVESSLFFAYIVRCIYEISPKLATTATDEILELFKEVWQEHQGKLPITDNILNYYRS 299

Query: 295 IILKNGEMIWDAVLARTNVNVS---GAGPVAWISWHRVQPLWKFVKHFTSSVPSSIQEIF 351
           +ILKN EMIW+A L++T  + +    +   A   W    PLWKF K+FT SVP SI E+ 
Sbjct: 300 VILKNTEMIWEAFLSKTKQHSNHTLNSFFTAENFWIHFNPLWKFFKNFTISVPFSISELS 359

Query: 352 LLTLSMAREAIAPAVVINLCFRILIFYSATRIIPALQXXXXXXXXXX---XXXLYWYSPC 408
            + L MA E+I+PAVV+NLCFR+LIFYSATRIIP+LQ                LYWYSPC
Sbjct: 360 GMMLQMASESISPAVVVNLCFRVLIFYSATRIIPSLQRKEVRDSRKSRRIMKVLYWYSPC 419

Query: 409 IVIAMYTHLIMQYSGQISNDLCLWGCFPWSP------PEGSKVVVDSWGFWNWCNIFCTM 462
           I+IAMYTHLI+QYSG++  +L LWG  P S        E + +VVDSW FWNWCNIF T+
Sbjct: 420 ILIAMYTHLILQYSGELKRELYLWG--PDSKLSFLVDKEENNIVVDSWSFWNWCNIFWTI 477

Query: 463 AIYASELFGSKSG 475
            IY  ELFG+ + 
Sbjct: 478 LIYGGELFGTPTA 490

>Ecym_3332 Chr3 (634314..635855) [1542 bp, 513 aa] {ON} similar to
           Ashbya gossypii ADL208W
          Length = 513

 Score =  471 bits (1212), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 256/515 (49%), Positives = 323/515 (62%), Gaps = 44/515 (8%)

Query: 1   MIPRSILQSIRVCLTSFYLLLILITIPIAFQVGGLYCGLSFTVTLFNLYLITTTLKIAAR 60
           M+ R +L+SIR  L  FYL L+LITIPI+FQVGGLYCGLSFTVTLF LY  TTTLKI   
Sbjct: 1   MLSRGLLRSIRFSLAIFYLFLVLITIPISFQVGGLYCGLSFTVTLFILYFTTTTLKITTT 60

Query: 61  --ARGFAKLASAAYYAQHXXXXXXXXXXXXXXXNDELKHQIDTNTRPDESLIDLLRSSTH 118
             +  F  LAS  YY QH               +D+L+  +D++     S   +   + +
Sbjct: 61  NGSGKFKLLASLIYYLQHFLIPSILFLFLSAFNSDQLQRLVDSDAVGASSKGFIFEGNVN 120

Query: 119 SQPWIFXXXXX-------------XXVVRPWQFLLLRSTPYFTLLEGFFTVLGIQAVGET 165
                                     +V+PWQ++LL +TPYFTL EGFFTVL IQA+GET
Sbjct: 121 ESLLQLLSLPPGNEGSVASYYYYYKYIVKPWQYMLLHATPYFTLTEGFFTVLAIQAIGET 180

Query: 166 NRWLSRGHGSNVWVISGLMTSGGVITAALYYLYRIYVTPIWELSVQTASLLGFTFSIVSG 225
            RWL     SN WVI  L+ SG VIT +++YLYRIYVTPIW LSVQTA+LLGFT S+V G
Sbjct: 181 GRWLRYKKNSNTWVILSLLVSGVVITTSMFYLYRIYVTPIWPLSVQTATLLGFTLSLVFG 240

Query: 226 LGIFGIVSGRGSTIESSLFFAYIVRCLYEISPQLATSAMDEISNLVKDTWHNQHRSLRSS 285
           LG++GI+SG+GSTIESSLFFAY+VRC+YEISPQLA +AM EI  +V DTW  Q  +L S 
Sbjct: 241 LGLYGIISGKGSTIESSLFFAYMVRCIYEISPQLALTAMTEIFQVVHDTWQLQQGTL-SK 299

Query: 286 DTFLAYYRDIILKNGEMIWDAVLARTNVNVSGAGPVAWIS-------------------- 325
           +  L YY   +  N E  WD++L +T +  + A    +                      
Sbjct: 300 NNLLTYYNTFV-SNAESFWDSLLKKTAIGTAAAAEETYTIFGYSMPFTSTIAKDTLIILQ 358

Query: 326 ---WHRVQPLWKFVKHFTSSVPSSIQEIFLLTLSMAREAIAPAVVINLCFRILIFYSATR 382
              W + Q +W F K+F+  +P SI EI ++TL MA+E+I PAV+ NL FR+L+FYSATR
Sbjct: 359 TQWWLKCQQIWSFTKNFSVGIPRSIHEILMVTLKMAKESINPAVITNLVFRVLVFYSATR 418

Query: 383 IIPALQXXX-XXXXXXXXXXLYWYSPCIVIAMYTHLIMQYSGQISNDLCLWGCFPW---S 438
           IIPALQ              +YWYSPCIVIAMYTHLI++YSG+++NDLC+WGCFPW   S
Sbjct: 419 IIPALQKATGATQSRKLMRIIYWYSPCIVIAMYTHLILRYSGELNNDLCIWGCFPWLNFS 478

Query: 439 PPEGSKVVVDSWGFWNWCNIFCTMAIYASELFGSK 473
               SK VVD+W FWNWCN+F T+ IYA EL GS+
Sbjct: 479 AKTRSKWVVDAWSFWNWCNLFFTLLIYAVELIGSR 513

>KLLA0E08207g Chr5 complement(740213..741673) [1461 bp, 486 aa] {ON}
           similar to uniprot|P40499 Saccharomyces cerevisiae
           YIL090W ICE2 Integral ER membrane protein with type-III
           transmembrane domains mutations cause defects in
           cortical ER morphology in both the mother and daughter
           cells
          Length = 486

 Score =  462 bits (1189), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 246/479 (51%), Positives = 311/479 (64%), Gaps = 39/479 (8%)

Query: 1   MIPRSILQSIRVCLTSFYLLLILITIPIAFQVGGLYCGLSFTVTLFNLYLITTTLKIAAR 60
           +I +S+LQ++R+ LT+ YL L+LITIPI+FQVGGL CGLSFTVTLF LY ++TT K+   
Sbjct: 42  LIKKSVLQTLRIFLTTMYLFLVLITIPISFQVGGLNCGLSFTVTLFALYFVSTTFKLVLL 101

Query: 61  ARGFAKLASAAYYAQHXXXXXXXXXXXXXXXNDELKHQIDTNTRPDESLIDLLRSSTHSQ 120
            RG A L++  YY QH               N      ID++T   E             
Sbjct: 102 DRGSA-LSTLIYYLQHLLIPSILFMFLSYFEN------IDSDTVDSE------------- 141

Query: 121 PWIFXXXXXXXVVRPWQFLLLRSTPYFTLLEGFFTVLGIQAVGETNRWLSRGHGSNVWVI 180
              +       +V+PWQ  L+ STP FTLLEG FT+L IQA+GET RWL     SN WVI
Sbjct: 142 ---YFKVFWNVMVKPWQLSLIHSTPVFTLLEGVFTILAIQAIGETERWLKMSRRSNQWVI 198

Query: 181 SGLMTSGGVITAALYYLYRIYVTPIWELSVQTASLLGFTFSIVSGLGIFGIVSGRGSTIE 240
             L+ SGG+IT +L+Y YRIYVTP+WELS  +ASLLGFTFSIV G+G++GI +G GS +E
Sbjct: 199 LSLLISGGIITLSLFYFYRIYVTPMWELSTPSASLLGFTFSIVCGIGLYGI-NGSGSVME 257

Query: 241 SSLFFAYIVRCLYEISPQLATSAMDEISNLVKDTWHNQHRSLRSSDTFLAYYRDIILKNG 300
           SSLFFAY+VR +YEISP++A +AMDEI ++VK+TW     +L   D  L    +++ KN 
Sbjct: 258 SSLFFAYMVRNVYEISPKMAMNAMDEIFDIVKETWKIHQANLPKKDNLL----ELMTKNY 313

Query: 301 EMIWDAVLARTNVN---VSGAGPVAWISWHRVQPLWKFVKHFTSSVPSSIQEIFLLTLSM 357
             IW  ++  T  N   +       WI    + PLW  VK+FT SVP SIQEIF++T  M
Sbjct: 314 RAIWSQIVEHTPRNHKYIKMMDQCKWI----LNPLWNSVKNFTKSVPISIQEIFVVTFKM 369

Query: 358 AREAIAPAVVINLCFRILIFYSATRIIPALQXXXXXXXX--XXXXXLYWYSPCIVIAMYT 415
           A+E++ PAVVINL FR+LIFYSATRIIP LQ               +YWYSPCI+IAMYT
Sbjct: 370 AKESLIPAVVINLVFRLLIFYSATRIIPTLQRNTKERRSFRRIMNFVYWYSPCIIIAMYT 429

Query: 416 HLIMQYSGQISNDLCLWGCFPWSPPEGSKVVVDSWGFWNWCNIFCTMAIYASELFGSKS 474
           HLI++YSGQ+ NDLC+WGCFP+      K+VVDSW FWNWCNI+ TM IYA EL GS  
Sbjct: 430 HLILRYSGQLKNDLCIWGCFPYE--TEPKIVVDSWSFWNWCNIYSTMLIYALELMGSNK 486

>Kpol_1003.42 s1003 (100704..102176) [1473 bp, 490 aa] {ON}
           (100704..102176) [1473 nt, 491 aa]
          Length = 490

 Score =  457 bits (1175), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 235/485 (48%), Positives = 311/485 (64%), Gaps = 14/485 (2%)

Query: 4   RSILQSIRVCLTSFYLLLILITIPIAFQVGGLYCGLSFTVTLFNLYLITTTLKIAARARG 63
           +++++S++V L  FYLL I+ TIPI+F++GGLYCGL+FTVTLF LY  +TTL I AR  G
Sbjct: 6   KNLIRSVQVVLVCFYLLNIVTTIPISFKIGGLYCGLTFTVTLFYLYFTSTTLNIIARRWG 65

Query: 64  FAK---LASAAYYAQHXXXXXXXXXXXXXXXNDELKHQIDTNTRPDESLIDLLRSS--TH 118
                 + S+ +Y Q+               N++L   I +  +P E+ +DLLR      
Sbjct: 66  SKPAIIITSSFFYFQNFIIPSLLHLFLNGFANEDLIKSIRSGIQPKETFLDLLRGDIPVS 125

Query: 119 SQPWIFXXXXXXXVVRPWQFLLLRSTPYFTLLEGFFTVLGIQAVGETNRWLSRGHGSNVW 178
            + W+         V+PWQ +L  STP FTLLEGFFT+LGIQ +GE N WL     SN+W
Sbjct: 126 VKNWLLFYYYYSYTVKPWQVILSYSTPVFTLLEGFFTILGIQTIGEMNTWLKHERNSNIW 185

Query: 179 VISGLMTSGGVITAALYYLYRIYVTPIWELSVQTASLLGFTFSIVSGLGIFGIVSGRGST 238
           +IS L+TSGG+IT +LYYLYRIY TPIW LSV  A+LLGFT S+V  LGI+GIVS  GS 
Sbjct: 186 IISSLLTSGGLITGSLYYLYRIYATPIWNLSVGAATLLGFTLSLVGSLGIYGIVSHNGSV 245

Query: 239 IESSLFFAYIVRCLYEISPQLATSAMDEISNLVKDTWHNQHRSLRSSDTFLAYYRDIILK 298
           IESSLFFAYIVRC+YEI+P+LAT+A +E    +K+ W + H +L  +D F++Y+ D    
Sbjct: 246 IESSLFFAYIVRCIYEIAPELATTATEEFLEGIKEVWQSHHANLNVADGFISYFYDSFHM 305

Query: 299 NGEMIWDAVLARTNV-----NVSGAGPVAWISWHRVQPLWKFVKHFTSSVPSSIQEIFLL 353
                W    +RT       N     P   +      P+W+ +K  T SVP+SI E+F L
Sbjct: 306 QAHKFWTLFTSRTPYYGYLHNYCMDYPSLVMIRSNFYPIWETLKTLTFSVPTSISELFHL 365

Query: 354 TLSMAREAIAPAVVINLCFRILIFYSATRIIPALQXXXXXXXXX---XXXXLYWYSPCIV 410
           T+ MA ++++PA++INLCFR++IFYSATRIIPA+Q                LYWYSPCI+
Sbjct: 366 TVRMAIDSVSPAIIINLCFRLMIFYSATRIIPAIQKRTRSETRKIRGIMKALYWYSPCIL 425

Query: 411 IAMYTHLIMQYSGQISNDLCLWGC-FPWSPPEGSKVVVDSWGFWNWCNIFCTMAIYASEL 469
           IAMYTHLI+QYSG++  DLCLWGC   W   +  ++ VD+W FWNWCNIF T+ IY SEL
Sbjct: 426 IAMYTHLILQYSGELKKDLCLWGCDSTWFGEDQERINVDAWSFWNWCNIFWTIIIYGSEL 485

Query: 470 FGSKS 474
            G K 
Sbjct: 486 IGGKK 490

>TPHA0C03440 Chr3 (752685..754424) [1740 bp, 579 aa] {ON} Anc_2.293
           YIL090W
          Length = 579

 Score =  410 bits (1053), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 229/537 (42%), Positives = 310/537 (57%), Gaps = 70/537 (13%)

Query: 1   MIPRSILQSIRVCLTSFYLLLILITIPIAFQVGGLYCGLSFTVTLFNLYLITTTLKIAAR 60
           +IPR ++ S    L +FYLL I++TIPI+F++GG+YCGLSFT TLF LY I+T++ I  +
Sbjct: 50  LIPRGVINSGHAVLVAFYLLNIVVTIPISFKIGGIYCGLSFTGTLFGLYFISTSVTIITK 109

Query: 61  ----ARGFAKLASAAYYAQHXXXXXXXXXXXXXXXNDEL------------KHQIDTNT- 103
                     LAS+ +Y Q+               N +L              +  TNT 
Sbjct: 110 RLTHNTTLRLLASSLFYIQNFIISSLLQIYLRGFNNKDLITALTFLDDYYYNEKNGTNTK 169

Query: 104 --------------------RPDESLIDLL----RSSTHSQP-------WIFXXXXXXXV 132
                               R D  L  +L    +S  +S P       WI         
Sbjct: 170 YQILFIIKDYFVNIMNLILFREDNGLNKMLQLALKSEGNSVPDPQKLNSWILFFYYYYIF 229

Query: 133 VRPWQFLLLRSTPYFTLLEGFFTVLGIQAVGETNRWLSRGHGSNVWVISGLMTSGGVITA 192
           ++PW+FLL+ STP+FTLLEGFFT+LGIQ +GETN WL +   S+ WVI  L++SGGVITA
Sbjct: 230 IKPWKFLLINSTPFFTLLEGFFTILGIQTIGETNIWLKQQKHSSFWVILSLLSSGGVITA 289

Query: 193 ALYYLYRIYVTPIWELSVQTASLLGFTFSIVSGLGIFGIVSGRGSTIESSLFFAYIVRCL 252
            LYYL RIYVTP W+L+V TAS+LGFT SIV GLG+FGIVS  GS IESSLFFAYIVRC+
Sbjct: 290 TLYYLNRIYVTPFWDLTVSTASMLGFTLSIVGGLGVFGIVSKNGSAIESSLFFAYIVRCI 349

Query: 253 YEISPQLATSAMDEISNLVKDTWHNQHRSLRSSDTFLAYYRDIILKNGEMIWDAVLARTN 312
           YE+SP+LA SA DE      + W      +  +D  L Y +  I+       DA  + ++
Sbjct: 350 YEMSPELAISATDEFLEGFNEVWQMNQNRITVADNVLTYCKKYIM-------DAFSSFSS 402

Query: 313 VNVSGAGPVAWISWHR---VQPLWKFVKHFTSSVPSSIQEIFLLTLSMAREAIAPAVVIN 369
           +          +   +   V+  W F+K+FT +VPSSI ++  +T  MA ++I+PA++IN
Sbjct: 403 IEHHLFPKTIELGISKNLIVKQFWVFLKNFTINVPSSINDLIQITAQMAVDSISPAIIIN 462

Query: 370 LCFRILIFYSATRIIPALQXXX---XXXXXXXXXXLYWYSPCIVIAMYTHLIMQYSGQIS 426
           L FR++IFYSATRIIPA+Q                +YW+SPC++IAMYTHLI+Q+SG++ 
Sbjct: 463 LSFRLMIFYSATRIIPAIQRRTKPDAHDLTGFMSAVYWFSPCMLIAMYTHLILQFSGELK 522

Query: 427 NDLCLWGCFPWSPPEG---------SKVVVDSWGFWNWCNIFCTMAIYASELFGSKS 474
            ++CLW C  W              + ++VDSW FWNWCNIF T+ IYASEL G +S
Sbjct: 523 KNICLWNCENWLSSSSDVKSTNLGDNSIIVDSWSFWNWCNIFWTIIIYASELIGGRS 579

>TBLA0B06990 Chr2 (1649581..1651191) [1611 bp, 536 aa] {ON} 
          Length = 536

 Score =  374 bits (960), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 212/533 (39%), Positives = 311/533 (58%), Gaps = 64/533 (12%)

Query: 2   IPRSILQSIRVCLTSFYLLLILITIPIAFQVGGLYCGLSFTVTLFNLYLITTTLKIAAR- 60
           + +S+ QSIR+    FYL+ +LITIP AF++GGLYCGLSFT+TLF+LY ++TT+ + A+ 
Sbjct: 4   VVKSVKQSIRMLWGCFYLISVLITIPSAFKIGGLYCGLSFTMTLFHLYFLSTTMHLIAKR 63

Query: 61  --ARGFAKLASAAYYAQHXXXXXXXXXXXXXXXNDELKHQIDTNTRPDE--SLI-----D 111
                +  L++  YY QH               +  L ++I +N + D+  SL+     D
Sbjct: 64  TLNNFYILLSTLVYYLQHIVIASLLYIFITIFSDGNL-NEILSNNKTDQLPSLLYYIKND 122

Query: 112 LLRSSTHSQPWIFXXXXXXXVVRPWQFLLLRSTPYFTLLEGFFTVLGIQAVGETNRWLSR 171
             +S + +  ++         V+PW +LL  STP+FTLLEGFFT+LGIQA+GET  WL  
Sbjct: 123 TSKSVSQNFHYLLFYYYYYYAVQPWNYLLSHSTPFFTLLEGFFTILGIQAIGETYCWLLL 182

Query: 172 GHGSNVWVISGLMTSGGVITAALYYLYRIYVTPIWELSVQTASLLGFTFSIVSGLGIFGI 231
                ++ +   + S GVI  A+++LY+IY   +WELS+QTASLLG T S+V  +GIFGI
Sbjct: 183 KKQKKIFKLLTWLISVGVIFTAIHFLYKIYEFQVWELSIQTASLLGVTMSLVLTVGIFGI 242

Query: 232 VSGRGSTIESSLFFAYIVRCLYEISPQLATSAMDEISNLVKDTWHNQHRSLRSSDTFLAY 291
            S  GS IESSLF  YI+RC YEISP+L+TSA  EI + +K+ W N   S+  ++  L Y
Sbjct: 243 FSTNGSLIESSLFLGYIIRCFYEISPELSTSATTEILDNIKEAWQNHQGSITVTEHILFY 302

Query: 292 YRDIILK--NGEMIWDAVLARTNVNVSGAGPVAWISW-----------------HRV--- 329
           Y +++LK  N   ++++  +++N   +    +A I                   H +   
Sbjct: 303 YNNVLLKNINSSYLFNSNFSKSNDTSAKNRTLAEIQRSTNNYTLTDITKPSDLIHLIGFK 362

Query: 330 ----------QPLWKFVKHFTSSVPSSIQEIFLLTLSMAREAIAPAVVINLCFRILIFYS 379
                      P+++ +K F  ++P+S+  +  +T  +A ++++P++VINLCFR+LIFYS
Sbjct: 363 SIYQNWLIYATPIYELLKDFVLNIPTSLANLSQVTYKLAYDSVSPSIVINLCFRVLIFYS 422

Query: 380 ATRIIPALQXXXXXXXXXXXXXL---YWYSPCIVIAMYTHLIMQYSGQISNDLCLWGCFP 436
           ATRIIPA+Q             L   Y +SPCIVIAMYT+LI+QYSG++ NDLC+WGC  
Sbjct: 423 ATRIIPAVQRKNHLETKRSRNFLKAFYLFSPCIVIAMYTNLILQYSGELKNDLCIWGCDI 482

Query: 437 WSPPEGSKV------------------VVDSWGFWNWCNIFCTMAIYASELFG 471
            S     ++                  +V+SWGFWNWCNIFCT+ IY  EL G
Sbjct: 483 ISKSISQRMSTINMDVGSDDTYPNREFIVNSWGFWNWCNIFCTIFIYGCELMG 535

>TBLA0B05980 Chr2 (1412745..1414226) [1482 bp, 493 aa] {ON}
           Anc_2.293 YIL090W
          Length = 493

 Score =  372 bits (955), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 211/496 (42%), Positives = 301/496 (60%), Gaps = 29/496 (5%)

Query: 2   IPRSILQSIRVCLTSFYLLLILITIPIAFQVGGLYCGLSFTVTLFNLYLITTTLKIAARA 61
           + +++ +S R      YLL +L+T+PIAFQ+GGL CGL+FT+TLF+ Y ITTTL   AR 
Sbjct: 4   VLKNLGESTRFFFAGIYLLSVLMTVPIAFQLGGLQCGLAFTLTLFSSYFITTTLNAIARK 63

Query: 62  ---RGFAKLASAAYYAQHXXXXXXXXXXXXXXXNDELKHQIDTNTRPDESLIDLLRSS-- 116
              + F    +  YY Q+               + EL   +       E++  +L+++  
Sbjct: 64  LRWQRFIAWTNFLYYFQNFNIIGILHIFLSLFSHTELSISMSDENPSMETITSILKNNDT 123

Query: 117 --THSQPWIFXXXXXXXVVRPWQFLLLRSTPYFTLLEGFFTVLGIQAVGETNRWLSRGHG 174
             + +  +I+       + R W+F L  STP F L+EGFFT+L IQ +GETN WL+    
Sbjct: 124 YPSKTISFIYKYFFYYAMPR-WKFCLSYSTPLFALVEGFFTILAIQVIGETNIWLTTVKN 182

Query: 175 SNVWVISGLMTSGGVITAALYYLYRIYVTPIWELSVQTASLLGFTFSIVSGLGIFGIVSG 234
           S++W+I  L+ S  ++T ++YY+Y+IYVTP+W LS Q ASLL FTFS+V G+ I+GIVS 
Sbjct: 183 SSIWIILSLIMSSSMVTTSIYYIYKIYVTPLWHLSNQVASLLSFTFSLVGGVAIYGIVSH 242

Query: 235 RGSTIESSLFFAYIVRCLYEISPQLATSAMDEISNLVKDTWHNQHRSLRSSDTFLAYYRD 294
           RGS +ESSLFFAYIV C+YEISP +AT+AMD+I + +K++W    R+   SD  L YY +
Sbjct: 243 RGSVVESSLFFAYIVCCIYEISPIMATTAMDDIFDTLKESWQIHQRNFFISDNLLIYYYN 302

Query: 295 IILKN-GEMIWDAVLART------NVNVSGAGPVAWISWHRVQPLWKFVKHFTSSVPSSI 347
            ++KN  E I   ++  T      N   S       IS    + + K  K FT  +PSSI
Sbjct: 303 SLIKNVDEFIKLKIIKLTTKDNFSNKFNSLLFQCVKISKKSFKFILKLSKRFTLGIPSSI 362

Query: 348 QEIFLLTLSMAREAIAPAVVINLCFRILIFYSATRIIPALQX---------XXXXXXXXX 398
            E++ +TL MA E+I+P +++NLC+R+LIFY+ATRIIPAL+                   
Sbjct: 363 YELYSITLKMASESISPVILVNLCYRVLIFYAATRIIPALESRSNGFSNNNIKTKSNSKF 422

Query: 399 XXXLYWYSPCIVIAMYTHLIMQYSGQISNDLCLWGCFPWSPPEGSKVVVDSWGFWNWCNI 458
              LYWYSPCI+IAMYT+LI+QYSG++ ++  L     W+    ++VVVDSW FWNWCNI
Sbjct: 423 MKVLYWYSPCILIAMYTNLILQYSGELKSEFKL-----WNNSNNNEVVVDSWRFWNWCNI 477

Query: 459 FCTMAIYASELFGSKS 474
           F T+ +Y SEL G + 
Sbjct: 478 FWTITLYGSELIGGRK 493

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.327    0.139    0.446 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 42,278,274
Number of extensions: 1561053
Number of successful extensions: 4933
Number of sequences better than 10.0: 28
Number of HSP's gapped: 4938
Number of HSP's successfully gapped: 30
Length of query: 475
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 362
Effective length of database: 40,524,141
Effective search space: 14669739042
Effective search space used: 14669739042
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 68 (30.8 bits)