Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_27.114442.307ON75775737710.0
KLTH0G10934g2.307ON75875325980.0
TDEL0G023702.307ON74774719400.0
Smik_4.1152.307ON79077119210.0
Skud_4.1332.307ON78775919110.0
Kpol_1003.532.307ON78873919080.0
YDL122W (UBP1)2.307ON80973718890.0
Suva_4.1252.307ON79377318770.0
CAGL0H10582g2.307ON79069918390.0
AGR389C2.307ON77572418210.0
ZYRO0A02420g2.307ON74576218170.0
TPHA0G008502.307ON78275518100.0
KAFR0A069102.307ON67869717120.0
SAKL0E07106g2.307ON79159217200.0
NDAI0B034302.307ON85673416490.0
KLLA0E08801g2.307ON77153015980.0
NCAS0B061302.307ON77050514960.0
TBLA0B060802.307ON82451814290.0
KNAG0A054502.307ON76450412521e-161
TBLA0B071602.307ON3843427711e-94
NCAS0G036802.307ON4824053849e-39
NDAI0G007802.307ON4864243531e-34
Ecym_11668.540ON6964241824e-13
AEL242W8.540ON6134551682e-11
SAKL0H10076g8.540ON7671931451e-08
Kwal_27.120308.540ON7491781423e-08
Suva_16.2408.540ON5234101403e-08
TBLA0H036008.540ON4822131378e-08
AFR551W8.742ON4691771314e-07
KLTH0E12540g8.540ON7521831308e-07
KLLA0E23387g8.540ON7821821262e-06
TPHA0L016708.540ON5244591243e-06
Kwal_14.20088.188ON4243201216e-06
Ecym_62488.742ON4661741128e-05
ZYRO0D03982g8.540ON8212451138e-05
YNL186W (UBP10)2.69ON792601139e-05
KAFR0E009308.540ON4981801101e-04
Smik_13.4318.742ON471841101e-04
KLTH0H07678g8.188ON8613001111e-04
Suva_13.4078.742ON4712071092e-04
Skud_13.3928.742ON473861082e-04
TBLA0B097602.69ON898601093e-04
SAKL0E13002g2.69ON739601083e-04
KLTH0B07150g2.69ON756601083e-04
Suva_14.1562.69ON788601074e-04
Kwal_33.144302.69ON511601064e-04
Kpol_1044.242.69ON724601065e-04
NDAI0F034102.69ON870601066e-04
NCAS0C021108.540ON4941881056e-04
ZYRO0G01606g5.443ON1305831057e-04
KAFR0L017307.390ON701621057e-04
YBL067C (UBP13)7.390ON747891048e-04
TDEL0B030608.540ON7341871048e-04
Kwal_26.91518.742ON454811038e-04
YMR223W (UBP8)8.742ON471581030.001
Skud_14.1482.69ON776601040.001
NCAS0G018002.69ON875681040.001
KLLA0D08459g2.69ON750651030.001
NDAI0C059008.188ON826831030.001
Skud_15.2865.443ON1278491030.001
Smik_16.1638.540ON5011901020.001
ZYRO0A05962g8.742ON4652061020.001
ZYRO0C09812g2.69ON702601020.002
YOR124C (UBP2)5.443ON1272491020.002
Suva_2.2288.188ON9272971020.002
Smik_15.3015.443ON1272491010.002
KAFR0A075802.69ON802601000.002
NDAI0E008108.742ON49358990.003
KNAG0F012202.69ON784751000.003
TPHA0O016402.69ON74659990.003
Suva_8.1765.443ON1270491000.003
Kpol_1062.235.443ON126649990.003
Kpol_513.255.18ON119051990.004
CAGL0J11352g2.69ON77160990.004
TDEL0A011002.69ON66160980.004
CAGL0M11198g8.742ON46158980.004
KNAG0A019708.540ON471164980.004
NDAI0E041807.390ON82765980.004
TDEL0D025805.443ON127272980.005
YPL072W (UBP16)8.540ON499497970.005
KNAG0B041905.443ON126277980.005
KAFR0A042108.742ON44081960.006
Skud_4.3238.188ON926297970.006
NCAS0A039108.188ON79567970.007
Smik_5.3098.188ON805371960.007
Kpol_1032.288.188ON88275960.007
Ecym_45145.443ON124666970.007
TBLA0A064705.443ON132070970.008
Smik_14.1442.69ON76360960.008
NCAS0H021005.443ON126947960.008
NCAS0B005808.742ON46658950.009
CAGL0A04477g7.390ON77079950.009
Kpol_1018.937.390ON75580950.010
Suva_2.507.390ON75089950.010
SAKL0H04994g8.742ON45459950.010
Kwal_14.19578.202ON444172940.011
TDEL0B036708.742ON46381930.015
CAGL0H05335g8.540ON483179920.020
KNAG0G029308.742ON45961920.022
CAGL0L01639g1.137ON1147285930.022
ABL145W2.69ON74960920.026
SAKL0G02728g5.443ON123749920.026
NDAI0E028208.540ON49573910.027
Kwal_55.213935.443ON123379920.027
Skud_10.221.137ON1255274920.029
NDAI0C015505.443ON129549910.030
TBLA0D006207.390ON117179910.031
TPHA0C027708.188ON97080910.034
TBLA0D010708.742ON48396900.038
KNAG0D019308.188ON98681900.038
TPHA0P006807.390ON72780900.044
Skud_2.387.390ON74889890.047
Smik_2.497.390ON74565890.050
KNAG0C035807.390ON77665890.052
Kpol_1064.488.742ON46657880.053
ACL164C5.443ON138948890.057
YDR069C (DOA4)8.188ON926297890.062
Suva_5.2728.188ON78848880.068
KLTH0H07370g8.202ON781173880.070
KLTH0D12760g8.742ON45386870.073
ZYRO0D07062g5.18ON119351880.081
KNAG0B023707.390ON75371870.081
Smik_4.3078.188ON929297880.083
CAGL0H06721g5.712ON1081317870.090
KLTH0F15862g5.443ON124148870.092
KLLA0E02377g5.443ON122084870.093
CAGL0G05247g8.188ON94770870.10
NDAI0A036808.188ON111686870.10
TPHA0D046605.712ON1045165870.11
NDAI0I025305.18ON119750860.12
NCAS0A143707.390ON72965860.13
KLLA0C06974g8.742ON44658850.14
KAFR0I026005.18ON121350850.15
TPHA0E017105.443ON128351850.15
AGR139C8.202ON78997850.16
TDEL0B045608.155ON2670114850.16
TPHA0G005608.742ON46357840.17
Skud_5.2818.188ON82371850.18
CAGL0I06600g8.202ON81649850.18
TBLA0C070205.18ON124751850.19
KAFR0C025908.188ON97883840.21
SAKL0E15136g5.712ON1037165840.22
TDEL0C015707.390ON76585830.25
Skud_2.1773.270ON782122830.26
NCAS0D023905.18ON121147830.27
YER144C (UBP5)8.188ON80574830.27
Kpol_1045.417.390ON71265830.30
Ecym_46857.390ON77865830.30
ZYRO0B03300g7.390ON81364830.31
AGR370W7.390ON74093820.33
TDEL0B042208.188ON82566820.34
Ecym_61848.188ON851283820.35
Skud_16.2098.540ON50372820.35
YJL197W (UBP12)1.137ON1254264820.38
Kpol_2001.541.137ON122362820.38
TBLA0C012001.369ON50354810.40
CAGL0G02563gsingletonON631176810.41
KNAG0L022005.712ON1161301820.43
NDAI0F002005.712ON1105319810.44
TDEL0A016208.202ON79584810.45
YMR304W (UBP15)5.18ON123050810.45
Smik_13.5215.18ON123150810.45
KLTH0B09944g5.18ON118951810.47
Suva_13.4955.18ON123050810.50
Skud_13.4785.18ON123150810.53
SAKL0H18656g8.202ON772171800.56
YBR058C (UBP14)3.270ON78123800.58
NCAS0B042808.188ON92274800.59
TPHA0L022905.18ON119347800.62
Suva_4.2953.270ON782155800.68
Ecym_56715.18ON117662800.69
CAGL0I06765g8.188ON88771790.80
Ecym_55448.202ON83495790.81
Kpol_1024.448.540ON496449780.95
AFR627C1.137ON1287148781.1
SAKL0H18986g8.188ON89331781.1
TBLA0F036108.188ON114469781.2
Smik_11.3625.712ON721277781.2
Smik_10.371.137ON124742781.2
YER151C (UBP3)8.202ON912176771.3
TBLA0B019308.202ON101988771.3
TPHA0J026205.443ON122551771.5
SAKL0H00418g5.18ON119061771.5
Skud_5.2898.202ON910173771.6
TDEL0G004105.18ON118654771.6
Smik_2.1893.270ON78221761.7
Skud_11.3385.712ON712415761.8
ZYRO0C17908g1.137ON120444761.9
Suva_6.2761.137ON125642761.9
KLLA0E10275g8.188ON79659761.9
TDEL0C056401.137ON1178148761.9
KAFR0C004103.270ON76923762.0
CAGL0M13783g5.18ON119648762.1
AGL357W5.18ON116647752.5
YJL025W (RRN7)5.183ON514108752.5
TBLA0J006001.137ON1462323752.6
Kpol_534.231.369ON49618742.6
KAFR0B023708.202ON829219752.7
ZYRO0G01188g1.369ON50067742.7
Klac_YGOB_Anc_5.18b5.18ON116650743.1
Kwal_55.196455.712ON97050743.3
KAFR0F015601.137ON1171265743.3
KAFR0H001505.712ON656275743.4
NCAS0I031401.137ON120144743.4
Kwal_34.162681.369ON44924733.9
ZYRO0G06798g8.188ON877292734.3
TPHA0D043508.202ON85429734.3
TPHA0A025401.137ON1286133725.4
TDEL0B020805.712ON1025162725.5
SAKL0C04246g1.137ON129757725.8
KLLA0C03476g1.137ON125244726.3
AFR007W8.188ON848298716.9
Smik_5.3188.202ON909172717.5
KLTH0E00814g5.712ON974127718.0
ZYRO0F01276g3.270ON77618718.1
Ecym_81401.137ON126451718.5
KAFR0D050705.443ON122740708.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_27.11444
         (757 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_27.11444 s27 complement(802766..805039) [2274 bp, 757 aa] {...  1457   0.0  
KLTH0G10934g Chr7 (919304..921580) [2277 bp, 758 aa] {ON} simila...  1005   0.0  
TDEL0G02370 Chr7 (456393..458636) [2244 bp, 747 aa] {ON} Anc_2.3...   751   0.0  
Smik_4.115 Chr4 (219167..221539) [2373 bp, 790 aa] {ON} YDL122W ...   744   0.0  
Skud_4.133 Chr4 (238225..240588) [2364 bp, 787 aa] {ON} YDL122W ...   740   0.0  
Kpol_1003.53 s1003 (121699..124065) [2367 bp, 788 aa] {ON} (1216...   739   0.0  
YDL122W Chr4 (242552..244981) [2430 bp, 809 aa] {ON}  UBP1Ubiqui...   732   0.0  
Suva_4.125 Chr4 (231011..233392) [2382 bp, 793 aa] {ON} YDL122W ...   727   0.0  
CAGL0H10582g Chr8 complement(1029876..1032248) [2373 bp, 790 aa]...   712   0.0  
AGR389C Chr7 complement(1444377..1446704) [2328 bp, 775 aa] {ON}...   706   0.0  
ZYRO0A02420g Chr1 (190417..192654) [2238 bp, 745 aa] {ON} simila...   704   0.0  
TPHA0G00850 Chr7 (158945..161293) [2349 bp, 782 aa] {ON} Anc_2.3...   701   0.0  
KAFR0A06910 Chr1 complement(1393653..1395689) [2037 bp, 678 aa] ...   664   0.0  
SAKL0E07106g Chr5 complement(584164..586539) [2376 bp, 791 aa] {...   667   0.0  
NDAI0B03430 Chr2 complement(868578..871148) [2571 bp, 856 aa] {ON}    639   0.0  
KLLA0E08801g Chr5 (784991..787306) [2316 bp, 771 aa] {ON} simila...   620   0.0  
NCAS0B06130 Chr2 complement(1159264..1161576) [2313 bp, 770 aa] ...   580   0.0  
TBLA0B06080 Chr2 (1437254..1439728) [2475 bp, 824 aa] {ON} Anc_2...   555   0.0  
KNAG0A05450 Chr1 (806796..809090) [2295 bp, 764 aa] {ON} Anc_2.3...   486   e-161
TBLA0B07160 Chr2 complement(1696047..1697201) [1155 bp, 384 aa] ...   301   1e-94
NCAS0G03680 Chr7 complement(682617..684065) [1449 bp, 482 aa] {O...   152   9e-39
NDAI0G00780 Chr7 (164452..165912) [1461 bp, 486 aa] {ON}              140   1e-34
Ecym_1166 Chr1 (339106..341196) [2091 bp, 696 aa] {ON} similar t...    75   4e-13
AEL242W Chr5 (182610..184451) [1842 bp, 613 aa] {ON} Syntenic ho...    69   2e-11
SAKL0H10076g Chr8 (863358..865661) [2304 bp, 767 aa] {ON} simila...    60   1e-08
Kwal_27.12030 s27 complement(1056215..1058464) [2250 bp, 749 aa]...    59   3e-08
Suva_16.240 Chr16 (429066..430637) [1572 bp, 523 aa] {ON} YPL072...    59   3e-08
TBLA0H03600 Chr8 complement(877069..878517) [1449 bp, 482 aa] {O...    57   8e-08
AFR551W Chr6 (1427498..1428907) [1410 bp, 469 aa] {ON} Syntenic ...    55   4e-07
KLTH0E12540g Chr5 complement(1111576..1113834) [2259 bp, 752 aa]...    55   8e-07
KLLA0E23387g Chr5 complement(2079405..2081753) [2349 bp, 782 aa]...    53   2e-06
TPHA0L01670 Chr12 complement(351116..352690) [1575 bp, 524 aa] {...    52   3e-06
Kwal_14.2008 s14 (571638..572912) [1275 bp, 424 aa] {ON} YDR069C...    51   6e-06
Ecym_6248 Chr6 (468203..469603) [1401 bp, 466 aa] {ON} similar t...    48   8e-05
ZYRO0D03982g Chr4 (324687..327152) [2466 bp, 821 aa] {ON} weakly...    48   8e-05
YNL186W Chr14 (289498..291876) [2379 bp, 792 aa] {ON}  UBP10Ubiq...    48   9e-05
KAFR0E00930 Chr5 (198914..200410) [1497 bp, 498 aa] {ON} Anc_8.5...    47   1e-04
Smik_13.431 Chr13 (700800..702215) [1416 bp, 471 aa] {ON} YMR223...    47   1e-04
KLTH0H07678g Chr8 (677217..679802) [2586 bp, 861 aa] {ON} simila...    47   1e-04
Suva_13.407 Chr13 (697513..698928) [1416 bp, 471 aa] {ON} YMR223...    47   2e-04
Skud_13.392 Chr13 (690758..692179) [1422 bp, 473 aa] {ON} YMR223...    46   2e-04
TBLA0B09760 Chr2 complement(2316180..2318876) [2697 bp, 898 aa] ...    47   3e-04
SAKL0E13002g Chr5 complement(1070150..1072369) [2220 bp, 739 aa]...    46   3e-04
KLTH0B07150g Chr2 complement(574195..576465) [2271 bp, 756 aa] {...    46   3e-04
Suva_14.156 Chr14 (285613..287979) [2367 bp, 788 aa] {ON} YNL186...    46   4e-04
Kwal_33.14430 s33 (669559..671094) [1536 bp, 511 aa] {ON} YNL186...    45   4e-04
Kpol_1044.24 s1044 (56564..58738) [2175 bp, 724 aa] {ON} (56564....    45   5e-04
NDAI0F03410 Chr6 complement(820002..822614) [2613 bp, 870 aa] {O...    45   6e-04
NCAS0C02110 Chr3 (398702..400186) [1485 bp, 494 aa] {ON} Anc_8.5...    45   6e-04
ZYRO0G01606g Chr7 complement(123893..127810) [3918 bp, 1305 aa] ...    45   7e-04
KAFR0L01730 Chr12 (316860..318965) [2106 bp, 701 aa] {ON} Anc_7....    45   7e-04
YBL067C Chr2 complement(93639..95882) [2244 bp, 747 aa] {ON}  UB...    45   8e-04
TDEL0B03060 Chr2 (545366..547570) [2205 bp, 734 aa] {ON} Anc_8.5...    45   8e-04
Kwal_26.9151 s26 complement(1095026..1096390) [1365 bp, 454 aa] ...    44   8e-04
YMR223W Chr13 (716715..718130) [1416 bp, 471 aa] {ON}  UBP8Ubiqu...    44   0.001
Skud_14.148 Chr14 (278827..281157) [2331 bp, 776 aa] {ON} YNL186...    45   0.001
NCAS0G01800 Chr7 (319652..322279) [2628 bp, 875 aa] {ON} Anc_2.69      45   0.001
KLLA0D08459g Chr4 complement(718046..720298) [2253 bp, 750 aa] {...    44   0.001
NDAI0C05900 Chr3 complement(1350639..1353119) [2481 bp, 826 aa] ...    44   0.001
Skud_15.286 Chr15 complement(511346..515182) [3837 bp, 1278 aa] ...    44   0.001
Smik_16.163 Chr16 (301703..303208) [1506 bp, 501 aa] {ON} YPL072...    44   0.001
ZYRO0A05962g Chr1 complement(474545..475942) [1398 bp, 465 aa] {...    44   0.001
ZYRO0C09812g Chr3 complement(743861..745969) [2109 bp, 702 aa] {...    44   0.002
YOR124C Chr15 complement(554824..558642) [3819 bp, 1272 aa] {ON}...    44   0.002
Suva_2.228 Chr2 complement(385322..388105) [2784 bp, 927 aa] {ON...    44   0.002
Smik_15.301 Chr15 complement(515941..519759) [3819 bp, 1272 aa] ...    44   0.002
KAFR0A07580 Chr1 complement(1528362..1530770) [2409 bp, 802 aa] ...    43   0.002
NDAI0E00810 Chr5 complement(163826..165307) [1482 bp, 493 aa] {O...    43   0.003
KNAG0F01220 Chr6 (219798..222152) [2355 bp, 784 aa] {ON} Anc_2.6...    43   0.003
TPHA0O01640 Chr15 complement(325844..328084) [2241 bp, 746 aa] {...    43   0.003
Suva_8.176 Chr8 complement(312595..316407) [3813 bp, 1270 aa] {O...    43   0.003
Kpol_1062.23 s1062 (51365..55165) [3801 bp, 1266 aa] {ON} (51365...    43   0.003
Kpol_513.25 s513 (71125..74697) [3573 bp, 1190 aa] {ON} (71125.....    43   0.004
CAGL0J11352g Chr10 complement(1103473..1105788) [2316 bp, 771 aa...    43   0.004
TDEL0A01100 Chr1 (186399..188384) [1986 bp, 661 aa] {ON} Anc_2.6...    42   0.004
CAGL0M11198g Chr13 (1102767..1104152) [1386 bp, 461 aa] {ON} sim...    42   0.004
KNAG0A01970 Chr1 (157670..159085) [1416 bp, 471 aa] {ON} Anc_8.5...    42   0.004
NDAI0E04180 Chr5 complement(941527..944010) [2484 bp, 827 aa] {O...    42   0.004
TDEL0D02580 Chr4 (493355..497173) [3819 bp, 1272 aa] {ON} Anc_5....    42   0.005
YPL072W Chr16 (418512..420011) [1500 bp, 499 aa] {ON}  UBP16Deub...    42   0.005
KNAG0B04190 Chr2 (795803..799591) [3789 bp, 1262 aa] {ON} Anc_5....    42   0.005
KAFR0A04210 Chr1 (843659..844981) [1323 bp, 440 aa] {ON} Anc_8.7...    42   0.006
Skud_4.323 Chr4 complement(560596..563376) [2781 bp, 926 aa] {ON...    42   0.006
NCAS0A03910 Chr1 (791578..793965) [2388 bp, 795 aa] {ON} Anc_8.188     42   0.007
Smik_5.309 Chr5 complement(462971..465388) [2418 bp, 805 aa] {ON...    42   0.007
Kpol_1032.28 s1032 complement(57514..60162) [2649 bp, 882 aa] {O...    42   0.007
Ecym_4514 Chr4 complement(1025172..1028912) [3741 bp, 1246 aa] {...    42   0.007
TBLA0A06470 Chr1 (1588461..1592423) [3963 bp, 1320 aa] {ON} Anc_...    42   0.008
Smik_14.144 Chr14 (268784..271075) [2292 bp, 763 aa] {ON} YNL186...    42   0.008
NCAS0H02100 Chr8 complement(406897..410706) [3810 bp, 1269 aa] {...    42   0.008
NCAS0B00580 Chr2 (86690..88090) [1401 bp, 466 aa] {ON} Anc_8.742       41   0.009
CAGL0A04477g Chr1 (442089..444401) [2313 bp, 770 aa] {ON} simila...    41   0.009
Kpol_1018.93 s1018 (248094..250361) [2268 bp, 755 aa] {ON} (2480...    41   0.010
Suva_2.50 Chr2 complement(90700..92952) [2253 bp, 750 aa] {ON} Y...    41   0.010
SAKL0H04994g Chr8 complement(445232..446596) [1365 bp, 454 aa] {...    41   0.010
Kwal_14.1957 s14 (549510..550844) [1335 bp, 444 aa] {ON} YER151C...    41   0.011
TDEL0B03670 Chr2 complement(656511..657902) [1392 bp, 463 aa] {O...    40   0.015
CAGL0H05335g Chr8 complement(512683..514134) [1452 bp, 483 aa] {...    40   0.020
KNAG0G02930 Chr7 (644555..645934) [1380 bp, 459 aa] {ON} Anc_8.7...    40   0.022
CAGL0L01639g Chr12 (178104..181547) [3444 bp, 1147 aa] {ON} simi...    40   0.022
ABL145W Chr2 (124839..127088) [2250 bp, 749 aa] {ON} Syntenic ho...    40   0.026
SAKL0G02728g Chr7 complement(223607..227320) [3714 bp, 1237 aa] ...    40   0.026
NDAI0E02820 Chr5 (598119..599606) [1488 bp, 495 aa] {ON} Anc_8.5...    40   0.027
Kwal_55.21393 s55 (816177..819878) [3702 bp, 1233 aa] {ON} YOR12...    40   0.027
Skud_10.22 Chr10 (38735..42502) [3768 bp, 1255 aa] {ON} YJL197W ...    40   0.029
NDAI0C01550 Chr3 (327953..331840) [3888 bp, 1295 aa] {ON} Anc_5....    40   0.030
TBLA0D00620 Chr4 complement(159706..163221) [3516 bp, 1171 aa] {...    40   0.031
TPHA0C02770 Chr3 (604690..607602) [2913 bp, 970 aa] {ON} Anc_8.1...    40   0.034
TBLA0D01070 Chr4 complement(275843..277294) [1452 bp, 483 aa] {O...    39   0.038
KNAG0D01930 Chr4 (324705..327665) [2961 bp, 986 aa] {ON} Anc_8.1...    39   0.038
TPHA0P00680 Chr16 (139640..141823) [2184 bp, 727 aa] {ON} Anc_7....    39   0.044
Skud_2.38 Chr2 complement(77293..79539) [2247 bp, 748 aa] {ON} Y...    39   0.047
Smik_2.49 Chr2 complement(87575..89812) [2238 bp, 745 aa] {ON} Y...    39   0.050
KNAG0C03580 Chr3 complement(699604..701934) [2331 bp, 776 aa] {O...    39   0.052
Kpol_1064.48 s1064 (88495..89895) [1401 bp, 466 aa] {ON} (88495....    39   0.053
ACL164C Chr3 complement(67792..71961) [4170 bp, 1389 aa] {ON} Sy...    39   0.057
YDR069C Chr4 complement(584939..587719) [2781 bp, 926 aa] {ON}  ...    39   0.062
Suva_5.272 Chr5 complement(429119..431485) [2367 bp, 788 aa] {ON...    39   0.068
KLTH0H07370g Chr8 (655985..658330) [2346 bp, 781 aa] {ON} some s...    39   0.070
KLTH0D12760g Chr4 (1045108..1046469) [1362 bp, 453 aa] {ON} simi...    38   0.073
ZYRO0D07062g Chr4 complement(609322..612903) [3582 bp, 1193 aa] ...    39   0.081
KNAG0B02370 Chr2 complement(463599..465860) [2262 bp, 753 aa] {O...    38   0.081
Smik_4.307 Chr4 complement(551719..554508) [2790 bp, 929 aa] {ON...    39   0.083
CAGL0H06721g Chr8 complement(667816..671061) [3246 bp, 1081 aa] ...    38   0.090
KLTH0F15862g Chr6 (1288742..1292467) [3726 bp, 1241 aa] {ON} sim...    38   0.092
KLLA0E02377g Chr5 complement(218647..222309) [3663 bp, 1220 aa] ...    38   0.093
CAGL0G05247g Chr7 complement(491024..493867) [2844 bp, 947 aa] {...    38   0.10 
NDAI0A03680 Chr1 (837931..841281) [3351 bp, 1116 aa] {ON}              38   0.10 
TPHA0D04660 Chr4 complement(1017401..1020538) [3138 bp, 1045 aa]...    38   0.11 
NDAI0I02530 Chr9 (584472..588065) [3594 bp, 1197 aa] {ON} Anc_5....    38   0.12 
NCAS0A14370 Chr1 (2830136..2832325) [2190 bp, 729 aa] {ON} Anc_7...    38   0.13 
KLLA0C06974g Chr3 complement(604344..605684) [1341 bp, 446 aa] {...    37   0.14 
KAFR0I02600 Chr9 (525365..529006) [3642 bp, 1213 aa] {ON} Anc_5....    37   0.15 
TPHA0E01710 Chr5 (343977..347828) [3852 bp, 1283 aa] {ON} Anc_5....    37   0.15 
AGR139C Chr7 complement(1010460..1012829) [2370 bp, 789 aa] {ON}...    37   0.16 
TDEL0B04560 Chr2 (808779..816791) [8013 bp, 2670 aa] {ON} Anc_8....    37   0.16 
TPHA0G00560 Chr7 complement(105403..106794) [1392 bp, 463 aa] {O...    37   0.17 
Skud_5.281 Chr5 complement(448432..450903) [2472 bp, 823 aa] {ON...    37   0.18 
CAGL0I06600g Chr9 (639096..641546) [2451 bp, 816 aa] {ON} simila...    37   0.18 
TBLA0C07020 Chr3 (1694706..1698449) [3744 bp, 1247 aa] {ON} Anc_...    37   0.19 
KAFR0C02590 Chr3 complement(503330..506266) [2937 bp, 978 aa] {O...    37   0.21 
SAKL0E15136g Chr5 complement(1258870..1261983) [3114 bp, 1037 aa...    37   0.22 
TDEL0C01570 Chr3 complement(269169..271466) [2298 bp, 765 aa] {O...    37   0.25 
Skud_2.177 Chr2 complement(322000..324348) [2349 bp, 782 aa] {ON...    37   0.26 
NCAS0D02390 Chr4 complement(451930..455565) [3636 bp, 1211 aa] {...    37   0.27 
YER144C Chr5 complement(457806..460223) [2418 bp, 805 aa] {ON}  ...    37   0.27 
Kpol_1045.41 s1045 complement(95233..97371) [2139 bp, 712 aa] {O...    37   0.30 
Ecym_4685 Chr4 complement(1332993..1335329) [2337 bp, 778 aa] {O...    37   0.30 
ZYRO0B03300g Chr2 (273903..276344) [2442 bp, 813 aa] {ON} simila...    37   0.31 
AGR370W Chr7 (1416579..1418801) [2223 bp, 740 aa] {ON} Syntenic ...    36   0.33 
TDEL0B04220 Chr2 (747864..750341) [2478 bp, 825 aa] {ON} Anc_8.1...    36   0.34 
Ecym_6184 Chr6 (341652..344207) [2556 bp, 851 aa] {ON} similar t...    36   0.35 
Skud_16.209 Chr16 (389855..391366) [1512 bp, 503 aa] {ON} YPL072...    36   0.35 
YJL197W Chr10 (63805..67569) [3765 bp, 1254 aa] {ON}  UBP12Ubiqu...    36   0.38 
Kpol_2001.54 s2001 complement(144924..148595) [3672 bp, 1223 aa]...    36   0.38 
TBLA0C01200 Chr3 complement(258492..259981,260188..260209) [1512...    36   0.40 
CAGL0G02563g Chr7 complement(235498..237393) [1896 bp, 631 aa] {...    36   0.41 
KNAG0L02200 Chr12 complement(394140..397625) [3486 bp, 1161 aa] ...    36   0.43 
NDAI0F00200 Chr6 (35966..39283) [3318 bp, 1105 aa] {ON} Anc_5.712      36   0.44 
TDEL0A01620 Chr1 (291670..294057) [2388 bp, 795 aa] {ON} Anc_8.2...    36   0.45 
YMR304W Chr13 (874987..878679) [3693 bp, 1230 aa] {ON}  UBP15Ubi...    36   0.45 
Smik_13.521 Chr13 (857682..861377) [3696 bp, 1231 aa] {ON} YMR30...    36   0.45 
KLTH0B09944g Chr2 complement(826050..829619) [3570 bp, 1189 aa] ...    36   0.47 
Suva_13.495 Chr13 (857778..861470) [3693 bp, 1230 aa] {ON} YMR30...    36   0.50 
Skud_13.478 Chr13 (848446..852141) [3696 bp, 1231 aa] {ON} YMR30...    36   0.53 
SAKL0H18656g Chr8 (1658629..1660947) [2319 bp, 772 aa] {ON} some...    35   0.56 
YBR058C Chr2 complement(353672..356017) [2346 bp, 781 aa] {ON}  ...    35   0.58 
NCAS0B04280 Chr2 (777104..779872) [2769 bp, 922 aa] {ON} Anc_8.188     35   0.59 
TPHA0L02290 Chr12 (479360..482941) [3582 bp, 1193 aa] {ON} Anc_5...    35   0.62 
Suva_4.295 Chr4 complement(520439..522787) [2349 bp, 782 aa] {ON...    35   0.68 
Ecym_5671 Chr5 complement(1362706..1366236) [3531 bp, 1176 aa] {...    35   0.69 
CAGL0I06765g Chr9 (655806..658469) [2664 bp, 887 aa] {ON} simila...    35   0.80 
Ecym_5544 Chr5 (1102256..1104760) [2505 bp, 834 aa] {ON} similar...    35   0.81 
Kpol_1024.44 s1024 (118060..119550) [1491 bp, 496 aa] {ON} (1180...    35   0.95 
AFR627C Chr6 complement(1572814..1576677) [3864 bp, 1287 aa] {ON...    35   1.1  
SAKL0H18986g Chr8 (1683752..1686433) [2682 bp, 893 aa] {ON} simi...    35   1.1  
TBLA0F03610 Chr6 (890140..893574) [3435 bp, 1144 aa] {ON} Anc_8....    35   1.2  
Smik_11.362 Chr11 complement(623098..625263) [2166 bp, 721 aa] {...    35   1.2  
Smik_10.37 Chr10 (61787..65530) [3744 bp, 1247 aa] {ON} YJL197W ...    35   1.2  
YER151C Chr5 complement(469686..472424) [2739 bp, 912 aa] {ON}  ...    34   1.3  
TBLA0B01930 Chr2 (439859..442918) [3060 bp, 1019 aa] {ON} Anc_8....    34   1.3  
TPHA0J02620 Chr10 complement(580898..584575) [3678 bp, 1225 aa] ...    34   1.5  
SAKL0H00418g Chr8 (50575..54147) [3573 bp, 1190 aa] {ON} similar...    34   1.5  
Skud_5.289 Chr5 complement(460660..463392) [2733 bp, 910 aa] {ON...    34   1.6  
TDEL0G00410 Chr7 complement(82945..86505) [3561 bp, 1186 aa] {ON...    34   1.6  
Smik_2.189 Chr2 complement(335612..337960) [2349 bp, 782 aa] {ON...    34   1.7  
Skud_11.338 Chr11 complement(614651..616789) [2139 bp, 712 aa] {...    34   1.8  
ZYRO0C17908g Chr3 complement(1393864..1397478) [3615 bp, 1204 aa...    34   1.9  
Suva_6.276 Chr6 complement(481843..485613) [3771 bp, 1256 aa] {O...    34   1.9  
KLLA0E10275g Chr5 (906675..909065) [2391 bp, 796 aa] {ON} simila...    34   1.9  
TDEL0C05640 Chr3 complement(1005536..1009072) [3537 bp, 1178 aa]...    34   1.9  
KAFR0C00410 Chr3 complement(85302..87611) [2310 bp, 769 aa] {ON}...    34   2.0  
CAGL0M13783g Chr13 (1354198..1357788) [3591 bp, 1196 aa] {ON} si...    34   2.1  
AGL357W Chr7 (33383..36883) [3501 bp, 1166 aa] {ON} Syntenic hom...    33   2.5  
YJL025W Chr10 (393967..395511) [1545 bp, 514 aa] {ON}  RRN7Compo...    33   2.5  
TBLA0J00600 Chr10 (129182..133570) [4389 bp, 1462 aa] {ON} Anc_1...    33   2.6  
Kpol_534.23 s534 (53632..53653,53786..55254) [1491 bp, 496 aa] {...    33   2.6  
KAFR0B02370 Chr2 complement(460558..463047) [2490 bp, 829 aa] {O...    33   2.7  
ZYRO0G01188g Chr7 (95655..95676,95759..97239) [1503 bp, 500 aa] ...    33   2.7  
Klac_YGOB_Anc_5.18b Chr3 (1201452..1202573,1202576..1204954) [35...    33   3.1  
Kwal_55.19645 s55 (62575..65487) [2913 bp, 970 aa] {ON} YIL156W ...    33   3.3  
KAFR0F01560 Chr6 (310936..314451) [3516 bp, 1171 aa] {ON} Anc_1....    33   3.3  
KAFR0H00150 Chr8 (14149..16119) [1971 bp, 656 aa] {ON} Anc_5.712...    33   3.4  
NCAS0I03140 Chr9 complement(576993..580598) [3606 bp, 1201 aa] {...    33   3.4  
Kwal_34.16268 s34 (268814..270163) [1350 bp, 449 aa] {ON} YFR010...    33   3.9  
ZYRO0G06798g Chr7 (544095..546728) [2634 bp, 877 aa] {ON} some s...    33   4.3  
TPHA0D04350 Chr4 complement(934597..937161) [2565 bp, 854 aa] {O...    33   4.3  
TPHA0A02540 Chr1 (543606..547466) [3861 bp, 1286 aa] {ON} Anc_1....    32   5.4  
TDEL0B02080 Chr2 (369534..372611) [3078 bp, 1025 aa] {ON} Anc_5....    32   5.5  
SAKL0C04246g Chr3 (412865..416758) [3894 bp, 1297 aa] {ON} simil...    32   5.8  
KLLA0C03476g Chr3 (314815..318573) [3759 bp, 1252 aa] {ON} simil...    32   6.3  
AFR007W Chr6 (448632..451178) [2547 bp, 848 aa] {ON} Syntenic ho...    32   6.9  
Smik_5.318 Chr5 complement(474889..477618) [2730 bp, 909 aa] {ON...    32   7.5  
KLTH0E00814g Chr5 (80059..82983) [2925 bp, 974 aa] {ON} similar ...    32   8.0  
ZYRO0F01276g Chr6 (102883..105213) [2331 bp, 776 aa] {ON} simila...    32   8.1  
Ecym_8140 Chr8 complement(295730..299524) [3795 bp, 1264 aa] {ON...    32   8.5  
KAFR0D05070 Chr4 complement(996195..999878) [3684 bp, 1227 aa] {...    32   8.9  

>Kwal_27.11444 s27 complement(802766..805039) [2274 bp, 757 aa] {ON}
           YDL122W (UBP1) - Ubiquitin-specific protease [contig 27]
           FULL
          Length = 757

 Score = 1457 bits (3771), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 714/757 (94%), Positives = 714/757 (94%)

Query: 1   MDLARERLSAVFTILSLFIKNLNIDHKSPTFLVIVASTGLLIYKNRRYIRNIMDALGTVG 60
           MDLARERLSAVFTILSLFIKNLNIDHKSPTFLVIVASTGLLIYKNRRYIRNIMDALGTVG
Sbjct: 1   MDLARERLSAVFTILSLFIKNLNIDHKSPTFLVIVASTGLLIYKNRRYIRNIMDALGTVG 60

Query: 61  GDLTRGFRNSYKGSVFNKWGSRNPAQEATMLKRGGYVGGLINDGNTCFMNSVIQSLASSK 120
           GDLTRGFRNSYKGSVFNKWGSRNPAQEATMLKRGGYVGGLINDGNTCFMNSVIQSLASSK
Sbjct: 61  GDLTRGFRNSYKGSVFNKWGSRNPAQEATMLKRGGYVGGLINDGNTCFMNSVIQSLASSK 120

Query: 121 SLMQFLDEELMEASKELENPNETSSAVEEEGNLGSNSELRNRSSSKKTYGKRKKRLTRNA 180
           SLMQFLDEELMEASKELENPNETSSAVEEEGNLGSNSELRNRSSSKKTYGKRKKRLTRNA
Sbjct: 121 SLMQFLDEELMEASKELENPNETSSAVEEEGNLGSNSELRNRSSSKKTYGKRKKRLTRNA 180

Query: 181 EKDAALEDEGVNMEFSAALKELLEKLNDKYHRDKPYFKTNKLLKTMSKAPNKNIILGYDQ 240
           EKDAALEDEGVNMEFSAALKELLEKLNDKYHRDKPYFKTNKLLKTMSKAPNKNIILGYDQ
Sbjct: 181 EKDAALEDEGVNMEFSAALKELLEKLNDKYHRDKPYFKTNKLLKTMSKAPNKNIILGYDQ 240

Query: 241 EDAQEFFQTILSELEKNIKSLRGKSDKDNEPTELADIPKNAMIGQERLGEMGTVYLPAEQ 300
           EDAQEFFQTILSELEKNIKSLRGKSDKDNEPTELADIPKNAMIGQERLGEMGTVYLPAEQ
Sbjct: 241 EDAQEFFQTILSELEKNIKSLRGKSDKDNEPTELADIPKNAMIGQERLGEMGTVYLPAEQ 300

Query: 301 IDPNCVLGHEAKQLFFPFDLVTPLDGITAERIGCLQCGENGGIRYSVFSGLSLNLPSDTV 360
           IDPNCVLGHEAKQLFFPFDLVTPLDGITAERIGCLQCGENGGIRYSVFSGLSLNLPSDTV
Sbjct: 301 IDPNCVLGHEAKQLFFPFDLVTPLDGITAERIGCLQCGENGGIRYSVFSGLSLNLPSDTV 360

Query: 361 GSALKLSQLLREWVKPEIIEGVECNRCALKAVLEHLEKTLTQYEINDKVSEKLVSAVSSR 420
           GSALKLSQLLREWVKPEIIEGVECNRCALKAVLEHLEKTLTQYEINDKVSEKLVSAVSSR
Sbjct: 361 GSALKLSQLLREWVKPEIIEGVECNRCALKAVLEHLEKTLTQYEINDKVSEKLVSAVSSR 420

Query: 421 VEELKAILAKPVVDDDDYKKLHTENMVRKCSKSKQILISRPPPLLSIHINRSVFDPRTYT 480
           VEELKAILAKPVVDDDDYKKLHTENMVRKCSKSKQILISRPPPLLSIHINRSVFDPRTYT
Sbjct: 421 VEELKAILAKPVVDDDDYKKLHTENMVRKCSKSKQILISRPPPLLSIHINRSVFDPRTYT 480

Query: 481 IRKNNSKVLFKSRLNLAPWSCGPDEINLDARLPMSKKDQRAMESSEDENIGGEYFAKLHR 540
           IRKNNSKVLFKSRLNLAPWSCGPDEINLDARLPMSKKDQRAMESSEDENIGGEYFAKLHR
Sbjct: 481 IRKNNSKVLFKSRLNLAPWSCGPDEINLDARLPMSKKDQRAMESSEDENIGGEYFAKLHR 540

Query: 541 RXXXXXXXXXXXXXNYSEKNRLNSDYDPLKGELXXXXXXXXXXXXXXXXXXLGNRVFKCK 600
           R             NYSEKNRLNSDYDPLKGEL                  LGNRVFKCK
Sbjct: 541 RFEEEFEDSDEESDNYSEKNRLNSDYDPLKGELDSSSEDDEYSEGEYEIDSLGNRVFKCK 600

Query: 601 NIQSDSDVNSVEEASEEDKPDTNDLENREITGGVGQENXXXXXXXXXXXXTQPTELNPLS 660
           NIQSDSDVNSVEEASEEDKPDTNDLENREITGGVGQEN            TQPTELNPLS
Sbjct: 601 NIQSDSDVNSVEEASEEDKPDTNDLENREITGGVGQENSDSEVESEDEVETQPTELNPLS 660

Query: 661 AGQLAPSSSTVPSGPLTYALRSVIVHYGSHNYGHYIAFRKFRGLWWRISDETVYVVDEAE 720
           AGQLAPSSSTVPSGPLTYALRSVIVHYGSHNYGHYIAFRKFRGLWWRISDETVYVVDEAE
Sbjct: 661 AGQLAPSSSTVPSGPLTYALRSVIVHYGSHNYGHYIAFRKFRGLWWRISDETVYVVDEAE 720

Query: 721 VLSTPGVFMLFYEHDYNQTLQKMNDDLEWEEQEEGIN 757
           VLSTPGVFMLFYEHDYNQTLQKMNDDLEWEEQEEGIN
Sbjct: 721 VLSTPGVFMLFYEHDYNQTLQKMNDDLEWEEQEEGIN 757

>KLTH0G10934g Chr7 (919304..921580) [2277 bp, 758 aa] {ON} similar
           to uniprot|P25037 Saccharomyces cerevisiae YDL122W UBP1
           Ubiquitin-specific protease that removes ubiquitin from
           ubiquitinated proteins cleaves at the C terminus of
           ubiquitin fusions irrespective of their size capable of
           cleaving polyubiquitin chains
          Length = 758

 Score = 1005 bits (2598), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 504/753 (66%), Positives = 592/753 (78%), Gaps = 11/753 (1%)

Query: 1   MDLARERLSAVFTILSLFIKNL-NIDHKSPTFLVIVASTGLLIYKNRRYIRNIMDALGTV 59
           M+   E+LSA+F+ LS+F++NL +ID+KS T +V++ASTG+L+YKN+R  RNIM+ +GTV
Sbjct: 1   MNFVLEKLSALFSTLSIFVRNLSHIDNKSSTLIVLIASTGILLYKNKRIFRNIMENIGTV 60

Query: 60  GGDLTRGFRNSYKGSVFNKWGSRNPAQEATMLKRGGYVGGLINDGNTCFMNSVIQSLASS 119
           GGDLTR FRN+YKGS+FNKWGS++P QEA MLKRGGYVGGL+NDGNTCFMNSV+QSLASS
Sbjct: 61  GGDLTRSFRNNYKGSMFNKWGSKDPEQEAAMLKRGGYVGGLVNDGNTCFMNSVLQSLASS 120

Query: 120 KSLMQFLDEELMEASKELENPNETSSAVEEEGNLGSNSELRNRSSSKKTYGKRKKRLTRN 179
           K+L+QFLD E+++A KE E   +   A +E  +    SE + +   K   GKRKKRLTRN
Sbjct: 121 KTLLQFLDNEVIQAYKEAEESEDEHVAEKEFESEKKLSESKTKPKKKVY-GKRKKRLTRN 179

Query: 180 AEKDAALEDEGVNMEFSAALKELLEKLNDKYHRDKPYFKTNKLLKTMSKAPNKNIILGYD 239
           AEKDA  +D+  N+EFS  LKELL KLN K++RD+PYFKTNKLLKTMSKAPNK+IILGYD
Sbjct: 180 AEKDALDDDQDANIEFSTTLKELLNKLNAKHYRDRPYFKTNKLLKTMSKAPNKSIILGYD 239

Query: 240 QEDAQEFFQTILSELEKNIKSLRGKSDKDNE-PTELADIPKNAMIGQERLGEMGTVYLPA 298
           QEDAQEFFQTILSELEKN+KSL GKS KD E P +   +P+++M+GQERLGEMGTVY+P 
Sbjct: 240 QEDAQEFFQTILSELEKNVKSLYGKSSKDEEAPVQFDQLPEDSMVGQERLGEMGTVYIPT 299

Query: 299 EQIDPNCVLGHEAKQLFFPFDLVTPLDGITAERIGCLQCGENGGIRYSVFSGLSLNLPSD 358
           EQIDPNCVL HE K L+ PF L+TPLDG+TAERIGCLQCGENGGIRYSVFSGLSLNLPS+
Sbjct: 300 EQIDPNCVLAHENKSLYSPFKLITPLDGLTAERIGCLQCGENGGIRYSVFSGLSLNLPSE 359

Query: 359 TVGSALKLSQLLREWVKPEIIEGVECNRCALKAVLEHLEKTLTQYEINDKVSEKLVSAVS 418
            +GS LKLS+LLREW+KPEIIEGVECNRCAL AVLEHLEKTL QYE ++  SEKLV+AV 
Sbjct: 360 NLGSTLKLSELLREWIKPEIIEGVECNRCALNAVLEHLEKTLIQYEGSEHSSEKLVAAVK 419

Query: 419 SRVEELKAILAKPVVDDDDYKKLHTENMVRKCSKSKQILISRPPPLLSIHINRSVFDPRT 478
           +RVE+LK ILAKP +DDDDYKKLHTENMVRKCSKSKQI+ISRPPPLL IHINRSVFDPRT
Sbjct: 420 ARVEQLKDILAKPAIDDDDYKKLHTENMVRKCSKSKQIIISRPPPLLCIHINRSVFDPRT 479

Query: 479 YTIRKNNSKVLFKSRLNLAPWSCGPDEINLDARLPMSKKDQRAMESSEDENIGGEYFAKL 538
           Y IRKNNS+VLFKS+LNLAPW C PDEINLDARLPMSKK+Q+++ESSEDEN+GGEYFAKL
Sbjct: 480 YMIRKNNSRVLFKSKLNLAPWCCAPDEINLDARLPMSKKEQKSLESSEDENVGGEYFAKL 539

Query: 539 HRRXXXXXXXXXXXXXNYSEKNRLNSDYDPLKGELXXXXXXXXXXXX-XXXXXXLGNRVF 597
           HR              N+   NR  SDYDPL+GE+                   LGNRVF
Sbjct: 540 HRHFEEEFEDSEEEEGNFEASNRDVSDYDPLRGEIESSSDENESSSDGEYEVDALGNRVF 599

Query: 598 KCKNIQSDSDVNSVEEASEEDKPDTNDLENREIT---GGVGQENXXXXXXXXXXXXTQPT 654
           K    Q++ ++  V+  S +  P+   LE  +      G+  E              +  
Sbjct: 600 KQNGAQTEQEL--VDGTSAD--PEVASLEGSDAAERLDGIEPETLDNEDEEDSESDHEVK 655

Query: 655 ELNPLSAGQLAPSSSTVPSGPLTYALRSVIVHYGSHNYGHYIAFRKFRGLWWRISDETVY 714
           +   LS+   APSSSTVP GPLTYALRSVIVHYG+HNYGHYIAFRKFRGLWWRISDETVY
Sbjct: 656 QPPSLSSLHHAPSSSTVPVGPLTYALRSVIVHYGTHNYGHYIAFRKFRGLWWRISDETVY 715

Query: 715 VVDEAEVLSTPGVFMLFYEHDYNQTLQKMNDDL 747
           VVDEAEVLSTPG+FMLFYEHDYN++L  MNDDL
Sbjct: 716 VVDEAEVLSTPGIFMLFYEHDYNESLHAMNDDL 748

>TDEL0G02370 Chr7 (456393..458636) [2244 bp, 747 aa] {ON} Anc_2.307
           YDL122W
          Length = 747

 Score =  751 bits (1940), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 404/747 (54%), Positives = 493/747 (65%), Gaps = 30/747 (4%)

Query: 14  ILSLFIKNLNIDHKSP---TFLVIVASTGLLIYKNRRYIRNIMDALGTVGGDLTRGFRNS 70
           I+S  I+ LN +  S    T  +I+ ST     K + +I N +  +G    D+TR F N 
Sbjct: 12  IISFIIEPLNRNTNSEVPITTAIILVSTAFFFIKYKSFIMNNLSHIG----DMTRNF-NP 66

Query: 71  YKGSVFNKWGSRNPAQEATMLKRGGYVGGLINDGNTCFMNSVIQSLASSKSLMQFLDEEL 130
             G  F +W  R    +   L +GGYV GL+NDGNTCFMNSVIQSLASS  LM+FLD+E+
Sbjct: 67  TNG--FRRWMPRGGQVDQHTLDKGGYVAGLVNDGNTCFMNSVIQSLASSAELMKFLDDEI 124

Query: 131 MEASKELENPNETSSAVEEEGNLGSNSELRNRSSSKKTYGKRKKRLTRNAEKDAALEDEG 190
            +     E  +ET    +EE       +   R    K+YGK KK   R      + E++ 
Sbjct: 125 AKK----EEIDETELLQDEEKPTSVEPDTIERKVKGKSYGKAKKHANRKLANGVSDEEKT 180

Query: 191 VNMEFSAALKELLEKLNDKYHRDKPYFKTNKLLKTMSKAPNKNIILGYDQEDAQEFFQTI 250
            ++ FS AL+E+L KLN KY++++P FKTNKLLK+M+K+PNKNIILGYDQEDAQEFFQTI
Sbjct: 181 PDVTFSLALREMLNKLNTKYYKERPCFKTNKLLKSMTKSPNKNIILGYDQEDAQEFFQTI 240

Query: 251 LSELEKNIKSLRGKSDKDNEPTELADIPKNAMIGQERLGEMGTVYLPAEQIDPNCVLGHE 310
           LSELEKN+KSL GK   +  P   A++PKNA+IGQ  L ++G VYLP++QIDPN VL +E
Sbjct: 241 LSELEKNVKSLEGKP-SEATPIPNAELPKNAVIGQAHLDKVGDVYLPSDQIDPNLVLTNE 299

Query: 311 AKQLFFPFDLVTPLDGITAERIGCLQCGENGGIRYSVFSGLSLNLPSDTVGSALKLSQLL 370
            KQL+ PF LVTPLDGITAERIGCLQCGENGGIRYSV S +SLNLPS+ +GS LKLS LL
Sbjct: 300 GKQLYTPFRLVTPLDGITAERIGCLQCGENGGIRYSVTSSMSLNLPSEDIGSTLKLSDLL 359

Query: 371 REWVKPEIIEGVECNRCALKAVLEHLEKTLTQYE-INDKVSEKLVSAVSSRVEELKAILA 429
            +W+KPEIIEGV CNRCAL+AV +HL + L QYE   D + EKL+ A  +RVEEL   L+
Sbjct: 360 NQWIKPEIIEGVSCNRCALEAVRDHLLEQLKQYENKGDSIPEKLLQAFKARVEELNVSLS 419

Query: 430 KPVVDDDDYKKLHTENMVRKCSKSKQILISRPPPLLSIHINRSVFDPRTYTIRKNNSKVL 489
           KP+V D+DYK+LHTENM RKCSKSKQIL  RPPPLLSIHINRSVFDPRTY IRKNNS+VL
Sbjct: 420 KPMVSDEDYKRLHTENMTRKCSKSKQILFLRPPPLLSIHINRSVFDPRTYMIRKNNSRVL 479

Query: 490 FKSRLNLAPWSCGPDEINLDARLPMSKKDQRAMESSEDENIGGEYFAKLHRRXXXXXXXX 549
           FKSRLNL+PW C  DEINLDARLPMSKK ++  ESSEDEN+GGEY+AKLH+         
Sbjct: 480 FKSRLNLSPWCCDVDEINLDARLPMSKKQEQVQESSEDENLGGEYYAKLHQTYEKEFEDS 539

Query: 550 XXXXXNYSEK--NRLNSDYDPLKGELXXXXXXXXXXXXXXXXXXLGNRVFKCKNIQSDSD 607
                   ++  NR  S+YDPL GE+                      V    N  +   
Sbjct: 540 DEEVEQDGDRYVNRDVSEYDPLNGEIDSVSSYSDNEDAHHSSEEFLEEVDALGNTVTKKV 599

Query: 608 VNSVEEASEEDKPDTNDLENREITGGVGQENXXXXXXXXXXXXTQPTELNPLSAGQLAPS 667
                   +ED  +       EI     +E               P  +N       AP 
Sbjct: 600 AKLQSHFGDEDGVEV------EIKENGAEELSSSESEGEQEDGIMPPPVN------TAPI 647

Query: 668 SSTVPSGPLTYALRSVIVHYGSHNYGHYIAFRKFRGLWWRISDETVYVVDEAEVLSTPGV 727
            STVP+GPLTY LRSVIVHYG+HNYGHYIAFRK+RG WWRISDETVYVV+EAEVLST GV
Sbjct: 648 PSTVPAGPLTYVLRSVIVHYGTHNYGHYIAFRKYRGCWWRISDETVYVVEEAEVLSTSGV 707

Query: 728 FMLFYEHDYNQTLQKMNDDLEWEEQEE 754
           FMLFYE+DY++   KM +DLE + ++E
Sbjct: 708 FMLFYEYDYDEATGKMREDLESDLEDE 734

>Smik_4.115 Chr4 (219167..221539) [2373 bp, 790 aa] {ON} YDL122W
           (REAL)
          Length = 790

 Score =  744 bits (1921), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 399/771 (51%), Positives = 515/771 (66%), Gaps = 42/771 (5%)

Query: 1   MDLARER-----LSAVFTILSLFIKNLNI---DHKSPTFLVIVASTGLLIYKNRRYIRNI 52
           MDL  ER     L  +F     F+K+  I   ++ + +  +++    +  YK   ++  +
Sbjct: 1   MDLFIERKINSLLHFLFGSRQDFLKSFEIWNNNNNNLSIYLLIFGVVVFFYKKPDHLNYV 60

Query: 53  MDALGTVGGDLTRGFRNSYKGSVFNKWGSRNPAQ--EATMLKRGGYVGGLINDGNTCFMN 110
           ++++     ++T  FRN+   +  ++W  R+     +  +LKRGG++ GL+NDGNTCFMN
Sbjct: 61  VESIR----EMTTNFRNN---NSLSRWLPRSKFTHLDEEILKRGGFIAGLVNDGNTCFMN 113

Query: 111 SVIQSLASSKSLMQFLDEELMEASKELENPNETSSAVEEEGNLGSNSELRNRSSSKKTYG 170
           SV+QSLASSK LM+FLD  +++  +E+E         E E   G  +  +N + S K YG
Sbjct: 114 SVLQSLASSKELMEFLDNNVIKTYEEMEQNEHNKEESEHEPEQGEYNNKKNSNRSGKVYG 173

Query: 171 KRKKRLTRN-AEKDAALEDEGVNMEFSAALKELLEKLNDKYHRDKPYFKTNKLLKTMSKA 229
           K KK+L R  + K+   E++  ++ FS AL++LL  LNDKY+RDKPYFKTN LLK+MSK+
Sbjct: 174 KHKKKLNRKLSSKEEERENQEPDITFSTALRDLLAALNDKYYRDKPYFKTNSLLKSMSKS 233

Query: 230 PNKNIILGYDQEDAQEFFQTILSELEKNIKSLRGKSDKDNEPTELADIPKNAMIGQERLG 289
           P KNI+LGYDQEDAQEFFQ IL+ELE N+KSL  +   D+ P   +++P++A++GQ+ LG
Sbjct: 234 PRKNILLGYDQEDAQEFFQNILAELESNVKSLNTEK-LDSTPIAKSNLPEDALVGQQNLG 292

Query: 290 EMGTVYLPAEQIDPNCVLGHEAKQLFFPFDLVTPLDGITAERIGCLQCGENGGIRYSVFS 349
           E+GTVY+P EQIDPN +L  ++ Q   PF L+TPLDGITAERIGCLQCGENGGIRYSVFS
Sbjct: 293 EVGTVYIPTEQIDPNSILHDKSIQNLTPFRLMTPLDGITAERIGCLQCGENGGIRYSVFS 352

Query: 350 GLSLNLPSDTVGSALKLSQLLREWVKPEIIEGVECNRCALKAVLEHLEKTLTQYEINDK- 408
           GLSLNLP++ +GS LKLSQLL +W KPEIIEGVECNRCAL A   HL + L Q++   + 
Sbjct: 353 GLSLNLPNENIGSTLKLSQLLSDWSKPEIIEGVECNRCALTAAHSHLMEQLDQFQKKPEG 412

Query: 409 -VSEKLVSAVSSRVEELKAILAKPVVDDDDYKKLHTENMVRKCSKSKQILISRPPPLLSI 467
            + EKL++AV  RV++++ +LAKPV+DD+DYKKLHT NMVRKCSKSKQILISRPPPLLSI
Sbjct: 413 SIPEKLMNAVKDRVQQIQEVLAKPVIDDEDYKKLHTANMVRKCSKSKQILISRPPPLLSI 472

Query: 468 HINRSVFDPRTYTIRKNNSKVLFKSRLNLAPWSCGPDEINLDARLPMSKKDQRAME-SSE 526
           HINRSVFDPRTY IRKNNSKVLFKSRLNLAPW C  DEINLDARLPMSKK++   + SSE
Sbjct: 473 HINRSVFDPRTYMIRKNNSKVLFKSRLNLAPWCCDIDEINLDARLPMSKKEKTVQQDSSE 532

Query: 527 DENIGGEYFAKLHRRXXXXXXXXXXX------XXNYS---EKNRLNSDYDPLKGELXXXX 577
           DENIGGEY+ KLH R                   NY+     ++ N++YDPL GE     
Sbjct: 533 DENIGGEYYTKLHERFEQEFEDSEEERDYNDGEENYTSHYSHSKNNNNYDPLNGE-ADDL 591

Query: 578 XXXXXXXXXXXXXXLGNRVFKCKNIQSDSDVNSVEEASEEDKPDTNDLENREITGGVGQE 637
                         LGN + K     ++ + + V       K D  +L N      V  +
Sbjct: 592 TSDDEDEHIEETDALGNTIRKRITENTNDENDYV-------KDDEKELHN---IDSVNID 641

Query: 638 NXXXXXXXXXXXXTQPTELNPLSAGQLAPSSSTVPSGPLTYALRSVIVHYGSHNYGHYIA 697
                        +   ++ P        S STVP+ PLTY+LRSVIVHYG+HNYGHYIA
Sbjct: 642 EPKVNVEDQLETSSDEEDVIPAPPINYTRSFSTVPATPLTYSLRSVIVHYGTHNYGHYIA 701

Query: 698 FRKFRGLWWRISDETVYVVDEAEVLSTPGVFMLFYEHDYNQTLQKMNDDLE 748
           FRK+RG WWRISDETVYVVDEAEVLSTPGVFMLFYE+DY++   +M DDLE
Sbjct: 702 FRKYRGCWWRISDETVYVVDEAEVLSTPGVFMLFYEYDYDEETGQMKDDLE 752

>Skud_4.133 Chr4 (238225..240588) [2364 bp, 787 aa] {ON} YDL122W
           (REAL)
          Length = 787

 Score =  740 bits (1911), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 395/759 (52%), Positives = 506/759 (66%), Gaps = 36/759 (4%)

Query: 8   LSAVFTILSLFIKNLNI---DHKSPTFLVIVASTGLLIYKNRRYIRNIMDALGTVGGDLT 64
           L  +F     F++N  I   ++ + +  +++    +  YK   +++ I+D +     ++T
Sbjct: 13  LQFLFGSRQDFLRNFKIWNSNNNNFSIYLLIFGVVVFFYKKPDHLKYIVDGIS----EMT 68

Query: 65  RGFRNSYKGSVFNKWGSRNPAQ--EATMLKRGGYVGGLINDGNTCFMNSVIQSLASSKSL 122
             F+N+   +  ++W  R+     +  +LKRGG++ GL+NDGNTCFMNSV+QSLASS+ L
Sbjct: 69  TNFKNN---NSLSRWLPRSKFTHLDEEILKRGGFIAGLVNDGNTCFMNSVLQSLASSREL 125

Query: 123 MQFLDEELMEASKELENPNETSSAVEEEGNLGSNSELRNRSSSKKTYGKRKKRLTRN-AE 181
           M FLD  +++  +++E   +       E     ++     S S K YGK +K+L R  + 
Sbjct: 126 MDFLDNNVIKTYEDIERSEQNKENNGNEREQDEDNHKTKSSRSGKVYGKHRKKLNRKLSS 185

Query: 182 KDAALEDEGVNMEFSAALKELLEKLNDKYHRDKPYFKTNKLLKTMSKAPNKNIILGYDQE 241
           K+   E++  ++ FS  LK+LL  LNDKY+RDKPYFKTN+LLK MSK+P KNI+LGYDQE
Sbjct: 186 KEEEEENQEPDITFSVTLKDLLAALNDKYYRDKPYFKTNRLLKAMSKSPRKNILLGYDQE 245

Query: 242 DAQEFFQTILSELEKNIKSLRGKSDKDNEPTELADIPKNAMIGQERLGEMGTVYLPAEQI 301
           DAQEFFQ IL+ELE N+KSL  ++  D  PT  +D+P +A++GQ  L  +GTVY+P EQI
Sbjct: 246 DAQEFFQNILAELESNVKSLNSET-LDTTPTAKSDLPDDALVGQRDLDRVGTVYIPTEQI 304

Query: 302 DPNCVLGHEAKQLFFPFDLVTPLDGITAERIGCLQCGENGGIRYSVFSGLSLNLPSDTVG 361
           DPN +L  ++ + F P+ L+TPLDGITAERIGCLQCGENGGIRYSVFSGLSLNLP++ +G
Sbjct: 305 DPNSILHDKSIKNFTPYKLMTPLDGITAERIGCLQCGENGGIRYSVFSGLSLNLPNENIG 364

Query: 362 SALKLSQLLREWVKPEIIEGVECNRCALKAVLEHLEKTLTQYE--INDKVSEKLVSAVSS 419
           S LKLSQLL +W KPEIIEGVECNRCAL A   HL   L Q+E   +  + EKL++AV  
Sbjct: 365 STLKLSQLLSDWSKPEIIEGVECNRCALTAAHSHLLGQLKQFEKKPDGSIPEKLINAVKE 424

Query: 420 RVEELKAILAKPVVDDDDYKKLHTENMVRKCSKSKQILISRPPPLLSIHINRSVFDPRTY 479
           RV +++ +LAKPV+DDDDYKKLHT NMVRKCSKSKQILISRPPPLLSIHINRSVFDPRTY
Sbjct: 425 RVHQIEQVLAKPVIDDDDYKKLHTANMVRKCSKSKQILISRPPPLLSIHINRSVFDPRTY 484

Query: 480 TIRKNNSKVLFKSRLNLAPWSCGPDEINLDARLPMSKKDQRA-MESSEDENIGGEYFAKL 538
           TIRKNNSKVLFKSRLNL+PW C  DEINLDARLPMSKK++    ESSEDENIGGEY+ KL
Sbjct: 485 TIRKNNSKVLFKSRLNLSPWCCDIDEINLDARLPMSKKEKVVQQESSEDENIGGEYYTKL 544

Query: 539 HRRXXXXXXXXXXXXXNYSEK---------NRLNSDYDPLKGELXXXXXXXXXXXXXXXX 589
           H R                EK         N+ NS+YDPLK E                 
Sbjct: 545 HERFEQEFEDSEEEREYNDEKENYASHYASNKGNSNYDPLKDE-ADDLTSDDEDEYIEET 603

Query: 590 XXLGNRVFKCKNIQSDSDVNSVEEASEEDKPDTNDLENREITGGVGQENXXXXXXXXXXX 649
             LGN + K + I+   + N  E   E+D+   + + N      +  +            
Sbjct: 604 DALGNTIRK-RTIEHADEKN--EHVIEDDEEALDSINN------INHDKPKIDVEDQLEP 654

Query: 650 XTQPTELNPLSAGQLAPSSSTVPSGPLTYALRSVIVHYGSHNYGHYIAFRKFRGLWWRIS 709
            +   ++ P      A S STVP+ PLTY+LRSVIVHYG+HNYGHYIAFRK+RG WWRIS
Sbjct: 655 SSDEDDVIPAPPINYARSFSTVPATPLTYSLRSVIVHYGTHNYGHYIAFRKYRGCWWRIS 714

Query: 710 DETVYVVDEAEVLSTPGVFMLFYEHDYNQTLQKMNDDLE 748
           DETVYVVDEAEVLSTPGVFMLFYE+DY++   +M DDLE
Sbjct: 715 DETVYVVDEAEVLSTPGVFMLFYEYDYDKETGEMKDDLE 753

>Kpol_1003.53 s1003 (121699..124065) [2367 bp, 788 aa] {ON}
           (121699..124065) [2367 nt, 789 aa]
          Length = 788

 Score =  739 bits (1908), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 400/739 (54%), Positives = 504/739 (68%), Gaps = 39/739 (5%)

Query: 30  TFLVIVASTGLLIYKNRRYIRNIMDALGTVGGDLTRGFRNSYKGSVFNKWGSRNPAQEAT 89
           + ++++ +T   IY  +      M+ L   G + T  FR    G+        N   E  
Sbjct: 34  SLILLILTTIYFIYTKKHLF---MERLSAFGNNST--FRRFLPGN--------NSQLEEK 80

Query: 90  MLKRGGYVGGLINDGNTCFMNSVIQSLASSKSLMQFLDEELMEASKELENPNETSSAVEE 149
           +L RGG+V GL+NDGNTCFMNSV+QSLASSK+L++FLD E++  ++ELE          E
Sbjct: 81  ILNRGGFVAGLVNDGNTCFMNSVLQSLASSKTLLEFLDSEIILKAEELEEKENNVEVDNE 140

Query: 150 EGNLGSNSELRNRSSSK-----------KTYGKRKKRLTRNAEKDAALEDEG---VNMEF 195
           E     + +    S+S+           KTYGKRKK+L R  ++ A  +DE     N+ F
Sbjct: 141 EEKEEDDEDKDEESTSEEVEKGTKTARSKTYGKRKKKLARKMDEIALKKDENEQERNVTF 200

Query: 196 SAALKELLEKLNDKYHRDKPYFKTNKLLKTMSKAPNKNIILGYDQEDAQEFFQTILSELE 255
           S   KELL+KLN KY+R++ YFKTNKLL+TMSKAPNKNIILGYDQEDAQEFFQ+IL ELE
Sbjct: 201 SLTFKELLDKLNFKYYRERHYFKTNKLLRTMSKAPNKNIILGYDQEDAQEFFQSILLELE 260

Query: 256 KNIKSLRGKSDKDNEPTELADIPKNAMIGQERLGEMGTVYLPAEQIDPNCVLGHEAKQLF 315
           KN+KSL  +++K  EP   +++P+NA+IGQ +LGE+GTVY+P +QIDPN +L  +    F
Sbjct: 261 KNVKSLGDETNK-QEPVPESELPENALIGQNKLGEVGTVYIPTDQIDPNSILNSDNSTKF 319

Query: 316 F-PFDLVTPLDGITAERIGCLQCGENGGIRYSVFSGLSLNLPSDTVGSALKLSQLLREWV 374
           + PF +VTPLDGITAERIGCLQCGENGGIRYS+ SG+SLNLP++ +GS LKLSQLL+EW+
Sbjct: 320 YTPFKMVTPLDGITAERIGCLQCGENGGIRYSISSGISLNLPAENIGSNLKLSQLLKEWI 379

Query: 375 KPEIIEGVECNRCALKAVLEHLEKTLTQYEINDK--VSEKLVSAVSSRVEELKAILAKPV 432
           KPEIIEGVECNRCAL AV EHL   L Q+E  +   + +KL+ A+S R+E+L+  L+KPV
Sbjct: 380 KPEIIEGVECNRCALNAVREHLTDQLKQFEAKESGAIPDKLIKAISERIEKLEQTLSKPV 439

Query: 433 VDDDDYKKLHTENMVRKCSKSKQILISRPPPLLSIHINRSVFDPRTYTIRKNNSKVLFKS 492
           +DDDDYK++HTENMVR+CSKSKQILISRPPPLLSIHINRSVFDPRTY IRKNNS+VLFKS
Sbjct: 440 IDDDDYKEMHTENMVRRCSKSKQILISRPPPLLSIHINRSVFDPRTYMIRKNNSRVLFKS 499

Query: 493 RLNLAPWSCGPDEINLDARLPMSKKDQRAMESSEDENIGGEYFAKLHRRXXXXXXXXXXX 552
           RLNLAPW C  DEINLDARLPMSKK + A ESSEDEN+GGEY+AKLH+R           
Sbjct: 500 RLNLAPWCCNIDEINLDARLPMSKKQEFASESSEDENVGGEYYAKLHQRFEQEFEDSDEE 559

Query: 553 XXNYSEK--NRLNSDYDPLKGELXXXXXXXXXXXXXXXXXXLGNRVFKCKNIQSDSDVNS 610
                E+  +R   DYDPL GE                   LGN +   +  + + D  +
Sbjct: 560 DEYGEEEYADRDVKDYDPLNGEFSEDNDDGDEEEYIEEQDALGNTI---RRRRVERDTLN 616

Query: 611 VEEASEEDKPDTNDLENREITGGVGQENXXXXXXXXXXXXTQPTEL-NPLSAGQ--LAPS 667
            +E  +++  D  +  + E    V +E                 EL N +S      APS
Sbjct: 617 EDEPLDDEDDDDENDVDYEEEKAVSEEVSELQHGDEKSDVDSEEELDNSISVPPTITAPS 676

Query: 668 SSTVPSGPLTYALRSVIVHYGSHNYGHYIAFRKFRGLWWRISDETVYVVDEAEVLSTPGV 727
           +STVP GPLTY+LRSVIVHYG+HNYGHYIAFRK+RG WWRISDE+V +VDEAEVLSTPGV
Sbjct: 677 ASTVPVGPLTYSLRSVIVHYGTHNYGHYIAFRKYRGCWWRISDESVTIVDEAEVLSTPGV 736

Query: 728 FMLFYEHDYNQTLQKMNDD 746
           FMLFYE+D+++    M DD
Sbjct: 737 FMLFYEYDFDEETGMMGDD 755

>YDL122W Chr4 (242552..244981) [2430 bp, 809 aa] {ON}
           UBP1Ubiquitin-specific protease that removes ubiquitin
           from ubiquitinated proteins; cleaves at the C terminus
           of ubiquitin fusions irrespective of their size; capable
           of cleaving polyubiquitin chains
          Length = 809

 Score =  732 bits (1889), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 391/737 (53%), Positives = 490/737 (66%), Gaps = 41/737 (5%)

Query: 30  TFLVIVASTGLLIYKNRRYIRNIMDALGTVGGDLTRGFRNSYKGSVFNKWGSRNPAQ--E 87
           +  +++    +  YK   ++  I++++     ++T  FRN+   +  ++W  R+     +
Sbjct: 38  SIYLLIFGIVVFFYKKPDHLNYIVESVS----EMTTNFRNN---NSLSRWLPRSKFTHLD 90

Query: 88  ATMLKRGGYVGGLINDGNTCFMNSVIQSLASSKSLMQFLDEELMEASKELENPNETSSAV 147
             +LKRGG++ GL+NDGNTCFMNSV+QSLASS+ LM+FLD  ++   +E+E         
Sbjct: 91  EEILKRGGFIAGLVNDGNTCFMNSVLQSLASSRELMEFLDNNVIRTYEEIEQNEHNEEGN 150

Query: 148 EEEGNLGSNSELRNRSSSKKTYGKRKKRLTRNAEKDAALEDEGVNME----FSAALKELL 203
            +E      +  +N     K YGK KK+L R   K ++ EDE  + E    FS AL++LL
Sbjct: 151 GQESAQDEATHKKNTRKGGKVYGKHKKKLNR---KSSSKEDEEKSQEPDITFSVALRDLL 207

Query: 204 EKLNDKYHRDKPYFKTNKLLKTMSKAPNKNIILGYDQEDAQEFFQTILSELEKNIKSLRG 263
             LN KY+RDKPYFKTN LLK MSK+P KNI+LGYDQEDAQEFFQ IL+ELE N+KSL  
Sbjct: 208 SALNAKYYRDKPYFKTNSLLKAMSKSPRKNILLGYDQEDAQEFFQNILAELESNVKSLNT 267

Query: 264 KSDKDNEPTELADIPKNAMIGQERLGEMGTVYLPAEQIDPNCVLGHEAKQLFFPFDLVTP 323
           +   D  P   +++P +A++GQ  LGE+GTVY+P EQIDPN +L  ++ Q F PF L+TP
Sbjct: 268 EK-LDTTPVAKSELPDDALVGQLNLGEVGTVYIPTEQIDPNSILHDKSIQNFTPFKLMTP 326

Query: 324 LDGITAERIGCLQCGENGGIRYSVFSGLSLNLPSDTVGSALKLSQLLREWVKPEIIEGVE 383
           LDGITAERIGCLQCGENGGIRYSVFSGLSLNLP++ +GS LKLSQLL +W KPEIIEGVE
Sbjct: 327 LDGITAERIGCLQCGENGGIRYSVFSGLSLNLPNENIGSTLKLSQLLSDWSKPEIIEGVE 386

Query: 384 CNRCALKAVLEHLEKTLTQYEINDK--VSEKLVSAVSSRVEELKAILAKPVVDDDDYKKL 441
           CNRCAL A   HL   L ++E   +  + EKL++AV  RV +++ +LAKPV+DD+DYKKL
Sbjct: 387 CNRCALTAAHSHLFGQLKEFEKKPEGSIPEKLINAVKDRVHQIEEVLAKPVIDDEDYKKL 446

Query: 442 HTENMVRKCSKSKQILISRPPPLLSIHINRSVFDPRTYTIRKNNSKVLFKSRLNLAPWSC 501
           HT NMVRKCSKSKQILISRPPPLLSIHINRSVFDPRTY IRKNNSKVLFKSRLNLAPW C
Sbjct: 447 HTANMVRKCSKSKQILISRPPPLLSIHINRSVFDPRTYMIRKNNSKVLFKSRLNLAPWCC 506

Query: 502 GPDEINLDARLPMSKKDQRAME-SSEDENIGGEYFAKLHRR------XXXXXXXXXXXXX 554
             +EINLDARLPMSKK++ A + SSEDENIGGEY+ KLH R                   
Sbjct: 507 DINEINLDARLPMSKKEKAAQQDSSEDENIGGEYYTKLHERFEQEFEDSEEEKEYDDAEG 566

Query: 555 NYSEKNRLNSD---YDPLKGELXXXXXXXXXXXXXXXXXXLGNRVFKCKNIQSDSDVNSV 611
           NY+       D   YDPL GE+                  LGN + K     SD +  +V
Sbjct: 567 NYASHYNHTKDISNYDPLNGEV-DGVTSDDEDEYIEETDALGNTIKKRIIEHSDVENENV 625

Query: 612 EEASEEDKPDTNDLENREITGGVGQENXXXXXXXXXXXXTQPTELNPLSAGQLAPSSSTV 671
           ++  E  + D   L+  +I                    +   ++ P      A S STV
Sbjct: 626 KDNEELQEIDNVSLDEPKIN-----------VEDQLETSSDEEDVIPAPPINYARSFSTV 674

Query: 672 PSGPLTYALRSVIVHYGSHNYGHYIAFRKFRGLWWRISDETVYVVDEAEVLSTPGVFMLF 731
           P+ PLTY+LRSVIVHYG+HNYGHYIAFRK+RG WWRISDETVYVVDEAEVLSTPGVFMLF
Sbjct: 675 PATPLTYSLRSVIVHYGTHNYGHYIAFRKYRGCWWRISDETVYVVDEAEVLSTPGVFMLF 734

Query: 732 YEHDYNQTLQKMNDDLE 748
           YE+D+++   KM DDLE
Sbjct: 735 YEYDFDEETGKMKDDLE 751

>Suva_4.125 Chr4 (231011..233392) [2382 bp, 793 aa] {ON} YDL122W
           (REAL)
          Length = 793

 Score =  727 bits (1877), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 399/773 (51%), Positives = 509/773 (65%), Gaps = 43/773 (5%)

Query: 1   MDLARER-----LSAVFTILSLFIKNL----NIDHKSPTFLVIVASTGLLIYKNRRYIRN 51
           MDL  ER     L  +F     F+KNL    N  +  P +L+I     + +YK   ++  
Sbjct: 1   MDLFIERKIDSLLQFLFVSRQDFLKNLRFWNNNSNNFPIYLLIFGVV-VFLYKRPDHLNR 59

Query: 52  IMDALGTVGGDLTRGFRNSYKGSVFNKWGSRNPAQ--EATMLKRGGYVGGLINDGNTCFM 109
           I+D++     ++T  FRN+   +  ++W  R+     +  +LKRGG++ GL+NDGNTCFM
Sbjct: 60  IVDSIS----EMTTNFRNN---NSLSRWLPRSKFTHLDEEVLKRGGFIAGLVNDGNTCFM 112

Query: 110 NSVIQSLASSKSLMQFLDEELMEASKELENPNETSSAVEEEGNLGSNSELRNRSSSKKTY 169
           NSV+QSLASS+ LM FLD  +++  +ELE   E       E     +   +  + + K Y
Sbjct: 113 NSVLQSLASSRELMDFLDNNVIKTYEELEENAENKEENGHEHEDEEDGHKKKSAKNGKVY 172

Query: 170 GKRKKRLTRN-AEKDAALEDEGVNMEFSAALKELLEKLNDKYHRDKPYFKTNKLLKTMSK 228
           GK KK+L R  + K    E++  ++ FS  L++LL  LNDKY+RDKPYFKTN+LLK MSK
Sbjct: 173 GKHKKKLNRKLSSKGEEEENQEPDVTFSVTLRDLLAALNDKYYRDKPYFKTNRLLKAMSK 232

Query: 229 APNKNIILGYDQEDAQEFFQTILSELEKNIKSLRGKSDKDNEPTELADIPKNAMIGQERL 288
           +P KN++LGYDQEDAQEFFQ +L+ELE NIKSL  +   D  P    ++P +A++GQ  L
Sbjct: 233 SPRKNMLLGYDQEDAQEFFQNLLAELENNIKSLNSEK-LDTTPIAKTELPADALVGQNNL 291

Query: 289 GEMGTVYLPAEQIDPNCVLGHEAKQLFFPFDLVTPLDGITAERIGCLQCGENGGIRYSVF 348
            ++GTVY+P EQIDPN +L  ++ + F P+ L+TPLDGITAERIGCLQCGENGGIRYSVF
Sbjct: 292 EKVGTVYIPTEQIDPNSILHDKSIKNFTPYKLITPLDGITAERIGCLQCGENGGIRYSVF 351

Query: 349 SGLSLNLPSDTVGSALKLSQLLREWVKPEIIEGVECNRCALKAVLEHLEKTLTQY--EIN 406
           SGLSLNLP++ +G  LKLSQLL +W KPEIIEGVECNRCAL A   HL   L ++  +  
Sbjct: 352 SGLSLNLPNENIGCTLKLSQLLSDWSKPEIIEGVECNRCALTAAHSHLLGQLKEFRKKPE 411

Query: 407 DKVSEKLVSAVSSRVEELKAILAKPVVDDDDYKKLHTENMVRKCSKSKQILISRPPPLLS 466
             + EKL++AV  RV++++ +LAKPV+DD+DY+KLHT NMVRKCSKSKQILISRPPPLLS
Sbjct: 412 GSIPEKLINAVEDRVQQIEEVLAKPVIDDEDYEKLHTANMVRKCSKSKQILISRPPPLLS 471

Query: 467 IHINRSVFDPRTYTIRKNNSKVLFKSRLNLAPWSCGPDEINLDARLPMSKKDQRAME--S 524
           IHINRSVFDPRTY IRKNNSKVLFKSRLNLAPW C  DEINLDARLPMSKK ++AM+  S
Sbjct: 472 IHINRSVFDPRTYMIRKNNSKVLFKSRLNLAPWCCDIDEINLDARLPMSKK-EKAMQQDS 530

Query: 525 SEDENIGGEYFAKLHRRXXXXXXXX---------XXXXXNYSEKNRLNSDYDPLKGELXX 575
           SEDENIGGEY++KLH R                      ++   NR  ++YDPL GE   
Sbjct: 531 SEDENIGGEYYSKLHERFEQEFEDSEEEREYDDGEENQASHYNDNRDTNNYDPLNGE-AD 589

Query: 576 XXXXXXXXXXXXXXXXLGNRVFKCKNIQSDSDVNSVEEASEEDKPDTNDLENREITGGVG 635
                           LGN + K +NI+     N+ EE     + +  +++N   TG   
Sbjct: 590 GLTSDDEDEYIEETDALGNTIRK-RNIEH---ANTNEEHEHVVEDNGEEMDN---TGNAN 642

Query: 636 QENXXXXXXXXXXXXTQPTELNPLSAGQLAPSSSTVPSGPLTYALRSVIVHYGSHNYGHY 695
                          +   +  P      A S STVP+ PLTY+LRSVIVHYG+HNYGHY
Sbjct: 643 HSELKVNVEDELDSSSDEEDAIPAPPINYARSFSTVPATPLTYSLRSVIVHYGTHNYGHY 702

Query: 696 IAFRKFRGLWWRISDETVYVVDEAEVLSTPGVFMLFYEHDYNQTLQKMNDDLE 748
           IAFRK+RG WWRISDETVYVVDEAEVLSTPGVFMLFYE+DY++   +M DDLE
Sbjct: 703 IAFRKYRGCWWRISDETVYVVDEAEVLSTPGVFMLFYEYDYDEETGEMKDDLE 755

>CAGL0H10582g Chr8 complement(1029876..1032248) [2373 bp, 790 aa]
           {ON} similar to uniprot|P25037 Saccharomyces cerevisiae
           YDL122w UBP1 ubiquitin-specific protease
          Length = 790

 Score =  712 bits (1839), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 376/699 (53%), Positives = 468/699 (66%), Gaps = 59/699 (8%)

Query: 90  MLKRGGYVGGLINDGNTCFMNSVIQSLASSKSLMQFLDEELMEASKELENPNETSSAVEE 149
           +L+RGGYVGGL+NDGN CFMNSVIQSLASSK L++FLD+E++   + LE        V +
Sbjct: 88  ILQRGGYVGGLLNDGNFCFMNSVIQSLASSKELLKFLDDEIIGRYESLE-----KDLVAD 142

Query: 150 EGNLGSNSEL---RNRSSSKKTYGKRKKRLTRNAEKDAALEDEGVNMEFSAALKELLEKL 206
           E ++  ++E    + ++S+ K YGK KK+  R+   D    D   +++F+ A KELL+KL
Sbjct: 143 EDSVSESNEQNGKKQKASNGKVYGKSKKKHNRSV--DNGDNDTEPDIQFTIAFKELLDKL 200

Query: 207 NDKYHRDKPYFKTNKLLKTMSKAPNKNIILGYDQEDAQEFFQTILSELEKNIKSLRGKSD 266
           N KY++++PYFKTN ++  MS +P K++++ YDQEDAQEFFQTILSELEKNIK+L  + D
Sbjct: 201 NYKYYKERPYFKTNSMVNKMSNSPKKSMLMAYDQEDAQEFFQTILSELEKNIKTLESRKD 260

Query: 267 KDNEPTELADIPKNAMIGQERLGEMGTVYLPAEQIDPNCVLGHEAKQLFFPFDLVTPLDG 326
            D  P    ++ ++ MIGQ  LG MGTVY+P+EQIDPN       ++ F PF LVTPLDG
Sbjct: 261 -DKTPVPAKNLSEDDMIGQAHLGRMGTVYIPSEQIDPNSYTEGSTEKSFTPFKLVTPLDG 319

Query: 327 ITAERIGCLQCGENGGIRYSVFSGLSLNLPSDTVGSALKLSQLLREWVKPEIIEGVECNR 386
           ITAERIGCLQCGENGGIRYSVFSGLSLNLPS+ +GS LKLS LL EW+KPEIIEGVECNR
Sbjct: 320 ITAERIGCLQCGENGGIRYSVFSGLSLNLPSENIGSTLKLSSLLNEWIKPEIIEGVECNR 379

Query: 387 CALKAVLEHLEKTLTQYEINDKVSEKLVSAVSSRVEELKAILAKPVVDDDDYKKLHTENM 446
           CAL+AV EHL   + + + +     KLV A+ +R+ EL+  L KPV+DDDDYKKLHTENM
Sbjct: 380 CALEAVREHLLSQMKEIDGSANTPAKLVDAMRTRLAELEETLKKPVIDDDDYKKLHTENM 439

Query: 447 VRKCSKSKQILISRPPPLLSIHINRSVFDPRTYTIRKNNSKVLFKSRLNLAPWSCGPDEI 506
           VRKCSKSKQ++ISRPP LLSIHINRSVFDPRTY IRKNNS+VLFKSR+NL PW C  DEI
Sbjct: 440 VRKCSKSKQVVISRPPALLSIHINRSVFDPRTYMIRKNNSRVLFKSRMNLEPWCCDIDEI 499

Query: 507 NLDARLPMSKKDQRAMESSEDENIGGEYFAKLHRRXXXX--------XXXXXXXXXNYSE 558
           NLDARLPMSKK Q+ +ESSEDENIGG+Y++KLH++                     N   
Sbjct: 500 NLDARLPMSKK-QKVVESSEDENIGGDYYSKLHQKFEKAFEDEDEEEYDDEDEEYNNGIY 558

Query: 559 KNRLNSDYDPLKGELXXXXXXXXXXXXXXXXXXLGNRVFKCKNIQSDSDVNSVEEASEED 618
           ++R  S+YDPL GEL                  LGN + K K +  +    S+ E S   
Sbjct: 559 ESRNVSEYDPLNGELSSDYSEEDEISSDEEVDALGNTIPKKKTVTLND--GSLTEIS--- 613

Query: 619 KPDTNDLENREITGGVGQ-------------------------ENXXXXXXXXXXXXTQP 653
                 + N  I  G G                          E+               
Sbjct: 614 ------VANGNIVDGDGNEDNSENEDDDDDDDDGDENYTDNDAEDDEAVDSDESNRSQDA 667

Query: 654 TELNPLSAGQLAPSSSTVPSGPLTYALRSVIVHYGSHNYGHYIAFRKFRGLWWRISDETV 713
            +  P++   LAP  STV   PLTYALRSVIVHYG+HNYGHYIA+RKFRG+WWRISDE+V
Sbjct: 668 VQAPPIN---LAPRYSTVNPSPLTYALRSVIVHYGTHNYGHYIAYRKFRGVWWRISDESV 724

Query: 714 YVVDEAEVLSTPGVFMLFYEHDYNQTLQKMNDDLEWEEQ 752
           YVVDEAEVLSTPGVFMLFYE+DY++   +M DD+E+E Q
Sbjct: 725 YVVDEAEVLSTPGVFMLFYEYDYDEKTGRMKDDIEYEFQ 763

>AGR389C Chr7 complement(1444377..1446704) [2328 bp, 775 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL122W
           (UBP1)
          Length = 775

 Score =  706 bits (1821), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 390/724 (53%), Positives = 493/724 (68%), Gaps = 36/724 (4%)

Query: 43  YKNRRYIRNIMDALGTVGGDLTRGFRNSYKGSVFNKWGSRNPAQEATMLKRGGYVGGLIN 102
           YK R+ + NIMD +G V G+ TR FR+   G    +W  ++   E    + GG VGGL+N
Sbjct: 37  YKQRKQVGNIMDGIGQVAGNFTRDFRHRMLG----RWAPQSAELEKQAHQHGGNVGGLVN 92

Query: 103 DGNTCFMNSVIQSLASSKSLMQFLDEELMEASKEL--ENPNETSSAVEEEGNLGSNSELR 160
           DGNTCF+NSVIQSLASS+ L++FLDEE+++AS+    E+ ++  +  E+EG+        
Sbjct: 93  DGNTCFINSVIQSLASSRELLRFLDEEIIDASQPGTDESADDVQNGDEDEGS-------- 144

Query: 161 NRSSSKKTYGKRKKRLTRNAEKDAALEDEGVNMEFSAALKELLEKLNDKYHRDKPYFKTN 220
             S+ KK YGKRKK+  R A+  A  + +G   +FSAAL+EL++ LN K++R+KPYF+T+
Sbjct: 145 -SSAKKKAYGKRKKKQARAADAVALAKADGPRTDFSAALRELIDNLNGKHYRNKPYFRTS 203

Query: 221 KLLKTMSKAPNKNIILGYDQEDAQEFFQTILSELEKNIKSLRGKSDKDNEPTELADIPKN 280
            LLKTMSKAPNKNIILGYDQEDAQEFFQTILSELEK+++S++GK +K+ +P    ++P +
Sbjct: 204 GLLKTMSKAPNKNIILGYDQEDAQEFFQTILSELEKDVQSIQGKPEKNAKPVPKEELPGD 263

Query: 281 AMIGQERLGEMGTVYLPAEQIDPNCVLGHEAKQLFFPFDLVTPLDGITAERIGCLQCGEN 340
           A+IG E +G +GTVY+P EQI PN VL ++ ++ + PF L+TP DGITAER+GCLQCGEN
Sbjct: 264 AIIGSEHIGRIGTVYIPTEQIAPNSVL-NDPERYYTPFKLLTPFDGITAERVGCLQCGEN 322

Query: 341 GGIRYSVFSGLSLNLPSDTVGSALKLSQLLREWVKPEIIEGVECNRCALKAVLEHLE--- 397
           GGIRY +FS LSLNLP+D   S LKLS+LLREWVKPEIIEGVECNRCAL+AV  HL    
Sbjct: 323 GGIRYCLFSSLSLNLPNDNTSSTLKLSELLREWVKPEIIEGVECNRCALQAVHAHLAAKV 382

Query: 398 KTLTQYEINDKVSEKLVSAVSSRVEELKAILAKPVVDDDDYKKLHTENMVRKCSKSKQIL 457
           K L   E    +S KL+S + +R+E+L+ ILAKP +DD+DYKKLHT+NMVRKCSKSKQ L
Sbjct: 383 KELQAAEDEKAMSAKLISLMKARLEQLEGILAKPAIDDEDYKKLHTDNMVRKCSKSKQTL 442

Query: 458 ISRPPPLLSIHINRSVFDPRTYTIRKNNSKVLFKSRLNLAPWSCGPDEINLDARLPMSKK 517
           I+RPPPLLSIHINRSVFDPRT+ IRKNNSKVLFKSRLNLAPW CG DE+NLDARLPMSKK
Sbjct: 443 ITRPPPLLSIHINRSVFDPRTFMIRKNNSKVLFKSRLNLAPWCCGVDEVNLDARLPMSKK 502

Query: 518 DQRAM-ESSEDENIGGEYFAKLHRRXXXXXXXXXXXXXNYSEKNRLNS--------DYDP 568
           D   + ESSEDE  G EY+ KLH R               +     +S        +YDP
Sbjct: 503 DAAELEESSEDEPQGTEYYNKLHLRFQAEYEDEDDLDKGPNPSGPHSSYRAVADVPNYDP 562

Query: 569 LKGELXXXXXXXXXXXXXXXXXXLGNRVFK-----CKNIQSDSDVNSVEEASEEDKPDTN 623
           L GE                   LGN + K      + + SD D+ +   A   +KPD +
Sbjct: 563 LAGE-YSSSSEEEHERESIELDALGNTIPKNGPASLEELSSDEDLATKPRAEILEKPDND 621

Query: 624 DLENREITGGVGQENXXXXXXXXXXXXTQPTELNPLSAGQLAPSSSTVPSGPLTYALRSV 683
           + E           +             +        A +L  SS  V + PLTY+LRSV
Sbjct: 622 EDEEPSDDEDADDYDSDSPRPGDSGSELRDPPAPATFATELHGSS--VLASPLTYSLRSV 679

Query: 684 IVHYGSHNYGHYIAFRKFRGLWWRISDETVYVVDEAEVLSTPGVFMLFYEHDYNQTLQKM 743
           IVHYG+HNYGHYIAFRKFRG+WWRISDET Y+VDEAEVLSTPGVFMLFYE+DY++   ++
Sbjct: 680 IVHYGTHNYGHYIAFRKFRGVWWRISDETAYIVDEAEVLSTPGVFMLFYEYDYDEATGQL 739

Query: 744 NDDL 747
            DDL
Sbjct: 740 RDDL 743

>ZYRO0A02420g Chr1 (190417..192654) [2238 bp, 745 aa] {ON} similar
           to uniprot|P25037 Saccharomyces cerevisiae YDL122W UBP1
           Ubiquitin-specific protease that removes ubiquitin from
           ubiquitinated proteins cleaves at the C terminus of
           ubiquitin fusions irrespective of their size capable of
           cleaving polyubiquitin chains
          Length = 745

 Score =  704 bits (1817), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 385/762 (50%), Positives = 501/762 (65%), Gaps = 54/762 (7%)

Query: 8   LSAVFTILSLFIKNLNIDHKSPTFL-VIVASTGLLIYKNRRYIRNIMDALGTVGGDLTRG 66
           L  +   +S FI N N     P  L +++ ST  L  K++++  N+        GD+ RG
Sbjct: 5   LGPIVQKISSFISNNNNKTSIPIALGIVILSTAFLFLKSKKHNSNV--------GDIARG 56

Query: 67  FRNSYKGSVFNKWGSRNPAQEATMLKRGGYVGGLINDGNTCFMNSVIQSLASSKSLMQFL 126
             +    S F +W  R+   E  +LKRGG +GGL+NDGNTCFMN V+QS+ASSK L++FL
Sbjct: 57  MTSK---SGFRRWMPRSGQMENEVLKRGGNIGGLVNDGNTCFMNCVLQSMASSKELLKFL 113

Query: 127 DEELMEASKELENPNETSSAVEEEGNLGSNSELRNRSSSKKTYGKRKKRLTRNAEKDAAL 186
           DEE+   +K  E+               SN +  N      T  +++KR     E++A  
Sbjct: 114 DEEIACKAKLDED--------------QSNGDDVNNEKPHNTSKQQQKR-----EEEAKS 154

Query: 187 EDEGV-NMEFSAALKELLEKLNDKYHRDKPYFKTNKLLKTMSKAPNKNIILGYDQEDAQE 245
           E E V ++ FSAALKELL+KLN KY+RD+PYFK NKLLK+MSKAPNKNI+LGYDQEDAQE
Sbjct: 155 EGETVPDVTFSAALKELLDKLNAKYYRDRPYFKANKLLKSMSKAPNKNILLGYDQEDAQE 214

Query: 246 FFQTILSELEKNIKSLRGKSDKDNEPTELADIPKNAMIGQERLGEMGTVYLPAEQIDPNC 305
           FFQT+LSELEKN KSL   +  D       D+P+ A+IGQ RL  +G VY+P EQ+ PN 
Sbjct: 215 FFQTMLSELEKNAKSLDNTT-IDKHAILEKDLPETAVIGQARLDHVGAVYIPTEQVTPNL 273

Query: 306 VLGHEAKQLFFPFDLVTPLDGITAERIGCLQCGENGGIRYSVFSGLSLNLPSDTVGSALK 365
           +     ++ F  F L+TPLDGI AERIGCLQCGE GGIRYSV SGLSLNLPSD +GS+LK
Sbjct: 274 IPPGSKEKYFTKFKLITPLDGILAERIGCLQCGETGGIRYSVSSGLSLNLPSDNMGSSLK 333

Query: 366 LSQLLREWVKPEIIEGVECNRCALKAVLEHLEKTLTQYEIN--DKVSEKLVSAVSSRVEE 423
           LS LL++++KPEIIEGVECNRCAL AV +HL++ L QYE    + +  KL  A  SR++E
Sbjct: 334 LSDLLKDYIKPEIIEGVECNRCALIAVRDHLKEQLQQYEDKKANAIPAKLCQAFQSRIQE 393

Query: 424 LKAILAKPVVDDDDYKKLHTENMVRKCSKSKQILISRPPPLLSIHINRSVFDPRTYTIRK 483
           L+ +L+KPV+DD++YKKLHTENMVRK SKSKQ+LISRPPPLL+IHINRSVFDPRT+ IRK
Sbjct: 394 LEKVLSKPVIDDEEYKKLHTENMVRKSSKSKQVLISRPPPLLAIHINRSVFDPRTFMIRK 453

Query: 484 NNSKVLFKSRLNLAPWSCGPDEINLDARLPMSKKDQRAMESSEDENIGGEYFAKLHRRXX 543
           NN++VLFKSRLNL+PW C  DEIN+DAR+PMS+K++  M+SSEDEN+GGE++ KLH++  
Sbjct: 454 NNARVLFKSRLNLSPWCCDIDEINMDARMPMSQKEEVIMDSSEDENVGGEFYTKLHQKYE 513

Query: 544 XXXXXXXXXXXNY--SEKNRLNSDYDPLKGELXXXXXXXXXXXXXXX-----XXXLGNRV 596
                          S  ++L S+YDPL G+                        LGN +
Sbjct: 514 REFEDSDEDSDQPIGSSDDKLVSNYDPLGGDGNSLSSYSDEEESNESDYIEKTDALGNTI 573

Query: 597 FKCKNIQSDSDVNSVEE----ASEEDKPDTNDLENREITGGVGQENXXXXXXXXXXXXTQ 652
            + +   +D    +V E    AS  ++ +  + +N+E+ G    E              +
Sbjct: 574 REPRARANDKVEVAVRENASGASSSEEEEEPEDKNQEMDGDDEDERASAPQNTESEGEDE 633

Query: 653 PTELN-PLSAGQLAPSSSTVPSGPLTYALRSVIVHYGSHNYGHYIAFRKFRGLWWRISDE 711
               N PL      PS  +VP+ PLTY+LRSV+VHYG+HNYGHYIAFR++RG WWRISDE
Sbjct: 634 GEATNGPL------PSKFSVPATPLTYSLRSVVVHYGTHNYGHYIAFRRYRGYWWRISDE 687

Query: 712 TVYVVDEAEVLSTPGVFMLFYEHDYNQ-TLQKMNDDLEWEEQ 752
           TVY+VDE EVLSTPGVFMLFYE+DY++ T Q   +D + EE+
Sbjct: 688 TVYIVDETEVLSTPGVFMLFYEYDYDESTGQTKQEDWQLEEE 729

>TPHA0G00850 Chr7 (158945..161293) [2349 bp, 782 aa] {ON} Anc_2.307
           YDL122W
          Length = 782

 Score =  701 bits (1810), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 393/755 (52%), Positives = 502/755 (66%), Gaps = 55/755 (7%)

Query: 27  KSPTF-----LVIVASTGLLIYKNRRYIRNIMDALGTVGGDLTRGFRNSYKGSVFNKWGS 81
           K+PTF      +   S   ++Y  R YI N + ++           RN+   S  N++  
Sbjct: 24  KNPTFQSNVRFLFFTSVIYILYSKRHYIMNNLSSI-----------RNN---STLNRFLP 69

Query: 82  RNPAQEATMLKRGGYVGGLINDGNTCFMNSVIQSLASSKSLMQFLDEELMEAS-KELENP 140
              + + T+LKRGG++ GL+NDGNTCFMNSV+QSLASS++L++FLDEE++ +  K+ E  
Sbjct: 70  SYNSMDDTILKRGGHIAGLVNDGNTCFMNSVLQSLASSRTLVEFLDEEIVNSQLKDDETE 129

Query: 141 NETSSAVEEEGNLGSNSELRNRSSSKKTYGKRKKRLTRNAEKDAALEDEGVNMEFSAALK 200
            E    V EE  +      +N++  K+    +K++   + EK    E    ++ FS ALK
Sbjct: 130 GENEKEVGEEVQVKVQKLNKNKNGGKRKKKLQKQKDQEDLEKTE--ESTEKDVAFSIALK 187

Query: 201 ELLEKLNDKYHRDKPYFKTNKLLKTMSKAPNKNIILGYDQEDAQEFFQTILSELEKNIKS 260
           ELL+KLN KY+RDKPYFKT+ LLKTMSKAPNKNII+GYDQEDAQEFFQ+ILSELEKN+KS
Sbjct: 188 ELLDKLNFKYYRDKPYFKTHSLLKTMSKAPNKNIIMGYDQEDAQEFFQSILSELEKNVKS 247

Query: 261 LRGKSDKDNEPTELADIPKNAMIGQERLGEMGTVYLPAEQIDPNCVL-GHEAKQLFFPFD 319
           +    +KD +P   +++P  A+IGQ  LG +GTV++P EQIDPN +L   ++ + + PF 
Sbjct: 248 I-SPIEKDVKPVPESELPDGALIGQNDLGSVGTVFIPTEQIDPNSILENKDSSKYYTPFR 306

Query: 320 LVTPLDGITAERIGCLQCGENGGIRYSVFSGLSLNLPSDTVGS-ALKLSQLLREWVKPEI 378
           ++TPLDGITAERIGCL CGENGGIRYS+ S LSLNLP++ + S ALKLS L++EW+KPEI
Sbjct: 307 MITPLDGITAERIGCLTCGENGGIRYSISSSLSLNLPNENINSQALKLSNLMQEWIKPEI 366

Query: 379 IEGVECNRCALKAVLEHLEKTLTQYE--INDKVSEKLVSAVSSRVEELKAILAKPVVDDD 436
           IEGVECNRCAL AVLEHL+  L Q +      + EKL+SAV  R+  L   L+KPV+DD+
Sbjct: 367 IEGVECNRCALNAVLEHLQDQLKQLQEKSTGSIPEKLISAVEERISILSKTLSKPVIDDE 426

Query: 437 DYKKLHTENMVRKCSKSKQILISRPPPLLSIHINRSVFDPRTYTIRKNNSKVLFKSRLNL 496
           DYKK HTENMVRKCSKSKQILISRPPPLLSIHINRSVFDP TYTIRKNNS+VLFKSR NL
Sbjct: 427 DYKKYHTENMVRKCSKSKQILISRPPPLLSIHINRSVFDPNTYTIRKNNSRVLFKSRFNL 486

Query: 497 APWSCGPDEINLDARLPMSKKDQRAMESSEDENIGGEYFAKLHRRXXXXXXXXXXXX--- 553
            PW C  DEINLDARLPMSKK+    ESSEDENIGGEY+AKLH +               
Sbjct: 487 EPWCCDIDEINLDARLPMSKKNNLPQESSEDENIGGEYYAKLHHKFEQEFEDSDEESYEN 546

Query: 554 -XNYSEKNRLNSDYDPLKGELXXXXXXXXXXXXXXXXXXLGN----RVFKCKNIQSDSDV 608
             +   + R  S+YDPL GE+                  LGN    RV + + IQ ++D+
Sbjct: 547 DSDMQLRGRDVSNYDPLHGEIEEDESVDDGAEYIEETDGLGNTIRRRVIEQEQIQKENDI 606

Query: 609 ---------NSVEEASEEDKPDTNDLENREITGGVGQENXXXXXXXXXXXXTQPTELNPL 659
                    +  E+  ++D  D ND E   I      +               P +   L
Sbjct: 607 AMESDEDDEDYTEDQEKDDIFDNNDPEGEHIVDTESSD----VESDRVSLPAPPRQYTSL 662

Query: 660 SAGQLAPSSSTVPSGPLTYALRSVIVHYGSHNYGHYIAFRKFRGLWWRISDETVYVVDEA 719
                  SSSTVP+ PLTY+LRSVIVHYG+HNYGHYIAFR++RG WWRISDE+VY+V+EA
Sbjct: 663 -------SSSTVPASPLTYSLRSVIVHYGTHNYGHYIAFRRYRGCWWRISDESVYIVEEA 715

Query: 720 EVLSTPGVFMLFYEHDYNQTLQKMNDDLEWEEQEE 754
           EVLSTPGVFMLFYE+DY+   +KM DD+E++++ E
Sbjct: 716 EVLSTPGVFMLFYEYDYDVETKKMFDDIEFDKEIE 750

>KAFR0A06910 Chr1 complement(1393653..1395689) [2037 bp, 678 aa]
           {ON} Anc_2.307 YDL122W
          Length = 678

 Score =  664 bits (1712), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 365/697 (52%), Positives = 447/697 (64%), Gaps = 97/697 (13%)

Query: 76  FNKWGSRNPAQEATMLKRGGYVGGLINDGNTCFMNSVIQSLASSKSLMQFLDEELMEASK 135
           F++    N   +   +KRGGY+ GL+NDGNTCFMNSV+QSLASSK L  F          
Sbjct: 36  FSRKMYNNAINDKKFIKRGGYIAGLVNDGNTCFMNSVLQSLASSKELAAF---------- 85

Query: 136 ELENPNETSSAVEEEGNLGSNSELRNRSSSKKTYGKRKKRLTRNAEKDAALEDEGVNMEF 195
            L+N  E  S                                         E+ G +++F
Sbjct: 86  -LDNVIENGS-----------------------------------------ENNG-DIKF 102

Query: 196 SAALKELLEKLNDKYHRDKPYFKTNKLLKTMSKAPNKNIILGYDQEDAQEFFQTILSELE 255
           +  L+ELL  LN KY+++KPYFKTNKLLKTMS  PNKNIILGYDQEDAQEFFQ ILS+LE
Sbjct: 103 TETLRELLLILNKKYYKEKPYFKTNKLLKTMSNGPNKNIILGYDQEDAQEFFQQILSDLE 162

Query: 256 KNIKSLRGKSDKDNEPTELADIPKNAMIGQERLGEMGTVYLPAEQIDPNCVLGHEAKQLF 315
           KNIK    +  ++    + +D+P +A++GQ+ L  +GTVY+P EQI+PN VL +  ++L+
Sbjct: 163 KNIKKPSTEKKEERNNIKESDLPDDALLGQDDLNNVGTVYIPTEQIEPNSVLENPDQKLY 222

Query: 316 FPFDLVTPLDGITAERIGCLQCGENGGIRYSVFSGLSLNLPSDTVG-SALKLSQLLREWV 374
            PF L+TPLDGITAERIGCL CGENGGIRYSVFSGLSLNLPS+++  S LKLS+LL EWV
Sbjct: 223 SPFKLITPLDGITAERIGCLTCGENGGIRYSVFSGLSLNLPSESLNQSTLKLSELLNEWV 282

Query: 375 KPEIIEGVECNRCALKAVLEHLEKTLTQYEINDKVSEKLVSAVSSRVEELKAILAKPVVD 434
           KPEIIEGVECNRC+L AV  HL+  +     ND + EKL  A++ R+  L  IL+KPV++
Sbjct: 283 KPEIIEGVECNRCSLNAVRSHLQDQIQ----NDTIPEKLKIAINQRLNLLTEILSKPVIE 338

Query: 435 DDDYKKLHTENMVRKCSKSKQILISRPPPLLSIHINRSVFDPRTYTIRKNNSKVLFKSRL 494
           +DDYKK HTENMVRKCSKSKQILISRPPP LSIHINRSVFDPRTY IRKNN++VLFK+RL
Sbjct: 339 EDDYKKYHTENMVRKCSKSKQILISRPPPFLSIHINRSVFDPRTYMIRKNNARVLFKTRL 398

Query: 495 NLAPWSCGPDEINLDARLPMSKKDQRAM--ESSEDENIGGEYFAKLHRRXXXXXXXXXXX 552
           NL  W+C  DEINLDARLPMSK +      ESSEDENIGG+Y+AKLH R           
Sbjct: 399 NLQKWACNVDEINLDARLPMSKNEHIVQNEESSEDENIGGDYYAKLHHRFEQEYEDSE-- 456

Query: 553 XXNYSEKNRLNSD-------YDPLKGE---LXXXXXXXXXXXXXXXXXXLGNRV----FK 598
                E+N ++SD       YDPL GE   L                  LGN +     +
Sbjct: 457 ----DEENEIDSDDDRDVRNYDPLNGEEMNLSSEFSSSEDEQEEEEVDALGNTIRNMPVR 512

Query: 599 CKNIQSDSDVNSVEEASEEDKPDTNDLENR-EITGGVGQENXXXXXXXXXXXXTQPTELN 657
             N + +  V     +SEED+    D E+  E+   V Q+N                   
Sbjct: 513 LAN-EVEQPVPMSNSSSEEDQEPAQDSESESELNEDVEQKNDEISI-------------- 557

Query: 658 PLSAGQLAPSSSTVPSGPLTYALRSVIVHYGSHNYGHYIAFRKFRGLWWRISDETVYVVD 717
           P + G +  SSS VP+GPL Y+LRSVIVHYG+HNYGHYIAFRK+RG WWRISDETVY+VD
Sbjct: 558 PPTNGSMTYSSS-VPAGPLIYSLRSVIVHYGTHNYGHYIAFRKYRGYWWRISDETVYIVD 616

Query: 718 EAEVLSTPGVFMLFYEHDYNQTLQKMNDDLEWEEQEE 754
           E EVLSTPGVFMLFYE+DY+    +M DDLE  +QE+
Sbjct: 617 ETEVLSTPGVFMLFYEYDYDSVTGRMKDDLESLDQED 653

>SAKL0E07106g Chr5 complement(584164..586539) [2376 bp, 791 aa] {ON}
           similar to uniprot|P25037 Saccharomyces cerevisiae
           YDL122W UBP1 Ubiquitin-specific protease that removes
           ubiquitin from ubiquitinated proteins cleaves at the C
           terminus of ubiquitin fusions irrespective of their size
           capable of cleaving polyubiquitin chains
          Length = 791

 Score =  667 bits (1720), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 342/592 (57%), Positives = 432/592 (72%), Gaps = 21/592 (3%)

Query: 1   MDLARERLSAVFTILSLFIKNLNIDHKSPTFLVIVASTGLLIYKNRRYIRNIMDALGTVG 60
           + +A + +S + +   + ++  +  +K+ T LV++ ST LL++K ++++  +M+ L   G
Sbjct: 2   ISVAEDTISLLSSTFDVLLEKFSDKNKTATVLVLIVST-LLLFKKKKFVHQLMENLSKAG 60

Query: 61  GDLTRGFRNSY--KGSVFNKWGSRNPAQEATMLKRGGYVGGLINDGNTCFMNSVIQSLAS 118
           G+LTRGFR+SY  + ++   WG R   QE  +LK+GGYVGGL+NDGNTCFMNSV+QSLAS
Sbjct: 61  GELTRGFRSSYYSRANMLGGWGQRRSEQEERVLKKGGYVGGLVNDGNTCFMNSVLQSLAS 120

Query: 119 SKSLMQFLDEELMEASKE------LENPNETSSAVEEEGNLGSNSELRNRSSSK---KTY 169
           S+ L++FLDEE++E S++       E      SA   +G  G   ++   S  K   K+Y
Sbjct: 121 SQQLLEFLDEEIVERSQDDEEPEEFEVEGGRRSADNADGLDGGLEKMEEESKPKVKGKSY 180

Query: 170 GKRKKRLTRNAE----KDAALEDEGVNMEFSAALKELLEKLNDKYHRDKPYFKTNKLLKT 225
           GKRKK+ TR+AE     + A E+E  +++FS  LKEL +KLN K++ ++PYFKTN+LLKT
Sbjct: 181 GKRKKKQTRDAEARVLSEKAEEEEEADVQFSITLKELFDKLNAKHYSERPYFKTNRLLKT 240

Query: 226 MSKAPNKNIILGYDQEDAQEFFQTILSELEKNIKSLRGKSDKDNEPTELADIPKNAMIGQ 285
           MSKAPNKNIILGYDQEDAQEFFQTILSELEKN+KS++ K  +   P    ++P +A+IGQ
Sbjct: 241 MSKAPNKNIILGYDQEDAQEFFQTILSELEKNVKSIKTKKKESKTPIPETELPADALIGQ 300

Query: 286 ERLGEMGTVYLPAEQIDPNCVLGHEAKQLFFPFDLVTPLDGITAERIGCLQCGENGGIRY 345
           + L ++GTVY+P EQIDPN VL +   + + PF  VTPLDGITAERIGCL CGENGGIRY
Sbjct: 301 QHLDKIGTVYIPTEQIDPNTVLNNSELKTYTPFQQVTPLDGITAERIGCLNCGENGGIRY 360

Query: 346 SVFSGLSLNLPSDTVGSALKLSQLLREWVKPEIIEGVECNRCALKAVLEHLEKTLTQYEI 405
           SVFSGLSLNLPS+ +GS LKLS L+ EW KPEIIEGVECNRCAL AV +HL+++L+ YE 
Sbjct: 361 SVFSGLSLNLPSENIGSTLKLSGLMNEWAKPEIIEGVECNRCALNAVRDHLQQSLSSYEQ 420

Query: 406 NDKVSEKLVSAVSSRVEELKAILAKPVVDDDDYKKLHTENMVRKCSKSKQILISRPPPLL 465
              + EKLV+AV  R+  L  IL KPV+DD+DYKKLHT NMVRKCSKSKQILISRPPPLL
Sbjct: 421 AGNIPEKLVAAVQKRLNLLNEILNKPVIDDEDYKKLHTVNMVRKCSKSKQILISRPPPLL 480

Query: 466 SIHINRSVFDPRTYTIRKNNSKVLFKSRLNLAPWSCGPDEINLDARLPMSKKDQRAMESS 525
           S+HINRSVFDPRT++IRKNNS+VLFK R NLAPW C  DEINLDARLPMSKK +   ESS
Sbjct: 481 SVHINRSVFDPRTFSIRKNNSRVLFKPRFNLAPWCCNIDEINLDARLPMSKKQEAPQESS 540

Query: 526 EDENIGGEYFAKLHRRXXXXXXXXXXX----XXNYSEKNRLNSDYDPLKGEL 573
           EDE IGGEYFAKLHR+                  Y  K R  SDYDPLKGE+
Sbjct: 541 EDEAIGGEYFAKLHRKFQEEFEDSDSEDDEGRDTYYNK-RDVSDYDPLKGEI 591

>NDAI0B03430 Chr2 complement(868578..871148) [2571 bp, 856 aa] {ON}
          Length = 856

 Score =  639 bits (1649), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/734 (48%), Positives = 452/734 (61%), Gaps = 108/734 (14%)

Query: 75  VFNKWGSRNPAQEATMLKRGGYVGGLINDGNTCFMNSVIQSLASSKSLMQFLDEELMEAS 134
           +  +W  R+   ++ +L  GGY+ GL+NDGNTCFMNSV+QSLASSK LM FLD  + +  
Sbjct: 105 IMRRWMPRSSQMDSNVLNHGGYIAGLLNDGNTCFMNSVLQSLASSKELMDFLDTTIKQEQ 164

Query: 135 KELENPNETSSAVEEEGNLGSNSELRNRSSSKKTYGKRKKRLTRNAEKDAALEDEGVNME 194
           +                          +   ++  G  KK              E V++ 
Sbjct: 165 E--------------------------QEQEQEQVGDEKK--------------EDVDIG 184

Query: 195 FSAALKELLEKLNDKYHRDKPYFKTNKLLKTMSKAPNKNIILGYDQEDAQEFFQTILSEL 254
           F+ +L ELL +LN KY++++PYFKTNKLLKTM  APNKN++LGYDQEDAQEFFQ ILSEL
Sbjct: 185 FTLSLNELLSQLNAKYYKERPYFKTNKLLKTMKNAPNKNMLLGYDQEDAQEFFQNILSEL 244

Query: 255 EKNIKSLRGKSDK------------DNEPTEL--ADIPKNAMIGQERLGEMGTVYLPAEQ 300
           EKN+KS+  +++K             NE  ++   D+PK+A+IGQE+LG++GTVY+P EQ
Sbjct: 245 EKNLKSISSQNNKEEEEEKKEQEKNSNECVKILKKDLPKDAIIGQEQLGKVGTVYIPTEQ 304

Query: 301 IDPNCVLG----HEAKQLFFPFDLVTPLDGITAERIGCLQCGENGGIRYSVFSGLSLNLP 356
           I+PN        +  ++L+ PF L+TPLDGI+AERIGCLQCGENGGIRYSVFSGLSLNLP
Sbjct: 305 IEPNTSTALPSSNPQEKLYTPFKLITPLDGISAERIGCLQCGENGGIRYSVFSGLSLNLP 364

Query: 357 SDTVGSALKLSQLLREWVKPEIIEGVECNRCALKAVLEHLEKTLTQYEIND-KVSEKLVS 415
           ++ +G  LKLS LL EW+KPEII+GVECNRCAL+A+  HL   L QY  N  ++ +KL+ 
Sbjct: 365 NENIGMTLKLSNLLNEWIKPEIIDGVECNRCALEAIKSHLLDQLEQYHNNSTEIPQKLID 424

Query: 416 AVSSRVEELKAILAKPVVDDDDYKKLHTENMVRKCSKSKQILISRPPPLLSIHINRSVFD 475
           AV  RVE L+ IL+KPV+D++DYKKLHTENMVRKCSKSKQILISRPPPLLSIHINRSVFD
Sbjct: 425 AVKDRVECLQKILSKPVIDEEDYKKLHTENMVRKCSKSKQILISRPPPLLSIHINRSVFD 484

Query: 476 PRTYTIRKNNSKVLFKSRLNLAPWSCGPDEINLDARLPMSKKD----QRAMESSEDENIG 531
            RTY IRKNNS+VLFKS+LNL PW+C  DEINLDARLPMSKK+    Q      ++    
Sbjct: 485 VRTYQIRKNNSRVLFKSKLNLEPWTCDIDEINLDARLPMSKKESSLGQDEFSEDDEATTN 544

Query: 532 GEYFAKLHRRXXXXXXXXXXXXXN------YSEKN---RLNSD---YDPLKGELXXXXXX 579
           GEY+ +LH++             +      YS  N   R   D   YDPL GE+      
Sbjct: 545 GEYYNRLHQKYQQEFEDSSDEDDDSDDNEIYSMDNNRRRTRKDVRNYDPLNGEIEDSSSV 604

Query: 580 XXXXXXXXX------XXXLGN----RVFKCKNIQSDSDVNSVEEASEEDKPDTNDLENRE 629
                             LGN    RV K +  +   D  S+E+ +E  + +     + +
Sbjct: 605 YSSADEKDTHDSIEETDSLGNTIRKRVIKQETFERAED--SIEKENEGAEAN-----HDD 657

Query: 630 ITGGVGQENXXXXXXXXXXXXTQPTELNPLSAGQLAPSSSTVPSG--------------- 674
                  E             + P   +          +S  PSG               
Sbjct: 658 DNDDNNDEQEHKGNNDDELPSSSPLAASEEEEDGEVQETSLSPSGAIPQTIRKKFDSTPI 717

Query: 675 -PLTYALRSVIVHYGSHNYGHYIAFRKFRGLWWRISDETVYVVDEAEVLSTPGVFMLFYE 733
            PLTY+LRSVIVHYG+HNYGHYIAFRK+RG+WWRISDETVY+VDEAEVLSTPGVFMLFYE
Sbjct: 718 GPLTYSLRSVIVHYGTHNYGHYIAFRKYRGVWWRISDETVYIVDEAEVLSTPGVFMLFYE 777

Query: 734 HDYNQTLQKMNDDL 747
           +DY++   K+ DDL
Sbjct: 778 YDYDEITGKLKDDL 791

>KLLA0E08801g Chr5 (784991..787306) [2316 bp, 771 aa] {ON} similar
           to uniprot|P25037 Saccharomyces cerevisiae YDL122W UBP1
           Ubiquitin-specific protease that removes ubiquitin from
           ubiquitinated proteins cleaves at the C terminus of
           ubiquitin fusions irrespective of their size capable of
           cleaving polyubiquitin chains
          Length = 771

 Score =  620 bits (1598), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/530 (56%), Positives = 396/530 (74%), Gaps = 6/530 (1%)

Query: 14  ILSLFIKNLNIDHKS--PTFLVIVASTGLLIYKNRRYIRNIMDALGTVGGDLTRGFRNSY 71
           +L+  ++ L  + K      L+ + ++   +YKN   I  +  ++ +   ++T+  R+  
Sbjct: 1   MLTTILEKLGFEEKRVLKAVLIGLIASLYFLYKNEFDITRVAVSVVSTTKEITQAVRDKI 60

Query: 72  KGSVFNKWGSRNPAQEATMLKRGGYVGGLINDGNTCFMNSVIQSLASSKSLMQFLDEELM 131
              +  +W  RN  QE T+++RGGYVGGL+NDGNTCFMNSV+Q LASSK L +F+D  ++
Sbjct: 61  ---MLGRWAPRNAEQEETIVRRGGYVGGLVNDGNTCFMNSVLQCLASSKELHKFMDTIIL 117

Query: 132 EASKELENPNETSSAVEEEGNLGSNSELRNRSSSKKTYGKRKKRLTRNAEKDAALEDEGV 191
           +++ + +N  + +    +  N  S  E + +++  KTYGKRKK   R A+ +        
Sbjct: 118 DSNDDSQNTIDENGEESDLPNEQSTVEKKPKATKNKTYGKRKKIAVRQADNELLKNSTEP 177

Query: 192 NMEFSAALKELLEKLNDKYHRDKPYFKTNKLLKTMSKAPNKNIILGYDQEDAQEFFQTIL 251
           NM F+ AL++L  KLN K++R++P+FKTNKLLKTMSKAPN+NIILGYDQEDAQEFFQTIL
Sbjct: 178 NMHFTLALQDLFSKLNAKHYRNRPWFKTNKLLKTMSKAPNRNIILGYDQEDAQEFFQTIL 237

Query: 252 SELEKNIKSLRGKSDKDNEPTELADIPKNAMIGQERLGEMGTVYLPAEQIDPNCVLGHEA 311
           SELEKN++S+ GK +KD +P    D+P++A++GQE LGE+G VY+P EQIDPN VL    
Sbjct: 238 SELEKNVESIYGKPEKDPKPVPQDDLPEDAIVGQEHLGEIGDVYIPTEQIDPNSVLA-SG 296

Query: 312 KQLFFPFDLVTPLDGITAERIGCLQCGENGGIRYSVFSGLSLNLPSDTVGSALKLSQLLR 371
           ++ + P+ +VTPLDGITAERIGCLQCGENGGIRYSVFSGLSLNLPSD +GS +KLSQLL 
Sbjct: 297 RKFYSPYKIVTPLDGITAERIGCLQCGENGGIRYSVFSGLSLNLPSDNIGSPIKLSQLLD 356

Query: 372 EWVKPEIIEGVECNRCALKAVLEHLEKTLTQYEINDKVSEKLVSAVSSRVEELKAILAKP 431
           EW KPEIIEGV+CNRCAL AVLEHL + L   +    V++KLV+ +  R+ E+K++L+K 
Sbjct: 357 EWSKPEIIEGVDCNRCALNAVLEHLVEQLNTIQSQPDVNQKLVTLMEDRINEVKSVLSKL 416

Query: 432 VVDDDDYKKLHTENMVRKCSKSKQILISRPPPLLSIHINRSVFDPRTYTIRKNNSKVLFK 491
            +DDDDYK++HTENMVRK SKSKQILISRPPPLLS+HINRSVFDPRTY IRKNNS+V+FK
Sbjct: 417 AIDDDDYKRMHTENMVRKSSKSKQILISRPPPLLSVHINRSVFDPRTYMIRKNNSRVIFK 476

Query: 492 SRLNLAPWSCGPDEINLDARLPMSKKDQRAMESSEDENIGGEYFAKLHRR 541
           S+LNL+PW C  D+INLDARLPMSKK +   ESSED+N G EY+ KLHRR
Sbjct: 477 SKLNLSPWCCNYDKINLDARLPMSKKQENWHESSEDDNNGTEYYNKLHRR 526

 Score =  152 bits (385), Expect = 9e-38,   Method: Compositional matrix adjust.
 Identities = 64/84 (76%), Positives = 74/84 (88%)

Query: 669 STVPSGPLTYALRSVIVHYGSHNYGHYIAFRKFRGLWWRISDETVYVVDEAEVLSTPGVF 728
           S+VP+GPLTY LRSVIVHYG+HNYGHYIAFR+FRG WWRISDE+VY+VDE EVLSTPGVF
Sbjct: 672 SSVPAGPLTYVLRSVIVHYGTHNYGHYIAFRRFRGCWWRISDESVYIVDEQEVLSTPGVF 731

Query: 729 MLFYEHDYNQTLQKMNDDLEWEEQ 752
           MLFYE+DY+    KM DD E+E +
Sbjct: 732 MLFYEYDYDTETGKMKDDTEYENE 755

>NCAS0B06130 Chr2 complement(1159264..1161576) [2313 bp, 770 aa]
           {ON} Anc_2.307 YDL122W
          Length = 770

 Score =  580 bits (1496), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/505 (59%), Positives = 369/505 (73%), Gaps = 47/505 (9%)

Query: 40  LLIYKNRRYIRNIMDALGTVGGDLTRGFRNSYKGSVFNKWGSRNPAQEATMLKRGGYVGG 99
            ++  N ++I+  M        DLT  F+N+   ++F +W  R    +  +LK+GG+VGG
Sbjct: 43  FILLTNLQFIKYKM-------SDLTNKFKNN---NMFRRWIPRAGNIDDKILKKGGFVGG 92

Query: 100 LINDGNTCFMNSVIQSLASSKSLMQFLDEELMEASKELENPNETSSAVEEEGNLGSNSEL 159
           L+NDGNTCFMNSV+QSLASSK L  FLD+ +++  +E E                     
Sbjct: 93  LVNDGNTCFMNSVLQSLASSKELNAFLDDSIIKKFQEQE--------------------- 131

Query: 160 RNRSSSKKTYGKRKKRLTRNAEKDAALEDEGVNMEFSAALKELLEKLNDKYHRDKPYFKT 219
                        K +   +  +    E++ V++ FS A KELL+KLN KY+RDKPYF+T
Sbjct: 132 ------------EKIQNEEDPNEKEEEEEKDVDVRFSVAFKELLDKLNSKYYRDKPYFRT 179

Query: 220 NKLLKTMSKAPNKNIILGYDQEDAQEFFQTILSELEKNIKSLRGKSDKDNEPTELADIPK 279
           NKLLKTMS APNKN++LGYDQEDAQEFFQ ILSELEKN+KSL  K   DN P    ++P 
Sbjct: 180 NKLLKTMSNAPNKNMLLGYDQEDAQEFFQNILSELEKNVKSLDPKK-FDNTPIPENELPD 238

Query: 280 NAMIGQERLGEMGTVYLPAEQIDPNCVLGHEAK--QLFFPFDLVTPLDGITAERIGCLQC 337
           +A+IGQ  LG++GTV+LP EQI+PN VL ++    + + PF L+TPLDGI+AERIGCLQC
Sbjct: 239 DAIIGQANLGDVGTVFLPTEQIEPNSVLNNDENDTKFYTPFKLITPLDGISAERIGCLQC 298

Query: 338 GENGGIRYSVFSGLSLNLPSDTVGSALKLSQLLREWVKPEIIEGVECNRCALKAVLEHLE 397
           GENGGIRYSVFSGLSLNLP + +GS LKL+ LL+EW+KPEIIEGVEC RC L+A+  HL 
Sbjct: 299 GENGGIRYSVFSGLSLNLPGENIGSTLKLTGLLKEWIKPEIIEGVECYRCGLEAIRSHLL 358

Query: 398 KTLTQY-EINDKVSEKLVSAVSSRVEELKAILAKPVVDDDDYKKLHTENMVRKCSKSKQI 456
           + L QY E N  + EKL+ AVS R++ L++ILAKPV++D+DYKKLHTENMVRKCSKSKQI
Sbjct: 359 EQLEQYRESNSGIPEKLLVAVSDRIKVLESILAKPVIEDEDYKKLHTENMVRKCSKSKQI 418

Query: 457 LISRPPPLLSIHINRSVFDPRTYTIRKNNSKVLFKSRLNLAPWSCGPDEINLDARLPMSK 516
           +ISRPPPLLSIHINRSVFDPRTY IRKNNS+VLFKSRLNL PW C   EINLDARLPMSK
Sbjct: 419 IISRPPPLLSIHINRSVFDPRTYQIRKNNSRVLFKSRLNLEPWCCNSSEINLDARLPMSK 478

Query: 517 KDQRAMESSEDENIGGEYFAKLHRR 541
           K+Q A ESSEDENIGGEY+AKLH++
Sbjct: 479 KEQFAQESSEDENIGGEYYAKLHQK 503

 Score =  160 bits (404), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 69/99 (69%), Positives = 81/99 (81%)

Query: 658 PLSAGQLAPSSSTVPSGPLTYALRSVIVHYGSHNYGHYIAFRKFRGLWWRISDETVYVVD 717
           PL      P   T P+GPLTY+LRSVIVHYG+HNYGHYIAFRKFRG WWRISDETVY+VD
Sbjct: 624 PLEPLSTVPPPVTAPAGPLTYSLRSVIVHYGTHNYGHYIAFRKFRGCWWRISDETVYIVD 683

Query: 718 EAEVLSTPGVFMLFYEHDYNQTLQKMNDDLEWEEQEEGI 756
           EAEVLSTPGVFMLFYE+DY++   K+ DDL+ E+++  I
Sbjct: 684 EAEVLSTPGVFMLFYEYDYDEATGKLKDDLDNEKEDMDI 722

>TBLA0B06080 Chr2 (1437254..1439728) [2475 bp, 824 aa] {ON}
           Anc_2.307 YDL122W
          Length = 824

 Score =  555 bits (1429), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/518 (55%), Positives = 371/518 (71%), Gaps = 32/518 (6%)

Query: 74  SVFNKWGSRNPAQ-EATMLKRGGYVGGLINDGNTCFMNSVIQSLASSKSLMQFLDEELME 132
           S + KW ++N  Q + T++KRGG+VGGL+N+GNTCFMNSV+QSLASS  +++FLDEE+++
Sbjct: 10  SGYRKWVTKNNLQIQNTVMKRGGFVGGLVNEGNTCFMNSVLQSLASSHEIVRFLDEEIIK 69

Query: 133 ASK-----ELENPNETSSAVEEEGNLGSNSELRNRSSSKKTYGKRKKRLTRNAEKDAALE 187
             K     ELE  ++ S +         N +  ++ S  K+YGKRKK+LT+  + D +  
Sbjct: 70  QFKQKQLQELEELHKKSDSAHNH----HNHQQDDKKSKNKSYGKRKKKLTKTNDDDMS-- 123

Query: 188 DEGVNMEFSAALKELLEKLNDKYHRDKPYFKTNKLLKTMSKAPNKNIILGYDQEDAQEFF 247
               ++ FS +LK+LL+KLNDKY+R++ Y++TN LLKTMSKAPNKNIILGY+QEDAQEFF
Sbjct: 124 ---TDVSFSISLKDLLDKLNDKYYRERKYYRTNNLLKTMSKAPNKNIILGYEQEDAQEFF 180

Query: 248 QTILSELEKNIKSLRGKSDK-DNEPTELADIPKNAMIGQERLGEMGTVYLPAEQIDPNCV 306
           QTIL ELEKNIK L    +K D +P   +D+P NA+IGQ  L  +GTVY+P   +DPN +
Sbjct: 181 QTILYELEKNIKFLDSDREKLDKKPIPESDLPSNALIGQNNLSHVGTVYIPTAHLDPNSL 240

Query: 307 LGHEAKQLFF-PFDLVTPLDGITAERIGCLQCGENGGIRYSVFSGLSLNLPSDTVGSALK 365
           L  +    +F PF LVTPLDGI AERIGCL CGE GGIRYSV SGLSLNLPS+ +G  LK
Sbjct: 241 LDKDPSTNYFTPFRLVTPLDGIVAERIGCLNCGETGGIRYSVSSGLSLNLPSENIGDTLK 300

Query: 366 LSQLLREWVKPEIIEGVECNRCALKAVLEHLEKTLTQYEINDK--VSEKLVSAVSSRVEE 423
           LSQLL EW KPEIIEGV C RC+L AVLEHLE  L       K  + +KL+SA+ +R++ 
Sbjct: 301 LSQLLNEWCKPEIIEGVNCYRCSLNAVLEHLENQLKTMSEKPKGSIPDKLISAIKTRIKA 360

Query: 424 LKAILAKPVVDDDDYKKLHTENMVRKCSKSKQILISRPPPLLSIHINRSVFDPRTYTIRK 483
           L   L+KPV+DD++YKK+HT+NMVRK SKSKQI+++RPPPLLSIHINRSVFD RT+ I+K
Sbjct: 361 LNETLSKPVIDDEEYKKMHTDNMVRKSSKSKQIILARPPPLLSIHINRSVFDTRTFMIKK 420

Query: 484 NNSKVLFKSRLNLAPWSCGPDEINLDARLPMSKKDQRAME----SSEDENIGGEYFAKLH 539
           NNS++ FK+RLNL PW C  ++INLDARLPMSK  Q++ E    SSEDE +GGEY+AKLH
Sbjct: 421 NNSRLAFKARLNLKPWCCDVNDINLDARLPMSKT-QKSEEDGSISSEDETVGGEYYAKLH 479

Query: 540 ----RRXXXXXXXXXXXXXNYSEKN-RLNSD---YDPL 569
               +              +YS+ N R N D   YDPL
Sbjct: 480 DKFQKEFEDSDEEQEDGMSDYSDYNMRSNRDVDNYDPL 517

 Score =  146 bits (369), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 64/84 (76%), Positives = 74/84 (88%), Gaps = 1/84 (1%)

Query: 665 APSSST-VPSGPLTYALRSVIVHYGSHNYGHYIAFRKFRGLWWRISDETVYVVDEAEVLS 723
           AP+ ST VP+GPLTY LRSVIVHYG+HNYGHYIAFRK+RG WWRISDETV++VDEAEVLS
Sbjct: 658 APTYSTKVPTGPLTYELRSVIVHYGTHNYGHYIAFRKYRGTWWRISDETVHMVDEAEVLS 717

Query: 724 TPGVFMLFYEHDYNQTLQKMNDDL 747
           TP VFMLFYE+D+++    M DDL
Sbjct: 718 TPSVFMLFYEYDFDEKSGMMKDDL 741

>KNAG0A05450 Chr1 (806796..809090) [2295 bp, 764 aa] {ON} Anc_2.307
           YDL122W
          Length = 764

 Score =  486 bits (1252), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 261/504 (51%), Positives = 331/504 (65%), Gaps = 70/504 (13%)

Query: 84  PAQEATMLKRGGYVGGLINDGNTCFMNSVIQSLASSKSLMQFLDEELMEASKELENPNET 143
           P+ +  +LKRGG+V GL+NDGNTCFMNSV+QSLASS+ L  FLD+ + E+     N NE 
Sbjct: 52  PSMDDVILKRGGFVAGLVNDGNTCFMNSVLQSLASSRELAHFLDDIIEESEP---NKNE- 107

Query: 144 SSAVEEEGNLGSNSELRNRSSSKKTYGKRKKRLTRNAEKDAALEDEGVNMEFSAALKELL 203
                                                            + FS A K LL
Sbjct: 108 -------------------------------------------------LNFSVAFKTLL 118

Query: 204 EKLNDKYHRDKPYFKTNKLLKTMSKAPNKNIILGYDQEDAQEFFQTILSELEKNIK---- 259
           +KLN KY R++ Y++ N LLKTM   PNKNI+LGYDQEDAQEFFQ I+S+LEK++K    
Sbjct: 119 DKLNAKYGRNRKYYRPNALLKTMESGPNKNILLGYDQEDAQEFFQQIISQLEKDLKKEDT 178

Query: 260 --------SLRGKSDKDNEPTELADIPKNAMIGQERLGEMGTVYLPAEQIDPNCVLGH-E 310
                   S++  S+ D  P   +D+P +A++ QE L ++GTVY+P EQ++PN  LG  E
Sbjct: 179 DGDFKKEESVQPSSEDDKTPILESDLPADALLNQENLEKVGTVYIPTEQVEPNFALGKGE 238

Query: 311 AKQLFFPFDLVTPLDGITAERIGCLQCGENGGIRYSVFSGLSLNLPSDTVGSALKLSQLL 370
            +  + P+ L+TPLDGI AERIGCL CGENGGIRYSV SGLSLNLP++ +G+ LKLS+LL
Sbjct: 239 HESFYTPYKLLTPLDGIIAERIGCLNCGENGGIRYSVSSGLSLNLPNENIGATLKLSELL 298

Query: 371 REWVKPEIIEGVECNRCALKAVLEHLEKTLTQYEINDKVS-EKLVSAVSSRVEELKAILA 429
            +WV+PEIIEGV+CNRCAL+AV  HL + L  +E N+K    KL+ A+  RV+ L+  L 
Sbjct: 299 DKWVEPEIIEGVDCNRCALEAVRSHLLEQLEGFEKNEKAPPAKLIDAMKERVKVLEETLL 358

Query: 430 KPVVDDDDYKKLHTENMVRKCSKSKQILISRPPPLLSIHINRSVFDPRTYTIRKNNSKVL 489
           KP +DD+DYKKLHT+NMVRKCSKSKQ++ISRPPPLLSIHINRSVFDPRTY I KN S+VL
Sbjct: 359 KPAIDDEDYKKLHTDNMVRKCSKSKQVVISRPPPLLSIHINRSVFDPRTYMICKNGSRVL 418

Query: 490 FKSRLNLAPWSCGPDEINLDARLPMSKKDQRAMESSEDENIGGEYFAKLHRRXXXXXXXX 549
           FKS+LNL  W C P EINLDARLPMSKK +R+ +SSE+E     YF+KLH+R        
Sbjct: 419 FKSKLNLDQWCCSPLEINLDARLPMSKKQKRSRDSSEEEEEELAYFSKLHQRFQREFEDS 478

Query: 550 XXXXXNY-SEKNRLNSDYDPLKGE 572
                   ++KN    DYDPL G+
Sbjct: 479 SEDEEPIRTDKNV--KDYDPLGGQ 500

 Score =  142 bits (357), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 60/85 (70%), Positives = 73/85 (85%)

Query: 672 PSGPLTYALRSVIVHYGSHNYGHYIAFRKFRGLWWRISDETVYVVDEAEVLSTPGVFMLF 731
           P+ PLTY+LRSVIVHYG+HNYGHYIAFRK+RG WWRISDETV +V EAEVLSTPGVFMLF
Sbjct: 618 PATPLTYSLRSVIVHYGTHNYGHYIAFRKYRGCWWRISDETVGIVTEAEVLSTPGVFMLF 677

Query: 732 YEHDYNQTLQKMNDDLEWEEQEEGI 756
           YE+DY++   K+ DD++ E+  + I
Sbjct: 678 YEYDYDEATGKLRDDVDQEQMSDEI 702

>TBLA0B07160 Chr2 complement(1696047..1697201) [1155 bp, 384 aa]
           {ON} Anc_2.307 YDL122W
          Length = 384

 Score =  301 bits (771), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 167/342 (48%), Positives = 224/342 (65%), Gaps = 48/342 (14%)

Query: 231 NKNIILGYDQEDAQEFFQTILSELEKNIKSL-------RGKSDKDN--EPTELADIPKNA 281
           N++++LGY Q+DAQEFFQ IL++LEKN+K +       + KS+++N  +      +P +A
Sbjct: 6   NQDVVLGYAQQDAQEFFQAILAKLEKNVKQIEHIPLKEKNKSNQNNILKSIPFEKLPSDA 65

Query: 282 MIGQERLGEMGTVYLPAEQIDPNCVLGHEA------KQLFFPFDLVTPLDGITAERIGCL 335
           ++G + L ++GTV++P +QI+PN +  +E+       QLF PF L+TPLDGI AERIGCL
Sbjct: 66  LLGHDHLDKVGTVFIPTDQINPNLIKNNESINSSNTNQLFTPFKLITPLDGIIAERIGCL 125

Query: 336 QCGENGGIRYSVFSGLSLNLPSDTVGSALKLSQLLREWVKPEIIEGVECNRCALKAVLEH 395
            CGENGGIRYSV S LSLNLP+ T   ++ L +LL  + +PEIIE V CNRC L ++ + 
Sbjct: 126 NCGENGGIRYSVSSSLSLNLPNYT-NDSISLYELLSNYTQPEIIEQVNCNRCTLASMYDS 184

Query: 396 LEKTL---------------------------TQYEINDKVSEKLVSAVSSRVEELKAIL 428
           +   L                           T   IND  + KL S ++ R+  +  +L
Sbjct: 185 INSKLKELTSEDVNINQIDNNTQEDENSTIEKTSMAINDS-NNKLKSVLTERLNTISNVL 243

Query: 429 AKPVVDDDDYKKLHTENMVRKCSKSKQILISRPPPLLSIHINRSVFDPRTYTIRKNNSKV 488
           +KPV+DDD +K L T NM  + SKSKQ+LISRPPPLLSIHINRSVFDP TY IRKNNS+V
Sbjct: 244 SKPVIDDDSFKTLSTSNMTCQTSKSKQLLISRPPPLLSIHINRSVFDPTTYQIRKNNSRV 303

Query: 489 LFKSRLNLAPWSCGPDEINLDARLPMSKK----DQRAMESSE 526
           LF+SRLNL  + C  DEINLDARLPM+K+    D++  ESSE
Sbjct: 304 LFESRLNLNGFCCNIDEINLDARLPMNKRDVTPDEKINESSE 345

>NCAS0G03680 Chr7 complement(682617..684065) [1449 bp, 482 aa] {ON}
           Anc_2.307 YDL122W
          Length = 482

 Score =  152 bits (384), Expect = 9e-39,   Method: Compositional matrix adjust.
 Identities = 134/405 (33%), Positives = 194/405 (47%), Gaps = 77/405 (19%)

Query: 94  GGYVGGLINDGNTCFMNSVIQSLASSKSLMQFLDEELMEASKELENPNETSSAVEEEGNL 153
           G  +GGLIN+GN+CFMNSV+Q+LAS  SL++FL  EL+     LE P     A +EE   
Sbjct: 23  GSTLGGLINNGNSCFMNSVLQALASLPSLLKFL--ELI-----LETP-----ATQEEP-- 68

Query: 154 GSNSELRNRSSSKKTYGKRKKRLTRNAEKDAALEDEGVNMEFSAALKELLEKLNDKYHRD 213
             + E+  ++  K  YG+RKK   +  E              +  LK+L  K N K    
Sbjct: 69  -KHVEISKKAQKKSKYGRRKKGRKKQVEPQEDEHSLTFLKLLNGLLKKLNVKCNSKS--- 124

Query: 214 KPYFKTNKLLKTMSKAPNKNIILGYDQEDAQEFFQTILSELEKNIKSLRGKSDKDNEPTE 273
              F  + LL+  +  P   + +  DQ+DAQEFFQ IL E++K   SL  K D      E
Sbjct: 125 ---FDCDSLLR--ASGPQFKLDME-DQQDAQEFFQHILLEIDK--VSLPPKYD------E 170

Query: 274 LADIPKNAMIGQERLGEMGTVYLPAEQIDPNCVLGHEAKQLFFPFDLVTPLDGITAERIG 333
                 N +         G  Y P             +K+L     + +P DGI    I 
Sbjct: 171 ATSTFTNVL----ECVNYGVCYFPDV-----------SKEL----TIRSPFDGIMKTTIR 211

Query: 334 CLQCGENGGIRYSVFSGLSLNLPSDTVGSALKLSQLLREWVKPEIIEGVECNRCALKAVL 393
           CLQC E     YS+ S ++LNLP  T     KLS L+  W++P I+E V CN+C L    
Sbjct: 212 CLQCNEISNAHYSILSNITLNLPH-TKSDCFKLSTLIHRWIEPCILEDVTCNKCTL---- 266

Query: 394 EHLEKTLTQYEINDKVSEKLVSAVSSRVEELKAILAKPVVDDDDYKKLHT-ENMVRKCSK 452
             L +T                + +  VEEL  +L+   ++D+D  KL       +K +K
Sbjct: 267 --LNRT----------------SRTPDVEEL--LLSGKYIEDEDMIKLKIIPEEKKKGNK 306

Query: 453 SKQILISRPPPLLSIHINRSVFDPRTYTIRKNNSKVLFKSRLNLA 497
            +   + + P ++S HINRS F  +T+ IRK+N +VLFK +L ++
Sbjct: 307 LRNSYMVQLPHVMSFHINRSRFHKKTFKIRKDNRRVLFKLQLTIS 351

 Score =  101 bits (252), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 40/58 (68%), Positives = 50/58 (86%)

Query: 676 LTYALRSVIVHYGSHNYGHYIAFRKFRGLWWRISDETVYVVDEAEVLSTPGVFMLFYE 733
           + Y L++VI+HYG+HNYGHYI++RKF   WWRISDE+V  VDE EVL++PGVFMLFYE
Sbjct: 420 IIYDLKAVIIHYGTHNYGHYISYRKFMNQWWRISDESVIEVDEMEVLTSPGVFMLFYE 477

>NDAI0G00780 Chr7 (164452..165912) [1461 bp, 486 aa] {ON} 
          Length = 486

 Score =  140 bits (353), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 123/424 (29%), Positives = 195/424 (45%), Gaps = 97/424 (22%)

Query: 97  VGGLIND-GNTCFMNSVIQSLASSKSLMQFLDEELMEASKELE-NPNETSSAVEEEGNLG 154
           +GGL ND GN+CF+NS++QS AS   L+QFLD  +   +   + N  E ++ +E++    
Sbjct: 5   IGGLNNDDGNSCFINSILQSSASCNYLLQFLDNVIENKTTGTDANVAEFTTTIEKKPKC- 63

Query: 155 SNSELRNRSSSKKTYGKRKKRLTRN-----AEKDAALEDEGVNMEFSAALKELLEKLNDK 209
                     SK  YGK+KK   +N     AEK++   +   N +F   L++LL  +N +
Sbjct: 64  --------IISKSKYGKKKKNKKQNQKNPLAEKNSKYHN---NEKFFIELRKLLTNVNTR 112

Query: 210 Y-HRDKPYFKTNKLLKTMSKAPNKNIILGYDQEDAQEFFQTILSELEKNIKSLRGKSDKD 268
           Y H+    F T+K + T+S   ++ II   DQ+DAQEF Q + ++LEK            
Sbjct: 113 YTHKKGLSFSTSKFISTLS---SQTIINATDQQDAQEFLQILFNDLEK------------ 157

Query: 269 NEPTELADIPKNAMIGQERLGEMGTVYLPAEQIDPNCVLGHEAKQLFFPFDLVTPLDGIT 328
                                    ++    +I  N  L            + TP +GI 
Sbjct: 158 -----------------------SQIFHTTVKITSNDALQ-----------IKTPFEGIL 183

Query: 329 AERIGCLQCGENGGIRYSVFSGLSLNLPSDTVGSALKLSQLLREWVKPEIIEGVECNRCA 388
             R+ CL C E     + +FS L+L+LP  +         L   W + + +E V CNRC 
Sbjct: 184 MARMKCLTCDEISNPNFKLFSNLTLSLPRYSKQETFN-DILSTFWNQLDYVENVSCNRCT 242

Query: 389 LKAVLEHLEKTLTQYEINDKVSEKLVSAVSSRVEELKAILAKPVVDDDDYKK-LHTENM- 446
           L   L+H                      ++   E + +L K V+ DDD +  L  +N+ 
Sbjct: 243 L---LKH----------------------ANSNSEYQNLLVKDVIKDDDMENILKRDNLE 277

Query: 447 VRKCSKSKQILISRPPPLLSIHINRSVFDPRTYTIRKNNSKVLFKSRLNLAPWSCGPDEI 506
           + K +K KQI I +PP +LS H NRS+FD + +  +KNN KVL   +LN++ +     ++
Sbjct: 278 MVKSNKIKQIKILKPPKILSFHFNRSIFDRKQFKFKKNNCKVLLTPKLNISKFCIVDSDL 337

Query: 507 NLDA 510
            +D 
Sbjct: 338 AVDV 341

 Score = 96.7 bits (239), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 50/65 (76%)

Query: 671 VPSGPLTYALRSVIVHYGSHNYGHYIAFRKFRGLWWRISDETVYVVDEAEVLSTPGVFML 730
           + +    Y+L+S++VHYGSH+YGHYI++R+F   WWRISDE+V  VDE EV S  G+F++
Sbjct: 421 IGNNKCVYSLKSIVVHYGSHDYGHYISYRRFEDQWWRISDESVLKVDEDEVFSASGIFIV 480

Query: 731 FYEHD 735
           FYE D
Sbjct: 481 FYEQD 485

>Ecym_1166 Chr1 (339106..341196) [2091 bp, 696 aa] {ON} similar to
           Ashbya gossypii AEL242W
          Length = 696

 Score = 74.7 bits (182), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 105/424 (24%), Positives = 176/424 (41%), Gaps = 92/424 (21%)

Query: 96  YVGGLINDGNTCFMNSVIQSLASSKSLMQFLD--EELMEASKE---LENPNETSSAVEEE 150
           Y  GL N  N CF NS IQ+LAS  +L ++L+   E++ ++++   L  P + ++   + 
Sbjct: 82  YTTGLTNSRNDCFANSSIQALASLPALAEYLNGVTEVVRSTRQALGLLVPRDDAADFSDH 141

Query: 151 GNLGSNSELRNRSSSKKTYGKRKKRLTRNAEKDAALEDEGV-NMEFSAALKELLEKLNDK 209
           G + S       +              +  E +    D  + ++    AL  ++  L   
Sbjct: 142 GGMPSKKSASPFTDPAAVSANCAAANGKEPEGNHVTPDLLLPDLRMHEALSIMIHNLQQP 201

Query: 210 YHRDKPYFKTN--KLLKTMSKAPNKNIILGYDQEDAQEFFQTILSELEKNIKSLRGKSDK 267
               K Y +T+   LL T+ +  N  I  G  Q DA EF Q +   LEK   +L+   +K
Sbjct: 202 V---KNYTQTSLQPLLHTLEQIHNAKISSG--QNDAHEFSQILFETLEKERLALKTFLEK 256

Query: 268 DNEPTELADIPKNAMIGQERLGEMGTVYLPAEQIDPNCVLGHEAKQLFFPFDLVTPLDGI 327
                +L+DI         R+ E                         FPF       G 
Sbjct: 257 Q----QLSDI---------RIPE-------------------------FPFQ------GS 272

Query: 328 TAERIGCLQCGENGGIRYSVFSGLSLNLPSDTVGSALKLSQLLREWV---KPEIIEGVEC 384
            A  + CL+C  +  +    F+  SL +P  +  S       L++ +   + E IEG  C
Sbjct: 273 LATNLICLRCNNSSKVNVHRFTMHSLPVPQMSSAS-------LKDMMFDNQTETIEGYSC 325

Query: 385 NRCALKAVLEHLEKTLTQYEINDKVSEKLVSAVSSRVEELKAILAKPVVDDD-------- 436
             C L+A+L + E+    + ++ +   KL        ++L  +L +  ++DD        
Sbjct: 326 ISCRLRAILNN-ERQRDYHNVSQEERAKL--------DDLAKLLPRICINDDLPEPLELY 376

Query: 437 --DYKK--LHTENMVRKCSKSKQILISRPPPLLSIHINRSVFDPRTYTIRKNNSKVLFKS 492
              Y K   H  ++  +  K + +++S P  LL +H++RSVFD  TYT  KN+  VLF  
Sbjct: 377 VKSYHKDGCHIPSLKSRILK-RTVVVSSPKVLL-LHLSRSVFDGVTYT--KNSCNVLFPE 432

Query: 493 RLNL 496
            L L
Sbjct: 433 DLIL 436

>AEL242W Chr5 (182610..184451) [1842 bp, 613 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL072W (UBP16)
          Length = 613

 Score = 69.3 bits (168), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 107/455 (23%), Positives = 176/455 (38%), Gaps = 118/455 (25%)

Query: 73  GSVFNKW---GSRNPAQEATMLKRGGYVGGLINDGNTCFMNSVIQSLASSKSLMQFLDEE 129
           G     W   GS    Q +T  ++  +  GL N+ N CF NS IQ+ AS  ++  +L+ E
Sbjct: 49  GPTIYTWLFPGSSAMFQSST--RKDKHTTGLANNRNDCFANSSIQAWASLPAVSVYLN-E 105

Query: 130 LMEASKEL-------ENPNETSSAVEEEGNLGSNS-ELRNRSSSKKTYGKRKKRLTRNAE 181
           +ME  KE+        +     +A +E G + + S E ++ +      G    ++  +  
Sbjct: 106 IMEIRKEVLRRMVRSSDGAHDGAAADEWGEVKAPSPEHKSEAHDMHDSGDHVGQMNLS-- 163

Query: 182 KDAALEDEGVNMEFSAALKELLEKLNDKYHRDKPYFKTNKLLKTMSKAPNKNIILGYDQE 241
                   GV++   AAL ++L +L     +   +     LL T+    +  +  G  Q 
Sbjct: 164 -------NGVDVRMHAALADILYQLQQPVAKST-FISLQPLLHTLELIYSAKLSRG--QN 213

Query: 242 DAQEFFQTILSELEKNIKSLRGKSDKDNEPTELADIPKNAMIGQERLGEMGTVYLPAEQI 301
           DA EF Q +L  LEK             E TEL+ + K    G +RL  +    +PA   
Sbjct: 214 DAHEFTQLLLETLEK-------------EHTELSLMLK----GDKRLEGLA---VPA--- 250

Query: 302 DPNCVLGHEAKQLFFPFDLVTPLDGITAERIGCLQCGENGGIRYSVFSGLSLNLPSDTVG 361
                                P+ G  A+ + CL+CG +  +    FS  +L +P+ T  
Sbjct: 251 --------------------FPIRGSLADNLVCLRCGGSSKVNVHQFSMHTLPVPNAT-- 288

Query: 362 SALKLSQLLREWV---KPEIIEGVECNRCALKAVL-------------------EHLEKT 399
                S  LR+ +   + E I+   C  C ++A+L                   E L + 
Sbjct: 289 -----SADLRDMLFDNQTETIDDYTCVSCQIRAILATEKNRGRQGVDSTELAIIEELARL 343

Query: 400 LTQYEINDKVSEKLVSAVSSRVEELKAILAKPVVDDDDYKKLHTENMVRKCSKSKQILIS 459
                IN+ +   L + VS+                  Y K H      K +  K+ +  
Sbjct: 344 APSISINEDMPPHLAAYVSA------------------YNKDHCITAALKSTIVKRTVSV 385

Query: 460 RPPPLLSIHINRSVFDPRTYTIRKNNSKVLFKSRL 494
             P +L +H++RSVF+  +Y   KN   V F   L
Sbjct: 386 DSPRVLILHLSRSVFNGVSYA--KNTCNVTFPEEL 418

>SAKL0H10076g Chr8 (863358..865661) [2304 bp, 767 aa] {ON} similar
           to gnl|GLV|KLLA0E23463g Kluyveromyces lactis
           KLLA0E23463g and some similarites with YPL072W
           uniprot|Q02863 Saccharomyces cerevisiae YPL072W UBP16
           Putative ubiquitin-specific protease
          Length = 767

 Score = 60.5 bits (145), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 51/193 (26%), Positives = 83/193 (43%), Gaps = 43/193 (22%)

Query: 323 PLDGITAERIGCLQCGENGGIRYSVFSGLSLNLPSDTVGSALKLSQLLREWVKPEIIEGV 382
           P+ G  A+ + CL C ++  +    FS   L +P +   S   L+ ++ +  + E IEG 
Sbjct: 317 PVRGSLADHLVCLNCRDSSKVNVHPFSMYPLPVPQE---STAVLADMISDN-QTETIEGY 372

Query: 383 ECNRCALKA-------------------VLEHLEKTLTQYEINDKVSEKLVSAVSSRVEE 423
            C  C ++A                   VL+ LEK L    IND +S +L + +      
Sbjct: 373 SCLSCKIRAILSNEKQRNFAGTSESERNVLQTLEKILPDIFINDDLSAELTTYI------ 426

Query: 424 LKAILAKPVVDDDDYKKLHTENMVRKCSKSKQILISRPPPLLSIHINRSVFDPRTYTIRK 483
                       D+Y K      + K +  K+ ++   P LL IH++RSVF+   YT  +
Sbjct: 427 ------------DNYNKDGVNTSILKSTIVKKTVVVDSPELLIIHLSRSVFNGMNYT--R 472

Query: 484 NNSKVLFKSRLNL 496
           N+  V F+  L L
Sbjct: 473 NSCNVAFEEDLGL 485

 Score = 37.4 bits (85), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 25/38 (65%)

Query: 96  YVGGLINDGNTCFMNSVIQSLASSKSLMQFLDEELMEA 133
           Y  GLIN+ N CF NS +Q+L+S   L  +L++ L +A
Sbjct: 73  YTTGLINNRNDCFANSSVQALSSLPKLTLYLNDILKQA 110

>Kwal_27.12030 s27 complement(1056215..1058464) [2250 bp, 749 aa]
           {ON} YPL072W (UBP16) - putative deubiquitinating enzyme
           [contig 24] FULL
          Length = 749

 Score = 59.3 bits (142), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 46/178 (25%), Positives = 85/178 (47%), Gaps = 15/178 (8%)

Query: 323 PLDGITAERIGCLQCGENGGIRYSVFSGLSLNLPSDTVGSALKLSQLLREWVKPEIIEGV 382
           P+ G  A+ + CL C  +  +    F+   L +P +   S     + +    + E IEG 
Sbjct: 311 PVKGCLADHLICLNCQGSSKVNLHPFTMYPLPVPQEHTASL----EAMIAGNQTETIEGY 366

Query: 383 ECNRCALKAVLEHLEKTLTQYEINDKVSEKLVSAVSSRVEELKAILAKPVVDD-----DD 437
            C  C +KA+L   E+   +YE N      +++ +S  V E+   +   + DD     ++
Sbjct: 367 GCLSCKIKAILATEEQR--KYEGNPDEENNILATLSKIVSEI--FINDDLSDDLMNYINN 422

Query: 438 YKKLHTENMVRKCSKSKQILISRPPPLLSIHINRSVFDPRTYTIRKNNSKVLFKSRLN 495
           YKK   +    K +  K+ +++  P +L +H++RSVF+   YT  +N+  V F+  L+
Sbjct: 423 YKKDGCDTSTLKSTIVKKTVVTESPDILILHLSRSVFNGMNYT--RNSCYVTFEEELH 478

 Score = 38.5 bits (88), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 36/63 (57%), Gaps = 7/63 (11%)

Query: 96  YVGGLINDGNTCFMNSVIQSLASSKSLMQFLDEELMEA--SKELENPNETS-----SAVE 148
           Y  GLIN+ N CF NS +Q+L++   L  +L++ L +    K L + NETS     +  +
Sbjct: 69  YTTGLINNRNDCFANSSVQALSALPKLTTYLNDLLKQVLFLKTLLDRNETSDDKPITGTQ 128

Query: 149 EEG 151
           EEG
Sbjct: 129 EEG 131

>Suva_16.240 Chr16 (429066..430637) [1572 bp, 523 aa] {ON} YPL072W
           (REAL)
          Length = 523

 Score = 58.5 bits (140), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 104/410 (25%), Positives = 168/410 (40%), Gaps = 90/410 (21%)

Query: 99  GLINDGNTCFMNSVIQSLASSKSLMQFLDEELMEASKELENPNETSSAVEEEGNLGSNSE 158
           GLIN+GN CF+ S +QSLA     +++L +E+    +EL  P       + + +L  N E
Sbjct: 69  GLINNGNDCFITSSLQSLAGIPRFVEYL-KEINSILRELYKP-------DFKFDLSRNEE 120

Query: 159 LRNRSSSKKTYGKRKKRLTRNAEKDAALEDEGVNMEFSAALKE-LLEKLND--KYHRDKP 215
             N              LT     DA+    G  +  S  L E LL  ++D      +K 
Sbjct: 121 GEN--------------LTTGEIMDAS--RCGSQLSLSTILHESLLSLVSDLVSIRENKK 164

Query: 216 YFKTNKLLKTMSKAPNKNIILGYDQEDAQEFFQTILSELEKNIKSLRGKSDKDNEPTELA 275
                 ++KT+       I     Q DA EF   +L  L++             E ++L 
Sbjct: 165 TISPKLVVKTLETIFKSKI--SSQQNDAHEFTLVLLQTLQE-------------EHSKLV 209

Query: 276 DIPKNAMIGQERLGEMGTVYLPAEQIDPNCVLGHEAKQLFFPFDLVTPLDGITAERIGCL 335
           +  KN          M  + +P                  FPF       G T++ + CL
Sbjct: 210 NYTKN----------MPDLNIPK-----------------FPFQ------GQTSKFLSCL 236

Query: 336 QCGENGGIRYSVFSGLSLNLPSDTVGSALKLSQLLREWVKPEIIEGVECNRCALKAVLEH 395
           QC       Y       L +P     S+ KL ++L    + EIIEG  C  C ++A+L H
Sbjct: 237 QCHRLSKPSYQESFIRELMVPQR---SSEKLMKILAND-ETEIIEGYSCLICQVRAILNH 292

Query: 396 LE----KTLTQYEINDKVSEKLVS-AVSSRVEELKAILAKPVVDDDDYKKLHTENMVRKC 450
            +    K  +Q E+  ++ + L + A  + + E   I  +  +      KL T N+  K 
Sbjct: 293 EKYRTFKNCSQDEL--RILDALKNYANDASINEDLPIKVEQYIKHYAKDKLRTSNV--KS 348

Query: 451 SKSKQILISRPPPLLSIHINRSVFDPRTYTIRKNNSKVLFKSRLNLAPWS 500
           +  K+ +  + P +L IH++RS F+  TYT  +N   V F+  + LA ++
Sbjct: 349 TVIKKDIAVQLPEVLVIHLSRSTFNGMTYT--RNPCNVEFEETIKLAEYT 396

 Score = 35.0 bits (79), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 14/37 (37%), Positives = 23/37 (62%), Gaps = 6/37 (16%)

Query: 669 STVPSGP------LTYALRSVIVHYGSHNYGHYIAFR 699
           +++  GP      + Y L+SV+ H GSH+ GHY+ +R
Sbjct: 396 TSIEKGPSAEYRQIEYHLKSVVKHTGSHSRGHYVCYR 432

>TBLA0H03600 Chr8 complement(877069..878517) [1449 bp, 482 aa] {ON}
           Anc_8.540 YPL072W
          Length = 482

 Score = 57.4 bits (137), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 52/213 (24%), Positives = 94/213 (44%), Gaps = 46/213 (21%)

Query: 306 VLGHEAKQLFFPFDLVT--------PLDGITAERIGCLQCGENGGIRYSVFSGLSLNLPS 357
           VL +E ++L    + +T        P +G     + CL+CG N  ++   F  L+LNLP+
Sbjct: 177 VLHNEYQELIRLMNFITNNLDIPTYPFEGKYCHELTCLKCGRNSEVKMFDFDILTLNLPA 236

Query: 358 DTVGSALKLSQLLREWVKPEIIEGVECNRCALKAVL--------------EHLEKTLTQY 403
                ++ L +L+      ++IEG  C  C + A+L              + L++   + 
Sbjct: 237 Q---PSISLDELI-SGSNSDVIEGFSCTVCKVSAILGGTGTHNPNTRSLIKSLKEIFPEL 292

Query: 404 EINDKVSEKLVSAVSSRVEELKAILAKPVVDDDDYKKLHTENMVRKCSKSKQILISRPPP 463
           +IN ++ E L S                 VD   +  + T N+  K +  K+ +    P 
Sbjct: 293 KINTELDEPLNS----------------FVDSYSHDGVITRNI--KSTIVKKTVFVEVPD 334

Query: 464 LLSIHINRSVFDPRTYTIRKNNSKVLFKSRLNL 496
           +L IH+ RS+F+  +YT  +N  K+ +  +L L
Sbjct: 335 ILLIHLTRSMFNGMSYT--RNACKIAYDEKLLL 365

 Score = 33.1 bits (74), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 20/38 (52%)

Query: 663 QLAPSSSTVPSGPLTYALRSVIVHYGSHNYGHYIAFRK 700
           QL     +V    + Y L S I H GSH+ GHY  +R+
Sbjct: 368 QLVMDGVSVMRNNIQYTLSSAIKHSGSHSMGHYQCYRR 405

>AFR551W Chr6 (1427498..1428907) [1410 bp, 469 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR223W (UBP8)
          Length = 469

 Score = 55.1 bits (131), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 50/177 (28%), Positives = 83/177 (46%), Gaps = 37/177 (20%)

Query: 93  RGGYVGGLINDGNTCFMNSVIQSLASSKSLMQFLDEELMEASKELENP-NETSSAVEE-E 150
           RG  + GL+N G+TCFM+SVIQ+      ++Q++ E L  A+ ++++  +  S AV+E  
Sbjct: 132 RGEGLLGLVNMGSTCFMSSVIQTFLHLPHVLQYMLERLHYATCDVQDSLSCISCAVDEIV 191

Query: 151 GNLGSNSELRNRSSSKKTYGKRKKRLTRNAEKDAALEDEGVNMEFSAALKELLEKLNDKY 210
            NL               YG+ K+      E  + +   G + +   AL + L K    +
Sbjct: 192 ANL---------------YGQVKE------EAASGVAGPGASTQ---ALSQSLSKQQQGF 227

Query: 211 HRDKPYFKTNKLLKTMSKAPNKNIILGYDQEDAQEFFQTILSELEKNIKSLRGKSDK 267
                       L T S   N+N+  GY Q+DA EF+Q +L++L  +   + G   K
Sbjct: 228 IN----------LLTCSWKINRNLA-GYSQQDAHEFWQFLLNQLHTDYIRIHGPPSK 273

 Score = 36.6 bits (83), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 19/68 (27%), Positives = 35/68 (51%), Gaps = 2/68 (2%)

Query: 666 PSSSTVPSGPLTYALRSVIVHYGSHNYGHYIAFRKFRG-LWWRISDETVYVVDEAEVLST 724
           P     P   LT+ L ++I H G+ + GHY    +  G +W + +D  V ++ E ++L  
Sbjct: 400 PMDDQHPVPNLTFKLSAIIPHQGTVDKGHYTTICRINGDVWAKFNDSMVTLISEEDMLKE 459

Query: 725 PGVFMLFY 732
              ++L+Y
Sbjct: 460 QA-YLLYY 466

>KLTH0E12540g Chr5 complement(1111576..1113834) [2259 bp, 752 aa]
           {ON} some similarities with uniprot|Q02863 Saccharomyces
           cerevisiae YPL072W UBP16 Putative ubiquitin- specific
           protease
          Length = 752

 Score = 54.7 bits (130), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 48/183 (26%), Positives = 89/183 (48%), Gaps = 25/183 (13%)

Query: 323 PLDGITAERIGCLQCGENGGIRYSVFSGLSLNLPSDTVGSALKLSQLLREWVKPEIIEGV 382
           P+ G  A+ + CL C  +  +    F+  SL +P +   S   LS ++ +  + E I+G 
Sbjct: 309 PVKGSLADHLICLNCQGSSKVNMHPFTMYSLPVPQEPSAS---LSAMIAD-NQTETIDGY 364

Query: 383 ECNRCALKAVLEHLEKTLTQYEINDKVSEKLVSAVSSRVEELKAILAKPVVDDD------ 436
            C  C +KA+L + E+  ++   ++   E+ + A  SR      I+++  ++DD      
Sbjct: 365 SCLSCKIKAILANEEQRGSKGNSDE---EQNILATLSR------IISEIFINDDLSDELT 415

Query: 437 ----DYKKLHTENMVRKCSKSKQILISRPPPLLSIHINRSVFDPRTYTIRKNNSKVLFKS 492
               +YKK   E    K    K+ +++  P +L +H++RSVF+   YT  +N+  V F  
Sbjct: 416 NYVNNYKKDGCETSSIKSRIVKKTVVTESPEILILHLSRSVFNGTNYT--RNSCYVNFDE 473

Query: 493 RLN 495
            L+
Sbjct: 474 ELH 476

 Score = 37.0 bits (84), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 31/91 (34%), Positives = 47/91 (51%), Gaps = 5/91 (5%)

Query: 80  GSRNPAQEATMLKRGGYVGGLINDGNTCFMNSVIQSLASSKSLMQFLDEELMEA--SKEL 137
           G RN    ++  +   Y  GLIN+ N CF NS +Q+ +S   L  ++++ L +    K L
Sbjct: 53  GGRNDEMFSSSKRSDKYTTGLINNRNDCFANSSVQAFSSLPKLTMYMNDLLKQVLFMKSL 112

Query: 138 --ENPNETSSAVEEEGNLGSNSELRN-RSSS 165
              N N   +  EEE +   NSE+ N RS+S
Sbjct: 113 LDRNNNGEENDSEEELDPLQNSEVSNGRSNS 143

 Score = 36.6 bits (83), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 12/26 (46%), Positives = 19/26 (73%)

Query: 675 PLTYALRSVIVHYGSHNYGHYIAFRK 700
           P+ Y L+S++ H G+H+ GHY  FR+
Sbjct: 492 PIKYKLKSMVKHQGTHSQGHYECFRR 517

>KLLA0E23387g Chr5 complement(2079405..2081753) [2349 bp, 782 aa]
           {ON} some similarities with uniprot|Q02863 Saccharomyces
           cerevisiae YPL072W UBP16 Putative ubiquitin-specific
           protease
          Length = 782

 Score = 53.1 bits (126), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 48/182 (26%), Positives = 85/182 (46%), Gaps = 25/182 (13%)

Query: 323 PLDGITAERIGCLQCGENGGIRYSVFSGLSLNLPSDTVGSALKLSQLLREWVKPEIIEGV 382
           P+ G  A+ + CL CGE+  +    F+  SL +P         L+Q++ +  + + I G 
Sbjct: 312 PVHGSLADSLFCLSCGESSKVNIHEFTMYSLPVPQLINA---DLAQMISD-NQTDQISGY 367

Query: 383 ECNRCALKAVLEHLEKTLTQYEINDKVSEKLVSAVSSRVEELKAILAKPVVDDD------ 436
            C  C L A++ + EK       +D+ ++ L        +EL+ +L K  ++DD      
Sbjct: 368 SCLCCKLNAIIAN-EKNRNYQNNSDEENQIL--------KELEELLPKAFINDDLARNLS 418

Query: 437 ----DYKKLHTENMVRKCSKSKQILISRPPPLLSIHINRSVFDPRTYTIRKNNSKVLFKS 492
                Y+K   +    K +  K+ ++   P +L +H++RSVFD   Y  +KN   V F+ 
Sbjct: 419 TYINSYEKGGIKTSEIKSTIVKKTVVVDSPDVLILHLSRSVFDGMGY--QKNTCNVSFEE 476

Query: 493 RL 494
            L
Sbjct: 477 EL 478

 Score = 36.6 bits (83), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 26/38 (68%)

Query: 96  YVGGLINDGNTCFMNSVIQSLASSKSLMQFLDEELMEA 133
           +  GLIN+ N CF NS IQ+L+S   L ++L++ L +A
Sbjct: 71  FTTGLINNRNDCFANSSIQALSSLVYLTKYLNDILKQA 108

 Score = 34.3 bits (77), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 13/23 (56%), Positives = 17/23 (73%)

Query: 677 TYALRSVIVHYGSHNYGHYIAFR 699
           +Y LRS++ H GSH+ GHY  FR
Sbjct: 497 SYKLRSMLRHQGSHSTGHYECFR 519

 Score = 33.5 bits (75), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 20/30 (66%), Gaps = 1/30 (3%)

Query: 705 WWRISDETVYVVDEAEVLS-TPGVFMLFYE 733
           WWRISD  V     +++LS T  V+ML+YE
Sbjct: 748 WWRISDTKVKEYKTSDILSETKFVYMLYYE 777

>TPHA0L01670 Chr12 complement(351116..352690) [1575 bp, 524 aa] {ON}
           Anc_8.540 YPL072W
          Length = 524

 Score = 52.4 bits (124), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 101/459 (22%), Positives = 181/459 (39%), Gaps = 119/459 (25%)

Query: 96  YVGGLINDGNTCFMNSVIQSLASSKSLMQFLDEELMEASKELENPNETSSAVEEEGNLGS 155
           Y  GLIN    CF+NS +Q+L+S      +L+E L      ++N N  SS +E       
Sbjct: 65  YTTGLINSSTYCFINSSLQALSSLPKFTIYLNETLKITYGFIQN-NHLSSNIE------- 116

Query: 156 NSELRNRSSSKKTYGKRKKRLTRNAEKDAALED--EGVNMEFSAALKELLEKLNDKYHRD 213
               R++ S    YG  ++ +  +      L D  + V    S ++++L++ L    H  
Sbjct: 117 ----RSKISPLDDYGSLRQIIPLHIAVSEFLFDLQKIVTKPTSTSVRQLIKVLEVSVH-- 170

Query: 214 KPYFKTNKLLKTMSKAPNKNIILGYDQEDAQEFFQTILSELEKNIKSLRGKSDKDNEPTE 273
               K N                   Q+DA E  Q +L  L+   K L     K  E   
Sbjct: 171 ---LKFNN-----------------GQQDAHEITQILLETLKNENKVLDQTFKKSGE--- 207

Query: 274 LADIPKNAMIGQERLGEMGTVYLPAEQIDPNCVLGHEAKQLFFPFDLVTPLDGITAERIG 333
                                   ++ + P            FPF       G   + + 
Sbjct: 208 ------------------------SQMVVPE-----------FPFL------GCQTDSLI 226

Query: 334 CLQCGENGGIRYSVFSGLSLNLP---SDTVGSALKLSQLLREWVKPEIIEGVECNRCALK 390
           CL C     +R   F  L+L+LP   SDT+ + +  +Q+       E I    C  C + 
Sbjct: 227 CLTCNRTSNVREHEFIILTLHLPRIQSDTLLNTINKNQV-------EEITDYACLVCQIN 279

Query: 391 AVL---EHLEKTLTQYEINDKVSEKLVSAVSSR-VEELKAILAKPVVDD---DD---YKK 440
           ++L   E+L++       N+  + K ++A  SR ++ L+ ++ K  +++   DD   Y K
Sbjct: 280 SILANEEYLKR-------NN--NGKTINAEESRYIDTLRQLVPKICINEELPDDVIYYIK 330

Query: 441 LHTENMVRKCSK-----SKQILISRPPPLLSIHINRSVFDPRTYTIRKNNSKVLFKSRLN 495
            + +N +  C K      K+ +I++ P  L +H++RS ++       +N+  + + S+L 
Sbjct: 331 SYNKNGLNVCQKIRSKIIKKTVITKAPLALILHLSRSSYNGMISV--RNSCNIAYDSKLE 388

Query: 496 LAPWSCGPDEINLDARLPMSKKDQRAMESSEDENIGGEY 534
           L   S      N+ + +  +K   +AM      ++ G Y
Sbjct: 389 LQSQSITD---NICSDIVNNKYSLQAMVKHTGTHMEGHY 424

 Score = 34.3 bits (77), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 22/34 (64%)

Query: 678 YALRSVIVHYGSHNYGHYIAFRKFRGLWWRISDE 711
           Y+L++++ H G+H  GHY  +RK   L  RIS E
Sbjct: 407 YSLQAMVKHTGTHMEGHYQCYRKKPNLVKRISYE 440

>Kwal_14.2008 s14 (571638..572912) [1275 bp, 424 aa] {ON} YDR069C
           (DOA4) - ubiquitin isopeptidase [contig 424] PARTIAL
          Length = 424

 Score = 51.2 bits (121), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 77/320 (24%), Positives = 127/320 (39%), Gaps = 80/320 (25%)

Query: 82  RNPAQEATMLKRGGYVG-GLINDGNTCFMNSVIQSLASSKSLMQ-FLDEELMEASKELEN 139
           +N +  ++++KRG  +  GL+N GN+C+MN +IQ L  ++ L+Q FLD+           
Sbjct: 39  QNHSMNSSLVKRGLNINVGLVNLGNSCYMNCIIQCLLGTRELVQIFLDD----------- 87

Query: 140 PNETSSAVEEEGNLGSNSELRNRSSSKKTYGKRKKRLTRNAEKDAALEDEGVNMEFSAAL 199
                       +  ++  L +R  SK    K   +L  N ++ A           SA+ 
Sbjct: 88  ------------SYKNHVNLNSRLGSKGVLAKYFSQLIHNMQQQA----------ISASG 125

Query: 200 KELLEKLNDKYHRDKPYFKT-----NKLLKTMSKAPNKNIILGYDQEDAQEFFQTILSEL 254
           ++     N++      +FK      N L KT S            Q+D QEF Q +L  L
Sbjct: 126 RKSTSG-NERNAVQPLHFKVACGSINSLFKTTS------------QQDCQEFCQFLLDGL 172

Query: 255 EKNIKSLRGKSDKDNEPTELADIPKNAMIGQERLGEMGTVYLPAEQIDPNCVLGHEAKQL 314
            +++    G          L ++ + A   +E+L       +  E            + L
Sbjct: 173 HEDLNQCGGNP-------ALKELSEEAEAIREKLCMRIASSIEWE------------RYL 213

Query: 315 FFPFDLVTPL-DGITAERIGCLQCGENGGIRYSVFSGLSLNLPSDTVGSALKLSQLLREW 373
              F ++  L  G  A ++ C  CG      Y  FS LS+ +P    G+   L     E+
Sbjct: 214 TTDFSVIVDLFQGQYASQLMCKVCGRT-STTYQPFSVLSVPVPR---GARCNLLDCFEEF 269

Query: 374 VKPEIIEGVE---CNRCALK 390
            K E +E  E   C RC +K
Sbjct: 270 TKIETLEKDEQWSCPRCKVK 289

>Ecym_6248 Chr6 (468203..469603) [1401 bp, 466 aa] {ON} similar to
           Ashbya gossypii AFR551W
          Length = 466

 Score = 47.8 bits (112), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 43/174 (24%), Positives = 78/174 (44%), Gaps = 40/174 (22%)

Query: 99  GLINDGNTCFMNSVIQSLASSKSLMQFLDEELMEASKELENPNETSSAVEEE--GNLGSN 156
           GL+N G+TCFM+SVIQ+L     ++Q + ++  +++ ++++     S   +E   NL   
Sbjct: 137 GLVNMGSTCFMSSVIQTLVHIPHVLQHVLKQTHQSTCDIQDSIACVSCAVDEIVANL--- 193

Query: 157 SELRNRSSSKKTYGKRKKRLTRNAEKDAALEDEGVNMEFSAALKELLEKLNDKYHRDKPY 216
                       YG  K        K +  +   ++  FS   K  ++            
Sbjct: 194 ------------YGYPKP---NAVTKSSVGQYSHISSTFSRQQKGFID------------ 226

Query: 217 FKTNKLLKTMSKAPNKNIILGYDQEDAQEFFQTILSELEK-NIKSLRGKSDKDN 269
                 L T S   NKN+  GY Q+DA EF+Q +L++L   ++++ +  S+  N
Sbjct: 227 ------LLTCSWKINKNLA-GYTQQDAHEFWQFLLNQLHSDHVRAHKPSSNNSN 273

 Score = 40.0 bits (92), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 19/68 (27%), Positives = 35/68 (51%), Gaps = 2/68 (2%)

Query: 666 PSSSTVPSGPLTYALRSVIVHYGSHNYGHYIAFRKFRG-LWWRISDETVYVVDEAEVLST 724
           P     P   + Y L ++I H+G+ + GHY    +  G +W + +D  V V+ E ++L  
Sbjct: 397 PVDCLHPVPNMMYKLSAIISHHGTVHQGHYTTICRINGDIWAKFNDSMVTVISEEDMLKE 456

Query: 725 PGVFMLFY 732
              ++L+Y
Sbjct: 457 QA-YLLYY 463

>ZYRO0D03982g Chr4 (324687..327152) [2466 bp, 821 aa] {ON} weakly
           similar to uniprot|Q02863 Saccharomyces cerevisiae
           YPL072W UBP16 Putative ubiquitin-specific protease
          Length = 821

 Score = 48.1 bits (113), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 61/245 (24%), Positives = 98/245 (40%), Gaps = 59/245 (24%)

Query: 280 NAMI--GQERLGEMGTVYLPAEQIDPNCVLGHEAKQLFFPFDLV-TPLDGITAERIGCLQ 336
           NA I  GQ    E+  V L   Q + N +    AK    P D+   P  G  A+ + C  
Sbjct: 289 NARISSGQNDAHELTQVILETLQKENNKIREF-AKNQKLPVDIPEIPFRGKVADHLVCTA 347

Query: 337 CGENGGIRYSVFSGLSLNLPSDTVGSALKLSQLLREWVKPEIIEGVECNRCALKAVLEH- 395
           C  +  +R + F+ L L +P        KL++++ +  + E IEG  C  C +  +LE+ 
Sbjct: 348 CRNSSKVRVTQFNMLPLAVPQAITA---KLAEMVSDN-QVESIEGYSCLTCKVGKILENE 403

Query: 396 ------------------LEKTLTQYEINDKVSEKLVSAVSSR------VEELKAILAKP 431
                             L +      IND VSE+L++ ++          +LK+ + K 
Sbjct: 404 KGRDTSSYETTEQNTLASLARAFPNLTINDDVSEELMNYINGYNRDGLVTSQLKSTIVK- 462

Query: 432 VVDDDDYKKLHTENMVRKCSKSKQILISRPPPLLSIHINRSVFDPRTYTIRKNNSKVLFK 491
                                 K +++  P  LL IH++RS+F+   YT  +N   V F 
Sbjct: 463 ----------------------KNVVVDAPQVLL-IHLSRSMFNGTNYT--RNPCAVNFD 497

Query: 492 SRLNL 496
             L L
Sbjct: 498 EILQL 502

 Score = 37.4 bits (85), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 27/37 (72%)

Query: 99  GLINDGNTCFMNSVIQSLASSKSLMQFLDEELMEASK 135
           GLIN+ N CF NS +Q+L++   L ++L++ L +AS+
Sbjct: 73  GLINNRNDCFANSSVQALSALPRLTRYLNDILSQASQ 109

 Score = 32.0 bits (71), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 10/24 (41%), Positives = 17/24 (70%)

Query: 676 LTYALRSVIVHYGSHNYGHYIAFR 699
           + Y L++++ H GSH+ GHY  +R
Sbjct: 518 VNYELKAIVKHAGSHSQGHYQCYR 541

>YNL186W Chr14 (289498..291876) [2379 bp, 792 aa] {ON}
           UBP10Ubiquitin-specific protease that deubiquitinates
           ubiquitin-protein moieties; may regulate silencing by
           acting on Sir4p; involved in posttranscriptionally
           regulating Gap1p and possibly other transporters;
           primarily located in the nucleus
          Length = 792

 Score = 48.1 bits (113), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 34/60 (56%), Gaps = 2/60 (3%)

Query: 675 PLTYALRSVIVHYG-SHNYGHYIAF-RKFRGLWWRISDETVYVVDEAEVLSTPGVFMLFY 732
           P+ Y L SV+VH G S + GHYIA  ++  G W    DE + ++ E +VL  P  + L Y
Sbjct: 671 PVKYQLLSVVVHEGRSLSSGHYIAHCKQPDGSWATYDDEYINIISERDVLKEPNAYYLLY 730

 Score = 31.6 bits (70), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 12/33 (36%), Positives = 21/33 (63%)

Query: 99  GLINDGNTCFMNSVIQSLASSKSLMQFLDEELM 131
           GL+N G TC+ N+ +Q++    S+  +L + LM
Sbjct: 363 GLLNHGVTCYTNAAVQAMLHIPSIQHYLFDILM 395

>KAFR0E00930 Chr5 (198914..200410) [1497 bp, 498 aa] {ON} Anc_8.540
           YPL072W
          Length = 498

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 45/180 (25%), Positives = 90/180 (50%), Gaps = 16/180 (8%)

Query: 323 PLDGITAERIGCLQCGENGGIRYSVFSGLSLNLPSDTVGSALKLSQLLREWVKPEIIEGV 382
           P +G+++  + CLQC +     +S F  L + +P +    + KL+ L+    + EIIEG 
Sbjct: 200 PFEGVSSNYLMCLQCNKYSQTIHSPFLMLEVAVPGNY---SEKLTDLILH-SQDEIIEGY 255

Query: 383 ECNRCALKAVLEHLEKTLTQYEINDKVSEKLVSAVSSRV------EELKAILAKPVVDDD 436
            C  C +  +L++ EK L Q     +  + +++ + +++      ++L A ++  V   D
Sbjct: 256 SCLYCKVNMILKN-EKYLNQLPEYSQEEQSILNFLRNQILTLYINDDLPADVSFYV---D 311

Query: 437 DYKKLHTENMVRKCSKSKQILISRPPPLLSIHINRSVFDPRTYTIRKNNSKVLFKSRLNL 496
            Y K        K +  K+  + + P  L +H++RS+F+    TI ++  +V ++  LNL
Sbjct: 312 HYSKNGCVTANFKSNIIKKNAVIKEPASLIVHLSRSIFNGA--TITRSACRVEYEQSLNL 369

 Score = 35.8 bits (81), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 14/26 (53%), Positives = 18/26 (69%)

Query: 675 PLTYALRSVIVHYGSHNYGHYIAFRK 700
           P+ Y L+SV+ H GSH  GHY  +RK
Sbjct: 384 PIKYELKSVVKHTGSHVQGHYQCYRK 409

 Score = 33.1 bits (74), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 22/33 (66%)

Query: 96  YVGGLINDGNTCFMNSVIQSLASSKSLMQFLDE 128
           +  GL+N  N CF+NS +Q+L   +SL  +L++
Sbjct: 73  FTTGLLNARNDCFLNSSLQALVPIESLTTYLNQ 105

>Smik_13.431 Chr13 (700800..702215) [1416 bp, 471 aa] {ON} YMR223W
           (REAL)
          Length = 471

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 29/84 (34%), Positives = 41/84 (48%), Gaps = 5/84 (5%)

Query: 653 PTELNPLSAGQLAPSSSTVPSGP---LTYALRSVIVHYGSHNYGHYIAFRKFR-GLWWRI 708
           PT LN  S      S     +G    + Y L  ++ H G+ N GHYIAF K   G W++ 
Sbjct: 383 PTYLNMKSYCSTGESEKHTGNGKVPDIIYELIGIVSHRGTVNEGHYIAFCKISGGQWFKF 442

Query: 709 SDETVYVVDEAEVLSTPGVFMLFY 732
           +D  V  + + EVL     ++LFY
Sbjct: 443 NDSVVTSIAQGEVLKEQA-YLLFY 465

 Score = 35.8 bits (81), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 36/187 (19%), Positives = 74/187 (39%), Gaps = 60/187 (32%)

Query: 79  WGSRNPAQEATMLKRGGYVGGLINDGNTCFMNSVIQSLASSKSLMQFLDEELMEASKELE 138
           W   +      +++R   + GLIN G+TCFM+S++Q L  +   ++    ++     ++ 
Sbjct: 118 WDDVSTKTTVPIMERRDGLSGLINMGSTCFMSSILQCLIHNPYFIRHSMSQIHSNKCKVG 177

Query: 139 NPNETSSAVEEEGNLGSNSELRNRSSSKKTYGKRKKRLTRNAEKDAALEDEGVNMEFSAA 198
           +P++  S                                                    A
Sbjct: 178 SPDKCFS---------------------------------------------------CA 186

Query: 199 LKELLEKLNDKYHRDKP---YFKTNK-----LLKTMSKAPNKNIILGYDQEDAQEFFQTI 250
           L +++++L    + D+P      TN+      L T +   N+N + GY Q+DA EF+Q I
Sbjct: 187 LDKIIQELYGVLNTDQPSPSSSATNRQTGFIYLLTCAWKINQN-LAGYSQQDAHEFWQFI 245

Query: 251 LSELEKN 257
           ++++ ++
Sbjct: 246 INQIHQS 252

>KLTH0H07678g Chr8 (677217..679802) [2586 bp, 861 aa] {ON} similar
           to uniprot|P32571 Saccharomyces cerevisiae YDR069C DOA4
           Ubiquitin hydrolase required for recycling ubiquitin
           from proteasome-bound ubiquitinated intermediates acts
           at the late endosome/prevacuolar compartment to recover
           ubiquitin from ubiquitinated membrane proteins en route
           to the vacuole
          Length = 861

 Score = 47.4 bits (111), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 72/300 (24%), Positives = 111/300 (37%), Gaps = 71/300 (23%)

Query: 96  YVGGLINDGNTCFMNSVIQSLASSKSLMQ-FLDEELMEASKELENPNETSSAVEEEGNLG 154
           +  GL N GN+C+MN +IQ L  +  L Q FLD+                     + ++ 
Sbjct: 493 FTVGLTNLGNSCYMNCIIQCLLGTHELTQIFLDDSY-------------------KNHVN 533

Query: 155 SNSELRNRSSSKKTYGKRKKRLTRNAEKDAALEDEGVNMEFSAALKELLEKLNDKYHRDK 214
            NS+L     SK    K   +L    ++ AA      N     A++ L        H   
Sbjct: 534 LNSKL----GSKGVLAKYFSQLIHTMQQQAASASTKQNSGDKTAVQPL--------HFKV 581

Query: 215 PYFKTNKLLKTMSKAPNKNIILGYDQEDAQEFFQTILSELEKNIKSLRGKSDKDNEPTEL 274
                N L ++ S            Q+D QEF Q +L  L +++    G          L
Sbjct: 582 ACGSINSLFRSSS------------QQDCQEFCQFLLDGLHEDLNQCGGNP-------AL 622

Query: 275 ADIPKNAMIGQERLGEMGTVYLPAEQIDPNCVLGHEAKQLFFPFDLVTPL-DGITAERIG 333
            ++ + A   +E+L       +  E            + L   F ++  L  G  A ++ 
Sbjct: 623 KELSEEAEGIREKLCMRIASSIEWE------------RYLTTDFSVIVDLFQGQYASQLT 670

Query: 334 CLQCGENGGIRYSVFSGLSLNLPSDTVGSALKLSQLLREWVKPEIIEGVE---CNRCALK 390
           C  CG      Y  FS LS+ +PS   GS   +    +E+ K E +E  E   C RC  K
Sbjct: 671 CKVCGRT-STTYQPFSVLSVPVPS---GSKCDIIDCFKEFTKVETLEKDEQWSCPRCKCK 726

 Score = 37.0 bits (84), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 27/94 (28%), Positives = 43/94 (45%), Gaps = 12/94 (12%)

Query: 655 ELNPLSA----GQLAPSSSTVPS----GPLTYALRSVIVHYGSHNYGHYIAF-RKFRGLW 705
           +L P  A    G+L P  + +P+     P  Y L +V  H+G+   GHY ++  K     
Sbjct: 767 DLTPFWANDFDGRLPPGVAELPTRGQVPPFNYNLYAVACHFGTLYGGHYTSYVDKGDKAG 826

Query: 706 WRISDETVY--VVDEAEVLSTPGVFMLFYEHDYN 737
           W   D+T +     + E + T   ++LFY   YN
Sbjct: 827 WCYFDDTSWRKAKSQGECI-TLSAYVLFYHRKYN 859

>Suva_13.407 Chr13 (697513..698928) [1416 bp, 471 aa] {ON} YMR223W
           (REAL)
          Length = 471

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 50/207 (24%), Positives = 82/207 (39%), Gaps = 61/207 (29%)

Query: 79  WGSRNPAQEATMLKRGGYVGGLINDGNTCFMNSVIQSLASSKSLMQFLDEELMEASKELE 138
           W   +      +++R   + GLIN G+TCFM+S++Q L                    + 
Sbjct: 118 WDDVSTKTVVPIMERRDGLSGLINMGSTCFMSSILQCL--------------------IH 157

Query: 139 NPNETSSAVEEEGNLGSNSELRNRSSSKKTYGKRKKRLTRNAEKDAALEDEGVNMEFSAA 198
           NP                      S S+  + K K R   N               FS A
Sbjct: 158 NP-----------------YFIKHSMSQSHFNKCKVRSPDNC--------------FSCA 186

Query: 199 LKELLEKLNDKYHRDKP---YFKTNK-----LLKTMSKAPNKNIILGYDQEDAQEFFQTI 250
           L +++ +L    + D+P      TN+      L T +   N+N+  GY Q+DA EF+Q I
Sbjct: 187 LDKIVHELYGVLNTDQPPSSSSATNRQAGFIYLLTCAWKINQNLA-GYSQQDAHEFWQFI 245

Query: 251 LSELEKN-IKSLRGKSDKDNEPTELAD 276
           ++++ +N + SL    + D E  +  D
Sbjct: 246 INQIHQNYVLSLPSTKESDKENIKHCD 272

 Score = 44.7 bits (104), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 42/84 (50%), Gaps = 5/84 (5%)

Query: 653 PTELNPLSAGQLAPSSSTVPSGP---LTYALRSVIVHYGSHNYGHYIAFRKFR-GLWWRI 708
           PT LN  S   +  S   + +     + Y L  ++ H G+ N GHYIAF K   G W++ 
Sbjct: 383 PTYLNMKSYCSIRESEKHIGNKKVPDIIYELIGIVSHKGTVNEGHYIAFCKISGGQWFKF 442

Query: 709 SDETVYVVDEAEVLSTPGVFMLFY 732
           +D  V  + + EVL     ++LFY
Sbjct: 443 NDSMVSSISQEEVLKEQA-YLLFY 465

>Skud_13.392 Chr13 (690758..692179) [1422 bp, 473 aa] {ON} YMR223W
           (REAL)
          Length = 473

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 42/86 (48%), Gaps = 7/86 (8%)

Query: 653 PTELNPLSAGQLAPSSSTVPSG-----PLTYALRSVIVHYGSHNYGHYIAFRKFR-GLWW 706
           PT LN  S    A S S    G      + Y L  ++ H G+ N GHYIAF K   G W+
Sbjct: 383 PTYLNMKSYCSTAESESENHIGNGKVPDIIYELIGIVSHKGTVNEGHYIAFCKISGGQWF 442

Query: 707 RISDETVYVVDEAEVLSTPGVFMLFY 732
           + +D  V  + + EVL     ++LFY
Sbjct: 443 KFNDSMVSSISQEEVLKEQA-YLLFY 467

 Score = 36.6 bits (83), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 45/181 (24%), Positives = 76/181 (41%), Gaps = 63/181 (34%)

Query: 84  PAQEATMLKRGGYVGGLINDGNTCFMNSVIQSLASSKSLMQFLDEELMEASKELENPNET 143
           PA E    +R G + GLIN G+TCFM+S++Q L                    + NP   
Sbjct: 128 PAME----RRDG-LSGLINMGSTCFMSSILQCL--------------------IHNPYFI 162

Query: 144 SSAVEEEGNLGSNSELRNRSSSKKTYGKRKKRLTRNAEKDAALEDEGVNMEFSAALKELL 203
                             R S ++ +  + K   R+ +K            FS AL +++
Sbjct: 163 ------------------RHSMRQIHSNKCK--VRSPDKC-----------FSCALDKIV 191

Query: 204 EKLNDKYHRDKPYFK---TNK---LLKTMSKAPNKNIIL-GYDQEDAQEFFQTILSELEK 256
            +L    + D+P      TN+    +  ++ A   N  L GY Q+DA EF+Q +++E+ +
Sbjct: 192 HELYGVLNTDQPSSSSSATNRQGGFIHLLTCAWKINQSLAGYSQQDAHEFWQFLINEIHQ 251

Query: 257 N 257
           +
Sbjct: 252 S 252

>TBLA0B09760 Chr2 complement(2316180..2318876) [2697 bp, 898 aa]
           {ON} Anc_2.69 YNL186W
          Length = 898

 Score = 46.6 bits (109), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 33/60 (55%), Gaps = 2/60 (3%)

Query: 675 PLTYALRSVIVHYG-SHNYGHYIAF-RKFRGLWWRISDETVYVVDEAEVLSTPGVFMLFY 732
           P+ Y L SV+VH G S + GHYIA  ++  G W    DE +  + E E+L  P  + L Y
Sbjct: 752 PVKYQLLSVVVHEGRSLSSGHYIAHCKQPDGSWATYDDEYINKISEREMLKEPNAYYLLY 811

>SAKL0E13002g Chr5 complement(1070150..1072369) [2220 bp, 739 aa]
           {ON} similar to uniprot|P53874 Saccharomyces cerevisiae
           YNL186W UBP10 Ubiquitin-specific protease that
           deubiquitinates ubiquitin-protein moieties may regulate
           silencing by acting on Sir4p involved in
           posttranscriptionally regulating Gap1p and possibly
           other transporters primarily located in the nucleus
          Length = 739

 Score = 46.2 bits (108), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 34/60 (56%), Gaps = 2/60 (3%)

Query: 675 PLTYALRSVIVHYG-SHNYGHYIAF-RKFRGLWWRISDETVYVVDEAEVLSTPGVFMLFY 732
           P+ Y L SV+VH G S + GHYIA  ++  G W    DE +  + E ++L  PG + L Y
Sbjct: 624 PVKYQLISVVVHEGRSLSSGHYIAHCKQPDGSWATYDDEYINKITEKQMLKEPGAYYLIY 683

 Score = 32.0 bits (71), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 20/80 (25%), Positives = 38/80 (47%), Gaps = 5/80 (6%)

Query: 99  GLINDGNTCFMNSVIQSLASSKSLMQFLDEELMEASKELENPNETSSAVEEEGNLGSNSE 158
           GL+N G TC+ N+ +Q++    S+  +L + L    K   +P   +  + E     ++  
Sbjct: 363 GLLNHGVTCYTNAAVQAMLHIPSIQHYLFDVLRGDHKTTISPQSVTQVLAE-----TSKR 417

Query: 159 LRNRSSSKKTYGKRKKRLTR 178
           + +   +K TY   KK + R
Sbjct: 418 MWSPEPNKNTYINPKKLIGR 437

>KLTH0B07150g Chr2 complement(574195..576465) [2271 bp, 756 aa] {ON}
           some similarities with uniprot|P53874 Saccharomyces
           cerevisiae YNL186W UBP10 Ubiquitin-specific protease
           that deubiquitinates ubiquitin-protein moieties may
           regulate silencing by acting on Sir4p involved in
           posttranscriptionally regulating Gap1p and possibly
           other transporters primarily located in the nucleus
          Length = 756

 Score = 46.2 bits (108), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 33/60 (55%), Gaps = 2/60 (3%)

Query: 675 PLTYALRSVIVHYG-SHNYGHYIAF-RKFRGLWWRISDETVYVVDEAEVLSTPGVFMLFY 732
           P+ Y L SV+VH G S   GHYIA  ++  G W    DE +  + E ++L  PG + L Y
Sbjct: 645 PVKYQLISVVVHEGRSLTSGHYIAHCKQPDGSWSTYDDEYINKISERQMLKEPGAYYLVY 704

 Score = 36.2 bits (82), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 40/85 (47%), Gaps = 11/85 (12%)

Query: 65  RGFRNSYKGSVFNKWGSRNPAQEATMLKRGGYVGGLINDGNTCFMNSVIQSLASSKSLMQ 124
           RG  NS +  +   WG     Q +TM  +G     L+N G TC+ N+ +Q+L    ++  
Sbjct: 355 RGANNSTR--ILKNWG----PQLSTMKPKG-----LLNHGVTCYTNAAVQALIHIPAIQH 403

Query: 125 FLDEELMEASKELENPNETSSAVEE 149
           +L + L    K   +PN  +  + E
Sbjct: 404 YLFDVLRGEYKSTISPNSVTQVLAE 428

>Suva_14.156 Chr14 (285613..287979) [2367 bp, 788 aa] {ON} YNL186W
           (REAL)
          Length = 788

 Score = 45.8 bits (107), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 33/60 (55%), Gaps = 2/60 (3%)

Query: 675 PLTYALRSVIVHYG-SHNYGHYIAF-RKFRGLWWRISDETVYVVDEAEVLSTPGVFMLFY 732
           P+ Y L SV+VH G S + GHYIA  ++  G W    DE +  + E +VL  P  + L Y
Sbjct: 666 PVKYQLLSVVVHEGRSLSSGHYIAHCKQPDGTWATYDDEYINKISERDVLKEPNAYYLLY 725

>Kwal_33.14430 s33 (669559..671094) [1536 bp, 511 aa] {ON} YNL186W
           (UBP10) - predicted to encode a ubiquitin-processing
           protease [contig 103] PARTIAL
          Length = 511

 Score = 45.4 bits (106), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 34/60 (56%), Gaps = 2/60 (3%)

Query: 675 PLTYALRSVIVHYG-SHNYGHYIAF-RKFRGLWWRISDETVYVVDEAEVLSTPGVFMLFY 732
           P+ Y L SV+VH G S + GHYIA  ++  G W    DE +  + E ++L  PG + L Y
Sbjct: 392 PVKYQLISVVVHEGRSLSSGHYIAHCKQPDGSWSTYDDEYINKISEKQMLKEPGAYYLVY 451

 Score = 32.7 bits (73), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 29/114 (25%), Positives = 49/114 (42%), Gaps = 16/114 (14%)

Query: 65  RGFRNSYKGSVFNKWGSRNPAQEATMLKRGGYVGGLINDGNTCFMNSVIQSLASSKSLMQ 124
           RG  NS +  +   WG     Q +TM  +G     L+N G TC+ N+ +Q+L    ++  
Sbjct: 102 RGTNNSKR--LLKNWG----PQLSTMKPKG-----LLNHGVTCYTNAAVQALVHIPAIQH 150

Query: 125 FLDEELMEASKELENPNETSSAVEEEGNLGSNSELRNRSSSKKTYGKRKKRLTR 178
           +L + L    K    P   +  + E     +   + +  SSK  +   KK + R
Sbjct: 151 YLFDVLRGEYKSTIAPQSVTQVLAE-----TTKRMWSNESSKNQFINPKKLIGR 199

>Kpol_1044.24 s1044 (56564..58738) [2175 bp, 724 aa] {ON}
           (56564..58738) [2175 nt, 725 aa]
          Length = 724

 Score = 45.4 bits (106), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 25/60 (41%), Positives = 32/60 (53%), Gaps = 2/60 (3%)

Query: 675 PLTYALRSVIVHYG-SHNYGHYIAF-RKFRGLWWRISDETVYVVDEAEVLSTPGVFMLFY 732
           P+ Y L SV+VH G S + GHYIA  R+  G W    DE +  + E  VL  P  + L Y
Sbjct: 604 PVKYQLISVVVHEGRSLSSGHYIAHCRQPDGSWAIYDDEYINKISERNVLKEPNAYYLIY 663

 Score = 32.0 bits (71), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 20/80 (25%), Positives = 38/80 (47%), Gaps = 3/80 (3%)

Query: 99  GLINDGNTCFMNSVIQSLASSKSLMQFLDEELMEASKELENPNETSSAVEEEGNLGSNSE 158
           GL+N G TC+ N+ +Q++    ++  +L + L  + K   N  +  S  +          
Sbjct: 312 GLLNHGVTCYTNAAVQAMLHIPAIQHYLFDVLRGSHK---NTIKADSVTQVLAETSKKMW 368

Query: 159 LRNRSSSKKTYGKRKKRLTR 178
            R++  +K TY   KK ++R
Sbjct: 369 WRDKKHNKSTYINPKKLISR 388

>NDAI0F03410 Chr6 complement(820002..822614) [2613 bp, 870 aa] {ON}
           Anc_2.69 YNL186W
          Length = 870

 Score = 45.4 bits (106), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 33/60 (55%), Gaps = 2/60 (3%)

Query: 675 PLTYALRSVIVHYG-SHNYGHYIAF-RKFRGLWWRISDETVYVVDEAEVLSTPGVFMLFY 732
           P  Y L SV+VH G S + GHYIA  R+  G W    DE +  + E ++L+ P  + L Y
Sbjct: 758 PAKYQLLSVVVHEGRSLSSGHYIAHCRQPDGTWATYDDELINKISELKLLTEPNAYYLVY 817

 Score = 34.3 bits (77), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 38/159 (23%), Positives = 65/159 (40%), Gaps = 51/159 (32%)

Query: 99  GLINDGNTCFMNSVIQSLASSKSLMQFLDEELMEASKELENPNETSSAVEEEGNLGSNSE 158
           GLIN G TC+ N+ +Q++    ++  +L + L    K ++ PN  S  + E       + 
Sbjct: 443 GLINHGVTCYTNAAVQAMVHIPAVQHYLFDILRGKYKNID-PNSVSYTLAE-------TT 494

Query: 159 LRNRSSSKKTYGKRKKRLTRNAEKDAALEDEGVNMEFSAALKELLEKLNDKYHRDKPYFK 218
            R   S+KK  G +K     N                     EL+E+L+D      P   
Sbjct: 495 RRMWLSNKK--GNKKVIAYYNPN-------------------ELIERLDDINWSMNP--- 530

Query: 219 TNKLLKTMSKAPNKNIILGYDQEDAQEFFQTILSELEKN 257
                              Y+QED+ E+F +++S+L++N
Sbjct: 531 -------------------YNQEDSHEYFMSLMSKLQEN 550

>NCAS0C02110 Chr3 (398702..400186) [1485 bp, 494 aa] {ON} Anc_8.540
           YPL072W
          Length = 494

 Score = 45.1 bits (105), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 49/188 (26%), Positives = 84/188 (44%), Gaps = 24/188 (12%)

Query: 319 DLVTPLDGITAERIGCLQCGENGGIRYSVFSGLSLNLPSDTVGSALKLSQLLREWVKPEI 378
           DL  P  GI    + CLQCG    +    F    L LP      ++KLS L+    + E 
Sbjct: 186 DLTVPFKGIVGNHLVCLQCGRTSHVNEQPFYIYELTLPQQ---GSVKLSDLVNGE-QMET 241

Query: 379 IEGVECNRCALKAVLEHLEKTLTQYEINDKVSEKLVSAVSSRVEELKAILAKPVVDDDDY 438
           IE   C  C   A+L +        E  +K +     A  + ++ LK  L+  +++++  
Sbjct: 242 IENYSCMYCKTVAMLTN--------EREEKSNVSRTDAELNILKFLKGKLSTLLINEELP 293

Query: 439 KKL-HTENMVRK--CSKS--KQILISRP-----PPLLSIHINRSVFDPRTYTIRKNNSKV 488
           + + H  N   K  C+ S  K +++ +      P +  IH++RSVF+   Y+  +N  +V
Sbjct: 294 EHITHYINSYNKGYCNTSEIKSVIVRKSTFAEFPEIFLIHLSRSVFNGMNYS--RNPCQV 351

Query: 489 LFKSRLNL 496
            F+  + L
Sbjct: 352 EFEEEILL 359

 Score = 34.7 bits (78), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 15/35 (42%), Positives = 20/35 (57%)

Query: 96  YVGGLINDGNTCFMNSVIQSLASSKSLMQFLDEEL 130
           +  GL+N GN CF+NS IQ+L     L  +L   L
Sbjct: 74  FTTGLVNPGNDCFINSSIQALVPLDKLTTYLSATL 108

>ZYRO0G01606g Chr7 complement(123893..127810) [3918 bp, 1305 aa] {ON}
            similar to uniprot|Q01476 Saccharomyces cerevisiae
            YOR124C UBP2 Ubiquitin-specific protease that removes
            ubiquitin from ubiquitinated proteins cleaves at the C
            terminus of ubiquitin fusions capable of cleaving
            polyubiquitin and possesses isopeptidase activity
          Length = 1305

 Score = 45.1 bits (105), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 46/83 (55%), Gaps = 11/83 (13%)

Query: 676  LTYALRSVIVHYGSHNYGHYIAFRKFR---GLWWRISDETVYVVDEAEVL-------STP 725
            + Y+L +V +H G  +YGHY  + K R   G+W + +DET+  V E+EV        +TP
Sbjct: 1221 IGYSLFAVFIHRGEASYGHYWIYIKDRYKSGIWRKYNDETITEVPESEVFNFSEGNTATP 1280

Query: 726  GVFMLFYEHDYNQTLQKMNDDLE 748
              F+++ +  + Q ++ +   LE
Sbjct: 1281 -YFLVYVKQGHEQEIEPLKRVLE 1302

 Score = 38.9 bits (89), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 32/93 (34%), Positives = 49/93 (52%), Gaps = 8/93 (8%)

Query: 38  TGLLIYKNRRYIRNIMDA--LGTVGGDLTR-GF-RNSYKGSVFNKWGSRNPAQEATMLKR 93
           T L I++ + Y   + DA     + G L++ GF RNS   S F   G+     +A+ L  
Sbjct: 673 TILEIFQRKWYKEPVFDADQFLKLKGALSKIGFERNSKLISHFIDTGT----VDASCLPA 728

Query: 94  GGYVGGLINDGNTCFMNSVIQSLASSKSLMQFL 126
             +  GL N GNTC++NS++Q   S  SL Q++
Sbjct: 729 ENWPTGLNNIGNTCYLNSLLQYYFSISSLRQYV 761

>KAFR0L01730 Chr12 (316860..318965) [2106 bp, 701 aa] {ON} Anc_7.390
           YBL067C
          Length = 701

 Score = 45.1 bits (105), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 26/62 (41%), Positives = 32/62 (51%), Gaps = 7/62 (11%)

Query: 678 YALRSVIVHYGSH-NYGHYIAFRKFRGLWWRI-SDETVYVVDEAEVLSTPG-----VFML 730
           Y L S ++H G    YGHYI+  K     W +  DETV  VDE  VLS  G      ++L
Sbjct: 559 YELASAVIHLGDGPQYGHYISLCKTETFGWLLFDDETVEAVDEQTVLSFTGENSDTAYVL 618

Query: 731 FY 732
           FY
Sbjct: 619 FY 620

>YBL067C Chr2 complement(93639..95882) [2244 bp, 747 aa] {ON}
           UBP13Putative ubiquitin carboxyl-terminal hydrolase,
           ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 747

 Score = 44.7 bits (104), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 27/89 (30%), Positives = 45/89 (50%), Gaps = 9/89 (10%)

Query: 678 YALRSVIVHYGSH-NYGHYIAFRKFRGLWWRI-SDETVYVVDEAEVLSTPG-------VF 728
           Y L  ++VH G    +GHY++  K     W +  DETV  V E  VL   G        +
Sbjct: 602 YELAGIVVHMGGGPQHGHYVSLCKHEKFGWLLFDDETVEAVKEETVLEFTGESPNMATAY 661

Query: 729 MLFYEHDYNQTLQKMNDDLEWEEQEEGIN 757
           +LFY+  Y+  ++K + +   +EQ++ I+
Sbjct: 662 VLFYKAMYSNAVEKNDRENMAKEQDDNID 690

>TDEL0B03060 Chr2 (545366..547570) [2205 bp, 734 aa] {ON} Anc_8.540
           YPL072W
          Length = 734

 Score = 44.7 bits (104), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 43/187 (22%), Positives = 77/187 (41%), Gaps = 43/187 (22%)

Query: 323 PLDGITAERIGCLQCGENGGIRYSVFSGLSLNLPSDTVGSALKLSQLLREWVKPEIIEGV 382
           P  G  A+ + C++C  +  +    F    L +P      + KLS ++ +  + + IEG 
Sbjct: 297 PFGGQLADHLVCMKCTNSSKVNIHPFIIYPLTVPQ---AMSAKLSDMVSDN-QTDTIEGY 352

Query: 383 ECNRCAL-------------------KAVLEHLEKTLTQYEINDKVSEKLVSAVSSRVEE 423
            C  C +                   K +L+ LE  L    IND++S++L S ++S    
Sbjct: 353 SCLTCKVSTIVNYEKGRGYAKCTQEEKRILKTLEDALPDMAINDELSDELTSYINS---- 408

Query: 424 LKAILAKPVVDDDDYKKLHTENMVRKCSKSKQILISRPPPLLSIHINRSVFDPRTYTIRK 483
                         Y K        K +  K+ ++   P  L +H++RS+FD  +Y  ++
Sbjct: 409 --------------YNKDGIVGADLKSTIVKKTVVVESPKTLVMHLSRSMFDGISY--QR 452

Query: 484 NNSKVLF 490
           N+  V F
Sbjct: 453 NSCGVAF 459

 Score = 38.9 bits (89), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 24/39 (61%)

Query: 96  YVGGLINDGNTCFMNSVIQSLASSKSLMQFLDEELMEAS 134
           Y  GLIN+ N CF N  +Q+LAS   L  +L+E L + S
Sbjct: 71  YTTGLINNRNDCFANCSVQALASLPGLTSYLNEFLHQVS 109

 Score = 36.6 bits (83), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 11/25 (44%), Positives = 19/25 (76%)

Query: 675 PLTYALRSVIVHYGSHNYGHYIAFR 699
           P++Y L++++ H GSH+ GHY  +R
Sbjct: 480 PISYKLKAIVAHSGSHSQGHYECYR 504

>Kwal_26.9151 s26 complement(1095026..1096390) [1365 bp, 454 aa]
           {ON} YMR223W (UBP8) - putative deubiquitinating enzyme
           [contig 70] FULL
          Length = 454

 Score = 44.3 bits (103), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 38/81 (46%), Gaps = 5/81 (6%)

Query: 653 PTELNPLSAGQLAPSSSTVPSGPLTYALRSVIVHYGSHNYGHYIAFRKF-RGLWWRISDE 711
           PT LN          S + P   + Y L +VI H GS N GHY +  K   G W+R +D 
Sbjct: 372 PTYLN---MAPFCHQSESRPVPDMMYELVAVISHEGSVNQGHYTSMCKIPGGQWFRFNDS 428

Query: 712 TVYVVDEAEVLSTPGVFMLFY 732
            +  + E E L     ++LFY
Sbjct: 429 MIVSISEEEALRQQA-YLLFY 448

 Score = 41.6 bits (96), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 48/221 (21%), Positives = 87/221 (39%), Gaps = 53/221 (23%)

Query: 74  SVFNK-WGSRNPAQEATMLKRGGYVGGLINDGNTCFMNSVIQSLASSKSLMQFLDEELME 132
           S+ NK W   +      + K    + GL+N G+TCFM+S+IQ+L  +  +++    ++  
Sbjct: 111 SMLNKNWDDISVKSSVPLAKGRDGLCGLVNMGSTCFMSSIIQTLVHNPYVLKTCMNQVHF 170

Query: 133 ASKELENPNETSSAVEEEGNLGSNSELRNRSSSKKTYGKRKKRLTRNAEKDAALEDEGVN 192
           +  ++++                         S   +     R+  N    AA      +
Sbjct: 171 SRCDIQD-------------------------SASCFSCALDRIVSNFYGPAA------D 199

Query: 193 MEFSAALKELLEKLNDKYHRDKPYFKTNKLLKTMSKAPNKNIILGYDQEDAQEFFQTILS 252
             F++  K  ++                  L   S   N+N+  GY Q+DA EF+Q  L+
Sbjct: 200 ASFTSQQKGFVD------------------LLLCSWKINRNLA-GYSQQDAHEFWQFFLN 240

Query: 253 ELEKNIKSLRGKSDKDNEPTELADIPKNAMIGQERLGEMGT 293
           +L  +   + GK  K ++P E   I  +A  G  R   + T
Sbjct: 241 QLHADHVRVTGK--KSSKPEECNCISHSAFQGSLRSSILCT 279

>YMR223W Chr13 (716715..718130) [1416 bp, 471 aa] {ON}
           UBP8Ubiquitin-specific protease that is a component of
           the SAGA (Spt-Ada-Gcn5-Acetyltransferase) acetylation
           complex; required for SAGA-mediated deubiquitination of
           histone H2B
          Length = 471

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 33/58 (56%), Gaps = 2/58 (3%)

Query: 676 LTYALRSVIVHYGSHNYGHYIAFRKFR-GLWWRISDETVYVVDEAEVLSTPGVFMLFY 732
           + Y L  ++ H G+ N GHYIAF K   G W++ +D  V  + + EVL     ++LFY
Sbjct: 409 IIYELIGIVSHKGTVNEGHYIAFCKISGGQWFKFNDSMVSSISQEEVLKEQA-YLLFY 465

 Score = 34.7 bits (78), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 35/58 (60%), Gaps = 1/58 (1%)

Query: 89  TMLKRGGYVGGLINDGNTCFMNSVIQSLASSKSLMQFLDEELMEASKELENPNETSSA 146
           +M +R G + GLIN G+TCFM+S++Q L  +   ++    ++   + ++ +P++  S 
Sbjct: 129 SMERRDG-LSGLINMGSTCFMSSILQCLIHNPYFIRHSMSQIHSNNCKVRSPDKCFSC 185

>Skud_14.148 Chr14 (278827..281157) [2331 bp, 776 aa] {ON} YNL186W
           (REAL)
          Length = 776

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 33/60 (55%), Gaps = 2/60 (3%)

Query: 675 PLTYALRSVIVHYG-SHNYGHYIAF-RKFRGLWWRISDETVYVVDEAEVLSTPGVFMLFY 732
           P+ Y L SV+VH G S + GHYIA  ++  G W    DE +  + E +VL  P  + L Y
Sbjct: 654 PVKYQLLSVVVHEGRSLSSGHYIAHCKQPDGNWATYDDEYINKISERDVLKEPNAYYLLY 713

>NCAS0G01800 Chr7 (319652..322279) [2628 bp, 875 aa] {ON} Anc_2.69
          Length = 875

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/68 (39%), Positives = 34/68 (50%), Gaps = 6/68 (8%)

Query: 671 VPSG----PLTYALRSVIVHYG-SHNYGHYIAF-RKFRGLWWRISDETVYVVDEAEVLST 724
            PSG    P+ Y L SV+VH G S + GHYIA  R+  G W    DE +  + E  VL  
Sbjct: 680 TPSGTKQLPVKYELLSVVVHEGRSLSSGHYIAHCRQPDGSWATYDDEYINKISELNVLKE 739

Query: 725 PGVFMLFY 732
              + L Y
Sbjct: 740 ANAYYLLY 747

>KLLA0D08459g Chr4 complement(718046..720298) [2253 bp, 750 aa] {ON}
           some similarities with uniprot|P53874 Saccharomyces
           cerevisiae YNL186W UBP10 Ubiquitin-specific protease
           that deubiquitinates ubiquitin-protein moieties may
           regulate silencing by acting on Sir4p involved in
           posttranscriptionally regulating Gap1p and possibly
           other transporters primarily located in the nucleus
          Length = 750

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/65 (36%), Positives = 36/65 (55%), Gaps = 2/65 (3%)

Query: 670 TVPSGPLTYALRSVIVHYG-SHNYGHYIAF-RKFRGLWWRISDETVYVVDEAEVLSTPGV 727
           ++ S P+ Y L SV+VH G S + GHYIA  ++  G W    DE +  + E ++L  P  
Sbjct: 631 SISSLPVRYQLISVVVHEGRSLSSGHYIAHCKQPDGSWATYDDEYINKISEKQLLKEPNA 690

Query: 728 FMLFY 732
           + L Y
Sbjct: 691 YFLVY 695

>NDAI0C05900 Chr3 complement(1350639..1353119) [2481 bp, 826 aa]
           {ON} Anc_8.188 YDR069C
          Length = 826

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 39/83 (46%), Gaps = 9/83 (10%)

Query: 662 GQLAPSSSTVP-----SGPLTYALRSVIVHYGSHNYGHYIAFRK---FRGLWWRISDETV 713
           G+L P+ +  P     + P  Y L +V  H G+   GHY A+     +RG W+R  D + 
Sbjct: 744 GKLPPNFNEPPPSRGQTPPFKYKLNAVSCHSGNLGSGHYTAYVDKGLYRG-WFRFDDASY 802

Query: 714 YVVDEAEVLSTPGVFMLFYEHDY 736
             V       TP  ++LFY+  Y
Sbjct: 803 RPVKFGTEFLTPDAYLLFYQRIY 825

>Skud_15.286 Chr15 complement(511346..515182) [3837 bp, 1278 aa] {ON}
            YOR124C (REAL)
          Length = 1278

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%), Gaps = 3/49 (6%)

Query: 678  YALRSVIVHYGSHNYGHYIAF---RKFRGLWWRISDETVYVVDEAEVLS 723
            Y+L SV +H G  +YGHY  +   R + G+W + +DET+  V E EV +
Sbjct: 1199 YSLFSVFIHRGEASYGHYWIYIKDRNYGGVWRKYNDETISEVQEEEVFN 1247

 Score = 33.5 bits (75), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 32/109 (29%), Positives = 52/109 (47%), Gaps = 12/109 (11%)

Query: 38  TGLLIYKNRRYIRNIM--DALGTVGGDLTRGF--RNSYKGSVFNKWGSRNPAQEATMLKR 93
           T L I+K + Y  ++   D    +   LTR    RNS   + F   G+ +P      L  
Sbjct: 676 TVLKIFKQKWYDESVFEPDQFLILRAALTRISIERNSNLITNFLLTGTIDP----NSLPP 731

Query: 94  GGYVGGLINDGNTCFMNSVIQSLASSKSLMQFLDEELMEASKELENPNE 142
             +  G+ N GNTC++NS++Q   S   L ++    ++E  K L+N N+
Sbjct: 732 ENWPTGINNIGNTCYLNSLLQYYFSIAPLRRY----ILEYQKTLDNFND 776

>Smik_16.163 Chr16 (301703..303208) [1506 bp, 501 aa] {ON} YPL072W
           (REAL)
          Length = 501

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 51/190 (26%), Positives = 87/190 (45%), Gaps = 29/190 (15%)

Query: 323 PLDGITAERIGCLQCGENGGIRYSVFSGLSLNLPSDTVGSALKLSQLLREWVKPEIIEGV 382
           P +G T++ + CLQC       Y       L++P  T   + KL  +L    + EIIE  
Sbjct: 204 PFEGETSKFLVCLQCKGLSKPSYQQTFIRELSVPQQT---SEKLLTILAND-ETEIIEDY 259

Query: 383 ECNRCALKAVLEHLEKTLTQYE-INDKVSEKLVSAVSSRVEELKAILAKPVVDDD----- 436
            C+ C ++A+L H      +Y    D   E+L+      +E LK    K  +++D     
Sbjct: 260 SCSICQIRAILNH-----ERYRNFKDCTPEELL-----MIEALKNYATKASINEDLPPEL 309

Query: 437 -DYKKLHTENMVRKCSKSKQILISRP-----PPLLSIHINRSVFDPRTYTIRKNNSKVLF 490
             Y K ++++ +   SK K  +I +      P +L +H++RS F+  TY   +N   V F
Sbjct: 310 EQYIKRYSKDKLH-ISKVKGKIIKKDVAVQLPDILVVHLSRSTFNGITYC--RNPCNVEF 366

Query: 491 KSRLNLAPWS 500
             R+ L  ++
Sbjct: 367 GERVKLPEYT 376

 Score = 37.0 bits (84), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 24/37 (64%)

Query: 664 LAPSSSTVPSGPLTYALRSVIVHYGSHNYGHYIAFRK 700
           LA + +   +  + Y L+SV+ H GSH+ GHYI +R+
Sbjct: 377 LAENRAITENRQVKYNLKSVVKHTGSHSRGHYICYRR 413

 Score = 32.7 bits (73), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 19/30 (63%)

Query: 99  GLINDGNTCFMNSVIQSLASSKSLMQFLDE 128
           GLIN GN CF+ S +Q LA     +++L +
Sbjct: 54  GLINRGNDCFITSSLQGLAGMPRFVEYLKQ 83

>ZYRO0A05962g Chr1 complement(474545..475942) [1398 bp, 465 aa] {ON}
           similar to uniprot|P50102 Saccharomyces cerevisiae
           YMR223W UBP8 Ubiquitin-specific protease that is a
           component of the SAGA (Spt-Ada-Gcn5-Acetyltransferase)
           acetylation complex required for SAGA-mediated
           deubiquitination of histone H2B
          Length = 465

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 48/206 (23%), Positives = 80/206 (38%), Gaps = 41/206 (19%)

Query: 73  GSVFNK-WGSRNPAQEATMLKRGGYVGGLINDGNTCFMNSVIQSLASSKSLMQFLDEELM 131
            S+ NK W       +   L+R   + GL+N G+TCFM+S++Q L  +    QF   +L 
Sbjct: 111 ASMLNKYWDDVVTKTQIPKLERRDGLQGLLNMGSTCFMSSIVQCLIHNPYFFQFSINQLH 170

Query: 132 EASKELENPNETSSAVEEEGNLGSNSELRNRSSSKKTYGKRKKRLTRNAEKDAALEDEGV 191
                L++P    S   +                 + YG     L +N E D+   +   
Sbjct: 171 SQRCPLQDPLSCISCALDR-------------MVWEFYG--HPELIKNGEDDS--NNSRT 213

Query: 192 NMEFSAALKELLEKLNDKYHRDKPYFKTNKLLKTMSKAPNKNIILGYDQEDAQEFFQTIL 251
           + E++  +                       L   S   N+N+  GY Q+DA E++Q +L
Sbjct: 214 SDEYAGFIG----------------------LFVSSWKINENLA-GYFQQDAHEYWQFLL 250

Query: 252 SELEKNIKSLRGKSDKDNEPTELADI 277
           ++L  +      KS  +    EL D 
Sbjct: 251 NQLHNDYMVSHNKSPDETNFAELCDC 276

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 33/58 (56%), Gaps = 2/58 (3%)

Query: 676 LTYALRSVIVHYGSHNYGHYIAFRKF-RGLWWRISDETVYVVDEAEVLSTPGVFMLFY 732
           + + L  +I H G+ N GHYIAF K   G W++ +D  V  + E E+L     ++LFY
Sbjct: 403 IIFELIGIIAHRGTVNEGHYIAFTKVTTGHWFKFNDSMVSSITEEELLQEQA-YLLFY 459

>ZYRO0C09812g Chr3 complement(743861..745969) [2109 bp, 702 aa] {ON}
           some similarities with uniprot|P53874 Saccharomyces
           cerevisiae YNL186W UBP10 Ubiquitin-specific protease
           that deubiquitinates ubiquitin-protein moieties may
           regulate silencing by acting on Sir4p involved in
           posttranscriptionally regulating Gap1p and possibly
           other transporters primarily located in the nucleus
          Length = 702

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 33/60 (55%), Gaps = 2/60 (3%)

Query: 675 PLTYALRSVIVHYG-SHNYGHYIAF-RKFRGLWWRISDETVYVVDEAEVLSTPGVFMLFY 732
           PL Y L +V+VH G S + GHYI   ++  G W    DE +  ++E +VL  P  + L Y
Sbjct: 584 PLKYQLITVVVHEGRSLSSGHYIVHCKQPEGHWATYDDEYINNINEKDVLREPNAYYLVY 643

>YOR124C Chr15 complement(554824..558642) [3819 bp, 1272 aa] {ON}
            UBP2Ubiquitin-specific protease that removes ubiquitin
            from ubiquitinated proteins; interacts with Rsp5p and is
            required for MVB sorting of membrane proteins; can cleave
            polyubiquitin and has isopeptidase activity
          Length = 1272

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/49 (42%), Positives = 30/49 (61%), Gaps = 3/49 (6%)

Query: 678  YALRSVIVHYGSHNYGHYIAFRKFR---GLWWRISDETVYVVDEAEVLS 723
            Y+L SV +H G  +YGHY  + K R   G+W + +DET+  V E EV +
Sbjct: 1193 YSLFSVFIHRGEASYGHYWIYIKDRNRNGIWRKYNDETISEVQEEEVFN 1241

>Suva_2.228 Chr2 complement(385322..388105) [2784 bp, 927 aa] {ON}
           YDR069C (REAL)
          Length = 927

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 66/297 (22%), Positives = 110/297 (37%), Gaps = 74/297 (24%)

Query: 96  YVGGLINDGNTCFMNSVIQSLASSKSLMQ-FLDEELMEASKELENPNETSSAVEEEGNLG 154
           +  GL N GN+C+MN +IQ +  +  L Q FLD+   +                   ++ 
Sbjct: 561 FAVGLENLGNSCYMNCIIQCILGTHELTQIFLDDSYAK-------------------HIN 601

Query: 155 SNSELRNRSSSKKTYGKRKKRLTRNAEKDAALEDEGVNMEFSAALKELLEKLNDKYHRDK 214
            NS+L ++    K Y  R   +    + D++ +D    ++F  A   +            
Sbjct: 602 INSKLGSKGILAK-YFARLVHMMYKKQVDSSKKDSISPIKFKLACGSV------------ 648

Query: 215 PYFKTNKLLKTMSKAPNKNIILGYDQEDAQEFFQTILSELEKNIKSLRGKSDKDNEPTEL 274
                N L KT S            Q+D QEF Q +L  L +++          N P  L
Sbjct: 649 -----NSLFKTAS------------QQDCQEFCQFLLDGLHEDLNQCGS-----NPP--L 684

Query: 275 ADIPKNAMIGQERLGEMGTVYLPAEQIDPNCVLGHEAKQLFFPFDLVTPL-DGITAERIG 333
            ++ + A   +ERL       +  E+             L   F ++  L  G  A R+ 
Sbjct: 685 KELSQEAETRRERLSLRIASSIEWERF------------LTTDFSVIVDLFQGQYASRLK 732

Query: 334 CLQCGENGGIRYSVFSGLSLNLPSDTVGSALKLSQLLREWVKPEIIEGVE---CNRC 387
           C  C       Y  F+ LS+ +P     + + +    +E+ K E +E  E   C  C
Sbjct: 733 CKTCNHTST-TYQPFTVLSIPIPKKNSQNKITIEDCFKEFTKCENLEIDEQWLCPHC 788

>Smik_15.301 Chr15 complement(515941..519759) [3819 bp, 1272 aa] {ON}
            YOR124C (REAL)
          Length = 1272

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/49 (44%), Positives = 30/49 (61%), Gaps = 3/49 (6%)

Query: 678  YALRSVIVHYGSHNYGHYIAFRKFR---GLWWRISDETVYVVDEAEVLS 723
            Y+L SV +H G  +YGHY  + K R   G+W + +DETV  V E EV +
Sbjct: 1193 YSLFSVFIHRGEASYGHYWIYIKDRNHNGVWRKYNDETVSEVQEDEVFN 1241

>KAFR0A07580 Chr1 complement(1528362..1530770) [2409 bp, 802 aa]
           {ON} Anc_2.69 YNL186W
          Length = 802

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 33/60 (55%), Gaps = 2/60 (3%)

Query: 675 PLTYALRSVIVHYG-SHNYGHYIAF-RKFRGLWWRISDETVYVVDEAEVLSTPGVFMLFY 732
           P+ Y L SV+VH G S + GHY+A  ++  GLW    DE +  + + EVL     + L Y
Sbjct: 670 PVKYQLISVVVHEGRSLSSGHYVAHCKQPDGLWATYDDEYINKISDKEVLRETNAYYLVY 729

 Score = 32.0 bits (71), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 13/51 (25%), Positives = 29/51 (56%)

Query: 99  GLINDGNTCFMNSVIQSLASSKSLMQFLDEELMEASKELENPNETSSAVEE 149
           GL+N G TC+ N+ +Q++    ++  +L + L     ++ +P+  S+ + E
Sbjct: 369 GLLNHGVTCYTNAAVQAMLHIPAVQHYLFDILRGKYNDIISPDSVSTVLAE 419

>NDAI0E00810 Chr5 complement(163826..165307) [1482 bp, 493 aa] {ON}
           Anc_8.742
          Length = 493

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 31/58 (53%), Gaps = 2/58 (3%)

Query: 676 LTYALRSVIVHYGSHNYGHYIAFRKFR-GLWWRISDETVYVVDEAEVLSTPGVFMLFY 732
           + Y L S+I H G+ N GHYI   K   G W++ +D  V  + E E L     ++LFY
Sbjct: 431 MIYELTSIISHKGTVNEGHYIVVVKVNDGQWFKFNDSMVSAITEEEALKQQA-YLLFY 487

 Score = 34.7 bits (78), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 44/187 (23%), Positives = 70/187 (37%), Gaps = 52/187 (27%)

Query: 74  SVFNK-WGSRNPAQEATMLKRGGYVGGLINDGNTCFMNSVIQSLASSKSLMQFLDEELME 132
           S+ NK W   +     T  +R   + GL+N G+TCFM+S++Q+L                
Sbjct: 112 SMLNKFWDDISKKTHITSQERKDGLFGLVNMGSTCFMSSILQTL---------------- 155

Query: 133 ASKELENPNETSSAVEEEGNLGSNSELRNRSSSKKTYGKRKKRLTRNAEKDAALEDEGVN 192
               + NP   + ++ +           N   SK         L     +  A E +G N
Sbjct: 156 ----IHNPYVVNYSMCQTH--------YNMCQSKNPLSCTSCALDLIITEFYATESKGNN 203

Query: 193 MEFSAALKELLEKLNDKYHRDKPYFKTNKLLKTMSKAPNKNIILGYDQEDAQEFFQTILS 252
              +  +  L                 N LL+      N+N   GY Q+DA EF Q IL+
Sbjct: 204 SSHTGFISLL-----------------NSLLQV-----NENFA-GYSQQDAHEFLQFILN 240

Query: 253 ELEKNIK 259
           ++  + K
Sbjct: 241 QIHNDYK 247

>KNAG0F01220 Chr6 (219798..222152) [2355 bp, 784 aa] {ON} Anc_2.69
           YNL186W
          Length = 784

 Score = 43.1 bits (100), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 40/75 (53%), Gaps = 3/75 (4%)

Query: 675 PLTYALRSVIVHYG-SHNYGHYIAF-RKFRGLWWRISDETVYVVDEAEVLSTPGVFMLFY 732
           P+ Y L SV+VH G S + GHYIA  ++  G W    DE +  + E +VL     + L Y
Sbjct: 642 PVKYQLISVVVHEGRSLSSGHYIAHCKQPDGSWSTYDDEYINKITERDVLRESNAYYLVY 701

Query: 733 EHDYNQTLQKMNDDL 747
               ++ + K+ DDL
Sbjct: 702 TRLTSKAI-KLRDDL 715

>TPHA0O01640 Chr15 complement(325844..328084) [2241 bp, 746 aa] {ON}
           Anc_2.69 YNL186W
          Length = 746

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 31/59 (52%), Gaps = 2/59 (3%)

Query: 676 LTYALRSVIVHYG-SHNYGHYIAF-RKFRGLWWRISDETVYVVDEAEVLSTPGVFMLFY 732
           + Y L SV+VH G S + GHYIA  ++  G W    DE   ++ E  VL  P  + L Y
Sbjct: 614 VMYQLISVVVHEGRSLSSGHYIAHCKQPDGTWATYDDEYTNIISERNVLKEPNAYYLVY 672

>Suva_8.176 Chr8 complement(312595..316407) [3813 bp, 1270 aa] {ON}
            YOR124C (REAL)
          Length = 1270

 Score = 43.1 bits (100), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/49 (42%), Positives = 30/49 (61%), Gaps = 3/49 (6%)

Query: 678  YALRSVIVHYGSHNYGHYIAFRKFR---GLWWRISDETVYVVDEAEVLS 723
            Y+L SV +H G  +YGHY  + K R   G+W + +DET+  V E EV +
Sbjct: 1191 YSLFSVFIHRGEASYGHYWIYIKDRNQNGVWRKYNDETISEVPEEEVFN 1239

>Kpol_1062.23 s1062 (51365..55165) [3801 bp, 1266 aa] {ON}
            (51365..55165) [3801 nt, 1267 aa]
          Length = 1266

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%), Gaps = 3/49 (6%)

Query: 678  YALRSVIVHYGSHNYGHYIAFRK---FRGLWWRISDETVYVVDEAEVLS 723
            Y+L +V +H G  +YGHY  + K     G+W + +DET+  V EAEV +
Sbjct: 1188 YSLFAVFIHRGEASYGHYWVYIKDFTKNGIWRKYNDETITEVPEAEVFN 1236

>Kpol_513.25 s513 (71125..74697) [3573 bp, 1190 aa] {ON}
           (71125..74697) [3573 nt, 1191 aa]
          Length = 1190

 Score = 42.7 bits (99), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 27/51 (52%), Gaps = 2/51 (3%)

Query: 674 GPLTYALRSVIVHYGSHNYGHYIAFRK--FRGLWWRISDETVYVVDEAEVL 722
           GP  Y L  V+VH G  + GHY A  K      W+R  DE V+ VD+ +V 
Sbjct: 437 GPKNYKLHGVLVHTGDISTGHYYAMIKPTLEDQWYRFDDEKVWKVDKKQVF 487

>CAGL0J11352g Chr10 complement(1103473..1105788) [2316 bp, 771 aa]
           {ON} similar to uniprot|P53874 Saccharomyces cerevisiae
           YNL186w UBP10
          Length = 771

 Score = 42.7 bits (99), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 32/60 (53%), Gaps = 2/60 (3%)

Query: 675 PLTYALRSVIVHYG-SHNYGHYIAF-RKFRGLWWRISDETVYVVDEAEVLSTPGVFMLFY 732
           P+ Y L SV+VH G S + GHYIA  ++  G W    DE +  + E EVL     + + Y
Sbjct: 659 PVKYELLSVVVHEGRSLSSGHYIAHCKQPDGSWATYDDEYINKITEREVLKERNAYYVLY 718

>TDEL0A01100 Chr1 (186399..188384) [1986 bp, 661 aa] {ON} Anc_2.69
           YNL186W
          Length = 661

 Score = 42.4 bits (98), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 32/60 (53%), Gaps = 2/60 (3%)

Query: 675 PLTYALRSVIVHYG-SHNYGHYIAF-RKFRGLWWRISDETVYVVDEAEVLSTPGVFMLFY 732
           P+ Y L +V+VH G S + GHYI   ++  G W    DE +  + E +VL  P  + L Y
Sbjct: 546 PVKYQLTTVVVHEGRSLSSGHYIVHCKQPDGTWATYDDEYINKITERDVLKEPNAYYLLY 605

>CAGL0M11198g Chr13 (1102767..1104152) [1386 bp, 461 aa] {ON}
           similar to uniprot|P50102 Saccharomyces cerevisiae
           YMR223w UBP8
          Length = 461

 Score = 42.4 bits (98), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 33/58 (56%), Gaps = 2/58 (3%)

Query: 676 LTYALRSVIVHYGSHNYGHYIAFRKFR-GLWWRISDETVYVVDEAEVLSTPGVFMLFY 732
           + Y L  +I H GS N GHY+AF K   G W++ +D  V  + E +VL     ++LFY
Sbjct: 399 ILYELIGIISHTGSVNEGHYVAFCKIENGEWFKFNDSMVTKILEKDVLKEQA-YLLFY 455

>KNAG0A01970 Chr1 (157670..159085) [1416 bp, 471 aa] {ON} Anc_8.540
           YPL072W
          Length = 471

 Score = 42.4 bits (98), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 42/164 (25%), Positives = 74/164 (45%), Gaps = 16/164 (9%)

Query: 323 PLDGITAERIGCLQCGENGGIRYSVFSGLSLNLPSDTVGSALKLSQLLREWVKPEIIEGV 382
           P +G T     CL+C +   +    F    L +P     S   L  +L +    E+IE  
Sbjct: 193 PFEGETTSFSVCLKCKQYSEVSAQKFLIHELVVPKK---SDAHLEDILTDG-DSELIEDY 248

Query: 383 ECNRCALKAVLEHLEKTL---TQYEINDKVSEKLVSAVSSRVEELKAILAKPVVDDD--- 436
            C  C + A+L +   T    T +E       ++V ++ S + +LK   A P    D   
Sbjct: 249 SCLYCQITAILTNESNTTKPPTGFE------AEMVGSLQSLLPDLKINTALPDTLLDYVK 302

Query: 437 DYKKLHTENMVRKCSKSKQILISRPPPLLSIHINRSVFDPRTYT 480
            Y+K +    + K +  ++  IS  P +LS+H++RS+F+  ++T
Sbjct: 303 SYRKGNCNTSILKTAIIRRTAISNAPSILSLHLSRSMFNGASFT 346

 Score = 36.2 bits (82), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 26/44 (59%)

Query: 96  YVGGLINDGNTCFMNSVIQSLASSKSLMQFLDEELMEASKELEN 139
           Y  GL N  N CF+NS +Q+L+S   L  +L + L+  S E E+
Sbjct: 63  YTPGLSNPANECFINSSLQALSSLDYLTAYLHDALLLLSPEEED 106

>NDAI0E04180 Chr5 complement(941527..944010) [2484 bp, 827 aa] {ON}
           Anc_7.390 YBL067C
          Length = 827

 Score = 42.4 bits (98), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 34/65 (52%), Gaps = 9/65 (13%)

Query: 678 YALRSVIVHYGSH-NYGHYIAFRKFRGLWWRI-SDETVYVVDEAEVLSTPG-------VF 728
           Y L+ ++VH GS    GHY+A  K     W +  DET   ++E EVLS  G        +
Sbjct: 672 YKLQGIVVHMGSSPQQGHYVAICKTDKYGWLLFDDETASWINEEEVLSFIGDEKSQNTAY 731

Query: 729 MLFYE 733
           +LFYE
Sbjct: 732 VLFYE 736

>TDEL0D02580 Chr4 (493355..497173) [3819 bp, 1272 aa] {ON} Anc_5.443
            YOR124C
          Length = 1272

 Score = 42.4 bits (98), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 39/72 (54%), Gaps = 15/72 (20%)

Query: 678  YALRSVIVHYGSHNYGHYIAFRKFR---GLWWRISDETVYVVDEAEVL-------STPGV 727
            Y+L +V +H G  +YGHY  + K R   G W + +DET+  V E EV        +TP  
Sbjct: 1191 YSLFAVFIHRGEASYGHYWVYIKDRSKNGTWRKYNDETITEVPETEVFNFTEGNTATP-Y 1249

Query: 728  FMLF----YEHD 735
            F+++    +EHD
Sbjct: 1250 FLVYVRQGHEHD 1261

>YPL072W Chr16 (418512..420011) [1500 bp, 499 aa] {ON}
           UBP16Deubiquitinating enzyme anchored to the outer
           mitochondrial membrane, probably not important for
           general mitochondrial functioning, but may perform a
           more specialized function at mitochondria
          Length = 499

 Score = 42.0 bits (97), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 110/497 (22%), Positives = 191/497 (38%), Gaps = 137/497 (27%)

Query: 18  FIKNLNIDHKSPTFLVIVASTGLLIYKNRRYIRNIMDALGTVGGDLTRGFRNSYKGSVFN 77
           +IKN+    +SPT L+   S GL+I  +   I   + AL  V GD  +            
Sbjct: 3   WIKNVT---ESPTSLIKKVSCGLIIAASLYAIAPSLSAL--VFGDSKQSI---------- 47

Query: 78  KWGSRNPAQEATMLKRGGYVG-GLINDGNTCFMNSVIQSLASSKSLMQFLDEELMEASKE 136
                           G Y   GLIN GN CF+ S +Q LA     +++L        K 
Sbjct: 48  ----------------GKYTTVGLINRGNDCFITSSLQGLAGIPRFVEYL--------KR 83

Query: 137 LENPNETSSAVEEEGNLGSNSELRNRSSSKKTYGKRKKRLTRNAEKDAALEDEGVNMEFS 196
           +      +  +E E  L +N++  N +    T   R  RL  ++   A L +       +
Sbjct: 84  IR-----TVLLELETKLSNNAKGDNPTVDNTT---RHSRLENSSNSLAPLHES-----LT 130

Query: 197 AALKELLEKLNDKYHRDKPYFKTNKLLKTM-SKAPNKNIILGYDQEDAQEFFQTILSELE 255
           + + +L+  + D+     P    N L     SK  +K       Q DA EF   +L  L+
Sbjct: 131 SLILDLIS-VKDRKTSISPKIVINTLESIFKSKISSK-------QNDAHEFTLILLQTLQ 182

Query: 256 KNIKSLRGKSDKDNEPTELADIPKNAMIGQERLGEMGTVYLPAEQIDPNCVLGHEAKQLF 315
           +             E ++L D  K          ++  + +P                  
Sbjct: 183 E-------------ERSKLIDYSK----------QICNLNIPK----------------- 202

Query: 316 FPFDLVTPLDGITAERIGCLQCGENGGIRYSVFSGLSLNLPSDTVGSALKLSQLLREWVK 375
           FPF+      G T++ + CL+C       Y       L++P  T   +  LS +L    +
Sbjct: 203 FPFE------GETSKFLVCLKCKGLSEPSYKQTFIRELSVPQQT---SENLSNILAHD-E 252

Query: 376 PEIIEGVECNRCALKAVLEHLEKTLTQYEINDKVSEKLVSAVSSRVEELKAILAKPVVDD 435
            EII+   C  C ++A+L H E         D   ++++      ++ LK    K  +++
Sbjct: 253 TEIIDDYSCLICQIRAILNHEEYR----NFKDCTPDEIL-----MLDRLKNYATKAPINE 303

Query: 436 DDYKKLHTENMVRKCSKS------------KQILISRPPPLLSIHINRSVFDPRTYTIRK 483
           +       E  V++ SK             K+ ++ + P +L +H++RS F+  TY+  +
Sbjct: 304 N--LPFEVEQYVKRYSKGNLQVSNIKGKVIKKDVVVQLPDILIVHLSRSTFNGITYS--R 359

Query: 484 NNSKVLFKSRLNLAPWS 500
           N   V F  R+ L+ ++
Sbjct: 360 NPCNVKFGERITLSEYT 376

 Score = 39.7 bits (91), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 32/56 (57%)

Query: 659 LSAGQLAPSSSTVPSGPLTYALRSVIVHYGSHNYGHYIAFRKFRGLWWRISDETVY 714
           LS   LA S +   +  + Y L+SV+ H GSH+ GHY+ +R+   + +   DE+ +
Sbjct: 372 LSEYTLAESGTITENRQVKYNLKSVVKHTGSHSSGHYMCYRRKTEIRFGKEDESSF 427

>KNAG0B04190 Chr2 (795803..799591) [3789 bp, 1262 aa] {ON} Anc_5.443
            YOR124C
          Length = 1262

 Score = 42.4 bits (98), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 43/77 (55%), Gaps = 11/77 (14%)

Query: 678  YALRSVIVHYGSHNYGHYIAFRK-FR--GLWWRISDETVYVVDEAEVL-------STPGV 727
            Y+L +V +H G  +YGHY  + K F+  G+W + +DETV  V E EV        +TP  
Sbjct: 1179 YSLFAVFIHRGEASYGHYWVYVKDFKNSGIWRKYNDETVSEVPEEEVFNFTEGNNATP-Y 1237

Query: 728  FMLFYEHDYNQTLQKMN 744
            F++  +  + Q ++ ++
Sbjct: 1238 FLVLVKQTHEQDIEPLH 1254

>KAFR0A04210 Chr1 (843659..844981) [1323 bp, 440 aa] {ON} Anc_8.742
           YMR223W
          Length = 440

 Score = 41.6 bits (96), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 39/81 (48%), Gaps = 7/81 (8%)

Query: 653 PTELNPLSAGQLAPSSSTVPSGPLTYALRSVIVHYGSHNYGHYIAFRKF-RGLWWRISDE 711
           PT LN         ++S++      Y L  VI H G+ N GHYIA  K     W++ +D 
Sbjct: 360 PTYLNMKKYCHTEENNSSI-----IYELNGVISHIGTVNEGHYIATLKLDSNNWFKFNDS 414

Query: 712 TVYVVDEAEVLSTPGVFMLFY 732
            V  + E EVL     ++LFY
Sbjct: 415 MVTSISEEEVLKDQA-YLLFY 434

 Score = 40.4 bits (93), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 41/171 (23%), Positives = 68/171 (39%), Gaps = 47/171 (27%)

Query: 89  TMLKRGGYVGGLINDGNTCFMNSVIQSLASSKSLMQFLDEELMEASKELENPNETSSAVE 148
           T+  R G + G +N G+TCFM+S++Q L  +  ++Q    +   +S ++ NPN   S   
Sbjct: 113 TVTNRDG-LHGFVNMGSTCFMSSILQVLIHNPFIVQNSMSQSHYSSCKIRNPNNCISCAL 171

Query: 149 EEGNLGSNSELRNRSSSKKTYGKRKKRLTRNAEKDAALEDEGVNMEFSAALKELLEKLND 208
           +E                ++YG   K    N +      D  ++M   +       K+ND
Sbjct: 172 DE-------------IIAESYGNFVKY--NNGKPINQYHDGFISMLNCSW------KIND 210

Query: 209 KYHRDKPYFKTNKLLKTMSKAPNKNIILGYDQEDAQEFFQTILSELEKNIK 259
            +                          GY Q+DA EF Q IL+ L ++ K
Sbjct: 211 NF-------------------------AGYSQQDAHEFLQFILNRLHRDYK 236

>Skud_4.323 Chr4 complement(560596..563376) [2781 bp, 926 aa] {ON}
           YDR069C (REAL)
          Length = 926

 Score = 42.0 bits (97), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 66/297 (22%), Positives = 110/297 (37%), Gaps = 74/297 (24%)

Query: 96  YVGGLINDGNTCFMNSVIQSLASSKSLMQ-FLDEELMEASKELENPNETSSAVEEEGNLG 154
           +  GL N GN+C+MN +IQ +  +  L Q FLD+   +                   ++ 
Sbjct: 560 FAVGLENLGNSCYMNCIIQCILGTHELTQIFLDDSYAK-------------------HIN 600

Query: 155 SNSELRNRSSSKKTYGKRKKRLTRNAEKDAALEDEGVNMEFSAALKELLEKLNDKYHRDK 214
            NS+L ++    K Y  R   +    + DA+ +     ++F  A   +            
Sbjct: 601 INSKLGSKGILAK-YFARLVHMMYKEQVDASKKISISPIKFKLACGSV------------ 647

Query: 215 PYFKTNKLLKTMSKAPNKNIILGYDQEDAQEFFQTILSELEKNIKSLRGKSDKDNEPTEL 274
                N L KT S            Q+D QEF Q +L  L +++          N P  L
Sbjct: 648 -----NSLFKTAS------------QQDCQEFCQFLLDGLHEDLNQCGS-----NPP--L 683

Query: 275 ADIPKNAMIGQERLGEMGTVYLPAEQIDPNCVLGHEAKQLFFPFDLVTPL-DGITAERIG 333
            ++ + A   +E+L       +  E+             L   F ++  L  G  A R+ 
Sbjct: 684 KELSQEAEARREKLSLRIASSIEWERF------------LTTDFSVIVDLFQGQYASRLK 731

Query: 334 CLQCGENGGIRYSVFSGLSLNLPSDTVGSALKLSQLLREWVKPEIIEGVE---CNRC 387
           C  CG      Y  F+ LS+ +P     + + +    +E+ K E +E  E   C  C
Sbjct: 732 CKICGHTST-TYQPFTVLSIPIPRKVPQNEITIEDCFKEFTKCENLEVDEQWLCPHC 787

 Score = 35.8 bits (81), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 29/73 (39%), Gaps = 4/73 (5%)

Query: 666 PSSSTVPSGPLTYALRSVIVHYGSHNYGHYIAFRK--FRGLWWRISDETVYVVDEAEVLS 723
           P    +P  P  Y L  V  H+G+   GHY A+ K   R  W    D     V     ++
Sbjct: 854 PVRGQIP--PFKYELYGVACHFGTLYGGHYTAYVKKGLRKGWLYFDDTKFKPVKNKTDVT 911

Query: 724 TPGVFMLFYEHDY 736
               ++LFY   Y
Sbjct: 912 NSNAYVLFYHRVY 924

>NCAS0A03910 Chr1 (791578..793965) [2388 bp, 795 aa] {ON} Anc_8.188
          Length = 795

 Score = 42.0 bits (97), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 31/67 (46%), Gaps = 4/67 (5%)

Query: 674 GPLTYALRSVIVHYGSHNYGHYIAFRKFRGL---WWRISDETVYVVDEAEVLSTPGVFML 730
           GP  Y L +V  H G+   GHY A+   +G    W+   D +  +V  A     P  ++L
Sbjct: 730 GPFKYQLNAVACHMGTLGSGHYTAYVN-KGPDVGWYYFDDSSHRIVKIATEYMNPDAYLL 788

Query: 731 FYEHDYN 737
           FY   YN
Sbjct: 789 FYHRVYN 795

>Smik_5.309 Chr5 complement(462971..465388) [2418 bp, 805 aa] {ON}
           YER144C (REAL)
          Length = 805

 Score = 41.6 bits (96), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 82/371 (22%), Positives = 128/371 (34%), Gaps = 107/371 (28%)

Query: 48  YIRNIMDALGTVGGDLTRGFRNSYKGSVFNKWGSRNP--------AQEATMLKRG----- 94
           +I+N ++ +G    D+     N Y  SV N    R P        +   T+L        
Sbjct: 383 FIKNKVNIIGKPSQDIRGTQINVYSPSVSNICPPRIPPLPQQNSSSSRQTILNNSQVIDL 442

Query: 95  GYVGGLINDGNTCFMNSVIQSLASSKSLMQ-FLDEELMEASKELENPNETSSAVEEEGNL 153
            ++ GL N GN C+MN ++Q L  +  L++ FLD             N   + +  + + 
Sbjct: 443 DFIVGLENTGNCCYMNCILQCLVGTHDLVRMFLD-------------NTYLNFINFDSSK 489

Query: 154 GSNSELRNRSSSKKTYGKRKKRLTRNAEKDAALEDEGVNMEFSAA----LKELLEKLNDK 209
           G          SK    K    L RN  +++A     VN   +       K++   +N  
Sbjct: 490 G----------SKGLLAKNFATLVRNMHRNSAF--MPVNSRTTPVQTIQFKKICGHINSI 537

Query: 210 YHRDKPYFKTNKLLKTMSKAPNKNIILGYDQEDAQEFFQTILSELEKNIKSLRGK----- 264
           Y                             Q+D QEF Q +L  L +++    GK     
Sbjct: 538 YSDSM-------------------------QQDCQEFCQFLLDGLHEDLNQNGGKEHLKQ 572

Query: 265 -SDKDNEPTELADIPKNAMIGQERLGEMGTVYLPAEQIDPNCVLGHEAKQLFFPFDLVTP 323
            ++++ +  E   I K + +  ER                          L   F  +  
Sbjct: 573 LTEEEEQKREKMTIRKASALEWERF-------------------------LLTDFSAIID 607

Query: 324 L-DGITAERIGCLQCGENGGIRYSVFSGLSLNLPSDTVGSALKLSQLLREWVKPE---II 379
           L  G  A R+ C  C +     Y  FS LS+ +P  T  + L      RE+ K E   I 
Sbjct: 608 LFQGQYASRLQCQAC-DRTSTTYQTFSVLSVPVPRITTCNIL---DCFREFTKCEKLGID 663

Query: 380 EGVECNRCALK 390
           E   C RC  K
Sbjct: 664 ELWSCPRCLKK 674

 Score = 35.8 bits (81), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 33/74 (44%), Gaps = 6/74 (8%)

Query: 666 PSSSTVPSGPLTYALRSVIVHYGSHNYGHYIAFRKFRGL---WWRISDETVYVVDEAEVL 722
           P+   +P  P  Y L  V  H GS   GHY ++  ++G    W+   D     +   +  
Sbjct: 735 PTRGQIP--PFRYRLYGVACHSGSLYGGHYTSY-VYKGPKKGWYFFDDSIYRPIRFNDEF 791

Query: 723 STPGVFMLFYEHDY 736
            TP  ++LFYE  +
Sbjct: 792 ITPNAYVLFYERIF 805

>Kpol_1032.28 s1032 complement(57514..60162) [2649 bp, 882 aa] {ON}
           complement(57514..60162) [2649 nt, 883 aa]
          Length = 882

 Score = 41.6 bits (96), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 38/75 (50%), Gaps = 8/75 (10%)

Query: 666 PSSSTVPSGPLTYALRSVIVHYGSHNYGHYIAFRKFRGL--WWRISDETVY--VVDEAEV 721
           P+   VP  P  Y L +V  H GS   GHY A+   +G+   W   D+T Y  + +E E 
Sbjct: 810 PTRGQVP--PFRYKLNAVASHVGSLYGGHYTAYVN-KGINRGWHYFDDTSYRPIKNETEC 866

Query: 722 LSTPGVFMLFYEHDY 736
           + TP  ++LFY   Y
Sbjct: 867 I-TPNAYVLFYHRVY 880

 Score = 33.9 bits (76), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 19/31 (61%)

Query: 96  YVGGLINDGNTCFMNSVIQSLASSKSLMQFL 126
           +  GL N GN+C+MN +IQ L S+  L Q  
Sbjct: 517 FTVGLENMGNSCYMNCIIQCLLSTHELSQIF 547

>Ecym_4514 Chr4 complement(1025172..1028912) [3741 bp, 1246 aa] {ON}
            similar to Ashbya gossypii ACL164C
          Length = 1246

 Score = 42.0 bits (97), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 35/66 (53%), Gaps = 8/66 (12%)

Query: 678  YALRSVIVHYGSHNYGHYIAF---RKFRGLWWRISDETVYVVDEAEVL-----STPGVFM 729
            Y L +V +H G  +YGHY  +   RK  G+W + +DE+V  V E+EV      +T   + 
Sbjct: 1168 YNLFAVFIHRGEASYGHYWVYIKDRKNSGIWRKYNDESVTEVPESEVFDFTEDNTATPYF 1227

Query: 730  LFYEHD 735
            L Y  D
Sbjct: 1228 LVYIKD 1233

 Score = 33.5 bits (75), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 30/59 (50%)

Query: 87  EATMLKRGGYVGGLINDGNTCFMNSVIQSLASSKSLMQFLDEELMEASKELENPNETSS 145
           +   L  G +  GL N GNTC++NS++Q   +   L  ++      AS  L N N++ +
Sbjct: 685 DTNYLTSGNWPTGLNNIGNTCYLNSLLQYYFTISPLRDYIQNYEDTASDLLLNMNQSGA 743

>TBLA0A06470 Chr1 (1588461..1592423) [3963 bp, 1320 aa] {ON} Anc_5.443
            YOR124C
          Length = 1320

 Score = 42.0 bits (97), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 38/70 (54%), Gaps = 11/70 (15%)

Query: 676  LTYALRSVIVHYGSHNYGHYIAFRKFR---GLWWRISDETVYVVDEAEVL-------STP 725
            L Y+L +V +H G  +YGHY  + K     G+W + +DE+V  V E EV        +TP
Sbjct: 1235 LAYSLFAVFIHRGEASYGHYWVYIKDHSKNGIWRKYNDESVTEVPEQEVFNFTEGNTATP 1294

Query: 726  GVFMLFYEHD 735
              F+++ + D
Sbjct: 1295 -YFLVYVKQD 1303

 Score = 34.7 bits (78), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 36/76 (47%), Gaps = 9/76 (11%)

Query: 51  NIMDALGTVGGDLTRGFRNSYKGSVFNKWGSRNPAQEATMLKRGGYVGGLINDGNTCFMN 110
           N+  AL  +  +     +NS   S F   G  +P    T L    +  GL N GNTC++N
Sbjct: 724 NLQSALSKIAYE-----KNSKLISNFIDTGIVDP----TCLPVENWPAGLNNIGNTCYLN 774

Query: 111 SVIQSLASSKSLMQFL 126
           S++Q   S K L  F+
Sbjct: 775 SLLQYYFSIKPLRDFI 790

>Smik_14.144 Chr14 (268784..271075) [2292 bp, 763 aa] {ON} YNL186W
           (REAL)
          Length = 763

 Score = 41.6 bits (96), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 32/60 (53%), Gaps = 2/60 (3%)

Query: 675 PLTYALRSVIVHYG-SHNYGHYIAF-RKFRGLWWRISDETVYVVDEAEVLSTPGVFMLFY 732
           P+ Y L SV+VH G S + GHYIA  ++  G W    DE +  + E +VL     + L Y
Sbjct: 641 PVKYQLLSVVVHEGRSLSSGHYIAHCKQPDGSWATYDDEYINKISERDVLKETNAYYLLY 700

>NCAS0H02100 Chr8 complement(406897..410706) [3810 bp, 1269 aa] {ON}
            Anc_5.443 YOR124C
          Length = 1269

 Score = 41.6 bits (96), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 20/47 (42%), Positives = 29/47 (61%), Gaps = 3/47 (6%)

Query: 678  YALRSVIVHYGSHNYGHYIAFRKFR---GLWWRISDETVYVVDEAEV 721
            Y++ +V +H G  +YGHY  + K R   G+W + +DETV  V E EV
Sbjct: 1186 YSIFAVFIHRGEASYGHYWIYIKDRSQNGIWRKYNDETVSEVPEEEV 1232

>NCAS0B00580 Chr2 (86690..88090) [1401 bp, 466 aa] {ON} Anc_8.742
          Length = 466

 Score = 41.2 bits (95), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 31/58 (53%), Gaps = 2/58 (3%)

Query: 676 LTYALRSVIVHYGSHNYGHYIAFRKFR-GLWWRISDETVYVVDEAEVLSTPGVFMLFY 732
           + Y L  ++ H GS N GHY+   K   G W++ +D  + V+ E E L     ++LFY
Sbjct: 404 IIYELTGILSHIGSINEGHYVVVLKINDGRWFKFNDSMISVIKEDEALKQQA-YLLFY 460

 Score = 36.2 bits (82), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 51/242 (21%), Positives = 97/242 (40%), Gaps = 53/242 (21%)

Query: 34  IVASTGLLIYKNRRYIRNIMDALGTVGGDLTRGFRNSYKGSVFNKWGSRNPAQEATMLKR 93
           I +S GLL      +    MD +G +   +     N Y   +  K  +  P+QE    +R
Sbjct: 88  INSSNGLL------FCFKCMDYIGHLET-INYSMLNKYWDDISTK--TTIPSQE----RR 134

Query: 94  GGYVGGLINDGNTCFMNSVIQSLASSKSLMQFLDEELMEASKELENPNETSSAVEEEGNL 153
            G + GL+N G+TCFM+S++Q+L  +  ++ +   +    +  ++N +   S   +   +
Sbjct: 135 DG-LFGLVNMGSTCFMSSILQALIHNPYIVNYSMSQTHFVNCSIKNSSLCMSCALDAMII 193

Query: 154 GSNSELRNRSSSKKTYGKRKKRLTRNAEKDAALEDEGVNMEFSAALKELLEKLNDKYHRD 213
                        + YG+ K +   ++   ++         F + L              
Sbjct: 194 -------------EFYGQSKLQPISSSSSSSSSSSSSSPSAFISLL-------------- 226

Query: 214 KPYFKTNKLLKTMSKAPNKNIILGYDQEDAQEFFQTILSELEKNIKSLRGKSDKDNEPTE 273
                      T S   N+N   GY Q+DA EF Q  L++L ++ K     ++++N    
Sbjct: 227 -----------TCSLKINENFA-GYSQQDAHEFLQYFLNQLHQDYKRDSSHNEQENNCPC 274

Query: 274 LA 275
           +A
Sbjct: 275 VA 276

>CAGL0A04477g Chr1 (442089..444401) [2313 bp, 770 aa] {ON} similar
           to uniprot|P38187 Saccharomyces cerevisiae YBL067c UBP13
           or uniprot|P39967 Saccharomyces cerevisiae YER098w UBP9
           ubiquitin carboxyl-terminal hydrolase
          Length = 770

 Score = 41.2 bits (95), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 37/79 (46%), Gaps = 9/79 (11%)

Query: 664 LAPSSSTVPSGPLTYALRSVIVHYGS-HNYGHYIAFRKFRGLWWRI-SDETVYVVDEAEV 721
           L  SS+  PS    Y L  ++VH G    +GHYI+  K     W +  DETV  + E  V
Sbjct: 599 LKVSSTFNPSISKNYELSGIVVHMGGGPQHGHYISLCKNEKFGWLLFDDETVEAISEQAV 658

Query: 722 LSTPG-------VFMLFYE 733
           L   G        ++LFY+
Sbjct: 659 LQYTGDKDTMTTAYVLFYQ 677

>Kpol_1018.93 s1018 (248094..250361) [2268 bp, 755 aa] {ON}
           (248094..250361) [2268 nt, 756 aa]
          Length = 755

 Score = 41.2 bits (95), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 26/80 (32%), Positives = 40/80 (50%), Gaps = 14/80 (17%)

Query: 678 YALRSVIVHYGSH-NYGHYIAFRKFRGLWWRI-SDETVYVVDEAEVLSTPG-------VF 728
           Y L  +I+H G+   +GHY+A  K     W +  DETV  V E +VL   G        +
Sbjct: 596 YELSGIIIHLGAGPQHGHYVAMCKTEKFGWLLYDDETVEAVLEKDVLRHVGDSNDLATAY 655

Query: 729 MLFYEHDYNQTLQKMNDDLE 748
           +LFY     +T++  + D+E
Sbjct: 656 ILFY-----KTIETQDSDME 670

>Suva_2.50 Chr2 complement(90700..92952) [2253 bp, 750 aa] {ON}
           YBL067C (REAL)
          Length = 750

 Score = 41.2 bits (95), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 28/89 (31%), Positives = 39/89 (43%), Gaps = 9/89 (10%)

Query: 678 YALRSVIVHYGSH-NYGHYIAFRKFRGLWWRI-SDETVYVVDEAEVLSTPG-------VF 728
           Y L  ++VH G    +GHY++  K     W +  DETV  V E  VL   G        +
Sbjct: 605 YQLAGIVVHMGGGPQHGHYVSLCKHEKFGWLLFDDETVEAVKEETVLEFTGESPNMATAY 664

Query: 729 MLFYEHDYNQTLQKMNDDLEWEEQEEGIN 757
           +LFY+  +     K   +    E EE IN
Sbjct: 665 VLFYKAMHLNAFNKNGSENISNEHEENIN 693

>SAKL0H04994g Chr8 complement(445232..446596) [1365 bp, 454 aa] {ON}
           similar to uniprot|P50102 Saccharomyces cerevisiae
           YMR223W UBP8 Ubiquitin-specific protease that is a
           component of the SAGA (Spt-Ada-Gcn5-Acetyltransferase)
           acetylation complex required for SAGA-mediated
           deubiquitination of histone H2B
          Length = 454

 Score = 41.2 bits (95), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 39/59 (66%), Gaps = 2/59 (3%)

Query: 92  KRGGYVGGLINDGNTCFMNSVIQSLASSKSLMQFLDEELMEASKELENPNET-SSAVEE 149
           KR G + GL+N G+TCFM+S+IQ+L  +  +++   ++L   + +L+N +   S AV++
Sbjct: 131 KRNG-LAGLVNMGSTCFMSSIIQTLIHNPYILKHSMDQLHSTTCDLQNSSSCMSCAVDQ 188

 Score = 40.4 bits (93), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 31/59 (52%), Gaps = 2/59 (3%)

Query: 675 PLTYALRSVIVHYGSHNYGHYIAFRKF-RGLWWRISDETVYVVDEAEVLSTPGVFMLFY 732
            + Y L  +I H GS N GHY +  K   G W++ +D  V  V E +VL     ++LFY
Sbjct: 391 AIVYELIGLISHQGSVNQGHYTSICKIPGGQWFKFNDSMVTAVAEIDVLKEQA-YLLFY 448

>Kwal_14.1957 s14 (549510..550844) [1335 bp, 444 aa] {ON} YER151C
           (UBP3) - Ubiquitin-specific protease [contig 231]
           PARTIAL
          Length = 444

 Score = 40.8 bits (94), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 45/172 (26%), Positives = 77/172 (44%), Gaps = 37/172 (21%)

Query: 99  GLINDGNTCFMNSVIQSLASSKSLMQFLDEELMEASKELENPNETSSAVEEEGNLGSNSE 158
           G++N GN CFM+S++Q L   +  +  ++   ++ S ++ N           G L  ++ 
Sbjct: 10  GIVNSGNICFMSSILQVLLFCEPFVSLMNLISIKTSAKMGNT----------GFLLLDAC 59

Query: 159 LRNRSSSKKTYGKRKKRLTRNAEKDAALEDEGVNMEFSAALKELLEKLNDKYHRDKPYFK 218
           L       K   +R+K    NA           N   S+AL + +              K
Sbjct: 60  LELYRKFDKVTFEREKAARINAG----------NSGISSALADAI--------------K 95

Query: 219 TNKLLKTMSKAPN-KNIILGYDQEDAQEFFQTILSEL-EKNIKSLRGKSDKD 268
            +   KT+SK P  K++  G+ QEDA+EF   +L +L E+ ++S+   SD D
Sbjct: 96  PDDFYKTLSKLPKFKDLRWGH-QEDAEEFLTHLLDQLHEEFVQSIDSLSDND 146

>TDEL0B03670 Chr2 complement(656511..657902) [1392 bp, 463 aa] {ON}
           Anc_8.742 YMR223W
          Length = 463

 Score = 40.4 bits (93), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 38/81 (46%), Gaps = 4/81 (4%)

Query: 653 PTELNPLSAGQLAPSSSTVPSGPLTYALRSVIVHYGSHNYGHYIAFRKFRG-LWWRISDE 711
           P  LN         S   VP   L Y L  V+ H G+ N GHY+A  K  G  W++ +D 
Sbjct: 380 PPYLNMRDYCSSGDSDVDVPD--LIYELIGVVAHKGTVNEGHYVATTKVAGRQWFKFNDS 437

Query: 712 TVYVVDEAEVLSTPGVFMLFY 732
            V  V + E L+    ++LFY
Sbjct: 438 MVSSVTQEEALNEQA-YLLFY 457

 Score = 36.2 bits (82), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 43/204 (21%), Positives = 74/204 (36%), Gaps = 47/204 (23%)

Query: 73  GSVFNK-WGSRNPAQEATMLKRGGYVGGLINDGNTCFMNSVIQSLASSKSLMQFLDEELM 131
            S+ NK W   +       ++R   + GL+N G+TCFM+S++Q L  +     F   +  
Sbjct: 111 ASMLNKYWDDVSIKTVVPSVERRDGLHGLLNLGSTCFMSSILQILIRNPYFFNFSISQSH 170

Query: 132 EASKELENPNETSSAVEEEGNLGSNSELRNRSSSKKTYGKRKKRLTRNAEKDAALEDEGV 191
                +++P    S   E+                + YG        +A     +E + +
Sbjct: 171 SKKCPIQDPKSCISCALEK-------------MVCEFYGS-------SAYSTGDVEPQAM 210

Query: 192 NMEFSAALKELLEKLNDKYHRDKPYFKTNKLLKTMSKAPNKNIILGYDQEDAQEFFQTIL 251
              F   L                           S   N+N+  GY Q+DA EF+Q +L
Sbjct: 211 YSGFIGLL-------------------------VCSWKINENLA-GYSQQDAHEFWQFLL 244

Query: 252 SELEKNIKSLRGKSDKDNEPTELA 275
           ++L  + +   GK   D    +L 
Sbjct: 245 NQLHHDFQVCSGKGVNDAISDDLC 268

>CAGL0H05335g Chr8 complement(512683..514134) [1452 bp, 483 aa] {ON}
           weakly similar to uniprot|Q02863 Saccharomyces
           cerevisiae YPL072w UBP16
          Length = 483

 Score = 40.0 bits (92), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 47/179 (26%), Positives = 76/179 (42%), Gaps = 17/179 (9%)

Query: 323 PLDGITAERIGCLQCGENGGIRYSVFSGLSLNLPSDTVGSALKLSQLLREWVKPEIIEGV 382
           P  G   E   CLQC      + S F+     LP       + L+ +L      EII+  
Sbjct: 199 PFAGTIIESYKCLQCQHETAPKKSTFNIFEAPLPQKY---EIDLNDVLMRN-SNEIIDDY 254

Query: 383 ECNRCALKAVLEHLEKTLTQYEINDKVSEKLVSAVSSRV------EELKAILAKPVVDDD 436
           +C  C +++V+  LE+        + +  KL+ A+  ++      EE    L   +   D
Sbjct: 255 KCMVCLIRSVIT-LERAHGFSGTAESIKGKLL-ALEKKLPDITINEEFDIELQNYL---D 309

Query: 437 DYKKLHTENMVRKCSKSKQILISRPPPLLSIHINRSVFDPRTYTIRKNNSKVLFKSRLN 495
            Y K   +N V + S  KQ      P +  IH++RS ++  T+T  +N  KV F   L+
Sbjct: 310 TYCKYGFKNNVARRSILKQCKFVNAPDIFVIHLSRSTYNGMTFT--RNGCKVHFGETLD 366

 Score = 37.0 bits (84), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 30/51 (58%), Gaps = 5/51 (9%)

Query: 96  YVGGLINDGNTCFMNSVIQSLASSKSLMQFLDEELMEASKELENPNETSSA 146
           Y  GL+N GN C+ NSVIQ+L+S      ++++ ++       + NE SSA
Sbjct: 70  YTTGLVNKGNYCYANSVIQALSSIDYFSDYINKFVIGI-----DENEISSA 115

 Score = 32.3 bits (72), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 11/23 (47%), Positives = 16/23 (69%)

Query: 678 YALRSVIVHYGSHNYGHYIAFRK 700
           Y L+S+++H GSH  GHY   R+
Sbjct: 386 YRLKSIVIHTGSHYSGHYQVLRR 408

>KNAG0G02930 Chr7 (644555..645934) [1380 bp, 459 aa] {ON} Anc_8.742
           YMR223W
          Length = 459

 Score = 40.0 bits (92), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 31/61 (50%), Gaps = 1/61 (1%)

Query: 672 PSGPLTYALRSVIVHYGSHNYGHYIAFRKF-RGLWWRISDETVYVVDEAEVLSTPGVFML 730
           P+  + Y L  V+ H G+ N GHY A  +   G W++ +D  + VV   +VL      +L
Sbjct: 390 PTTSIVYRLSGVVSHSGTVNEGHYTAVLQLNSGEWFKFNDSMISVVSAEDVLREQAYLLL 449

Query: 731 F 731
           +
Sbjct: 450 Y 450

 Score = 34.3 bits (77), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 19/40 (47%), Positives = 27/40 (67%), Gaps = 3/40 (7%)

Query: 79  WGSRNPAQEA--TMLKRGGYVGGLINDGNTCFMNSVIQSL 116
           W S    Q +  T L+R G + GL+N G+TCFM+S++QSL
Sbjct: 117 WDSAMSKQVSLPTSLRRDG-LYGLLNLGSTCFMSSILQSL 155

>CAGL0L01639g Chr12 (178104..181547) [3444 bp, 1147 aa] {ON} similar
           to uniprot|P39538 Saccharomyces cerevisiae YJL197w UBP12
           ubiquitin C-terminal hydrolase
          Length = 1147

 Score = 40.4 bits (93), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 62/285 (21%), Positives = 97/285 (34%), Gaps = 72/285 (25%)

Query: 78  KWGSRNPAQEATMLKRGGYVGGLINDGNTCFMNSVIQSLASSKSLMQFLDEELMEASKEL 137
           KW S        M   G  + GL N GNTC+MNS +Q L     L  +      E    L
Sbjct: 271 KWPSYFFMYNNPMTMTG--IVGLSNLGNTCYMNSGLQCLVHIPKLRDYFFYGGYEQEINL 328

Query: 138 ENPNETSSAVEEEGNLGSNSELRNRSSSKKTYGKRKKRLTRNAEKDAALEDEGVNMEFSA 197
           +NP                                                 G N   + 
Sbjct: 329 DNP------------------------------------------------LGYNGTVAT 340

Query: 198 ALKELLEKLNDKYHRDKPY--FKTNKLLKTMSKAPNKNIILGYDQEDAQEFFQTILSELE 255
           A   L++ L   +   + Y  +  N+   T+ +A   ++  GY Q+D+QEF   +L  L 
Sbjct: 341 AFGNLIQNLYSYHWNQQQYQSYSPNRFKMTLGQA--NSMFAGYMQQDSQEFLAFLLDSLH 398

Query: 256 KNIKSLRGKSDKDNEPTELADIPKNAMIGQERLGEMGTVYLPAEQIDPNCVLGHEAKQLF 315
           +++  +  K            I K  +   E L +   V    +Q+       H A+   
Sbjct: 399 EDLNRIHDK----------PYIEKPTLETSEELADENAV----KQLAKKTWDAHLARNDS 444

Query: 316 FPFDLVTPLDGITAERIGCLQCGENGGIRYSVFSGLSLNLPSDTV 360
              DL     G+    + C  C +N  I +  ++ L+L LP  TV
Sbjct: 445 VINDLFV---GMYKSTLKCPTC-KNISITFDPYNDLTLPLPISTV 485

>ABL145W Chr2 (124839..127088) [2250 bp, 749 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL186W (UBP10)
          Length = 749

 Score = 40.0 bits (92), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 31/60 (51%), Gaps = 2/60 (3%)

Query: 675 PLTYALRSVIVHYG-SHNYGHYIAF-RKFRGLWWRISDETVYVVDEAEVLSTPGVFMLFY 732
           P+ Y L SV+VH G S + GHYIA  ++  G W    DE +  + E  VL     + L Y
Sbjct: 635 PVKYQLISVVVHEGRSLSSGHYIAHCKQPDGTWATYDDEYINKITERNVLKEVNAYYLVY 694

 Score = 32.0 bits (71), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 14/51 (27%), Positives = 28/51 (54%)

Query: 99  GLINDGNTCFMNSVIQSLASSKSLMQFLDEELMEASKELENPNETSSAVEE 149
           GL+N G TC+ N+ +Q++    +L  +L +      K++ +P+  S  + E
Sbjct: 352 GLLNHGVTCYQNAAVQAMLHIPALQHYLFDIAQGKYKDVISPSSVSQVLAE 402

>SAKL0G02728g Chr7 complement(223607..227320) [3714 bp, 1237 aa] {ON}
            similar to uniprot|Q01476 Saccharomyces cerevisiae
            YOR124C UBP2 Ubiquitin-specific protease that removes
            ubiquitin from ubiquitinated proteins cleaves at the C
            terminus of ubiquitin fusions capable of cleaving
            polyubiquitin and possesses isopeptidase activity
          Length = 1237

 Score = 40.0 bits (92), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 30/49 (61%), Gaps = 3/49 (6%)

Query: 678  YALRSVIVHYGSHNYGHYIAF---RKFRGLWWRISDETVYVVDEAEVLS 723
            Y+L +  +H G  +YGHY  +   RK  G+W + +DE+V  V ++EV +
Sbjct: 1157 YSLFAAFIHRGEASYGHYWIYIKDRKKNGIWRKYNDESVTEVPQSEVFN 1205

 Score = 32.3 bits (72), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 23/40 (57%)

Query: 87  EATMLKRGGYVGGLINDGNTCFMNSVIQSLASSKSLMQFL 126
           + + L  G +  GL N GNTC++NS++Q   S   L  ++
Sbjct: 690 DVSCLPAGNWPTGLNNIGNTCYLNSLLQYYFSISPLRDYV 729

>NDAI0E02820 Chr5 (598119..599606) [1488 bp, 495 aa] {ON} Anc_8.540
           YPL072W
          Length = 495

 Score = 39.7 bits (91), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 37/73 (50%), Gaps = 4/73 (5%)

Query: 322 TPLDGITAERIGCLQCGENGGIRYSVFSGLSLNLPSDTVGSALKLSQLLREWVKPEIIEG 381
            P+ G+    + C++CG    I+  +FS   LN+P     S+ KL+ ++    + E IEG
Sbjct: 189 VPMKGVVGNHLICIRCGHISQIKEEMFSIYELNVPQ---CSSSKLTDIIHNN-QLEKIEG 244

Query: 382 VECNRCALKAVLE 394
             C  C +  +L+
Sbjct: 245 YSCLYCEINMILK 257

 Score = 32.0 bits (71), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 27/47 (57%), Gaps = 2/47 (4%)

Query: 676 LTYALRSVIVHYGSHNYGHYIAFRKFRGLWWRISDETVYVVDEAEVL 722
           + Y L+S++ H GSH  GHY  +R    L  RI+ E   +++ + V+
Sbjct: 384 IRYELKSLVKHTGSHYQGHYQCYRHKPKL--RINKENGEIINRSSVI 428

>Kwal_55.21393 s55 (816177..819878) [3702 bp, 1233 aa] {ON} YOR124C
            (UBP2) - Ubiquitin-specific protease [contig 130] FULL
          Length = 1233

 Score = 40.0 bits (92), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 42/79 (53%), Gaps = 11/79 (13%)

Query: 676  LTYALRSVIVHYGSHNYGHYIAFRKFR---GLWWRISDETVYVVDEAEVL-------STP 725
            L Y+L +V +H G  +YGHY  + K     G+W + +DETV    E EV        +TP
Sbjct: 1148 LGYSLFAVFIHRGEASYGHYWLYIKDHNRNGIWRKYNDETVTEAPENEVFNFTEGNTATP 1207

Query: 726  GVFMLFYEHDYNQTLQKMN 744
              F+++ ++ +   +Q ++
Sbjct: 1208 -YFLVYVKNGHESEIQPLH 1225

 Score = 32.3 bits (72), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 34/68 (50%), Gaps = 10/68 (14%)

Query: 99  GLINDGNTCFMNSVIQSLASSKSLMQFLDEELMEASKELENPNETSSAVEEEGNLGSNSE 158
           GL N GNTC++NS++Q       L QF    +++  K L   +++       GNLGS   
Sbjct: 704 GLNNIGNTCYLNSLLQYYFCISPLRQF----IVDYQKTLAEFHDSI------GNLGSKRR 753

Query: 159 LRNRSSSK 166
           +  R  S+
Sbjct: 754 IGGREVSE 761

>Skud_10.22 Chr10 (38735..42502) [3768 bp, 1255 aa] {ON} YJL197W
           (REAL)
          Length = 1255

 Score = 40.0 bits (92), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 59/274 (21%), Positives = 101/274 (36%), Gaps = 69/274 (25%)

Query: 91  LKRGGYVGGLINDGNTCFMNSVIQSLASSKSLMQFLDEELMEASKELENPNETSSAVEEE 150
           L+ G    GL+N GNTC+MNS +Q L     L  +           L N  E  S + EE
Sbjct: 357 LEPGSGTTGLVNLGNTCYMNSALQCLVHIPQLRDYF----------LYNGYE--SEINEE 404

Query: 151 GNLGSNSELRNRSSS--KKTYGKRKKRLTRNAEKDAALEDEGVNMEFSAALKELLEKLND 208
             LG +  +    S   +K +  +   + RNA    ++             K  +   N 
Sbjct: 405 NPLGYHGYVARAFSDLVQKLFHNKLSSMQRNAAFPPSM------------FKSTVGHFNS 452

Query: 209 KYHRDKPYFKTNKLLKTMSKAPNKNIILGYDQEDAQEFFQTILSELEKNIKSLRGKSDKD 268
            +                          GY Q+D+QEF   +L  L +++  +  K    
Sbjct: 453 MFS-------------------------GYMQQDSQEFLAFLLDSLHEDLNRIIKK---- 483

Query: 269 NEPTELADIPKNAMIGQERLGEMGTVYLPAEQIDPNCVLGHEAKQLFFPFDLVTPLDGIT 328
                 A I K ++   + + +   V    +++  +    H  +      DL     G+ 
Sbjct: 484 ------AYIEKPSLSPDDDVNDWNVV----KKLADDTWEMHLKRNCSVITDLFV---GLY 530

Query: 329 AERIGCLQCGENGGIRYSVFSGLSLNLPSDTVGS 362
              + C +C +N  I +  ++ ++L LP DTV S
Sbjct: 531 KSTLYCPEC-KNVSITFDPYNDVTLPLPVDTVWS 563

>NDAI0C01550 Chr3 (327953..331840) [3888 bp, 1295 aa] {ON} Anc_5.443
            YOR124C
          Length = 1295

 Score = 39.7 bits (91), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 29/49 (59%), Gaps = 3/49 (6%)

Query: 678  YALRSVIVHYGSHNYGHYIAFRK---FRGLWWRISDETVYVVDEAEVLS 723
            Y+L +V +H G  +YGHY  + K     G+W + +DETV  V + EV +
Sbjct: 1214 YSLFAVFIHRGEASYGHYWVYIKDYNQNGIWRKYNDETVSEVPDEEVFN 1262

>TBLA0D00620 Chr4 complement(159706..163221) [3516 bp, 1171 aa] {ON}
            Anc_7.390 YBL067C
          Length = 1171

 Score = 39.7 bits (91), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 37/79 (46%), Gaps = 9/79 (11%)

Query: 664  LAPSSSTVPSGPLTYALRSVIVHYGS-HNYGHYIAFRKFRGL-WWRISDETVYVVDEAEV 721
            L  SSS  P+    Y L  ++VH G    +GHY+A  K     W  + DETV  + E  V
Sbjct: 992  LDVSSSFNPNINKRYELNGIVVHMGGGPQHGHYVAICKNDKFGWLLMDDETVETISEETV 1051

Query: 722  LSTPG-------VFMLFYE 733
            L   G        ++LFY+
Sbjct: 1052 LRCKGDSKDLTTAYVLFYK 1070

>TPHA0C02770 Chr3 (604690..607602) [2913 bp, 970 aa] {ON} Anc_8.188
           YDR069C
          Length = 970

 Score = 39.7 bits (91), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 35/80 (43%), Gaps = 3/80 (3%)

Query: 658 PLSAGQLAPSSSTVPSGPLTYALRSVIVHYGSHNYGHYIAFRKFRGLWWRISDET-VYVV 716
           P    +  P+   +P  P  Y L +V  H+GS   GHY ++       WR  D+T +  +
Sbjct: 891 PPGVTEELPTRGQIP--PFNYKLNAVAAHFGSLYGGHYTSYVDKGKFGWRYFDDTKIRPL 948

Query: 717 DEAEVLSTPGVFMLFYEHDY 736
             +    T   ++LFY   Y
Sbjct: 949 KNSYECITSNAYVLFYHRVY 968

>TBLA0D01070 Chr4 complement(275843..277294) [1452 bp, 483 aa] {ON}
           Anc_8.742 YMR223W
          Length = 483

 Score = 39.3 bits (90), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 26/96 (27%), Positives = 44/96 (45%), Gaps = 12/96 (12%)

Query: 653 PTELNPLSAGQLAPSSSTVP---------SGP-LTYALRSVIVHYGSHNYGHYIAFRKFR 702
           P  LN + +   AP+  T P         S P + Y L  ++ H G+ N GHYI + K  
Sbjct: 389 PLHLN-MKSFCTAPTPDTDPTNLNEKTNKSTPDMIYELTGIVTHRGTVNEGHYITYTKTA 447

Query: 703 -GLWWRISDETVYVVDEAEVLSTPGVFMLFYEHDYN 737
            G+W++ +D  V  V   ++L      +++    +N
Sbjct: 448 DGVWYQFNDSVVMKVPLEQMLKEQAYLLIYTIRQFN 483

>KNAG0D01930 Chr4 (324705..327665) [2961 bp, 986 aa] {ON} Anc_8.188
           YDR069C
          Length = 986

 Score = 39.3 bits (90), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 37/81 (45%), Gaps = 5/81 (6%)

Query: 658 PLSAGQLAPSSSTVPSGPLTYALRSVIVHYGSHNYGHYIAF--RKFRGLWWRISDETVYV 715
           PL+  +L P+    P  P  Y L  V  H+GS   GHY A+  +  +  W+   D +   
Sbjct: 905 PLNVSEL-PTRGQKP--PFNYKLYGVACHFGSLYGGHYTAYVDKGIKNGWYYFDDTSCRP 961

Query: 716 VDEAEVLSTPGVFMLFYEHDY 736
           +  +    T   ++LFY+  Y
Sbjct: 962 IKNSMEPITSSAYVLFYKRIY 982

 Score = 38.5 bits (88), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 74/301 (24%), Positives = 114/301 (37%), Gaps = 74/301 (24%)

Query: 96  YVGGLINDGNTCFMNSVIQSLASSKSLMQ-FLDEELMEASKELENPNETSSAVEEEGNLG 154
           ++ GL N GN+C++N +IQ L  +  L++ FLD                 ++ E+  NL 
Sbjct: 618 FMVGLENMGNSCYLNCIIQCLLGNNELIKIFLD-----------------NSFEKYVNL- 659

Query: 155 SNSELRNRSSSKKTYGKRKKRLTRNAEKDAALEDEGVNMEFSAALKELLEKLNDKYHRDK 214
            NS+L     SK    +   RL      +A     G                  K+   K
Sbjct: 660 -NSKL----GSKGVLARYFSRLIHTMYNNARTIKHG-----------------GKHAPVK 697

Query: 215 P-YFKTNKLLKTMSKAPNKNIILGYDQEDAQEFFQTILSELEKNIKSLRGKSDKDNEPTE 273
           P  FK       M+     +   G  Q+D QEF Q +L  L +++    G          
Sbjct: 698 PAQFK-------MACGSVNSAFKGGSQQDCQEFCQFLLDGLHEDLNQCGGNK-------R 743

Query: 274 LADIPKNAMIGQERLGEMGTVYLPAEQIDPNCVLGHEAKQLFFPFDLVTPL-DGITAERI 332
           LA++ + A   +E+L       +  E+             L   F ++  L  G  A R+
Sbjct: 744 LAELTEEAENLREKLSLRIASSIEWERF------------LTTDFSVIGDLFQGQYASRL 791

Query: 333 GCLQCGENGGIRYSVFSGLSLNLPSDTVGSALKLSQLLREWVKPEIIEGVE---CNRCAL 389
            C  CG+     Y  FS LS+ +PS  + S   +     E+ K E +E  E   C RC  
Sbjct: 792 QCKTCGKT-STTYQPFSVLSIPVPSKHI-SKCSIIDCFDEFTKVENLEVDEQWSCPRCKS 849

Query: 390 K 390
           K
Sbjct: 850 K 850

>TPHA0P00680 Chr16 (139640..141823) [2184 bp, 727 aa] {ON} Anc_7.390
           YBL067C
          Length = 727

 Score = 39.3 bits (90), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 27/80 (33%), Positives = 40/80 (50%), Gaps = 11/80 (13%)

Query: 678 YALRSVIVHYG-SHNYGHYIAFRKFRGLWWRI-SDETVYVVDEAEVLS--------TPGV 727
           Y L S++VH G S   GHY+   K +   W I  DETV  V + E++S        +   
Sbjct: 587 YELNSIVVHIGESPQLGHYVTLCKHKSYGWLIYDDETVQAVSD-ELVSRILNNEQRSATA 645

Query: 728 FMLFYEHDYNQTLQKMNDDL 747
           ++LFYE   ++  Q  + DL
Sbjct: 646 YLLFYEEVDSKITQIYDIDL 665

>Skud_2.38 Chr2 complement(77293..79539) [2247 bp, 748 aa] {ON}
           YBL067C (REAL)
          Length = 748

 Score = 38.9 bits (89), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 28/89 (31%), Positives = 39/89 (43%), Gaps = 9/89 (10%)

Query: 678 YALRSVIVHYGS-HNYGHYIAFRKFRGLWWRI-SDETVYVVDEAEVLSTPG-------VF 728
           Y L  ++VH G    +GHY++  K     W +  DETV  V E  VL   G        +
Sbjct: 604 YELSGIVVHMGGGPQHGHYVSLCKHEIFGWLLFDDETVEAVKEEAVLEFTGESPNMATAY 663

Query: 729 MLFYEHDYNQTLQKMNDDLEWEEQEEGIN 757
           +LFY+  Y             +EQEE I+
Sbjct: 664 VLFYKTKYPCAADDNGGRNIAKEQEEHID 692

>Smik_2.49 Chr2 complement(87575..89812) [2238 bp, 745 aa] {ON}
           YBL067C (REAL)
          Length = 745

 Score = 38.9 bits (89), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 32/65 (49%), Gaps = 9/65 (13%)

Query: 678 YALRSVIVHYGSH-NYGHYIAFRKFRGLWWRI-SDETVYVVDEAEVLSTPG-------VF 728
           Y L  ++VH G    +GHY++  K +   W +  DETV  V E  VL   G        +
Sbjct: 602 YELAGIVVHMGGGPQHGHYVSLCKHQKFGWLLFDDETVEAVKEETVLEFTGESANMATAY 661

Query: 729 MLFYE 733
           +LFY+
Sbjct: 662 VLFYK 666

>KNAG0C03580 Chr3 complement(699604..701934) [2331 bp, 776 aa] {ON}
           Anc_7.390 YBL067C
          Length = 776

 Score = 38.9 bits (89), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 35/65 (53%), Gaps = 9/65 (13%)

Query: 677 TYALRSVIVHYGSH-NYGHYIAFRKFRGLWWRI-SDETVYVVDEAEVLSTPG-------V 727
           +Y L+ V+VH G+  ++GHY++        W +  DETV  VDE+ VL   G        
Sbjct: 610 SYRLQGVVVHMGNGPHHGHYVSLCHTELFGWLLFDDETVESVDESYVLDFVGSHESPTTA 669

Query: 728 FMLFY 732
           ++LFY
Sbjct: 670 YVLFY 674

>Kpol_1064.48 s1064 (88495..89895) [1401 bp, 466 aa] {ON}
           (88495..89895) [1401 nt, 467 aa]
          Length = 466

 Score = 38.5 bits (88), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 28/57 (49%), Gaps = 1/57 (1%)

Query: 676 LTYALRSVIVHYGSHNYGHYIAFRKF-RGLWWRISDETVYVVDEAEVLSTPGVFMLF 731
           L Y L  +I H G+ N GHY A  K   G W + +D  V ++ E  +L      +++
Sbjct: 404 LIYELIGIICHTGTVNEGHYTAICKIPEGQWIKFNDSMVTIISEETMLKEQAYLLIY 460

 Score = 35.0 bits (79), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 41/177 (23%), Positives = 72/177 (40%), Gaps = 49/177 (27%)

Query: 90  MLKRGGYVGGLINDGNTCFMNSVIQSLASSKSLMQFLDEELMEASKELENPNETSSAVEE 149
           M KR G + GL+N G+TC+++ +IQ L  +     FL   L ++  ++   ++ ++ +  
Sbjct: 130 MSKRDG-LSGLVNMGSTCYVSCIIQCLVRNP---YFLKYSLNQSHFKICKTHDPTTCIS- 184

Query: 150 EGNLGSNSELRNRSSSKKTYGKRKKRLTRNAEKDAALEDEGVNMEFSAALKELLEKLNDK 209
                                              AL+    +    + L + ++K N+ 
Sbjct: 185 ----------------------------------CALDSIVTDFYGISDLDDDVKKTNND 210

Query: 210 YHRDKPYFKTNKLLKTMSKAPNKNIILGYDQEDAQEFFQTILSELEKNIKSLRGKSD 266
              D         L T S   N+N+  GY Q+DA EF+Q +L+ L    KS  G +D
Sbjct: 211 GLID---------LLTCSWKINQNLA-GYSQQDAHEFWQFLLNRLHSEYKSNIGPTD 257

>ACL164C Chr3 complement(67792..71961) [4170 bp, 1389 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YOR124C
            (UBP2)
          Length = 1389

 Score = 38.9 bits (89), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 29/48 (60%), Gaps = 3/48 (6%)

Query: 678  YALRSVIVHYGSHNYGHYIAFRK---FRGLWWRISDETVYVVDEAEVL 722
            Y+L +V +H G  +YGHY  + K     G+W + +DE+V  V E+EV 
Sbjct: 1310 YSLGAVFIHRGEASYGHYWVYIKDCQNGGIWRKYNDESVTEVPESEVF 1357

>YDR069C Chr4 complement(584939..587719) [2781 bp, 926 aa] {ON}
           DOA4Ubiquitin isopeptidase, required for recycling
           ubiquitin from proteasome-bound ubiquitinated
           intermediates, acts at the late endosome/prevacuolar
           compartment to recover ubiquitin from ubiquitinated
           membrane proteins en route to the vacuole
          Length = 926

 Score = 38.9 bits (89), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 65/297 (21%), Positives = 108/297 (36%), Gaps = 74/297 (24%)

Query: 96  YVGGLINDGNTCFMNSVIQSLASSKSLMQ-FLDEELMEASKELENPNETSSAVEEEGNLG 154
           +  GL N GN+C+MN +IQ +  +  L Q FLD+   +                   ++ 
Sbjct: 560 FAVGLENLGNSCYMNCIIQCILGTHELTQIFLDDSYAK-------------------HIN 600

Query: 155 SNSELRNRSSSKKTYGKRKKRLTRNAEKDAALEDEGVNMEFSAALKELLEKLNDKYHRDK 214
            NS+L ++    K Y  R   +    + D + +     ++F  A   +            
Sbjct: 601 INSKLGSKGILAK-YFARLVHMMYKEQVDGSKKISISPIKFKLACGSV------------ 647

Query: 215 PYFKTNKLLKTMSKAPNKNIILGYDQEDAQEFFQTILSELEKNIKSLRGKSDKDNEPTEL 274
                N L KT S            Q+D QEF Q +L  L +++          N P  L
Sbjct: 648 -----NSLFKTAS------------QQDCQEFCQFLLDGLHEDLNQCGS-----NPP--L 683

Query: 275 ADIPKNAMIGQERLGEMGTVYLPAEQIDPNCVLGHEAKQLFFPFDLVTPL-DGITAERIG 333
            ++ + A   +E+L       +  E+             L   F ++  L  G  A R+ 
Sbjct: 684 KELSQEAEARREKLSLRIASSIEWERF------------LTTDFSVIVDLFQGQYASRLK 731

Query: 334 CLQCGENGGIRYSVFSGLSLNLPSDTVGSALKLSQLLREWVKPEIIEGVE---CNRC 387
           C  C       Y  F+ LS+ +P     + + +    RE+ K E +E  E   C  C
Sbjct: 732 CKVCSHTST-TYQPFTVLSIPIPKKNSRNNITIEDCFREFTKCENLEVDEQWLCPHC 787

 Score = 37.0 bits (84), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 39/75 (52%), Gaps = 8/75 (10%)

Query: 666 PSSSTVPSGPLTYALRSVIVHYGSHNYGHYIAFRKFRGL--WWRISDETVY--VVDEAEV 721
           P    +P  P  Y L  V  H+G+   GHY A+ K +GL   W   D+T Y  V ++A+ 
Sbjct: 854 PIRGQIP--PFKYELYGVACHFGTLYGGHYTAYVK-KGLKKGWLYFDDTKYKPVKNKADA 910

Query: 722 LSTPGVFMLFYEHDY 736
           +++   ++LFY   Y
Sbjct: 911 INS-NAYVLFYHRVY 924

>Suva_5.272 Chr5 complement(429119..431485) [2367 bp, 788 aa] {ON}
           YER144C (REAL)
          Length = 788

 Score = 38.5 bits (88), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 28/48 (58%), Gaps = 1/48 (2%)

Query: 81  SRNPAQEATMLKRGGYVGGLINDGNTCFMNSVIQSLASSKSLMQ-FLD 127
           S+ P Q +T +    ++ GL N GN C+MN ++Q L  +  L + FLD
Sbjct: 412 SKPPIQNSTQMFDLDFIVGLENMGNCCYMNCILQCLVGTHDLTRMFLD 459

 Score = 37.4 bits (85), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 35/71 (49%), Gaps = 6/71 (8%)

Query: 666 PSSSTVPSGPLTYALRSVIVHYGSHNYGHYIAFRKFRGLW--WRISDETVY-VVDEAEVL 722
           P+   +P  P  Y L  V  H GS   GHY ++  ++G    W   D+T+Y ++      
Sbjct: 718 PTRGQIP--PFRYRLYGVACHSGSLYGGHYTSY-VYKGPQKGWYFFDDTIYRLIRFNNEF 774

Query: 723 STPGVFMLFYE 733
            TP  ++LFYE
Sbjct: 775 ITPNAYVLFYE 785

 Score = 33.5 bits (75), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 43/161 (26%), Positives = 61/161 (37%), Gaps = 39/161 (24%)

Query: 240 QEDAQEFFQTILSELEKNI------KSLRGKSDKDNEPTELADIPKNAMIGQERLGEMGT 293
           Q+D QEF Q +L  L +++      K L+  S+++    E   I K + +  ER      
Sbjct: 526 QQDCQEFCQFLLDGLHEDLNQNGGKKHLKQLSEEEERTRENMSIRKASALEWERF----- 580

Query: 294 VYLPAEQIDPNCVLGHEAKQLFFPFDLVTPL-DGITAERIGCLQCGENGGIRYSVFSGLS 352
                               L   F  V  L  G  A R+ C  C E+    Y  FS LS
Sbjct: 581 --------------------LLTDFSAVIDLFQGQYASRLQCQAC-EHTSTTYQTFSVLS 619

Query: 353 LNLPSDTVGSALKLSQLLREWVKPE---IIEGVECNRCALK 390
           + +P     + L      RE+ K E   I E   C+RC  K
Sbjct: 620 VPVPRIMTCNVL---DCFREFTKCEKLGIGEQWSCSRCLKK 657

>KLTH0H07370g Chr8 (655985..658330) [2346 bp, 781 aa] {ON} some
           similarities with uniprot|Q01477 Saccharomyces
           cerevisiae YER151C UBP3 Ubiquitin-specific protease that
           interacts with Bre5p to co-regulate anterograde and
           retrograde transport between endoplasmic reticulum and
           Golgi compartments inhibitor of gene silencing cleaves
           ubiquitin fusions but not polyubiquitin
          Length = 781

 Score = 38.5 bits (88), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 46/173 (26%), Positives = 81/173 (46%), Gaps = 40/173 (23%)

Query: 99  GLINDGNTCFMNSVIQSLASSKSLMQFLDEELMEASKELENPNETSSAVEEEGNLGSNSE 158
           G++N GN CFM+S++Q L   +  +  ++  L+          +TS+ +   G L  ++ 
Sbjct: 348 GIVNTGNICFMSSILQVLLFCEPFVNLMN--LISV--------KTSAKMGSTGFLLLDAC 397

Query: 159 LR-NRSSSKKTYGKRKKRLTRNAEKDAALEDEGVNMEFSAALKELLEKLNDKYHRDKPYF 217
           L   R   K+ + + K          A+    GVN+  S+AL + +              
Sbjct: 398 LELYRKFDKQAFEREK----------ASRSSSGVNI--SSALADAI-------------- 431

Query: 218 KTNKLLKTMSKAPN-KNIILGYDQEDAQEFFQTILSEL-EKNIKSLRGKSDKD 268
           K +   KT+SK P  K++  G+ QEDA+EF   +L +L E+ + S+   SD +
Sbjct: 432 KPDDFYKTLSKLPKFKDLRWGH-QEDAEEFLTHLLDQLHEEFVNSIDSLSDSE 483

>KLTH0D12760g Chr4 (1045108..1046469) [1362 bp, 453 aa] {ON} similar
           to uniprot|P50102 Saccharomyces cerevisiae YMR223W UBP8
           Ubiquitin-specific protease that is a component of the
           SAGA (Spt-Ada-Gcn5- Acetyltransferase) acetylation
           complex required for SAGA- mediated deubiquitination of
           histone H2B
          Length = 453

 Score = 38.1 bits (87), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 30/86 (34%), Positives = 40/86 (46%), Gaps = 11/86 (12%)

Query: 651 TQPTELNPLSAGQLAP--SSSTVPSGP-LTYALRSVIVHYGSHNYGHYIAFRKF-RGLWW 706
           T P  LN      +AP    S   S P + Y L +VI   GS N GHY    K   G W+
Sbjct: 369 TYPAYLN------MAPFCHHSEARSVPDMVYELVAVISQEGSVNQGHYTCMCKVPGGQWF 422

Query: 707 RISDETVYVVDEAEVLSTPGVFMLFY 732
           R +D  +  + E +VL     ++LFY
Sbjct: 423 RFNDTMIVSITEEDVLRQQA-YLLFY 447

 Score = 34.3 bits (77), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 39/163 (23%), Positives = 63/163 (38%), Gaps = 58/163 (35%)

Query: 99  GLINDGNTCFMNSVIQSLASSKSLMQFLDEELMEASKELENPNETSSAVEEEGNLGSNSE 158
           GL+N G+TCFM+S+IQ+L  +  ++           K+  N N  S             +
Sbjct: 137 GLVNMGSTCFMSSIIQTLVHNPYVL-----------KQCMNQNHYSRC-----------D 174

Query: 159 LRNRSSSKKTYGKRKKRLTRNAEKDAALEDEGVNMEFSAALKELLEKL----NDKYHRDK 214
           +++ SS                              FS AL +++       +D     +
Sbjct: 175 IQDSSSC-----------------------------FSCALDQIVMNFYGPTSDATFTSQ 205

Query: 215 PYFKTNKLLKTMSKAPNKNIILGYDQEDAQEFFQTILSELEKN 257
                + LL   S   NKN+  GY Q+DA EF Q  L++L  +
Sbjct: 206 QRGFVDLLL--CSWKTNKNLA-GYSQQDAHEFLQFFLNQLHAD 245

>ZYRO0D07062g Chr4 complement(609322..612903) [3582 bp, 1193 aa]
           {ON} similar to uniprot|P50101 Saccharomyces cerevisiae
           YMR304W UBP15 Ubiquitin-specific protease that may play
           a role in ubiquitin precursor processing
          Length = 1193

 Score = 38.5 bits (88), Expect = 0.081,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 25/51 (49%), Gaps = 2/51 (3%)

Query: 674 GPLTYALRSVIVHYGSHNYGHYIAFRK--FRGLWWRISDETVYVVDEAEVL 722
           GP  Y L  V+VH G  + GHY A  K      W+R  DE V+ V + +  
Sbjct: 436 GPRWYGLHGVLVHTGDISTGHYYALIKPGLEDQWYRFDDERVWKVSKKQAF 486

>KNAG0B02370 Chr2 complement(463599..465860) [2262 bp, 753 aa] {ON}
           Anc_7.390 YBL067C
          Length = 753

 Score = 38.1 bits (87), Expect = 0.081,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 35/71 (49%), Gaps = 9/71 (12%)

Query: 672 PSGPLTYALRSVIVHYGSH-NYGHYIAFRKFRGL-WWRISDETVYVVDEAEVLS------ 723
           PS    Y L  V++H G    +GHY++  K     W    DETV  +DE +VL+      
Sbjct: 589 PSVSKKYELTGVVLHMGGGPQHGHYVSVCKTDNFGWLFFDDETVETLDEPQVLNFTGDTT 648

Query: 724 -TPGVFMLFYE 733
            +   ++LFY+
Sbjct: 649 TSTTAYVLFYK 659

>Smik_4.307 Chr4 complement(551719..554508) [2790 bp, 929 aa] {ON}
           YDR069C (REAL)
          Length = 929

 Score = 38.5 bits (88), Expect = 0.083,   Method: Compositional matrix adjust.
 Identities = 64/297 (21%), Positives = 109/297 (36%), Gaps = 74/297 (24%)

Query: 96  YVGGLINDGNTCFMNSVIQSLASSKSLMQ-FLDEELMEASKELENPNETSSAVEEEGNLG 154
           +  GL N GN+C+MN +IQ +  +  L Q FLD+   +                   ++ 
Sbjct: 563 FAVGLENLGNSCYMNCIIQCILGTHELTQIFLDDSYAK-------------------HIN 603

Query: 155 SNSELRNRSSSKKTYGKRKKRLTRNAEKDAALEDEGVNMEFSAALKELLEKLNDKYHRDK 214
            NS+L ++    K Y  R   +    + D++ +     ++F  A   +            
Sbjct: 604 INSKLGSKGILAK-YFARLVHMMYKEQVDSSKKISISPIKFKLACGSV------------ 650

Query: 215 PYFKTNKLLKTMSKAPNKNIILGYDQEDAQEFFQTILSELEKNIKSLRGKSDKDNEPTEL 274
                N L KT S            Q+D QEF Q +L  L +++          N P  L
Sbjct: 651 -----NSLFKTAS------------QQDCQEFCQFLLDGLHEDLNQCGS-----NPP--L 686

Query: 275 ADIPKNAMIGQERLGEMGTVYLPAEQIDPNCVLGHEAKQLFFPFDLVTPL-DGITAERIG 333
            ++ + A   +E+L       +  E+             L   F ++  L  G  A R+ 
Sbjct: 687 KELSQEAEARREKLSLRIASSIEWERF------------LTTDFSVIVDLFQGQYASRLR 734

Query: 334 CLQCGENGGIRYSVFSGLSLNLPSDTVGSALKLSQLLREWVKPEIIEGVE---CNRC 387
           C  C       Y  F+ LS+ +P     + + +    +E+ K E +E  E   C  C
Sbjct: 735 CKVCNHTSTT-YQPFTVLSIPIPKKNSQNKITIEDCFKEFTKCENLEVEEQWLCPHC 790

 Score = 35.8 bits (81), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 35/66 (53%), Gaps = 6/66 (9%)

Query: 675 PLTYALRSVIVHYGSHNYGHYIAFRKFRGL--WWRISDETVY--VVDEAEVLSTPGVFML 730
           P  Y L  V  H+G+   GHY A+ K +GL   W   D+T Y  V ++ + +++   ++L
Sbjct: 864 PFKYELYGVACHFGTLYGGHYTAYVK-KGLKKGWLYFDDTKYKPVKNQTDAINS-NAYVL 921

Query: 731 FYEHDY 736
           FY   Y
Sbjct: 922 FYHRVY 927

>CAGL0H06721g Chr8 complement(667816..671061) [3246 bp, 1081 aa]
           {ON} similar to uniprot|P40453 Saccharomyces cerevisiae
           YIL156w UBP7
          Length = 1081

 Score = 38.1 bits (87), Expect = 0.090,   Method: Compositional matrix adjust.
 Identities = 66/317 (20%), Positives = 115/317 (36%), Gaps = 106/317 (33%)

Query: 97  VGGLINDGNTCFMNSVIQSLASSKSLMQFLDEELMEASKELENPNETSSAVEEEGNLGSN 156
           V GL N GNTC++N ++QSL ++                                     
Sbjct: 647 VTGLRNLGNTCYINCMLQSLFAT------------------------------------- 669

Query: 157 SELRNRSSSKKTYGKRKKRLTRNAEKDAALEDEGVNMEFSAALKELLEKLNDKYHR---- 212
           +EL+N   S K    R+ ++  N  K++A+ +   N+             N  Y      
Sbjct: 670 NELKNLFISGKY---REYQMKPNDNKESAISNTFANL------------FNKMYMNGGCT 714

Query: 213 --DKPYFKTNKLLKTMSKAPNKNIILGYDQEDAQEFFQTILSELEKNIKSLRGKSDKDNE 270
                + K    L+   + P+       DQ+D QEF   IL+ L   +          N+
Sbjct: 715 VVPSGFLKICNFLRPDLRIPD-------DQQDTQEFLLFILNRLHDELS---------NQ 758

Query: 271 PTELADIPKNAMIGQERLGEMGTVYLPAEQIDPNCVLGHEAKQLFFPFDLV----TPLDG 326
              + D P   +   +++                 ++  E  + +F   +V    +P+DG
Sbjct: 759 VNVINDYPNLLLYDDDKM-----------------MVDKEKYKKWFDKTVVANGLSPVDG 801

Query: 327 ITAERI-GCLQCGENG--GIRYSVFSGLSLNLPSDTVGS-----ALKLSQLLREWVKPEI 378
           +   ++   LQC   G   + YS F  LSL LP  +  +      +KL   +  +   E+
Sbjct: 802 VFQGQMENALQCQRCGYESVNYSTFYVLSLALPKPSAPAFYKSGRVKLEDCINMFTSDEV 861

Query: 379 IEG---VECNRCALKAV 392
           + G    +C +C  KAV
Sbjct: 862 LTGENAWDCPKCGSKAV 878

>KLTH0F15862g Chr6 (1288742..1292467) [3726 bp, 1241 aa] {ON} similar
            to uniprot|Q01476 Saccharomyces cerevisiae YOR124C UBP2
            Ubiquitin-specific protease that removes ubiquitin from
            ubiquitinated proteins cleaves at the C terminus of
            ubiquitin fusions capable of cleaving polyubiquitin and
            possesses isopeptidase activity
          Length = 1241

 Score = 38.1 bits (87), Expect = 0.092,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 28/48 (58%), Gaps = 3/48 (6%)

Query: 678  YALRSVIVHYGSHNYGHYIAFRK---FRGLWWRISDETVYVVDEAEVL 722
            Y+L +V +H G  +YGHY  + K     G+W + +DE+V    E+EV 
Sbjct: 1158 YSLFAVFIHRGEASYGHYWIYIKDSGKNGIWRKYNDESVTEAPESEVF 1205

 Score = 32.3 bits (72), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 19/68 (27%), Positives = 34/68 (50%), Gaps = 4/68 (5%)

Query: 87  EATMLKRGGYVGGLINDGNTCFMNSVIQSLASSKSLMQFLDEELMEASKELENPNETSSA 146
           + + L  G +  GL N GNTC++NS++Q       L Q     ++E  K L   +++   
Sbjct: 692 DVSCLPAGNWPTGLNNIGNTCYLNSLLQYYFCISPLRQ----SIVEYQKTLSEFHQSIGH 747

Query: 147 VEEEGNLG 154
           +E +  +G
Sbjct: 748 LESKRRIG 755

>KLLA0E02377g Chr5 complement(218647..222309) [3663 bp, 1220 aa] {ON}
            uniprot|O42726 Kluyveromyces lactis UBP2 Ubiquitin
            carboxyl-terminal hydrolase 2
          Length = 1220

 Score = 38.1 bits (87), Expect = 0.093,   Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 43/84 (51%), Gaps = 10/84 (11%)

Query: 678  YALRSVIVHYGSHNYGHYIAFRKFR---GLWWRISDETVYVVDEAEVL-------STPGV 727
            Y+L +V +H G  +YGHY  + K     G+W + +D++V  V ++EV        +TP  
Sbjct: 1137 YSLFAVFIHRGEASYGHYWVYIKDHTKNGIWRKYNDDSVTEVPQSEVFNFTEGNTATPYF 1196

Query: 728  FMLFYEHDYNQTLQKMNDDLEWEE 751
             +   E    +T++ +   L+ +E
Sbjct: 1197 LVYVREGQEQETIEPLKRILQQQE 1220

>CAGL0G05247g Chr7 complement(491024..493867) [2844 bp, 947 aa] {ON}
           similar to uniprot|P32571 Saccharomyces cerevisiae
           YDR069c DOA4 ubiquitin-specific protease
          Length = 947

 Score = 38.1 bits (87), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 35/70 (50%), Gaps = 6/70 (8%)

Query: 666 PSSSTVPSGPLTYALRSVIVHYGSHNYGHYIAFRKFRGL---WWRISDETVYVVDEAEVL 722
           P+   +P  P  Y+L +V  H+GS   GHY ++   +GL   W+   D+   +V +   +
Sbjct: 875 PARGQIP--PFKYSLYAVANHFGSLYGGHYTSYVN-KGLSRGWYYFDDQNYRLVKKTSEV 931

Query: 723 STPGVFMLFY 732
                ++LFY
Sbjct: 932 VNSNAYVLFY 941

 Score = 37.0 bits (84), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 65/305 (21%), Positives = 109/305 (35%), Gaps = 84/305 (27%)

Query: 96  YVGGLINDGNTCFMNSVIQSLASSKSLMQFLDEELMEASKELENPNETSSAVEEEGNLGS 155
           +  GL N GN+C+MN ++Q +  +  L Q                   +++ E+  N+ S
Sbjct: 581 FTVGLENMGNSCYMNCILQCIMGTNELSQIF----------------LNNSYEKHININS 624

Query: 156 NSELRNRSSSKKTYGKRKKRLTRNAEKDAALEDEGVNMEFSAALKELLEKLNDKYHRDKP 215
                                         L  +GV   + A L  ++ + +  Y ++K 
Sbjct: 625 -----------------------------KLGSKGVLARYFARLAHIMHQTS--YDQEKK 653

Query: 216 YFKTNKLLKTMSKAPNKNIILGYDQEDAQEFFQTILSELEKNIKS------LRGKSDKDN 269
                     M+ A   ++    +Q+D QEF Q +L  L +++        L+  S++  
Sbjct: 654 AAIVRPTQFRMAIASINSMFRNTNQQDCQEFCQFLLDGLHEDLNQCGNNPPLKELSEEAE 713

Query: 270 EPTELADIPKNAMIGQERLGEMGTVYLPAEQIDPNCVLGHEAKQLFFPFDLVTPL-DGIT 328
           +  EL  +   + I  ER                          L   F ++  L  G  
Sbjct: 714 KKRELLSLRIASSIEWERF-------------------------LTTNFSVIIDLFQGQY 748

Query: 329 AERIGCLQCGENGGIRYSVFSGLSLNLPSDTVGSALKLSQLLREWVKPEIIEGVE---CN 385
           A R+ C  C  N    Y  FS LS+ LP+ T  S++ L     E+ K E +E  E   C 
Sbjct: 749 ASRLKCSVCS-NTSTTYQPFSVLSVPLPTGT-KSSVNLMDCFNEFTKCEKLEHDEYWNCP 806

Query: 386 RCALK 390
            C  K
Sbjct: 807 TCKKK 811

>NDAI0A03680 Chr1 (837931..841281) [3351 bp, 1116 aa] {ON} 
          Length = 1116

 Score = 38.1 bits (87), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 29/86 (33%), Positives = 42/86 (48%), Gaps = 9/86 (10%)

Query: 655  ELNPLSAGQLAPSSSTVPSGPLTYALRSVIVHYGSHNYGHYIAF--RKFRGLWWRISDET 712
            EL P    +L P    +P  P  Y L    +H+GS   GHY AF  +  R  W+   D+T
Sbjct: 1034 ELPPGVTDEL-PKRGQIP--PFKYRLYGAALHFGSLYGGHYTAFVNKGIRNGWYYF-DDT 1089

Query: 713  VY--VVDEAEVLSTPGVFMLFYEHDY 736
             Y  + +E E +S+   ++LFY   Y
Sbjct: 1090 NYRPIKNEREPISS-NAYVLFYHRIY 1114

>TPHA0D04660 Chr4 complement(1017401..1020538) [3138 bp, 1045 aa]
           {ON} Anc_5.712 YIL156W
          Length = 1045

 Score = 38.1 bits (87), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 42/165 (25%), Positives = 63/165 (38%), Gaps = 41/165 (24%)

Query: 239 DQEDAQEFFQTILSELEKNIKSLRGKSDKDNEPTELADIPKNAMIGQERLGEMGTVYLPA 298
           DQ+D QEF   +L  L   +           E T L D     +   ER+          
Sbjct: 712 DQQDTQEFLMLVLDRLHDELSK---------EDTVLNDYSNLLLYDAERMH--------- 753

Query: 299 EQIDPNCVLGHEAKQLFFPFDL---VTPLDGI----TAERIGCLQCGENGGIRYSVFSGL 351
                  V   + K+ F   +L   V+P+D I        I C +CG      YS F  L
Sbjct: 754 -------VKVDQYKKWFENSNLSGGVSPIDDIFQGQIENSINCQRCGY-SSFNYSSFYVL 805

Query: 352 SLNLPSDTVGS-----ALKLSQLLREWVKPEIIEG---VECNRCA 388
           SL +P  +V S      +KL   +  + + E++ G    +C+RC 
Sbjct: 806 SLAIPKISVMSFSRTNRVKLEDCINMFTRDEVLSGENAWDCSRCG 850

>NDAI0I02530 Chr9 (584472..588065) [3594 bp, 1197 aa] {ON} Anc_5.18
           YMR304W
          Length = 1197

 Score = 37.7 bits (86), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 25/50 (50%), Gaps = 2/50 (4%)

Query: 675 PLTYALRSVIVHYGSHNYGHYIAFRK--FRGLWWRISDETVYVVDEAEVL 722
           P  Y L  V+VH G  + GHY A  K      W+R  DE V+ V + +V 
Sbjct: 435 PCIYNLHGVLVHTGDISTGHYYAMIKPDLEDQWYRFDDEKVWKVTKKQVF 484

>NCAS0A14370 Chr1 (2830136..2832325) [2190 bp, 729 aa] {ON}
           Anc_7.390
          Length = 729

 Score = 37.7 bits (86), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 32/65 (49%), Gaps = 9/65 (13%)

Query: 678 YALRSVIVHYG-SHNYGHYIAFRKFRGLWWRI-SDETVYVVDEAEVLSTPG-------VF 728
           Y L  V++H G S  +GHY++  K     W +  DETV  V E  VL   G        +
Sbjct: 588 YELTGVVIHMGGSPQHGHYVSLCKNDKFGWLLFDDETVESVTEKTVLEFTGDSSNQATAY 647

Query: 729 MLFYE 733
           +LFY+
Sbjct: 648 VLFYK 652

>KLLA0C06974g Chr3 complement(604344..605684) [1341 bp, 446 aa] {ON}
           similar to uniprot|P50102 Saccharomyces cerevisiae
           YMR223W UBP8 Ubiquitin-specific protease that is a
           component of the SAGA (Spt-Ada-Gcn5-Acetyltransferase)
           acetylation complex required for SAGA-mediated
           deubiquitination of histone H2B
          Length = 446

 Score = 37.4 bits (85), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 31/58 (53%), Gaps = 2/58 (3%)

Query: 676 LTYALRSVIVHYGSHNYGHYIAFRKFR-GLWWRISDETVYVVDEAEVLSTPGVFMLFY 732
           + Y L +V+ H G+ + GHY    K   G W++ +D  V  V E +VL     ++LFY
Sbjct: 387 IAYDLLNVVSHQGTVDQGHYTTVSKTEDGQWFKFNDSVVTSVTEEQVLEQQA-YLLFY 443

>KAFR0I02600 Chr9 (525365..529006) [3642 bp, 1213 aa] {ON} Anc_5.18
           YMR304W
          Length = 1213

 Score = 37.4 bits (85), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 25/50 (50%), Gaps = 2/50 (4%)

Query: 675 PLTYALRSVIVHYGSHNYGHYIAFRK--FRGLWWRISDETVYVVDEAEVL 722
           P  Y L  V+VH G  + GHY A  K      W+R  DE V+ V + +V 
Sbjct: 428 PCIYKLHGVLVHAGDISTGHYYAMIKPSTEDQWYRFDDEKVWKVTKTQVF 477

>TPHA0E01710 Chr5 (343977..347828) [3852 bp, 1283 aa] {ON} Anc_5.443
            YOR124C
          Length = 1283

 Score = 37.4 bits (85), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 31/51 (60%), Gaps = 3/51 (5%)

Query: 676  LTYALRSVIVHYGSHNYGHYIAFRK-FR--GLWWRISDETVYVVDEAEVLS 723
            + Y L +V +H G  +YGHY  + K F+   +W + +DET+  V ++EV +
Sbjct: 1199 IKYNLFAVFIHRGEASYGHYWTYIKDFQQNSIWRKYNDETITEVPDSEVFN 1249

>AGR139C Chr7 complement(1010460..1012829) [2370 bp, 789 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER151C
           (UBP3)
          Length = 789

 Score = 37.4 bits (85), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 29/97 (29%), Positives = 44/97 (45%), Gaps = 11/97 (11%)

Query: 34  IVASTGLLIYKNRRYIRNIM---DALGTVGGDLTRGFRNSYKGSVFNKWGSRNPAQEATM 90
           I A+  L   K +RYI + +   + LGTV        R        N   S  P  E+  
Sbjct: 290 IPANVSLAAKKEKRYIPSSIKGSEPLGTVA------LRMCLDKDYINYVSSTMP--ESAK 341

Query: 91  LKRGGYVGGLINDGNTCFMNSVIQSLASSKSLMQFLD 127
             + G   G++N GN CFM+SV+Q L   +  ++ L+
Sbjct: 342 AIKLGIPRGIMNKGNICFMSSVLQVLLFCEPFIEMLN 378

>TDEL0B04560 Chr2 (808779..816791) [8013 bp, 2670 aa] {ON} Anc_8.155
           YGL195W
          Length = 2670

 Score = 37.4 bits (85), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 29/114 (25%), Positives = 46/114 (40%), Gaps = 21/114 (18%)

Query: 152 NLGSNSELRNRSSSKKTYGKRKKRLTRNAEKDAALEDEGVNMEFSAALKELLEKLNDKYH 211
            L   S +R + S      KR  RL +   KDAAL D G N+ F  A+  LL        
Sbjct: 797 QLAKESAVRAKVSQSALKLKRSIRLVKQLTKDAALVDNGKNLWFPVAVSHLL-------- 848

Query: 212 RDKPYFKTNKLLKTMSKAPNKNIILGYDQEDAQEFFQTILSELEKNIKSLRGKS 265
                        T+ + PN  +++G   +++     TI+SE    ++   G +
Sbjct: 849 -------------TLMQEPNSLVLVGRLAQESYLDLSTIISERLGTVRLFIGTA 889

>TPHA0G00560 Chr7 complement(105403..106794) [1392 bp, 463 aa] {ON}
           Anc_8.742 YMR223W
          Length = 463

 Score = 37.0 bits (84), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 27/57 (47%), Gaps = 1/57 (1%)

Query: 676 LTYALRSVIVHYGSHNYGHYIAFRKF-RGLWWRISDETVYVVDEAEVLSTPGVFMLF 731
           + Y L  VI H G+ N GHYI   K     W + +D  + +VD   VL      +++
Sbjct: 401 IIYELIGVICHTGTVNEGHYICSCKLANNQWVKFNDSMITIVDNETVLKEQAYLLIY 457

>Skud_5.281 Chr5 complement(448432..450903) [2472 bp, 823 aa] {ON}
           YER144C (REAL)
          Length = 823

 Score = 37.4 bits (85), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 35/71 (49%), Gaps = 6/71 (8%)

Query: 666 PSSSTVPSGPLTYALRSVIVHYGSHNYGHYIAFRKFRGLW--WRISDETVYV-VDEAEVL 722
           P+   +P  P  Y L  V  H GS   GHY ++  ++G    W   D++VY  +   +  
Sbjct: 753 PTRGQIP--PFRYRLYGVACHSGSLYGGHYTSY-VYKGPQKGWYFFDDSVYCPIRFNDEF 809

Query: 723 STPGVFMLFYE 733
            TP  ++LFYE
Sbjct: 810 ITPNAYVLFYE 820

>CAGL0I06600g Chr9 (639096..641546) [2451 bp, 816 aa] {ON} similar
           to uniprot|Q01477 Saccharomyces cerevisiae YER151c UBP3
           ubiquitin-specific proteinase
          Length = 816

 Score = 37.4 bits (85), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 28/49 (57%), Gaps = 3/49 (6%)

Query: 677 TYALRSVIVHYG-SHNYGHYIA--FRKFRGLWWRISDETVYVVDEAEVL 722
           TY L  VI H+G S + GHY A  F K    W+RI D  +  +++ +VL
Sbjct: 746 TYELSGVIYHHGMSPDGGHYTADVFHKQTKTWYRIDDVNITKLEDDDVL 794

>TBLA0C07020 Chr3 (1694706..1698449) [3744 bp, 1247 aa] {ON}
           Anc_5.18 YMR304W
          Length = 1247

 Score = 37.4 bits (85), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 26/51 (50%), Gaps = 2/51 (3%)

Query: 674 GPLTYALRSVIVHYGSHNYGHYIAFRK--FRGLWWRISDETVYVVDEAEVL 722
           GP  Y L  V+VH G  + GHY A  K      W+R  DE V+ V + +V 
Sbjct: 492 GPNNYNLHGVLVHTGDISTGHYYAMIKPTTDDKWYRFDDEKVWRVTKKQVF 542

>KAFR0C02590 Chr3 complement(503330..506266) [2937 bp, 978 aa] {ON}
           Anc_8.188 YDR069C
          Length = 978

 Score = 37.0 bits (84), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 28/83 (33%), Positives = 41/83 (49%), Gaps = 9/83 (10%)

Query: 662 GQLAPS-SSTVPS----GPLTYALRSVIVHYGSHNYGHYIAF-RKFRGLWWRISDETVY- 714
           G L P  S+ +P+     P  Y L  V  H+GS   GHY A+  K  G  W   D+T Y 
Sbjct: 894 GNLPPGVSNELPARGQIKPFNYRLYGVACHFGSLYGGHYTAYVDKGIGNGWYYFDDTTYR 953

Query: 715 -VVDEAEVLSTPGVFMLFYEHDY 736
            + ++ E +S+   ++LFY   Y
Sbjct: 954 PLKNDKEPISS-SAYVLFYTRVY 975

>SAKL0E15136g Chr5 complement(1258870..1261983) [3114 bp, 1037 aa]
           {ON} uniprot|Q875P1 Saccharomyces kluyveri UBP7
          Length = 1037

 Score = 37.0 bits (84), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 42/165 (25%), Positives = 70/165 (42%), Gaps = 41/165 (24%)

Query: 239 DQEDAQEFFQTILSELEKNIKSLRGKSDKDNEPTELA-DIPKNAMIGQERLGEMGTVYLP 297
           DQ+D QEF   +L +L           D+ ++P ++A D P+  +   + L         
Sbjct: 700 DQQDTQEFLLFLLDQLH----------DELSDPEQVANDYPQLLLHDDDNL--------- 740

Query: 298 AEQIDPNCVLGHEAKQLF---FPFDLVTPLDGITAERI-GCLQCGENG--GIRYSVFSGL 351
             Q+D     G E  + F      + ++P+D I   ++  CLQC   G     YS F  L
Sbjct: 741 --QVD-----GKEYDKWFEDSISKNGLSPIDSIFQGQMENCLQCQRCGHSSYNYSTFYVL 793

Query: 352 SLNLPSDTVGSALKLSQLLRE-----WVKPEIIEG---VECNRCA 388
           SL +P+    +  K  ++L E     +   E++ G    +C RC 
Sbjct: 794 SLAIPTPGTSTFGKTKKVLLEDCINLFTSDEVLSGENAWDCPRCG 838

>TDEL0C01570 Chr3 complement(269169..271466) [2298 bp, 765 aa] {ON}
           Anc_7.390 YBL067C
          Length = 765

 Score = 36.6 bits (83), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 39/85 (45%), Gaps = 13/85 (15%)

Query: 678 YALRSVIVHYGSH-NYGHYIAFRKFRGLWWRI-SDETVYVVDEAEVLSTPG-------VF 728
           Y L  ++VH G    +GHY++  K     W +  DETV  V E+ V    G        +
Sbjct: 615 YELTGIVVHMGGGPQHGHYVSLCKNDNFGWLLFDDETVEAVHESTVSKFIGDRDSLTTAY 674

Query: 729 MLFYEHDYNQTLQKMNDDLEWEEQE 753
           +LFY+    +  Q  N DL  E ++
Sbjct: 675 VLFYK----EIAQSENQDLSREPKD 695

>Skud_2.177 Chr2 complement(322000..324348) [2349 bp, 782 aa] {ON}
           YBR058C (REAL)
          Length = 782

 Score = 36.6 bits (83), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 34/122 (27%), Positives = 55/122 (45%), Gaps = 14/122 (11%)

Query: 90  MLKRGGYVGGLINDGNTCFMNSVIQSLASSKSLMQFLDEELMEASKELENP--NETSSAV 147
           +L    Y  GLIN GN+C++NSV+QSL +       LD    E   ++  P  N     +
Sbjct: 315 LLPNKDYGCGLINLGNSCYLNSVLQSLLNGGVPNWSLDFLGSEFPLDVVYPASNLKCQWI 374

Query: 148 EEEGNLGSNSELR----NRSSSKKTYGKRKKRLTRNAEKDAALEDEGVNMEFSAALKELL 203
           +    +    E+       ++ KK  GK  +  + N ++DA        MEF   L +LL
Sbjct: 375 KLLNAMKCEPEIYPNGIKPTTFKKCVGKSHEEFSSNRQQDA--------MEFLTFLSDLL 426

Query: 204 EK 205
           ++
Sbjct: 427 DR 428

>NCAS0D02390 Chr4 complement(451930..455565) [3636 bp, 1211 aa] {ON}
           Anc_5.18
          Length = 1211

 Score = 36.6 bits (83), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 25/47 (53%), Gaps = 2/47 (4%)

Query: 678 YALRSVIVHYGSHNYGHYIAFRK--FRGLWWRISDETVYVVDEAEVL 722
           Y L  V+VH G  + GHY A  K   +  W+R  DE V+ V + +V 
Sbjct: 444 YTLHGVLVHTGDISTGHYYAMIKPDLQDQWYRFDDEKVWKVTKKQVF 490

>YER144C Chr5 complement(457806..460223) [2418 bp, 805 aa] {ON}
           UBP5Putative ubiquitin-specific protease, closest
           paralog of Doa4p but has no functional overlap;
           concentrates at the bud neck
          Length = 805

 Score = 36.6 bits (83), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 33/74 (44%), Gaps = 6/74 (8%)

Query: 666 PSSSTVPSGPLTYALRSVIVHYGSHNYGHYIAFRKFRGL---WWRISDETVYVVDEAEVL 722
           P+   VP  P  Y L  V  H GS   GHY ++  ++G    W+   D     +  +   
Sbjct: 735 PTRGQVP--PFRYRLYGVACHSGSLYGGHYTSY-VYKGPKKGWYFFDDSLYRPITFSTEF 791

Query: 723 STPGVFMLFYEHDY 736
            TP  ++LFYE  +
Sbjct: 792 ITPSAYVLFYERIF 805

>Kpol_1045.41 s1045 complement(95233..97371) [2139 bp, 712 aa] {ON}
           complement(95235..97373) [2139 nt, 713 aa]
          Length = 712

 Score = 36.6 bits (83), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 32/65 (49%), Gaps = 9/65 (13%)

Query: 678 YALRSVIVHYG-SHNYGHYIAFRKFRGLWWRI-SDETVYVVDEAEVLSTPG-------VF 728
           Y L  ++VH G    +GHYI+  K     W +  DETV  + E  VLS  G        +
Sbjct: 574 YELGGLVVHIGIGPQHGHYISVCKTSDYGWLLFDDETVECISEDTVLSFVGDSNSAGTAY 633

Query: 729 MLFYE 733
           +LFY+
Sbjct: 634 VLFYK 638

>Ecym_4685 Chr4 complement(1332993..1335329) [2337 bp, 778 aa] {ON}
           similar to Ashbya gossypii AGR370W
          Length = 778

 Score = 36.6 bits (83), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 31/65 (47%), Gaps = 9/65 (13%)

Query: 678 YALRSVIVHYGSH-NYGHYIAFRKFRGLWWRI-SDETVYVVDEAEVLSTPG-------VF 728
           Y L  +++H G    +GHY+A  K     W +  DETV  +DE  V    G        +
Sbjct: 637 YELNGIVIHMGGGPQHGHYVAICKHDMFGWLLYDDETVESIDEETVFKFVGDEKDMTTAY 696

Query: 729 MLFYE 733
           +LF++
Sbjct: 697 VLFFK 701

>ZYRO0B03300g Chr2 (273903..276344) [2442 bp, 813 aa] {ON} similar
           to uniprot|P39967 Saccharomyces cerevisiae YER098W UBP9
           Ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 813

 Score = 36.6 bits (83), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 30/64 (46%), Gaps = 9/64 (14%)

Query: 678 YALRSVIVHYGS-HNYGHYIAFRKFRGLWWRI-SDETVYVVDEAEVLSTPG-------VF 728
           Y L  ++VH G    +GHY++  K     W +  DETV  V E  VL   G        +
Sbjct: 658 YELSGIVVHMGGGPQHGHYVSLCKNDNFGWLLFDDETVESVSEKTVLDFVGDSSTLTTAY 717

Query: 729 MLFY 732
           +LFY
Sbjct: 718 VLFY 721

>AGR370W Chr7 (1416579..1418801) [2223 bp, 740 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YER098W (UBP9) and
           YBL067C (UBP13)
          Length = 740

 Score = 36.2 bits (82), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 26/93 (27%), Positives = 39/93 (41%), Gaps = 21/93 (22%)

Query: 678 YALRSVIVHYGSH-NYGHYIAFRKFRGLWWRI-SDETVYVVDEAEVLSTPG-------VF 728
           Y L  +++H G    +GHY+A  K     W +  DETV  V E  VL   G        +
Sbjct: 592 YELNGIVIHMGGGPQHGHYVAICKHELFGWLLYDDETVESVGEDAVLRFIGDVNDMTTAY 651

Query: 729 MLFYE------------HDYNQTLQKMNDDLEW 749
           +LFY+             DYN  + ++    +W
Sbjct: 652 VLFYKSKREDDDTPAELQDYNANIDQLLKYDDW 684

>TDEL0B04220 Chr2 (747864..750341) [2478 bp, 825 aa] {ON} Anc_8.188
           YDR069C
          Length = 825

 Score = 36.2 bits (82), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 28/66 (42%), Gaps = 2/66 (3%)

Query: 673 SGPLTYALRSVIVHYGSHNYGHYIAF--RKFRGLWWRISDETVYVVDEAEVLSTPGVFML 730
           S P  Y L  +  H GS   GHY ++  +  +  W    D +   V  A    TP  ++L
Sbjct: 758 SPPFNYKLYGIASHVGSLYGGHYTSYVDKGPKRGWCYFDDTSFRPVRNATECITPNAYVL 817

Query: 731 FYEHDY 736
           FY   Y
Sbjct: 818 FYHRVY 823

>Ecym_6184 Chr6 (341652..344207) [2556 bp, 851 aa] {ON} similar to
           Ashbya gossypii AFR007W
          Length = 851

 Score = 36.2 bits (82), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 69/283 (24%), Positives = 108/283 (38%), Gaps = 74/283 (26%)

Query: 82  RNPAQEATMLKRGG--YVGGLINDGNTCFMNSVIQSLASSKSLM-QFLDEELMEASKELE 138
           ++P QE  ML      +  GL+N GN+C+M+ +IQ L  ++ L   FL+           
Sbjct: 468 KSPGQEWAMLTAFNLNFSVGLVNCGNSCYMSCIIQCLLGTQELCTMFLN----------- 516

Query: 139 NPNETSSAVEEEGNLGSNSELRNRSSS--KKTYGKRKK-RLTRNAEKDAALEDEGVNMEF 195
             N   + +     LGS   L    S    + Y + K  R T   EK A L       +F
Sbjct: 517 --NSYQNHINLNSRLGSKGVLARYFSQLIHQMYQQGKDIRKTSGTEKTAVLP-----AQF 569

Query: 196 SAALKELLEKLNDKYHRDKPYFKTNKLLKTMSKAPNKNIILGYDQEDAQEFFQTILSELE 255
             A   +                 N L +  S            Q+D QEF Q +L  L 
Sbjct: 570 KIACGSI-----------------NALFRDRS------------QQDCQEFCQFLLDGLH 600

Query: 256 KNIKSLRGKSDKDNEPTELADIPKNAMIGQERLGEMGTVYLPAEQIDPNCVLGHEAKQLF 315
           +++         +N P  L ++ + A    E++ EM  + + A  I+         + L 
Sbjct: 601 EDLNQC-----GNNPP--LKELSEKA----EKMREMMPMRI-ASSIE-------WERYLT 641

Query: 316 FPFDLVTPL-DGITAERIGCLQCGENGGIRYSVFSGLSLNLPS 357
             F ++  L  G  A ++ C  CG      Y  FS LS+ +PS
Sbjct: 642 TDFSVIVDLFQGQYASQLRCKVCGRT-STTYQPFSVLSVPVPS 683

>Skud_16.209 Chr16 (389855..391366) [1512 bp, 503 aa] {ON} YPL072W
           (REAL)
          Length = 503

 Score = 36.2 bits (82), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 25/72 (34%), Positives = 38/72 (52%), Gaps = 6/72 (8%)

Query: 99  GLINDGNTCFMNSVIQSLASSKSLMQFLDEELMEASKELENP--NETSSAVEEE---GNL 153
           GLIN GN CF+ S +Q+LA     +++L+  +    +EL NP     S +  E     N+
Sbjct: 59  GLINRGNDCFITSALQALAGIPRFVEYLN-GIKSILQELNNPELKSFSRSTRENPTADNI 117

Query: 154 GSNSELRNRSSS 165
            ++S L N S S
Sbjct: 118 ANDSRLENFSDS 129

 Score = 36.2 bits (82), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 29/48 (60%), Gaps = 2/48 (4%)

Query: 676 LTYALRSVIVHYGSHNYGHYIAFRKFRGLWWRISDETVYVVDEAEVLS 723
           + Y L+SV+ H GSH+ GHY+ +R+   + +   DE+   VD   +++
Sbjct: 397 IVYNLKSVVKHTGSHSRGHYMCYRRKGDILFDKEDES--FVDSRSIIT 442

 Score = 34.7 bits (78), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 46/186 (24%), Positives = 87/186 (46%), Gaps = 21/186 (11%)

Query: 323 PLDGITAERIGCLQCGENGGIRYSVFSGLSLNLPSDTVGSALKLSQLLREWVKPEIIEGV 382
           P +G T++ + C+QC     I +       L++P  +  + L +  L  +  + EIIE  
Sbjct: 212 PFEGETSKFLVCVQCNGLSKISHQKTFIRELSVPQKSSENLLDI--LSND--ETEIIEDY 267

Query: 383 ECNRCALKAVLEHLEKTLTQYE-INDKVSEKLVSAVSSRVEELKAILAKPV-VDDDDYKK 440
            C  C  +A+L H      QY    D   ++L+   + +    +A + + + ++ D Y  
Sbjct: 268 SCLICRARAILAH-----EQYRNFKDCAPDELLILDALKDYATEASINEDLPLEIDQYIN 322

Query: 441 LHTENMVRKC-SKSKQILISRP-----PPLLSIHINRSVFDPRTYTIRKNNSKVLFKSRL 494
            +T++  + C S  K  +I R      P +L IH++RS F+  TY+  +N   V F+  +
Sbjct: 323 HYTKD--KFCISNVKGKVIKRDIAVKLPKVLVIHLSRSTFNGVTYS--RNPCNVKFQEEI 378

Query: 495 NLAPWS 500
            L  ++
Sbjct: 379 KLTEYT 384

>YJL197W Chr10 (63805..67569) [3765 bp, 1254 aa] {ON}
           UBP12Ubiquitin carboxyl-terminal hydrolase,
           ubiquitin-specific protease present in the nucleus and
           cytoplasm that cleaves ubiquitin from ubiquitinated
           proteins
          Length = 1254

 Score = 36.2 bits (82), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 54/264 (20%), Positives = 93/264 (35%), Gaps = 69/264 (26%)

Query: 99  GLINDGNTCFMNSVIQSLASSKSLMQFLDEELMEASKELENPNETSSAVEEEGNLGSNSE 158
           GL+N GNTC+MNS +Q L     L  +   +  E     ENP            LG +  
Sbjct: 365 GLVNLGNTCYMNSALQCLVHIPQLRDYFLYDGYEDEINEENP------------LGYHGY 412

Query: 159 LRNRSSS--KKTYGKRKKRLTRNAEKDAALEDEGVNMEFSAALKELLEKLNDKYHRDKPY 216
           +    S   +K +  R   + RNA    ++             K  +   N  +      
Sbjct: 413 VARAFSDLVQKLFQNRMSIMQRNAAFPPSM------------FKSTIGHFNSMFS----- 455

Query: 217 FKTNKLLKTMSKAPNKNIILGYDQEDAQEFFQTILSELEKNIKSLRGKSDKDNEPTELAD 276
                               GY Q+D+QEF   +L  L +++  +  K   +       D
Sbjct: 456 --------------------GYMQQDSQEFLAFLLDSLHEDLNRIIKKEYTEKPSLSPGD 495

Query: 277 IPKNAMIGQERLGEMGTVYLPAEQIDPNCVLGHEAKQLFFPFDLVTPLDGITAERIGCLQ 336
              +  + ++   +   ++L       NC +      LF          G+    + C +
Sbjct: 496 DVNDWNVVKKLADDTWEMHLKR-----NCSV---ITDLFV---------GMYKSTLYCPE 538

Query: 337 CGENGGIRYSVFSGLSLNLPSDTV 360
           C +N  I +  ++ ++L LP DTV
Sbjct: 539 C-QNVSITFDPYNDVTLPLPVDTV 561

>Kpol_2001.54 s2001 complement(144924..148595) [3672 bp, 1223 aa]
           {ON} complement(144924..148595) [3672 nt, 1224 aa]
          Length = 1223

 Score = 36.2 bits (82), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 28/62 (45%), Gaps = 2/62 (3%)

Query: 79  WGSRNPAQEATMLKRGGYVGGLINDGNTCFMNSVIQSLASSKSLMQFLDEELMEASKELE 138
           W S      A    RG    GL N GNTC+MNS +Q L     L  +   ++ E    L+
Sbjct: 325 WLSNYFHYNALTPSRGNI--GLNNLGNTCYMNSALQCLVHIPQLRDYFLYKVFEKEINLD 382

Query: 139 NP 140
           NP
Sbjct: 383 NP 384

>TBLA0C01200 Chr3 complement(258492..259981,260188..260209) [1512
           bp, 503 aa] {ON} Anc_1.369 YFR010W
          Length = 503

 Score = 35.8 bits (81), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 32/54 (59%), Gaps = 4/54 (7%)

Query: 677 TYALRSVIVHYGSHN-YGHYIAF---RKFRGLWWRISDETVYVVDEAEVLSTPG 726
            Y L  +I H G+++  GHY AF   R+   +W++ +D+ V +VD+ ++ +  G
Sbjct: 433 VYNLIGIITHQGANSESGHYQAFIRDREDEEIWYKFNDDKVTIVDKEKIETLAG 486

>CAGL0G02563g Chr7 complement(235498..237393) [1896 bp, 631 aa] {ON}
           weakly similar to uniprot|P36026 Saccharomyces
           cerevisiae YKR098c UBP11 ubiquitin C-terminal hydrolase
          Length = 631

 Score = 35.8 bits (81), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 46/176 (26%), Positives = 72/176 (40%), Gaps = 23/176 (13%)

Query: 317 PFDLVTPLDGITAERIGCLQCGENGGIRYSVFSGLSLNLPSDTVG-----SALKLSQLLR 371
           P DL+    G    ++ C  C E+    +S F  LSLN+P +          ++L   + 
Sbjct: 362 PIDLL--FRGDVESKLICKHCNESAST-FSSFYILSLNIPKEKSSLFFKSKTIRLEDCIN 418

Query: 372 EWVKPEIIEG---VECNRCALKA---VLEHLEKTLTQYEINDKVSEKL---VSAVSSRVE 422
            + + EI+ G     C  C  KA   V+++ +KT  Q   N     K     S + +   
Sbjct: 419 LFTRKEILTGENSWACPSCETKARYNVIDN-DKTYQQKHTNIGKHSKFPRFFSHIEAGKT 477

Query: 423 ELKAILAKPVVDDDDYKKLHTENMVRKCSKSKQIL---ISRPPPLLSIHINRSVFD 475
           E  +   K       Y  L  E   R+  KS+ IL       PP+L IH++R  +D
Sbjct: 478 ERNSGANK--FSQLKYDNLENEQRHRQQKKSETILSVSFVSLPPILVIHLSRFCYD 531

 Score = 31.6 bits (70), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 20/31 (64%), Gaps = 3/31 (9%)

Query: 97  VGGLINDGNTCFMNSVIQSLASSKSLMQFLD 127
           V G+ N GNTC+MNS++Q L  S    QF D
Sbjct: 212 VFGIRNMGNTCYMNSMLQCLFGS---TQFRD 239

>KNAG0L02200 Chr12 complement(394140..397625) [3486 bp, 1161 aa]
           {ON} Anc_5.712 YIL156W
          Length = 1161

 Score = 36.2 bits (82), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 65/301 (21%), Positives = 109/301 (36%), Gaps = 77/301 (25%)

Query: 97  VGGLINDGNTCFMNSVIQSLASSKSLMQ-FLDEELMEASKELENPNETSSAVEEEGNLGS 155
           + GL N GNTC++NS+IQ L ++KS    F+  +  E  KE+           + G  GS
Sbjct: 690 ITGLRNLGNTCYINSMIQCLFATKSFRNLFISMKYKEFLKEV---------APKPGANGS 740

Query: 156 NSELRNRSSSKKTYGKRKKRLTRNAEKDAALEDEGVNMEFSAALKELLEKLNDKYHRDKP 215
              +       +T+    K++  N           V + F                    
Sbjct: 741 QPVI------SRTFYILFKKMYLNGGCSV------VPISF-------------------- 768

Query: 216 YFKTNKLLKTMSKAPNKNIILGYDQEDAQEFFQTILSELEKNIKSLRGKSDKDNEPTELA 275
             K+  LL+   K P+       DQ+D  EF   IL  L   +          N+   + 
Sbjct: 769 -LKSCSLLRPDFKIPD-------DQQDTTEFLMLILDRLHDELS---------NQDAVVN 811

Query: 276 DIPKNAMIGQERLGEMGTVYLPAEQIDPNCVLGHEAKQLFFPFDLVTPLDGITAERIGCL 335
           + P   +  +++L      Y   ++     V+G+       P D +    G     + C 
Sbjct: 812 EYPDLILYDEKKLNVQNKEY---KKWFDKSVIGNGLS----PIDDI--FQGQMENSLHCQ 862

Query: 336 QCGENGGIRYSVFSGLSLNLPSDTVGS-----ALKLSQLLREWVKPEIIEG---VECNRC 387
           +CG +    YS F  LSL +P  T  +      + L + L  +   E++ G    +C  C
Sbjct: 863 RCG-HSSFNYSTFYVLSLAIPKATSSTFSRSKRVSLEECLNMYTSDEVLSGENAWDCPNC 921

Query: 388 A 388
            
Sbjct: 922 C 922

>NDAI0F00200 Chr6 (35966..39283) [3318 bp, 1105 aa] {ON} Anc_5.712
          Length = 1105

 Score = 35.8 bits (81), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 73/319 (22%), Positives = 121/319 (37%), Gaps = 84/319 (26%)

Query: 216  YFKTNKLLKTMSKAPNKNIILGYDQEDAQEFFQTILSELEKNIKSLRGKSDKDNEPTELA 275
            + KT  +L+   + P+       DQ+D QEF   IL  L   +          N+   + 
Sbjct: 750  FLKTCNILRPDLRIPD-------DQQDTQEFLMIILDRLHDEL---------SNQQEVVN 793

Query: 276  DIPKNAMIGQERLGEMGTVYLPAEQIDPNCVLGHEAKQLFFPFDLVTPLDGITAERIGCL 335
            + P   +  +  L      Y      D N V+G+       P D +    G     + C 
Sbjct: 794  EYPNLLLYDENNLKVQNKEY--KHWFDKN-VIGNGLS----PIDHI--FSGQMENSLQCQ 844

Query: 336  QCGENGGIRYSVFSGLSLNL--PSDTVGS---ALKLSQLLREWVKPEIIEG---VECNRC 387
            +CG N    YS F  LSL +  PS T  S    +KL + +  +   E++ G    +C +C
Sbjct: 845  RCG-NSSYNYSTFYVLSLAIPKPSSTTFSRSKRVKLEECINMFTSDEVLSGENAWDCPKC 903

Query: 388  ALKAVLEHLEKTLTQYEINDKVSEKLVSAVSSRVEELKAILAKPVVDDDDYKK----LHT 443
               A                  SEKL++  SS+ + + +       +   YK     LHT
Sbjct: 904  GSSASST------------ISDSEKLLNVTSSKKKNMSS-----HNEHHRYKSKFFTLHT 946

Query: 444  EN------MVRKCS-------------KSKQILISRP------PPLLSIHINRSVFDPRT 478
             +        +K S             KSK+++  +       PP+L IH++R  +D   
Sbjct: 947  RSHRSISPFRKKTSPAAVPSSTKNEPWKSKKLITIKTLNFIVLPPILVIHLSRFYYD--- 1003

Query: 479  YTIRKNNSKVLFKSRLNLA 497
               +KNN+ + +   LN+ 
Sbjct: 1004 -LTKKNNTVITYPLILNIV 1021

>TDEL0A01620 Chr1 (291670..294057) [2388 bp, 795 aa] {ON} Anc_8.202
           YER151C
          Length = 795

 Score = 35.8 bits (81), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 39/84 (46%), Gaps = 4/84 (4%)

Query: 44  KNRRYIRNIMDALGTVGGDLTRGFRNSYKGSVFNKWGSRNPAQEATMLKRGGYVGGLIND 103
           K+++YI      +  +G   +   R  Y    F  +  +NP  E ++  R     G+IN 
Sbjct: 308 KDKKYIPPSTKGIEPLG---SVALRMCYDPD-FIDYTLKNPVLEKSLSIREVAPRGIINR 363

Query: 104 GNTCFMNSVIQSLASSKSLMQFLD 127
            N CFM+SV+Q L   K  +  L+
Sbjct: 364 ANICFMSSVMQVLLYCKPFINILN 387

>YMR304W Chr13 (874987..878679) [3693 bp, 1230 aa] {ON}
           UBP15Ubiquitin-specific protease involved in protein
           deubiquitination; catalytic activity regulated by an
           N-terminal TRAF-like domain and and C-terminal
           sequences; physically interacts with anaphase-promoting
           complex/cyclosome (APC/C) activator, Cdh1p
          Length = 1230

 Score = 35.8 bits (81), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 24/50 (48%), Gaps = 2/50 (4%)

Query: 675 PLTYALRSVIVHYGSHNYGHYIAFRK--FRGLWWRISDETVYVVDEAEVL 722
           P  Y L  V+VH G  + GHY    K      W+R  DE V+ V + +V 
Sbjct: 446 PYVYNLHGVLVHSGDISTGHYYTLIKPGVEDQWYRFDDERVWRVTKKQVF 495

>Smik_13.521 Chr13 (857682..861377) [3696 bp, 1231 aa] {ON} YMR304W
           (REAL)
          Length = 1231

 Score = 35.8 bits (81), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 24/50 (48%), Gaps = 2/50 (4%)

Query: 675 PLTYALRSVIVHYGSHNYGHYIAFRK--FRGLWWRISDETVYVVDEAEVL 722
           P  Y L  V+VH G  + GHY    K      W+R  DE V+ V + +V 
Sbjct: 446 PYVYNLHGVLVHSGDISTGHYYTLIKPGVEDQWYRFDDERVWRVTKKQVF 495

>KLTH0B09944g Chr2 complement(826050..829619) [3570 bp, 1189 aa]
           {ON} similar to uniprot|P50101 Saccharomyces cerevisiae
           YMR304W UBP15 Ubiquitin-specific protease that may play
           a role in ubiquitin precursor processing
          Length = 1189

 Score = 35.8 bits (81), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 25/51 (49%), Gaps = 2/51 (3%)

Query: 674 GPLTYALRSVIVHYGSHNYGHYIAFRK--FRGLWWRISDETVYVVDEAEVL 722
           GP  Y L  V+VH G  + GHY A  K      W+R  D+ V+ V + +  
Sbjct: 435 GPCVYNLHGVLVHSGEISVGHYYAMIKPDVGDQWFRFDDDKVWRVTKEQAF 485

>Suva_13.495 Chr13 (857778..861470) [3693 bp, 1230 aa] {ON} YMR304W
           (REAL)
          Length = 1230

 Score = 35.8 bits (81), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 24/50 (48%), Gaps = 2/50 (4%)

Query: 675 PLTYALRSVIVHYGSHNYGHYIAFRK--FRGLWWRISDETVYVVDEAEVL 722
           P  Y L  V+VH G  + GHY    K      W+R  DE V+ V + +V 
Sbjct: 445 PYIYNLHGVLVHSGDISTGHYYTLIKPGVEDQWYRFDDERVWRVTKKQVF 494

>Skud_13.478 Chr13 (848446..852141) [3696 bp, 1231 aa] {ON} YMR304W
           (REAL)
          Length = 1231

 Score = 35.8 bits (81), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 24/50 (48%), Gaps = 2/50 (4%)

Query: 675 PLTYALRSVIVHYGSHNYGHYIAFRK--FRGLWWRISDETVYVVDEAEVL 722
           P  Y L  V+VH G  + GHY    K      W+R  DE V+ V + +V 
Sbjct: 446 PYIYNLHGVLVHSGDISTGHYYTLIKPGVEDQWYRFDDERVWRVTKKQVF 495

>SAKL0H18656g Chr8 (1658629..1660947) [2319 bp, 772 aa] {ON} some
           similarities with uniprot|Q01477 Saccharomyces
           cerevisiae YER151C UBP3 Ubiquitin-specific protease that
           interacts with Bre5p to co-regulate anterograde and
           retrograde transport between endoplasmic reticulum and
           Golgi compartments inhibitor of gene silencing cleaves
           ubiquitin fusions but not polyubiquitin
          Length = 772

 Score = 35.4 bits (80), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 44/171 (25%), Positives = 74/171 (43%), Gaps = 31/171 (18%)

Query: 99  GLINDGNTCFMNSVIQSLASSKSLMQFLDEELMEASKELENPNETSSAVEEEGNLGSNSE 158
           G++N GN CFM+SV+Q L   K  +  L+        ++       S+V    +L +  E
Sbjct: 334 GIVNTGNICFMSSVLQVLLYCKPFISILNVISYRTVAKI------GSSVSP--SLDACLE 385

Query: 159 LRNRSSSKKTYGKRKKRLTRNAEKDAALEDEGVNMEFSAALKELLEKLNDKYHRDKPYFK 218
           L  R   K+T    KK + ++   +      G N+  + A + +               K
Sbjct: 386 LYRR-FDKQTCENEKKPVPKSKLAN------GNNVGITPAAEPI---------------K 423

Query: 219 TNKLLKTMSKAPNKNIILGYDQEDAQEFFQTILSEL-EKNIKSLRGKSDKD 268
            +   KT+SK P    +    QEDA+EF   +L +L E+ I S+   ++ D
Sbjct: 424 PDDFYKTLSKLPKFRDLRWGHQEDAEEFLTHLLDQLHEEFITSIDALNESD 474

>YBR058C Chr2 complement(353672..356017) [2346 bp, 781 aa] {ON}
           UBP14Ubiquitin-specific protease that specifically
           disassembles unanchored ubiquitin chains; involved in
           fructose-1,6-bisphosphatase (Fbp1p) degradation; similar
           to human isopeptidase T
          Length = 781

 Score = 35.4 bits (80), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 15/23 (65%), Positives = 19/23 (82%)

Query: 96  YVGGLINDGNTCFMNSVIQSLAS 118
           Y  GLIN GN+C++NSVIQSL +
Sbjct: 321 YGCGLINLGNSCYLNSVIQSLVN 343

>NCAS0B04280 Chr2 (777104..779872) [2769 bp, 922 aa] {ON} Anc_8.188
          Length = 922

 Score = 35.4 bits (80), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 30/74 (40%), Gaps = 4/74 (5%)

Query: 666 PSSSTVPSGPLTYALRSVIVHYGSHNYGHYIAF--RKFRGLWWRISDETVYVVDEAEVLS 723
           P    +P  P  Y L  V  H+GS   GHY A+  +  +  W+   D     +       
Sbjct: 850 PKRGQIP--PFKYKLYGVASHFGSLYGGHYTAYVDKGPKHGWYYFDDTNYRSIKNKNEPI 907

Query: 724 TPGVFMLFYEHDYN 737
           T   ++LFY   Y+
Sbjct: 908 TSSAYLLFYHRIYD 921

 Score = 33.9 bits (76), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 60/304 (19%), Positives = 105/304 (34%), Gaps = 82/304 (26%)

Query: 96  YVGGLINDGNTCFMNSVIQSLASSKSLMQFLDEELMEASKELENPNETSSAVEEEGNLGS 155
           ++ GL N GN+C++N +IQ L  +  L +       E                       
Sbjct: 557 FIVGLQNIGNSCYLNCIIQCLLGTHELTKIFLNNFYE----------------------- 593

Query: 156 NSELRNRSSSKKTYGKRKKRLTRNAEKDAALEDEGVNMEFSAALKELLE-----KLNDKY 210
                                 R+   ++ L  +GV  ++ A L  L+      KL + Y
Sbjct: 594 ----------------------RHINLNSKLGSKGVLAKYFARLIHLMHNHANPKLKNNY 631

Query: 211 HRDKPYFKTNKLLKTMSKAPNKNIILGYDQEDAQEFFQTILSELEKNIKSLRGKSDKDNE 270
            R   +         M+      +     Q+D QEF Q +L  L +++          N 
Sbjct: 632 VRPAQF--------KMAVGSVNTLFKNCSQQDCQEFCQFLLDGLHEDLNQCGS-----NP 678

Query: 271 PTELADIPKNAMIGQERLGEMGTVYLPAEQIDPNCVLGHEAKQLFFPFDLVTPL-DGITA 329
           P  L ++   A   +E+L       +  E+             L   F ++  L  G  A
Sbjct: 679 P--LKELSSAAEKNREKLSLRIASSIEWERF------------LTTDFSVIVDLFQGQYA 724

Query: 330 ERIGCLQCGENGGIRYSVFSGLSLNLPSDTVGSALKLSQLLREWVKPEIIEGVE---CNR 386
            R+ C  C ++    Y  FS LS+ +P    G  + +    +++ K E+++  E   C  
Sbjct: 725 SRLQCEVC-KHTSTTYQPFSVLSVPIPRVPKGVKVNILDCFKDFTKLELLDTDEQWLCPT 783

Query: 387 CALK 390
           C  K
Sbjct: 784 CKKK 787

>TPHA0L02290 Chr12 (479360..482941) [3582 bp, 1193 aa] {ON} Anc_5.18
           YMR304W
          Length = 1193

 Score = 35.4 bits (80), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 23/47 (48%), Gaps = 2/47 (4%)

Query: 678 YALRSVIVHYGSHNYGHYIAFRK--FRGLWWRISDETVYVVDEAEVL 722
           Y L  V+VH G  + GHY    K      W+R  DE V+ VD  +V 
Sbjct: 448 YKLHGVLVHTGDISTGHYYTMIKPDLGDQWYRFDDERVWKVDRKQVF 494

>Suva_4.295 Chr4 complement(520439..522787) [2349 bp, 782 aa] {ON}
           YBR058C (REAL)
          Length = 782

 Score = 35.4 bits (80), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 44/155 (28%), Positives = 69/155 (44%), Gaps = 32/155 (20%)

Query: 96  YVGGLINDGNTCFMNSVIQSLASSKSLMQFLDEELMEASKELENPN--------ETSSAV 147
           Y  GLIN GN+C++NSV+QSL +       LD    E   ++  P         +  +A+
Sbjct: 321 YGCGLINLGNSCYLNSVMQSLLNGGVPSWSLDFLGSEFPLDVVYPANNLKCQWIKLLNAM 380

Query: 148 EEEGNLGSNSELRNRSSSKKTYGKRKKRLTRNAEKDAALEDEGVNMEFSAALKELLEKLN 207
           + E  L +N      ++ KK  GK  +  + N ++DA        MEF   L  LL+ L 
Sbjct: 381 KHEPKLYANG--IKPTTFKKCIGKNHEEFSSNRQQDA--------MEF---LTFLLDSL- 426

Query: 208 DKYHRDKPYFKTNKLLKTMSKAPNKNIILGYDQED 242
                D+ +F  N      + A N N ++ +  ED
Sbjct: 427 -----DRNFFSDNS-----AGASNPNDLMRFMMED 451

>Ecym_5671 Chr5 complement(1362706..1366236) [3531 bp, 1176 aa] {ON}
           similar to Ashbya gossypii AGL357W
          Length = 1176

 Score = 35.4 bits (80), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 30/62 (48%), Gaps = 4/62 (6%)

Query: 664 LAPSSSTVPSGPLTYALRSVIVHYGSHNYGHYIAFRKFRGL---WWRISDETVYVVDEAE 720
           L P    +    + Y L  V+VH G  + GHY A  K  GL   W+R  D+ V+ V + +
Sbjct: 422 LDPEVRKIRPESMMYNLHGVLVHTGDISTGHYYAMIK-PGLDDKWYRFDDDKVWQVTKKQ 480

Query: 721 VL 722
           V 
Sbjct: 481 VF 482

>CAGL0I06765g Chr9 (655806..658469) [2664 bp, 887 aa] {ON} similar
           to uniprot|P32571 Saccharomyces cerevisiae YDR069c DOA4
           ubiquitin-specific protease
          Length = 887

 Score = 35.0 bits (79), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 34/71 (47%), Gaps = 6/71 (8%)

Query: 666 PSSSTVPSGPLTYALRSVIVHYGSHNYGHYIAF-RKFRGLWWRISDETVY--VVDEAEVL 722
           P+   VP  P  Y L     H+G+   GHY ++  K     W   D+TVY  V  + E +
Sbjct: 816 PARGQVP--PFNYRLYGAACHFGTLYGGHYTSYVDKGPEKGWIYFDDTVYRPVRFQNEFI 873

Query: 723 STPGVFMLFYE 733
           S P  ++LFY 
Sbjct: 874 S-PSAYVLFYH 883

>Ecym_5544 Chr5 (1102256..1104760) [2505 bp, 834 aa] {ON} similar to
           Ashbya gossypii AGR139C
          Length = 834

 Score = 35.0 bits (79), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 41/95 (43%), Gaps = 7/95 (7%)

Query: 34  IVASTGLLIYKNRRYIRNIMDALGTVGGDLTR-GFRNSYKGSVFNKWGSRNPAQEATMLK 92
           I  +T  L  + ++Y+ + +     VG    R  F   YK  V       + A E T   
Sbjct: 330 ISITTSTLSKREKKYVPSNIKGSEPVGAVALRMSFDRDYKKYV------NDTAPETTKAI 383

Query: 93  RGGYVGGLINDGNTCFMNSVIQSLASSKSLMQFLD 127
                 G++N GN CFM+SV+Q L   K  +  L+
Sbjct: 384 NTIVPRGILNKGNICFMSSVLQVLLFCKPFISMLN 418

>Kpol_1024.44 s1024 (118060..119550) [1491 bp, 496 aa] {ON}
           (118060..119550) [1491 nt, 497 aa]
          Length = 496

 Score = 34.7 bits (78), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 91/449 (20%), Positives = 169/449 (37%), Gaps = 109/449 (24%)

Query: 74  SVFNKWGSRNPAQEATMLKRGGYVGGLINDGNTCFMNSVIQSLASSKSLMQFLDEELMEA 133
           S+FN    ++ + E +  ++  Y  GL+N    C+ NS +Q LAS  +   +L++ +   
Sbjct: 43  SIFNLVFRKSVSNERSE-RKDKYTTGLVNTSTECYANSSVQVLASLSNFTIYLNKVISIF 101

Query: 134 SKELENPNETSSAVEEEGNLGSNSELRNRSSSKKTYGKRKKRLTRNAEKDAALEDEGVNM 193
             EL+        VE++     ++ L                                 +
Sbjct: 102 ELELK-----IEKVEKDAKEAFDTYLYKV------------------------------I 126

Query: 194 EFSAALKELLEKLNDKYHRDKPYFKTNKLLKTMSKAPNKNIILGYDQEDAQEFFQTILSE 253
               AL +LL  L +   R +    +N  ++ +  + +K I  G  Q+DA E  Q +L  
Sbjct: 127 PVHYALCQLLADLQELIDRPRERSVSN-FIRILEASIHKRITGG--QQDANELTQIVLEV 183

Query: 254 LEKNIKSLRGKSDKDNEPTELA-DIPKNAMIGQERLGEMGTVYLPAEQIDPNCVLGHEAK 312
           L+  ++SL+   ++     EL+ ++P+                                 
Sbjct: 184 LQNELESLKKYVNR----MELSIEVPR--------------------------------- 206

Query: 313 QLFFPFDLVTPLDGITAERIGCLQCGENGGIRYSVFSGLSLNLPSDTVGSALKLSQLLRE 372
              FPF+      G  A  + CL CG+      S F+ L +  P +        S  L E
Sbjct: 207 ---FPFE------GKLASYLSCLNCGQTSIPNISTFNILPIQTPQE-------YSAELEE 250

Query: 373 WVKPEIIEGV---ECNRCALKAVLE------HLEKTLTQYEINDKVSEKLVSAVSSRVEE 423
            +    I+ +    C  C   A+L+      H   T  ++EI   + + L   V    EE
Sbjct: 251 IIYGNQIDQITDYSCLVCQTNAILKNEKTNGHKGNTTDEHEIVKYLEDVL--PVLRINEE 308

Query: 424 LKAILAKPVVDDDDYKKLHTENMVRKCSKSKQILISRPPPLLSIHINRSVFDPRTYTIRK 483
           L    +K +     Y K   ++   K +  K+  I   P +L IH++RS+++       +
Sbjct: 309 LD---SKTLNYIKYYNKYGMKSGNIKSTIIKKNSIIETPKILMIHLSRSIYNGMVAV--R 363

Query: 484 NNSKVLFKSRLNLAPWSCGPDEINLDARL 512
           N+ +V F+ ++++   +      NL   L
Sbjct: 364 NSCRVRFEEKMSIERQTTDEKNENLKIEL 392

 Score = 34.3 bits (77), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 12/23 (52%), Positives = 17/23 (73%)

Query: 678 YALRSVIVHYGSHNYGHYIAFRK 700
           Y L+S+I H G+HN GHY  +R+
Sbjct: 395 YQLQSIIKHTGTHNSGHYQCYRR 417

>AFR627C Chr6 complement(1572814..1576677) [3864 bp, 1287 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL197W
           (UBP12)
          Length = 1287

 Score = 34.7 bits (78), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 40/148 (27%), Positives = 55/148 (37%), Gaps = 24/148 (16%)

Query: 99  GLINDGNTCFMNSVIQSLASSKSLMQFLDEELMEASKELENPNETSSAVEEEGNLGSNSE 158
           GL N GNTC+MNS +Q L        +      E    +ENP            LG    
Sbjct: 347 GLSNLGNTCYMNSALQCLLHIPEFKDYFLYNGYEKEVNIENP------------LGHKGH 394

Query: 159 LRNRSSS--KKTYGKRKKRLTRNAEKDAALEDEGVNMEFSAAL----KELLEKLNDKYHR 212
           +    +S  +  +GKR    T  + ++       +N  FS       +E L  L D  H 
Sbjct: 395 IAWAFASMVQALFGKRHSAATSYSPRNFKNTIGHLNSMFSGYQQQDSQEFLAFLLDGLHE 454

Query: 213 D------KPYFKTNKLLKTMSKAPNKNI 234
           D      KPY +  +L  T   A  K I
Sbjct: 455 DLNRIIEKPYVEKPELTSTDDTAEFKVI 482

>SAKL0H18986g Chr8 (1683752..1686433) [2682 bp, 893 aa] {ON} similar
           to uniprot|P32571 Saccharomyces cerevisiae YDR069C DOA4
           Ubiquitin hydrolase required for recycling ubiquitin
           from proteasome-bound ubiquitinated intermediates acts
           at the late endosome/prevacuolar compartment to recover
           ubiquitin from ubiquitinated membrane proteins en route
           to the vacuole
          Length = 893

 Score = 34.7 bits (78), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 22/31 (70%), Gaps = 1/31 (3%)

Query: 99  GLINDGNTCFMNSVIQSLASSKSLMQ-FLDE 128
           GL+N GN+C+MN +IQ L  +  L Q FL++
Sbjct: 524 GLVNLGNSCYMNCIIQCLLGTHELSQMFLND 554

>TBLA0F03610 Chr6 (890140..893574) [3435 bp, 1144 aa] {ON} Anc_8.188
            YDR069C
          Length = 1144

 Score = 34.7 bits (78), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 34/69 (49%), Gaps = 6/69 (8%)

Query: 666  PSSSTVPSGPLTYALRSVIVHYGSHNYGHYIAFRKFRGL--WWRISDETVY-VVDEAEVL 722
            P+   +P  P  Y L  V +H GS   GHY A+   +GL   W   D+TVY  +  +  +
Sbjct: 1029 PARGQIP--PFKYELSGVALHMGSLYGGHYTAYVN-KGLKNGWYYFDDTVYRSIKYSSEM 1085

Query: 723  STPGVFMLF 731
             T   ++LF
Sbjct: 1086 ITQNAYVLF 1094

>Smik_11.362 Chr11 complement(623098..625263) [2166 bp, 721 aa] {ON}
           YKR098C (REAL)
          Length = 721

 Score = 34.7 bits (78), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 66/277 (23%), Positives = 106/277 (38%), Gaps = 57/277 (20%)

Query: 239 DQEDAQEFFQTILSELEKNIKSLRGKSDKDNEPTELADIPKNAMIGQERLGEMGTVYLPA 298
           DQ+D QEF   IL+ L +    L   +  +  P +L     NA                 
Sbjct: 391 DQQDTQEFLLIILARLHE---ELSNGTVTEYYP-DLVSYDANAF---------------- 430

Query: 299 EQIDPNCVLG-HEAKQLFFPFDLVTPLD----GITAERIGCLQCGENGGIRYSVFSGLSL 353
            Q++P+     +E   L    D ++P+D    G     + C +CG N    YS F  LSL
Sbjct: 431 -QVNPSKYQKWYEGSVLT---DGLSPIDYIFRGQMENILKCQRCG-NSSHSYSTFYVLSL 485

Query: 354 NLPSDTVGS------ALKLSQLLREWVKPEIIEG---VECNRCALKAVLEHLEKTLTQYE 404
            +P  ++ S       +KL   +  +   E + G    +C  C           T  + +
Sbjct: 486 AIPKISLYSFTSKSKKIKLEDCINLFTSDEELSGDNSWDCPNCG---------TTDLKTK 536

Query: 405 INDKVSEKLVSAV-----SSRVEELKAILAKPVVDDDDYKKLHTENMVRKCSKSKQILIS 459
           IN+  S+K  S        SR +             D+ +K   +   RK +  K     
Sbjct: 537 INESTSQKKKSTFFSFHSRSRSKSPHHHHHHHHHSHDNTEKHSKKWNSRKLTTVKSSDFI 596

Query: 460 RPPPLLSIHINRSVFDPRTYTIRKNNSKVLFKSRLNL 496
             PP+L IH++R  +D      RKNN+ + +   LN+
Sbjct: 597 VLPPILVIHLSRFYYD----LTRKNNTVITYPLILNV 629

>Smik_10.37 Chr10 (61787..65530) [3744 bp, 1247 aa] {ON} YJL197W
           (REAL)
          Length = 1247

 Score = 34.7 bits (78), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 22/42 (52%)

Query: 99  GLINDGNTCFMNSVIQSLASSKSLMQFLDEELMEASKELENP 140
           GL+N GNTC+MNS +Q L     L  +   +  E     ENP
Sbjct: 365 GLVNLGNTCYMNSALQCLVHIPQLRDYFLYDGYENEINEENP 406

>YER151C Chr5 complement(469686..472424) [2739 bp, 912 aa] {ON}
           UBP3Ubiquitin-specific protease involved in transport
           and osmotic response; interacts with Bre5p to
           co-regulate anterograde and retrograde transport between
           the ER and Golgi; involved in transcription elongation
           in response to osmostress through phosphorylation at
           Ser695 by Hog1p; inhibitor of gene silencing; cleaves
           ubiquitin fusions but not polyubiquitin; also has mRNA
           binding activity
          Length = 912

 Score = 34.3 bits (77), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 45/176 (25%), Positives = 73/176 (41%), Gaps = 30/176 (17%)

Query: 99  GLINDGNTCFMNSVIQSLASSKSLMQFLDEELMEASKELENPNETSSAVEEEGNLGSNSE 158
           G+IN  N CFM+SV+Q L   K  +  ++         L   N  S        L     
Sbjct: 461 GIINRANICFMSSVLQVLLYCKPFIDVIN--------VLSTRNTNSRVGTSSCKLLDACL 512

Query: 159 LRNRSSSKKTYGKRKKRLTRNAEK----DAALEDEGVNMEFSAALKELLEKLNDKYHRDK 214
              +   K+TY K+      +AEK    DA    +  + +  A    +            
Sbjct: 513 TMYKQFDKETYEKKFLENADDAEKTTESDAKKSSKSKSFQHCATADAV------------ 560

Query: 215 PYFKTNKLLKTMSKAPN-KNIILGYDQEDAQEFFQTILSEL-EKNIKSLRGKSDKD 268
              K ++  KT+S  P  K++  G+ QEDA+EF   +L +L E+ I ++ G +D +
Sbjct: 561 ---KPDEFYKTLSTIPKFKDLQWGH-QEDAEEFLTHLLDQLHEELISAIDGLTDNE 612

>TBLA0B01930 Chr2 (439859..442918) [3060 bp, 1019 aa] {ON} Anc_8.202
           YER151C
          Length = 1019

 Score = 34.3 bits (77), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 43/88 (48%), Gaps = 11/88 (12%)

Query: 44  KNRRYI----RNIMDALGTVGGDLTRGFRNSYKGSVFNKWGSRNPAQEATMLKRGGYVGG 99
           K+++YI    +N  + LGT+   L   F ++Y         + +     +++ RG     
Sbjct: 518 KDKKYIPSTTKNGTEPLGTIA--LRMSFDSNYIPYTLKTLPASSSIPIKSIVPRG----- 570

Query: 100 LINDGNTCFMNSVIQSLASSKSLMQFLD 127
           +IN+ N CFM+SV+Q L   K  +  L+
Sbjct: 571 IINNANICFMSSVLQVLLYCKPFIDILN 598

>TPHA0J02620 Chr10 complement(580898..584575) [3678 bp, 1225 aa] {ON}
            Anc_5.443 YOR124C
          Length = 1225

 Score = 34.3 bits (77), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 27/51 (52%), Gaps = 2/51 (3%)

Query: 674  GPLTYALRSVIVHYGSHNYGHY-IAFRKFR-GLWWRISDETVYVVDEAEVL 722
              + Y+L +V +H G  ++GHY +  R F  G+W + +D  V    E E+ 
Sbjct: 1140 AKIRYSLFAVFIHRGQASFGHYWVYIRDFENGIWRKYNDHQVTGAHEDEIF 1190

 Score = 33.9 bits (76), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 27/88 (30%), Positives = 41/88 (46%), Gaps = 6/88 (6%)

Query: 76  FNKWGSRNPAQEATMLKRGGYVGGLINDGNTCFMNSVIQSLASSKSLMQFLDEELMEASK 135
           F ++G  NP     M+    +  G+ N GNTC++NS++Q   S     +F+ E       
Sbjct: 740 FYEFGKVNPK----MIDSELWPTGINNIGNTCYLNSLLQYYFSITLFREFI-ENYQSIES 794

Query: 136 ELENPNETSSAVEEEGNLGSNSELRNRS 163
           +L N N   S     G    N+E+ NRS
Sbjct: 795 DLLNSNAEMSKRRVGGREIQNNEI-NRS 821

>SAKL0H00418g Chr8 (50575..54147) [3573 bp, 1190 aa] {ON} similar to
           uniprot|P50101 Saccharomyces cerevisiae YMR304W UBP15
           Ubiquitin-specific protease that may play a role in
           ubiquitin precursor processing
          Length = 1190

 Score = 34.3 bits (77), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 28/61 (45%), Gaps = 2/61 (3%)

Query: 664 LAPSSSTVPSGPLTYALRSVIVHYGSHNYGHYIAFRK--FRGLWWRISDETVYVVDEAEV 721
           L P  S+  +    Y L  V+VH G  + GHY    K      W+R  D+ V+ V + +V
Sbjct: 429 LDPEISSSNADSYIYDLHGVLVHTGDISTGHYYTMIKPSIEDQWYRFDDDKVWRVTKNQV 488

Query: 722 L 722
            
Sbjct: 489 F 489

>Skud_5.289 Chr5 complement(460660..463392) [2733 bp, 910 aa] {ON}
           YER151C (REAL)
          Length = 910

 Score = 34.3 bits (77), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 45/173 (26%), Positives = 70/173 (40%), Gaps = 29/173 (16%)

Query: 99  GLINDGNTCFMNSVIQSLASSKSLMQFLDEELMEASKELENPNETSSAVEEEGNLGSNSE 158
           G+IN  N CFM+SV+Q L   +  +  L+         L   N  S        L     
Sbjct: 460 GIINRANICFMSSVLQVLLYCEPFIDVLN--------VLSTRNTNSRIGTSSCKLLDACL 511

Query: 159 LRNRSSSKKTYGKRKKRLT---RNAEKDAALEDEGVNMEFSAALKELLEKLNDKYHRDKP 215
              +   K+TY    +      R+ E DA       N + S   + +             
Sbjct: 512 TMYKQFDKETYETSLESADDNERSTETDAKKPSRSKNFQHSVNAEAV------------- 558

Query: 216 YFKTNKLLKTMSKAPN-KNIILGYDQEDAQEFFQTILSEL-EKNIKSLRGKSD 266
             K ++  KT+S  P  K++  G+ QEDA+EF   +L +L E+ I ++ G SD
Sbjct: 559 --KPDEFYKTLSTIPKFKDLQWGH-QEDAEEFLTHLLDQLHEELISAIDGLSD 608

>TDEL0G00410 Chr7 complement(82945..86505) [3561 bp, 1186 aa] {ON}
           Anc_5.18 YMR304W
          Length = 1186

 Score = 34.3 bits (77), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 30/54 (55%), Gaps = 5/54 (9%)

Query: 92  KRGGYVGGLINDGNTCFMNSVIQSLASSKSLMQFLDEELMEASKELENPNETSS 145
           K  GYVG   N G TC++NS++QS   +K   +     + +   E ENPN++ +
Sbjct: 198 KVTGYVG-FRNQGATCYLNSLLQSYYFTKYFRRL----VYQIPTEGENPNDSVT 246

 Score = 33.9 bits (76), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 25/51 (49%), Gaps = 2/51 (3%)

Query: 674 GPLTYALRSVIVHYGSHNYGHYIAFRK--FRGLWWRISDETVYVVDEAEVL 722
           GP  Y L  V+VH G  + GHY    K   +  W+R  D+ V+   + ++ 
Sbjct: 436 GPKIYKLHGVLVHTGDISTGHYYTLIKPSTKDEWYRFDDDRVWRATKKQIF 486

>Smik_2.189 Chr2 complement(335612..337960) [2349 bp, 782 aa] {ON}
           YBR058C (REAL)
          Length = 782

 Score = 33.9 bits (76), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 14/21 (66%), Positives = 18/21 (85%)

Query: 96  YVGGLINDGNTCFMNSVIQSL 116
           Y  GLIN GN+C++NSV+QSL
Sbjct: 321 YGCGLINLGNSCYLNSVMQSL 341

>Skud_11.338 Chr11 complement(614651..616789) [2139 bp, 712 aa] {ON}
           YKR098C (REAL)
          Length = 712

 Score = 33.9 bits (76), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 86/415 (20%), Positives = 146/415 (35%), Gaps = 102/415 (24%)

Query: 97  VGGLINDGNTCFMNSVIQSLASSKSLMQ-FLDEELMEASKELENPNETSSAVEEEGNLGS 155
           + GL N  NTC++NS+IQ L  S      FL ++     K  E P E             
Sbjct: 291 ITGLQNPCNTCYINSIIQCLFGSTPFRDLFLTKKYRLFLKTEEYPKE------------- 337

Query: 156 NSELRNRSSSKKTYGKRKKRLTRNAEKDAALEDEGVNMEFSAALKELLEKLNDKYHRDKP 215
                                                ++ S ++  L +K+   Y     
Sbjct: 338 -------------------------------------VQLSRSIYSLFKKM---YANGGS 357

Query: 216 YFKTNKLLKTMSKAPNKNIILGYDQEDAQEFFQTILSELEKNIKSLRGKSDKDNEPTELA 275
               N  LK M K    ++ +  DQ+D QEF   IL+ + + +       +      +L 
Sbjct: 358 AIVPNGFLK-MCKKLRPDLNIPDDQQDTQEFLLIILARIHEEL----SNENVTKYYCDLV 412

Query: 276 DIPKNAMIGQERLGEMGTVYLPAEQIDPNCVLGHEAKQLFFPFDLVTPLDGITAER---- 331
               NA+                 Q++P  +   +  +     D ++P+D I   +    
Sbjct: 413 SYDTNAL-----------------QVNP--IKYQKWYEETILADGLSPIDHIFRGQMENI 453

Query: 332 IGCLQCGENGGIRYSVFSGLSLNLPSDTVGS------ALKLSQLLREWVKPEIIEG---V 382
           + C +CG N    YS F  LSL +P ++V S       +KL   +  +   E + G    
Sbjct: 454 LKCQRCG-NSSFSYSTFYVLSLAIPKNSVHSFTSKSKKIKLEDCINLFTSDEELTGDNAW 512

Query: 383 ECNRCALKAVLEHLEKTLTQYEINDKVSEKLVSAVS-SRVEELKAILAKPVVDDDDYKKL 441
           +C  C +        K  T    + K    L S  S SR +             D+  K 
Sbjct: 513 DCPECRIDD-----SKLKTGENSSQKKRSPLFSFHSRSRSKSPHHHHHYHHHGSDNTTKN 567

Query: 442 HTENMVRKCSKSKQILISRPPPLLSIHINRSVFDPRTYTIRKNNSKVLFKSRLNL 496
             +   ++ +  K +     PP+L IH++R  +D      +KNN+ + +   LN+
Sbjct: 568 SNKWKSKRLTTIKSLDFIFLPPILVIHLSRFYYD----LTKKNNAVITYPLILNI 618

>ZYRO0C17908g Chr3 complement(1393864..1397478) [3615 bp, 1204 aa]
           {ON} similar to uniprot|P39538 Saccharomyces cerevisiae
           YJL197W UBP12 Ubiquitin-specific protease present in the
           nucleus and cytoplasm that cleaves ubiquitin from
           ubiquitinated proteins
          Length = 1204

 Score = 33.9 bits (76), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 20/44 (45%)

Query: 97  VGGLINDGNTCFMNSVIQSLASSKSLMQFLDEELMEASKELENP 140
           + GL N GNTC+MNS +Q L     L  +      E      NP
Sbjct: 292 ITGLYNLGNTCYMNSALQCLVHIPELRDYFLYNCFEDEINCNNP 335

>Suva_6.276 Chr6 complement(481843..485613) [3771 bp, 1256 aa] {ON}
           YJL197W (REAL)
          Length = 1256

 Score = 33.9 bits (76), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 21/42 (50%)

Query: 99  GLINDGNTCFMNSVIQSLASSKSLMQFLDEELMEASKELENP 140
           GL+N GNTC+MNS +Q L     L  +      E     ENP
Sbjct: 362 GLVNLGNTCYMNSALQCLVHLPQLRDYFLYNGYEKEINEENP 403

>KLLA0E10275g Chr5 (906675..909065) [2391 bp, 796 aa] {ON} similar
           to uniprot|P39944 Saccharomyces cerevisiae YER144C UBP5
           Putative ubiquitin-specific protease that does not
           associate with the proteasome
          Length = 796

 Score = 33.9 bits (76), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 27/59 (45%), Gaps = 1/59 (1%)

Query: 675 PLTYALRSVIVHYGSHNYGHYIAF-RKFRGLWWRISDETVYVVDEAEVLSTPGVFMLFY 732
           P  Y L +V  H G+   GHY +F  K R  W    D +   +   +   TP  ++LFY
Sbjct: 733 PFNYRLFAVASHSGTLYGGHYTSFVDKGRVGWCSFDDVSWRKIRRKDEYITPNAYVLFY 791

>TDEL0C05640 Chr3 complement(1005536..1009072) [3537 bp, 1178 aa]
           {ON} Anc_1.137 YJL197W
          Length = 1178

 Score = 33.9 bits (76), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 35/148 (23%), Positives = 62/148 (41%), Gaps = 24/148 (16%)

Query: 97  VGGLINDGNTCFMNSVIQSLASSKSLMQFLDEELMEASKELENPNETSSAVEEEGNLGSN 156
           + GL N GNTC+MNS +Q L     L  +   +   +    +NP      +  +GN+   
Sbjct: 301 ITGLTNLGNTCYMNSALQCLVHIPELRDYFLYDGFTSEINSDNP------LGYQGNIAKA 354

Query: 157 SELRNRSSSKKTYGKRKKRLTRNAEKDAALEDEGVNMEFSAALKE--------LLEKLND 208
             L  +S    +YG    +    +  +  +     N  FS  +++        LL+ L++
Sbjct: 355 FSLLVKSLFGASYGSASSQAF--SPNNFKMIMGHCNTMFSGYMQQDSQEFLAFLLDGLHE 412

Query: 209 KYHR--DKPYFKTNKLLKTMSKAPNKNI 234
             +R  DKPY +   L      +PN ++
Sbjct: 413 DLNRVHDKPYIEKPSL------SPNSDV 434

>KAFR0C00410 Chr3 complement(85302..87611) [2310 bp, 769 aa] {ON}
           Anc_3.270 YBR058C
          Length = 769

 Score = 33.9 bits (76), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 12/23 (52%), Positives = 19/23 (82%)

Query: 94  GGYVGGLINDGNTCFMNSVIQSL 116
           G +  GLIN GN+C++NS++Q+L
Sbjct: 315 GNFGCGLINLGNSCYLNSILQAL 337

>CAGL0M13783g Chr13 (1354198..1357788) [3591 bp, 1196 aa] {ON}
           similar to uniprot|P50101 Saccharomyces cerevisiae
           YMR304w UBP15
          Length = 1196

 Score = 33.9 bits (76), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 23/48 (47%), Gaps = 2/48 (4%)

Query: 677 TYALRSVIVHYGSHNYGHYIAFRK--FRGLWWRISDETVYVVDEAEVL 722
            Y L  V+VH G  + GHY    K      W+R  DE V+ V + +V 
Sbjct: 438 VYNLHGVLVHAGDISTGHYYTLIKPGLEDQWYRFDDERVWKVTKNQVF 485

>AGL357W Chr7 (33383..36883) [3501 bp, 1166 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR304W (UBP15)
          Length = 1166

 Score = 33.5 bits (75), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 24/47 (51%), Gaps = 2/47 (4%)

Query: 678 YALRSVIVHYGSHNYGHYIAFRK--FRGLWWRISDETVYVVDEAEVL 722
           Y L  V+VH G  + GHY A  K      W+R  D+ V+ V + +V 
Sbjct: 427 YNLHGVLVHTGDISTGHYYAMIKPGLEDAWYRFDDDKVWRVTKKQVF 473

 Score = 31.6 bits (70), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 15/35 (42%), Positives = 22/35 (62%), Gaps = 1/35 (2%)

Query: 92  KRGGYVGGLINDGNTCFMNSVIQSLASSKSLMQFL 126
           K  GYVG L N G TC++NS++QS   +K   + +
Sbjct: 185 KVTGYVG-LKNQGATCYLNSLLQSYYFTKYFRKLV 218

>YJL025W Chr10 (393967..395511) [1545 bp, 514 aa] {ON}
           RRN7Component of the core factor (CF) rDNA transcription
           factor complex; CF is required for transcription of 35S
           rRNA genes by RNA polymerase I and is composed of Rrn6p,
           Rrn7p, and Rrn11p
          Length = 514

 Score = 33.5 bits (75), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 27/108 (25%), Positives = 49/108 (45%), Gaps = 14/108 (12%)

Query: 118 SSKSLMQFLDEELMEASKELEN---PNETSSAVEEEGNLGSNSELRNRSSSKKTYGKRKK 174
           +S    Q+ +EE +E  K +E    P +T S   E G++     +  + + +K Y  +  
Sbjct: 362 TSSDYFQWSEEETLEFLKWMEKQFLPTQTKSLHNENGSM--EMTIDQKIARRKLY--KIF 417

Query: 175 RLTRNAEKDAALEDEGVNMEFSAALKELLEKLNDKYHRDKPYFKTNKL 222
            L R A  D    D    + F       +E L ++Y +  P+F++NK+
Sbjct: 418 PLDREANHDGEFNDSTHQLTF-------IEDLQERYAKQTPFFESNKI 458

>TBLA0J00600 Chr10 (129182..133570) [4389 bp, 1462 aa] {ON}
           Anc_1.137 YJL197W
          Length = 1462

 Score = 33.5 bits (75), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 67/323 (20%), Positives = 116/323 (35%), Gaps = 80/323 (24%)

Query: 99  GLINDGNTCFMNSVIQSLASSKSLMQFLDEELMEASKELENPNETSSAVEEEGNLGSNSE 158
           GL+N GNTC+MNS +Q L       ++      +    L+NP      +  +GN+ +   
Sbjct: 415 GLVNLGNTCYMNSALQCLIHLPKFNEYFLLNGYQKEINLDNP------IGYQGNVAN--- 465

Query: 159 LRNRSSSKKTYGKRKKRLTRNAEKDAALEDEGVNMEFSAALKELLEKLNDKYHRDKPYFK 218
                     +GK   +L          E+  ++ E                  +K  F 
Sbjct: 466 ---------AFGKLIHKL---------FEERIIDNE-----------------SEKSSFS 490

Query: 219 TNKLLKTMSKAP---NKNIILGYDQEDAQEFFQTILSELEKNIKSLRGKSDKDNEPTELA 275
            N    T  K+      ++  GY Q+D+QEF   IL  L +++  +  K        E  
Sbjct: 491 INSFSPTNFKSTVGYCNSMFSGYLQQDSQEFLAFILDGLHEDLNRILKKP-----FVEKP 545

Query: 276 DIPKNAMIGQERLGEMGTVYLPAEQIDPNCVLGHEAKQLFFPFDLVTPLDGITAERIGCL 335
            +P+N+             Y   +++  +    H  +      DL     G+    + C 
Sbjct: 546 SLPENSNYKD---------YKVIKKLADDTWEAHLKRNDSIVTDLFV---GMYKSTLQCP 593

Query: 336 QCGENGGIRYSVFSGLSLNLPSDTVGSALKLSQLLREWVKPEIIEGVECNRCALKAVLEH 395
            C  N  + +  ++ L+L LP +T+            W K   I       C+L+     
Sbjct: 594 DC-HNVSVTFDPYNDLTLPLPVETI------------WNKVIKIFPSNSPPCSLEV---E 637

Query: 396 LEKTLTQYEINDKVSEKLVSAVS 418
           LEKT T  ++ + +S     A S
Sbjct: 638 LEKTSTYNDLKEYISRNTGIAAS 660

>Kpol_534.23 s534 (53632..53653,53786..55254) [1491 bp, 496 aa] {ON}
           (53632..53653,53786..55254) [1491 nt, 497 aa]
          Length = 496

 Score = 33.1 bits (74), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 12/18 (66%), Positives = 16/18 (88%)

Query: 99  GLINDGNTCFMNSVIQSL 116
           GL+N GNTC+MNS +Q+L
Sbjct: 110 GLLNMGNTCYMNSTLQAL 127

>KAFR0B02370 Chr2 complement(460558..463047) [2490 bp, 829 aa] {ON}
           Anc_8.202 YER151C
          Length = 829

 Score = 33.5 bits (75), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 49/219 (22%), Positives = 87/219 (39%), Gaps = 38/219 (17%)

Query: 44  KNRRYI---RNIMDALGTVGGDLTRGFRNSYKGSVFNKWGSRNPAQEATMLKRGGYVGGL 100
           K+ RY+       + LG+V   L   F   Y G V  K    +     ++  RG     +
Sbjct: 342 KDTRYVPPSTKGAEPLGSVT--LRMCFDPDYIGYVLKKDSENDLLPLKSIFPRG-----I 394

Query: 101 INDGNTCFMNSVIQSLASSKSLMQFLDEELMEASKELENPNETSSAVEEEGNLGSNSELR 160
           IN  N CF++SV+Q L   +  +  L+         L   N  S     +  L       
Sbjct: 395 INTANVCFLSSVLQVLLYCQPFIDVLN--------VLSTRNVHSRIASSQSKLLDACITI 446

Query: 161 NRSSSKKTYGKRKKRLTRNAEKDAALEDEGVNMEFSAALKELLEKLN-DKYHRDKPYFKT 219
            +   ++ + + KKR         ++EDE  + E +     +++ +N D+++R       
Sbjct: 447 YKQFDRENFLESKKR-------QQSVEDEIEDNEKTPTYGSVIDAINPDEFYR------- 492

Query: 220 NKLLKTMSKAPNKNIILGYDQEDAQEFFQTILSELEKNI 258
                T+S  P    +    QEDA+EF   +L +L + +
Sbjct: 493 -----TISTIPKFKDLQWGQQEDAEEFLTHLLDQLHEEL 526

>ZYRO0G01188g Chr7 (95655..95676,95759..97239) [1503 bp, 500 aa]
           {ON} highly similar to uniprot|P43593 Saccharomyces
           cerevisiae YFR010W UBP6 Ubiquitin-specific protease
           situated in the base subcomplex of the 26S proteasome
           releases free ubiquitin from branched polyubiquitin
           chains deletion causes hypersensitivity to cycloheximide
           and other toxic compounds
          Length = 500

 Score = 33.1 bits (74), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 35/67 (52%), Gaps = 5/67 (7%)

Query: 665 APSSSTVPSGPLT-YALRSVIVHYGSHN-YGHYIAFRKF---RGLWWRISDETVYVVDEA 719
            PS  T    P + Y L  VI H G+++  GHY +F +       W++ +D+ V VVD+ 
Sbjct: 417 TPSEVTEGENPSSLYELVGVITHQGANSESGHYQSFIRDDYDEDKWYKFNDDKVSVVDKE 476

Query: 720 EVLSTPG 726
           ++ S  G
Sbjct: 477 KIESLSG 483

>Klac_YGOB_Anc_5.18b Chr3 (1201452..1202573,1202576..1204954) [3501
           bp, 1166 aa] {ON} ANNOTATED BY YGOB -
          Length = 1166

 Score = 33.1 bits (74), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 24/50 (48%), Gaps = 2/50 (4%)

Query: 675 PLTYALRSVIVHYGSHNYGHYIAFRK--FRGLWWRISDETVYVVDEAEVL 722
           P  Y L  V+VH G  + GHY A  +    G W+R  D+ V    + +V 
Sbjct: 428 PADYILHGVLVHSGDISTGHYYAMIQPDAHGSWYRFDDDRVIKATDKQVF 477

>Kwal_55.19645 s55 (62575..65487) [2913 bp, 970 aa] {ON} YIL156W
           (UBP7) - Ubiquitin-specific protease [contig 159] FULL
          Length = 970

 Score = 33.1 bits (74), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 30/50 (60%), Gaps = 2/50 (4%)

Query: 97  VGGLINDGNTCFMNSVIQSLASSKSLMQ-FLDEELMEA-SKELENPNETS 144
           + GL N GNTC++NS++Q L +++     FL  +  +  SK   NP++ S
Sbjct: 555 ITGLRNMGNTCYINSMLQCLFATRKFRDLFLSPKYEDYFSKRYSNPHQLS 604

>KAFR0F01560 Chr6 (310936..314451) [3516 bp, 1171 aa] {ON} Anc_1.137
           YJL197W
          Length = 1171

 Score = 33.1 bits (74), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 57/265 (21%), Positives = 93/265 (35%), Gaps = 65/265 (24%)

Query: 99  GLINDGNTCFMNSVIQSLASSKSLMQFLDEELMEASKELENPNETSSAVEEEGNLGSNSE 158
           GL N GNTC+MNS +Q L     L  +                   SA E E N      
Sbjct: 324 GLSNLGNTCYMNSALQCLVHIPQLRDYF----------------LYSAYEAELNTD---- 363

Query: 159 LRNRSSSKKTYGKRKKRLTRNAEKDAALEDEGVNMEFSAALKELLEKLNDKYHRDKPYFK 218
             N    K    K    L +N   D  +  +G N  F                    +FK
Sbjct: 364 --NLIGYKGYVAKAFSSLVQNLFGD-TITKQGTNSSFGPN-----------------HFK 403

Query: 219 TNKLLKTMSKAPNKNIILGYDQEDAQEFFQTILSELEKNIKSLRGKSDKDNEPTELADIP 278
           +       +     ++  GY Q+D+QEF   +L  L +++  +  K   +    +  D  
Sbjct: 404 S-------TVGHFNSMFSGYLQQDSQEFLAFLLDSLHEDLNRIINKPSTEKPSLKEGDDY 456

Query: 279 KNAMIGQERLGEMGTVYLPAEQIDPNCVLGHEAKQLFFPFDLVTPLDGITAERIGCLQCG 338
            +  + +    E   ++L    +  + V+           DL     G+    + C +C 
Sbjct: 457 NDPAVIKSLADETWKMHL----LRNDSVIT----------DLFV---GMYKSTLECPECT 499

Query: 339 ENGGIRYSVFSGLSLNLPSDTVGSA 363
            N  I +  +S L+L LP D+  S+
Sbjct: 500 -NVSITFDPYSDLTLPLPVDSTWSS 523

>KAFR0H00150 Chr8 (14149..16119) [1971 bp, 656 aa] {ON} Anc_5.712
           YIL156W possible pseudogene; NNN added to avoid internal
           stop codon
          Length = 656

 Score = 33.1 bits (74), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 62/275 (22%), Positives = 105/275 (38%), Gaps = 50/275 (18%)

Query: 239 DQEDAQEFFQTILSELEKNIKSLRGKSDKDNEPTELADIPKNAMIGQERLGEMGTVYLPA 298
           DQ+D QEF   +L  L              +E     D+  N  +  +    +G  Y+P 
Sbjct: 324 DQQDTQEFLVILLDILH-------------DELVYTDDLISNNYVSDD--INLGKEYMPW 368

Query: 299 EQIDPNCVLGHEAKQLFFPFDLVTPLDGITAERIGCLQCGENGGIRYSVFSGLSLNLPS- 357
            Q +    L    K    P DL+    G     + C +CG N    YS+F  LSL +P  
Sbjct: 369 LQNN----LKANGKS---PIDLI--FQGQIENCLQCQRCG-NTSYNYSMFYMLSLAIPKI 418

Query: 358 --DTVGSALKLSQLLREWVKPEIIEG---VECNRCALK-----------AVLEHLEKTLT 401
             +   + +KL   +  +   EI+ G     C +C              A +E+  K  +
Sbjct: 419 AKENSKNRVKLEDCINFFTSDEILTGENAWNCPKCCPTTIETYDEADSPATVENRVKNKS 478

Query: 402 QYEINDKVSEKLVSAVSSRVEELKAILAKPVVDDDDYKKLHTENMVRKCSKSKQILISRP 461
              +N     K++S  S               D  +  K   E ++      KQ+   + 
Sbjct: 479 INPLNFFKLHKVLSPSSGNHHRHHHHHHHHKSDGKNKNKYKNEKLI----TLKQLNFIKL 534

Query: 462 PPLLSIHINRSVFDPRTYTIRKNNSKVLFKSRLNL 496
           PP+L IH++R  ++    + +KNN+ + +   LN+
Sbjct: 535 PPILVIHLSRFYYN----STKKNNAVITYPLILNI 565

 Score = 32.7 bits (73), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 19/31 (61%)

Query: 99  GLINDGNTCFMNSVIQSLASSKSLMQFLDEE 129
           GL N GNTC++NS++Q L  +K L      E
Sbjct: 239 GLRNQGNTCYINSMVQCLFGTKVLRDLFISE 269

>NCAS0I03140 Chr9 complement(576993..580598) [3606 bp, 1201 aa] {ON}
           Anc_1.137 YJL197W
          Length = 1201

 Score = 33.1 bits (74), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 14/44 (31%), Positives = 22/44 (50%)

Query: 97  VGGLINDGNTCFMNSVIQSLASSKSLMQFLDEELMEASKELENP 140
           + GL+N GNTC+MNS +Q +       ++      E     +NP
Sbjct: 320 ITGLVNLGNTCYMNSALQCITHIPVFREYFLYSGYEKELNTDNP 363

>Kwal_34.16268 s34 (268814..270163) [1350 bp, 449 aa] {ON} YFR010W
           (UBP6) - (putative) ubiquitin-specific protease [contig
           710] FULL
          Length = 449

 Score = 32.7 bits (73), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 14/24 (58%), Positives = 17/24 (70%)

Query: 99  GLINDGNTCFMNSVIQSLASSKSL 122
           GL N GNTC+MNS +Q+L   K L
Sbjct: 61  GLKNLGNTCYMNSTLQALYQIKPL 84

>ZYRO0G06798g Chr7 (544095..546728) [2634 bp, 877 aa] {ON} some
           similarities with uniprot|P32571 Saccharomyces
           cerevisiae YDR069C DOA4 Ubiquitin hydrolase required for
           recycling ubiquitin from proteasome-bound ubiquitinated
           intermediates acts at the late endosome/prevacuolar
           compartment to recover ubiquitin from ubiquitinated
           membrane proteins en route to the vacuole
          Length = 877

 Score = 32.7 bits (73), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 69/292 (23%), Positives = 105/292 (35%), Gaps = 78/292 (26%)

Query: 96  YVGGLINDGNTCFMNSVIQSLASSKSLMQFLDEELMEASKELENPNETSSAVEEEGNLGS 155
           +  GL N GN+C++N +IQ L  +  L                     +++ E   NL  
Sbjct: 513 FTVGLENMGNSCYINCIIQCLLGTHELTNIF----------------LNNSYERHINL-- 554

Query: 156 NSELRNRSSSKKTYGKRKKRLTRNAEKDAALEDEGVNMEFSAALKELLEKLNDKYHRDKP 215
           NS+L     SK    K   RL     + AA                   K +DK    +P
Sbjct: 555 NSKL----GSKGVLAKHFARLIHQMHQSAAF------------------KKSDKNKAVRP 592

Query: 216 Y-FKTNKLLKTMSKAPNKNIILGYDQEDAQEFFQTILSELEKNIKSLRGKSDKDNEPTEL 274
           Y FK       M+     ++     Q+D+QEF Q +L  L +++    G     N P  L
Sbjct: 593 YEFK-------MACGSINSLFRESGQQDSQEFCQFLLDGLHEDLNQCGG-----NPP--L 638

Query: 275 ADIPKNAMIGQERLGEMGTVYLPAEQIDPNCVLGHEAKQLFFPFDLVTPL-DGITAERIG 333
            ++ + A   +ERL       +  E            + L   F ++  L  G  A ++ 
Sbjct: 639 KELSEEAEKMRERLSMRIASSIEWE------------RYLTRDFSVIVDLFQGQYASQLR 686

Query: 334 CLQCGENGGIRYSVFSGLSLNLPS-------DTVGSALKLSQLLR--EWVKP 376
           C  C       Y  FS L+  +P        D      KL QL +  EW+ P
Sbjct: 687 CKVCNHT-STTYQPFSILAAPVPHAKSCYLLDCFKEFTKLEQLEKDEEWLCP 737

>TPHA0D04350 Chr4 complement(934597..937161) [2565 bp, 854 aa] {ON}
           Anc_8.202 YER151C
          Length = 854

 Score = 32.7 bits (73), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 13/29 (44%), Positives = 18/29 (62%)

Query: 99  GLINDGNTCFMNSVIQSLASSKSLMQFLD 127
           G+IN  N CFM+SV+Q L S    +  L+
Sbjct: 420 GIINSANICFMSSVLQVLLSCAPFINILN 448

>TPHA0A02540 Chr1 (543606..547466) [3861 bp, 1286 aa] {ON} Anc_1.137
           YJL197W
          Length = 1286

 Score = 32.3 bits (72), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 37/133 (27%), Positives = 57/133 (42%), Gaps = 27/133 (20%)

Query: 99  GLINDGNTCFMNSVIQSLASSKSLMQFLDEELMEASKELENP--------NETSSAVEEE 150
           GL N GNTC+MNS +Q LA    +  +      +    L+NP        N  S+ V+  
Sbjct: 399 GLNNLGNTCYMNSALQCLAHIPPIRDYFKFGAYKNEINLDNPLGFQGNIANAFSALVQ-- 456

Query: 151 GNLGSNSELRNRSSS----KKTYGKRKKRLTRNAEKDAALEDEGVNMEFSA----ALKEL 202
            NL  N  + + S +    K T G   +  +   ++D+         EF A     L E 
Sbjct: 457 -NLYKNQFIPSASYAPSQFKLTIGHYNQMFSGYFQQDS--------QEFLAFLLDGLHED 507

Query: 203 LEKLNDKYHRDKP 215
           L ++ DK + +KP
Sbjct: 508 LNRIKDKPYVEKP 520

>TDEL0B02080 Chr2 (369534..372611) [3078 bp, 1025 aa] {ON} Anc_5.712
           YIL156W
          Length = 1025

 Score = 32.3 bits (72), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 36/162 (22%), Positives = 61/162 (37%), Gaps = 35/162 (21%)

Query: 239 DQEDAQEFFQTILSELEKNIKSLRGKSDKDNEPTELADIPKNAMIGQERLGEMGTVYLPA 298
           DQ+D QEF    L  L   +          N+     + P   +  + ++   G  Y   
Sbjct: 695 DQQDTQEFLMVTLDRLHDELS---------NQAAVANEYPDLLLYDEHQMDVNGKEY--- 742

Query: 299 EQIDPNCVLGHEAKQLFFPFDLVTPLDGITAERI----GCLQCGENGGIRYSVFSGLSLN 354
           ++     V+G+           + P+D I   +I     C +CG N    YS F  LSL 
Sbjct: 743 KKWFEESVIGNG----------LAPIDHIFQGQIENILECQRCG-NSSFSYSTFYVLSLA 791

Query: 355 LPSDTVGS-----ALKLSQLLREWVKPEIIEG---VECNRCA 388
           +P  +  +      +KL   +  +   EI+ G    +C +C 
Sbjct: 792 IPKPSTSTFSRAKRVKLEDCINMFTNDEILSGENAWDCPKCG 833

>SAKL0C04246g Chr3 (412865..416758) [3894 bp, 1297 aa] {ON} similar to
            uniprot|P39538 Saccharomyces cerevisiae YJL197W UBP12
            Ubiquitin-specific protease present in the nucleus and
            cytoplasm that cleaves ubiquitin from ubiquitinated
            proteins
          Length = 1297

 Score = 32.3 bits (72), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 28/57 (49%), Gaps = 3/57 (5%)

Query: 678  YALRSVIVHYGSHNYGHYIAFRK--FRGLWWRISDETVYVVDEAEVLSTPGVFMLFY 732
            Y L +V  H+G    GHY A+ K      W+   D  V  VD   V S+ G ++LFY
Sbjct: 1032 YDLIAVDNHFGGLGSGHYTAYVKNPVDDKWYLFDDSEVREVDAESVASSFG-YLLFY 1087

>KLLA0C03476g Chr3 (314815..318573) [3759 bp, 1252 aa] {ON} similar
           to uniprot|P39538 Saccharomyces cerevisiae YJL197W UBP12
           Ubiquitin-specific protease present in the nucleus and
           cytoplasm that cleaves ubiquitin from ubiquitinated
           proteins
          Length = 1252

 Score = 32.3 bits (72), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 23/44 (52%)

Query: 97  VGGLINDGNTCFMNSVIQSLASSKSLMQFLDEELMEASKELENP 140
           + GL N GNTC+MNS +Q L     L ++   +  E    + NP
Sbjct: 338 IMGLSNLGNTCYMNSALQCLLHIPELNEYFLYKGYEREININNP 381

>AFR007W Chr6 (448632..451178) [2547 bp, 848 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR069C (DOA4) and
           YER144C (UBP5)
          Length = 848

 Score = 32.0 bits (71), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 69/298 (23%), Positives = 109/298 (36%), Gaps = 80/298 (26%)

Query: 99  GLINDGNTCFMNSVIQSLASSKSLM-QFLDEELMEASKELENPNETSSAVEEEGNLGSNS 157
           GL+N GN+C+M+ +IQ L  ++ L   FL+             N   + +     LGS  
Sbjct: 489 GLVNCGNSCYMSCIIQCLLGTQELCTMFLN-------------NSYQNHINLNSRLGSKG 535

Query: 158 ELRNRSS----SKKTYGKRKKRLTRNAEKDAALEDEGVNMEFSAALKELLEKLNDKYHRD 213
            L    S        YGK  ++   N EK A +       +F  A   +     D     
Sbjct: 536 LLARYFSQLIHQMYQYGKDIRKKMGN-EKTAVIP-----TQFKIACGSINSSFKDN---- 585

Query: 214 KPYFKTNKLLKTMSKAPNKNIILGYDQEDAQEFFQTILSELEKNIKSLRGKSDKDNEPTE 273
                                     Q+D QEF Q +L  L +++         +N P  
Sbjct: 586 -------------------------TQQDCQEFCQFLLDGLHEDLNQC-----GNNPP-- 613

Query: 274 LADIPKNAMIGQERLGEMGTVYLPAEQIDPNCVLGHEAKQLFFPFDLVTPL-DGITAERI 332
           L ++ + A    E++ EM  + L A  I+         + L   F ++  L  G  A ++
Sbjct: 614 LKELSEEA----EKMREMMPMRL-ASAIE-------WERYLTTDFSVIVDLFQGQYASQL 661

Query: 333 GCLQCGENGGIRYSVFSGLSLNLPSDTVGSALKLSQLLREWVKPEIIEGVE---CNRC 387
            C  C +     Y  FS LS+ +PS    +   L+    E+ K E +E  E   C  C
Sbjct: 662 QCKVC-QRTSTTYQPFSVLSVPVPSTRTCT---LTDCFTEFTKIETLEQEEQWSCPSC 715

>Smik_5.318 Chr5 complement(474889..477618) [2730 bp, 909 aa] {ON}
           YER151C (REAL)
          Length = 909

 Score = 32.0 bits (71), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 40/172 (23%), Positives = 82/172 (47%), Gaps = 23/172 (13%)

Query: 99  GLINDGNTCFMNSVIQSLASSKSLMQFLDEELMEASKELENPNETSSAVEEEGNLGSNSE 158
           G++N  N CFM+SV+Q L   +  +  L+   + +++   +   TSS    +  L    +
Sbjct: 459 GIVNRANICFMSSVLQVLLYCQPFVDVLN---VLSTRNTNSRIGTSSCKLLDACLTMYKQ 515

Query: 159 LRNRSSSKKTYGKRKKRLTRNAEKDAALEDEGVNMEFSAALKELLEKLNDKYHRDKPYFK 218
             ++ + +KT  +  +   +++E DA    +  N   +  ++ +               K
Sbjct: 516 F-DKENYEKTM-ENAEDTEKSSENDAKKPSKSKNFHHNTTVEAV---------------K 558

Query: 219 TNKLLKTMSKAPN-KNIILGYDQEDAQEFFQTILSEL-EKNIKSLRGKSDKD 268
            ++  KT+S  P  K++  G+ QEDA+EF   +L +L E+ I ++ G +D +
Sbjct: 559 PDEFYKTLSTIPKFKDLQWGH-QEDAEEFLTHLLDQLHEELISAIDGLTDNE 609

>KLTH0E00814g Chr5 (80059..82983) [2925 bp, 974 aa] {ON} similar to
           uniprot|P40453 Saccharomyces cerevisiae YIL156W UBP7
           Ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 974

 Score = 32.0 bits (71), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 35/127 (27%), Positives = 50/127 (39%), Gaps = 25/127 (19%)

Query: 236 LGYDQEDAQEFFQTILSELEKNI-KSLRGKSDKDNEPTELADIPKNAMIGQERLGEMGTV 294
           + +DQ+D QEF   +LS+L   + +S R  +D    P  L    K   + Q+        
Sbjct: 640 IPHDQQDTQEFLLFLLSQLHDELSESNRVANDY---PGLLLHDDKKLDVDQKEYDTWFEK 696

Query: 295 YLPAEQIDP--NCVLGHEAKQLFFPFDLVTPLDGITAERIGCLQCGENGGIRYSVFSGLS 352
           ++    I P  N   G     LF                  C +CG +    YSVF  LS
Sbjct: 697 HISENGISPIDNIFQGQMENGLF------------------CQRCG-HSSFNYSVFYVLS 737

Query: 353 LNLPSDT 359
           L +PS T
Sbjct: 738 LAIPSST 744

>ZYRO0F01276g Chr6 (102883..105213) [2331 bp, 776 aa] {ON} similar
           to uniprot|P38237 YBR058C Saccharomyces cerevisiae UBP14
           Ubiquitin-specific protease that specifically
           disassembles unanchored ubiquitin chains
          Length = 776

 Score = 32.0 bits (71), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 12/18 (66%), Positives = 16/18 (88%)

Query: 99  GLINDGNTCFMNSVIQSL 116
           GLIN GN+C++NSV+Q L
Sbjct: 324 GLINLGNSCYLNSVLQCL 341

>Ecym_8140 Chr8 complement(295730..299524) [3795 bp, 1264 aa] {ON}
           similar to Ashbya gossypii AFR627C
          Length = 1264

 Score = 32.0 bits (71), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 23/51 (45%), Gaps = 1/51 (1%)

Query: 90  MLKRGGYVGGLINDGNTCFMNSVIQSLASSKSLMQFLDEELMEASKELENP 140
           M    G VG L N GNTC+MNS +Q L        +      E    ++NP
Sbjct: 342 MTPSNGTVG-LGNLGNTCYMNSALQCLVHIPEFKDYFLYNAYEKEINVDNP 391

>KAFR0D05070 Chr4 complement(996195..999878) [3684 bp, 1227 aa] {ON}
           Anc_5.443 YOR124C
          Length = 1227

 Score = 31.6 bits (70), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 25/40 (62%)

Query: 87  EATMLKRGGYVGGLINDGNTCFMNSVIQSLASSKSLMQFL 126
           +A +L+   +  GL N GNTC++NS++Q   S   L +++
Sbjct: 699 DANLLQPENWPIGLNNIGNTCYLNSLLQYYFSIAPLREYI 738

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.313    0.132    0.376 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 78,874,517
Number of extensions: 3501387
Number of successful extensions: 14409
Number of sequences better than 10.0: 423
Number of HSP's gapped: 14920
Number of HSP's successfully gapped: 550
Length of query: 757
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 640
Effective length of database: 40,065,477
Effective search space: 25641905280
Effective search space used: 25641905280
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 70 (31.6 bits)