Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_27.103288.830ON1271276585e-90
KLTH0C04070g8.830ON1131134422e-57
SAKL0D01738g8.830ON1781133493e-42
KLLA0D01661g8.830ON1121023252e-39
YML108W8.830ON1051063223e-39
Skud_13.338.830ON1051063215e-39
AAL184W8.830ON1121083173e-38
Smik_13.268.830ON1051093163e-38
TBLA0B031908.830ON1221203122e-37
Suva_13.368.830ON1051063093e-37
KNAG0G033608.830ON1111043061e-36
Kpol_1069.38.830ON1151093062e-36
CAGL0J06666g8.830ON1121063042e-36
ZYRO0G13970g8.830ON1121023043e-36
Ecym_27118.830ON1151122964e-35
NCAS0B011008.830ON1151052949e-35
NDAI0E003608.830ON1221202959e-35
TDEL0B006708.830ON1111102887e-34
TPHA0I001908.830ON138852838e-33
KAFR0A027608.830ON112872801e-32
ADR015W7.157ON43670700.39
KLTH0F13398g7.157ON41971690.64
ZYRO0D11154g5.472ON63344661.4
Skud_4.6635.472ON63544661.4
TBLA0J018707.157ON47078661.7
Ecym_44697.157ON43371651.8
Suva_12.605.170ON114172642.6
Kpol_543.75.472ON63444642.9
Kwal_55.209657.157ON42171633.5
SAKL0F04444g7.157ON42970633.7
YCR045C (RRT12)6.313ON49144634.3
NDAI0A043305.472ON63245634.4
Suva_2.5665.472ON63544624.8
KLLA0D13464g7.157ON43370608.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_27.10328
         (127 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_27.10328 s27 (287686..288069) [384 bp, 127 aa] {ON} YML108W...   258   5e-90
KLTH0C04070g Chr3 (355923..356264) [342 bp, 113 aa] {ON} similar...   174   2e-57
SAKL0D01738g Chr4 (138687..139223) [537 bp, 178 aa] {ON} similar...   139   3e-42
KLLA0D01661g Chr4 complement(148193..148531) [339 bp, 112 aa] {O...   129   2e-39
YML108W Chr13 (54793..55110) [318 bp, 105 aa] {ON} Putative prot...   128   3e-39
Skud_13.33 Chr13 (54349..54666) [318 bp, 105 aa] {ON} YML108W (R...   128   5e-39
AAL184W Chr1 (12906..13244) [339 bp, 112 aa] {ON} Syntenic homol...   126   3e-38
Smik_13.26 Chr13 (51023..51340) [318 bp, 105 aa] {ON} YML108W (R...   126   3e-38
TBLA0B03190 Chr2 complement(742438..742806) [369 bp, 122 aa] {ON...   124   2e-37
Suva_13.36 Chr13 (54612..54929) [318 bp, 105 aa] {ON} YML108W (R...   123   3e-37
KNAG0G03360 Chr7 complement(723353..723688) [336 bp, 111 aa] {ON...   122   1e-36
Kpol_1069.3 s1069 (4998..5345) [348 bp, 115 aa] {ON} (4998..5345...   122   2e-36
CAGL0J06666g Chr10 complement(639077..639415) [339 bp, 112 aa] {...   121   2e-36
ZYRO0G13970g Chr7 complement(1111500..1111838) [339 bp, 112 aa] ...   121   3e-36
Ecym_2711 Chr2 (1376908..1377255) [348 bp, 115 aa] {ON} similar ...   118   4e-35
NCAS0B01100 Chr2 complement(181912..182259) [348 bp, 115 aa] {ON...   117   9e-35
NDAI0E00360 Chr5 (57992..58360) [369 bp, 122 aa] {ON} Anc_8.830 ...   118   9e-35
TDEL0B00670 Chr2 (127614..127949) [336 bp, 111 aa] {ON} Anc_8.83...   115   7e-34
TPHA0I00190 Chr9 complement(33784..34200) [417 bp, 138 aa] {ON} ...   113   8e-33
KAFR0A02760 Chr1 complement(575048..575386) [339 bp, 112 aa] {ON...   112   1e-32
ADR015W Chr4 (732199..733509) [1311 bp, 436 aa] {ON} Syntenic ho...    32   0.39 
KLTH0F13398g Chr6 (1101625..1102884) [1260 bp, 419 aa] {ON} simi...    31   0.64 
ZYRO0D11154g Chr4 complement(943550..945451) [1902 bp, 633 aa] {...    30   1.4  
Skud_4.663 Chr4 complement(1175516..1177423) [1908 bp, 635 aa] {...    30   1.4  
TBLA0J01870 Chr10 complement(438718..440130) [1413 bp, 470 aa] {...    30   1.7  
Ecym_4469 Chr4 complement(953409..954710) [1302 bp, 433 aa] {ON}...    30   1.8  
Suva_12.60 Chr12 complement(81323..84748) [3426 bp, 1141 aa] {ON...    29   2.6  
Kpol_543.7 s543 complement(17522..19426) [1905 bp, 634 aa] {ON} ...    29   2.9  
Kwal_55.20965 s55 (627332..628597) [1266 bp, 421 aa] {ON} YIR004...    29   3.5  
SAKL0F04444g Chr6 complement(357126..358415) [1290 bp, 429 aa] {...    29   3.7  
YCR045C Chr3 complement(208135..209610) [1476 bp, 491 aa] {ON}  ...    29   4.3  
NDAI0A04330 Chr1 (974010..975908) [1899 bp, 632 aa] {ON} Anc_5.472     29   4.4  
Suva_2.566 Chr2 complement(1006259..1008166) [1908 bp, 635 aa] {...    28   4.8  
KLLA0D13464g Chr4 complement(1159251..1160552) [1302 bp, 433 aa]...    28   8.8  

>Kwal_27.10328 s27 (287686..288069) [384 bp, 127 aa] {ON} YML108W -
           Hypothetical ORF [contig 36] FULL
          Length = 127

 Score =  258 bits (658), Expect = 5e-90,   Method: Compositional matrix adjust.
 Identities = 127/127 (100%), Positives = 127/127 (100%)

Query: 1   MSKLHTRKRETKSKMSDERAYRMLVLVEDPVKSEGTVDGEKEENTDAPKATHEFVDELIL 60
           MSKLHTRKRETKSKMSDERAYRMLVLVEDPVKSEGTVDGEKEENTDAPKATHEFVDELIL
Sbjct: 1   MSKLHTRKRETKSKMSDERAYRMLVLVEDPVKSEGTVDGEKEENTDAPKATHEFVDELIL 60

Query: 61  PFEIDDMDTLNEWFDKFDAEICIPNEGFIKYEISSDGLVVLLLDRSREEVVAEVRKFVQS 120
           PFEIDDMDTLNEWFDKFDAEICIPNEGFIKYEISSDGLVVLLLDRSREEVVAEVRKFVQS
Sbjct: 61  PFEIDDMDTLNEWFDKFDAEICIPNEGFIKYEISSDGLVVLLLDRSREEVVAEVRKFVQS 120

Query: 121 ERASDVN 127
           ERASDVN
Sbjct: 121 ERASDVN 127

>KLTH0C04070g Chr3 (355923..356264) [342 bp, 113 aa] {ON} similar to
           uniprot|Q03759 Saccharomyces cerevisiae YML108W defines
           a new subfamily of the split beta-alpha- beta
           sandwiches.
          Length = 113

 Score =  174 bits (442), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 84/113 (74%), Positives = 98/113 (86%)

Query: 15  MSDERAYRMLVLVEDPVKSEGTVDGEKEENTDAPKATHEFVDELILPFEIDDMDTLNEWF 74
           MSDER YRMLVLVED ++  G  + ++ +   APKATHEFVDELILPFEIDDMD LNEWF
Sbjct: 1   MSDERNYRMLVLVEDVLEQAGEKNEQETKGEGAPKATHEFVDELILPFEIDDMDKLNEWF 60

Query: 75  DKFDAEICIPNEGFIKYEISSDGLVVLLLDRSREEVVAEVRKFVQSERASDVN 127
           DKFDA+ICIPNEGFIKYEISSDGLVVLLLDRS+E+VVA+VRKFV++E   ++N
Sbjct: 61  DKFDADICIPNEGFIKYEISSDGLVVLLLDRSKEDVVAQVRKFVEAESGDEIN 113

>SAKL0D01738g Chr4 (138687..139223) [537 bp, 178 aa] {ON} similar to
           uniprot|Q03759 Saccharomyces cerevisiae YML108W defines
           a new subfamily of the split beta-alpha- beta
           sandwiches.
          Length = 178

 Score =  139 bits (349), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 63/113 (55%), Positives = 86/113 (76%), Gaps = 5/113 (4%)

Query: 13  SKMSDERAYRMLVLVEDPVKSEGTVDGEKEENTDAPKATHEFVDELILPFEIDDMDTLNE 72
           S MS +  YRML+L+E+ +      D  +E N +  K +HEFVDEL+LP ++D+MD LN+
Sbjct: 68  SVMSGDNGYRMLMLLEEAIP-----DSSQENNENTTKTSHEFVDELVLPIQVDEMDLLND 122

Query: 73  WFDKFDAEICIPNEGFIKYEISSDGLVVLLLDRSREEVVAEVRKFVQSERASD 125
           WFDKFD +ICIPNEG+IKYEISSDGL+VL+L++ REEVV +VR+FV+  +  D
Sbjct: 123 WFDKFDEQICIPNEGYIKYEISSDGLIVLILNKEREEVVDKVRRFVEEHQVQD 175

>KLLA0D01661g Chr4 complement(148193..148531) [339 bp, 112 aa] {ON}
           similar to uniprot|Q03759 Saccharomyces cerevisiae
           YML108W defines a new subfamily of the split beta-alpha-
           beta sandwiches.
          Length = 112

 Score =  129 bits (325), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 63/102 (61%), Positives = 79/102 (77%), Gaps = 6/102 (5%)

Query: 18  ERAYRMLVLVEDPVKSEGTVDGEKEENTDAPKATHEFVDELILPFEIDDMDTLNEWFDKF 77
           E  YRML+L+E+P+ SE   D +K++N     ATHEFVDEL LP ++D+MD LN WFDKF
Sbjct: 5   ENVYRMLILLEEPI-SESAGDTKKKQN-----ATHEFVDELPLPIQVDEMDLLNSWFDKF 58

Query: 78  DAEICIPNEGFIKYEISSDGLVVLLLDRSREEVVAEVRKFVQ 119
           D +ICIPNEG IKYEISSDGL+VL+LD+S E +V EV  FV+
Sbjct: 59  DEKICIPNEGHIKYEISSDGLIVLILDKSIEHIVQEVTSFVE 100

>YML108W Chr13 (54793..55110) [318 bp, 105 aa] {ON} Putative protein
           of unknown function whose structure defines a new
           subfamily of the split beta-alpha-beta sandwiches; green
           fluorescent protein (GFP)-fusion protein localizes to
           the cytoplasm and nucleus; YML108W is not an essential
           gene
          Length = 105

 Score =  128 bits (322), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 79/106 (74%), Gaps = 5/106 (4%)

Query: 15  MSDERAYRMLVLVEDPVKSEGTVDGEKEENTDA-PKATHEFVDELILPFEIDDMDTLNEW 73
           MS    YRMLVL+ED  K    ++ E E+     P   HEFVDELILPF +D++D LN W
Sbjct: 1   MSKSNTYRMLVLLEDDTK----INKEDEKFLKGKPGKMHEFVDELILPFNVDELDELNTW 56

Query: 74  FDKFDAEICIPNEGFIKYEISSDGLVVLLLDRSREEVVAEVRKFVQ 119
           FDKFDAEICIPNEG IKYEISSDGL+VL+LD+  EEVV +V+KFV+
Sbjct: 57  FDKFDAEICIPNEGHIKYEISSDGLIVLMLDKEIEEVVEKVKKFVE 102

>Skud_13.33 Chr13 (54349..54666) [318 bp, 105 aa] {ON} YML108W
           (REAL)
          Length = 105

 Score =  128 bits (321), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 67/106 (63%), Positives = 79/106 (74%), Gaps = 5/106 (4%)

Query: 15  MSDERAYRMLVLVEDPVKSEGTVDGEKEENTDA-PKATHEFVDELILPFEIDDMDTLNEW 73
           MS   AYRMLVL+ED  K    +  E E+     P   HEFVDELILPFEID++D LN W
Sbjct: 1   MSKSNAYRMLVLLEDDTK----ISKEDEKFLKGKPGKMHEFVDELILPFEIDELDELNIW 56

Query: 74  FDKFDAEICIPNEGFIKYEISSDGLVVLLLDRSREEVVAEVRKFVQ 119
           FDKFDAEICIPNEG IKYEISSDGL+VL+LD+  +EVV +V+ FV+
Sbjct: 57  FDKFDAEICIPNEGHIKYEISSDGLIVLMLDKEIQEVVEKVKNFVE 102

>AAL184W Chr1 (12906..13244) [339 bp, 112 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YML108W
          Length = 112

 Score =  126 bits (317), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 61/108 (56%), Positives = 80/108 (74%), Gaps = 6/108 (5%)

Query: 15  MSDERAYRMLVLVEDPVKSEGTVDGEKEENTDAPKATHEFVDELILPFEIDDMDTLNEWF 74
           M+ +  YRM++L+E+P K   T DG K EN     A+H+FVDEL+LP ++DD++ LN WF
Sbjct: 1   MATDNFYRMMILLEEPHKQHST-DGRKIEN-----ASHDFVDELLLPIQVDDLEVLNTWF 54

Query: 75  DKFDAEICIPNEGFIKYEISSDGLVVLLLDRSREEVVAEVRKFVQSER 122
           DKFD EICIPNEG IKYEISSDGL+VL+LD+   EV+  VR FV + +
Sbjct: 55  DKFDEEICIPNEGHIKYEISSDGLIVLILDKEISEVIGLVRDFVAANQ 102

>Smik_13.26 Chr13 (51023..51340) [318 bp, 105 aa] {ON} YML108W
           (REAL)
          Length = 105

 Score =  126 bits (316), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 65/109 (59%), Positives = 81/109 (74%), Gaps = 5/109 (4%)

Query: 15  MSDERAYRMLVLVEDPVKSEGTVDGEKEENTDA-PKATHEFVDELILPFEIDDMDTLNEW 73
           MS    YRMLVL+ED  K    V+ E E+     P   HEFVDELILPF++D++D LN W
Sbjct: 1   MSRNNTYRMLVLLEDDAK----VNKEDEKFLKGKPGKMHEFVDELILPFDVDELDELNIW 56

Query: 74  FDKFDAEICIPNEGFIKYEISSDGLVVLLLDRSREEVVAEVRKFVQSER 122
           FDKFDAEICIPNEG IKYEISSDGL+VL+LD+  EEV+ +V++FV+  +
Sbjct: 57  FDKFDAEICIPNEGHIKYEISSDGLIVLMLDKEIEEVIEKVKQFVEDNK 105

>TBLA0B03190 Chr2 complement(742438..742806) [369 bp, 122 aa] {ON}
           Anc_8.830 YML108W
          Length = 122

 Score =  124 bits (312), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 59/120 (49%), Positives = 83/120 (69%), Gaps = 13/120 (10%)

Query: 16  SDERAYRMLVLVED---PVKSEGTVDGEKEENTDA----------PKATHEFVDELILPF 62
           S+  AYRM+VL+E+   P++ +  +  E   N +           PK +HEF+DELILPF
Sbjct: 3   SNSVAYRMMVLLEEDMEPIEDDINLKSESSSNDNTEKVTTTKNTEPKKSHEFIDELILPF 62

Query: 63  EIDDMDTLNEWFDKFDAEICIPNEGFIKYEISSDGLVVLLLDRSREEVVAEVRKFVQSER 122
            +D++D LNEWFDKFD +ICIPNEG IKYEI+SDGL++L+LD   + VV +V+ FVQ+ +
Sbjct: 63  HVDELDILNEWFDKFDEQICIPNEGHIKYEITSDGLIILILDNDIKHVVEQVKDFVQNNQ 122

>Suva_13.36 Chr13 (54612..54929) [318 bp, 105 aa] {ON} YML108W
           (REAL)
          Length = 105

 Score =  123 bits (309), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 62/106 (58%), Positives = 80/106 (75%), Gaps = 5/106 (4%)

Query: 15  MSDERAYRMLVLVEDPVKSEGTVDGEKEENTDA-PKATHEFVDELILPFEIDDMDTLNEW 73
           M+    YRMLVL+ED  K    ++ E E+     P   HEFVDEL+LPF++D++D LN W
Sbjct: 1   MAKNNTYRMLVLLEDDTK----INKEDEKFLKGKPGKMHEFVDELMLPFQVDELDELNVW 56

Query: 74  FDKFDAEICIPNEGFIKYEISSDGLVVLLLDRSREEVVAEVRKFVQ 119
           FDKFDAEICIPNEG IKYEISSDGL+VL+LD+  E+VV +V++FV+
Sbjct: 57  FDKFDAEICIPNEGHIKYEISSDGLIVLMLDKEIEDVVEKVKRFVE 102

>KNAG0G03360 Chr7 complement(723353..723688) [336 bp, 111 aa] {ON}
           Anc_8.830 YML108W
          Length = 111

 Score =  122 bits (306), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 55/104 (52%), Positives = 79/104 (75%), Gaps = 1/104 (0%)

Query: 20  AYRMLVLVEDPVKSE-GTVDGEKEENTDAPKATHEFVDELILPFEIDDMDTLNEWFDKFD 78
            YRML+LVE+P++ +  T +   E+ +   K+THE++DEL LPF +D++D LNEWFDKFD
Sbjct: 8   TYRMLILVEEPLEDDVPTTEVTSEDGSQPIKSTHEYIDELHLPFGLDELDALNEWFDKFD 67

Query: 79  AEICIPNEGFIKYEISSDGLVVLLLDRSREEVVAEVRKFVQSER 122
            EICIPNEG IKYEISSDGL+VL+L +  E V  +++ F+++ +
Sbjct: 68  EEICIPNEGHIKYEISSDGLIVLMLGKEIEHVYEQIKSFIETHQ 111

>Kpol_1069.3 s1069 (4998..5345) [348 bp, 115 aa] {ON} (4998..5345)
           [348 nt, 116 aa]
          Length = 115

 Score =  122 bits (306), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 58/109 (53%), Positives = 82/109 (75%), Gaps = 2/109 (1%)

Query: 18  ERAYRMLVLVEDPVKS--EGTVDGEKEENTDAPKATHEFVDELILPFEIDDMDTLNEWFD 75
           E  YRML+L+E+ +++  E     ++ E     K  HEFVDEL+LPF++D++D+LN+WFD
Sbjct: 6   ESNYRMLILLEEGMENLDEEQTQQDRTEEPKESKKMHEFVDELVLPFQVDEIDSLNDWFD 65

Query: 76  KFDAEICIPNEGFIKYEISSDGLVVLLLDRSREEVVAEVRKFVQSERAS 124
           KFD EICIPNEG IKYEI+SDG++VL+LD+  E V+ +V++FVQS   S
Sbjct: 66  KFDEEICIPNEGHIKYEITSDGIIVLILDKEIENVLDKVKEFVQSNHDS 114

>CAGL0J06666g Chr10 complement(639077..639415) [339 bp, 112 aa] {ON}
           similar to uniprot|Q03759 Saccharomyces cerevisiae
           YML108w
          Length = 112

 Score =  121 bits (304), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 60/106 (56%), Positives = 79/106 (74%), Gaps = 5/106 (4%)

Query: 21  YRMLVLVEDPVKSEGTVDGEKEENTDAPKATHEFVDELILPFEIDDMDTLNEWFDKFDAE 80
           YRM+VL+E+P++ + T+   KEE     K  HEF+DEL LPF+ID++D LN+WFDKFD E
Sbjct: 5   YRMMVLLEEPMEEDITISDSKEEK----KVMHEFMDELTLPFQIDEIDLLNKWFDKFDDE 60

Query: 81  ICIPNEGFIKYEISSDGLVVLLLDRS-REEVVAEVRKFVQSERASD 125
           ICIPNEG IKYEI+SDGL+VL+LD+   EE V +V+ FV+     D
Sbjct: 61  ICIPNEGHIKYEITSDGLIVLILDKELGEEFVGKVKTFVEQNNVED 106

>ZYRO0G13970g Chr7 complement(1111500..1111838) [339 bp, 112 aa]
           {ON} highly similar to uniprot|Q03759 Saccharomyces
           cerevisiae YML108W defines a new subfamily of the split
           beta-alpha-beta sandwiches.
          Length = 112

 Score =  121 bits (304), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 58/102 (56%), Positives = 77/102 (75%), Gaps = 9/102 (8%)

Query: 18  ERAYRMLVLVEDPVKSEGTVDGEKEENTDAPKATHEFVDELILPFEIDDMDTLNEWFDKF 77
           E +YRMLVL+E+PV       G K E+    K  HEF+DEL+LPF +D++D LN WFDKF
Sbjct: 5   ENSYRMLVLLEEPVS------GSKPEDE---KKVHEFMDELVLPFNVDEIDQLNSWFDKF 55

Query: 78  DAEICIPNEGFIKYEISSDGLVVLLLDRSREEVVAEVRKFVQ 119
           D +ICIPNEG IKYEI+SDG++VL+LD+  E +V++VR FV+
Sbjct: 56  DEQICIPNEGHIKYEITSDGIIVLILDKEMEPLVSQVRSFVE 97

>Ecym_2711 Chr2 (1376908..1377255) [348 bp, 115 aa] {ON} similar to
           Ashbya gossypii AAL184W
          Length = 115

 Score =  118 bits (296), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 55/112 (49%), Positives = 80/112 (71%), Gaps = 7/112 (6%)

Query: 15  MSDERAYRMLVLVEDPVKSEGTVDGEKEENTDAPKATHEFVDELILPFEIDDMDTLNEWF 74
           MS +  YRM++L+E+ +         K+EN  A  ATH+FVDE++LP ++D++D LN+WF
Sbjct: 4   MSADNFYRMMILLEEAIPES------KDENIKA-NATHDFVDEVVLPMQVDELDVLNKWF 56

Query: 75  DKFDAEICIPNEGFIKYEISSDGLVVLLLDRSREEVVAEVRKFVQSERASDV 126
           DKFD EIC+PNEG+IKYEISSDGL+VL++ + R  +V +V+ FV      +V
Sbjct: 57  DKFDEEICLPNEGYIKYEISSDGLIVLMVSQERSSIVNQVKNFVAKNPLDNV 108

>NCAS0B01100 Chr2 complement(181912..182259) [348 bp, 115 aa] {ON}
           Anc_8.830 YML108W
          Length = 115

 Score =  117 bits (294), Expect = 9e-35,   Method: Compositional matrix adjust.
 Identities = 60/105 (57%), Positives = 81/105 (77%), Gaps = 1/105 (0%)

Query: 15  MSDERAYRMLVLVEDPVKSEGTVDGEKEEN-TDAPKATHEFVDELILPFEIDDMDTLNEW 73
           MS +  YRMLVL+E+ ++     D +  ++    PK THEF++EL+LPFE+ ++D LN+W
Sbjct: 1   MSKDNMYRMLVLLEEEMEEPELFDNDTTDSKATEPKKTHEFIEELLLPFEVSELDALNKW 60

Query: 74  FDKFDAEICIPNEGFIKYEISSDGLVVLLLDRSREEVVAEVRKFV 118
           FDKFD EICIPNEG IKYEISSDGL+VLLLD+  E V++EV+KF+
Sbjct: 61  FDKFDEEICIPNEGHIKYEISSDGLIVLLLDKEIENVISEVKKFI 105

>NDAI0E00360 Chr5 (57992..58360) [369 bp, 122 aa] {ON} Anc_8.830
           YML108W
          Length = 122

 Score =  118 bits (295), Expect = 9e-35,   Method: Compositional matrix adjust.
 Identities = 57/120 (47%), Positives = 80/120 (66%), Gaps = 13/120 (10%)

Query: 16  SDERAYRMLVLVEDPVKSEGTVDGEKEENTDAP-------------KATHEFVDELILPF 62
           S    YR+++L+E+ +      DG  +E T+               K  HEF++ELILPF
Sbjct: 3   STNNMYRLMILLEEEIGEPDLKDGSIDEATETETKDVHNSDEEKNVKKMHEFIEELILPF 62

Query: 63  EIDDMDTLNEWFDKFDAEICIPNEGFIKYEISSDGLVVLLLDRSREEVVAEVRKFVQSER 122
             +++D LNEWFDKFD EICIPNEG IKYEI+SDGL+VLLLD+  E+VV E++KF+++ +
Sbjct: 63  GTEELDLLNEWFDKFDEEICIPNEGHIKYEITSDGLIVLLLDKEIEDVVGEIKKFIETNQ 122

>TDEL0B00670 Chr2 (127614..127949) [336 bp, 111 aa] {ON} Anc_8.830
           YML108W
          Length = 111

 Score =  115 bits (288), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 53/110 (48%), Positives = 81/110 (73%), Gaps = 3/110 (2%)

Query: 16  SDERAYRMLVLVEDPVKS--EGTVDGEKEENTDAPKATHEFVDELILPFEIDDMDTLNEW 73
            ++  Y M++ +E+ +++  EG      E+  D  K++HEFVDEL+LPF++D++D LNEW
Sbjct: 3   GNDNFYHMIIFLEESIENGQEGNSVDNGEDKQDV-KSSHEFVDELVLPFQVDEIDALNEW 61

Query: 74  FDKFDAEICIPNEGFIKYEISSDGLVVLLLDRSREEVVAEVRKFVQSERA 123
           FDKFD ++CIPNEG IKYEI+SDG++VLLLD+  E +V +V+ FV+   +
Sbjct: 62  FDKFDEKLCIPNEGHIKYEITSDGMMVLLLDKELEHLVNDVKTFVEENSS 111

>TPHA0I00190 Chr9 complement(33784..34200) [417 bp, 138 aa] {ON}
           Anc_8.830 YML108W
          Length = 138

 Score =  113 bits (283), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 52/85 (61%), Positives = 68/85 (80%), Gaps = 2/85 (2%)

Query: 43  ENTDAPKATHEFVDELILPFEIDDMDTLNEWFDKFDAEICIPNEGFIKYEISSDGLVVLL 102
           E  +    +HEFVDELILPF +D++D LNEWFDKFD E+CIPNEG IKYEI+SDGL+VL+
Sbjct: 40  EKGETQSKSHEFVDELILPFNVDELDMLNEWFDKFDDEVCIPNEGHIKYEITSDGLIVLM 99

Query: 103 LDRSREEVVAEVRKFVQSER--ASD 125
           LD+  E VV++V++FV + +  ASD
Sbjct: 100 LDKEIEHVVSKVKEFVSANQMLASD 124

>KAFR0A02760 Chr1 complement(575048..575386) [339 bp, 112 aa] {ON}
           Anc_8.830 YML108W
          Length = 112

 Score =  112 bits (280), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 54/87 (62%), Positives = 68/87 (78%), Gaps = 4/87 (4%)

Query: 40  EKEENTDAPKA----THEFVDELILPFEIDDMDTLNEWFDKFDAEICIPNEGFIKYEISS 95
           E  +N + PK     +HEF++ELILPFE  ++DTLNEWFDKFD EICIPNEG IKYEISS
Sbjct: 26  EDNDNGEQPKQESTKSHEFIEELILPFETSELDTLNEWFDKFDEEICIPNEGNIKYEISS 85

Query: 96  DGLVVLLLDRSREEVVAEVRKFVQSER 122
           DGLVVLL+D+  E VV +V++FV + +
Sbjct: 86  DGLVVLLIDKQIENVVEKVKEFVNNNQ 112

>ADR015W Chr4 (732199..733509) [1311 bp, 436 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YIR004W (DJP1)
          Length = 436

 Score = 31.6 bits (70), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 30/70 (42%), Gaps = 12/70 (17%)

Query: 19 RAYRMLVLVEDPVKSEGTVDGEKEENTDAPKATHEFVDELILPFEIDDMDTLNEWFDKFD 78
          +AYR   + E P K           N + PKAT  F   +   +++   D L   +DKF 
Sbjct: 24 KAYRKKSVQEHPDK-----------NPNDPKATERF-QAISEAYQVLSSDELRAKYDKFG 71

Query: 79 AEICIPNEGF 88
           E  +P  GF
Sbjct: 72 KEEAVPQNGF 81

>KLTH0F13398g Chr6 (1101625..1102884) [1260 bp, 419 aa] {ON}
          similar to uniprot|P40564 YIR004W Saccharomyces
          cerevisiae DJP1 Cytosolic J-domain-containing protein,
          required for peroxisomal protein import
          Length = 419

 Score = 31.2 bits (69), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 31/71 (43%), Gaps = 12/71 (16%)

Query: 18 ERAYRMLVLVEDPVKSEGTVDGEKEENTDAPKATHEFVDELILPFEIDDMDTLNEWFDKF 77
          ++AYR   + E P K           N + P AT  F   +   +++   D L   +DKF
Sbjct: 23 KKAYRKKSVQEHPDK-----------NPNDPTATERF-QAISQAYQVLSKDDLRAKYDKF 70

Query: 78 DAEICIPNEGF 88
            E  +P EGF
Sbjct: 71 GKEEAVPKEGF 81

>ZYRO0D11154g Chr4 complement(943550..945451) [1902 bp, 633 aa] {ON}
           similar to uniprot|P52488 Saccharomyces cerevisiae
           YDR390C UBA2 Nuclear protein that acts as a heterodimer
           with Aos1p to activate Smt3p (SUMO) before its
           conjugation to proteins (sumoylation) which may play a
           role in protein targeting essential for viability
          Length = 633

 Score = 30.0 bits (66), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 26/44 (59%), Gaps = 3/44 (6%)

Query: 38  DGEKEENTDAPKATHEFVDELILPFEIDDMDTLN---EWFDKFD 78
           D ++ ++T A KA   F +  ++P++ + MDT      WFD+FD
Sbjct: 71  DIKQPKSTTAVKAVQHFSNSKLVPYQGNVMDTNQFPLHWFDQFD 114

>Skud_4.663 Chr4 complement(1175516..1177423) [1908 bp, 635 aa] {ON}
           YDR390C (REAL)
          Length = 635

 Score = 30.0 bits (66), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 14/44 (31%), Positives = 26/44 (59%), Gaps = 3/44 (6%)

Query: 38  DGEKEENTDAPKATHEFVDELILPFEIDDMDTLN---EWFDKFD 78
           D ++ ++T A KA   F +  ++P++ + MDT      WF++FD
Sbjct: 71  DIKQPKSTTAVKAVQHFNNSKLVPYQGNVMDTFTFPLHWFEQFD 114

>TBLA0J01870 Chr10 complement(438718..440130) [1413 bp, 470 aa]
          {ON} Anc_7.157 YIR004W
          Length = 470

 Score = 30.0 bits (66), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 21/78 (26%), Positives = 35/78 (44%), Gaps = 12/78 (15%)

Query: 11 TKSKMSDERAYRMLVLVEDPVKSEGTVDGEKEENTDAPKATHEFVDELILPFEIDDMDTL 70
          T ++   ++AYR   + E P K           N + P AT  F  ++   +++   + L
Sbjct: 16 TATQAEIKKAYRKKSIKEHPDK-----------NPNDPTATERF-QQISEAYQVLSDEHL 63

Query: 71 NEWFDKFDAEICIPNEGF 88
             +D+F  E  IP EGF
Sbjct: 64 RNNYDQFGKEQAIPKEGF 81

>Ecym_4469 Chr4 complement(953409..954710) [1302 bp, 433 aa] {ON}
          similar to Ashbya gossypii ADR015W
          Length = 433

 Score = 29.6 bits (65), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 19/71 (26%), Positives = 32/71 (45%), Gaps = 12/71 (16%)

Query: 18 ERAYRMLVLVEDPVKSEGTVDGEKEENTDAPKATHEFVDELILPFEIDDMDTLNEWFDKF 77
          ++AYR   + E P           ++N + PKAT  F   +   +++   D L   +DKF
Sbjct: 23 KKAYRKKSVQEHP-----------DKNPNDPKATERF-QAISEAYQVLGSDELRAKYDKF 70

Query: 78 DAEICIPNEGF 88
            +  +P  GF
Sbjct: 71 GKDEAVPQNGF 81

>Suva_12.60 Chr12 complement(81323..84748) [3426 bp, 1141 aa] {ON}
            YJL020C (REAL)
          Length = 1141

 Score = 29.3 bits (64), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 17/72 (23%), Positives = 30/72 (41%)

Query: 43   ENTDAPKATHEFVDELILPFEIDDMDTLNEWFDKFDAEICIPNEGFIKYEISSDGLVVLL 102
            +N +  K    F + L  P E      L+ +  KF+A+I   +   I   I +   V  +
Sbjct: 955  DNANPEKTVTTFQEHLPAPAEAQSAQLLDGYAQKFNAKILEKSHSLINSHIGAKNFVPQI 1014

Query: 103  LDRSREEVVAEV 114
            L   + EV+  +
Sbjct: 1015 LSEFKNEVILPI 1026

>Kpol_543.7 s543 complement(17522..19426) [1905 bp, 634 aa] {ON}
           complement(17522..19426) [1905 nt, 635 aa]
          Length = 634

 Score = 29.3 bits (64), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 14/44 (31%), Positives = 26/44 (59%), Gaps = 3/44 (6%)

Query: 38  DGEKEENTDAPKATHEFVDELILPFEIDDMDTLN---EWFDKFD 78
           D ++ ++T A KA   F +  ++P++ + MDT      WF++FD
Sbjct: 72  DIKQPKSTTAVKAVSHFSNSKLIPYQGNIMDTNQFPLHWFNQFD 115

>Kwal_55.20965 s55 (627332..628597) [1266 bp, 421 aa] {ON} YIR004W
          (DJP1) - involved in peroxisome biogenesis [contig 135]
          FULL
          Length = 421

 Score = 28.9 bits (63), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 19/71 (26%), Positives = 32/71 (45%), Gaps = 12/71 (16%)

Query: 18 ERAYRMLVLVEDPVKSEGTVDGEKEENTDAPKATHEFVDELILPFEIDDMDTLNEWFDKF 77
          ++AYR   + E P           ++N + P AT  F   +   +++   + L   +DK+
Sbjct: 24 KKAYRKKSVQEHP-----------DKNPNDPTATERF-QAISQAYQVLSKEDLRAKYDKY 71

Query: 78 DAEICIPNEGF 88
            E  IP EGF
Sbjct: 72 GKEEAIPKEGF 82

>SAKL0F04444g Chr6 complement(357126..358415) [1290 bp, 429 aa]
          {ON} similar to uniprot|P40564 YIR004W Saccharomyces
          cerevisiae DJP1 Cytosolic J-domain-containing protein,
          required for peroxisomal protein import
          Length = 429

 Score = 28.9 bits (63), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 19/70 (27%), Positives = 29/70 (41%), Gaps = 12/70 (17%)

Query: 19 RAYRMLVLVEDPVKSEGTVDGEKEENTDAPKATHEFVDELILPFEIDDMDTLNEWFDKFD 78
          +AYR   + E P K           N + P AT  F   +   +++   + L   +DKF 
Sbjct: 24 KAYRKKSVQEHPDK-----------NPNDPSATERF-QSISQAYQVLSNEELRTKYDKFG 71

Query: 79 AEICIPNEGF 88
           E  +P  GF
Sbjct: 72 KEEAVPQNGF 81

>YCR045C Chr3 complement(208135..209610) [1476 bp, 491 aa] {ON}
           RRT12Probable subtilisin-family protease with a role in
           formation of the dityrosine layer of spore walls;
           localizes to the spore wall and also the nuclear
           envelope and ER region in mature spores
          Length = 491

 Score = 28.9 bits (63), Expect = 4.3,   Method: Composition-based stats.
 Identities = 14/44 (31%), Positives = 21/44 (47%), Gaps = 4/44 (9%)

Query: 38  DGEKEENT----DAPKATHEFVDELILPFEIDDMDTLNEWFDKF 77
           D E+E+N     DAP+          LPF++ D D    WF+ +
Sbjct: 115 DVEEEQNITYQPDAPRHLARISRHYQLPFDVGDKDRYKSWFNYY 158

>NDAI0A04330 Chr1 (974010..975908) [1899 bp, 632 aa] {ON} Anc_5.472
          Length = 632

 Score = 28.9 bits (63), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 27/45 (60%), Gaps = 5/45 (11%)

Query: 38  DGEKEENTDAPKATHEFVDELILPFEIDDMDTLNE----WFDKFD 78
           D ++ ++T A KA   F +  ++P++ + MDT NE    WF +FD
Sbjct: 71  DIKQPKSTTAVKAVQHFSNSKLVPYQGNIMDT-NEFPLHWFHQFD 114

>Suva_2.566 Chr2 complement(1006259..1008166) [1908 bp, 635 aa] {ON}
           YDR390C (REAL)
          Length = 635

 Score = 28.5 bits (62), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 14/44 (31%), Positives = 26/44 (59%), Gaps = 3/44 (6%)

Query: 38  DGEKEENTDAPKATHEFVDELILPFEIDDMDTLN---EWFDKFD 78
           D ++ ++T A KA   F +  ++P++ + MDT      WF++FD
Sbjct: 71  DIKQPKSTTAVKAVQHFNNSKLVPYQGNVMDTSTFPLHWFEQFD 114

>KLLA0D13464g Chr4 complement(1159251..1160552) [1302 bp, 433 aa]
          {ON} similar to uniprot|P40564 YIR004W Saccharomyces
          cerevisiae DJP1 Cytosolic J-domain-containing protein,
          required for peroxisomal protein import
          Length = 433

 Score = 27.7 bits (60), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 29/70 (41%), Gaps = 12/70 (17%)

Query: 19 RAYRMLVLVEDPVKSEGTVDGEKEENTDAPKATHEFVDELILPFEIDDMDTLNEWFDKFD 78
          +AYR   + E P K           N D P AT  F   +   +++   + L   +DKF 
Sbjct: 24 KAYRKKSVKEHPDK-----------NPDDPTATERF-QAISEAYQVLSSEELRMKYDKFG 71

Query: 79 AEICIPNEGF 88
           E  +P  GF
Sbjct: 72 KEEAMPKNGF 81

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.133    0.366 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 13,518,601
Number of extensions: 595981
Number of successful extensions: 1733
Number of sequences better than 10.0: 63
Number of HSP's gapped: 1720
Number of HSP's successfully gapped: 63
Length of query: 127
Length of database: 53,481,399
Length adjustment: 96
Effective length of query: 31
Effective length of database: 42,473,463
Effective search space: 1316677353
Effective search space used: 1316677353
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 59 (27.3 bits)