Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_27.103328.829ON37837819410.0
KLTH0C04114g8.829ON37837817100.0
KLLA0D01639g8.829ON38137914630.0
SAKL0D01760g8.829ON38137914440.0
YMR272C (SCS7)8.829ON38437914380.0
Smik_13.4858.829ON38437914210.0
Skud_13.4448.829ON38437914150.0
TDEL0B006808.829ON38337914100.0
ZYRO0G13948g8.829ON38438413900.0
Suva_13.4608.829ON38437913350.0
NCAS0C004708.829ON42637813170.0
AAL183W8.829ON37737813120.0
NDAI0K004708.829ON38638212551e-172
CAGL0F03399g8.829ON38038312471e-171
Ecym_27128.829ON38137912421e-170
Kpol_541.98.829ON37437712201e-167
KAFR0B038508.829ON37737812181e-167
KNAG0J003208.829ON37337911751e-160
TBLA0D031808.829ON40037911731e-160
TPHA0C047108.829ON37737711471e-156
Kpol_1069.48.829ON2772748291e-110
NCAS0G025702.166ON121561608e-13
Kpol_505.142.166ON123741601e-12
NDAI0F027302.166ON121741582e-12
TDEL0F012102.166ON126711582e-12
ZYRO0B09812g2.166ON183871613e-12
TBLA0B013102.166ON123711563e-12
AFL223W2.166ON165621513e-11
CAGL0L03828g2.166ON121511467e-11
Skud_14.2212.166ON120741468e-11
Suva_13.1054.304ON591631579e-11
KNAG0I020402.166ON119741441e-10
Kpol_1014.54.304ON596671533e-10
Skud_13.924.304ON591631533e-10
TDEL0H02180na 1ON203571463e-10
YML054C (CYB2)4.304ON591631523e-10
Smik_13.924.304ON591631524e-10
Suva_14.2282.166ON120561405e-10
NDAI0D047104.304ON616661515e-10
KLLA0F27577gna 1ON172701428e-10
Ecym_4346na 1ON2091001439e-10
Kwal_47.18167na 1ON227561449e-10
KLLA0B14795gna 2ON5561031499e-10
NCAS0A02770na 3ON6091041471e-09
KAFR0B045502.166ON126521362e-09
TPHA0F017902.166ON182741392e-09
Smik_14.2162.166ON120561352e-09
Kwal_26.84612.166ON123761343e-09
KNAG0E038604.304ON604781444e-09
CAGL0K10736g4.304ON593801444e-09
TPHA0B018204.304ON576871434e-09
KLTH0C11858gsingletonON555471434e-09
NDAI0D04700na 3ON625771435e-09
KLTH0D06930g2.536ON204761366e-09
YNL111C (CYB5)2.166ON120561317e-09
NCAS0A027804.304ON602731419e-09
SAKL0F08316gna 1ON178791341e-08
KLLA0F23672g2.166ON123761301e-08
ADL085Cna 1ON2731571361e-08
TDEL0D00190singletonON552501392e-08
SAKL0E10626g2.166ON123761282e-08
KAFR0I005204.304ON586921382e-08
ZYRO0B13728g4.304ON598801373e-08
KLTH0D09284g2.166ON123861273e-08
SAKL0F16610gsingletonON564501355e-08
KLTH0A04026gna 1ON233571315e-08
ZYRO0B02090g2.536ON194721286e-08
KLLA0D02640g4.304ON589681339e-08
KLTH0C11770gsingletonON618491339e-08
Kwal_23.2823na 2ON560481312e-07
ZYRO0C18524gsingletonON554661283e-07
KAFR0A047406.106ON483721283e-07
SAKL0G16852g4.304ON580591284e-07
TDEL0D011404.304ON584601274e-07
Kwal_26.80462.536ON198741163e-06
Ecym_54202.166ON145501133e-06
NDAI0H013702.536ON224721155e-06
ZYRO0D16654gna 1ON190581101e-05
Kwal_14.807singletonON578481142e-05
TBLA0I015302.536ON221891102e-05
NCAS0F008702.536ON189761083e-05
CAGL0K03069g2.536ON194491066e-05
TDEL0A031102.536ON200761057e-05
KLLA0E18459g2.536ON148731037e-05
TPHA0G035502.536ON218511058e-05
Kpol_478.176.106ON484871025e-04
KNAG0F032506.106ON489741025e-04
Kpol_348.122.536ON21780988e-04
AAL078Wna 4ON592461000.001
TBLA0C06220singletonON49446980.001
NCAS0D032506.106ON49774970.002
NDAI0I016206.106ON44175970.002
Kwal_23.5693na 4ON51346960.003
Ecym_3180na 4ON62146960.003
SAKL0A09570g2.536ON21170920.004
ZYRO0G16742gna 4ON54377940.004
Ecym_30806.106ON47972930.005
SAKL0G10274gna 4ON52246930.006
KLLA0C10692gna 4ON52098930.006
CAGL0I00418g6.106ON49072920.008
KLTH0H06798g6.106ON48872920.009
SAKL0A07326g6.106ON48046900.015
KLTH0G06358gna 4ON51346880.023
KLLA0C05566g6.106ON47772880.024
TPHA0B027006.106ON48888880.025
YMR073C (IRC21)2.536ON20176860.025
TDEL0E03250na 4ON53677870.032
AAR153C6.106ON47872870.033
ZYRO0C05016g6.106ON48374860.044
Kwal_14.18456.106ON28872850.047
Smik_13.2522.536ON20136830.057
Skud_7.2266.106ON50974830.091
TDEL0G036506.106ON48346830.094
YGL055W (OLE1)6.106ON51048830.10
Smik_7.2256.106ON51048830.11
Skud_13.2292.536ON20176790.16
Suva_13.2502.536ON20176780.23
Ecym_72512.536ON19555750.58
KAFR0A018902.536ON16174711.2
Suva_7.2166.106ON47039731.6
CAGL0M13101g2.589ON34151712.3
KNAG0C057802.536ON18071683.5
Kpol_1054.12singletonON300104684.9
ACL114Wna 5ON31957676.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_27.10332
         (378 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_27.10332 s27 (289484..290620) [1137 bp, 378 aa] {ON} YMR272...   752   0.0  
KLTH0C04114g Chr3 (357195..358331) [1137 bp, 378 aa] {ON} highly...   663   0.0  
KLLA0D01639g Chr4 complement(146344..147489) [1146 bp, 381 aa] {...   568   0.0  
SAKL0D01760g Chr4 (140050..141195) [1146 bp, 381 aa] {ON} simila...   560   0.0  
YMR272C Chr13 complement(809623..810777) [1155 bp, 384 aa] {ON} ...   558   0.0  
Smik_13.485 Chr13 complement(792640..793794) [1155 bp, 384 aa] {...   551   0.0  
Skud_13.444 Chr13 complement(783092..784246) [1155 bp, 384 aa] {...   549   0.0  
TDEL0B00680 Chr2 (128650..129801) [1152 bp, 383 aa] {ON} Anc_8.8...   547   0.0  
ZYRO0G13948g Chr7 complement(1109941..1111095) [1155 bp, 384 aa]...   540   0.0  
Suva_13.460 Chr13 complement(792221..793375) [1155 bp, 384 aa] {...   518   0.0  
NCAS0C00470 Chr3 (78059..79339) [1281 bp, 426 aa] {ON} Anc_8.829      511   0.0  
AAL183W Chr1 (13713..14846) [1134 bp, 377 aa] {ON} Syntenic homo...   509   0.0  
NDAI0K00470 Chr11 (107509..108669) [1161 bp, 386 aa] {ON} Anc_8....   488   e-172
CAGL0F03399g Chr6 complement(333955..335097) [1143 bp, 380 aa] {...   484   e-171
Ecym_2712 Chr2 (1378070..1379215) [1146 bp, 381 aa] {ON} similar...   483   e-170
Kpol_541.9 s541 complement(23399..24523) [1125 bp, 374 aa] {ON} ...   474   e-167
KAFR0B03850 Chr2 complement(796399..797532) [1134 bp, 377 aa] {O...   473   e-167
KNAG0J00320 Chr10 (50267..51388) [1122 bp, 373 aa] {ON} Anc_8.82...   457   e-160
TBLA0D03180 Chr4 complement(774883..776085) [1203 bp, 400 aa] {O...   456   e-160
TPHA0C04710 Chr3 complement(1015392..1016525) [1134 bp, 377 aa] ...   446   e-156
Kpol_1069.4 s1069 (6163..6996) [834 bp, 277 aa] {ON} (6163..6996...   323   e-110
NCAS0G02570 Chr7 complement(460218..460583) [366 bp, 121 aa] {ON...    66   8e-13
Kpol_505.14 s505 (37085..37456) [372 bp, 123 aa] {ON} (37085..37...    66   1e-12
NDAI0F02730 Chr6 (669821..670186) [366 bp, 121 aa] {ON} Anc_2.166      65   2e-12
TDEL0F01210 Chr6 complement(216322..216702) [381 bp, 126 aa] {ON...    65   2e-12
ZYRO0B09812g Chr2 (765874..766425) [552 bp, 183 aa] {ON} similar...    67   3e-12
TBLA0B01310 Chr2 (276173..276544) [372 bp, 123 aa] {ON} Anc_2.16...    65   3e-12
AFL223W Chr6 (19601..20098) [498 bp, 165 aa] {ON} Syntenic homol...    63   3e-11
CAGL0L03828g Chr12 (442660..443025) [366 bp, 121 aa] {ON} simila...    61   7e-11
Skud_14.221 Chr14 complement(407119..407481) [363 bp, 120 aa] {O...    61   8e-11
Suva_13.105 Chr13 complement(168279..170054) [1776 bp, 591 aa] {...    65   9e-11
KNAG0I02040 Chr9 (397527..397886) [360 bp, 119 aa] {ON} Anc_2.16...    60   1e-10
Kpol_1014.5 s1014 complement(3107..4897) [1791 bp, 596 aa] {ON} ...    64   3e-10
Skud_13.92 Chr13 complement(163654..165429) [1776 bp, 591 aa] {O...    64   3e-10
TDEL0H02180 Chr8 (369539..370150) [612 bp, 203 aa] {ON}                61   3e-10
YML054C Chr13 complement(165533..167308) [1776 bp, 591 aa] {ON} ...    63   3e-10
Smik_13.92 Chr13 complement(163135..164910) [1776 bp, 591 aa] {O...    63   4e-10
Suva_14.228 Chr14 complement(413753..414115) [363 bp, 120 aa] {O...    59   5e-10
NDAI0D04710 Chr4 (1106280..1108130) [1851 bp, 616 aa] {ON} Anc_4...    63   5e-10
KLLA0F27577g Chr6 (2556662..2557180) [519 bp, 172 aa] {ON} some ...    59   8e-10
Ecym_4346 Chr4 (739106..739735) [630 bp, 209 aa] {ON} similar to...    60   9e-10
Kwal_47.18167 s47 complement(716570..717253) [684 bp, 227 aa] {O...    60   9e-10
KLLA0B14795g Chr2 (1299429..1301099) [1671 bp, 556 aa] {ON} simi...    62   9e-10
NCAS0A02770 Chr1 (528814..530643) [1830 bp, 609 aa] {ON}               61   1e-09
KAFR0B04550 Chr2 (946561..946941) [381 bp, 126 aa] {ON} Anc_2.16...    57   2e-09
TPHA0F01790 Chr6 (412270..412818) [549 bp, 182 aa] {ON} Anc_2.16...    58   2e-09
Smik_14.216 Chr14 complement(396585..396947) [363 bp, 120 aa] {O...    57   2e-09
Kwal_26.8461 s26 (794482..794853) [372 bp, 123 aa] {ON} YNL111C ...    56   3e-09
KNAG0E03860 Chr5 (763388..765202) [1815 bp, 604 aa] {ON} Anc_4.3...    60   4e-09
CAGL0K10736g Chr11 (1046127..1047908) [1782 bp, 593 aa] {ON} hig...    60   4e-09
TPHA0B01820 Chr2 complement(406416..408146) [1731 bp, 576 aa] {O...    60   4e-09
KLTH0C11858g Chr3 (979073..980740) [1668 bp, 555 aa] {ON} simila...    60   4e-09
NDAI0D04700 Chr4 (1103670..1105547) [1878 bp, 625 aa] {ON}             60   5e-09
KLTH0D06930g Chr4 complement(604805..605419) [615 bp, 204 aa] {O...    57   6e-09
YNL111C Chr14 complement(416940..417302) [363 bp, 120 aa] {ON}  ...    55   7e-09
NCAS0A02780 Chr1 (531072..532880) [1809 bp, 602 aa] {ON} Anc_4.304     59   9e-09
SAKL0F08316g Chr6 complement(634949..635485) [537 bp, 178 aa] {O...    56   1e-08
KLLA0F23672g Chr6 (2212223..2212594) [372 bp, 123 aa] {ON} simil...    55   1e-08
ADL085C Chr4 complement(535293..536114) [822 bp, 273 aa] {ON} NO...    57   1e-08
TDEL0D00190 Chr4 (29971..31629) [1659 bp, 552 aa] {ON}                 58   2e-08
SAKL0E10626g Chr5 (885272..885643) [372 bp, 123 aa] {ON} similar...    54   2e-08
KAFR0I00520 Chr9 complement(107239..108999) [1761 bp, 586 aa] {O...    58   2e-08
ZYRO0B13728g Chr2 (1110636..1112432) [1797 bp, 598 aa] {ON} simi...    57   3e-08
KLTH0D09284g Chr4 (770560..770931) [372 bp, 123 aa] {ON} similar...    54   3e-08
SAKL0F16610g Chr6 (1373674..1375368) [1695 bp, 564 aa] {ON} simi...    57   5e-08
KLTH0A04026g Chr1 complement(337200..337901) [702 bp, 233 aa] {O...    55   5e-08
ZYRO0B02090g Chr2 complement(169589..170173) [585 bp, 194 aa] {O...    54   6e-08
KLLA0D02640g Chr4 complement(225482..227251) [1770 bp, 589 aa] {...    56   9e-08
KLTH0C11770g Chr3 (970979..972835) [1857 bp, 618 aa] {ON} simila...    56   9e-08
Kwal_23.2823 s23 (29032..30714) [1683 bp, 560 aa] {ON} YML054C (...    55   2e-07
ZYRO0C18524g Chr3 (1450641..1452305) [1665 bp, 554 aa] {ON} simi...    54   3e-07
KAFR0A04740 Chr1 (942850..944301) [1452 bp, 483 aa] {ON} Anc_6.1...    54   3e-07
SAKL0G16852g Chr7 (1452894..1454636) [1743 bp, 580 aa] {ON} simi...    54   4e-07
TDEL0D01140 Chr4 complement(214858..216612) [1755 bp, 584 aa] {O...    54   4e-07
Kwal_26.8046 s26 complement(621715..622311) [597 bp, 198 aa] {ON...    49   3e-06
Ecym_5420 Chr5 (865505..865942) [438 bp, 145 aa] {ON} similar to...    48   3e-06
NDAI0H01370 Chr8 (336807..337481) [675 bp, 224 aa] {ON} Anc_2.536      49   5e-06
ZYRO0D16654g Chr4 complement(1380316..1380888) [573 bp, 190 aa] ...    47   1e-05
Kwal_14.807 s14 complement(57218..58954) [1737 bp, 578 aa] {ON} ...    49   2e-05
TBLA0I01530 Chr9 (334102..334767) [666 bp, 221 aa] {ON} Anc_2.53...    47   2e-05
NCAS0F00870 Chr6 (177678..178247) [570 bp, 189 aa] {ON} Anc_2.53...    46   3e-05
CAGL0K03069g Chr11 complement(285190..285774) [585 bp, 194 aa] {...    45   6e-05
TDEL0A03110 Chr1 complement(554890..555492) [603 bp, 200 aa] {ON...    45   7e-05
KLLA0E18459g Chr5 (1641507..1641953) [447 bp, 148 aa] {ON} simil...    44   7e-05
TPHA0G03550 Chr7 complement(755688..756344) [657 bp, 218 aa] {ON...    45   8e-05
Kpol_478.17 s478 (61375..62829) [1455 bp, 484 aa] {ON} (61375..6...    44   5e-04
KNAG0F03250 Chr6 complement(607667..609136) [1470 bp, 489 aa] {O...    44   5e-04
Kpol_348.12 s348 complement(21978..22631) [654 bp, 217 aa] {ON} ...    42   8e-04
AAL078W Chr1 (209600..211378) [1779 bp, 592 aa] {ON} Non-synteni...    43   0.001
TBLA0C06220 Chr3 (1507690..1509174) [1485 bp, 494 aa] {ON}             42   0.001
NCAS0D03250 Chr4 (608476..609969) [1494 bp, 497 aa] {ON} Anc_6.106     42   0.002
NDAI0I01620 Chr9 complement(382761..384086) [1326 bp, 441 aa] {O...    42   0.002
Kwal_23.5693 s23 (1277807..1279348) [1542 bp, 513 aa] {ON} YGL05...    42   0.003
Ecym_3180 Chr3 (344929..346794) [1866 bp, 621 aa] {ON} similar t...    42   0.003
SAKL0A09570g Chr1 complement(838406..839041) [636 bp, 211 aa] {O...    40   0.004
ZYRO0G16742g Chr7 (1373818..1375449) [1632 bp, 543 aa] {ON} weak...    41   0.004
Ecym_3080 Chr3 (149461..150900) [1440 bp, 479 aa] {ON} similar t...    40   0.005
SAKL0G10274g Chr7 complement(874738..876306) [1569 bp, 522 aa] {...    40   0.006
KLLA0C10692g Chr3 complement(916718..918280) [1563 bp, 520 aa] {...    40   0.006
CAGL0I00418g Chr9 (30058..31530) [1473 bp, 490 aa] {ON} highly s...    40   0.008
KLTH0H06798g Chr8 (596966..598432) [1467 bp, 488 aa] {ON} unipro...    40   0.009
SAKL0A07326g Chr1 (648420..649862) [1443 bp, 480 aa] {ON} unipro...    39   0.015
KLTH0G06358g Chr7 complement(503325..504866) [1542 bp, 513 aa] {...    39   0.023
KLLA0C05566g Chr3 complement(497877..499310) [1434 bp, 477 aa] {...    39   0.024
TPHA0B02700 Chr2 (620423..621889) [1467 bp, 488 aa] {ON} Anc_6.1...    39   0.025
YMR073C Chr13 complement(412268..412873) [606 bp, 201 aa] {ON}  ...    38   0.025
TDEL0E03250 Chr5 complement(612008..613618) [1611 bp, 536 aa] {O...    38   0.032
AAR153C Chr1 complement(619953..621389) [1437 bp, 478 aa] {ON} S...    38   0.033
ZYRO0C05016g Chr3 (394581..396032) [1452 bp, 483 aa] {ON} simila...    38   0.044
Kwal_14.1845 s14 (491597..492463) [867 bp, 288 aa] {ON} YGL055W ...    37   0.047
Smik_13.252 Chr13 complement(396365..396970) [606 bp, 201 aa] {O...    37   0.057
Skud_7.226 Chr7 (402118..403647) [1530 bp, 509 aa] {ON} YGL055W ...    37   0.091
TDEL0G03650 Chr7 (673347..674798) [1452 bp, 483 aa] {ON} Anc_6.1...    37   0.094
YGL055W Chr7 (398628..400160) [1533 bp, 510 aa] {ON}  OLE1Delta(...    37   0.10 
Smik_7.225 Chr7 (393200..394732) [1533 bp, 510 aa] {ON} YGL055W ...    37   0.11 
Skud_13.229 Chr13 complement(386598..387203) [606 bp, 201 aa] {O...    35   0.16 
Suva_13.250 Chr13 complement(393510..394115) [606 bp, 201 aa] {O...    35   0.23 
Ecym_7251 Chr7 (530372..530959) [588 bp, 195 aa] {ON} similar to...    33   0.58 
KAFR0A01890 Chr1 complement(392001..392486) [486 bp, 161 aa] {ON...    32   1.2  
Suva_7.216 Chr7 (391750..393162) [1413 bp, 470 aa] {ON} YGL055W ...    33   1.6  
CAGL0M13101g Chr13 (1288111..1289136) [1026 bp, 341 aa] {ON} sim...    32   2.3  
KNAG0C05780 Chr3 (1124591..1125133) [543 bp, 180 aa] {ON} Anc_2....    31   3.5  
Kpol_1054.12 s1054 complement(28294..29196) [903 bp, 300 aa] {ON...    31   4.9  
ACL114W Chr3 (144800..145759) [960 bp, 319 aa] {ON} Non-syntenic...    30   6.8  

>Kwal_27.10332 s27 (289484..290620) [1137 bp, 378 aa] {ON} YMR272C
           (SCS7) - desaturase/hydroxylase enzyme [contig 36] FULL
          Length = 378

 Score =  752 bits (1941), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 366/378 (96%), Positives = 366/378 (96%)

Query: 1   METKTLPLYSASQVQEHNSADDCWVTLQNRKIYDVTKFLEDHPGGGDLIVEYAGKDITEV 60
           METKTLPLYSASQVQEHNSADDCWVTLQNRKIYDVTKFLEDHPGGGDLIVEYAGKDITEV
Sbjct: 1   METKTLPLYSASQVQEHNSADDCWVTLQNRKIYDVTKFLEDHPGGGDLIVEYAGKDITEV 60

Query: 61  MKDGPLHSHSFVAYEVLDEEYHVGYLATAEEEQKLLGNSKHKVEVKLEDEYDSTVFVPEV 120
           MKDGPLHSHSFVAYEVLDEEYHVGYLATAEEEQKLLGNSKHKVEVKLEDEYDSTVFVPEV
Sbjct: 61  MKDGPLHSHSFVAYEVLDEEYHVGYLATAEEEQKLLGNSKHKVEVKLEDEYDSTVFVPEV 120

Query: 121 PAEEKLSIVTDYTRDYGRHKFLDLNRPLLMQMLTADFTKEFYLDQVHRPRHYGRGSAPLF 180
           PAEEKLSIVTDYTRDYGRHKFLDLNRPLLMQMLTADFTKEFYLDQVHRPRHYGRGSAPLF
Sbjct: 121 PAEEKLSIVTDYTRDYGRHKFLDLNRPLLMQMLTADFTKEFYLDQVHRPRHYGRGSAPLF 180

Query: 181 GNFLEPLSKTSWYVIPIVWLPVVAYHIFTAMQNMNKLFAVFLFFVGIFVWTLIEYGMHRF 240
           GNFLEPLSKTSWYVIPIVWLPVVAYHIFTAMQNMNKLFAVFLFFVGIFVWTLIEYGMHRF
Sbjct: 181 GNFLEPLSKTSWYVIPIVWLPVVAYHIFTAMQNMNKLFAVFLFFVGIFVWTLIEYGMHRF 240

Query: 241 LFHLDFYLPRNQVAYTVHFLLHGVHHYLPMDRYRLVMXXXXXXXXXXXXYKLVFALLPYY 300
           LFHLDFYLPRNQVAYTVHFLLHGVHHYLPMDRYRLVM            YKLVFALLPYY
Sbjct: 241 LFHLDFYLPRNQVAYTVHFLLHGVHHYLPMDRYRLVMPPTLFLLLCTPFYKLVFALLPYY 300

Query: 301 WACAGFAGGMLGYVCYDLTHYFLHHAKLPGILKKLKKYHMEHHYKNYELGFGVTSWVWDK 360
           WACAGFAGGMLGYVCYDLTHYFLHHAKLPGILKKLKKYHMEHHYKNYELGFGVTSWVWDK
Sbjct: 301 WACAGFAGGMLGYVCYDLTHYFLHHAKLPGILKKLKKYHMEHHYKNYELGFGVTSWVWDK 360

Query: 361 VFGTYLAENAPLSQMKFD 378
           VFGTYLAENAPLSQMKFD
Sbjct: 361 VFGTYLAENAPLSQMKFD 378

>KLTH0C04114g Chr3 (357195..358331) [1137 bp, 378 aa] {ON} highly
           similar to uniprot|Q03529 Saccharomyces cerevisiae
           YMR272C SCS7 Required for the hydroxylation of the very
           long chain fatty acid (VLCFA) located in the endoplasmic
           reticulum desaturase/hydroxylase enzyme
          Length = 378

 Score =  663 bits (1710), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/378 (82%), Positives = 343/378 (90%)

Query: 1   METKTLPLYSASQVQEHNSADDCWVTLQNRKIYDVTKFLEDHPGGGDLIVEYAGKDITEV 60
           METKTLPLYS SQ+++HN+ DDCWV+L +RKIY+VT FL++HPGG +LI EYAGKD+TE+
Sbjct: 1   METKTLPLYSQSQLEQHNTRDDCWVSLHHRKIYNVTSFLDEHPGGAELIEEYAGKDVTEI 60

Query: 61  MKDGPLHSHSFVAYEVLDEEYHVGYLATAEEEQKLLGNSKHKVEVKLEDEYDSTVFVPEV 120
           MKDGP H HS+VAYEVLDEEYHVGYLAT EEE+KLLGN +H VEVKLE++YDSTVFVPEV
Sbjct: 61  MKDGPTHEHSYVAYEVLDEEYHVGYLATPEEEKKLLGNPEHPVEVKLEEDYDSTVFVPEV 120

Query: 121 PAEEKLSIVTDYTRDYGRHKFLDLNRPLLMQMLTADFTKEFYLDQVHRPRHYGRGSAPLF 180
           P EEKLSIVTDYT+DYGRHKFLDLNRPLLMQMLT+DF+KEFYLDQVHRPRHYGRGSAPLF
Sbjct: 121 PPEEKLSIVTDYTKDYGRHKFLDLNRPLLMQMLTSDFSKEFYLDQVHRPRHYGRGSAPLF 180

Query: 181 GNFLEPLSKTSWYVIPIVWLPVVAYHIFTAMQNMNKLFAVFLFFVGIFVWTLIEYGMHRF 240
           GNFLEPLSKT+WYVIP+VW PVV YH++TA+QNMN + AVFLF +G+FVWTLIEYG+HRF
Sbjct: 181 GNFLEPLSKTAWYVIPLVWFPVVVYHMYTALQNMNNVLAVFLFCLGVFVWTLIEYGLHRF 240

Query: 241 LFHLDFYLPRNQVAYTVHFLLHGVHHYLPMDRYRLVMXXXXXXXXXXXXYKLVFALLPYY 300
           LFHLDFYLPRNQVAYTVHFLLHGVHHYLPMDRYRLVM            YKLVFALLP Y
Sbjct: 241 LFHLDFYLPRNQVAYTVHFLLHGVHHYLPMDRYRLVMPPTLFVVLCTPFYKLVFALLPKY 300

Query: 301 WACAGFAGGMLGYVCYDLTHYFLHHAKLPGILKKLKKYHMEHHYKNYELGFGVTSWVWDK 360
           WACAGFAGGM GY+CYDLTHYFLHHAKLP  ++KLKKYHMEHHYKNYELGFGVTSW WDK
Sbjct: 301 WACAGFAGGMFGYMCYDLTHYFLHHAKLPSYMRKLKKYHMEHHYKNYELGFGVTSWFWDK 360

Query: 361 VFGTYLAENAPLSQMKFD 378
           VFGTYL +NAPLSQMKFD
Sbjct: 361 VFGTYLGDNAPLSQMKFD 378

>KLLA0D01639g Chr4 complement(146344..147489) [1146 bp, 381 aa] {ON}
           similar to uniprot|Q03529 Saccharomyces cerevisiae
           YMR272C SCS7 Required for the hydroxylation of the very
           long chain fatty acid (VLCFA) located in the endoplasmic
           reticulum desaturase/hydroxylase enzyme
          Length = 381

 Score =  568 bits (1463), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 267/379 (70%), Positives = 315/379 (83%), Gaps = 2/379 (0%)

Query: 2   ETKTLPLYSASQVQEHNSADDCWVTLQNRKIYDVTKFLEDHPGGGDLIVEYAGKDITEVM 61
            ++ LPLYS + +++HN  +DCWV+L  RKIY+VT+FL++HPGG + I++YAG DIT+VM
Sbjct: 3   SSRILPLYSKTDLEKHNDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYILDYAGTDITDVM 62

Query: 62  KDGPLHSHSFVAYEVLDEEYHVGYLATAEEEQKLLGNSKHKVEVKLE--DEYDSTVFVPE 119
           KD   H HS  AYE++DE Y VGYLAT EEE+KLL N  H VEV L+  +E+DSTVFV E
Sbjct: 63  KDVLTHEHSESAYEIMDESYLVGYLATEEEEKKLLTNKDHVVEVNLKGNNEFDSTVFVKE 122

Query: 120 VPAEEKLSIVTDYTRDYGRHKFLDLNRPLLMQMLTADFTKEFYLDQVHRPRHYGRGSAPL 179
           +P E+KLSI TDY  DY +HKFLDLN+PLL Q+L   FTK+FYLDQVHRPRHYG+GSAPL
Sbjct: 123 LPTEDKLSIATDYQNDYKKHKFLDLNKPLLWQVLFGKFTKDFYLDQVHRPRHYGKGSAPL 182

Query: 180 FGNFLEPLSKTSWYVIPIVWLPVVAYHIFTAMQNMNKLFAVFLFFVGIFVWTLIEYGMHR 239
           FGNFLEPLSKT W+++P+VWLPVV YHI+TA+ NMN+ FA+FLF VG+FVWTLIEYG+HR
Sbjct: 183 FGNFLEPLSKTPWWMVPVVWLPVVTYHIYTALMNMNQAFAIFLFAVGVFVWTLIEYGLHR 242

Query: 240 FLFHLDFYLPRNQVAYTVHFLLHGVHHYLPMDRYRLVMXXXXXXXXXXXXYKLVFALLPY 299
           FLFHLD  LP  Q A+T+HFLLHGVHHYLPMDR+RLVM            YKLVFALLPY
Sbjct: 243 FLFHLDDRLPEKQWAFTLHFLLHGVHHYLPMDRFRLVMPPTLFVVLCTPFYKLVFALLPY 302

Query: 300 YWACAGFAGGMLGYVCYDLTHYFLHHAKLPGILKKLKKYHMEHHYKNYELGFGVTSWVWD 359
           YWACAGFAGGMLGYVCYDLTHYFLHH++LP  ++KLKKYH+EHHYKNYELGFGVTSW WD
Sbjct: 303 YWACAGFAGGMLGYVCYDLTHYFLHHSQLPPYMRKLKKYHLEHHYKNYELGFGVTSWFWD 362

Query: 360 KVFGTYLAENAPLSQMKFD 378
           KVFGTYL ENAPLS MK+D
Sbjct: 363 KVFGTYLGENAPLSNMKYD 381

>SAKL0D01760g Chr4 (140050..141195) [1146 bp, 381 aa] {ON} similar
           to uniprot|Q03529 Saccharomyces cerevisiae YMR272C SCS7
           Required for the hydroxylation of the very long chain
           fatty acid (VLCFA) located in the endoplasmic reticulum
           desaturase/hydroxylase enzyme
          Length = 381

 Score =  560 bits (1444), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 261/379 (68%), Positives = 314/379 (82%), Gaps = 2/379 (0%)

Query: 2   ETKTLPLYSASQVQEHNSADDCWVTLQNRKIYDVTKFLEDHPGGGDLIVEYAGKDITEVM 61
           E+KTLPL S +Q+ +HN+ +DCWV+L NRK+Y+VT FLE+HPGG   I+++AG+DITE+M
Sbjct: 3   ESKTLPLLSKTQLSQHNTKEDCWVSLYNRKVYNVTAFLEEHPGGDQYILDHAGEDITEIM 62

Query: 62  KDGPLHSHSFVAYEVLDEEYHVGYLATAEEEQKLLGNSKHKVEVKLED--EYDSTVFVPE 119
           KD  +H HS  AYE++++ Y VGYLA  EEE+KLL N  H VEVKL +  ++DST FV E
Sbjct: 63  KDKLVHEHSESAYEIMNDMYLVGYLANEEEEKKLLTNEDHTVEVKLNESTQFDSTTFVKE 122

Query: 120 VPAEEKLSIVTDYTRDYGRHKFLDLNRPLLMQMLTADFTKEFYLDQVHRPRHYGRGSAPL 179
           +P E+KLSI TDY+ DY +HKFLDL++PLL Q++  +FTK+FYLDQVHRPRHYG+GSAPL
Sbjct: 123 LPTEDKLSIATDYSSDYKKHKFLDLDKPLLWQVVFGNFTKDFYLDQVHRPRHYGKGSAPL 182

Query: 180 FGNFLEPLSKTSWYVIPIVWLPVVAYHIFTAMQNMNKLFAVFLFFVGIFVWTLIEYGMHR 239
           FGNFLEPLSKT WY IPI WLPVV YH++ A+ NMNK FA+FLF +G+FVWTLIEY +HR
Sbjct: 183 FGNFLEPLSKTPWYAIPIAWLPVVFYHLYVALTNMNKPFALFLFSLGVFVWTLIEYCLHR 242

Query: 240 FLFHLDFYLPRNQVAYTVHFLLHGVHHYLPMDRYRLVMXXXXXXXXXXXXYKLVFALLPY 299
           FLFHLD YLP  Q+A+ +HFLLHGVHHYLPMDRYRLVM            YKLVF+LLPY
Sbjct: 243 FLFHLDQYLPERQLAFALHFLLHGVHHYLPMDRYRLVMPPTLFVLLCTPFYKLVFSLLPY 302

Query: 300 YWACAGFAGGMLGYVCYDLTHYFLHHAKLPGILKKLKKYHMEHHYKNYELGFGVTSWVWD 359
           YWACAGFAGGMLGY CYDLTHYFLHHAKLP  ++KLKKYH+EHHYKNYELGFGVTSW WD
Sbjct: 303 YWACAGFAGGMLGYTCYDLTHYFLHHAKLPPYMRKLKKYHLEHHYKNYELGFGVTSWFWD 362

Query: 360 KVFGTYLAENAPLSQMKFD 378
           KVFGTYL  +APLS+MK++
Sbjct: 363 KVFGTYLGSDAPLSKMKYE 381

>YMR272C Chr13 complement(809623..810777) [1155 bp, 384 aa] {ON}
           SCS7Sphingolipid alpha-hydroxylase, functions in the
           alpha-hydroxylation of sphingolipid-associated very long
           chain fatty acids, has both cytochrome b5-like and
           hydroxylase/desaturase domains, not essential for growth
          Length = 384

 Score =  558 bits (1438), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 257/379 (67%), Positives = 312/379 (82%), Gaps = 3/379 (0%)

Query: 3   TKTLPLYSASQVQEHNSADDCWVTLQNRKIYDVTKFLEDHPGGGDLIVEYAGKDITEVMK 62
           +KTL L+S   VQEHN+A+DCWVT QNRKIYDVT+FL +HPGG + I++YAGKDITE+MK
Sbjct: 6   SKTLELFSKKTVQEHNTANDCWVTYQNRKIYDVTRFLSEHPGGDESILDYAGKDITEIMK 65

Query: 63  DGPLHSHSFVAYEVLDEEYHVGYLATAEEEQKLLGNSKHKVEVKLE---DEYDSTVFVPE 119
           D  +H HS  AYE+L++EY +GYLAT EE  +LL N  HKVEV+L     E+DST FV E
Sbjct: 66  DSDVHEHSDSAYEILEDEYLIGYLATDEEAARLLTNKNHKVEVQLSADGTEFDSTTFVKE 125

Query: 120 VPAEEKLSIVTDYTRDYGRHKFLDLNRPLLMQMLTADFTKEFYLDQVHRPRHYGRGSAPL 179
           +PAEEKLSI TDY+ DY +HKFLDLNRPLLMQ+L +DF K+FY+DQ+HRPRHYG+GSAPL
Sbjct: 126 LPAEEKLSIATDYSNDYKKHKFLDLNRPLLMQILRSDFKKDFYVDQIHRPRHYGKGSAPL 185

Query: 180 FGNFLEPLSKTSWYVIPIVWLPVVAYHIFTAMQNMNKLFAVFLFFVGIFVWTLIEYGMHR 239
           FGNFLEPL+KT+W+V+P+ WLPVV YH+  A++NMN+LFA FLF VG+FVWTLIEYG+HR
Sbjct: 186 FGNFLEPLTKTAWWVVPVAWLPVVVYHMGVALKNMNQLFACFLFCVGVFVWTLIEYGLHR 245

Query: 240 FLFHLDFYLPRNQVAYTVHFLLHGVHHYLPMDRYRLVMXXXXXXXXXXXXYKLVFALLPY 299
           FLFH D +LP + +A+  HFLLHG HHYLPMD+YRLVM            YKLVFALLP 
Sbjct: 246 FLFHFDDWLPESNIAFATHFLLHGCHHYLPMDKYRLVMPPTLFVILCAPFYKLVFALLPL 305

Query: 300 YWACAGFAGGMLGYVCYDLTHYFLHHAKLPGILKKLKKYHMEHHYKNYELGFGVTSWVWD 359
           YWA AGFAGG+ GYVCYD  H+FLHH+KLP  ++KLKKYH+EHHYKNY+LGFGVTSW WD
Sbjct: 306 YWAYAGFAGGLFGYVCYDECHFFLHHSKLPPFMRKLKKYHLEHHYKNYQLGFGVTSWFWD 365

Query: 360 KVFGTYLAENAPLSQMKFD 378
           +VFGTYL  +APLS+MK++
Sbjct: 366 EVFGTYLGPDAPLSKMKYE 384

>Smik_13.485 Chr13 complement(792640..793794) [1155 bp, 384 aa] {ON}
           YMR272C (REAL)
          Length = 384

 Score =  551 bits (1421), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 256/379 (67%), Positives = 309/379 (81%), Gaps = 3/379 (0%)

Query: 3   TKTLPLYSASQVQEHNSADDCWVTLQNRKIYDVTKFLEDHPGGGDLIVEYAGKDITEVMK 62
           +KTL L+S   V++HN+A DCWVT QNRKIYDVTKFL +HPGG + I++YAGKDITEVMK
Sbjct: 6   SKTLELFSKKTVEKHNTAKDCWVTYQNRKIYDVTKFLSEHPGGDESILDYAGKDITEVMK 65

Query: 63  DGPLHSHSFVAYEVLDEEYHVGYLATAEEEQKLLGNSKHKVEVKLED---EYDSTVFVPE 119
           D  +H HS  AYE+L++EY +GYLAT EE  +LL N  HKVEV+L     E+DST FV +
Sbjct: 66  DTDVHEHSDSAYEILEDEYLIGYLATDEEAARLLTNKNHKVEVQLSSDGTEFDSTTFVKD 125

Query: 120 VPAEEKLSIVTDYTRDYGRHKFLDLNRPLLMQMLTADFTKEFYLDQVHRPRHYGRGSAPL 179
           +PAEEKLSI TDY  DY +HKFLDLNRPLLMQ+L +DF K+FY+DQ+HRPRHYG+GSAPL
Sbjct: 126 LPAEEKLSIATDYGNDYKKHKFLDLNRPLLMQILCSDFKKDFYVDQIHRPRHYGKGSAPL 185

Query: 180 FGNFLEPLSKTSWYVIPIVWLPVVAYHIFTAMQNMNKLFAVFLFFVGIFVWTLIEYGMHR 239
           FGNFLEPL+KT+W+V+P  WLPVV YH+  A++NMN+LFA FLF VG+FVWTLIEYG+HR
Sbjct: 186 FGNFLEPLTKTAWWVVPTAWLPVVVYHMGVALKNMNQLFACFLFCVGVFVWTLIEYGLHR 245

Query: 240 FLFHLDFYLPRNQVAYTVHFLLHGVHHYLPMDRYRLVMXXXXXXXXXXXXYKLVFALLPY 299
           FLFH D +LP + +A+  HFLLHG HHYLPMD+YRLVM            YKLVFALLP 
Sbjct: 246 FLFHFDDWLPESNIAFATHFLLHGCHHYLPMDKYRLVMPPTLFVILCAPFYKLVFALLPL 305

Query: 300 YWACAGFAGGMLGYVCYDLTHYFLHHAKLPGILKKLKKYHMEHHYKNYELGFGVTSWVWD 359
           YWA AGFAGG+ GYVCYD  H+FLHH+KLP  ++KLKKYH+EHHYKNY+LGFGVTSW WD
Sbjct: 306 YWAYAGFAGGLFGYVCYDECHFFLHHSKLPPFMRKLKKYHLEHHYKNYQLGFGVTSWFWD 365

Query: 360 KVFGTYLAENAPLSQMKFD 378
           +VFGTYL  +APLS+MK++
Sbjct: 366 EVFGTYLGPDAPLSKMKYE 384

>Skud_13.444 Chr13 complement(783092..784246) [1155 bp, 384 aa] {ON}
           YMR272C (REAL)
          Length = 384

 Score =  549 bits (1415), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 255/379 (67%), Positives = 308/379 (81%), Gaps = 3/379 (0%)

Query: 3   TKTLPLYSASQVQEHNSADDCWVTLQNRKIYDVTKFLEDHPGGGDLIVEYAGKDITEVMK 62
           +KTL L+S   V+EHN+A DCWVT QNRKIYDVTKFL +HPGG + I++YAGKD+TE+MK
Sbjct: 6   SKTLELFSRKTVEEHNTAKDCWVTYQNRKIYDVTKFLGEHPGGDESILDYAGKDVTEIMK 65

Query: 63  DGPLHSHSFVAYEVLDEEYHVGYLATAEEEQKLLGNSKHKVEVKLE---DEYDSTVFVPE 119
           D  +H HS  AYE+L++EY +GYLAT EE  +LL N  HKVEV+L     E+DST FV  
Sbjct: 66  DSDVHEHSDSAYEILEDEYLIGYLATDEEATRLLTNKSHKVEVQLSADGKEFDSTTFVKN 125

Query: 120 VPAEEKLSIVTDYTRDYGRHKFLDLNRPLLMQMLTADFTKEFYLDQVHRPRHYGRGSAPL 179
           +P EEKLSI TDY  DY +HKFLDLNRPLLMQ+L +DF K+FY+DQ+HRPRHYG+GSAPL
Sbjct: 126 LPTEEKLSIATDYGNDYKKHKFLDLNRPLLMQILRSDFKKDFYVDQIHRPRHYGKGSAPL 185

Query: 180 FGNFLEPLSKTSWYVIPIVWLPVVAYHIFTAMQNMNKLFAVFLFFVGIFVWTLIEYGMHR 239
           FGNFLEPL+KT+W+V+P+ WLPVV YH+  A++NMN+LFA FLF VG+FVWTLIEYG+HR
Sbjct: 186 FGNFLEPLTKTAWWVVPLPWLPVVVYHMGVALKNMNQLFACFLFCVGVFVWTLIEYGLHR 245

Query: 240 FLFHLDFYLPRNQVAYTVHFLLHGVHHYLPMDRYRLVMXXXXXXXXXXXXYKLVFALLPY 299
           FLFH D +LP + VA+  HFLLHG HHYLPMD+YRLVM            YKLVFALLP 
Sbjct: 246 FLFHFDDWLPESNVAFATHFLLHGCHHYLPMDKYRLVMPPTLFVILCAPFYKLVFALLPL 305

Query: 300 YWACAGFAGGMLGYVCYDLTHYFLHHAKLPGILKKLKKYHMEHHYKNYELGFGVTSWVWD 359
           YWA AGFAGG+ GYVCYD  H+FLHH+KLP  ++KLKKYH+EHHYKNY+LGFGVTSW WD
Sbjct: 306 YWAYAGFAGGLFGYVCYDECHFFLHHSKLPPFMRKLKKYHLEHHYKNYQLGFGVTSWFWD 365

Query: 360 KVFGTYLAENAPLSQMKFD 378
           +VFGTYL  +APLS+MK++
Sbjct: 366 EVFGTYLGPDAPLSKMKYE 384

>TDEL0B00680 Chr2 (128650..129801) [1152 bp, 383 aa] {ON} Anc_8.829
           YMR272C
          Length = 383

 Score =  547 bits (1410), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 258/379 (68%), Positives = 308/379 (81%), Gaps = 2/379 (0%)

Query: 2   ETKTLPLYSASQVQEHNSADDCWVTLQNRKIYDVTKFLEDHPGGGDLIVEYAGKDITEVM 61
           ++KTL L+S  QV EHN+A+DCWVT+ NRKIYDVTKFL++HPGG   I++YAGKDITEV+
Sbjct: 5   QSKTLELFSRKQVSEHNNANDCWVTVSNRKIYDVTKFLDEHPGGPQYILDYAGKDITEVL 64

Query: 62  KDGPLHSHSFVAYEVL-DEEYHVGYLATAEEEQKLLGNSKHKVEVKLED-EYDSTVFVPE 119
           KD  +H HS  AYE+L D  Y VGY+AT  EE++LL NS HKVEVKL   ++DST FV +
Sbjct: 65  KDSTIHEHSESAYEILEDSSYLVGYMATELEEKELLTNSSHKVEVKLATLDFDSTTFVKD 124

Query: 120 VPAEEKLSIVTDYTRDYGRHKFLDLNRPLLMQMLTADFTKEFYLDQVHRPRHYGRGSAPL 179
           +P EEKLSI TDY+RDY RH FLDL +PLL Q++   FTK+FY+DQ+HRPRHYG+GSAPL
Sbjct: 125 LPTEEKLSIATDYSRDYKRHHFLDLQKPLLPQVMFGKFTKDFYVDQIHRPRHYGKGSAPL 184

Query: 180 FGNFLEPLSKTSWYVIPIVWLPVVAYHIFTAMQNMNKLFAVFLFFVGIFVWTLIEYGMHR 239
           FGNFLEPLSKTSWYVIP+VWLPVV YH+  A +NMN +F +F F +G FVWTLIEYG+HR
Sbjct: 185 FGNFLEPLSKTSWYVIPMVWLPVVLYHVGVAFKNMNPIFTIFFFCLGTFVWTLIEYGLHR 244

Query: 240 FLFHLDFYLPRNQVAYTVHFLLHGVHHYLPMDRYRLVMXXXXXXXXXXXXYKLVFALLPY 299
           FLFH D +LP + V +T+HFLLHGVHHYLPMD+YRLVM            YKLVF LLP 
Sbjct: 245 FLFHFDDWLPESNVCFTLHFLLHGVHHYLPMDKYRLVMPPTLFVILCTPFYKLVFGLLPL 304

Query: 300 YWACAGFAGGMLGYVCYDLTHYFLHHAKLPGILKKLKKYHMEHHYKNYELGFGVTSWVWD 359
           Y A AGFAGG+ GYVCYDLTHYFLHH+KLP  ++KLKKYH+EHHYKNY+LGFGVTSW WD
Sbjct: 305 YVAYAGFAGGLFGYVCYDLTHYFLHHSKLPSFMRKLKKYHLEHHYKNYQLGFGVTSWFWD 364

Query: 360 KVFGTYLAENAPLSQMKFD 378
           KVFGTYL+  +P+SQMK+D
Sbjct: 365 KVFGTYLSPTSPISQMKYD 383

>ZYRO0G13948g Chr7 complement(1109941..1111095) [1155 bp, 384 aa]
           {ON} similar to uniprot|Q03529 Saccharomyces cerevisiae
           YMR272C SCS7 Required for the hydroxylation of the very
           long chain fatty acid (VLCFA) located in the endoplasmic
           reticulum desaturase/hydroxylase enzyme
          Length = 384

 Score =  540 bits (1390), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 255/384 (66%), Positives = 306/384 (79%), Gaps = 6/384 (1%)

Query: 1   METK--TLPLYSASQVQEHNSADDCWVTLQNRKIYDVTKFLEDHPGGGDLIVEYAGKDIT 58
           M TK  TL L+S  Q+ +HN+  DCWV++  RKIY+VT+FL++HPGG + I++YAG+DIT
Sbjct: 1   MSTKSPTLQLFSQEQLSKHNNEKDCWVSVYQRKIYNVTEFLDEHPGGAEYILKYAGRDIT 60

Query: 59  EVMKDGPLHSHSFVAYEVLDEEYHVGYLATAEEEQKLLGNSKHKVEVKLEDE----YDST 114
           EV+KD  +H HS  AYE+LD+ Y VGYLAT EE  KLL N KH+VEV L D+    +DST
Sbjct: 61  EVLKDRDVHEHSESAYEILDDNYLVGYLATKEEATKLLTNKKHQVEVHLTDQNNSDFDST 120

Query: 115 VFVPEVPAEEKLSIVTDYTRDYGRHKFLDLNRPLLMQMLTADFTKEFYLDQVHRPRHYGR 174
            FVPE+PAEEKL+I TDY RDY +HKFLDLNR LL Q++  +F+K+FYLDQVHRPRHYG+
Sbjct: 121 TFVPELPAEEKLNIATDYGRDYKKHKFLDLNRALLPQVMFGNFSKDFYLDQVHRPRHYGK 180

Query: 175 GSAPLFGNFLEPLSKTSWYVIPIVWLPVVAYHIFTAMQNMNKLFAVFLFFVGIFVWTLIE 234
           GSAPLFGNFLEP+SKT W+ IPI+W+PVV++H +    NMNKLF+ FLF +GIFVWTLIE
Sbjct: 181 GSAPLFGNFLEPISKTPWWAIPIIWIPVVSFHFYVGFTNMNKLFSTFLFCLGIFVWTLIE 240

Query: 235 YGMHRFLFHLDFYLPRNQVAYTVHFLLHGVHHYLPMDRYRLVMXXXXXXXXXXXXYKLVF 294
           Y +HRFLFHLD +LP N  A T+HFLLHGVHHYLPMDRYRLVM            YK VF
Sbjct: 241 YCLHRFLFHLDEWLPDNNAALTLHFLLHGVHHYLPMDRYRLVMPPTLGIVLMAPIYKTVF 300

Query: 295 ALLPYYWACAGFAGGMLGYVCYDLTHYFLHHAKLPGILKKLKKYHMEHHYKNYELGFGVT 354
            LLP YWA +GFAGG+ GYVCYDLTHYFLHHAKLP  ++KLKKYH+EHHYKNY+LGFGVT
Sbjct: 301 GLLPTYWAYSGFAGGLFGYVCYDLTHYFLHHAKLPSYMRKLKKYHLEHHYKNYQLGFGVT 360

Query: 355 SWVWDKVFGTYLAENAPLSQMKFD 378
           SW WD VFGTYL  +APL+ MK+D
Sbjct: 361 SWFWDNVFGTYLGPDAPLAHMKYD 384

>Suva_13.460 Chr13 complement(792221..793375) [1155 bp, 384 aa] {ON}
           YMR272C (REAL)
          Length = 384

 Score =  518 bits (1335), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 254/379 (67%), Positives = 306/379 (80%), Gaps = 3/379 (0%)

Query: 3   TKTLPLYSASQVQEHNSADDCWVTLQNRKIYDVTKFLEDHPGGGDLIVEYAGKDITEVMK 62
           +KTL L+S   V+EHN+A DCWVT QNRKIYDVTKFL +HPGG + I++YAGKDITEVMK
Sbjct: 6   SKTLELFSKKTVEEHNTAKDCWVTYQNRKIYDVTKFLSEHPGGEESILDYAGKDITEVMK 65

Query: 63  DGPLHSHSFVAYEVLDEEYHVGYLATAEEEQKLLGNSKHKVEVKLE---DEYDSTVFVPE 119
           D  +H HS  AYE+L++EY VGYLAT EE  +LL N  HKVEV+L     E+DST FV +
Sbjct: 66  DSDVHEHSESAYEILEDEYLVGYLATDEEATRLLTNKNHKVEVQLSADGTEFDSTTFVKD 125

Query: 120 VPAEEKLSIVTDYTRDYGRHKFLDLNRPLLMQMLTADFTKEFYLDQVHRPRHYGRGSAPL 179
           +P EEKLSI TDY  DY +HKFLDLN+PLLMQ+L +DFT++FY+DQ+HRPRHYG+GSAPL
Sbjct: 126 LPTEEKLSIATDYGSDYKKHKFLDLNKPLLMQILRSDFTRDFYVDQIHRPRHYGKGSAPL 185

Query: 180 FGNFLEPLSKTSWYVIPIVWLPVVAYHIFTAMQNMNKLFAVFLFFVGIFVWTLIEYGMHR 239
           FGNFLEPL+KT+W+V+P+ W+PVV YH+  A++NMN LFA FLF VG+FVWTLIEY +HR
Sbjct: 186 FGNFLEPLTKTAWWVVPVAWVPVVVYHMGVALKNMNPLFACFLFGVGMFVWTLIEYSLHR 245

Query: 240 FLFHLDFYLPRNQVAYTVHFLLHGVHHYLPMDRYRLVMXXXXXXXXXXXXYKLVFALLPY 299
           FLFH D +LP + +A+  HFLLHG HHYLPMD YRLVM            YKLVFALLP 
Sbjct: 246 FLFHFDDWLPESNIAFATHFLLHGCHHYLPMDGYRLVMPPSLFVILCAPFYKLVFALLPL 305

Query: 300 YWACAGFAGGMLGYVCYDLTHYFLHHAKLPGILKKLKKYHMEHHYKNYELGFGVTSWVWD 359
           YWA AGFAGG+ GYVCYD  HYF+HH+KLP  ++KLKKYH+EHHYKNY+LGFGVTSW WD
Sbjct: 306 YWAYAGFAGGLFGYVCYDECHYFIHHSKLPPFMRKLKKYHLEHHYKNYQLGFGVTSWFWD 365

Query: 360 KVFGTYLAENAPLSQMKFD 378
            VFGTYL  +APLS+MK++
Sbjct: 366 DVFGTYLGPDAPLSKMKYE 384

>NCAS0C00470 Chr3 (78059..79339) [1281 bp, 426 aa] {ON} Anc_8.829
          Length = 426

 Score =  511 bits (1317), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 236/378 (62%), Positives = 297/378 (78%), Gaps = 7/378 (1%)

Query: 3   TKTLPLYSASQVQEHNSADDCWVTLQNRKIYDVTKFLEDHPGGGDLIVEYAGKDITEVMK 62
           +KTL L+S  QV +HN+ +DCWVT+ +RKIYDV+KFL DHP G   I+++AGKDITE++K
Sbjct: 52  SKTLELFSKDQVAKHNTEEDCWVTVYDRKIYDVSKFLLDHPDGDKSILKHAGKDITELLK 111

Query: 63  DGPLHSHSFVAYEVLDEEYHVGYLATAEEEQKLLGNSKHKVEVKLEDE---YDSTVFVPE 119
           D  +   +    ++LD++Y +GY+AT  EE+KLL N  HKVEVKL +    +DST FV +
Sbjct: 112 DEKIDQQT----DLLDDQYLIGYMATDAEEEKLLTNKDHKVEVKLNESTNTFDSTTFVKD 167

Query: 120 VPAEEKLSIVTDYTRDYGRHKFLDLNRPLLMQMLTADFTKEFYLDQVHRPRHYGRGSAPL 179
           +P E+KLSI TDY +D  +H FLDLN+PLL Q+L  +FTK+FYLDQ+HRPRHYG+ SAPL
Sbjct: 168 LPTEDKLSIATDYEKDLKKHNFLDLNKPLLKQILFGNFTKDFYLDQIHRPRHYGQESAPL 227

Query: 180 FGNFLEPLSKTSWYVIPIVWLPVVAYHIFTAMQNMNKLFAVFLFFVGIFVWTLIEYGMHR 239
           FGNFLEP +KT+WY++PI WLPVV YHI  A +N+N LFA+ LF +G++VWT IEY MHR
Sbjct: 228 FGNFLEPFTKTAWYLVPIAWLPVVFYHIALAFKNINALFAIMLFCIGVYVWTFIEYCMHR 287

Query: 240 FLFHLDFYLPRNQVAYTVHFLLHGVHHYLPMDRYRLVMXXXXXXXXXXXXYKLVFALLPY 299
           FLFH D  LP +  AY +HFLLHG HHYLPMD+YRLV+            YKLVFALLPY
Sbjct: 288 FLFHFDERLPEHNFAYMIHFLLHGCHHYLPMDKYRLVVPPVLFIFLCAPFYKLVFALLPY 347

Query: 300 YWACAGFAGGMLGYVCYDLTHYFLHHAKLPGILKKLKKYHMEHHYKNYELGFGVTSWVWD 359
           YWACAGFAGGM GY+CYDL HYFLHH+KLP  ++KLKKYH+EHHYKNY+LG+GVTSW WD
Sbjct: 348 YWACAGFAGGMFGYICYDLCHYFLHHSKLPPFMRKLKKYHLEHHYKNYQLGYGVTSWYWD 407

Query: 360 KVFGTYLAENAPLSQMKF 377
           K FGTYL+ ++PLS+MK+
Sbjct: 408 KKFGTYLSPDSPLSKMKY 425

>AAL183W Chr1 (13713..14846) [1134 bp, 377 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YMR272C (SCS7)
          Length = 377

 Score =  509 bits (1312), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 238/378 (62%), Positives = 295/378 (78%), Gaps = 1/378 (0%)

Query: 1   METKTLPLYSASQVQEHNSADDCWVTLQNRKIYDVTKFLEDHPGGGDLIVEYAGKDITEV 60
           M +KTLPLYS + +Q+H     CWV++ NRKIYDV++FL++HPGG   I++YAGKDIT V
Sbjct: 1   MVSKTLPLYSKATLQKHTDRTSCWVSVGNRKIYDVSQFLDEHPGGDQYILDYAGKDITAV 60

Query: 61  MKDGPLHSHSFVAYEVLDEEYHVGYLATAEEEQKLLGNSKHKVEVKLEDEYDSTVFVPEV 120
           +KD  +H H+  AYE+LDE Y VGYLAT EEE KLL N KH +EV  E+  D+T FV E+
Sbjct: 61  LKDKLIHEHTEAAYEILDESYLVGYLATEEEEIKLLTNEKHVMEVTPEN-LDTTTFVKEL 119

Query: 121 PAEEKLSIVTDYTRDYGRHKFLDLNRPLLMQMLTADFTKEFYLDQVHRPRHYGRGSAPLF 180
           PAEE LS+ TD+  DY +H FLDLN+PLLMQ+L  +FT++FY+DQ+HRPRHYG+GSAPLF
Sbjct: 120 PAEEVLSVATDFGTDYTKHHFLDLNKPLLMQVLRGNFTRDFYIDQIHRPRHYGKGSAPLF 179

Query: 181 GNFLEPLSKTSWYVIPIVWLPVVAYHIFTAMQNMNKLFAVFLFFVGIFVWTLIEYGMHRF 240
           GNFLEPLSKT W+V+P+VW PVV Y++  A+QNM    A+  F  G+FVWTLIEY +HRF
Sbjct: 180 GNFLEPLSKTVWWVVPMVWYPVVLYYLTRALQNMPAHLALTCFAAGVFVWTLIEYSLHRF 239

Query: 241 LFHLDFYLPRNQVAYTVHFLLHGVHHYLPMDRYRLVMXXXXXXXXXXXXYKLVFALLPYY 300
           LFH D  +P + +A+TVHFLLHGVHHYLPMD+YRLVM            Y+LVF++ P Y
Sbjct: 240 LFHFDDNMPESNIAFTVHFLLHGVHHYLPMDKYRLVMPPALFVVLCAPFYRLVFSIFPEY 299

Query: 301 WACAGFAGGMLGYVCYDLTHYFLHHAKLPGILKKLKKYHMEHHYKNYELGFGVTSWVWDK 360
            AC  FAGG+ GYVCYD+THYFLHH KLP  ++KLKKYH+EHHYKNYELGFGVTSW WDK
Sbjct: 300 CACGCFAGGLFGYVCYDVTHYFLHHHKLPPFMRKLKKYHLEHHYKNYELGFGVTSWYWDK 359

Query: 361 VFGTYLAENAPLSQMKFD 378
           VFGTYLA N+P+S+ K +
Sbjct: 360 VFGTYLASNSPVSRPKCE 377

>NDAI0K00470 Chr11 (107509..108669) [1161 bp, 386 aa] {ON} Anc_8.829
          Length = 386

 Score =  488 bits (1255), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 231/382 (60%), Positives = 295/382 (77%), Gaps = 7/382 (1%)

Query: 3   TKTLPLYSASQVQEHNSADDCWVTLQNRKIYDVTKFLEDHPGGG--DLIVEYAGKDITEV 60
           +KTL L+S  +V  HN++DDCW+T Q+RKIYDVTKFL D+P     DL++E+AGKDIT+ 
Sbjct: 6   SKTLELFSKDKVAAHNTSDDCWITFQDRKIYDVTKFLNDNPNDANKDLLLEFAGKDITDE 65

Query: 61  MKDGPLHSHSFVAYEVLD-EEYHVGYLATAEEEQKLLGNSKHKVEVKLEDE---YDSTVF 116
           +KD  + S    ++ +L  ++Y +GYLAT  EE+ LL N  HKVEV+L +    +DST F
Sbjct: 66  LKDK-IDSIKNPSFPILQTDQYLIGYLATDHEEKTLLTNKDHKVEVQLNEATNGFDSTTF 124

Query: 117 VPEVPAEEKLSIVTDYTRDYGRHKFLDLNRPLLMQMLTADFTKEFYLDQVHRPRHYGRGS 176
           V ++P E+KLSI TD  +D  +HKFLDL++PLL Q+L  +FTK+FYLDQ+HRPRHYG  S
Sbjct: 125 VKDLPTEDKLSIATDTKKDLEKHKFLDLDKPLLKQILFGNFTKDFYLDQIHRPRHYGDKS 184

Query: 177 APLFGNFLEPLSKTSWYVIPIVWLPVVAYHIFTAMQNMNKLFAVFLFFVGIFVWTLIEYG 236
           APLFGN LEPL+KTSWY++PI WLPVV YHI  A+ NMN +FA+ LF +GI+VWTLIEY 
Sbjct: 185 APLFGNILEPLTKTSWYLVPIFWLPVVFYHIAVALTNMNPIFAIVLFAIGIYVWTLIEYC 244

Query: 237 MHRFLFHLDFYLPRNQVAYTVHFLLHGVHHYLPMDRYRLVMXXXXXXXXXXXXYKLVFAL 296
           MHRFLFH D  LP + + Y +HFLLHG HHYLPMD+YRLV+            YK+VF L
Sbjct: 245 MHRFLFHFDERLPEHNIFYVIHFLLHGCHHYLPMDKYRLVVPPTLFIFLCFPFYKVVFKL 304

Query: 297 LPYYWACAGFAGGMLGYVCYDLTHYFLHHAKLPGILKKLKKYHMEHHYKNYELGFGVTSW 356
           LP YWA AGFAGG+ GYVCYDL HYFLHH+K+P  L+KLKKYH+EHHYKNY+LG+GVTSW
Sbjct: 305 LPLYWAYAGFAGGLFGYVCYDLCHYFLHHSKMPPPLRKLKKYHLEHHYKNYQLGYGVTSW 364

Query: 357 VWDKVFGTYLAENAPLSQMKFD 378
            WDK+FGTYL+ ++P+S+MK++
Sbjct: 365 YWDKIFGTYLSPDSPMSKMKYE 386

>CAGL0F03399g Chr6 complement(333955..335097) [1143 bp, 380 aa] {ON}
           highly similar to uniprot|Q03529 Saccharomyces
           cerevisiae YMR272c SCS7 required for hydroxylation of
           ceramide
          Length = 380

 Score =  484 bits (1247), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 231/383 (60%), Positives = 289/383 (75%), Gaps = 15/383 (3%)

Query: 2   ETKTLPLYSASQVQEHNSADDCWVTLQNRKIYDVTKFLEDHPGGGDLIVEYA----GKDI 57
            +KTL L+  S + +HNS DDCWV+   RKIYDV+K+L+DHP   D + +      G DI
Sbjct: 7   SSKTLELFPQSVLAKHNSKDDCWVSTHERKIYDVSKYLKDHPEEADAVHKALDGKHGTDI 66

Query: 58  TEVMKDGPLHSHSFVAYEVLDEEYHVGYLATAEEEQKLLGNSKHKVEVKL--EDEYDSTV 115
           +++              + + ++Y VGYLAT++EE+KLL N  HKVEVKL  ++ +DST 
Sbjct: 67  SQM---------ELTTLKFVTDDYLVGYLATSDEEKKLLTNKSHKVEVKLNADNTFDSTT 117

Query: 116 FVPEVPAEEKLSIVTDYTRDYGRHKFLDLNRPLLMQMLTADFTKEFYLDQVHRPRHYGRG 175
           FV ++P E+KLSI TDY RDY +HKFLDLN+PLL Q+L  +FTK+FYLDQ+HRPRHYG+G
Sbjct: 118 FVKDLPTEDKLSITTDYERDYKKHKFLDLNKPLLKQILFGNFTKDFYLDQIHRPRHYGKG 177

Query: 176 SAPLFGNFLEPLSKTSWYVIPIVWLPVVAYHIFTAMQNMNKLFAVFLFFVGIFVWTLIEY 235
           SAPLFGNFLE  +KT+W+V+P VW PVV Y I TA+ NMN   A+FLF +GIFVWTLIEY
Sbjct: 178 SAPLFGNFLEAFTKTAWWVVPTVWGPVVLYFITTALMNMNNPLALFLFGLGIFVWTLIEY 237

Query: 236 GMHRFLFHLDFYLPRNQVAYTVHFLLHGVHHYLPMDRYRLVMXXXXXXXXXXXXYKLVFA 295
            +HRFLFH D +LP + + + +HFLLHG HHYLPMD YRLV+            YKLVFA
Sbjct: 238 CLHRFLFHFDEWLPEHSMFFMIHFLLHGCHHYLPMDAYRLVVPPALFVVLCAPIYKLVFA 297

Query: 296 LLPYYWACAGFAGGMLGYVCYDLTHYFLHHAKLPGILKKLKKYHMEHHYKNYELGFGVTS 355
            LPYYWACAGFAGGMLGY+CYDL HYFLHH+K+P  ++KLKKYH+EHHYKNY+LGFGVTS
Sbjct: 298 ALPYYWACAGFAGGMLGYICYDLCHYFLHHSKMPPFMRKLKKYHLEHHYKNYQLGFGVTS 357

Query: 356 WVWDKVFGTYLAENAPLSQMKFD 378
           W WDKVFGTYL  +APLS+MK++
Sbjct: 358 WFWDKVFGTYLGPDAPLSKMKYE 380

>Ecym_2712 Chr2 (1378070..1379215) [1146 bp, 381 aa] {ON} similar to
           Ashbya gossypii AAL183W
          Length = 381

 Score =  483 bits (1242), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 228/379 (60%), Positives = 295/379 (77%), Gaps = 3/379 (0%)

Query: 2   ETKTLPLYSASQVQEHNSADDCWVTLQNRKIYDVTKFLEDHPGGGDLIVEYAGKDITEVM 61
             KTLPLYS S+ ++H   + CWV++  RKIY+V+KFL+++P G   ++++AG+D+T+++
Sbjct: 4   SCKTLPLYSKSEFEKHVKPNQCWVSIDQRKIYNVSKFLDENPEGYQYVLDHAGQDVTQLL 63

Query: 62  KDGPLHSHSFVAYEVLDEEYHVGYLATAEEEQKLLGNSKHKVEVKLED--EYDSTVFVPE 119
           KD      + +A+++L + Y +GYLAT+EEE+KLL N+ H VEVK  +    DS  FV +
Sbjct: 64  KDMQTDEPTDLAHQLLSDAYLIGYLATSEEERKLLTNANHVVEVKPANGNRVDSG-FVKK 122

Query: 120 VPAEEKLSIVTDYTRDYGRHKFLDLNRPLLMQMLTADFTKEFYLDQVHRPRHYGRGSAPL 179
           +P EEKL+I TD+  DY +H FLDL++PL MQ+L  +FTKEFY+DQVHRPRHYG+ SAPL
Sbjct: 123 LPTEEKLAIATDFKTDYEKHHFLDLDKPLFMQVLFGNFTKEFYIDQVHRPRHYGKESAPL 182

Query: 180 FGNFLEPLSKTSWYVIPIVWLPVVAYHIFTAMQNMNKLFAVFLFFVGIFVWTLIEYGMHR 239
           FGNFLEPLSKTSW+VIPIVW P V Y+I TA+ N++   A+FLF VG+FVWTLIEYG+HR
Sbjct: 183 FGNFLEPLSKTSWWVIPIVWYPCVIYYIRTALLNISTPLALFLFGVGVFVWTLIEYGLHR 242

Query: 240 FLFHLDFYLPRNQVAYTVHFLLHGVHHYLPMDRYRLVMXXXXXXXXXXXXYKLVFALLPY 299
           FLFH D  +P + + +T+HFLLHG+HHYLPMD+YRLVM            YKLVF++LPY
Sbjct: 243 FLFHFDDRMPESNIVFTLHFLLHGIHHYLPMDKYRLVMPPALFLALCYPFYKLVFSILPY 302

Query: 300 YWACAGFAGGMLGYVCYDLTHYFLHHAKLPGILKKLKKYHMEHHYKNYELGFGVTSWVWD 359
           Y ACAGFAGG+ GYV YD+THYFLHH KLP  ++KLKKYH+EHHYKNYELGFGVTSW WD
Sbjct: 303 YCACAGFAGGLFGYVGYDVTHYFLHHRKLPPFMRKLKKYHLEHHYKNYELGFGVTSWYWD 362

Query: 360 KVFGTYLAENAPLSQMKFD 378
           KVF TYL+  APLS+ K+D
Sbjct: 363 KVFNTYLSPTAPLSRAKYD 381

>Kpol_541.9 s541 complement(23399..24523) [1125 bp, 374 aa] {ON}
           complement(23399..24523) [1125 nt, 375 aa]
          Length = 374

 Score =  474 bits (1220), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 222/377 (58%), Positives = 292/377 (77%), Gaps = 9/377 (2%)

Query: 2   ETKTLPLYSASQVQEHNSADDCWVTLQNRKIYDVTKFLEDHPGGGDLIVEYAGKDITEVM 61
           ++KTL L++ S+ +EHN+  DCWV+++ R IYDV+ +L+D+      I+E+AGKDIT++ 
Sbjct: 5   DSKTLELFAKSRFEEHNTEADCWVSVKERLIYDVSSYLKDNADADSSILEHAGKDITKLT 64

Query: 62  KDGPLHSHSFVAYEVLDEEYHVGYLATAEEEQKLLGNSKHKVEVKLED-EYDSTVFVPEV 120
           K           ++ + +EY VGYLAT EEE +LL N  HKVEV L+D  YDSTVFV E+
Sbjct: 65  KTR--------EFKFISDEYLVGYLATEEEEVRLLTNKDHKVEVNLQDGTYDSTVFVKEL 116

Query: 121 PAEEKLSIVTDYTRDYGRHKFLDLNRPLLMQMLTADFTKEFYLDQVHRPRHYGRGSAPLF 180
           PAEEK ++ TD  +D+  H FLDLN+P+L Q+L  +FT++FY+DQVHRPRHYG+GSAPLF
Sbjct: 117 PAEEKFTVATDLGKDFQDHHFLDLNKPMLWQVLFGNFTRDFYIDQVHRPRHYGKGSAPLF 176

Query: 181 GNFLEPLSKTSWYVIPIVWLPVVAYHIFTAMQNMNKLFAVFLFFVGIFVWTLIEYGMHRF 240
           GNFLEP+S T W++IPI+W PVV YH+  A+ NMN +FA FLF +GIFVWTLIEY +HRF
Sbjct: 177 GNFLEPISLTPWWLIPIIWGPVVVYHLSVALNNMNNIFAGFLFCLGIFVWTLIEYCLHRF 236

Query: 241 LFHLDFYLPRNQVAYTVHFLLHGVHHYLPMDRYRLVMXXXXXXXXXXXXYKLVFALLPYY 300
           LFHLD ++P++ + YT+HFLLHGVHHYLPMD+YRLV+            YKLVF LLP Y
Sbjct: 237 LFHLDDWVPQHNIFYTLHFLLHGVHHYLPMDQYRLVVPPALFLVLCTPIYKLVFGLLPLY 296

Query: 301 WACAGFAGGMLGYVCYDLTHYFLHHAKLPGILKKLKKYHMEHHYKNYELGFGVTSWVWDK 360
           WA AGFAGG+LGY+CYDLTHYF+HH KLP  ++K+KK+H+EHHYKNY+LGFGV+++ WDK
Sbjct: 297 WAYAGFAGGLLGYICYDLTHYFIHHVKLPKFMRKVKKHHLEHHYKNYQLGFGVSNYFWDK 356

Query: 361 VFGTYLAENAPLSQMKF 377
           VFGTYL  ++P S M++
Sbjct: 357 VFGTYLGPDSPASIMRY 373

>KAFR0B03850 Chr2 complement(796399..797532) [1134 bp, 377 aa] {ON}
           Anc_8.829 YMR272C
          Length = 377

 Score =  473 bits (1218), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 226/378 (59%), Positives = 285/378 (75%), Gaps = 6/378 (1%)

Query: 3   TKTLPLYSASQVQEHNSADDCWVTLQNRKIYDVTKFLEDHPGGGDLIVEYAGKDITEVMK 62
            KTL L+S  +V  H   +DCWVT+ +RKIYDVTKFL+++     L+++YAG DIT+ + 
Sbjct: 4   AKTLELFSKKEVANHTKREDCWVTIFSRKIYDVTKFLDENRDFDSLLLDYAGTDITDELV 63

Query: 63  DGPLHSHSFVAYEVLDEE-YHVGYLATAEEEQKLLGNSKHKVEVKLEDEYDSTVFVPEVP 121
           +G L       Y+ LD + Y VGY+ATA+EEQKLL N  HKVEV LE ++D    V E+P
Sbjct: 64  NGKLDE----KYKALDNDNYLVGYVATADEEQKLLTNKDHKVEVTLEQDFDLATLVVELP 119

Query: 122 AEEKLSIVTDYTRDYGRHKFLDLNRPLLMQMLTADFTKEFYLDQVHRPRHYGRGSAPLFG 181
            EEKL+I T+Y RD+ +HKFLDLN+PLL Q+L   FT+EFY+DQ++RPRHYG+ SAPLFG
Sbjct: 120 PEEKLTIATNYDRDFKKHKFLDLNKPLLPQILKGKFTREFYVDQINRPRHYGQKSAPLFG 179

Query: 182 N-FLEPLSKTSWYVIPIVWLPVVAYHIFTAMQNMNKLFAVFLFFVGIFVWTLIEYGMHRF 240
           N FLEP SKT+W+V+P  WLPVV +    A++NMN   A+FLF VG+FVWTL+EY +HRF
Sbjct: 180 NAFLEPFSKTAWWVVPTFWLPVVFHFFRVALKNMNNPLALFLFCVGVFVWTLLEYCLHRF 239

Query: 241 LFHLDFYLPRNQVAYTVHFLLHGVHHYLPMDRYRLVMXXXXXXXXXXXXYKLVFALLPYY 300
           LFH D YLP N +A+ +HFLLHG HHYLPMD YRLV+            YK VF LLPYY
Sbjct: 240 LFHFDNYLPENNIAFALHFLLHGFHHYLPMDPYRLVVPPALFIILCAPIYKTVFLLLPYY 299

Query: 301 WACAGFAGGMLGYVCYDLTHYFLHHAKLPGILKKLKKYHMEHHYKNYELGFGVTSWVWDK 360
           WACAGFAGG+ GYV YD+ HY LHH+KLP  +++LK+YH+EHHYKNYELG+G+TSW WDK
Sbjct: 300 WACAGFAGGLFGYVYYDMCHYALHHSKLPPFMRRLKQYHLEHHYKNYELGYGITSWFWDK 359

Query: 361 VFGTYLAENAPLSQMKFD 378
           VFGTYL+++AP S MKFD
Sbjct: 360 VFGTYLSKDAPASVMKFD 377

>KNAG0J00320 Chr10 (50267..51388) [1122 bp, 373 aa] {ON} Anc_8.829
           YMR272C
          Length = 373

 Score =  457 bits (1175), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 217/379 (57%), Positives = 281/379 (74%), Gaps = 11/379 (2%)

Query: 2   ETKTLPLYSASQVQEHNSADDCWVTLQNRKIYDVTKFLEDHPGGGDLIVEYAGKDITEVM 61
            ++TL L S   V  HN  +D WV +Q RK+ D++ ++ + P   +L++  AGKDIT+  
Sbjct: 4   NSRTLELVSKDTVASHNQKNDAWVVVQGRKVVDISAYIRERPEKEELLLSLAGKDITD-- 61

Query: 62  KDGPLHSHSFVAYEVLDEEYHVGYLATAEEEQKLLGNSKHKVEVKLE--DEYDSTVFVPE 119
                 SH F       +++ VGYLAT  EE++LL N  HKVEVKLE  + +DS+ FV +
Sbjct: 62  -----RSHEFPGLNA--DDHLVGYLATDLEEKELLSNKDHKVEVKLEGGETFDSSTFVKD 114

Query: 120 VPAEEKLSIVTDYTRDYGRHKFLDLNRPLLMQMLTADFTKEFYLDQVHRPRHYGRGSAPL 179
           +P E+KLSI TD  RDY +H FLDL +PL+ Q+L   FTK+FY+DQ+HRPRHYG+GSAPL
Sbjct: 115 LPTEDKLSIATDTKRDYQKHHFLDLEKPLIPQVLFGSFTKDFYVDQIHRPRHYGKGSAPL 174

Query: 180 FGNFLEPLSKTSWYVIPIVWLPVVAYHIFTAMQNMNKLFAVFLFFVGIFVWTLIEYGMHR 239
           FGNFLEP+SKT+WYV+PIVW PVV Y +  +++ ++ +FA+ LF +G FVWTLIEY MHR
Sbjct: 175 FGNFLEPISKTAWYVVPIVWGPVVLYFLGRSLKGIHPIFALMLFALGGFVWTLIEYCMHR 234

Query: 240 FLFHLDFYLPRNQVAYTVHFLLHGVHHYLPMDRYRLVMXXXXXXXXXXXXYKLVFALLPY 299
           FLFH D +LP N VA+T+HFLLHGVHHYLPMD YRLV+            YKLVF LLP+
Sbjct: 235 FLFHFDDWLPENNVAFTIHFLLHGVHHYLPMDGYRLVVPPALFVVLCTPFYKLVFKLLPH 294

Query: 300 YWACAGFAGGMLGYVCYDLTHYFLHHAKLPGILKKLKKYHMEHHYKNYELGFGVTSWVWD 359
           Y ACAGFAGGM GY+CYDL HYFLHH+K+P  ++KLK+YH+EHHYKNY+LGFGV++W WD
Sbjct: 295 YVACAGFAGGMFGYICYDLIHYFLHHSKMPKFMRKLKQYHLEHHYKNYQLGFGVSNWFWD 354

Query: 360 KVFGTYLAENAPLSQMKFD 378
           KVF TYL ++AP+S MK+D
Sbjct: 355 KVFDTYLGKDAPISPMKYD 373

>TBLA0D03180 Chr4 complement(774883..776085) [1203 bp, 400 aa] {ON}
           Anc_8.829 YMR272C
          Length = 400

 Score =  456 bits (1173), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 213/379 (56%), Positives = 277/379 (73%), Gaps = 5/379 (1%)

Query: 5   TLPLYSASQVQEHNSADDCWVTLQNRKIYDVTKFLEDHPGGGDLIVEYAGKDITEVMKDG 64
           T  L+S   VQ+HN+  DCWV  QNRKIYDV+++L D+P G   I+++AGKDIT   K+ 
Sbjct: 22  TKELFSLESVQKHNTKKDCWVIYQNRKIYDVSQYLADYPKGNSKIIDFAGKDITSSFKNQ 81

Query: 65  PLHSHSFVAYEVL--DEEYHVGYLATAEEEQKLLGNSKHKVEVKLEDE---YDSTVFVPE 119
             ++H    Y+ +  +++Y VGYLA  EE  KLL N  HKVEVKL ++   YDST FV E
Sbjct: 82  ERYNHDPETYDFMSHNDKYLVGYLANEEEAYKLLSNPSHKVEVKLTEQPSTYDSTTFVKE 141

Query: 120 VPAEEKLSIVTDYTRDYGRHKFLDLNRPLLMQMLTADFTKEFYLDQVHRPRHYGRGSAPL 179
           +P+E+   I TDY +D+  H FLDL +PL+ Q+  A F + FY+DQ+HRPRH+G  SAPL
Sbjct: 142 LPSEDHFVIATDYKKDFNEHHFLDLEKPLIPQLWRAKFNRAFYIDQIHRPRHFGNKSAPL 201

Query: 180 FGNFLEPLSKTSWYVIPIVWLPVVAYHIFTAMQNMNKLFAVFLFFVGIFVWTLIEYGMHR 239
           FGNFLEPL+KT+W+VIP+VWLPVV YH+  A  NMN +FA FLF VG+FVWTLIEY +HR
Sbjct: 202 FGNFLEPLTKTAWWVIPVVWLPVVFYHLKVAFHNMNNIFATFLFCVGVFVWTLIEYSLHR 261

Query: 240 FLFHLDFYLPRNQVAYTVHFLLHGVHHYLPMDRYRLVMXXXXXXXXXXXXYKLVFALLPY 299
           FLFH+D  +P + + Y +HF +HG HHYLPMD YRLVM            YKLVF++LP 
Sbjct: 262 FLFHMDNRIPDHPMFYVLHFTIHGCHHYLPMDPYRLVMPPTLFLILCTPFYKLVFSVLPL 321

Query: 300 YWACAGFAGGMLGYVCYDLTHYFLHHAKLPGILKKLKKYHMEHHYKNYELGFGVTSWVWD 359
           YWA AGFAGG+ GYVCYD  HY+LHH+++P  ++ LKK H+EHHYKNY+L FGV+++ WD
Sbjct: 322 YWAYAGFAGGLFGYVCYDEVHYWLHHSRVPKFMRLLKKLHLEHHYKNYQLAFGVSNYFWD 381

Query: 360 KVFGTYLAENAPLSQMKFD 378
           KVFGTYL  ++PLS MK++
Sbjct: 382 KVFGTYLYPDSPLSPMKYE 400

>TPHA0C04710 Chr3 complement(1015392..1016525) [1134 bp, 377 aa]
           {ON} Anc_8.829 YMR272C
          Length = 377

 Score =  446 bits (1147), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 211/377 (55%), Positives = 286/377 (75%), Gaps = 11/377 (2%)

Query: 3   TKTLPLYSASQVQEHNSADDCWVTLQNRKIYDVTKFLEDHPGGG--DLIVEYAGKDITEV 60
           +KTL L+S+ + Q HN+ DDCWV++++R IYDV+KF++++      D +++ AGKDI+++
Sbjct: 7   SKTLELFSSEKFQSHNTEDDCWVSVKDRLIYDVSKFVQENKDVPVEDAVLKRAGKDISDL 66

Query: 61  MKDGPLHSHSFVAYEVLDEEYHVGYLATAEEEQKLLGNSKHKVEVKLED-EYDSTVFVPE 119
           ++          +++ +D++Y VGYLA + EE +LL N  HKVEV L+D  YDSTVFV E
Sbjct: 67  LETK--------SFKFVDDKYLVGYLANSTEEARLLTNKDHKVEVNLKDGTYDSTVFVKE 118

Query: 120 VPAEEKLSIVTDYTRDYGRHKFLDLNRPLLMQMLTADFTKEFYLDQVHRPRHYGRGSAPL 179
           +P+EE  +I TDY +D+  H FLDL +PLLMQMLT +FT+EFY+DQ+HRPRHYG+GSA L
Sbjct: 119 LPSEEHFTISTDYKKDFVDHHFLDLEKPLLMQMLTGNFTREFYIDQIHRPRHYGKGSAKL 178

Query: 180 FGNFLEPLSKTSWYVIPIVWLPVVAYHIFTAMQNMNKLFAVFLFFVGIFVWTLIEYGMHR 239
           FGN+LEP+S T W++IPI+W PVV YH +   Q+M+ L AVF +F+GIFVWT IEY +HR
Sbjct: 179 FGNWLEPISLTPWWLIPIIWGPVVVYHFYVGAQHMHPLSAVFFYFLGIFVWTFIEYCLHR 238

Query: 240 FLFHLDFYLPRNQVAYTVHFLLHGVHHYLPMDRYRLVMXXXXXXXXXXXXYKLVFALLPY 299
           FLFHLD ++P++   YT+HFLLHGVHHYLPMD+YRLV+            YK VFALLP 
Sbjct: 239 FLFHLDDWVPQHNFFYTIHFLLHGVHHYLPMDQYRLVVPPALFVVLCTPFYKAVFALLPL 298

Query: 300 YWACAGFAGGMLGYVCYDLTHYFLHHAKLPGILKKLKKYHMEHHYKNYELGFGVTSWVWD 359
           Y A  GFAGG+ GY+ YDLTHYF+HH KLP + +K+KK+H+EHHYKNY+LGFGV+++ WD
Sbjct: 299 YVAYVGFAGGLTGYIIYDLTHYFIHHVKLPRVFRKIKKHHLEHHYKNYQLGFGVSNYFWD 358

Query: 360 KVFGTYLAENAPLSQMK 376
            VFGTYL  ++P S M+
Sbjct: 359 LVFGTYLGPDSPASIMR 375

>Kpol_1069.4 s1069 (6163..6996) [834 bp, 277 aa] {ON} (6163..6996)
           [834 nt, 278 aa]
          Length = 277

 Score =  323 bits (829), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 145/274 (52%), Positives = 205/274 (74%), Gaps = 2/274 (0%)

Query: 105 VKLEDEYDSTVFVPEVP-AEEKLSIVTDYTRDYGRHKFLDLNRPLLMQMLTADFTKEFYL 163
           +K+E+  ++ + + +    EEKL + TDY +D+  + FL L+ PL  Q+L+++FT++FY+
Sbjct: 1   MKIEESIETYIHIRKTTLTEEKLKVTTDYNKDFNENGFLKLDEPLFWQLLSSNFTRDFYI 60

Query: 164 DQVHRPRHYGRGSAPLFGNFLEPLSKTSWYVIPIVWLPVVAYHIFTAMQNMNKLFAVFLF 223
           DQVH+PRHYG  SAP+FGNFLEP +KT W+++P++W PVV Y+   +++ ++ + A+ LF
Sbjct: 61  DQVHKPRHYGIESAPIFGNFLEPFTKTHWFMVPLIWGPVVLYNFIVSLREISIILAITLF 120

Query: 224 FVGIFVWTLIEYGMHRFLFHLDFYLPRNQVAYTVHFLLHGVHHYLPMDRYRLVMXXXXXX 283
            +G+FVWTLIEY MHR+LFHLD  +P  ++ + +HFLLHG+HHYLPMD+YRLVM      
Sbjct: 121 SIGVFVWTLIEYCMHRYLFHLDDSVPETRLFFVLHFLLHGIHHYLPMDKYRLVMPPALFS 180

Query: 284 XXXXXXYKLVFALLPYYWACAGFAGGMLGYVCYDLTHYFLHHAKLPGILKKLKKYHMEHH 343
                 Y L FA+ P YWA AGFAGG+ GYVCYD+THYFLHH K+P  ++K+KKYH+EHH
Sbjct: 181 ILCYPFYLLTFAIFPRYWAHAGFAGGLFGYVCYDVTHYFLHHKKMPSFMRKVKKYHLEHH 240

Query: 344 YKNYELGFGVTSWVWDKVFGTYL-AENAPLSQMK 376
           YKN++LGFGVTS  WD+VFGTYL  +  P ++ K
Sbjct: 241 YKNFQLGFGVTSSFWDRVFGTYLDPKTIPYARSK 274

>NCAS0G02570 Chr7 complement(460218..460583) [366 bp, 121 aa] {ON}
          Anc_2.536 YMR073C
          Length = 121

 Score = 66.2 bits (160), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 28/56 (50%), Positives = 40/56 (71%), Gaps = 1/56 (1%)

Query: 8  LYSASQVQEHNSADDCWVTLQNRKIYDVTKFLEDHPGGGDLIVEYAGKDITEVMKD 63
          +YS  Q+ EHN  DD W+ ++  K+YDV+KFL++HPGG ++I E AG+D TE   D
Sbjct: 4  VYSYQQIAEHNKPDDAWIIIEG-KVYDVSKFLDEHPGGDEIIFELAGQDATEHFLD 58

>Kpol_505.14 s505 (37085..37456) [372 bp, 123 aa] {ON}
          (37085..37456) [372 nt, 124 aa]
          Length = 123

 Score = 66.2 bits (160), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 29/74 (39%), Positives = 49/74 (66%), Gaps = 4/74 (5%)

Query: 8  LYSASQVQEHNSADDCWVTLQNRKIYDVTKFLEDHPGGGDLIVEYAGKDITEVMKDGPLH 67
          +Y+  ++ EHN+ + CW+ +   K+YD TKFL++HPGG ++I++ AG+D TE  +D    
Sbjct: 4  VYTYQEIAEHNTTESCWIVIDG-KVYDTTKFLDEHPGGDEIILDLAGQDATESFED---I 59

Query: 68 SHSFVAYEVLDEEY 81
           HS  A ++L + Y
Sbjct: 60 GHSDEALKILKKLY 73

>NDAI0F02730 Chr6 (669821..670186) [366 bp, 121 aa] {ON} Anc_2.166
          Length = 121

 Score = 65.5 bits (158), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 31/74 (41%), Positives = 49/74 (66%), Gaps = 4/74 (5%)

Query: 8  LYSASQVQEHNSADDCWVTLQNRKIYDVTKFLEDHPGGGDLIVEYAGKDITEVMKDGPLH 67
          +Y+  ++ +HNS DD W+ ++  K+YDV+KFL++HPGG ++I E AG D TE  +D    
Sbjct: 4  IYTYEEIAKHNSPDDTWIVIEG-KVYDVSKFLDEHPGGEEIIFELAGTDATENFED---I 59

Query: 68 SHSFVAYEVLDEEY 81
           HS  A ++L + Y
Sbjct: 60 GHSDDALKILKKMY 73

>TDEL0F01210 Chr6 complement(216322..216702) [381 bp, 126 aa] {ON}
          Anc_2.166 YNL111C
          Length = 126

 Score = 65.5 bits (158), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 31/71 (43%), Positives = 51/71 (71%), Gaps = 4/71 (5%)

Query: 8  LYSASQVQEHNSADDCWVTLQNRKIYDVTKFLEDHPGGGDLIVEYAGKDITEVMKDGPLH 67
          +YS  Q+ EHNSA+D W+ + + K+YDVTKF+++HPGG ++I++ AG+D +E  +D    
Sbjct: 4  VYSYQQIAEHNSAEDIWIVV-DGKVYDVTKFMDEHPGGDEIILDLAGQDASEPFRD---I 59

Query: 68 SHSFVAYEVLD 78
           HS  A ++L+
Sbjct: 60 GHSEEALKILN 70

>ZYRO0B09812g Chr2 (765874..766425) [552 bp, 183 aa] {ON} similar to
           uniprot|P40312 Saccharomyces cerevisiae YNL111C CYB5
           Cytochrome b5 involved in the sterol and lipid
           biosynthesis pathways required for sterol C5-6 and fatty
           acid desaturation
          Length = 183

 Score = 66.6 bits (161), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 37/87 (42%), Positives = 55/87 (63%), Gaps = 5/87 (5%)

Query: 8   LYSASQVQEHNSADDCWVTLQNRKIYDVTKFLEDHPGGGDLIVEYAGKDITEVMKDGPLH 67
           +Y+  QV EHN+ +D W+ + + K+YDVTKF+EDHPGG ++I++ AG+D TE   D    
Sbjct: 60  VYTFEQVAEHNTPEDAWLIV-DGKVYDVTKFVEDHPGGDEIILDLAGQDGTEAFND---I 115

Query: 68  SHSFVAYEVLDEEYHVGYLATAEEEQK 94
            HS  A  +L +++ VG L  A    K
Sbjct: 116 GHSEDAVNML-KDFIVGSLDPASRPAK 141

>TBLA0B01310 Chr2 (276173..276544) [372 bp, 123 aa] {ON} Anc_2.166
          YNL111C
          Length = 123

 Score = 64.7 bits (156), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 31/71 (43%), Positives = 47/71 (66%), Gaps = 4/71 (5%)

Query: 8  LYSASQVQEHNSADDCWVTLQNRKIYDVTKFLEDHPGGGDLIVEYAGKDITEVMKDGPLH 67
          LYS  ++  HN+ +  W+ +++ K+YDVTKFL+ HPGG ++I+E AG+D T+  +D    
Sbjct: 4  LYSYEEIAAHNTTESAWIIIKD-KVYDVTKFLDSHPGGDEIILELAGQDATQDFED---I 59

Query: 68 SHSFVAYEVLD 78
           HS  A E LD
Sbjct: 60 GHSNDALEFLD 70

>AFL223W Chr6 (19601..20098) [498 bp, 165 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YNL111C (CYB5)
          Length = 165

 Score = 62.8 bits (151), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 42/62 (67%), Gaps = 1/62 (1%)

Query: 2  ETKTLPLYSASQVQEHNSADDCWVTLQNRKIYDVTKFLEDHPGGGDLIVEYAGKDITEVM 61
          ET    LY+  ++ EHNS +D W+ + N K+YD TKF E+HPGG +++++ AG+D TE  
Sbjct: 37 ETTMPKLYTYQEIAEHNSENDLWLII-NGKVYDCTKFAEEHPGGDEVLIDLAGQDATEPF 95

Query: 62 KD 63
           D
Sbjct: 96 AD 97

>CAGL0L03828g Chr12 (442660..443025) [366 bp, 121 aa] {ON} similar
          to uniprot|P40312 Saccharomyces cerevisiae YNL111c CYB5
          Length = 121

 Score = 60.8 bits (146), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 24/51 (47%), Positives = 35/51 (68%), Gaps = 1/51 (1%)

Query: 8  LYSASQVQEHNSADDCWVTLQNRKIYDVTKFLEDHPGGGDLIVEYAGKDIT 58
          +Y+  QV EHN   DCW+ +    +YDV+KFL++HPGG ++I E+ G D T
Sbjct: 4  VYTYKQVSEHNKEGDCWIIIDG-SVYDVSKFLDEHPGGDEIIFEHRGTDAT 53

>Skud_14.221 Chr14 complement(407119..407481) [363 bp, 120 aa]
          {ON} YNL111C (REAL)
          Length = 120

 Score = 60.8 bits (146), Expect = 8e-11,   Method: Composition-based stats.
 Identities = 28/74 (37%), Positives = 47/74 (63%), Gaps = 4/74 (5%)

Query: 8  LYSASQVQEHNSADDCWVTLQNRKIYDVTKFLEDHPGGGDLIVEYAGKDITEVMKDGPLH 67
          +YS  +V EHN  ++CW+ + + K+YDV++F ++HPGG ++I++  G+D TE   D    
Sbjct: 4  VYSYQEVAEHNGPENCWIIIDD-KVYDVSQFKDEHPGGDEIIMDLGGQDATESFVD---I 59

Query: 68 SHSFVAYEVLDEEY 81
           HS  A  +L + Y
Sbjct: 60 GHSDEALRLLKDLY 73

>Suva_13.105 Chr13 complement(168279..170054) [1776 bp, 591 aa] {ON}
           YML054C (REAL)
          Length = 591

 Score = 65.1 bits (157), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 46/63 (73%), Gaps = 3/63 (4%)

Query: 10  SASQVQEHNSADDCWVTLQNRKIYDVTKFLEDHPGGGDLIVEYAGKDITEVMKDGPLHSH 69
           S ++V +HNSADDCWV + N  +YD+T+F+ +HPGG D+I   AG+D+T + +  PLH+ 
Sbjct: 92  SPAEVAKHNSADDCWVVI-NGYVYDLTRFVPNHPGGPDVIKYNAGRDVTAIFE--PLHAP 148

Query: 70  SFV 72
           + +
Sbjct: 149 NVI 151

>KNAG0I02040 Chr9 (397527..397886) [360 bp, 119 aa] {ON} Anc_2.166
          YNL111C
          Length = 119

 Score = 60.1 bits (144), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 28/74 (37%), Positives = 47/74 (63%), Gaps = 4/74 (5%)

Query: 8  LYSASQVQEHNSADDCWVTLQNRKIYDVTKFLEDHPGGGDLIVEYAGKDITEVMKDGPLH 67
          +Y+   V +H++++D W+ + NR +Y+VTKFL++HPGG ++++E AG D T    D    
Sbjct: 4  IYTYEDVAQHSTSEDAWIVIDNR-VYEVTKFLDEHPGGEEILLEMAGADATTNFLD---I 59

Query: 68 SHSFVAYEVLDEEY 81
           HS  A ++L   Y
Sbjct: 60 GHSDDAMKILKTRY 73

>Kpol_1014.5 s1014 complement(3107..4897) [1791 bp, 596 aa] {ON}
           complement(3107..4897) [1791 nt, 597 aa]
          Length = 596

 Score = 63.5 bits (153), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 30/67 (44%), Positives = 45/67 (67%), Gaps = 3/67 (4%)

Query: 1   METKTLPLYSASQVQEHNSADDCWVTLQNRKIYDVTKFLEDHPGGGDLIVEYAGKDITEV 60
           +  K+L + +  +V +HNS DDCWV + N  +YD+T F++ HPGG D+IV  AGKD++ +
Sbjct: 83  LSKKSLKIITPQEVIKHNSKDDCWVVI-NDIVYDLTFFIKKHPGGQDVIVGNAGKDVSNI 141

Query: 61  MKDGPLH 67
               PLH
Sbjct: 142 FL--PLH 146

>Skud_13.92 Chr13 complement(163654..165429) [1776 bp, 591 aa] {ON}
           YML054C (REAL)
          Length = 591

 Score = 63.5 bits (153), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 45/63 (71%), Gaps = 3/63 (4%)

Query: 10  SASQVQEHNSADDCWVTLQNRKIYDVTKFLEDHPGGGDLIVEYAGKDITEVMKDGPLHSH 69
           S ++V +HN ADDCWV + N  +YD+T+F+ +HPGG D+I   AG+D+T + +  PLH+ 
Sbjct: 92  SPAEVAKHNKADDCWVVI-NGYVYDLTRFMPNHPGGPDVIKFNAGRDVTAIFE--PLHAP 148

Query: 70  SFV 72
           + +
Sbjct: 149 NVI 151

>TDEL0H02180 Chr8 (369539..370150) [612 bp, 203 aa] {ON} 
          Length = 203

 Score = 60.8 bits (146), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 26/57 (45%), Positives = 38/57 (66%), Gaps = 1/57 (1%)

Query: 2  ETKTLPLYSASQVQEHNSADDCWVTLQNRKIYDVTKFLEDHPGGGDLIVEYAGKDIT 58
          E + LP    ++V+EHN+A DCW+ +  R +YDVT  L  HPGG  ++++YAG D T
Sbjct: 18 EDRNLPKIRLAEVREHNTAHDCWMAIHGR-VYDVTPILSKHPGGCQILLKYAGMDAT 73

>YML054C Chr13 complement(165533..167308) [1776 bp, 591 aa] {ON}
           CYB2Cytochrome b2 (L-lactate cytochrome-c
           oxidoreductase), component of the mitochondrial
           intermembrane space, required for lactate utilization;
           expression is repressed by glucose and anaerobic
           conditions
          Length = 591

 Score = 63.2 bits (152), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 44/63 (69%), Gaps = 3/63 (4%)

Query: 10  SASQVQEHNSADDCWVTLQNRKIYDVTKFLEDHPGGGDLIVEYAGKDITEVMKDGPLHSH 69
           S ++V +HN  DDCWV + N  +YD+T+FL +HPGG D+I   AGKD+T + +  PLH+ 
Sbjct: 92  SPAEVAKHNKPDDCWVVI-NGYVYDLTRFLPNHPGGQDVIKFNAGKDVTAIFE--PLHAP 148

Query: 70  SFV 72
           + +
Sbjct: 149 NVI 151

>Smik_13.92 Chr13 complement(163135..164910) [1776 bp, 591 aa] {ON}
           YML054C (REAL)
          Length = 591

 Score = 63.2 bits (152), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 44/63 (69%), Gaps = 3/63 (4%)

Query: 10  SASQVQEHNSADDCWVTLQNRKIYDVTKFLEDHPGGGDLIVEYAGKDITEVMKDGPLHSH 69
           S ++V +HN  DDCWV + N  +YD+T+FL +HPGG D+I   AGKD+T + +  PLH+ 
Sbjct: 92  SPAEVAKHNKPDDCWVVI-NGYVYDLTRFLPNHPGGQDVIKFNAGKDVTAIFE--PLHAP 148

Query: 70  SFV 72
           + +
Sbjct: 149 NVI 151

>Suva_14.228 Chr14 complement(413753..414115) [363 bp, 120 aa]
          {ON} YNL111C (REAL)
          Length = 120

 Score = 58.5 bits (140), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 22/56 (39%), Positives = 40/56 (71%), Gaps = 1/56 (1%)

Query: 8  LYSASQVQEHNSADDCWVTLQNRKIYDVTKFLEDHPGGGDLIVEYAGKDITEVMKD 63
          +YS  +V EHN  ++CW+ + + K+YDV++F ++HPGG ++I++  G+D T+   D
Sbjct: 4  VYSYQEVAEHNGPENCWIIIDD-KVYDVSQFKDEHPGGDEIIMDLGGQDATDSFVD 58

>NDAI0D04710 Chr4 (1106280..1108130) [1851 bp, 616 aa] {ON}
           Anc_4.304
          Length = 616

 Score = 62.8 bits (151), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 43/66 (65%), Gaps = 3/66 (4%)

Query: 7   PLYSASQVQEHNSADDCWVTLQNRKIYDVTKFLEDHPGGGDLIVEYAGKDITEVMKDGPL 66
           PL S  +V +H++  DCWV + + K+YD+T F+  HPGG D+I   AGKD+T +   GP+
Sbjct: 94  PLISPDEVAKHHTPADCWVVIHD-KVYDLTSFIPIHPGGPDIIKSNAGKDVTNIF--GPI 150

Query: 67  HSHSFV 72
           H+   +
Sbjct: 151 HAPGVI 156

>KLLA0F27577g Chr6 (2556662..2557180) [519 bp, 172 aa] {ON} some
          similarities with uniprot|P40312 Saccharomyces
          cerevisiae YNL111C CYB5 Cytochrome b5
          Length = 172

 Score = 59.3 bits (142), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 43/70 (61%), Gaps = 2/70 (2%)

Query: 7  PLYSASQVQEHNSADDCWVTLQNRKIYDVTKFLEDHPGGGDLIVEYAGKDITEVMKDGPL 66
          PL +  +V  H+S  DCW  +   K+YD+T FL  HPGG  ++++YAGKD T +  D   
Sbjct: 4  PLITMDEVARHSSRSDCWTVIHG-KVYDITSFLHKHPGGAQVLLKYAGKDST-LQFDDIG 61

Query: 67 HSHSFVAYEV 76
          HS   +AY++
Sbjct: 62 HSMESLAYDL 71

>Ecym_4346 Chr4 (739106..739735) [630 bp, 209 aa] {ON} similar to
           Ashbya gossypii ADL085C
          Length = 209

 Score = 59.7 bits (143), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 37/100 (37%), Positives = 54/100 (54%), Gaps = 12/100 (12%)

Query: 10  SASQVQEHNSADDCWVTLQNRKIYDVTKFLEDHPGGGDLIVEYAGKDITEVMKDGPLHSH 69
           S S+V+ H SADDCW  + N K+YD+T  L  HPGG   +++YAG+D T    D   HS 
Sbjct: 7   SLSEVRRHTSADDCWFIIHN-KVYDITNLLSTHPGGAKTLLKYAGRDATLPFDDVG-HST 64

Query: 70  SFVAYEV--------LDEEYHVGYLATAEEEQKLLGNSKH 101
             + Y++        +D + H G L  + E++ L   SK 
Sbjct: 65  ESLVYDMAPGSCLGEVDLKPHEGGL--SREDRCLFSQSKR 102

>Kwal_47.18167 s47 complement(716570..717253) [684 bp, 227 aa]
          {ON} YNL111C (CYB5) - cytochrome b5 [contig 197] FULL
          Length = 227

 Score = 60.1 bits (144), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 24/56 (42%), Positives = 37/56 (66%), Gaps = 1/56 (1%)

Query: 3  TKTLPLYSASQVQEHNSADDCWVTLQNRKIYDVTKFLEDHPGGGDLIVEYAGKDIT 58
          +  LP  S+ +V  H  ADDCW+++   K+YDV+ +L  HPGG  ++++ AGKD T
Sbjct: 28 SSQLPFISSDEVATHTDADDCWISIHG-KVYDVSSYLPQHPGGAQVMLKLAGKDAT 82

>KLLA0B14795g Chr2 (1299429..1301099) [1671 bp, 556 aa] {ON} similar
           to uniprot|P00175 Saccharomyces cerevisiae YML054C CYB2
           Cytochrome b2 (L-lactate cytochrome-c oxidoreductase)
           component of the mitochondrial intermembrane space
           required for lactate utilization expression is repressed
           by glucose and anaerobic conditions
          Length = 556

 Score = 62.0 bits (149), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 37/103 (35%), Positives = 57/103 (55%), Gaps = 15/103 (14%)

Query: 10  SASQVQEHNSADDCWVTLQNRKIYDVTKFLEDHPGGGDLIVEYAGKDITEVMKDGPLHSH 69
           S  +V+ HN  DDCW+ + N ++YD+TKFL  HPGG   ++E+AG+D TE         H
Sbjct: 82  SVKEVKMHNRIDDCWIVIDN-EVYDITKFLSQHPGGVARLMEFAGRDATERF----YQMH 136

Query: 70  SFVAYEVLDEE-YHVGYLATA------EEEQKLLGNSKHKVEV 105
           S    E + E   ++G L  A      EEE +++   +HK ++
Sbjct: 137 SSATLEKMKEHLVYIGKLKGAFDKELSEEEIRII---EHKAKI 176

>NCAS0A02770 Chr1 (528814..530643) [1830 bp, 609 aa] {ON} 
          Length = 609

 Score = 61.2 bits (147), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 35/104 (33%), Positives = 58/104 (55%), Gaps = 9/104 (8%)

Query: 10  SASQVQEHNSADDCWVTLQNRKIYDVTKFLEDHPGGGDLIVEYAGKDITEVMKDGPLHSH 69
           S  +V +HNS +DCW+ + N ++YD+T F+  HPGG D+I   AGKD++ +    PLH+ 
Sbjct: 96  STDEVTKHNSENDCWIVI-NGQVYDLTSFMSIHPGGSDIIKLNAGKDVSAIF--NPLHAP 152

Query: 70  SFVAYEVLDEEYHVGYLATAEEEQKLL-----GNSKHKVEVKLE 108
           + +    L  E ++G L     ++ +      G SK  +  KL+
Sbjct: 153 NAIE-RFLPPECYLGPLQGTMPKELICDPYTPGESKEDIARKLK 195

>KAFR0B04550 Chr2 (946561..946941) [381 bp, 126 aa] {ON} Anc_2.166
          YNL111C
          Length = 126

 Score = 57.0 bits (136), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 38/52 (73%), Gaps = 1/52 (1%)

Query: 8  LYSASQVQEHNSADDCWVTLQNRKIYDVTKFLEDHPGGGDLIVEYAGKDITE 59
          +Y+ + V EH   DDCW+ + + K+Y+V+KFL++HPGG ++I E AG D TE
Sbjct: 4  VYTYADVAEHVLPDDCWIAI-DGKVYNVSKFLDEHPGGDEIIYELAGSDATE 54

>TPHA0F01790 Chr6 (412270..412818) [549 bp, 182 aa] {ON} Anc_2.166
           YNL111C
          Length = 182

 Score = 58.2 bits (139), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 47/74 (63%), Gaps = 4/74 (5%)

Query: 8   LYSASQVQEHNSADDCWVTLQNRKIYDVTKFLEDHPGGGDLIVEYAGKDITEVMKDGPLH 67
           +Y+  ++ EHN+ +  W+ ++  K+Y+VTKFL++HPGG ++I + AG D TE  +D    
Sbjct: 62  IYTYEEIAEHNTTESSWIVIEG-KVYNVTKFLDEHPGGDEIIFDLAGTDATENFED---I 117

Query: 68  SHSFVAYEVLDEEY 81
            HS  A +VL   Y
Sbjct: 118 GHSDQALKVLKTLY 131

>Smik_14.216 Chr14 complement(396585..396947) [363 bp, 120 aa]
          {ON} YNL111C (REAL)
          Length = 120

 Score = 56.6 bits (135), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 23/56 (41%), Positives = 39/56 (69%), Gaps = 1/56 (1%)

Query: 8  LYSASQVQEHNSADDCWVTLQNRKIYDVTKFLEDHPGGGDLIVEYAGKDITEVMKD 63
          +YS  +V EHN  ++ W+ + + K+YDV+KF ++HPGG ++I++  G+D TE   D
Sbjct: 4  VYSYQEVAEHNGPENFWIIIDD-KVYDVSKFKDEHPGGDEIIMDLGGQDATESFVD 58

>Kwal_26.8461 s26 (794482..794853) [372 bp, 123 aa] {ON} YNL111C
          (CYB5) - 1:1 [contig 61] FULL
          Length = 123

 Score = 56.2 bits (134), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 29/76 (38%), Positives = 46/76 (60%), Gaps = 8/76 (10%)

Query: 8  LYSASQVQEHNSADDCWVTLQNRKIYDVTKFLEDHPGGGDLIVEYAGKDITEVMKDGPLH 67
          LYS  ++ EHN+  D W+ +   K+YD TKF+++HPGG +++V+  G+D T     GP  
Sbjct: 4  LYSYKEIAEHNTEKDLWMIIDG-KVYDCTKFMDEHPGGEEVLVDLGGQDAT-----GPFA 57

Query: 68 S--HSFVAYEVLDEEY 81
             HS  A ++L + Y
Sbjct: 58 DIGHSDDAVKMLADLY 73

>KNAG0E03860 Chr5 (763388..765202) [1815 bp, 604 aa] {ON} Anc_4.304
           YML054C
          Length = 604

 Score = 60.1 bits (144), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 51/78 (65%), Gaps = 4/78 (5%)

Query: 10  SASQVQEHNSADDCWVTLQNRKIYDVTKFLEDHPGGGDLIVEYAGKDITEVMKDGPLHSH 69
           S S+V +HN+ DDCWV ++   +Y++T+F+  HPGG  +I   AGKD+T + K  PLH+ 
Sbjct: 93  SPSEVAKHNTPDDCWVVIEGY-VYNLTEFIPTHPGGPMVIKSNAGKDVTAIFK--PLHAK 149

Query: 70  SFVAYEVLDEEYHVGYLA 87
             +  + + +E+ +G L+
Sbjct: 150 GTI-EKFVKKEWFIGPLS 166

>CAGL0K10736g Chr11 (1046127..1047908) [1782 bp, 593 aa] {ON} highly
           similar to uniprot|P00175 Saccharomyces cerevisiae
           YML054c CYB2 lactate dehydrogenase cytochrome b2
          Length = 593

 Score = 60.1 bits (144), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 31/80 (38%), Positives = 47/80 (58%), Gaps = 4/80 (5%)

Query: 7   PLYSASQVQEHNSADDCWVTLQNRKIYDVTKFLEDHPGGGDLIVEYAGKDITEVMKDGPL 66
           P  S S+V +HN+ +DCWV +    +YD+T F+  HPGG D+I   AGKD+T +    P+
Sbjct: 88  PKISPSEVIKHNTPEDCWVVIDGY-VYDLTNFIALHPGGPDIIKTNAGKDVTAIFD--PI 144

Query: 67  HSHSFVAYEVLDEEYHVGYL 86
           H    +  + +  E H+G L
Sbjct: 145 HPPDAIE-KYIKPEQHIGPL 163

>TPHA0B01820 Chr2 complement(406416..408146) [1731 bp, 576 aa] {ON}
           Anc_4.304 YML054C
          Length = 576

 Score = 59.7 bits (143), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 30/87 (34%), Positives = 53/87 (60%), Gaps = 4/87 (4%)

Query: 1   METKTLPLYSASQVQEHNSADDCWVTLQNRKIYDVTKFLEDHPGGGDLIVEYAGKDITEV 60
           M  K   + +  +V  HN  DDCWV + N  +Y++T F++ HPGG ++IV  +GKD+T++
Sbjct: 65  MLLKNSKVITPEEVARHNKRDDCWVVI-NDSVYNLTDFIDSHPGGKNVIVANSGKDVTKL 123

Query: 61  MKDGPLHSHSFVAYEVLDEEYHVGYLA 87
            +  P+H+ + V  + L  +  +G L+
Sbjct: 124 FE--PIHAPN-VLEKYLQPKMRLGTLS 147

>KLTH0C11858g Chr3 (979073..980740) [1668 bp, 555 aa] {ON} similar
           to uniprot|P00175 Saccharomyces cerevisiae YML054C CYB2
           Cytochrome b2 (L-lactate cytochrome-c oxidoreductase)
           component of the mitochondrial intermembrane space
           required for lactate utilization expression is repressed
           by glucose and anaerobic conditions
          Length = 555

 Score = 59.7 bits (143), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 33/47 (70%), Gaps = 1/47 (2%)

Query: 12  SQVQEHNSADDCWVTLQNRKIYDVTKFLEDHPGGGDLIVEYAGKDIT 58
           S+V +HN  DDCW+ L N ++YDVT FL+ HPGG   I+E AG D T
Sbjct: 79  SEVMQHNKPDDCWIVL-NGEVYDVTSFLQMHPGGAARIMEVAGNDAT 124

>NDAI0D04700 Chr4 (1103670..1105547) [1878 bp, 625 aa] {ON} 
          Length = 625

 Score = 59.7 bits (143), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 51/77 (66%), Gaps = 4/77 (5%)

Query: 10  SASQVQEHNSADDCWVTLQNRKIYDVTKFLEDHPGGGDLIVEYAGKDITEVMKDGPLHSH 69
           + +++ +HN+ +DCWV + N+ +YD+T F++ HPGG ++I   AGKD+T +    PLH  
Sbjct: 106 TPNELMKHNTPEDCWVVINNQ-VYDLTTFIQVHPGGPNIIRSNAGKDVTAIF--NPLHPP 162

Query: 70  SFVAYEVLDEEYHVGYL 86
           + +   +L ++ +VG L
Sbjct: 163 NTIET-MLPKQCYVGPL 178

>KLTH0D06930g Chr4 complement(604805..605419) [615 bp, 204 aa] {ON}
           weakly similar to uniprot|Q04772 Saccharomyces
           cerevisiae YMR073C Hypothetical ORF
          Length = 204

 Score = 57.0 bits (136), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 48/76 (63%), Gaps = 6/76 (7%)

Query: 10  SASQVQEHNSADDCWVTLQNRKIYDVTKFLEDHPGGGDLIVE-YAGKDITEVMKDGPLHS 68
           + +Q+Q+HN+A+DCW  L N+++Y V+ +L+ HPGG ++++   AGKD T +        
Sbjct: 130 TKAQLQKHNTAEDCWCVL-NQRVYCVSSYLDFHPGGAEILLRTAAGKDATALFN----KY 184

Query: 69  HSFVAYEVLDEEYHVG 84
           H +V YE L E   VG
Sbjct: 185 HRWVNYERLLETCLVG 200

>YNL111C Chr14 complement(416940..417302) [363 bp, 120 aa] {ON}
          CYB5Cytochrome b5, involved in the sterol and lipid
          biosynthesis pathways; acts as an electron donor to
          support sterol C5-6 desaturation
          Length = 120

 Score = 55.1 bits (131), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 22/56 (39%), Positives = 39/56 (69%), Gaps = 1/56 (1%)

Query: 8  LYSASQVQEHNSADDCWVTLQNRKIYDVTKFLEDHPGGGDLIVEYAGKDITEVMKD 63
          +YS  +V EHN  ++ W+ + + K+YDV++F ++HPGG ++I++  G+D TE   D
Sbjct: 4  VYSYQEVAEHNGPENFWIIIDD-KVYDVSQFKDEHPGGDEIIMDLGGQDATESFVD 58

>NCAS0A02780 Chr1 (531072..532880) [1809 bp, 602 aa] {ON} Anc_4.304
          Length = 602

 Score = 58.9 bits (141), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 44/73 (60%), Gaps = 5/73 (6%)

Query: 2   ETKTLP--LYSASQVQEHNSADDCWVTLQNRKIYDVTKFLEDHPGGGDLIVEYAGKDITE 59
           E+K  P  +   S+V  HN+  DCW+ + N  +YD+T F+  HPGG D+I   AGKD+T 
Sbjct: 80  ESKLAPKRVIDPSEVARHNTPADCWIVI-NGVVYDLTSFIPVHPGGADIIKSNAGKDVTA 138

Query: 60  VMKDGPLHSHSFV 72
           + +  P+H+   +
Sbjct: 139 IFE--PIHAPGVI 149

>SAKL0F08316g Chr6 complement(634949..635485) [537 bp, 178 aa]
          {ON} some similarities with uniprot|P00175
          Saccharomyces cerevisiae YML054C CYB2 Cytochrome b2
          (L-lactate cytochrome-c oxidoreductase), component of
          the mitochondrial intermembrane space, required for
          lactate utilization; expression is repressed by glucose
          and anaerobic conditions
          Length = 178

 Score = 56.2 bits (134), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 30/79 (37%), Positives = 49/79 (62%), Gaps = 3/79 (3%)

Query: 8  LYSASQVQEHNSADDCWVTLQNRKIYDVTKFLEDHPGGGDLIVEYAGKDITEVMKDGPLH 67
          + S S+V +HN  DDCW+ +   K+Y++T FL  HPGG  +I++Y G+D T+   D   H
Sbjct: 3  VISPSEVVKHNRPDDCWMIIHG-KVYNLTSFLSQHPGGAHVILQYGGRDATKQF-DEVGH 60

Query: 68 SHSFVAYEVLDEEYHVGYL 86
          S   + Y+ LD +  +G++
Sbjct: 61 SMESLLYD-LDPKCCLGFV 78

>KLLA0F23672g Chr6 (2212223..2212594) [372 bp, 123 aa] {ON}
          similar to uniprot|P40312 Saccharomyces cerevisiae
          YNL111C CYB5 Cytochrome b5 involved in the sterol and
          lipid biosynthesis pathways required for sterol C5-6
          and fatty acid desaturation
          Length = 123

 Score = 54.7 bits (130), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 28/76 (36%), Positives = 45/76 (59%), Gaps = 8/76 (10%)

Query: 8  LYSASQVQEHNSADDCWVTLQNRKIYDVTKFLEDHPGGGDLIVEYAGKDITEVMKDGPLH 67
          L +  +V EH + DD W+ +   K+YD TKF+++HPGG +++V+  G+D T     GP  
Sbjct: 4  LLTYKEVSEHKTVDDLWMIIDG-KVYDCTKFVDEHPGGDEILVDLGGQDAT-----GPFE 57

Query: 68 S--HSFVAYEVLDEEY 81
             HS  A ++L+  Y
Sbjct: 58 DIGHSDDAIKLLEPMY 73

>ADL085C Chr4 complement(535293..536114) [822 bp, 273 aa] {ON}
           NOHBY406; No homolog in Saccharomyces cerevisiae
          Length = 273

 Score = 57.0 bits (136), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 44/157 (28%), Positives = 70/157 (44%), Gaps = 29/157 (18%)

Query: 10  SASQVQEHNSADDCWVTLQNRKIYDVTKFLEDHPGGGDLIVEYAGKDIT----------- 58
           S  +V +H S DDCW  +  R +YD+T  LE+HPGG  ++++YAG+D T           
Sbjct: 94  SIEEVSQHTSRDDCWFIIHGR-VYDITGLLENHPGGTKILLKYAGRDATLPFDDVGHSME 152

Query: 59  -------------EVMKDGPLHS-HSFVAYEVLDEEYHVGYLATAEEEQKLLGNSKHKVE 104
                        EV     ++S  S V++  L      G  A+ +   + LG+   K+E
Sbjct: 153 SLIYDMAPGSYLGEVDGGENVNSCSSVVSWRSLRWLRSWGKGASDDATVRSLGSQSEKLE 212

Query: 105 VKLEDEYDSTVFVPEVPAEEKLSIVTDY---TRDYGR 138
             L++    T+ +  +     L +V  Y   TR  GR
Sbjct: 213 SDLQNWLQKTLLLLVICVCCVLLLVIRYHNRTRRAGR 249

>TDEL0D00190 Chr4 (29971..31629) [1659 bp, 552 aa] {ON} 
          Length = 552

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 37/50 (74%), Gaps = 1/50 (2%)

Query: 10  SASQVQEHNSADDCWVTLQNRKIYDVTKFLEDHPGGGDLIVEYAGKDITE 59
           SAS++++HN+  DCW+ L N ++YDVT FL+ HPGG   ++E AG D TE
Sbjct: 76  SASELRKHNTVHDCWIAL-NGEVYDVTAFLQMHPGGVARLMEVAGGDATE 124

>SAKL0E10626g Chr5 (885272..885643) [372 bp, 123 aa] {ON} similar
          to uniprot|P40312 Saccharomyces cerevisiae YNL111C CYB5
          Cytochrome b5 involved in the sterol and lipid
          biosynthesis pathways required for sterol C5-6 and
          fatty acid desaturation
          Length = 123

 Score = 53.9 bits (128), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 27/76 (35%), Positives = 46/76 (60%), Gaps = 8/76 (10%)

Query: 8  LYSASQVQEHNSADDCWVTLQNRKIYDVTKFLEDHPGGGDLIVEYAGKDITEVMKDGPLH 67
          L++  ++ EHN+  D W+ +   K+YD TKF+++HPGG +++V+  G+D T     GP  
Sbjct: 4  LFTYQEIAEHNTEGDLWMIIDG-KVYDCTKFIDEHPGGEEVLVDLGGQDAT-----GPFA 57

Query: 68 S--HSFVAYEVLDEEY 81
             HS  A ++L+  Y
Sbjct: 58 DIGHSDDAIKLLEPLY 73

>KAFR0I00520 Chr9 complement(107239..108999) [1761 bp, 586 aa] {ON}
           Anc_4.304 YML054C
          Length = 586

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 34/92 (36%), Positives = 50/92 (54%), Gaps = 4/92 (4%)

Query: 2   ETKTLPLYSASQVQEHNSADDCWVTLQNRKIYDVTKFLEDHPGGGDLIVEYAGKDITEVM 61
           E  T  L    +V +H + DDCWV + N  +YD+T F+  HPGG D++   AGKD+T + 
Sbjct: 76  EAITTRLILPEEVAKHKTPDDCWVVI-NGYVYDITSFIMSHPGGPDVLETNAGKDVTAIF 134

Query: 62  KDGPLHSHSFVAYEVLDEEYHVGYLATAEEEQ 93
              PLH+   V  + L  E  +G L  +  E+
Sbjct: 135 V--PLHAPG-VLEKYLPRELKLGKLQGSMPEE 163

>ZYRO0B13728g Chr2 (1110636..1112432) [1797 bp, 598 aa] {ON} similar
           to uniprot|P00175 Saccharomyces cerevisiae YML054C CYB2
           Cytochrome b2 (L-lactate cytochrome-c oxidoreductase)
           component of the mitochondrial intermembrane space
           required for lactate utilization expression is repressed
           by glucose and anaerobic conditions
          Length = 598

 Score = 57.4 bits (137), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 30/80 (37%), Positives = 45/80 (56%), Gaps = 4/80 (5%)

Query: 7   PLYSASQVQEHNSADDCWVTLQNRKIYDVTKFLEDHPGGGDLIVEYAGKDITEVMKDGPL 66
           P  S  +V +HNS DDCWV +    +YD+T+F   HPGG  +I   AGKD++ +    PL
Sbjct: 82  PAISPDEVAKHNSPDDCWVVIDGY-VYDLTEFAPVHPGGPTVIKSNAGKDVSAIFD--PL 138

Query: 67  HSHSFVAYEVLDEEYHVGYL 86
           H+   +  + +D    +G L
Sbjct: 139 HAPDVIE-KFIDPSKRLGPL 157

>KLTH0D09284g Chr4 (770560..770931) [372 bp, 123 aa] {ON} similar
          to uniprot|P40312 Saccharomyces cerevisiae YNL111C CYB5
          Cytochrome b5 involved in the sterol and lipid
          biosynthesis pathways required for sterol C5-6 and
          fatty acid desaturation
          Length = 123

 Score = 53.5 bits (127), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 53/86 (61%), Gaps = 9/86 (10%)

Query: 8  LYSASQVQEHNSADDCWVTLQNRKIYDVTKFLEDHPGGGDLIVEYAGKDITEVMKDGPLH 67
          LYS  ++ EHN+ +D W+ + + K+YD TKF+++HPGG +++++  G+D T     GP  
Sbjct: 4  LYSYKEIAEHNTENDLWMII-DGKVYDCTKFMDEHPGGEEVLLDLGGQDAT-----GPFA 57

Query: 68 --SHSFVAYEVLDEEYHVGYLATAEE 91
             HS  A ++L E+ +VG +    E
Sbjct: 58 DIGHSDDAVKML-EDLYVGDVDKDSE 82

>SAKL0F16610g Chr6 (1373674..1375368) [1695 bp, 564 aa] {ON} similar
           to uniprot|P00175 Saccharomyces cerevisiae YML054C CYB2
           Cytochrome b2 (L-lactate cytochrome-c oxidoreductase)
           component of the mitochondrial intermembrane space
           required for lactate utilization expression is repressed
           by glucose and anaerobic conditions
          Length = 564

 Score = 56.6 bits (135), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 36/50 (72%), Gaps = 1/50 (2%)

Query: 10  SASQVQEHNSADDCWVTLQNRKIYDVTKFLEDHPGGGDLIVEYAGKDITE 59
           +  +V+ HN+ DDCW+ L N  +YD+T+F++ HPGG   ++E AG+D TE
Sbjct: 89  TVDEVKLHNNIDDCWIVL-NGDVYDITEFIKIHPGGAARLMEVAGRDATE 137

>KLTH0A04026g Chr1 complement(337200..337901) [702 bp, 233 aa]
          {ON} weakly similar to uniprot|P40312 Saccharomyces
          cerevisiae YNL111C CYB5 Cytochrome b5, involved in the
          sterol and lipid biosynthesis pathways
          Length = 233

 Score = 55.1 bits (131), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 36/57 (63%), Gaps = 1/57 (1%)

Query: 7  PLYSASQVQEHNSADDCWVTLQNRKIYDVTKFLEDHPGGGDLIVEYAGKDITEVMKD 63
          P+ S  ++  H SA+DCW+ +    +YDV+++L  HPGG  ++++ AGKD T    D
Sbjct: 32 PVISREELATHTSAEDCWLAIHG-AVYDVSRYLTQHPGGAQVMLKLAGKDATAQFDD 87

>ZYRO0B02090g Chr2 complement(169589..170173) [585 bp, 194 aa] {ON}
           similar to gnl|GLV|KLLA0E18535g Kluyveromyces lactis
           KLLA0E18535g and weakly similar to YMR073C
           uniprot|Q04772 Saccharomyces cerevisiae YMR073C
           Hypothetical ORF
          Length = 194

 Score = 53.9 bits (128), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 28/72 (38%), Positives = 45/72 (62%), Gaps = 6/72 (8%)

Query: 14  VQEHNSADDCWVTLQNRKIYDVTKFLEDHPGGGDLIVEY-AGKDITEVMKDGPLHSHSFV 72
           ++ HN+ DDCW  +Q  K+Y +T + + HPGG D+++ Y AGKD T++  +     H +V
Sbjct: 124 LRRHNTKDDCWCVIQG-KVYCLTNYFDFHPGGVDILLRYCAGKDATKMFNE----YHRWV 178

Query: 73  AYEVLDEEYHVG 84
           +Y+ L E   VG
Sbjct: 179 SYDKLLETCFVG 190

>KLLA0D02640g Chr4 complement(225482..227251) [1770 bp, 589 aa] {ON}
           similar to uniprot|P00175 Saccharomyces cerevisiae
           YML054C CYB2 Cytochrome b2 (L-lactate cytochrome-c
           oxidoreductase) component of the mitochondrial
           intermembrane space required for lactate utilization
           expression is repressed by glucose and anaerobic
           conditions
          Length = 589

 Score = 55.8 bits (133), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 25/68 (36%), Positives = 42/68 (61%), Gaps = 3/68 (4%)

Query: 5   TLPLYSASQVQEHNSADDCWVTLQNRKIYDVTKFLEDHPGGGDLIVEYAGKDITEVMKDG 64
           T P  S ++V +H+S  DCWV ++   +Y++T F+  HPGG  +I   AGKD+T++    
Sbjct: 86  TKPKVSPTEVAKHSSPKDCWVVIEGY-VYNLTDFISAHPGGPAIIENNAGKDVTKIF--A 142

Query: 65  PLHSHSFV 72
           P+H+   +
Sbjct: 143 PIHAPDVI 150

>KLTH0C11770g Chr3 (970979..972835) [1857 bp, 618 aa] {ON} similar
           to uniprot|P00175 Saccharomyces cerevisiae YML054C CYB2
           Cytochrome b2 (L-lactate cytochrome-c oxidoreductase)
           component of the mitochondrial intermembrane space
           required for lactate utilization expression is repressed
           by glucose and anaerobic conditions
          Length = 618

 Score = 55.8 bits (133), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 24/49 (48%), Positives = 33/49 (67%), Gaps = 1/49 (2%)

Query: 10  SASQVQEHNSADDCWVTLQNRKIYDVTKFLEDHPGGGDLIVEYAGKDIT 58
           SA++V  HN  DDCWV +    +YDVT F++ HPGG  +I   AGKD++
Sbjct: 120 SATEVIRHNKEDDCWVVIDG-YVYDVTAFIDQHPGGSAVIRGNAGKDVS 167

>Kwal_23.2823 s23 (29032..30714) [1683 bp, 560 aa] {ON} YML054C
           (CYB2) - Cytochrome b2 [L--lactate cytochrome-c
           oxidoreductase] [contig 246] FULL
          Length = 560

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 32/48 (66%), Gaps = 1/48 (2%)

Query: 12  SQVQEHNSADDCWVTLQNRKIYDVTKFLEDHPGGGDLIVEYAGKDITE 59
           S+V  HN  +DCW+ L N ++YDVT F+  HPGG   I+E AG D TE
Sbjct: 84  SEVMLHNKLNDCWIVL-NDEVYDVTSFIAAHPGGVQRILEVAGSDATE 130

>ZYRO0C18524g Chr3 (1450641..1452305) [1665 bp, 554 aa] {ON} similar
           to uniprot|P00175 Saccharomyces cerevisiae YML054C CYB2
           Cytochrome b2 (L-lactate cytochrome-c oxidoreductase)
           component of the mitochondrial intermembrane space
           required for lactate utilization expression is repressed
           by glucose and anaerobic conditions
          Length = 554

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 39/66 (59%), Gaps = 8/66 (12%)

Query: 13  QVQEHNSADDCWVTLQNRKIYDVTKFLEDHPGGGDLIVEYAGKDITEVMKDGPLHSHSFV 72
           +V  HN+ +DCW+ L N +IYDVT F+  HPGG   ++E AG+D T       L  HS  
Sbjct: 80  EVMLHNNVNDCWIVL-NGEIYDVTSFIGKHPGGAARLLEVAGRDATAKF----LQVHS-- 132

Query: 73  AYEVLD 78
             EVLD
Sbjct: 133 -QEVLD 137

>KAFR0A04740 Chr1 (942850..944301) [1452 bp, 483 aa] {ON} Anc_6.106
           YGL055W
          Length = 483

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 28/72 (38%), Positives = 43/72 (59%), Gaps = 1/72 (1%)

Query: 6   LPLYSASQVQEHNSADDCWVTLQNRKIYDVTKFLEDHPGGGDLIVEYAGKDITEVMKDGP 65
           LP+++ S+ Q     ++  +T+    ++DVT F+ +HPGG  LI E  GKD T V   G 
Sbjct: 381 LPVWNYSEFQRQIEKNERKLTIIGGVVHDVTDFINEHPGGEPLIKEALGKDATRVFSGG- 439

Query: 66  LHSHSFVAYEVL 77
           ++SHS  AY +L
Sbjct: 440 VYSHSNAAYNIL 451

>SAKL0G16852g Chr7 (1452894..1454636) [1743 bp, 580 aa] {ON} similar
           to uniprot|P00175 Saccharomyces cerevisiae YML054C CYB2
           Cytochrome b2 (L-lactate cytochrome-c oxidoreductase)
           component of the mitochondrial intermembrane space
           required for lactate utilization expression is repressed
           by glucose and anaerobic conditions
          Length = 580

 Score = 53.9 bits (128), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 24/59 (40%), Positives = 36/59 (61%), Gaps = 3/59 (5%)

Query: 14  VQEHNSADDCWVTLQNRKIYDVTKFLEDHPGGGDLIVEYAGKDITEVMKDGPLHSHSFV 72
           V +HN   DCWV +    +YD+T+F+  HPGG  +I   AGKD+T +   GP+H+   +
Sbjct: 86  VAKHNDPKDCWVVIDGY-VYDLTEFIHSHPGGPTIIENNAGKDVTAIF--GPIHAPDVI 141

>TDEL0D01140 Chr4 complement(214858..216612) [1755 bp, 584 aa] {ON}
           Anc_4.304 YML054C
          Length = 584

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 38/60 (63%), Gaps = 3/60 (5%)

Query: 13  QVQEHNSADDCWVTLQNRKIYDVTKFLEDHPGGGDLIVEYAGKDITEVMKDGPLHSHSFV 72
           +V++HN+ DDCWV +    +YD++ F+  HPGG  +I   AGKD++ +    PLH+   +
Sbjct: 82  EVEKHNAPDDCWVVIDGY-VYDLSDFIPSHPGGPAVIRANAGKDVSAIFD--PLHAPDVI 138

>Kwal_26.8046 s26 complement(621715..622311) [597 bp, 198 aa] {ON}
           YMR073C - Hypothetical ORF [contig 55] FULL
          Length = 198

 Score = 49.3 bits (116), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 45/74 (60%), Gaps = 6/74 (8%)

Query: 12  SQVQEHNSADDCWVTLQNRKIYDVTKFLEDHPGGGDLIVE-YAGKDITEVMKDGPLHSHS 70
           +Q+ +H + +DCW  + N+K+Y ++ +L+ HPGG D++++  AGKD T +        H 
Sbjct: 126 AQLAQHKAPEDCWCVI-NQKVYCISSYLDFHPGGVDILMKGAAGKDCTSMFN----KYHR 180

Query: 71  FVAYEVLDEEYHVG 84
           +V YE + E   VG
Sbjct: 181 WVNYEKVLETSLVG 194

>Ecym_5420 Chr5 (865505..865942) [438 bp, 145 aa] {ON} similar to
          Ashbya gossypii AFL223W
          Length = 145

 Score = 48.1 bits (113), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 35/50 (70%), Gaps = 1/50 (2%)

Query: 9  YSASQVQEHNSADDCWVTLQNRKIYDVTKFLEDHPGGGDLIVEYAGKDIT 58
          ++  ++ +HNS  D W+ + N K+YD +KF ++HPGG +++++  G+D T
Sbjct: 5  FTYQEIADHNSEQDLWLII-NGKVYDCSKFADEHPGGDEVLLDLGGQDAT 53

>NDAI0H01370 Chr8 (336807..337481) [675 bp, 224 aa] {ON} Anc_2.536
          Length = 224

 Score = 48.9 bits (115), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 30/72 (41%), Positives = 43/72 (59%), Gaps = 6/72 (8%)

Query: 14  VQEHNSADDCWVTLQNRKIYDVTKFLEDHPGGGDLIV-EYAGKDITEVMKDGPLHSHSFV 72
           +Q+H S DDCW T+ N K+Y +T +L  HPGG D+++ E AGKD T +  +     H +V
Sbjct: 152 LQKHVSEDDCW-TVHNGKVYCMTYYLHFHPGGADILLEEAAGKDCTRLFNE----YHPWV 206

Query: 73  AYEVLDEEYHVG 84
             E L E   +G
Sbjct: 207 NVEKLFETCLIG 218

>ZYRO0D16654g Chr4 complement(1380316..1380888) [573 bp, 190 aa]
          {ON} conserved hypothetical protein
          Length = 190

 Score = 47.0 bits (110), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 35/58 (60%), Gaps = 1/58 (1%)

Query: 1  METKTLPLYSASQVQEHNSADDCWVTLQNRKIYDVTKFLEDHPGGGDLIVEYAGKDIT 58
          ++ + LP  S  ++++H +  DCW+ +  R +Y+V   L  HPGG  +++ Y G+D T
Sbjct: 22 VDDEDLPSLSWDEIRKHMTPPDCWMVIHGR-VYNVAPVLASHPGGSQILLHYVGRDAT 78

>Kwal_14.807 s14 complement(57218..58954) [1737 bp, 578 aa] {ON}
           YML054C (CYB2) - Cytochrome b2 [L--lactate cytochrome-c
           oxidoreductase] [contig 245] FULL
          Length = 578

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 32/48 (66%), Gaps = 1/48 (2%)

Query: 13  QVQEHNSADDCWVTLQNRKIYDVTKFLEDHPGGGDLIVEYAGKDITEV 60
           +V +H+  DDCWV + N  +YD++ F+  HPGG  +I   AGKD++ +
Sbjct: 83  EVAKHSKPDDCWVVI-NGYVYDLSDFIAVHPGGPAIIKANAGKDVSAI 129

>TBLA0I01530 Chr9 (334102..334767) [666 bp, 221 aa] {ON} Anc_2.536
           YMR073C
          Length = 221

 Score = 47.0 bits (110), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 24/89 (26%), Positives = 48/89 (53%), Gaps = 8/89 (8%)

Query: 4   KTLPLYSASQ--VQEHNSADDCWVTLQNRKIYDVTKFLEDHPGGGDLIVEYA-GKDITEV 60
           K  P++  +Q  + EH   DDCW  ++ R +Y ++++++ HPGG  +++    GKD++ +
Sbjct: 137 KIRPMFKINQKILSEHQEVDDCWCVIKGR-VYSISRYMDYHPGGKQILINTCLGKDVSNL 195

Query: 61  MKDGPLHSHSFVAYEVLDEEYHVGYLATA 89
                   H +V  + L E+  VG   ++
Sbjct: 196 FD----KYHRWVNVDKLLEKCCVGVYTSS 220

>NCAS0F00870 Chr6 (177678..178247) [570 bp, 189 aa] {ON} Anc_2.536
           YMR073C
          Length = 189

 Score = 46.2 bits (108), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 31/76 (40%), Positives = 42/76 (55%), Gaps = 6/76 (7%)

Query: 10  SASQVQEHNSADDCWVTLQNRKIYDVTKFLEDHPGGGDLIVE-YAGKDITEVMKDGPLHS 68
           + S +Q H S  DCW T+   K+Y V+ +LE HPGG D+I +  AGKD T +        
Sbjct: 114 NNSILQRHTSRTDCW-TIYKGKVYCVSDYLEYHPGGPDIIFQNCAGKDSTVLFN----QY 168

Query: 69  HSFVAYEVLDEEYHVG 84
           HS+V  E L E   +G
Sbjct: 169 HSWVNAEKLLETCLIG 184

>CAGL0K03069g Chr11 complement(285190..285774) [585 bp, 194 aa] {ON}
           weakly similar to uniprot|Q04772 Saccharomyces
           cerevisiae YMR073c
          Length = 194

 Score = 45.4 bits (106), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 34/49 (69%), Gaps = 2/49 (4%)

Query: 11  ASQVQEHNSADDCWVTLQNRKIYDVTKFLEDHPGGGDLIVE-YAGKDIT 58
           A ++  HN+A+DCW T+ N K+Y ++ +L  HPGG  ++++  +G+D T
Sbjct: 121 AHELARHNTAEDCW-TVINGKVYSISSYLSFHPGGAKILIDKSSGQDST 168

>TDEL0A03110 Chr1 complement(554890..555492) [603 bp, 200 aa] {ON}
           Anc_2.536 YMR073C
          Length = 200

 Score = 45.1 bits (105), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 44/76 (57%), Gaps = 6/76 (7%)

Query: 14  VQEHNSADDCWVTLQNRKIYDVTKFLEDHPGGGDLIVE-YAGKDITEVMKDGPLHSHSFV 72
           +Q+H + DDCW  ++ R +Y +T + + HPGG D++ +  AGKD TE+        H +V
Sbjct: 130 LQKHKTLDDCWCVIKGR-VYCLTYYFDFHPGGVDILFKTCAGKDGTEMFN----KYHRWV 184

Query: 73  AYEVLDEEYHVGYLAT 88
           +++ L E   VG   +
Sbjct: 185 SFDKLLETCLVGVFVS 200

>KLLA0E18459g Chr5 (1641507..1641953) [447 bp, 148 aa] {ON} similar
           to uniprot|Q59TA9 Candida albicans CaO19 Potential
           heme/steroid binding protein and some similarites with
           YMR073C uniprot|Q04772 Saccharomyces cerevisiae YMR073C
           Hypothetical ORF
          Length = 148

 Score = 44.3 bits (103), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 26/73 (35%), Positives = 41/73 (56%), Gaps = 6/73 (8%)

Query: 19  SADDCWVTLQNRKIYDVTKFLEDHPGGGDLIVEYAGKDITEVMKDGPLHSHSFVAYEVLD 78
           + D+ W  + NRK+Y +  +L  HPGG  ++ + AGKD+T +        H +V YE L 
Sbjct: 80  NKDNFWCVI-NRKVYCIKAYLSYHPGGEVILKQCAGKDVTSLFN----KYHRWVNYERLL 134

Query: 79  EEYHVG-YLATAE 90
           E   +G Y+ +AE
Sbjct: 135 ETCFIGMYVGSAE 147

>TPHA0G03550 Chr7 complement(755688..756344) [657 bp, 218 aa] {ON}
           Anc_2.536 YMR073C
          Length = 218

 Score = 45.1 bits (105), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 31/51 (60%), Gaps = 2/51 (3%)

Query: 10  SASQVQEHNSADDCWVTLQNRKIYDVTKFLEDHPGGGDLIVEY-AGKDITE 59
           S   V EHN+ DDCW  ++  K+Y +T + E HPGG  ++  + +G D TE
Sbjct: 144 SEKMVAEHNTVDDCWCIIKG-KVYCITNYFEYHPGGDKILKNFCSGVDATE 193

>Kpol_478.17 s478 (61375..62829) [1455 bp, 484 aa] {ON}
           (61375..62829) [1455 nt, 485 aa]
          Length = 484

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 44/87 (50%), Gaps = 3/87 (3%)

Query: 6   LPLYSASQVQEHNSADDCWVTLQNRKIYDVTKFLEDHPGGGDLIVEYAGKDITEVMKDGP 65
           LP++S  Q  E+  +D   V +    +++V  ++ DHPGG  LI    GKD T    +G 
Sbjct: 382 LPVWSKDQFLENLKSDPELVVISG-VVHNVKNYINDHPGGKTLIKSALGKDATSAF-NGG 439

Query: 66  LHSHSFVAYEVLDEEYHVGYLATAEEE 92
           ++ HS  A  VL  ++ V  L   +E 
Sbjct: 440 VYRHSNAAQNVL-ADFRVALLDDGKES 465

>KNAG0F03250 Chr6 complement(607667..609136) [1470 bp, 489 aa] {ON}
           Anc_6.106 YGL055W
          Length = 489

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 25/74 (33%), Positives = 41/74 (55%), Gaps = 2/74 (2%)

Query: 4   KTLPLYSASQVQEHNSADDCWVTLQNRKIYDVTKFLEDHPGGGDLIVEYAGKDITEVMKD 63
             LP++  ++ + + S +   V +    I+DVT F+E+HPGG  L+ +  GKD T     
Sbjct: 387 NNLPVWDKAEFERNLSQNPNLVVIGG-IIHDVTGFVEEHPGGAPLLNDALGKDATTAFTG 445

Query: 64  GPLHSHSFVAYEVL 77
           G ++ HS  A+ VL
Sbjct: 446 G-VYRHSNAAHNVL 458

>Kpol_348.12 s348 complement(21978..22631) [654 bp, 217 aa] {ON}
           complement(21978..22631) [654 nt, 218 aa]
          Length = 217

 Score = 42.4 bits (98), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 41/80 (51%), Gaps = 6/80 (7%)

Query: 8   LYSASQVQEHNSADDCWVTLQNRKIYDVTKFLEDHPGGGDLIV-EYAGKDITEVMKDGPL 66
           + +   V +H   DDCW  ++  K+Y ++ + + HPGG  +++ + +G+D T+       
Sbjct: 142 MITKKMVAKHKDIDDCWCIIRG-KVYSISNYFKFHPGGDKILINQCSGRDCTKAFD---- 196

Query: 67  HSHSFVAYEVLDEEYHVGYL 86
             H +V  E L E   VG L
Sbjct: 197 QYHRWVNVERLLETCFVGNL 216

>AAL078W Chr1 (209600..211378) [1779 bp, 592 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YGL055W
          Length = 592

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/46 (45%), Positives = 29/46 (63%), Gaps = 1/46 (2%)

Query: 32  IYDVTKFLEDHPGGGDLIVEYAGKDITEVMKDGPLHSHSFVAYEVL 77
           I+DVT F+ DHPGG  L+V   GKD T    +G +++HS  A  +L
Sbjct: 496 IHDVTPFMHDHPGGMALVVASVGKDATPAF-NGAVYAHSTAARNLL 540

>TBLA0C06220 Chr3 (1507690..1509174) [1485 bp, 494 aa] {ON} 
          Length = 494

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/46 (43%), Positives = 30/46 (65%), Gaps = 1/46 (2%)

Query: 32  IYDVTKFLEDHPGGGDLIVEYAGKDITEVMKDGPLHSHSFVAYEVL 77
           ++D+T +++ HPGG  LI E  GKD T V  +G +++HS  A  VL
Sbjct: 415 VHDITNYIDRHPGGQKLIKEARGKDATSVF-NGGVYNHSNAANNVL 459

>NCAS0D03250 Chr4 (608476..609969) [1494 bp, 497 aa] {ON} Anc_6.106
          Length = 497

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 38/74 (51%), Gaps = 2/74 (2%)

Query: 6   LPLYSASQVQEHNSADDCWVTLQNRKIYDVTKFLEDHPGGGDLIVEYAGKDITEVMKDGP 65
           LP++   +  E    +   V +    I+D++ ++ +HPGG  LI +  GKD T   + G 
Sbjct: 396 LPVWDKKEFVEQAQLNKNLVVISG-IIHDISNYIPEHPGGESLIKQALGKDATRAFQGG- 453

Query: 66  LHSHSFVAYEVLDE 79
           ++ HS  A  VL E
Sbjct: 454 VYRHSTAAQNVLSE 467

>NDAI0I01620 Chr9 complement(382761..384086) [1326 bp, 441 aa] {ON}
           Anc_6.106
          Length = 441

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 43/75 (57%), Gaps = 2/75 (2%)

Query: 6   LPLYSASQ-VQEHNSADDCWVTLQNRKIYDVTKFLEDHPGGGDLIVEYAGKDITEVMKDG 64
           LP++  +  + E NS ++  + + +  I+DVT + ++HPGG  L+    GKD T   + G
Sbjct: 338 LPIWDKNDFMNEVNSNNNRKLVIISGIIHDVTNYTKEHPGGEKLLNSAVGKDGTRAFQGG 397

Query: 65  PLHSHSFVAYEVLDE 79
            ++ HS  A+ VL +
Sbjct: 398 -VYRHSNSAHNVLAD 411

>Kwal_23.5693 s23 (1277807..1279348) [1542 bp, 513 aa] {ON} YGL055W
           (OLE1) - delta-9-fatty acid desaturase [contig 11] FULL
          Length = 513

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/46 (43%), Positives = 29/46 (63%), Gaps = 1/46 (2%)

Query: 32  IYDVTKFLEDHPGGGDLIVEYAGKDITEVMKDGPLHSHSFVAYEVL 77
           ++DVT F+ DHPGG  L+    GKD T+   +G ++SHS  A  +L
Sbjct: 410 VHDVTPFIHDHPGGVALVETSIGKDATQAF-NGAVYSHSQAARNLL 454

>Ecym_3180 Chr3 (344929..346794) [1866 bp, 621 aa] {ON} similar to
           Ashbya gossypii AAL078W
          Length = 621

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/46 (43%), Positives = 29/46 (63%), Gaps = 1/46 (2%)

Query: 32  IYDVTKFLEDHPGGGDLIVEYAGKDITEVMKDGPLHSHSFVAYEVL 77
           ++DVT F+ DHPGG  L+V   GKD T    +G +++HS  A  +L
Sbjct: 524 VHDVTPFIHDHPGGVALVVCAIGKDATPAF-NGAVYAHSTAARNLL 568

>SAKL0A09570g Chr1 complement(838406..839041) [636 bp, 211 aa] {ON}
           similar to gnl|GLV|CAGL0K03069g Candida glabrata
           CAGL0K03069g and weakly similar to YMR073C
           uniprot|Q04772 Saccharomyces cerevisiae YMR073C
           Hypothetical ORF
          Length = 211

 Score = 40.0 bits (92), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 40/70 (57%), Gaps = 6/70 (8%)

Query: 16  EHNSADDCWVTLQNRKIYDVTKFLEDHPGGGDLIV-EYAGKDITEVMKDGPLHSHSFVAY 74
           +H + DDCW  L+  K+Y ++ + + HPGG ++++ + AG+D T +        H +V +
Sbjct: 143 KHKTVDDCWCVLKG-KVYCLSAYFDFHPGGVEILLNKCAGRDATMMFN----KYHRWVNF 197

Query: 75  EVLDEEYHVG 84
           E L E   VG
Sbjct: 198 ERLLEPCLVG 207

>ZYRO0G16742g Chr7 (1373818..1375449) [1632 bp, 543 aa] {ON} weakly
           similar to uniprot|P21147 Saccharomyces cerevisiae
           YGL055W OLE1 Fatty acid desaturase required for
           monounsaturated fatty acid synthesis and for normal
           distribution of mitochondria
          Length = 543

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 42/77 (54%), Gaps = 8/77 (10%)

Query: 32  IYDVTKFLEDHPGGGDLIVEYAGKDITEVMKDGPLHSHSFVAYEVLDEEYHVGYLATAEE 91
           ++DVT F+ DHPGG  L+    GKD T    +G ++ HS  A  +L     +  L+++E 
Sbjct: 448 VHDVTPFIHDHPGGTALVQLSVGKDATHAF-NGAVYFHSKAARNLL-ATMRIAKLSSSER 505

Query: 92  ------EQKLLGNSKHK 102
                 E+++L +S+ +
Sbjct: 506 VQNTVWERRMLKDSRDQ 522

>Ecym_3080 Chr3 (149461..150900) [1440 bp, 479 aa] {ON} similar to
           Ashbya gossypii AAR153C
          Length = 479

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 40/72 (55%), Gaps = 2/72 (2%)

Query: 6   LPLYSASQVQEHNSADDCWVTLQNRKIYDVTKFLEDHPGGGDLIVEYAGKDITEVMKDGP 65
           LP++  ++  +   A+   V +    ++DVT ++ +HPGG  LI    GKD T+   +G 
Sbjct: 379 LPVWDKAEFMKETKANPGLVVISG-IVHDVTGYITEHPGGETLIRASLGKDATKAF-NGG 436

Query: 66  LHSHSFVAYEVL 77
           ++ HS  A+ +L
Sbjct: 437 VYLHSNAAHNIL 448

>SAKL0G10274g Chr7 complement(874738..876306) [1569 bp, 522 aa] {ON}
           weakly similar to uniprot|P21147 Saccharomyces
           cerevisiae YGL055W OLE1 Fatty acid desaturase required
           for monounsaturated fatty acid synthesis and for normal
           distribution of mitochondria
          Length = 522

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 20/46 (43%), Positives = 28/46 (60%), Gaps = 1/46 (2%)

Query: 32  IYDVTKFLEDHPGGGDLIVEYAGKDITEVMKDGPLHSHSFVAYEVL 77
           ++DVT F+ DHPGG  L+    GKD T    +G ++SHS  A  +L
Sbjct: 419 VHDVTPFIYDHPGGVTLVETSIGKDATAAF-NGAVYSHSRAARNLL 463

>KLLA0C10692g Chr3 complement(916718..918280) [1563 bp, 520 aa] {ON}
           weakly similar to uniprot|P21147 Saccharomyces
           cerevisiae YGL055W OLE1 Fatty acid desaturase required
           for monounsaturated fatty acid synthesis and for normal
           distribution of mitochondria
          Length = 520

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 28/98 (28%), Positives = 44/98 (44%), Gaps = 17/98 (17%)

Query: 27  LQNRKIY--------DVTKFLEDHPGGGDLIVEYAGKDITEVMKDGPLHSHSFVAYEVLD 78
           ++NRK Y        DVT F+ DHPGG  L+    GKD T+   +G ++ HS  A  +L 
Sbjct: 404 IKNRKAYVAIEGIVHDVTPFIYDHPGGVTLVETSIGKDATQAF-NGAVYRHSNAARNLL- 461

Query: 79  EEYHVGYLATAEE-------EQKLLGNSKHKVEVKLED 109
               V  +            E+  + N+ H+  +  +D
Sbjct: 462 ATMRVAVITDQSSNIQRTTWEENSIANATHRNNMDRQD 499

>CAGL0I00418g Chr9 (30058..31530) [1473 bp, 490 aa] {ON} highly
           similar to uniprot|P21147 Saccharomyces cerevisiae
           YGL055w OLE1 stearoyl-CoA desaturase
          Length = 490

 Score = 40.0 bits (92), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 38/72 (52%), Gaps = 2/72 (2%)

Query: 6   LPLYSASQVQEHNSADDCWVTLQNRKIYDVTKFLEDHPGGGDLIVEYAGKDITEVMKDGP 65
           LP ++  +  E N  +D  V +    ++DV+ ++ +HPGG  L+    GKD T+    G 
Sbjct: 386 LPAWTKEEFLEKNRENDGLVIVGG-IVHDVSGYITEHPGGEKLLKNALGKDATKAFSGG- 443

Query: 66  LHSHSFVAYEVL 77
           ++ HS  A+  L
Sbjct: 444 VYRHSNAAHNTL 455

>KLTH0H06798g Chr8 (596966..598432) [1467 bp, 488 aa] {ON}
           uniprot|P79047 Delta 9-fatty acid desaturase
          Length = 488

 Score = 40.0 bits (92), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 39/72 (54%), Gaps = 2/72 (2%)

Query: 6   LPLYSASQVQEHNSADDCWVTLQNRKIYDVTKFLEDHPGGGDLIVEYAGKDITEVMKDGP 65
           LP++   Q  E+   +   V +    ++DV+ ++ +HPGG  LI    GKD T+   +G 
Sbjct: 387 LPVWDKQQFMENIKTNPGLVIISG-IVHDVSNYITEHPGGETLIQAALGKDATKAF-NGG 444

Query: 66  LHSHSFVAYEVL 77
           ++ HS  A+ VL
Sbjct: 445 VYLHSNAAHNVL 456

>SAKL0A07326g Chr1 (648420..649862) [1443 bp, 480 aa] {ON}
           uniprot|Q9HFB2 Saccharomyces kluyveri Sk Delta 9- fatty
           acid desaturase
          Length = 480

 Score = 39.3 bits (90), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 30/46 (65%), Gaps = 1/46 (2%)

Query: 32  IYDVTKFLEDHPGGGDLIVEYAGKDITEVMKDGPLHSHSFVAYEVL 77
           ++DV+ ++ +HPGG  LI   AGKD T+   +G ++ HS  A+ VL
Sbjct: 404 VHDVSGYITEHPGGETLIQAAAGKDATKAF-NGGVYLHSNAAHNVL 448

>KLTH0G06358g Chr7 complement(503325..504866) [1542 bp, 513 aa] {ON}
           weakly similar to uniprot|P21147 Saccharomyces
           cerevisiae YGL055W OLE1 Fatty acid desaturase required
           for monounsaturated fatty acid synthesis and for normal
           distribution of mitochondria
          Length = 513

 Score = 38.5 bits (88), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 28/46 (60%), Gaps = 1/46 (2%)

Query: 32  IYDVTKFLEDHPGGGDLIVEYAGKDITEVMKDGPLHSHSFVAYEVL 77
           ++DVT F+ DHPGG  L+    GKD T+   +G ++ HS  A  +L
Sbjct: 410 VHDVTPFIHDHPGGVALVETSIGKDATQAF-NGAVYLHSQAARNLL 454

>KLLA0C05566g Chr3 complement(497877..499310) [1434 bp, 477 aa] {ON}
           similar to uniprot|P21147 Saccharomyces cerevisiae
           YGL055W OLE1 Fatty acid desaturase required for
           monounsaturated fatty acid synthesis and for normal
           distribution of mitochondria
          Length = 477

 Score = 38.5 bits (88), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 40/72 (55%), Gaps = 2/72 (2%)

Query: 6   LPLYSASQVQEHNSADDCWVTLQNRKIYDVTKFLEDHPGGGDLIVEYAGKDITEVMKDGP 65
           LP++   +  E   +++  V +    ++DV+ ++ +HPGG  LI    GKD T+   +G 
Sbjct: 379 LPVWDKDEFMEKLKSNNGLVVISG-IVHDVSGYITEHPGGETLIQASLGKDATKAF-NGG 436

Query: 66  LHSHSFVAYEVL 77
           ++ HS  A+ +L
Sbjct: 437 VYLHSNAAHNIL 448

>TPHA0B02700 Chr2 (620423..621889) [1467 bp, 488 aa] {ON} Anc_6.106
           YGL055W
          Length = 488

 Score = 38.5 bits (88), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 41/88 (46%), Gaps = 3/88 (3%)

Query: 5   TLPLYSASQVQEHNSADDCWVTLQNRKIYDVTKFLEDHPGGGDLIVEYAGKDITEVMKDG 64
            LP +  +Q  E +  +   + +    ++DV  ++ +HPGG  LI    GKD T    +G
Sbjct: 385 NLPKWDKAQFIEESKTNGNLIVISG-IVHDVKGYITEHPGGQLLIKSALGKDATSAF-NG 442

Query: 65  PLHSHSFVAYEVLDEEYHVGYLATAEEE 92
            ++ HS  A  VL     V  +  +EE 
Sbjct: 443 GVYRHSNAATNVL-ANLRVAVIVESEES 469

>YMR073C Chr13 complement(412268..412873) [606 bp, 201 aa] {ON}
           IRC21Putative protein of unknown function; may be
           involved in resistance to carboplatin and cisplatin;
           null mutant displays increase in spontaneous Rad52p
           foci; contains a lipid-binding domain and binds
           cardiolipin in a large-scale study
          Length = 201

 Score = 37.7 bits (86), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 41/76 (53%), Gaps = 7/76 (9%)

Query: 14  VQEHNSADDCWVTLQNRKIYDVTKFLEDHPGGGDLIVEYAGKD--ITEVMKDGPLHSHSF 71
           V++H   +D    + N K+YD++ +L+ HPGG D+++++   D  IT   K      H +
Sbjct: 130 VKKHCKGEDELWCVINGKVYDISSYLKFHPGGTDILIKHRNSDDLITYFNK-----YHQW 184

Query: 72  VAYEVLDEEYHVGYLA 87
           V YE L +   +G + 
Sbjct: 185 VNYEKLLQVCFIGVVC 200

>TDEL0E03250 Chr5 complement(612008..613618) [1611 bp, 536 aa] {ON} 
          Length = 536

 Score = 38.1 bits (87), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 41/77 (53%), Gaps = 8/77 (10%)

Query: 32  IYDVTKFLEDHPGGGDLIVEYAGKDITEVMKDGPLHSHSFVAYEVLDEEYHVGYLATAEE 91
           ++DVT F+  HPGG  L+    GKD T+   +G ++ HS  A  +L     +  L+++E+
Sbjct: 441 VHDVTPFIHSHPGGTALVKISIGKDATQAF-NGAVYLHSQAARNLL-ATMRIAMLSSSEQ 498

Query: 92  ------EQKLLGNSKHK 102
                 E ++L  S+ K
Sbjct: 499 VENTVWEIRMLQRSQDK 515

>AAR153C Chr1 complement(619953..621389) [1437 bp, 478 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL055W
           (OLE1)
          Length = 478

 Score = 38.1 bits (87), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 38/72 (52%), Gaps = 2/72 (2%)

Query: 6   LPLYSASQVQEHNSADDCWVTLQNRKIYDVTKFLEDHPGGGDLIVEYAGKDITEVMKDGP 65
           LP++  S+    +  +   V +    ++DV+ ++ +HPGG  LI    GKD T    +G 
Sbjct: 378 LPVWDRSEFVRASRENSGLVVISG-IVHDVSGYITEHPGGETLIQAALGKDATRAF-NGG 435

Query: 66  LHSHSFVAYEVL 77
           ++ HS  A+ +L
Sbjct: 436 VYMHSNAAHNIL 447

>ZYRO0C05016g Chr3 (394581..396032) [1452 bp, 483 aa] {ON} similar
           to uniprot|P21147 Saccharomyces cerevisiae YGL055W OLE1
           Fatty acid desaturase required for monounsaturated fatty
           acid synthesis and for normal distribution of
           mitochondria
          Length = 483

 Score = 37.7 bits (86), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 39/74 (52%), Gaps = 4/74 (5%)

Query: 32  IYDVTKFLEDHPGGGDLIVEYAGKDITEVMKDGPLHSHSFVAYEVLDEEYHVGYLATAEE 91
           ++DV+ +L +HPGG  L+    GKD T+   +G ++ HS  A+ VL     +      E 
Sbjct: 407 VHDVSGYLTEHPGGETLLKAALGKDATKAF-NGGVYRHSNAAHNVLAT---MRVAVVKEG 462

Query: 92  EQKLLGNSKHKVEV 105
           EQ+ +  +  + EV
Sbjct: 463 EQQAIRFAARRGEV 476

>Kwal_14.1845 s14 (491597..492463) [867 bp, 288 aa] {ON} YGL055W
           (OLE1) - 1:1 [contig 236] PARTIAL
          Length = 288

 Score = 37.4 bits (85), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 38/72 (52%), Gaps = 2/72 (2%)

Query: 6   LPLYSASQVQEHNSADDCWVTLQNRKIYDVTKFLEDHPGGGDLIVEYAGKDITEVMKDGP 65
           LP++   Q  E+   +   V +    ++DV+ ++ +HPGG  LI     KD T+   +G 
Sbjct: 187 LPVWDKQQFMENIKTNPGLVIISG-IVHDVSNYITEHPGGETLIKAALNKDATKAF-NGG 244

Query: 66  LHSHSFVAYEVL 77
           ++ HS  A+ VL
Sbjct: 245 VYLHSNAAHNVL 256

>Smik_13.252 Chr13 complement(396365..396970) [606 bp, 201 aa] {ON}
           YMR073C (REAL)
          Length = 201

 Score = 36.6 bits (83), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 13/36 (36%), Positives = 24/36 (66%), Gaps = 1/36 (2%)

Query: 21  DDCWVTLQNRKIYDVTKFLEDHPGGGDLIVEYAGKD 56
           D+ W  + N K+YD++ +L+ HPGG D+++ +   D
Sbjct: 138 DELWCVINN-KVYDISSYLKFHPGGTDILLRHRNSD 172

>Skud_7.226 Chr7 (402118..403647) [1530 bp, 509 aa] {ON} YGL055W
           (REAL)
          Length = 509

 Score = 36.6 bits (83), Expect = 0.091,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 39/74 (52%), Gaps = 2/74 (2%)

Query: 6   LPLYSASQVQEHNSADDCWVTLQNRKIYDVTKFLEDHPGGGDLIVEYAGKDITEVMKDGP 65
           LPL+   Q     S ++  + + +  ++DV+ ++ +HPGG  LI    GKD T+    G 
Sbjct: 408 LPLWD-KQTFLAKSKENKGLVIISGIVHDVSGYISEHPGGETLIKTALGKDATKAFSGG- 465

Query: 66  LHSHSFVAYEVLDE 79
           ++ HS  A  VL +
Sbjct: 466 VYRHSNAAQNVLAD 479

>TDEL0G03650 Chr7 (673347..674798) [1452 bp, 483 aa] {ON} Anc_6.106
           YGL055W
          Length = 483

 Score = 36.6 bits (83), Expect = 0.094,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 29/46 (63%), Gaps = 1/46 (2%)

Query: 32  IYDVTKFLEDHPGGGDLIVEYAGKDITEVMKDGPLHSHSFVAYEVL 77
           ++DV+ ++ +HPGG  L+    GKD T+   +G ++ HS  A+ VL
Sbjct: 407 VHDVSGYITEHPGGETLLQAALGKDATKAF-NGGVYRHSNAAHNVL 451

>YGL055W Chr7 (398628..400160) [1533 bp, 510 aa] {ON}  OLE1Delta(9)
           fatty acid desaturase, required for monounsaturated
           fatty acid synthesis and for normal distribution of
           mitochondria
          Length = 510

 Score = 36.6 bits (83), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 28/48 (58%), Gaps = 1/48 (2%)

Query: 32  IYDVTKFLEDHPGGGDLIVEYAGKDITEVMKDGPLHSHSFVAYEVLDE 79
           ++DV+ ++ +HPGG  LI    GKD T+    G ++ HS  A  VL +
Sbjct: 434 VHDVSGYISEHPGGETLIKTALGKDATKAFSGG-VYRHSNAAQNVLAD 480

>Smik_7.225 Chr7 (393200..394732) [1533 bp, 510 aa] {ON} YGL055W
           (REAL)
          Length = 510

 Score = 36.6 bits (83), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 28/48 (58%), Gaps = 1/48 (2%)

Query: 32  IYDVTKFLEDHPGGGDLIVEYAGKDITEVMKDGPLHSHSFVAYEVLDE 79
           ++DV+ ++ +HPGG  LI    GKD T+    G ++ HS  A  VL +
Sbjct: 434 VHDVSGYISEHPGGETLIKTALGKDATKAFSGG-VYRHSNAAQNVLAD 480

>Skud_13.229 Chr13 complement(386598..387203) [606 bp, 201 aa] {ON}
           YMR073C (REAL)
          Length = 201

 Score = 35.0 bits (79), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 39/76 (51%), Gaps = 7/76 (9%)

Query: 14  VQEHNSADDCWVTLQNRKIYDVTKFLEDHPGGGDLIVEYAGKD--ITEVMKDGPLHSHSF 71
           V+ H   +D    + N K+YD++ +L+ HPGG  ++++  G +  IT   K      H +
Sbjct: 130 VKRHCKGEDELWCVINSKVYDISSYLKFHPGGTKILLKNCGSEDFITLFNK-----YHQW 184

Query: 72  VAYEVLDEEYHVGYLA 87
           V YE L +   +G + 
Sbjct: 185 VNYEKLLQVCFIGIVC 200

>Suva_13.250 Chr13 complement(393510..394115) [606 bp, 201 aa] {ON}
           YMR073C (REAL)
          Length = 201

 Score = 34.7 bits (78), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 40/76 (52%), Gaps = 7/76 (9%)

Query: 14  VQEHNSADDCWVTLQNRKIYDVTKFLEDHPGGGDLIVEYAGKD--ITEVMKDGPLHSHSF 71
           V++H   +D +  + N K+YD++ +L+ HPGG  +++ +   D  IT   K      H +
Sbjct: 130 VKKHCKGEDEFWCVINGKVYDISGYLKFHPGGSKIVLRHRDSDDLITLFNK-----YHQW 184

Query: 72  VAYEVLDEEYHVGYLA 87
           V YE L +   +G + 
Sbjct: 185 VNYEKLLQVCFIGLVC 200

>Ecym_7251 Chr7 (530372..530959) [588 bp, 195 aa] {ON} similar to
           Saccharomyces cerevisiae YMR073C
          Length = 195

 Score = 33.5 bits (75), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 30/55 (54%), Gaps = 3/55 (5%)

Query: 7   PLYSASQVQEHNSADDCWVTLQNRKIYDVTKFLEDHPGGGDLIVEYA-GKDITEV 60
           PL     V E    +D W  L+ R +Y +T +L+ HPGG  ++V+   GKD T +
Sbjct: 119 PLRVDKMVLESTKEND-WCVLKGR-VYCITDYLDFHPGGVQILVKNCRGKDATRL 171

>KAFR0A01890 Chr1 complement(392001..392486) [486 bp, 161 aa] {ON}
           Anc_2.536 YMR073C
          Length = 161

 Score = 32.0 bits (71), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 39/74 (52%), Gaps = 8/74 (10%)

Query: 14  VQEHN-SADDCWVTLQNRKIYDVTKFLEDHPGGGDLIVEYAGK--DITEVMKDGPLHSHS 70
           +Q H  S +D W   +  K+Y ++++LE HPGG ++I+    K  D+T +        H 
Sbjct: 89  LQRHQISKEDFWGVYKG-KVYSLSRYLEYHPGGIEIILNNCKKNVDMTAIFN----KYHP 143

Query: 71  FVAYEVLDEEYHVG 84
           +V  E L E  +VG
Sbjct: 144 WVNMERLLETCYVG 157

>Suva_7.216 Chr7 (391750..393162) [1413 bp, 470 aa] {ON} YGL055W
           (REAL)
          Length = 470

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 24/39 (61%), Gaps = 1/39 (2%)

Query: 32  IYDVTKFLEDHPGGGDLIVEYAGKDITEVMKDGPLHSHS 70
           ++DV+ ++ +HPGG  LI    GKD T+    G ++ HS
Sbjct: 430 VHDVSGYISEHPGGETLIKTALGKDATKAFSGG-VYRHS 467

>CAGL0M13101g Chr13 (1288111..1289136) [1026 bp, 341 aa] {ON}
           similar to uniprot|P35735 Saccharomyces cerevisiae
           YKL051w
          Length = 341

 Score = 32.0 bits (71), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 24/51 (47%), Gaps = 2/51 (3%)

Query: 296 LLPYYWACAGFAGGMLGYVCYDLTHYFLHHAKLPGILKKLKKYHMEHHYKN 346
           L P + ACAG+ G  LGYV      YF    + P  +   K  H+E  Y N
Sbjct: 59  LRPLFIACAGWQG--LGYVITIACEYFQRAGRWPFRMPNSKSPHVEAEYDN 107

>KNAG0C05780 Chr3 (1124591..1125133) [543 bp, 180 aa] {ON} Anc_2.536
           YMR073C
          Length = 180

 Score = 30.8 bits (68), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 40/71 (56%), Gaps = 4/71 (5%)

Query: 15  QEHNSADDCWVTLQNRKIYDVTKFLEDHPGGGDLIVEYAGKDITEVMKDGPLHS-HSFVA 73
           Q++ S  D W   +  K+Y ++ +L+ HPGG ++I+++A +D  ++   G     H +V+
Sbjct: 108 QDYLSKHDFWAVYKG-KVYCLSYYLDFHPGGIEIIIDHATRDPPDIR--GAFDRYHRWVS 164

Query: 74  YEVLDEEYHVG 84
            E L E   VG
Sbjct: 165 AEKLLETCLVG 175

>Kpol_1054.12 s1054 complement(28294..29196) [903 bp, 300 aa] {ON}
           complement(28294..29196) [903 nt, 301 aa]
          Length = 300

 Score = 30.8 bits (68), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 28/104 (26%), Positives = 42/104 (40%), Gaps = 13/104 (12%)

Query: 174 RGSAPLFGNFLEPLSKTSWYVIPIV-WLP---VVAYHIFTAMQNMNKLFAVFLFFVGIFV 229
           R   P F N    L    W V     + P   V  YH F+++ ++   F+ F FF  +  
Sbjct: 103 RLPGPWFNNTSNALLADRWTVKRSTGYTPGYLVFGYHGFSSLDSLLYSFSTFDFFTTVSS 162

Query: 230 WTLIEYGMHRFLFHLDFYLPRNQVAYTVHFLLHGVHHYLPMDRY 273
           ++L+ Y   +FLF         + A +   L H   H L M  Y
Sbjct: 163 YSLLYYRAQQFLF---------REAASSQALAHLSRHRLKMKEY 197

>ACL114W Chr3 (144800..145759) [960 bp, 319 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YJR107W
          Length = 319

 Score = 30.4 bits (67), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 15/57 (26%), Positives = 30/57 (52%), Gaps = 4/57 (7%)

Query: 31  KIYDVTKFLEDHPGGGDLIVEY----AGKDITEVMKDGPLHSHSFVAYEVLDEEYHV 83
           K++D  K +ED   GG+    Y      +DI  ++  GP+++H+ + + + D +  V
Sbjct: 208 KVFDNVKKVEDLKNGGNPRNAYIRVVQSRDIVPMVPTGPIYTHAGILFTITDVDSEV 264

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.325    0.141    0.453 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 41,665,994
Number of extensions: 1890563
Number of successful extensions: 6286
Number of sequences better than 10.0: 130
Number of HSP's gapped: 6351
Number of HSP's successfully gapped: 130
Length of query: 378
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 267
Effective length of database: 40,753,473
Effective search space: 10881177291
Effective search space used: 10881177291
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 66 (30.0 bits)