Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_27.102758.837ON37937915510.0
KLTH0C03938g8.837ON37638611471e-156
KAFR0B039008.837ON37939010361e-139
SAKL0D01540g8.837ON36538610101e-135
TDEL0B006008.837ON36938410051e-135
CAGL0M02937g8.837ON3733869921e-133
NCAS0C004308.837ON3693899621e-128
Smik_13.4898.837ON3723899601e-128
Kpol_1068.118.837ON3813979561e-127
Skud_13.4488.837ON3643869521e-127
ZYRO0G14124g8.837ON3693889211e-122
YMR276W (DSK2)8.837ON3733989061e-120
Suva_13.4648.837ON3663949041e-119
KLLA0D01859g8.837ON3713848931e-118
NDAI0K004408.837ON4044118941e-117
Ecym_46088.837ON4064198901e-117
ABL129W8.837ON3453798821e-116
TPHA0I002208.837ON3773958741e-115
TBLA0D032308.837ON3754008711e-114
KNAG0J002908.837ON3673968381e-109
TBLA0B032408.837ON2842191531e-10
TDEL0F043808.311ON77711225e-08
Kpol_1036.628.311ON77711121e-06
TPHA0C008908.311ON77711112e-06
ZYRO0D05962g8.311ON77711084e-06
TDEL0G017504.16ON77711066e-06
KLTH0G12540g8.311ON77711067e-06
NDAI0H002704.16ON77711059e-06
SAKL0H15818g8.311ON77711059e-06
NCAS0B035208.311ON77731041e-05
NDAI0J010708.311ON77711041e-05
Skud_9.205.701ON125561072e-05
Smik_11.3575.701ON125561072e-05
Smik_9.215.701ON124561072e-05
Kwal_YGOB_Anc_5.7015.701ON128711062e-05
KLTH0E01078g5.701ON128711062e-05
ZYRO0G06622g5.701ON128711062e-05
KAFR0D022305.701ON128711062e-05
KAFR0H002205.701ON128711062e-05
Suva_11.3305.701ON128711062e-05
Skud_11.3335.701ON128711062e-05
YIL148W (RPL40A)5.701ON128711062e-05
YKR094C (RPL40B)5.701ON128711062e-05
KLLA0A00616g5.701ON128711062e-05
TPHA0E002405.701ON128711062e-05
TPHA0D046005.701ON128711062e-05
TBLA0E021105.701ON128711062e-05
CAGL0G02475g5.701ON128711062e-05
SAKL0E14894g5.701ON128711062e-05
Kpol_1043.695.701ON128711062e-05
NDAI0E050305.701ON128711052e-05
NCAS0A032105.701ON128711052e-05
NCAS0G002405.701ON128711052e-05
TDEL0B022005.701ON128711053e-05
KLTH0C03410g1.480ON391531123e-05
Ecym_40195.701ON128711043e-05
AFR285C5.701ON128711043e-05
KNAG0L021205.701ON128711043e-05
SAKL0D11814g1.480ON400751114e-05
Suva_10.32singletonON6256994e-05
AFR358W1.480ON413771104e-05
Kwal_27.101521.480ON381531096e-05
KNAG0J028804.16ON153711047e-05
Ecym_84084.16ON153711037e-05
TPHA0K022504.16ON153711037e-05
KLLA0F17974g8.311ON7773988e-05
TPHA0C023908.386ON150711021e-04
ZYRO0C04026g8.386ON152711021e-04
KLTH0F08734g8.386ON150711021e-04
Ecym_41818.386ON152711021e-04
Kwal_23.33118.386ON150711011e-04
SAKL0H13926g8.386ON154711011e-04
Suva_10.34singletonON151711011e-04
KNAG0C065805.701ON149711011e-04
KLLA0D18304g8.386ON150711011e-04
KLTH0E05852g4.16ON409711061e-04
NCAS0C029408.386ON152711012e-04
TBLA0G006704.16ON229711032e-04
NDAI0D049304.16ON229711032e-04
KAFR0I014704.16ON229711032e-04
YLR167W (RPS31)8.386ON152711012e-04
Suva_10.33singletonON254711042e-04
NDAI0G022808.386ON152711012e-04
KAFR0H020008.386ON152711012e-04
Suva_9.405.701ON144561002e-04
Kwal_55.206074.16ON231711032e-04
AGL128W8.386ON152711002e-04
TDEL0F051008.386ON150711002e-04
CAGL0G08173g8.386ON152711002e-04
CAGL0B01589g8.311ON7771952e-04
SAKL0H25784g4.16ON305711042e-04
Skud_12.294.16ON381711043e-04
YLL039C (UBI4)4.16ON381711043e-04
Suva_10.304.16ON381711043e-04
ACL062C4.16ON382711033e-04
KNAG0A027308.386ON15071993e-04
KLLA0E00749g4.16ON381711033e-04
CAGL0L01309g1.480ON392661033e-04
Smik_12.184.16ON460711033e-04
Kpol_1070.64.16ON533711043e-04
Kpol_1030.58.386ON15271983e-04
Kpol_1024.168.386ON15271983e-04
ZYRO0G07854g4.16ON460711033e-04
CAGL0D05082g4.16ON533711033e-04
NCAS0C058504.16ON388711033e-04
Suva_10.2668.386ON15271983e-04
Skud_12.2348.386ON15271983e-04
Smik_12.2298.386ON15271983e-04
TBLA0H031808.386ON15271984e-04
Ecym_35721.480ON443771025e-04
NDAI0F003005.701ON18777986e-04
KAFR0C030008.142ON39755980.001
KAFR0E005301.480ON37966970.002
KLLA0E22133g1.480ON38366970.002
TBLA0B021601.480ON40467960.002
TPHA0O004401.480ON36966940.004
NCAS0G041201.480ON39258930.005
YDR139C (RUB1)8.311ON7771850.006
Suva_5.321.480ON40966910.009
TBLA0D022108.142ON56338910.010
Skud_5.531.480ON39766900.013
NCAS0B045908.142ON44738890.017
CAGL0L06028g8.142ON50538890.019
NDAI0B01850singletonON40344870.026
YEL037C (RAD23)1.480ON39866870.031
NDAI0G003301.480ON42766860.036
SAKL0H24772g8.142ON41462850.049
TDEL0C025901.480ON36858830.076
Smik_5.561.480ON39766830.098
Smik_7.918.142ON39938810.17
TDEL0B046908.142ON44238810.18
YGL181W (GTS1)8.142ON39638810.18
KAFR0I027801.480ON21457770.33
ZYRO0F05192g1.480ON38463780.35
NCAS0C040908.142ON39655780.38
Suva_7.818.142ON40138770.49
Suva_10.31singletonON6451670.92
Kpol_370.61.480ON40466731.3
Skud_7.908.142ON39638694.7
Kpol_541.508.142ON51138687.1
KNAG0M011706.21ON339100677.4
Kwal_23.56065.281ON20560667.7
TPHA0H004008.142ON46638678.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_27.10275
         (379 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_27.10275 s27 complement(273277..274416) [1140 bp, 379 aa] {...   602   0.0  
KLTH0C03938g Chr3 complement(344354..345484) [1131 bp, 376 aa] {...   446   e-156
KAFR0B03900 Chr2 (810391..811530) [1140 bp, 379 aa] {ON} Anc_8.8...   403   e-139
SAKL0D01540g Chr4 complement(124423..125520) [1098 bp, 365 aa] {...   393   e-135
TDEL0B00600 Chr2 complement(115615..116724) [1110 bp, 369 aa] {O...   391   e-135
CAGL0M02937g Chr13 (331097..332218) [1122 bp, 373 aa] {ON} highl...   386   e-133
NCAS0C00430 Chr3 complement(67718..68827) [1110 bp, 369 aa] {ON}...   375   e-128
Smik_13.489 Chr13 (801868..802986) [1119 bp, 372 aa] {ON} YMR276...   374   e-128
Kpol_1068.11 s1068 complement(21199..22344) [1146 bp, 381 aa] {O...   372   e-127
Skud_13.448 Chr13 (792186..793277) [1092 bp, 364 aa] {ON} YMR276...   371   e-127
ZYRO0G14124g Chr7 (1125418..1126527) [1110 bp, 369 aa] {ON} simi...   359   e-122
YMR276W Chr13 (818827..819948) [1122 bp, 373 aa] {ON}  DSK2Nucle...   353   e-120
Suva_13.464 Chr13 (801516..802616) [1101 bp, 366 aa] {ON} YMR276...   352   e-119
KLLA0D01859g Chr4 (161628..162743) [1116 bp, 371 aa] {ON} simila...   348   e-118
NDAI0K00440 Chr11 complement(99224..100438) [1215 bp, 404 aa] {O...   348   e-117
Ecym_4608 Chr4 (1185310..1186530) [1221 bp, 406 aa] {ON} similar...   347   e-117
ABL129W Chr2 (153723..154760) [1038 bp, 345 aa] {ON} Syntenic ho...   344   e-116
TPHA0I00220 Chr9 (39858..40991) [1134 bp, 377 aa] {ON} Anc_8.837...   341   e-115
TBLA0D03230 Chr4 complement(796939..798066) [1128 bp, 375 aa] {O...   340   e-114
KNAG0J00290 Chr10 complement(44234..45337) [1104 bp, 367 aa] {ON...   327   e-109
TBLA0B03240 Chr2 (756434..757288) [855 bp, 284 aa] {ON} Anc_8.83...    64   1e-10
TDEL0F04380 Chr6 complement(823866..823950,824011..824159) [234 ...    52   5e-08
Kpol_1036.62 s1036 complement(173662..173746,173844..173992) [23...    48   1e-06
TPHA0C00890 Chr3 (187882..188030,188103..188187) [234 bp, 77 aa]...    47   2e-06
ZYRO0D05962g Chr4 (506710..506858,506936..507020) [234 bp, 77 aa...    46   4e-06
TDEL0G01750 Chr7 (343412..343645) [234 bp, 77 aa] {ON} Anc_4.16 ...    45   6e-06
KLTH0G12540g Chr7 (1065801..1065949,1066013..1066097) [234 bp, 7...    45   7e-06
NDAI0H00270 Chr8 complement(45883..46116) [234 bp, 77 aa] {ON} A...    45   9e-06
SAKL0H15818g Chr8 (1379077..1379225,1379297..1379381) [234 bp, 7...    45   9e-06
NCAS0B03520 Chr2 complement(621285..621369,621473..621621) [234 ...    45   1e-05
NDAI0J01070 Chr10 (247102..247250,247366..247450) [234 bp, 77 aa...    45   1e-05
Skud_9.20 Chr9 (46249..46623) [375 bp, 125 aa] {ON} YKR094C (REAL)     46   2e-05
Smik_11.357 Chr11 complement(608082..608456) [375 bp, 125 aa] {O...    46   2e-05
Smik_9.21 Chr9 (46848..47219) [372 bp, 124 aa] {ON} YKR094C (REAL)     46   2e-05
Kwal_YGOB_Anc_5.701 s55 (88799..88806,89169..89547) [387 bp, 128...    45   2e-05
KLTH0E01078g Chr5 (105372..105379,105743..106121) [387 bp, 128 a...    45   2e-05
ZYRO0G06622g Chr7 (527968..527975,528043..528421) [387 bp, 128 a...    45   2e-05
KAFR0D02230 Chr4 (449707..449714,450088..450466) [387 bp, 128 aa...    45   2e-05
KAFR0H00220 Chr8 (32171..32178,32513..32891) [387 bp, 128 aa] {O...    45   2e-05
Suva_11.330 Chr11 complement(602690..603068,603446..603453) [387...    45   2e-05
Skud_11.333 Chr11 complement(599496..599874,600245..600252) [387...    45   2e-05
YIL148W Chr9 (68708..68715,69150..69528) [387 bp, 128 aa] {ON}  ...    45   2e-05
YKR094C Chr11 complement(617996..618374,618743..618750) [387 bp,...    45   2e-05
KLLA0A00616g Chr1 (59180..59187,59727..60105) [387 bp, 128 aa] {...    45   2e-05
TPHA0E00240 Chr5 (33468..33475,34104..34482) [387 bp, 128 aa] {O...    45   2e-05
TPHA0D04600 Chr4 complement(1005511..1005889,1006076..1006083) [...    45   2e-05
TBLA0E02110 Chr5 complement(516651..517029,517297..517304) [387 ...    45   2e-05
CAGL0G02475g Chr7 complement(220990..221368,222103..222110) [387...    45   2e-05
SAKL0E14894g Chr5 complement(1235488..1235866,1236205..1236212) ...    45   2e-05
Kpol_1043.69 s1043 complement(145335..145721) [387 bp, 128 aa] {...    45   2e-05
NDAI0E05030 Chr5 complement(1148916..1149294,1149627..1149634) [...    45   2e-05
NCAS0A03210 Chr1 (633779..633786,634077..634455) [387 bp, 128 aa...    45   2e-05
NCAS0G00240 Chr7 (39394..39401,39701..40079) [387 bp, 128 aa] {O...    45   2e-05
TDEL0B02200 Chr2 (395520..395527,395598..395976) [387 bp, 128 aa...    45   3e-05
KLTH0C03410g Chr3 complement(295299..296474) [1176 bp, 391 aa] {...    48   3e-05
Ecym_4019 Chr4 (48709..48716,49112..49490) [387 bp, 128 aa] {ON}...    45   3e-05
AFR285C Chr6 complement(950588..950966,951128..951135) [387 bp, ...    45   3e-05
KNAG0L02120 Chr12 complement(379968..380346,380662..380669) [387...    45   3e-05
SAKL0D11814g Chr4 (981832..983034) [1203 bp, 400 aa] {ON} simila...    47   4e-05
Suva_10.32 Chr10 complement(68200..68385) [186 bp, 62 aa] {ON} Y...    43   4e-05
AFR358W Chr6 (1087725..1088966) [1242 bp, 413 aa] {ON} Syntenic ...    47   4e-05
Kwal_27.10152 s27 complement(216695..217840) [1146 bp, 381 aa] {...    47   6e-05
KNAG0J02880 Chr10 (550889..551350) [462 bp, 153 aa] {ON} Anc_4.1...    45   7e-05
Ecym_8408 Chr8 (845058..845519) [462 bp, 153 aa] {ON} similar to...    44   7e-05
TPHA0K02250 Chr11 (482029..482490) [462 bp, 153 aa] {ON} Anc_4.1...    44   7e-05
KLLA0F17974g Chr6 (1644903..1645051,1645153..1645237) [234 bp, 7...    42   8e-05
TPHA0C02390 Chr3 complement(536137..536589) [453 bp, 150 aa] {ON...    44   1e-04
ZYRO0C04026g Chr3 (318229..318687) [459 bp, 152 aa] {ON} similar...    44   1e-04
KLTH0F08734g Chr6 complement(754886..755338) [453 bp, 150 aa] {O...    44   1e-04
Ecym_4181 Chr4 complement(379972..380430) [459 bp, 152 aa] {ON} ...    44   1e-04
Kwal_23.3311 s23 complement(238458..238910) [453 bp, 150 aa] {ON...    44   1e-04
SAKL0H13926g Chr8 complement(1189515..1189979) [465 bp, 154 aa] ...    44   1e-04
Suva_10.34 Chr10 complement(69167..69622) [456 bp, 151 aa] {ON} ...    44   1e-04
KNAG0C06580 Chr3 complement(1275504..1275945,1276297..1276304) [...    44   1e-04
KLLA0D18304g Chr4 (1545371..1545823) [453 bp, 150 aa] {ON} simil...    44   1e-04
KLTH0E05852g Chr5 complement(528861..530090) [1230 bp, 409 aa] {...    45   1e-04
NCAS0C02940 Chr3 complement(552015..552473) [459 bp, 152 aa] {ON...    44   2e-04
TBLA0G00670 Chr7 (142636..143325) [690 bp, 229 aa] {ON} Anc_4.16...    44   2e-04
NDAI0D04930 Chr4 (1172741..1173430) [690 bp, 229 aa] {ON}              44   2e-04
KAFR0I01470 Chr9 (306964..307653) [690 bp, 229 aa] {ON} Anc_5.70...    44   2e-04
YLR167W Chr12 (498947..499405) [459 bp, 152 aa] {ON}  RPS31Fusio...    44   2e-04
Suva_10.33 Chr10 complement(68388..69152) [765 bp, 254 aa] {ON} ...    45   2e-04
NDAI0G02280 Chr7 complement(511522..511980) [459 bp, 152 aa] {ON...    44   2e-04
KAFR0H02000 Chr8 complement(369778..370236) [459 bp, 152 aa] {ON...    44   2e-04
Suva_9.40 Chr9 (63806..64240) [435 bp, 144 aa] {ON} YIL148W (REAL)     43   2e-04
Kwal_55.20607 s55 complement(488683..489378) [696 bp, 231 aa] {O...    44   2e-04
AGL128W Chr7 (470174..470632) [459 bp, 152 aa] {ON} Syntenic hom...    43   2e-04
TDEL0F05100 Chr6 (959574..960026) [453 bp, 150 aa] {ON} Anc_8.38...    43   2e-04
CAGL0G08173g Chr7 (776549..777007) [459 bp, 152 aa] {ON} highly ...    43   2e-04
CAGL0B01589g Chr2 (145132..145280,145404..145488) [234 bp, 77 aa...    41   2e-04
SAKL0H25784g Chr8 (2259314..2260231) [918 bp, 305 aa] {ON} highl...    45   2e-04
Skud_12.29 Chr12 complement(55051..55829,56058..56424) [1146 bp,...    45   3e-04
YLL039C Chr12 complement(64062..65207) [1146 bp, 381 aa] {ON}  U...    45   3e-04
Suva_10.30 Chr10 complement(67747..67841,68061..68288,68558..690...    45   3e-04
ACL062C Chr3 complement(255353..256501) [1149 bp, 382 aa] {ON} S...    44   3e-04
KNAG0A02730 Chr1 complement(296966..297418) [453 bp, 150 aa] {ON...    43   3e-04
KLLA0E00749g Chr5 complement(74948..76093) [1146 bp, 381 aa] {ON...    44   3e-04
CAGL0L01309g Chr12 complement(148931..150109) [1179 bp, 392 aa] ...    44   3e-04
Smik_12.18 Chr12 complement(49088..49552,49091..49552,49091..495...    44   3e-04
Kpol_1070.6 s1070 complement(16980..18581) [1602 bp, 533 aa] {ON...    45   3e-04
Kpol_1030.5 s1030 complement(10263..10721) [459 bp, 152 aa] {ON}...    42   3e-04
Kpol_1024.16 s1024 complement(58683..59141) [459 bp, 152 aa] {ON...    42   3e-04
ZYRO0G07854g Chr7 complement(634289..635671) [1383 bp, 460 aa] {...    44   3e-04
CAGL0D05082g Chr4 (488733..490334) [1602 bp, 533 aa] {ON} simila...    44   3e-04
NCAS0C05850 Chr3 (1203331..1204497) [1167 bp, 388 aa] {ON}             44   3e-04
Suva_10.266 Chr10 (471118..471576) [459 bp, 152 aa] {ON} YLR167W...    42   3e-04
Skud_12.234 Chr12 (445677..446135) [459 bp, 152 aa] {ON} YLR167W...    42   3e-04
Smik_12.229 Chr12 (446071..446529) [459 bp, 152 aa] {ON} YLR167W...    42   3e-04
TBLA0H03180 Chr8 (775282..775740) [459 bp, 152 aa] {ON} Anc_8.38...    42   4e-04
Ecym_3572 Chr3 complement(1083184..1084515) [1332 bp, 443 aa] {O...    44   5e-04
NDAI0F00300 Chr6 (66116..66679) [564 bp, 187 aa] {ON} Anc_5.701        42   6e-04
KAFR0C03000 Chr3 (597127..598320) [1194 bp, 397 aa] {ON} Anc_8.1...    42   0.001
KAFR0E00530 Chr5 complement(113019..114158) [1140 bp, 379 aa] {O...    42   0.002
KLLA0E22133g Chr5 complement(1974635..1975786) [1152 bp, 383 aa]...    42   0.002
TBLA0B02160 Chr2 complement(496901..498115) [1215 bp, 404 aa] {O...    42   0.002
TPHA0O00440 Chr15 (78697..79806) [1110 bp, 369 aa] {ON} Anc_1.48...    41   0.004
NCAS0G04120 Chr7 (768760..769938) [1179 bp, 392 aa] {ON} Anc_1.4...    40   0.005
YDR139C Chr4 complement(733618..733702,733776..733924) [234 bp, ...    37   0.006
Suva_5.32 Chr5 complement(56798..58027) [1230 bp, 409 aa] {ON} Y...    40   0.009
TBLA0D02210 Chr4 (555236..556927) [1692 bp, 563 aa] {ON} Anc_8.1...    40   0.010
Skud_5.53 Chr5 complement(79502..80695) [1194 bp, 397 aa] {ON} Y...    39   0.013
NCAS0B04590 Chr2 complement(835478..836821) [1344 bp, 447 aa] {O...    39   0.017
CAGL0L06028g Chr12 complement(677581..679098) [1518 bp, 505 aa] ...    39   0.019
NDAI0B01850 Chr2 complement(440321..441532) [1212 bp, 403 aa] {O...    38   0.026
YEL037C Chr5 complement(81407..82603) [1197 bp, 398 aa] {ON}  RA...    38   0.031
NDAI0G00330 Chr7 complement(54805..56088) [1284 bp, 427 aa] {ON}...    38   0.036
SAKL0H24772g Chr8 complement(2155837..2157081) [1245 bp, 414 aa]...    37   0.049
TDEL0C02590 Chr3 complement(448900..450006) [1107 bp, 368 aa] {O...    37   0.076
Smik_5.56 Chr5 complement(83505..84698) [1194 bp, 397 aa] {ON} Y...    37   0.098
Smik_7.91 Chr7 (152642..153637,153905..154108) [1200 bp, 399 aa]...    36   0.17 
TDEL0B04690 Chr2 (832571..833899) [1329 bp, 442 aa] {ON} Anc_8.1...    36   0.18 
YGL181W Chr7 (157906..159096) [1191 bp, 396 aa] {ON}  GTS1Protei...    36   0.18 
KAFR0I02780 Chr9 (560687..561331) [645 bp, 214 aa] {ON} Anc_1.48...    34   0.33 
ZYRO0F05192g Chr6 (434982..436136) [1155 bp, 384 aa] {ON} simila...    35   0.35 
NCAS0C04090 Chr3 (833393..834583) [1191 bp, 396 aa] {ON} Anc_8.142     35   0.38 
Suva_7.81 Chr7 (153418..154434,154933..155121) [1206 bp, 401 aa]...    34   0.49 
Suva_10.31 Chr10 complement(68008..68199) [192 bp, 64 aa] {ON} Y...    30   0.92 
Kpol_370.6 s370 (10094..11308) [1215 bp, 404 aa] {ON} (10094..11...    33   1.3  
Skud_7.90 Chr7 (163529..164719) [1191 bp, 396 aa] {ON} YGL181W (...    31   4.7  
Kpol_541.50 s541 complement(162130..163665) [1536 bp, 511 aa] {O...    31   7.1  
KNAG0M01170 Chr13 complement(211476..212495) [1020 bp, 339 aa] {...    30   7.4  
Kwal_23.5606 s23 complement(1234938..1235555) [618 bp, 205 aa] {...    30   7.7  
TPHA0H00400 Chr8 (77122..78522) [1401 bp, 466 aa] {ON} Anc_8.142...    30   8.8  

>Kwal_27.10275 s27 complement(273277..274416) [1140 bp, 379 aa] {ON}
           YMR276W (DSK2) - ubiquitin-like protein [contig 37] FULL
          Length = 379

 Score =  602 bits (1551), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/379 (81%), Positives = 310/379 (81%)

Query: 1   MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
           MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY
Sbjct: 1   MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60

Query: 61  KILDGHAVHLVKSGTKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFNPLSD 120
           KILDGHAVHLVKSGTK                                      FNPLSD
Sbjct: 61  KILDGHAVHLVKSGTKSGSGAIGAPGSGSTAPTNTASSGAAAAPASLSSGQAGGFNPLSD 120

Query: 121 LTSARYAGYLNLPSADSFGPDGGMTSAPNSDDMLRMLENPVMQSQMNEMLSNPQMIDFLI 180
           LTSARYAGYLNLPSADSFGPDGGMTSAPNSDDMLRMLENPVMQSQMNEMLSNPQMIDFLI
Sbjct: 121 LTSARYAGYLNLPSADSFGPDGGMTSAPNSDDMLRMLENPVMQSQMNEMLSNPQMIDFLI 180

Query: 181 QQSPQLQSMGPQARQMLQSPFFRQMMTNPEMIRQSMQFSGVLGGAGDPSAAGANAFPAPG 240
           QQSPQLQSMGPQARQMLQSPFFRQMMTNPEMIRQSMQFSGVLGGAGDPSAAGANAFPAPG
Sbjct: 181 QQSPQLQSMGPQARQMLQSPFFRQMMTNPEMIRQSMQFSGVLGGAGDPSAAGANAFPAPG 240

Query: 241 TADSDASAQPASTNTSTADAAQSATNANPFXXXXXXXXXXXXXXXXXXNPFLSMXXXXXX 300
           TADSDASAQPASTNTSTADAAQSATNANPF                  NPFLSM      
Sbjct: 241 TADSDASAQPASTNTSTADAAQSATNANPFASLLAGQAAAPGGASAPANPFLSMLGQQAP 300

Query: 301 XXXXXXXFDPAMLSALLGGAGNNASQQPQDTRPPEERYEQQLRQLNDMGFFEFDRNVAAL 360
                  FDPAMLSALLGGAGNNASQQPQDTRPPEERYEQQLRQLNDMGFFEFDRNVAAL
Sbjct: 301 GAGGLPAFDPAMLSALLGGAGNNASQQPQDTRPPEERYEQQLRQLNDMGFFEFDRNVAAL 360

Query: 361 RRSGGSVQGALDALLNGDV 379
           RRSGGSVQGALDALLNGDV
Sbjct: 361 RRSGGSVQGALDALLNGDV 379

>KLTH0C03938g Chr3 complement(344354..345484) [1131 bp, 376 aa] {ON}
           some similarities with uniprot|P48510 Saccharomyces
           cerevisiae YMR276W DSK2 Nuclear-enriched ubiquitin-like
           polyubiquitin-binding protein required for spindle pole
           body (SPB) duplication and for transit through the G2/M
           phase of the cell cycle involved in proteolysis
           interacts with the proteasome
          Length = 376

 Score =  446 bits (1147), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 251/386 (65%), Positives = 278/386 (72%), Gaps = 17/386 (4%)

Query: 1   MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
           MSITVH+KSGQ+KWDV++D  ST+AQFK+AIA  S+IAPENQRLIYSGKILKDDQT+ESY
Sbjct: 1   MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60

Query: 61  KILDGHAVHLVKSGTKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX------ 114
           KILD H+VHLVKSG                                              
Sbjct: 61  KILDDHSVHLVKSGGSKKATSPGATAAASGDATATGATSTPAAQPQQSAPANLSTGQGNG 120

Query: 115 FNPLSDLTSARYAGYLNLPSADSFGPDGGMTSAPNSDDMLRMLENPVMQSQMNEMLSNPQ 174
           FNPLSDLTSARYAG+LNLPSADSFGPDGGMTSAPNSDD+LRMLENPVMQSQMNEMLSNPQ
Sbjct: 121 FNPLSDLTSARYAGFLNLPSADSFGPDGGMTSAPNSDDVLRMLENPVMQSQMNEMLSNPQ 180

Query: 175 MIDFLIQQSPQLQSMGPQARQMLQSPFFRQMMTNPEMIRQSMQFSGVLGGAGDPSAAGAN 234
           MIDFLIQQSPQLQSMGPQAR +LQSPFFRQMMTNP+MIRQSMQFS +LGG    +A G +
Sbjct: 181 MIDFLIQQSPQLQSMGPQARTLLQSPFFRQMMTNPDMIRQSMQFSSMLGGDS--AAGGGS 238

Query: 235 AFPAPGT-ADSDASAQPASTNTSTADAAQSATNANPFXXXXXXXXXXXXXXXXXXNPFLS 293
           +FPAPGT A++DA +QPA+  ++   A      ANPF                  NPFLS
Sbjct: 239 SFPAPGTPAEADAPSQPAANPSAAPSAG----TANPF-ASLLGGQAGASGASPAANPFLS 293

Query: 294 MXXXXXXXXXXXXXFDPAMLSALLGGAGNNASQQPQDTRPPEERYEQQLRQLNDMGFFEF 353
           M              DP +LS++LGGAG  A+QQPQDTRPPEERYE QLRQLNDMGFFEF
Sbjct: 294 M--LGGGSAGTPPALDPMVLSSILGGAG-AANQQPQDTRPPEERYEHQLRQLNDMGFFEF 350

Query: 354 DRNVAALRRSGGSVQGALDALLNGDV 379
           DRNVAALRRSGGSVQGALDALLNGDV
Sbjct: 351 DRNVAALRRSGGSVQGALDALLNGDV 376

>KAFR0B03900 Chr2 (810391..811530) [1140 bp, 379 aa] {ON} Anc_8.837
           YMR276W
          Length = 379

 Score =  403 bits (1036), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 216/390 (55%), Positives = 258/390 (66%), Gaps = 22/390 (5%)

Query: 1   MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
           MSIT+H+KSGQ+KWDV+ +   ++A  K  I++ S+I   NQRLIYSGKILKDDQT+ESY
Sbjct: 1   MSITIHIKSGQNKWDVNTNLSDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESY 60

Query: 61  KILDGHAVHLVKSGTKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFNPLSD 120
           KI +GH++HLVKSG                                        FNPL+D
Sbjct: 61  KIEEGHSIHLVKSGGNVARNSAATNTTPTATSNENTNSAPSVPSNIASGQTGG-FNPLND 119

Query: 121 LTSARYAGYLNLPSADSFGPDGGMTSAPNSDDMLRMLENPVMQSQMNEMLSNPQMIDFLI 180
           LTSARYAGYLN+PSAD FGPDGG+ S P+ DDMLRML+NPV QSQMNEMLSNPQMIDF+I
Sbjct: 120 LTSARYAGYLNMPSADMFGPDGGLNSGPSQDDMLRMLDNPVFQSQMNEMLSNPQMIDFMI 179

Query: 181 QQSPQLQSMGPQARQMLQSPFFRQMMTNPEMIRQSMQFSGVLGGAGDPSAAGAN--AFPA 238
           Q +PQLQ+MGPQARQMLQSP FRQM+ NP+MIRQSMQF+ ++ G  DP+A G +  AFPA
Sbjct: 180 QSNPQLQAMGPQARQMLQSPMFRQMLINPDMIRQSMQFARMMNGGNDPAATGNDPSAFPA 239

Query: 239 PGTADSDASAQ--PASTNTSTADAAQSATN-------ANPFXXXXXXXXXXXXXXXXXXN 289
           PG A +  + Q   AS  ++TA  A + TN       ANPF                  N
Sbjct: 240 PGEASASTNEQNTNASGESTTAGGATNNTNSTSAPAAANPF----------DALFNPAAN 289

Query: 290 PFLSMXXXXXXXXXXXXXFDPAMLSALLGGAGNNASQQPQDTRPPEERYEQQLRQLNDMG 349
           PF +M             FDPA+L+++LG   +  +   QD RPPEERYE QLRQLNDMG
Sbjct: 290 PFGAMSSNTNGSQPQQPAFDPALLASMLGMPQSQQTPAQQDNRPPEERYEAQLRQLNDMG 349

Query: 350 FFEFDRNVAALRRSGGSVQGALDALLNGDV 379
           FF+FDRNVAALRRSGGSVQGALDALLNGDV
Sbjct: 350 FFDFDRNVAALRRSGGSVQGALDALLNGDV 379

>SAKL0D01540g Chr4 complement(124423..125520) [1098 bp, 365 aa] {ON}
           similar to uniprot|P48510 Saccharomyces cerevisiae
           YMR276W DSK2 Nuclear-enriched ubiquitin-like
           polyubiquitin- binding protein required for spindle pole
           body (SPB) duplication and for transit through the G2/M
           phase of the cell cycle involved in proteolysis
           interacts with the proteasome
          Length = 365

 Score =  393 bits (1010), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 221/386 (57%), Positives = 262/386 (67%), Gaps = 28/386 (7%)

Query: 1   MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
           MSIT+H+KSGQ+KWDVS++  +TV + K AI++ S+I P NQRLIYSGKILKDDQT+ESY
Sbjct: 1   MSITLHIKSGQNKWDVSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESY 60

Query: 61  KILDGHAVHLVKSGTKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFNPLSD 120
           KI D HAVHLV+SG                                        FNPL+D
Sbjct: 61  KIADDHAVHLVRSGGPKPAASKSESTSATDTGAAAAAAVPSNISSGQTGG----FNPLAD 116

Query: 121 LTSARYAGYLNLPSADSFGPDGGMTSAPNSDDMLRMLENPVMQSQMNEMLSNPQMIDFLI 180
           LT ARYAGY NLPSAD FGPDGG+T+APNSD++L ML+NP++QSQMNEMLSNPQM+DF+I
Sbjct: 117 LTGARYAGYANLPSADMFGPDGGLTNAPNSDEILNMLDNPIVQSQMNEMLSNPQMVDFMI 176

Query: 181 QQSPQLQSMGPQARQMLQSPFFRQMMTNPEMIRQSMQFSGVLGGAGDPSAAGANAFPAPG 240
           QQ+PQLQ+MGP+AR++LQS +FRQMMTNP+MIRQSMQF+ + G  G  +     AFPAPG
Sbjct: 177 QQNPQLQAMGPRARELLQSDYFRQMMTNPDMIRQSMQFARMFGMEG--AEGAGGAFPAPG 234

Query: 241 TADSDASAQ--PASTNTS---TADAAQSATNANPFXXXXXXXXXXXXXXXXXXNPFLSMX 295
           TA   AS +  PA T  S   T + + ++  ANPF                  NPF SM 
Sbjct: 235 TATQTASTEGGPAGTTASPSTTGNGSANSEAANPF----------ASLFNGQANPFASM- 283

Query: 296 XXXXXXXXXXXXFDPAMLSALLGG--AGNNASQQPQDTRPPEERYEQQLRQLNDMGFFEF 353
                       FDP++LS+ LGG  A     QQPQD RPPEERYEQQLRQLNDMGFF+F
Sbjct: 284 ----FPNGRAPQFDPSLLSSFLGGNTAAPGQQQQPQDNRPPEERYEQQLRQLNDMGFFDF 339

Query: 354 DRNVAALRRSGGSVQGALDALLNGDV 379
           DRNVAALRRSGGSVQGALDALLNGDV
Sbjct: 340 DRNVAALRRSGGSVQGALDALLNGDV 365

>TDEL0B00600 Chr2 complement(115615..116724) [1110 bp, 369 aa] {ON}
           Anc_8.837 YMR276W
          Length = 369

 Score =  391 bits (1005), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 219/384 (57%), Positives = 259/384 (67%), Gaps = 20/384 (5%)

Query: 1   MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
           MSITV VK GQSKW+VSV+ + TVA+FK  IA+ S+I   NQRLIYSGKILKDDQ +ESY
Sbjct: 1   MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60

Query: 61  KILDGHAVHLVKSGTKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFNPLSD 120
           KI DGHA+HLVKSG                                        FNPLSD
Sbjct: 61  KIQDGHAIHLVKSG--GGGGNTAAKASTSSQESNTAAPGSATVPSNIASGQTGGFNPLSD 118

Query: 121 LTSARYAGYLNLPSADSFGPDGGMTSAPNSDDMLRMLENPVMQSQMNEMLSNPQMIDFLI 180
           LTSARYAG+ NLPSAD FGPDGG+T+ PN DDML MLENP+ QSQMNEMLSNPQM+DF+I
Sbjct: 119 LTSARYAGFTNLPSADMFGPDGGLTNMPNQDDMLGMLENPIFQSQMNEMLSNPQMVDFMI 178

Query: 181 QQSPQLQSMGPQARQMLQSPFFRQMMTNPEMIRQSMQFSGVLGGAGDPSAAGANAFPAPG 240
           Q +PQLQ+MGPQARQ+LQSPFFRQM+TNP+M+RQSMQFS ++  +G   AA A +FPAPG
Sbjct: 179 QSNPQLQAMGPQARQLLQSPFFRQMLTNPQMLRQSMQFSSMMNPSGGNDAAAA-SFPAPG 237

Query: 241 TADSDASAQPASTNTSTADAAQSATNANPFXXXXXXXXXXXXXXXXXXNPFLSM---XXX 297
            + ++AS+  A+T+ +    A + TNA                     NP  SM      
Sbjct: 238 DSTTEASSTEANTDANANTNANANTNA---------ANPFAAMFNPGSNPLASMFGNQGV 288

Query: 298 XXXXXXXXXXFDPAMLSALLGGAGNNASQQ--PQDTRPPEERYEQQLRQLNDMGFFEFDR 355
                     FDP+ML++LLGG    A+QQ   QD RPPEERYEQQLRQLNDMGFF+F++
Sbjct: 289 GAADNQQNQPFDPSMLASLLGGG---AAQQRAEQDNRPPEERYEQQLRQLNDMGFFDFEK 345

Query: 356 NVAALRRSGGSVQGALDALLNGDV 379
           NVAALRRSGGSVQGALD+LLNGDV
Sbjct: 346 NVAALRRSGGSVQGALDSLLNGDV 369

>CAGL0M02937g Chr13 (331097..332218) [1122 bp, 373 aa] {ON} highly
           similar to uniprot|P48510 Saccharomyces cerevisiae
           YMR276w DSK2
          Length = 373

 Score =  386 bits (992), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 211/386 (54%), Positives = 252/386 (65%), Gaps = 20/386 (5%)

Query: 1   MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
           MSIT+H+KSGQ+KWDVS+D   T+   K  IA+ S+I   NQRLIYSGKILKDDQT+ESY
Sbjct: 1   MSITIHIKSGQNKWDVSIDPSQTILNLKEEIAKVSEIPSGNQRLIYSGKILKDDQTVESY 60

Query: 61  KILDGHAVHLVKSGTKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFNPLSD 120
            I D HA+H+VKSG                                        FNPL+D
Sbjct: 61  NIKDDHAIHMVKSGGNASTSNAPTNANESSNSSTTAVPSNIASGQTGG------FNPLAD 114

Query: 121 LTSARYAGYLNLPSADSFGPDGGMTSAPNSDDMLRMLENPVMQSQMNEMLSNPQMIDFLI 180
           LT ARYAGY NLPSAD FGPDGG+ +AP+ D+MLRM+ENP+ QSQMNEMLSNP+M+DF+I
Sbjct: 115 LTGARYAGYANLPSADMFGPDGGINNAPDQDEMLRMMENPIFQSQMNEMLSNPEMLDFMI 174

Query: 181 QQSPQLQSMGPQARQMLQSPFFRQMMTNPEMIRQSMQFSGVLGGAG---DPSAAGANAFP 237
           Q +PQLQ+MGPQARQMLQSPFFRQM+TNP MIRQSMQF+ ++ G G      A  A+AFP
Sbjct: 175 QSNPQLQAMGPQARQMLQSPFFRQMLTNPAMIRQSMQFARMMNGQGGMPGADATDASAFP 234

Query: 238 APGTADSDASAQPASTNTSTADAAQSATNANPFXXXXXXXXXXXXXXXXXXNPFLSMXXX 297
           APG  D++ +   ++ NTST     + TN+N                    NPF +M   
Sbjct: 235 APGGDDTETTTG-STENTST----NNRTNSNANANPNAAANPFAALMDPASNPFAAMMGN 289

Query: 298 XXXXXXXXX----XFDPAMLSALLGGAGNNASQQPQDTRPPEERYEQQLRQLNDMGFFEF 353
                         FDP +L++LLGG     +Q  +D RPPEERYEQQLRQLNDMGFF+F
Sbjct: 290 MNNQQGGAGVQQPAFDPTLLASLLGGQLPAPAQ--EDNRPPEERYEQQLRQLNDMGFFDF 347

Query: 354 DRNVAALRRSGGSVQGALDALLNGDV 379
           DRNVAALRRSGGSVQGALDALLNGDV
Sbjct: 348 DRNVAALRRSGGSVQGALDALLNGDV 373

>NCAS0C00430 Chr3 complement(67718..68827) [1110 bp, 369 aa] {ON}
           Anc_8.837 YMR276W
          Length = 369

 Score =  375 bits (962), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 204/389 (52%), Positives = 254/389 (65%), Gaps = 30/389 (7%)

Query: 1   MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
           MSI++HVKSGQ+ W VS+D  ST+ Q K  IA+ S++   NQRLI+SGKILKDDQT+E Y
Sbjct: 1   MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60

Query: 61  KILDGHAVHLVKSGTKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFNPLSD 120
           KILDG ++H+VKSG                                        FNPLSD
Sbjct: 61  KILDGLSIHMVKSG--------GGSANKNKSPPPQANTTATPVAPNMAAGETGGFNPLSD 112

Query: 121 LTSARYAGYLNLPSADSFGPDGGMT-SAPNSDDMLRMLENPVMQSQMNEMLSNPQMIDFL 179
           LTSARYAGYLNLPSAD+FGPDGG+  S PN D+MLRML+NPV QSQMNEMLSNPQM+DF+
Sbjct: 113 LTSARYAGYLNLPSADTFGPDGGLNNSGPNQDEMLRMLDNPVFQSQMNEMLSNPQMLDFI 172

Query: 180 IQQSPQLQSMGPQARQMLQSPFFRQMMTNPEMIRQSMQFSGVLGGAGDPSAAG----ANA 235
           IQ +PQLQ+MGPQARQ+LQ+P FRQM+TNP+MIRQSMQ +  + G  DP+  G    ++ 
Sbjct: 173 IQANPQLQAMGPQARQILQNPMFRQMLTNPDMIRQSMQMARAMNGGVDPNGNGQANTSSD 232

Query: 236 FPAPGTADSDASAQ--PASTNTSTADAAQSATN--ANPFXXXXXXXXXXXXXXXXXXNPF 291
           FPAPG  D +  ++  P++TNT++ + + +AT   ANPF                  NPF
Sbjct: 233 FPAPGGDDDNTVSENTPSTTNTASTNPSSTATTNAANPF----------ASLFNPAMNPF 282

Query: 292 LS-MXXXXXXXXXXXXXFDPAMLSALLGGAGNNASQQPQDTRPPEERYEQQLRQLNDMGF 350
            + M             FDP+  +++         Q  +DTRPPEERYE QLRQLNDMGF
Sbjct: 283 AAGMANTNAAGSGNPPAFDPSFFASMFQPPAAQQQQ--EDTRPPEERYEHQLRQLNDMGF 340

Query: 351 FEFDRNVAALRRSGGSVQGALDALLNGDV 379
           F+FDRNVAALRRSGG+V+ AL+ALLNGDV
Sbjct: 341 FDFDRNVAALRRSGGNVESALNALLNGDV 369

>Smik_13.489 Chr13 (801868..802986) [1119 bp, 372 aa] {ON} YMR276W
           (REAL)
          Length = 372

 Score =  374 bits (960), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 211/389 (54%), Positives = 256/389 (65%), Gaps = 27/389 (6%)

Query: 1   MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
           MS+ +H+KSGQ KW+VSV  +STV+QFK AI++ + +   NQRLIYSGKILKDDQT+ESY
Sbjct: 1   MSLNIHIKSGQDKWEVSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESY 60

Query: 61  KILDGHAVHLVKSGTKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFNPLSD 120
            I DGH+VHLVKS  K                                      FNPL+D
Sbjct: 61  HIQDGHSVHLVKSQPKPQPGAAAGTNNATATGAAAGTVATPNMSSGQSAG----FNPLAD 116

Query: 121 LTSARYAGYLNLPSADSFGPDGGMTS--APNSDDMLRMLENPVMQSQMNEMLSNPQMIDF 178
           LTSARYAGYLN+PSAD FGPDGG  +  + N D++LRM+ENP+ QSQMNEMLSNPQM+DF
Sbjct: 117 LTSARYAGYLNMPSADMFGPDGGALNNDSNNQDELLRMMENPIFQSQMNEMLSNPQMLDF 176

Query: 179 LIQQSPQLQSMGPQARQMLQSPFFRQMMTNPEMIRQSMQFSGVLG-GAGDPSAAG-ANAF 236
           +IQ +PQLQ+MGPQARQMLQSP FRQM+TNP+MIRQSMQF+ ++   AG  S  G A+AF
Sbjct: 177 MIQSNPQLQAMGPQARQMLQSPMFRQMLTNPDMIRQSMQFARMMDPNAGTGSTGGAASAF 236

Query: 237 PAPGTADSDASA-----QPASTNTSTADAAQSATNANPFXXXXXXXXXXXXXXXXXXNPF 291
           PAPG    + SA        +++ +    A S+T ANPF                  NPF
Sbjct: 237 PAPGGDAPEESANTNTNTNTASSPNAGSNASSSTAANPF----------ASLLNPALNPF 286

Query: 292 LSMXXXXXXXXXXXXXFDPAMLSALLGGAGNNA-SQQPQDTRPPEERYEQQLRQLNDMGF 350
            S              FDPA+L+++      +A + QP+DTRPPEERYE QLRQLNDMGF
Sbjct: 287 AS---AGNATGTGMPAFDPALLASMFQPQQASAQASQPEDTRPPEERYEHQLRQLNDMGF 343

Query: 351 FEFDRNVAALRRSGGSVQGALDALLNGDV 379
           F+FDRNVAALRRSGGSVQGALD+LLNGDV
Sbjct: 344 FDFDRNVAALRRSGGSVQGALDSLLNGDV 372

>Kpol_1068.11 s1068 complement(21199..22344) [1146 bp, 381 aa] {ON}
           complement(21199..22344) [1146 nt, 382 aa]
          Length = 381

 Score =  372 bits (956), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 217/397 (54%), Positives = 249/397 (62%), Gaps = 34/397 (8%)

Query: 1   MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
           M I +H+KSGQ+KW+V+VD  +TV Q K  IA+ S+I  ENQRLIYSGKILKDDQ LE Y
Sbjct: 1   MGIKIHIKSGQNKWEVTVDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFY 60

Query: 61  KILDGHAVHLVKSGTKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFNPLSD 120
           KI D H++HLVKSG                                        FNPLSD
Sbjct: 61  KIQDEHSIHLVKSGG-ASKTNTSASAAAASTSTATNSDSNAPLPSNIAAGQSGGFNPLSD 119

Query: 121 LTSARYAGY-LNLPSADSFGPDGGMTSAPNSDDMLRMLENPVMQSQMNEMLSNPQMIDFL 179
           LTSARYAGY LNLPSAD FGPDGGM S PN DDMLRMLENPV QSQMNEMLSNPQMIDF+
Sbjct: 120 LTSARYAGYGLNLPSADMFGPDGGMNSMPNQDDMLRMLENPVFQSQMNEMLSNPQMIDFM 179

Query: 180 IQQSPQLQSMGPQARQMLQSPFFRQMMTNPEMIRQSMQFSGVLGGAGDPSA-AGANAFPA 238
           IQ +PQLQ+MGP+ARQM QSPFFRQM+TNPEMIRQSMQ + ++GG G   A A A++FPA
Sbjct: 180 IQSNPQLQAMGPEARQMFQSPFFRQMLTNPEMIRQSMQMANMMGGNGQFGANAAASSFPA 239

Query: 239 PGTADSDASAQPASTNTSTADAAQSATNA-----NPFXXXXXXXXXXXXXXXXXXNPFLS 293
           PG  D+ A+A+   TNT T     +   A     NPF                  NPF +
Sbjct: 240 PGETDTTAAAE---TNTETTSTPAATGAAAAGQQNPFASLFNPAM----------NPFAA 286

Query: 294 MXXXXXXXXXXXX-----------XFDPAMLSALLGGAGNNASQQPQDTRPPEERYEQQL 342
           M                        FDP++ +++         QQ QD RPPEERYE QL
Sbjct: 287 MMNNNAAAAAGAGATGAAGATGTPAFDPSLFASMF--QPPQQQQQEQDNRPPEERYESQL 344

Query: 343 RQLNDMGFFEFDRNVAALRRSGGSVQGALDALLNGDV 379
           RQLNDMGFF+FDRNVAALRRSGGSVQGALDALL+ DV
Sbjct: 345 RQLNDMGFFDFDRNVAALRRSGGSVQGALDALLSNDV 381

>Skud_13.448 Chr13 (792186..793277) [1092 bp, 364 aa] {ON} YMR276W
           (REAL)
          Length = 364

 Score =  371 bits (952), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 211/386 (54%), Positives = 255/386 (66%), Gaps = 29/386 (7%)

Query: 1   MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
           MS+ +H+KSGQ KW+V+V  + TV QFK AI++ + I   NQRLIYSGKILKDDQT++SY
Sbjct: 1   MSLNIHIKSGQDKWEVAVAPECTVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSY 60

Query: 61  KILDGHAVHLVKSGTKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFNPLSD 120
            I DGH+VHLVKS  K                                      FNPL+D
Sbjct: 61  HIQDGHSVHLVKSQPKPDAGGATGANNATATSAAVGTSATPNMSSGQSAG----FNPLAD 116

Query: 121 LTSARYAGYLNLPSADSFGPDGGMTS--APNSDDMLRMLENPVMQSQMNEMLSNPQMIDF 178
           LTSARYAGYLN+PSAD FGPDGG  +  + N D++LRM+ENP+ QSQMNEMLSNPQM+DF
Sbjct: 117 LTSARYAGYLNMPSADMFGPDGGALNNDSNNQDELLRMMENPIFQSQMNEMLSNPQMLDF 176

Query: 179 LIQQSPQLQSMGPQARQMLQSPFFRQMMTNPEMIRQSMQFSGVLGGAGDPSAAGANAFPA 238
           +IQ +PQLQ+MGPQARQMLQSP FRQM+TNPEM+RQSMQF+ ++    D SA  A+AFPA
Sbjct: 177 MIQSNPQLQAMGPQARQMLQSPMFRQMLTNPEMMRQSMQFARMMDPNADNSA--ASAFPA 234

Query: 239 PGTADSDASAQPASTN---TSTADAAQSAT-NANPFXXXXXXXXXXXXXXXXXXNPFLSM 294
           PG    DAS + A+TN   +S A    SA   ANPF                  NPF + 
Sbjct: 235 PG---GDASEEGANTNAVPSSNAGTNGSANAAANPF----------ASLLNPALNPFAN- 280

Query: 295 XXXXXXXXXXXXXFDPAMLSALLGGAGNNA-SQQPQDTRPPEERYEQQLRQLNDMGFFEF 353
                        FDPA+L+++      +A + QP+D+RPPEERYE QLRQLNDMGFF+F
Sbjct: 281 --AGNTAPTGMPAFDPALLASMFQPQQASAQASQPEDSRPPEERYEHQLRQLNDMGFFDF 338

Query: 354 DRNVAALRRSGGSVQGALDALLNGDV 379
           DRNVAALRRSGGSVQGALD+LLNGDV
Sbjct: 339 DRNVAALRRSGGSVQGALDSLLNGDV 364

>ZYRO0G14124g Chr7 (1125418..1126527) [1110 bp, 369 aa] {ON} similar
           to uniprot|P48510 Saccharomyces cerevisiae YMR276W DSK2
           Nuclear-enriched ubiquitin-like polyubiquitin- binding
           protein required for spindle pole body (SPB) duplication
           and for transit through the G2/M phase of the cell cycle
           involved in proteolysis interacts with the proteasome
          Length = 369

 Score =  359 bits (921), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 198/388 (51%), Positives = 244/388 (62%), Gaps = 31/388 (7%)

Query: 2   SITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESYK 61
           +ITV +KSGQ+KW+V+VD +STV+ FK  I++ S+I   +QRLIYSGKILKDDQTL+ Y 
Sbjct: 3   TITVQIKSGQNKWEVTVDPESTVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYN 62

Query: 62  ILDGHAVHLVKSGTKXXXXXXXXXXXXXXX----------XXXXXXXXXXXXXXXXXXXX 111
           + DGH+VHLVKS                                                
Sbjct: 63  LQDGHSVHLVKSSKAPGNASGGSSSTAAATAGSGASAVPPSGNASTTPTTGAPSNLSAGQ 122

Query: 112 XXXFNPLSDLTSARYAGYLNLPSADSFGPDGGMTSAPNSDDMLRMLENPVMQSQMNEMLS 171
              FNPL+DLTSARYAG+ +LPSAD FGPDGG T+ PN +D+L ML+NP+ QSQMNEMLS
Sbjct: 123 SGGFNPLADLTSARYAGFTSLPSADMFGPDGGATNMPNQEDLLNMLDNPIFQSQMNEMLS 182

Query: 172 NPQMIDFLIQQSPQLQSMGPQARQMLQSPFFRQMMTNPEMIRQSMQFSGVLGGAGDPSAA 231
           NPQM+DF+IQ +PQLQ+MGPQARQM QSPFFRQM+TNP+MIRQSMQF+ ++   G  + A
Sbjct: 183 NPQMVDFMIQSNPQLQAMGPQARQMFQSPFFRQMLTNPQMIRQSMQFARMMNPGGGENDA 242

Query: 232 GANAFPAPGTADSDASAQPASTNTSTADAAQSATNANPFXXXXXXXXXXXXXXXXXXNPF 291
            ANAFPAPG  +++                +SA  AN                    NPF
Sbjct: 243 -ANAFPAPGNENTE---------------GESAAGAN--DGGNPAAAATNAGAPPAGNPF 284

Query: 292 LSMXXXXXXXXXXXXXFDPAMLSALLGGAGNNASQQPQDTRPPEERYEQQLRQLNDMGFF 351
            ++              DP +L+++LG    +  QQPQD RPPEERYE QLRQLN+MGFF
Sbjct: 285 AALLGGGGPLQQPGGL-DPQLLASMLGAP--SQQQQPQDNRPPEERYETQLRQLNEMGFF 341

Query: 352 EFDRNVAALRRSGGSVQGALDALLNGDV 379
           +FDRNVAALRRSGGSVQGALD+LLNGDV
Sbjct: 342 DFDRNVAALRRSGGSVQGALDSLLNGDV 369

>YMR276W Chr13 (818827..819948) [1122 bp, 373 aa] {ON}
           DSK2Nuclear-enriched ubiquitin-like
           polyubiquitin-binding protein, required for spindle pole
           body (SPB) duplication and for transit through the G2/M
           phase of the cell cycle, involved in proteolysis,
           interacts with the proteasome
          Length = 373

 Score =  353 bits (906), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 209/398 (52%), Positives = 249/398 (62%), Gaps = 44/398 (11%)

Query: 1   MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
           MS+ +H+KSGQ KW+V+V  +STV QFK AI + + I   NQRLIYSGKILKDDQT+ESY
Sbjct: 1   MSLNIHIKSGQDKWEVNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESY 60

Query: 61  KILDGHAVHLVKSGTKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFNPLSD 120
            I DGH+VHLVKS  K                                      FNPL+D
Sbjct: 61  HIQDGHSVHLVKSQPKPQTASAAGANNATATGAAAGTGATPNMSSGQSAG----FNPLAD 116

Query: 121 LTSARYAGYLNLPSADSFGPDGGMTS--APNSDDMLRMLENPVMQSQMNEMLSNPQMIDF 178
           LTSARYAGYLN+PSAD FGPDGG  +  + N D++LRM+ENP+ QSQMNEMLSNPQM+DF
Sbjct: 117 LTSARYAGYLNMPSADMFGPDGGALNNDSNNQDELLRMMENPIFQSQMNEMLSNPQMLDF 176

Query: 179 LIQQSPQLQSMGPQARQMLQSPFFRQMMTNPEMIRQSMQFSGVLGGAGDPS------AAG 232
           +IQ +PQLQ+MGPQARQMLQSP FRQM+TNP+MIRQSMQF+ ++    DP+         
Sbjct: 177 MIQSNPQLQAMGPQARQMLQSPMFRQMLTNPDMIRQSMQFARMM----DPNAGMGSAGGA 232

Query: 233 ANAFPAPG-----------TADSDASAQPASTNTSTADAAQSATNANPFXXXXXXXXXXX 281
           A+AFPAPG           T  S  +   A TN  T   A +A  ANPF           
Sbjct: 233 ASAFPAPGGDAPEEGSNTNTTSSSNTGNNAGTNAGTNAGANTA--ANPF----------A 280

Query: 282 XXXXXXXNPFLSMXXXXXXXXXXXXXFDPAMLSALLGGAGNNASQQPQDTRPPEERYEQQ 341
                  NPF +              FDPA+L+++        + Q +DTRPPEERYE Q
Sbjct: 281 SLLNPALNPFAN---AGNAASTGMPAFDPALLASMFQPPVQ--ASQAEDTRPPEERYEHQ 335

Query: 342 LRQLNDMGFFEFDRNVAALRRSGGSVQGALDALLNGDV 379
           LRQLNDMGFF+FDRNVAALRRSGGSVQGALD+LLNGDV
Sbjct: 336 LRQLNDMGFFDFDRNVAALRRSGGSVQGALDSLLNGDV 373

>Suva_13.464 Chr13 (801516..802616) [1101 bp, 366 aa] {ON} YMR276W
           (REAL)
          Length = 366

 Score =  352 bits (904), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 211/394 (53%), Positives = 254/394 (64%), Gaps = 43/394 (10%)

Query: 1   MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
           MS+ V+VKSGQ KW+VSV  +STV QFK AI+E + I   NQRLIYSGKILKDDQT+ESY
Sbjct: 1   MSLNVYVKSGQDKWEVSVAPESTVLQFKEAISEANGIPVANQRLIYSGKILKDDQTVESY 60

Query: 61  KILDGHAVHLVKSGTKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFNPLSD 120
            I DGH+VHLVKS  +                                      FNPL+D
Sbjct: 61  HIQDGHSVHLVKSQPRPQAGAATGAGGDAGASATNASVSATPNMSSGQSAG---FNPLAD 117

Query: 121 LTSARYAGYLNLPSADSFGPDGGMTS--APNSDDMLRMLENPVMQSQMNEMLSNPQMIDF 178
           LTSARYAGYLN+PSAD FGPDGG  +  + N D++LRM++NP+ QSQMNEMLSNPQM+DF
Sbjct: 118 LTSARYAGYLNMPSADMFGPDGGALNNDSNNQDELLRMMDNPIFQSQMNEMLSNPQMLDF 177

Query: 179 LIQQSPQLQSMGPQARQMLQSPFFRQMMTNPEMIRQSMQFSGVLGGAGDP------SAAG 232
           +IQ +PQLQ+MGPQARQMLQSP FRQM+TNP+MIRQSMQF+ ++    DP      +   
Sbjct: 178 MIQSNPQLQAMGPQARQMLQSPMFRQMLTNPDMIRQSMQFARMM----DPNAGNGSAGGA 233

Query: 233 ANAFPAPG------TADSDASAQPASTNTSTADAAQSATNANPFXXXXXXXXXXXXXXXX 286
           A+AFPAPG      T D+DA+  P+S   + A A   A+  NP                 
Sbjct: 234 ASAFPAPGGDAPEETTDTDAA--PSSNAGANAAANPFASLLNP----------------- 274

Query: 287 XXNPFLSMXXXXXXXXXXXXXFDPAMLSALL-GGAGNNASQQPQDTRPPEERYEQQLRQL 345
             NPF +              FDPA+L+++         + QP+DTRPPEERYEQQLRQL
Sbjct: 275 ALNPFAN--AGNSAAATGMPAFDPALLASMFQPQQAAAQAPQPEDTRPPEERYEQQLRQL 332

Query: 346 NDMGFFEFDRNVAALRRSGGSVQGALDALLNGDV 379
           NDMGFF+FDRNVAALRRSGGSVQGALD+LLNGDV
Sbjct: 333 NDMGFFDFDRNVAALRRSGGSVQGALDSLLNGDV 366

>KLLA0D01859g Chr4 (161628..162743) [1116 bp, 371 aa] {ON} similar
           to uniprot|P48510 Saccharomyces cerevisiae YMR276W DSK2
           Nuclear-enriched ubiquitin-like polyubiquitin- binding
           protein required for spindle pole body (SPB) duplication
           and for transit through the G2/M phase of the cell cycle
           involved in proteolysis interacts with the proteasome
          Length = 371

 Score =  348 bits (893), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 200/384 (52%), Positives = 241/384 (62%), Gaps = 23/384 (5%)

Query: 3   ITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESYKI 62
           I+VHVKSGQ+ W V +++ +T+  FK  I+  S +  +NQRLIYSGKILKD +T+ESYKI
Sbjct: 4   ISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYKI 63

Query: 63  LDGHAVHLVKSGTKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFNPLSDLT 122
            DGH+VH+VKSG                                        FNPL+DLT
Sbjct: 64  QDGHSVHMVKSGGASAATTGSTTTGSAASPAATNSAAPSNISAGQTGG----FNPLADLT 119

Query: 123 SARYAGYLNLPSADSFGPDGGMTSA--PNSDDMLRMLENPVMQSQMNEMLSNPQMIDFLI 180
            ARYAG  NLPSAD FGPDGG+ S+   N + ML+MLENP+ QSQMNEMLSNPQM+DFLI
Sbjct: 120 GARYAGLANLPSADMFGPDGGLNSSNGANPESMLQMLENPIFQSQMNEMLSNPQMVDFLI 179

Query: 181 QQSPQLQSMGPQARQMLQSPFFRQMMTNPEMIRQSMQFSGVLGGAGDPSAAGANAFPAPG 240
           QQ+PQLQ++GP+AR MLQSPFFRQMMT+P+MIRQSMQ +  +G + D     A+AFPAPG
Sbjct: 180 QQNPQLQALGPRARDMLQSPFFRQMMTDPQMIRQSMQMANSMGMSPD---GAASAFPAPG 236

Query: 241 TADSDASAQPASTN----TSTADAAQSATNANPFXXXXXXXXXXXXXXXXXXNPFLSMXX 296
           +A     A   STN     +T  AA S   ANPF                  NPF  +  
Sbjct: 237 SASGAGGANETSTNDADSAATGAAASSTGQANPF----AGLFGATPGNAAAANPFAGL-- 290

Query: 297 XXXXXXXXXXXFDPAMLSALLGGAGNNASQQPQ-DTRPPEERYEQQLRQLNDMGFFEFDR 355
                      F+  +L+++ GG  N     P  D RPPEERYE QLRQLNDMGFF+FDR
Sbjct: 291 ---FPGGQQPQFNQELLASMFGGNSNATGAAPAVDNRPPEERYESQLRQLNDMGFFDFDR 347

Query: 356 NVAALRRSGGSVQGALDALLNGDV 379
           NVAALRR+GGSVQGALDALLNGDV
Sbjct: 348 NVAALRRAGGSVQGALDALLNGDV 371

>NDAI0K00440 Chr11 complement(99224..100438) [1215 bp, 404 aa] {ON}
           Anc_8.837 YMR276W
          Length = 404

 Score =  348 bits (894), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 202/411 (49%), Positives = 252/411 (61%), Gaps = 42/411 (10%)

Query: 2   SITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESYK 61
           +I++H+KSGQ+ W VS+D  +++A  K  IA+ S+I   NQRLIYSGKILKDDQ ++ Y 
Sbjct: 3   TISIHIKSGQNNWQVSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYN 62

Query: 62  ILDGHAVHLVKSGTKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFNPLSDL 121
           I DGH+VHLV+SG K                                      FNPL+DL
Sbjct: 63  IQDGHSVHLVRSGKKSTPTPATTNTTTNASNNTVPSNISAGQTGG--------FNPLADL 114

Query: 122 TSARYAGY-LNLPSADSFGPDGGMT-SAPNSDDMLRMLENPVMQSQMNEMLSNPQMIDFL 179
           TSARYAGY LNLPSAD+FGPDGGM  S  N D+ L ML+NP++QSQMNEMLSNPQMIDF+
Sbjct: 115 TSARYAGYNLNLPSADAFGPDGGMNQSGTNPDEFLSMLDNPIVQSQMNEMLSNPQMIDFM 174

Query: 180 IQQSPQLQSMGPQARQMLQSPFFRQMMTNPEMIRQSMQFSGVLG------GAGDPSAAGA 233
           IQ +PQLQ+MGPQARQM QSP FRQM+TNP+MIRQSMQ + ++G      G+ + +   A
Sbjct: 175 IQSNPQLQAMGPQARQMFQSPMFRQMLTNPDMIRQSMQLANMMGMGPGARGSTNATDNAA 234

Query: 234 NAFPAPGTAD----------------SDASAQPASTNTSTADAAQSATNANPFXXXXXXX 277
           ++FPAPG  D                +D +    S N +  + A SA   NPF       
Sbjct: 235 SSFPAPGGDDIINNNNTNTNTNTNTNNDTNDTATSNNDNANNNASSANTQNPF-ASLFNP 293

Query: 278 XXXXXXXXXXXNPFLSMXXXXXXXXXXXXX--------FDPAMLSALLGGAGN-NASQQP 328
                      NPFL+M                     FDP+M ++L GGAG  + + Q 
Sbjct: 294 TANNDSTGLAPNPFLAMLNNAGAGSGTNNAGATGTLPPFDPSMFASLFGGAGAPSTTPQQ 353

Query: 329 QDTRPPEERYEQQLRQLNDMGFFEFDRNVAALRRSGGSVQGALDALLNGDV 379
           QDTRPPEERYE QLRQLNDMGFF+FDRN+AALRR+GGSV+ A++ALLNGDV
Sbjct: 354 QDTRPPEERYETQLRQLNDMGFFDFDRNIAALRRTGGSVEAAVNALLNGDV 404

>Ecym_4608 Chr4 (1185310..1186530) [1221 bp, 406 aa] {ON} similar to
           Ashbya gossypii ABL129W
          Length = 406

 Score =  347 bits (890), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 204/419 (48%), Positives = 241/419 (57%), Gaps = 53/419 (12%)

Query: 1   MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
           MSI++HVKSGQ+KW VS D  S++   K  IAE S I  ENQRLIYSGKILKDDQT+ESY
Sbjct: 1   MSISLHVKSGQNKWQVSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESY 60

Query: 61  KILDGHAVHLVKSGTK-------XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 113
           KI DGH++HLV+SG                                              
Sbjct: 61  KIADGHSIHLVRSGGGKVSGSSGATGGASGSVEAVGSGGRNSTAGSGSTVPNNITAGQMG 120

Query: 114 XFNPLSDLTSARYAGYLNLPSADSFGPDGGMTSAPNSDDMLRMLENPVMQSQMNEMLSNP 173
            FNPL+DLT ARYAGY NLPS D FGPDGG+ SA   +++L ML+NP+ QSQ+NEML+NP
Sbjct: 121 GFNPLADLTGARYAGYANLPSTDMFGPDGGLNSAIGQEEILGMLDNPIFQSQVNEMLANP 180

Query: 174 QMIDFLIQQSPQLQSMGPQARQMLQSPFFRQMMTNPEMIRQSMQFSGVLGGAGDPSAAGA 233
           QMIDFLIQQ P LQ+MGP AR+MLQSPFFRQMMTNP++IRQ  +F   +G A   S    
Sbjct: 181 QMIDFLIQQHPHLQAMGPAAREMLQSPFFRQMMTNPDVIRQVSRFQMDMGAANGQS---T 237

Query: 234 NAFPAPGTADSDA--SAQPASTNTSTADAAQSATNANPFXXXXXXXXXXXXXXXXXXNPF 291
           N FPAPG+A++ A  S   A+  ++      +A  ANP                   NPF
Sbjct: 238 NDFPAPGSANNSATTSGDNATLTSTGTGTNTNAAAANPL----------TSLFNAQSNPF 287

Query: 292 LSM--------------XXXXXXXXXXXXXF----------------DPAMLSALL-GGA 320
            +M                           F                DPAMLSALL GG 
Sbjct: 288 AAMFAPPANSGPNPGTNAGATNSTTNPAAAFGADSQQPSRGFSLPPLDPAMLSALLSGGF 347

Query: 321 GNNASQQPQDTRPPEERYEQQLRQLNDMGFFEFDRNVAALRRSGGSVQGALDALLNGDV 379
                QQ +D RPPEERY+QQL QLN+MGF +FDRNVAALRRSGGSVQGAL+ALLNGDV
Sbjct: 348 TATGRQQTEDNRPPEERYQQQLEQLNEMGFVDFDRNVAALRRSGGSVQGALNALLNGDV 406

>ABL129W Chr2 (153723..154760) [1038 bp, 345 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR276W (DSK2)
          Length = 345

 Score =  344 bits (882), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 201/379 (53%), Positives = 236/379 (62%), Gaps = 34/379 (8%)

Query: 1   MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
           M+I + VKSGQ++W+VSV+A  +V + K  IA+ S+I  ENQRLIYSGKILKDDQT+ESY
Sbjct: 1   MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60

Query: 61  KILDGHAVHLVKSGTKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFNPLSD 120
           KI DGHA+HLVKSG                                        FNPL+D
Sbjct: 61  KIADGHAIHLVKSGGAKAAPAASAAGGESTGAAAGAGAVPSSISAGQSGG----FNPLAD 116

Query: 121 LTSARYAGYLNLPSADSFGPDGGMTSAPNSDDMLRMLENPVMQSQMNEMLSNPQMIDFLI 180
           LT ARYAGY NLPS D FGPDGG+ SA   ++++ MLENP+ QSQMNEML+NPQMIDFLI
Sbjct: 117 LTGARYAGYTNLPSTDMFGPDGGLNSAVGQEEIIGMLENPIFQSQMNEMLNNPQMIDFLI 176

Query: 181 QQSPQLQSMGPQARQMLQSPFFRQMMTNPEMIRQSMQFSGVLGGAGDPSAAGANAFPAPG 240
           QQ P LQ+MGP AR+MLQSPFFRQM+TNP++IRQ  +    +GGAG   A     FPAPG
Sbjct: 177 QQHPHLQAMGPAAREMLQSPFFRQMLTNPDIIRQMSRLQMGMGGAG---AEQGTDFPAPG 233

Query: 241 TADSDASAQPASTNTSTADAAQSATNANPFXXXXXXXXXXXXXXXXXXNPFLSMXXXXXX 300
           +A +  +A PA    +     Q    ANP                      L+M      
Sbjct: 234 SAATPDAAAPAPNPLAAILGLQPGA-ANPLGAAPADRG-------------LAM------ 273

Query: 301 XXXXXXXFDPAMLSALLGGAGNNASQQPQDTRPPEERYEQQLRQLNDMGFFEFDRNVAAL 360
                   DPAMLS+L       AS  P D RPPEERYEQQLRQLNDMGFF+FDRNVAAL
Sbjct: 274 -----PPLDPAMLSSLF--GAGAASPAPADNRPPEERYEQQLRQLNDMGFFDFDRNVAAL 326

Query: 361 RRSGGSVQGALDALLNGDV 379
           RR+GGSVQGALDALLNGDV
Sbjct: 327 RRAGGSVQGALDALLNGDV 345

>TPHA0I00220 Chr9 (39858..40991) [1134 bp, 377 aa] {ON} Anc_8.837
           YMR276W
          Length = 377

 Score =  341 bits (874), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 200/395 (50%), Positives = 244/395 (61%), Gaps = 34/395 (8%)

Query: 1   MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
           MSI+V +KSGQ+KWDV+V+  +T+ +FK  I++ S I   NQRLIYSGKILKD +T+ESY
Sbjct: 1   MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60

Query: 61  KILDGHAVHLVKSGTKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFNPLSD 120
           KI DGH++HLVKSG                                        FNPL+D
Sbjct: 61  KIQDGHSIHLVKSG-DASANAAKSSTAAAATANAAAGSAESAVPTNITSGQTNGFNPLAD 119

Query: 121 LTSARYAGY-LNLPSADSFGPDGGMTSAPNSDDMLRMLENPVMQSQMNEMLSNPQMIDFL 179
           LTSARYAGY L +PSAD FGPDGGMT+ PN DDML MLENPV QSQMNEMLSNPQM++++
Sbjct: 120 LTSARYAGYNLPMPSADMFGPDGGMTNMPNQDDMLSMLENPVFQSQMNEMLSNPQMVEYM 179

Query: 180 IQQSPQLQSMGPQARQMLQSPFFRQMMTNPEMIRQSMQFSGVLGGAGDPSAAGA---NAF 236
           I  +PQLQ++GPQAR+M QSPFFRQM+TNP+MIRQSM+ + ++GG G     G    ++F
Sbjct: 180 INSNPQLQALGPQAREMFQSPFFRQMLTNPDMIRQSMEMARMMGGEGVGIGGGLNGDSSF 239

Query: 237 PAPGTADSDASAQPASTNTSTA-DAAQSATNANPFXXXXXXXXXXXXXXXXXXNPFLSMX 295
           PAPG           ST ++TA D A +   A                     NPF  + 
Sbjct: 240 PAPGE---------TSTESATAEDNAAARNPAATNPAAANPANPFAALFNPGMNPFAGLG 290

Query: 296 XXXXXXXX------XXXXFDPAMLSALLGGAGNNASQQP-----QDTRPPEERYEQQLRQ 344
                             F+P+ML+++L        QQP     +DTRPPE RYE QLRQ
Sbjct: 291 NPAAAGSTGAPGTPQYPGFNPSMLASML--------QQPRQPAQEDTRPPEVRYESQLRQ 342

Query: 345 LNDMGFFEFDRNVAALRRSGGSVQGALDALLNGDV 379
           LNDMGFFEFDRN+AALRRSGGSVQGALDALLN DV
Sbjct: 343 LNDMGFFEFDRNIAALRRSGGSVQGALDALLNNDV 377

>TBLA0D03230 Chr4 complement(796939..798066) [1128 bp, 375 aa] {ON}
           Anc_8.837 YMR276W
          Length = 375

 Score =  340 bits (871), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 200/400 (50%), Positives = 243/400 (60%), Gaps = 53/400 (13%)

Query: 1   MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
           M+I+VH+KSGQ+ WDV ++A ST+  FK  IA  S+I   NQRLIYSGKILKDDQT+ESY
Sbjct: 1   MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60

Query: 61  KILDGHAVHLVKSGTKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFNPLSD 120
           KI DGH++H+VKSG                                        FNPLSD
Sbjct: 61  KIQDGHSIHMVKSGAHATASSTTNSMTTTNTTAPQNNNGSSGMSTGRGSG----FNPLSD 116

Query: 121 LTSARYAGYLNLPSADSFGPDGGMTSAPNSDDMLRMLENPVMQSQMNEMLSNPQMIDFLI 180
           LTSARYAGY NLPSAD FGPDGG  ++ + DDML MLENPV QSQMNEMLSNP+++DFLI
Sbjct: 117 LTSARYAGYTNLPSADMFGPDGGSFASQSQDDMLHMLENPVFQSQMNEMLSNPEIVDFLI 176

Query: 181 QQSPQLQSMGPQARQMLQSPFFRQMMTNPEMIRQSMQFSGVL-GGAGDPSAAGANAFPAP 239
             +PQLQS+GPQAR M QSP FRQM+TNP+MIRQSM+ + ++ GG G    A A++FPAP
Sbjct: 177 NSNPQLQSLGPQARTMFQSPMFRQMLTNPDMIRQSMRMAQMMNGGEG---TASASSFPAP 233

Query: 240 G-----------TADSDASAQ-------------PASTNTSTADAAQSATNANPFXXXXX 275
           G             DSD +A              P +TN+ TA        ANPF     
Sbjct: 234 GDSTTTTQPTSTNIDSDTNATNNTNNATNTPTDVPGTTNSGTA-------AANPF----- 281

Query: 276 XXXXXXXXXXXXXNPFLSMXXXXXXXXXXXXXFDPAMLSALLGGAGNNASQQPQDTRPPE 335
                        NP+ +              F+PA  +  L  A  + +Q+P+D RPPE
Sbjct: 282 -----AALFDPSMNPYAA---LGGGNGNANNMFNPAAFAQALQAAAPH-TQEPEDNRPPE 332

Query: 336 ERYEQQLRQLNDMGFFEFDRNVAALRRSGGSVQGALDALL 375
           ERYE QLRQLNDMGFF+FD+NVAALRRSGGSVQGA++ALL
Sbjct: 333 ERYEHQLRQLNDMGFFDFDKNVAALRRSGGSVQGAVNALL 372

>KNAG0J00290 Chr10 complement(44234..45337) [1104 bp, 367 aa] {ON}
           Anc_8.837 YMR276W
          Length = 367

 Score =  327 bits (838), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 208/396 (52%), Positives = 240/396 (60%), Gaps = 46/396 (11%)

Query: 1   MSITVHVKSGQSKWDVSVDAD---STVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTL 57
           M ITV VK GQ++WDV+V ++   +TVAQFK  +A  + +  ENQRLIYSGKILKD QTL
Sbjct: 1   MGITVGVKQGQNRWDVAVASEPGETTVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTL 60

Query: 58  ESYKILDGHAVHLVKSGTKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFNP 117
           E YKI DGH VHLVKSG                                        FNP
Sbjct: 61  EEYKITDGHTVHLVKSGGAKSAGSSSSSSEATTAAGTAGTAPAAGASMAAGQQPG--FNP 118

Query: 118 LSDLTSARYAGY-LNLPSADSFGPDGGMTSAPNS------DDMLRMLENPVMQSQMNEML 170
           L+DLTSARYAGY L +PSAD FGPDGG+TS          +++L MLENP+ QSQMNEM 
Sbjct: 119 LADLTSARYAGYNLPMPSADMFGPDGGLTSGGGPGGPQSQEEILSMLENPIFQSQMNEMF 178

Query: 171 SNPQMIDFLIQQSPQLQSMGPQARQMLQSPFFRQMMTNPEMIRQSMQFSGVL------GG 224
           SNPQM+DFLIQ +PQLQ+MGPQAR+MLQSP FRQM+TNP+M+RQSMQFS ++       G
Sbjct: 179 SNPQMVDFLIQSNPQLQAMGPQAREMLQSPMFRQMLTNPDMVRQSMQFSQMMQGSGAGAG 238

Query: 225 AGDPSAAGANAFPAPGTADSDASAQPASTNTSTADAAQSATNANPFXXXXXXXXXXXXXX 284
             DP     NAFPAPG  D+ A      TNTST  +A     ANPF              
Sbjct: 239 GADP-----NAFPAPGGDDTGAP-----TNTSTNASAAGPAGANPFSSLFGGAPAPAA-- 286

Query: 285 XXXXNPFLSMXXXXXXXXXXXXXFDPAMLSALLGGAGNNA-SQQPQDTRPPEERYEQQLR 343
                PF S              FD A     +   G  A +  PQDTRPPEERYEQQLR
Sbjct: 287 ----QPFQS-----------APGFDAAAFMQAMSRNGATAPAAAPQDTRPPEERYEQQLR 331

Query: 344 QLNDMGFFEFDRNVAALRRSGGSVQGALDALLNGDV 379
           QLNDMGF +FDRNVAALRR+GGS+QGALDALLNGDV
Sbjct: 332 QLNDMGFSDFDRNVAALRRAGGSLQGALDALLNGDV 367

>TBLA0B03240 Chr2 (756434..757288) [855 bp, 284 aa] {ON} Anc_8.837
           YMR276W
          Length = 284

 Score = 63.5 bits (153), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 52/219 (23%), Positives = 94/219 (42%), Gaps = 20/219 (9%)

Query: 3   ITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESYKI 62
           I+V++K  + K+ +  + D  ++     I +   I P NQRLIYSG+IL  ++TL+ Y  
Sbjct: 2   ISVNIKFKEEKFTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNF 61

Query: 63  LDGHAVHLVKSGTKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFNPLSDLT 122
            DGH + ++    +                                        P++  T
Sbjct: 62  KDGHCIIVIIHKEEKNNLHPPPNNTTNLNPNNSVYPASNT--------------PINSPT 107

Query: 123 SARYAGYLNLPSA--DSFGPDGGMTSAPNSD-DMLRMLENPVMQSQMNEMLSNPQ-MIDF 178
                  + + +   D +G        P  + ++L++L++P    Q NEML N Q ++ F
Sbjct: 108 PFGEGNIITITTTSPDPYGVRSNEVHDPEVERELLQVLDHP-RSFQENEMLLNNQNLLRF 166

Query: 179 LIQQSPQLQSMGPQ-ARQMLQSPFFRQMMTNPEMIRQSM 216
           LIQ +P L+ M    ARQ+L+ P  ++   +   + Q +
Sbjct: 167 LIQTNPHLRHMDINGARQVLRDPRLQRAFMDVNFLNQQI 205

>TDEL0F04380 Chr6 complement(823866..823950,824011..824159) [234
          bp, 77 aa] {ON} Anc_8.311 YDR139C
          Length = 77

 Score = 51.6 bits (122), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 27/71 (38%), Positives = 42/71 (59%), Gaps = 1/71 (1%)

Query: 1  MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
          M I V   +G+ +  V + +D+ + + K  + E   I P  QRLI+ GK + D QTLE+ 
Sbjct: 1  MIIKVKTLTGK-EIAVELKSDAPIYRIKQLLEEKEGIPPSQQRLIFQGKQIDDRQTLEAA 59

Query: 61 KILDGHAVHLV 71
          K++DG  +HLV
Sbjct: 60 KLVDGMVLHLV 70

>Kpol_1036.62 s1036 complement(173662..173746,173844..173992) [234
          bp, 77 aa] {ON}
          complement(173662..173746,173844..173992) [234 nt, 78
          aa]
          Length = 77

 Score = 47.8 bits (112), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 25/71 (35%), Positives = 38/71 (53%), Gaps = 1/71 (1%)

Query: 1  MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
          M + V   +G+ +  V +     V   K  + E   I P  QRLI+ GK + D+QT++S 
Sbjct: 1  MYVKVKTLTGK-EISVEIQGSDKVYHIKELLEEKEGIPPSQQRLIFQGKQIDDEQTVDSA 59

Query: 61 KILDGHAVHLV 71
          K+ DG  +HLV
Sbjct: 60 KLTDGMQLHLV 70

>TPHA0C00890 Chr3 (187882..188030,188103..188187) [234 bp, 77 aa]
          {ON} Anc_8.311 YDR139C
          Length = 77

 Score = 47.4 bits (111), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 26/71 (36%), Positives = 38/71 (53%), Gaps = 1/71 (1%)

Query: 1  MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
          M I V   +G+ +  + V     V   K  + E   I P  QRLI+ GK + D+QT+ES 
Sbjct: 1  MQIKVKTLTGK-EIAIEVQGSDKVFHIKDLLEEKEGIPPSQQRLIFQGKQIDDEQTVESA 59

Query: 61 KILDGHAVHLV 71
           ++DG  +HLV
Sbjct: 60 NLIDGMQLHLV 70

>ZYRO0D05962g Chr4 (506710..506858,506936..507020) [234 bp, 77 aa]
          {ON} similar to uniprot|Q03919 Saccharomyces cerevisiae
          YDR139C RUB1 Ubiquitin-like protein with similarity to
          mammalian NEDD8
          Length = 77

 Score = 46.2 bits (108), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1  MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
          M I V   +G+ +  V ++ +  + + K  + E   I P  QRLI+ GK + D QT+ S 
Sbjct: 1  MIIKVKTLTGK-EIAVELNGEDPIYRIKELLEEKEGIPPSQQRLIFQGKQIDDQQTVSSA 59

Query: 61 KILDGHAVHLV 71
          K++DG  +HLV
Sbjct: 60 KLVDGMQLHLV 70

>TDEL0G01750 Chr7 (343412..343645) [234 bp, 77 aa] {ON} Anc_4.16
          YLL039C
          Length = 77

 Score = 45.4 bits (106), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1  MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
          M I V   +G++   + V++  T+   K+ I +   I P+ QRLI++GK L+D +TL  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDGHAVHLV 71
           I     +HLV
Sbjct: 60 NIQKESTLHLV 70

>KLTH0G12540g Chr7 (1065801..1065949,1066013..1066097) [234 bp, 77
          aa] {ON} similar to uniprot|Q03919 Saccharomyces
          cerevisiae YDR139C RUB1 Ubiquitin-like protein with
          similarity to mammalian NEDD8
          Length = 77

 Score = 45.4 bits (106), Expect = 7e-06,   Method: Composition-based stats.
 Identities = 26/71 (36%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1  MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
          M +TV   +G+ +  V VD D  V + K  + E   I P  QRLI+ GK + DD+++ S 
Sbjct: 1  MKLTVKTLTGK-EIPVVVDPDDKVYRIKEYLEEKEGIPPTQQRLIFQGKQIDDDKSVSSA 59

Query: 61 KILDGHAVHLV 71
           +  G  +HLV
Sbjct: 60 NLSSGMQLHLV 70

>NDAI0H00270 Chr8 complement(45883..46116) [234 bp, 77 aa] {ON}
          Anc_4.16
          Length = 77

 Score = 45.1 bits (105), Expect = 9e-06,   Method: Composition-based stats.
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1  MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
          M I V   +G++   + V++  T+   K+ I +   I P+ QRLI++GK L+D +TL  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDGHAVHLV 71
           I     +HLV
Sbjct: 60 NIQKESTLHLV 70

>SAKL0H15818g Chr8 (1379077..1379225,1379297..1379381) [234 bp, 77
          aa] {ON} similar to uniprot|Q03919 Saccharomyces
          cerevisiae YDR139C RUB1 Ubiquitin-like protein with
          similarity to mammalian NEDD8
          Length = 77

 Score = 45.1 bits (105), Expect = 9e-06,   Method: Composition-based stats.
 Identities = 24/71 (33%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1  MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
          M + V   +G+ +  +S+++   V + K  + E   I P  QRLI+ GK ++DDQT++S 
Sbjct: 1  MELKVKTLTGK-EIPISLESHEKVYRIKELLEEKEGIPPSQQRLIFQGKQIEDDQTVDSA 59

Query: 61 KILDGHAVHLV 71
           +  G  +HLV
Sbjct: 60 NLSSGMQLHLV 70

>NCAS0B03520 Chr2 complement(621285..621369,621473..621621) [234
          bp, 77 aa] {ON}
          Length = 77

 Score = 44.7 bits (104), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 27/73 (36%), Positives = 40/73 (54%), Gaps = 5/73 (6%)

Query: 1  MSITVHVKSGQSKWDVSVDADST--VAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLE 58
          M I V   +G+   ++ VD   T  V + K  + E   I P  QRLI+ GK + D+QT+ 
Sbjct: 1  MIIKVKTLTGK---EIPVDIQGTDPVYRIKEMLEEKEGIPPSQQRLIFQGKQIDDEQTVS 57

Query: 59 SYKILDGHAVHLV 71
          S  ++DG  +HLV
Sbjct: 58 SANLIDGMQLHLV 70

>NDAI0J01070 Chr10 (247102..247250,247366..247450) [234 bp, 77 aa]
          {ON} Anc_8.311 YDR139C
          Length = 77

 Score = 44.7 bits (104), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 24/71 (33%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1  MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
          M I V   +G+ +  V +  +  V + K  + E   I P  QRLI+ GK + D+Q++ S 
Sbjct: 1  MIIKVKTLTGK-EIPVEISGNEPVYRIKELLEEKEGIPPSQQRLIFQGKQIDDEQSVSSA 59

Query: 61 KILDGHAVHLV 71
           ++DG  +HLV
Sbjct: 60 NLVDGMQLHLV 70

>Skud_9.20 Chr9 (46249..46623) [375 bp, 125 aa] {ON} YKR094C
          (REAL)
          Length = 125

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 21/56 (37%), Positives = 33/56 (58%)

Query: 16 VSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESYKILDGHAVHLV 71
          + V++  T+   K+ I +   I P+ QRLI++GK L+D +TL  Y I     +HLV
Sbjct: 12 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 67

>Smik_11.357 Chr11 complement(608082..608456) [375 bp, 125 aa]
          {ON} YKR094C (REAL)
          Length = 125

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 21/56 (37%), Positives = 33/56 (58%)

Query: 16 VSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESYKILDGHAVHLV 71
          + V++  T+   K+ I +   I P+ QRLI++GK L+D +TL  Y I     +HLV
Sbjct: 12 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 67

>Smik_9.21 Chr9 (46848..47219) [372 bp, 124 aa] {ON} YKR094C
          (REAL)
          Length = 124

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 21/56 (37%), Positives = 33/56 (58%)

Query: 16 VSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESYKILDGHAVHLV 71
          + V++  T+   K+ I +   I P+ QRLI++GK L+D +TL  Y I     +HLV
Sbjct: 11 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 66

>Kwal_YGOB_Anc_5.701 s55 (88799..88806,89169..89547) [387 bp, 128
          aa] {ON} ANNOTATED BY YGOB -
          Length = 128

 Score = 45.4 bits (106), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1  MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
          M I V   +G++   + V++  T+   K+ I +   I P+ QRLI++GK L+D +TL  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDGHAVHLV 71
           I     +HLV
Sbjct: 60 NIQKESTLHLV 70

>KLTH0E01078g Chr5 (105372..105379,105743..106121) [387 bp, 128
          aa] {ON} highly similar to uniprot|P61864 Saccharomyces
          cerevisiae YKR094c RPL40B and highly similar to
          uniprot|P61864 Saccharomyces cerevisiae YIL148w RPL40A
          Length = 128

 Score = 45.4 bits (106), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1  MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
          M I V   +G++   + V++  T+   K+ I +   I P+ QRLI++GK L+D +TL  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDGHAVHLV 71
           I     +HLV
Sbjct: 60 NIQKESTLHLV 70

>ZYRO0G06622g Chr7 (527968..527975,528043..528421) [387 bp, 128
          aa] {ON} highly similar to uniprot|P14796 Saccharomyces
          cerevisiae YKR094C RPL40B
          Length = 128

 Score = 45.4 bits (106), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1  MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
          M I V   +G++   + V++  T+   K+ I +   I P+ QRLI++GK L+D +TL  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDGHAVHLV 71
           I     +HLV
Sbjct: 60 NIQKESTLHLV 70

>KAFR0D02230 Chr4 (449707..449714,450088..450466) [387 bp, 128 aa]
          {ON} Anc_5.701 YIL148W
          Length = 128

 Score = 45.4 bits (106), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1  MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
          M I V   +G++   + V++  T+   K+ I +   I P+ QRLI++GK L+D +TL  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDGHAVHLV 71
           I     +HLV
Sbjct: 60 NIQKESTLHLV 70

>KAFR0H00220 Chr8 (32171..32178,32513..32891) [387 bp, 128 aa]
          {ON} 
          Length = 128

 Score = 45.4 bits (106), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1  MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
          M I V   +G++   + V++  T+   K+ I +   I P+ QRLI++GK L+D +TL  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDGHAVHLV 71
           I     +HLV
Sbjct: 60 NIQKESTLHLV 70

>Suva_11.330 Chr11 complement(602690..603068,603446..603453) [387
          bp, 128 aa] {ON} YKR094C (REAL)
          Length = 128

 Score = 45.4 bits (106), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1  MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
          M I V   +G++   + V++  T+   K+ I +   I P+ QRLI++GK L+D +TL  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDGHAVHLV 71
           I     +HLV
Sbjct: 60 NIQKESTLHLV 70

>Skud_11.333 Chr11 complement(599496..599874,600245..600252) [387
          bp, 128 aa] {ON} YKR094C (REAL)
          Length = 128

 Score = 45.4 bits (106), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1  MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
          M I V   +G++   + V++  T+   K+ I +   I P+ QRLI++GK L+D +TL  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDGHAVHLV 71
           I     +HLV
Sbjct: 60 NIQKESTLHLV 70

>YIL148W Chr9 (68708..68715,69150..69528) [387 bp, 128 aa] {ON}
          RPL40AFusion protein, identical to Rpl40Bp, that is
          cleaved to yield ubiquitin and a ribosomal protein of
          the large (60S) ribosomal subunit with similarity to
          rat L40; ubiquitin may facilitate assembly of the
          ribosomal protein into ribosomes
          Length = 128

 Score = 45.4 bits (106), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1  MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
          M I V   +G++   + V++  T+   K+ I +   I P+ QRLI++GK L+D +TL  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDGHAVHLV 71
           I     +HLV
Sbjct: 60 NIQKESTLHLV 70

>YKR094C Chr11 complement(617996..618374,618743..618750) [387 bp,
          128 aa] {ON}  RPL40BFusion protein, identical to
          Rpl40Ap, that is cleaved to yield ubiquitin and a
          ribosomal protein of the large (60S) ribosomal subunit
          with similarity to rat L40; ubiquitin may facilitate
          assembly of the ribosomal protein into ribosomes
          Length = 128

 Score = 45.4 bits (106), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1  MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
          M I V   +G++   + V++  T+   K+ I +   I P+ QRLI++GK L+D +TL  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDGHAVHLV 71
           I     +HLV
Sbjct: 60 NIQKESTLHLV 70

>KLLA0A00616g Chr1 (59180..59187,59727..60105) [387 bp, 128 aa]
          {ON} highly similar to uniprot|P04838 Saccharomyces
          cerevisiae YKR094C RPL40B Fusion protein, identical to
          Rpl40Ap, that is cleaved to yield ubiquitin and a
          ribosomal protein of the large (60S) ribosomal subunit
          with similarity to rat L40; ubiquitin may facilitate
          assembly of the ribosomal protein into ribosomes
          Length = 128

 Score = 45.4 bits (106), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1  MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
          M I V   +G++   + V++  T+   K+ I +   I P+ QRLI++GK L+D +TL  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDGHAVHLV 71
           I     +HLV
Sbjct: 60 NIQKESTLHLV 70

>TPHA0E00240 Chr5 (33468..33475,34104..34482) [387 bp, 128 aa]
          {ON} Anc_5.701 YIL148W
          Length = 128

 Score = 45.4 bits (106), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1  MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
          M I V   +G++   + V++  T+   K+ I +   I P+ QRLI++GK L+D +TL  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDGHAVHLV 71
           I     +HLV
Sbjct: 60 NIQKESTLHLV 70

>TPHA0D04600 Chr4 complement(1005511..1005889,1006076..1006083)
          [387 bp, 128 aa] {ON} Anc_5.701 YIL148W
          Length = 128

 Score = 45.4 bits (106), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1  MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
          M I V   +G++   + V++  T+   K+ I +   I P+ QRLI++GK L+D +TL  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDGHAVHLV 71
           I     +HLV
Sbjct: 60 NIQKESTLHLV 70

>TBLA0E02110 Chr5 complement(516651..517029,517297..517304) [387
          bp, 128 aa] {ON} Anc_5.701 YIL148W
          Length = 128

 Score = 45.4 bits (106), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1  MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
          M I V   +G++   + V++  T+   K+ I +   I P+ QRLI++GK L+D +TL  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDGHAVHLV 71
           I     +HLV
Sbjct: 60 NIQKESTLHLV 70

>CAGL0G02475g Chr7 complement(220990..221368,222103..222110) [387
          bp, 128 aa] {ON} highly similar to uniprot|P04838
          Saccharomyces cerevisiae YKR094c UBI2 ubiquitin and
          highly similar to uniprot|P04838 Saccharomyces
          cerevisiae YIL148w UBI1 ubiquitin
          Length = 128

 Score = 45.4 bits (106), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1  MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
          M I V   +G++   + V++  T+   K+ I +   I P+ QRLI++GK L+D +TL  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDGHAVHLV 71
           I     +HLV
Sbjct: 60 NIQKESTLHLV 70

>SAKL0E14894g Chr5 complement(1235488..1235866,1236205..1236212)
          [387 bp, 128 aa] {ON} highly similar to uniprot|P61864
          Saccharomyces cerevisiae YLR167W RPS31 and highly
          similar to uniprot|P04838 Saccharomyces cerevisiae
          YIL148W and highly similar to uniprot|P04838
          Saccharomyces cerevisiae YKR094C and highly similar to
          uniprot|P04838 Saccharomyces cerevisiae YLL039C Fusion
          proteins that are cleaved to yield a ribosomal protein
          of the small (40S) subunit and ubiquitin
          Length = 128

 Score = 45.4 bits (106), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1  MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
          M I V   +G++   + V++  T+   K+ I +   I P+ QRLI++GK L+D +TL  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDGHAVHLV 71
           I     +HLV
Sbjct: 60 NIQKESTLHLV 70

>Kpol_1043.69 s1043 complement(145335..145721) [387 bp, 128 aa]
          {ON} complement(145335..145721) [387 nt, 129 aa]
          Length = 128

 Score = 45.4 bits (106), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1  MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
          M I V   +G++   + V++  T+   K+ I +   I P+ QRLI++GK L+D +TL  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDGHAVHLV 71
           I     +HLV
Sbjct: 60 NIQKESTLHLV 70

>NDAI0E05030 Chr5 complement(1148916..1149294,1149627..1149634)
          [387 bp, 128 aa] {ON} Anc_5.701
          Length = 128

 Score = 45.1 bits (105), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1  MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
          M I V   +G++   + V++  T+   K+ I +   I P+ QRLI++GK L+D +TL  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDGHAVHLV 71
           I     +HLV
Sbjct: 60 NIQKESTLHLV 70

>NCAS0A03210 Chr1 (633779..633786,634077..634455) [387 bp, 128 aa]
          {ON} Anc_5.701
          Length = 128

 Score = 45.1 bits (105), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1  MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
          M I V   +G++   + V++  T+   K+ I +   I P+ QRLI++GK L+D +TL  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDGHAVHLV 71
           I     +HLV
Sbjct: 60 NIQKESTLHLV 70

>NCAS0G00240 Chr7 (39394..39401,39701..40079) [387 bp, 128 aa]
          {ON} Anc_5.701
          Length = 128

 Score = 45.1 bits (105), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1  MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
          M I V   +G++   + V++  T+   K+ I +   I P+ QRLI++GK L+D +TL  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDGHAVHLV 71
           I     +HLV
Sbjct: 60 NIQKESTLHLV 70

>TDEL0B02200 Chr2 (395520..395527,395598..395976) [387 bp, 128 aa]
          {ON} 
          Length = 128

 Score = 45.1 bits (105), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1  MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
          M I V   +G++   + V++  T+   K+ I +   I P+ QRLI++GK L+D +TL  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDGHAVHLV 71
           I     +HLV
Sbjct: 60 NIQKESTLHLV 70

>KLTH0C03410g Chr3 complement(295299..296474) [1176 bp, 391 aa]
          {ON} similar to uniprot|P32628 Saccharomyces cerevisiae
          YEL037C RAD23
          Length = 391

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 34/53 (64%)

Query: 16 VSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESYKILDGHAV 68
          + +D+ ST+++ K  +AE         +LIYSGKIL+DD+T+  YK+ DG  V
Sbjct: 16 LELDSGSTISEAKQRLAENKDCDESQIKLIYSGKILQDDRTIADYKLNDGDQV 68

>Ecym_4019 Chr4 (48709..48716,49112..49490) [387 bp, 128 aa] {ON}
          similar to Ashbya gossypii AFR285C 1-intron
          Length = 128

 Score = 44.7 bits (104), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1  MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
          M I V   +G++   + V++  T+   K  I +   I P+ QRLI++GK L+D +TL  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDGHAVHLV 71
           I     +HLV
Sbjct: 60 NIQKESTLHLV 70

>AFR285C Chr6 complement(950588..950966,951128..951135) [387 bp,
          128 aa] {ON} Syntenic homolog of Saccharomyces
          cerevisiae YKR094C (RPL40B) and YIL148W (RPL40A);
          1-intron
          Length = 128

 Score = 44.7 bits (104), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1  MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
          M I V   +G++   + V++  T+   K  I +   I P+ QRLI++GK L+D +TL  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDGHAVHLV 71
           I     +HLV
Sbjct: 60 NIQKESTLHLV 70

>KNAG0L02120 Chr12 complement(379968..380346,380662..380669) [387
          bp, 128 aa] {ON} 
          Length = 128

 Score = 44.7 bits (104), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1  MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
          M I V   +G++   + V++  T+   K  I +   I P+ QRLI++GK L+D +TL  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDGHAVHLV 71
           I     +HLV
Sbjct: 60 NIQKESTLHLV 70

>SAKL0D11814g Chr4 (981832..983034) [1203 bp, 400 aa] {ON} similar
          to uniprot|P32628 Saccharomyces cerevisiae YEL037C
          RAD23
          Length = 400

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 42/75 (56%), Gaps = 1/75 (1%)

Query: 3  ITVHVKS-GQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESYK 61
          IT++ K   + K  + +D  STV Q K  +A T     +  +LI+SGK+L+D +TLE  K
Sbjct: 2  ITINFKDFKKEKLPLELDPTSTVLQAKQQLASTKSCDEDQIKLIFSGKVLQDGKTLEECK 61

Query: 62 ILDGHAVHLVKSGTK 76
          + DG  V  + S  +
Sbjct: 62 LKDGDQVIFMISKKR 76

>Suva_10.32 Chr10 complement(68200..68385) [186 bp, 62 aa] {ON}
          YLL039C (REAL)
          Length = 62

 Score = 42.7 bits (99), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 21/56 (37%), Positives = 32/56 (57%)

Query: 16 VSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESYKILDGHAVHLV 71
          + V+   T+   K+ I +   I P+ QRLI++GK L+D +TL  Y I     +HLV
Sbjct: 1  LEVEYSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 56

>AFR358W Chr6 (1087725..1088966) [1242 bp, 413 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YEL037C (RAD23)
          Length = 413

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 42/77 (54%), Gaps = 1/77 (1%)

Query: 1  MSITVHVKS-GQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLES 59
          M+IT+H K   + +  + +   +T+A+ K  +A   Q      ++I+SGK+L+D  TLE 
Sbjct: 1  MNITIHFKDFKKERLPLQLSPSATIAEAKQMLARAKQCDESQLKMIFSGKVLQDGNTLEG 60

Query: 60 YKILDGHAVHLVKSGTK 76
           K+ DG  V  + S  K
Sbjct: 61 CKLKDGDQVIFMISKKK 77

>Kwal_27.10152 s27 complement(216695..217840) [1146 bp, 381 aa]
          {ON} YEL037C (RAD23) - ubiquitin-like protein [contig
          41] FULL
          Length = 381

 Score = 46.6 bits (109), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 33/53 (62%)

Query: 16 VSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESYKILDGHAV 68
          + ++  STV + K  +AE  +      +LIYSGKIL+DD+T+  YK+ DG  V
Sbjct: 16 LELELSSTVNEAKQKLAENKECDDSQIKLIYSGKILQDDRTIGDYKLKDGDQV 68

>KNAG0J02880 Chr10 (550889..551350) [462 bp, 153 aa] {ON} Anc_4.16
          YLL039C
          Length = 153

 Score = 44.7 bits (104), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1  MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
          M I V   +G++   + V++  T+   K+ I +   I P+ QRLI++GK L+D +TL  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDGHAVHLV 71
           I     +HLV
Sbjct: 60 NIQKESTLHLV 70

 Score = 44.7 bits (104), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1   MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
           M I V   +G++   + V++  T+   K+ I +   I P+ QRLI++GK L+D +TL  Y
Sbjct: 77  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KILDGHAVHLV 71
            I     +HLV
Sbjct: 136 NIQKESTLHLV 146

>Ecym_8408 Chr8 (845058..845519) [462 bp, 153 aa] {ON} similar to
          Ashbya gossypii ACL062C
          Length = 153

 Score = 44.3 bits (103), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1  MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
          M I V   +G++   + V++  T+   K+ I +   I P+ QRLI++GK L+D +TL  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDGHAVHLV 71
           I     +HLV
Sbjct: 60 NIQKESTLHLV 70

 Score = 44.3 bits (103), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1   MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
           M I V   +G++   + V++  T+   K+ I +   I P+ QRLI++GK L+D +TL  Y
Sbjct: 77  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KILDGHAVHLV 71
            I     +HLV
Sbjct: 136 NIQKESTLHLV 146

>TPHA0K02250 Chr11 (482029..482490) [462 bp, 153 aa] {ON} Anc_4.16
          YLL039C
          Length = 153

 Score = 44.3 bits (103), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1  MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
          M I V   +G++   + V++  T+   K+ I +   I P+ QRLI++GK L+D +TL  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDGHAVHLV 71
           I     +HLV
Sbjct: 60 NIQKESTLHLV 70

 Score = 44.3 bits (103), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1   MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
           M I V   +G++   + V++  T+   K+ I +   I P+ QRLI++GK L+D +TL  Y
Sbjct: 77  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KILDGHAVHLV 71
            I     +HLV
Sbjct: 136 NIQKESTLHLV 146

>KLLA0F17974g Chr6 (1644903..1645051,1645153..1645237) [234 bp, 77
          aa] {ON} similar to uniprot|Q03919 Saccharomyces
          cerevisiae YDR139C RUB1 Ubiquitin-like protein with
          similarity to mammalian NEDD8
          Length = 77

 Score = 42.4 bits (98), Expect = 8e-05,   Method: Composition-based stats.
 Identities = 26/73 (35%), Positives = 39/73 (53%), Gaps = 5/73 (6%)

Query: 1  MSITVHVKSGQSKWDVSVDADS--TVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLE 58
          M + V   +G+   ++SVD  S  TV   K  + E   I P  Q+LI+ GK + D+ T+ 
Sbjct: 1  MQLKVKTLTGK---EISVDVQSSETVYHIKELLEEKEGIPPSQQKLIFQGKQIDDNATIG 57

Query: 59 SYKILDGHAVHLV 71
          S  + DG  +HLV
Sbjct: 58 SADLQDGSLLHLV 70

>TPHA0C02390 Chr3 complement(536137..536589) [453 bp, 150 aa] {ON}
          Anc_8.386 YLR167W
          Length = 150

 Score = 43.9 bits (102), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1  MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
          M I V   +G++   + V++  T+   K+ I +   I P+ QRLI++GK L+D +TL  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDGHAVHLV 71
           I     +HLV
Sbjct: 60 NIQKESTLHLV 70

>ZYRO0C04026g Chr3 (318229..318687) [459 bp, 152 aa] {ON} similar
          to uniprot|P05759 Saccharomyces cerevisiae YLR167W
          RPS31 Fusion protein that is cleaved to yield a
          ribosomal protein of the small (40S) subunit and
          ubiquitin ubiquitin may facilitate assembly of the
          ribosomal protein into ribosomes interacts genetically
          with translation factor eIF2B
          Length = 152

 Score = 43.9 bits (102), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1  MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
          M I V   +G++   + V++  T+   K+ I +   I P+ QRLI++GK L+D +TL  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDGHAVHLV 71
           I     +HLV
Sbjct: 60 NIQKESTLHLV 70

>KLTH0F08734g Chr6 complement(754886..755338) [453 bp, 150 aa]
          {ON} similar to uniprot|P61864 Saccharomyces cerevisiae
          YLR167W RPS31 Fusion protein that is cleaved to yield a
          ribosomal protein of the small (40S) subunit and
          ubiquitin
          Length = 150

 Score = 43.9 bits (102), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1  MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
          M I V   +G++   + V++  T+   K+ I +   I P+ QRLI++GK L+D +TL  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDGHAVHLV 71
           I     +HLV
Sbjct: 60 NIQKESTLHLV 70

>Ecym_4181 Chr4 complement(379972..380430) [459 bp, 152 aa] {ON}
          similar to Ashbya gossypii AGL128W
          Length = 152

 Score = 43.9 bits (102), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1  MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
          M I V   +G++   + V++  T+   K+ I +   I P+ QRLI++GK L+D +TL  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDGHAVHLV 71
           I     +HLV
Sbjct: 60 NIQKESTLHLV 70

>Kwal_23.3311 s23 complement(238458..238910) [453 bp, 150 aa] {ON}
          YLR167W (RPS31) - Ribosomal protein S31 (S37) (YS24)
          [contig 251] FULL
          Length = 150

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1  MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
          M I V   +G++   + V++  T+   K+ I +   I P+ QRLI++GK L+D +TL  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDGHAVHLV 71
           I     +HLV
Sbjct: 60 NIQKESTLHLV 70

>SAKL0H13926g Chr8 complement(1189515..1189979) [465 bp, 154 aa]
          {ON} similar to uniprot|P61864 Saccharomyces cerevisiae
          YLR167W RPS31 and similar to uniprot|P04838
          Saccharomyces cerevisiae YIL148W and similar to
          uniprot|P04838 Saccharomyces cerevisiae YKR094C and
          similar to uniprot|P04838 Saccharomyces cerevisiae
          YLL039C Fusion proteins that are cleaved to yield a
          ribosomal protein of the small (40S) subunit and
          ubiquitin
          Length = 154

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1  MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
          M I V   +G++   + V++  T+   K+ I +   I P+ QRLI++GK L+D +TL  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDGHAVHLV 71
           I     +HLV
Sbjct: 60 NIQKESTLHLV 70

>Suva_10.34 Chr10 complement(69167..69622) [456 bp, 151 aa] {ON}
          YALI0E18986g (REAL)
          Length = 151

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1  MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
          M I V   +G++   + V++  T+   K+ I +   I P+ QRLI++GK L+D +TL  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDGHAVHLV 71
           I     +HLV
Sbjct: 60 NIQKESTLHLV 70

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1   MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
           M I V   +G++   + V++  T+   K+ I +   I P+ QRLI++GK L+D +TL  Y
Sbjct: 77  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KILDGHAVHLV 71
            I     +HLV
Sbjct: 136 NIQKESTLHLV 146

>KNAG0C06580 Chr3 complement(1275504..1275945,1276297..1276304)
          [450 bp, 149 aa] {ON} 
          Length = 149

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1  MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
          M I V   +G++   + V++  T+   K  I +   I P+ QRLI++GK L+D +TL  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDGHAVHLV 71
           I     +HLV
Sbjct: 60 NIQKESTLHLV 70

>KLLA0D18304g Chr4 (1545371..1545823) [453 bp, 150 aa] {ON}
          similar to uniprot|P04838 Saccharomyces cerevisiae
          YLR167W RPS31 Fusion protein that is cleaved to yield a
          ribosomal protein of the small (40S) subunit and
          ubiquitin; ubiquitin may facilitate assembly of the
          ribosomal protein into ribosomes; interacts genetically
          with translation factor eIF2B
          Length = 150

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1  MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
          M I V   +G++   + V++  T+   K+ I +   I P+ QRLI++GK L+D +TL  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDGHAVHLV 71
           I     +HLV
Sbjct: 60 NIQKESTLHLV 70

>KLTH0E05852g Chr5 complement(528861..530090) [1230 bp, 409 aa] {ON}
           highly similar to uniprot|P04838 Saccharomyces
           cerevisiae YLL039c UBI4 ubiquitin
          Length = 409

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1   MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
           M I V   +G++   + V++  T+   K+ I +   I P+ QRLI++GK L+D +TL  Y
Sbjct: 105 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 163

Query: 61  KILDGHAVHLV 71
            I     +HLV
Sbjct: 164 NIQKESTLHLV 174

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1   MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
           M I V   +G++   + V++  T+   K+ I +   I P+ QRLI++GK L+D +TL  Y
Sbjct: 181 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 239

Query: 61  KILDGHAVHLV 71
            I     +HLV
Sbjct: 240 NIQKESTLHLV 250

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1   MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
           M I V   +G++   + V++  T+   K+ I +   I P+ QRLI++GK L+D +TL  Y
Sbjct: 257 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 315

Query: 61  KILDGHAVHLV 71
            I     +HLV
Sbjct: 316 NIQKESTLHLV 326

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1   MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
           M I V   +G++   + V++  T+   K+ I +   I P+ QRLI++GK L+D +TL  Y
Sbjct: 333 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 391

Query: 61  KILDGHAVHLV 71
            I     +HLV
Sbjct: 392 NIQKESTLHLV 402

>NCAS0C02940 Chr3 complement(552015..552473) [459 bp, 152 aa] {ON}
          Anc_8.386
          Length = 152

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1  MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
          M I V   +G++   + V++  T+   K+ I +   I P+ QRLI++GK L+D +TL  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDGHAVHLV 71
           I     +HLV
Sbjct: 60 NIQKESTLHLV 70

>TBLA0G00670 Chr7 (142636..143325) [690 bp, 229 aa] {ON} Anc_4.16
          YLL039C
          Length = 229

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1  MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
          M I V   +G++   + V++  T+   K+ I +   I P+ QRLI++GK L+D +TL  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDGHAVHLV 71
           I     +HLV
Sbjct: 60 NIQKESTLHLV 70

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1   MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
           M I V   +G++   + V++  T+   K+ I +   I P+ QRLI++GK L+D +TL  Y
Sbjct: 77  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KILDGHAVHLV 71
            I     +HLV
Sbjct: 136 NIQKESTLHLV 146

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1   MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
           M I V   +G++   + V++  T+   K+ I +   I P+ QRLI++GK L+D +TL  Y
Sbjct: 153 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 211

Query: 61  KILDGHAVHLV 71
            I     +HLV
Sbjct: 212 NIQKESTLHLV 222

>NDAI0D04930 Chr4 (1172741..1173430) [690 bp, 229 aa] {ON} 
          Length = 229

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1  MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
          M I V   +G++   + V++  T+   K+ I +   I P+ QRLI++GK L+D +TL  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDGHAVHLV 71
           I     +HLV
Sbjct: 60 NIQKESTLHLV 70

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1   MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
           M I V   +G++   + V++  T+   K+ I +   I P+ QRLI++GK L+D +TL  Y
Sbjct: 77  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KILDGHAVHLV 71
            I     +HLV
Sbjct: 136 NIQKESTLHLV 146

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1   MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
           M I V   +G++   + V++  T+   K+ I +   I P+ QRLI++GK L+D +TL  Y
Sbjct: 153 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 211

Query: 61  KILDGHAVHLV 71
            I     +HLV
Sbjct: 212 NIQKESTLHLV 222

>KAFR0I01470 Chr9 (306964..307653) [690 bp, 229 aa] {ON} Anc_5.701
          YIL148W
          Length = 229

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1  MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
          M I V   +G++   + V++  T+   K+ I +   I P+ QRLI++GK L+D +TL  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDGHAVHLV 71
           I     +HLV
Sbjct: 60 NIQKESTLHLV 70

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1   MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
           M I V   +G++   + V++  T+   K+ I +   I P+ QRLI++GK L+D +TL  Y
Sbjct: 77  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KILDGHAVHLV 71
            I     +HLV
Sbjct: 136 NIQKESTLHLV 146

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1   MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
           M I V   +G++   + V++  T+   K+ I +   I P+ QRLI++GK L+D +TL  Y
Sbjct: 153 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 211

Query: 61  KILDGHAVHLV 71
            I     +HLV
Sbjct: 212 NIQKESTLHLV 222

>YLR167W Chr12 (498947..499405) [459 bp, 152 aa] {ON}  RPS31Fusion
          protein that is cleaved to yield a ribosomal protein of
          the small (40S) subunit and ubiquitin; ubiquitin may
          facilitate assembly of the ribosomal protein into
          ribosomes; interacts genetically with translation
          factor eIF2B
          Length = 152

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1  MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
          M I V   +G++   + V++  T+   K+ I +   I P+ QRLI++GK L+D +TL  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDGHAVHLV 71
           I     +HLV
Sbjct: 60 NIQKESTLHLV 70

>Suva_10.33 Chr10 complement(68388..69152) [765 bp, 254 aa] {ON}
          YLL039C (REAL)
          Length = 254

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1  MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
          M I V   +G++   + V++  T+   K+ I +   I P+ QRLI++GK L+D +TL  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDGHAVHLV 71
           I     +HLV
Sbjct: 60 NIQKESTLHLV 70

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1   MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
           M I V   +G++   + V++  T+   K+ I +   I P+ QRLI++GK L+D +TL  Y
Sbjct: 77  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KILDGHAVHLV 71
            I     +HLV
Sbjct: 136 NIQKESTLHLV 146

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1   MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
           M I V   +G++   + V++  T+   K+ I +   I P+ QRLI++GK L+D +TL  Y
Sbjct: 153 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 211

Query: 61  KILDGHAVHLV 71
            I     +HLV
Sbjct: 212 NIQKESTLHLV 222

>NDAI0G02280 Chr7 complement(511522..511980) [459 bp, 152 aa] {ON}
          Anc_8.386
          Length = 152

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1  MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
          M I V   +G++   + V++  T+   K+ I +   I P+ QRLI++GK L+D +TL  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDGHAVHLV 71
           I     +HLV
Sbjct: 60 NIQKESTLHLV 70

>KAFR0H02000 Chr8 complement(369778..370236) [459 bp, 152 aa] {ON}
          Anc_8.386 YLR167W
          Length = 152

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1  MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
          M I V   +G++   + V++  T+   K+ I +   I P+ QRLI++GK L+D +TL  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDGHAVHLV 71
           I     +HLV
Sbjct: 60 NIQKESTLHLV 70

>Suva_9.40 Chr9 (63806..64240) [435 bp, 144 aa] {ON} YIL148W
          (REAL)
          Length = 144

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 33/56 (58%)

Query: 16 VSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESYKILDGHAVHLV 71
          + V++  T+   K+ I +   I P+ QRLI++GK L+D +TL  Y I     +HLV
Sbjct: 31 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 86

>Kwal_55.20607 s55 complement(488683..489378) [696 bp, 231 aa]
          {ON} YLL039C (UBI4) - 1:1 [contig 144] FULL
          Length = 231

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1  MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
          M I V   +G++   + V++  T+   K+ I +   I P+ QRLI++GK L+D +TL  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDGHAVHLV 71
           I     +HLV
Sbjct: 60 NIQKESTLHLV 70

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1   MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
           M I V   +G++   + V++  T+   K+ I +   I P+ QRLI++GK L+D +TL  Y
Sbjct: 77  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KILDGHAVHLV 71
            I     +HLV
Sbjct: 136 NIQKESTLHLV 146

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1   MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
           M I V   +G++   + V++  T+   K+ I +   I P+ QRLI++GK L+D +TL  Y
Sbjct: 153 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 211

Query: 61  KILDGHAVHLV 71
            I     +HLV
Sbjct: 212 NIQKESTLHLV 222

>AGL128W Chr7 (470174..470632) [459 bp, 152 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YLR167W (RPS31)
          Length = 152

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1  MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
          M I V   +G++   + V++  T+   K  I +   I P+ QRLI++GK L+D +TL  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDGHAVHLV 71
           I     +HLV
Sbjct: 60 NIQKESTLHLV 70

>TDEL0F05100 Chr6 (959574..960026) [453 bp, 150 aa] {ON} Anc_8.386
          YLR167W
          Length = 150

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1  MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
          M I V   +G++   + V++  T+   K+ I +   I P+ QRLI++GK L+D +TL  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDGHAVHLV 71
           I     +HLV
Sbjct: 60 NIQKESTLHLV 70

>CAGL0G08173g Chr7 (776549..777007) [459 bp, 152 aa] {ON} highly
          similar to uniprot|P61864 Saccharomyces cerevisiae
          YLR167w UBI3 Fusion protein that is cleaved to yield a
          ribosomal protein of the small (40S) subunit and
          ubiquitin
          Length = 152

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1  MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
          M I V   +G++   + V++  T+   K+ I +   I P+ QRLI++GK L+D +TL  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDGHAVHLV 71
           I     +HLV
Sbjct: 60 NIQKESTLHLV 70

>CAGL0B01589g Chr2 (145132..145280,145404..145488) [234 bp, 77 aa]
          {ON} highly similar to uniprot|Q03919 Saccharomyces
          cerevisiae YDR139c RUB1
          Length = 77

 Score = 41.2 bits (95), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 24/71 (33%), Positives = 36/71 (50%), Gaps = 1/71 (1%)

Query: 1  MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
          M I V   +G+ +  V V  +  V   K  + E   I    QRLI+ GK + +D T+ + 
Sbjct: 1  MIIKVKTLTGK-EIPVEVSGEDKVYHIKELLEEKEGIPASQQRLIFHGKQINNDDTISTA 59

Query: 61 KILDGHAVHLV 71
          K+ DG  +HLV
Sbjct: 60 KLSDGMQLHLV 70

>SAKL0H25784g Chr8 (2259314..2260231) [918 bp, 305 aa] {ON} highly
          similar to uniprot|P04838 Saccharomyces cerevisiae
          YLL039c UBI4 ubiquitin
          Length = 305

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1  MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
          M I V   +G++   + V++  T+   K+ I +   I P+ QRLI++GK L+D +TL  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDGHAVHLV 71
           I     +HLV
Sbjct: 60 NIQKESTLHLV 70

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1   MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
           M I V   +G++   + V++  T+   K+ I +   I P+ QRLI++GK L+D +TL  Y
Sbjct: 77  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KILDGHAVHLV 71
            I     +HLV
Sbjct: 136 NIQKESTLHLV 146

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1   MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
           M I V   +G++   + V++  T+   K+ I +   I P+ QRLI++GK L+D +TL  Y
Sbjct: 153 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 211

Query: 61  KILDGHAVHLV 71
            I     +HLV
Sbjct: 212 NIQKESTLHLV 222

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1   MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
           M I V   +G++   + V++  T+   K+ I +   I P+ QRLI++GK L+D +TL  Y
Sbjct: 229 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 287

Query: 61  KILDGHAVHLV 71
            I     +HLV
Sbjct: 288 NIQKESTLHLV 298

>Skud_12.29 Chr12 complement(55051..55829,56058..56424) [1146 bp,
          381 aa] {ON} YLL039C (REAL)
          Length = 381

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1  MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
          M I V   +G++   + V++  T+   K+ I +   I P+ QRLI++GK L+D +TL  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDGHAVHLV 71
           I     +HLV
Sbjct: 60 NIQKESTLHLV 70

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1   MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
           M I V   +G++   + V++  T+   K+ I +   I P+ QRLI++GK L+D +TL  Y
Sbjct: 77  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KILDGHAVHLV 71
            I     +HLV
Sbjct: 136 NIQKESTLHLV 146

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1   MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
           M I V   +G++   + V++  T+   K+ I +   I P+ QRLI++GK L+D +TL  Y
Sbjct: 153 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 211

Query: 61  KILDGHAVHLV 71
            I     +HLV
Sbjct: 212 NIQKESTLHLV 222

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1   MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
           M I V   +G++   + V++  T+   K+ I +   I P+ QRLI++GK L+D +TL  Y
Sbjct: 229 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 287

Query: 61  KILDGHAVHLV 71
            I     +HLV
Sbjct: 288 NIQKESTLHLV 298

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1   MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
           M I V   +G++   + V++  T+   K+ I +   I P+ QRLI++GK L+D +TL  Y
Sbjct: 305 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 363

Query: 61  KILDGHAVHLV 71
            I     +HLV
Sbjct: 364 NIQKESTLHLV 374

>YLL039C Chr12 complement(64062..65207) [1146 bp, 381 aa] {ON}
          UBI4Ubiquitin, becomes conjugated to proteins, marking
          them for selective degradation via the ubiquitin-26S
          proteasome system; essential for the cellular stress
          response; encoded as a polyubiquitin precursor
          comprised of 5 head-to-tail repeats
          Length = 381

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1  MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
          M I V   +G++   + V++  T+   K+ I +   I P+ QRLI++GK L+D +TL  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDGHAVHLV 71
           I     +HLV
Sbjct: 60 NIQKESTLHLV 70

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1   MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
           M I V   +G++   + V++  T+   K+ I +   I P+ QRLI++GK L+D +TL  Y
Sbjct: 77  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KILDGHAVHLV 71
            I     +HLV
Sbjct: 136 NIQKESTLHLV 146

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1   MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
           M I V   +G++   + V++  T+   K+ I +   I P+ QRLI++GK L+D +TL  Y
Sbjct: 153 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 211

Query: 61  KILDGHAVHLV 71
            I     +HLV
Sbjct: 212 NIQKESTLHLV 222

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1   MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
           M I V   +G++   + V++  T+   K+ I +   I P+ QRLI++GK L+D +TL  Y
Sbjct: 229 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 287

Query: 61  KILDGHAVHLV 71
            I     +HLV
Sbjct: 288 NIQKESTLHLV 298

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1   MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
           M I V   +G++   + V++  T+   K+ I +   I P+ QRLI++GK L+D +TL  Y
Sbjct: 305 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 363

Query: 61  KILDGHAVHLV 71
            I     +HLV
Sbjct: 364 NIQKESTLHLV 374

>Suva_10.30 Chr10
          complement(67747..67841,68061..68288,68558..69013,
          69256..69622) [1146 bp, 381 aa] {ON} YLL039C (REAL)
          Length = 381

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1  MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
          M I V   +G++   + V++  T+   K+ I +   I P+ QRLI++GK L+D +TL  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDGHAVHLV 71
           I     +HLV
Sbjct: 60 NIQKESTLHLV 70

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1   MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
           M I V   +G++   + V++  T+   K+ I +   I P+ QRLI++GK L+D +TL  Y
Sbjct: 77  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KILDGHAVHLV 71
            I     +HLV
Sbjct: 136 NIQKESTLHLV 146

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1   MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
           M I V   +G++   + V++  T+   K+ I +   I P+ QRLI++GK L+D +TL  Y
Sbjct: 153 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 211

Query: 61  KILDGHAVHLV 71
            I     +HLV
Sbjct: 212 NIQKESTLHLV 222

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1   MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
           M I V   +G++   + V++  T+   K+ I +   I P+ QRLI++GK L+D +TL  Y
Sbjct: 229 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 287

Query: 61  KILDGHAVHLV 71
            I     +HLV
Sbjct: 288 NIQKESTLHLV 298

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1   MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
           M I V   +G++   + V++  T+   K+ I +   I P+ QRLI++ K L+D +TL  Y
Sbjct: 305 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAEKQLEDGRTLSDY 363

Query: 61  KILDGHAVHLV 71
            I     +HLV
Sbjct: 364 NIQKESTLHLV 374

>ACL062C Chr3 complement(255353..256501) [1149 bp, 382 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YLL039C
          (UBI4)
          Length = 382

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1  MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
          M I V   +G++   + V++  T+   K+ I +   I P+ QRLI++GK L+D +TL  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDGHAVHLV 71
           I     +HLV
Sbjct: 60 NIQKESTLHLV 70

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1   MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
           M I V   +G++   + V++  T+   K+ I +   I P+ QRLI++GK L+D +TL  Y
Sbjct: 77  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KILDGHAVHLV 71
            I     +HLV
Sbjct: 136 NIQKESTLHLV 146

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1   MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
           M I V   +G++   + V++  T+   K+ I +   I P+ QRLI++GK L+D +TL  Y
Sbjct: 153 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 211

Query: 61  KILDGHAVHLV 71
            I     +HLV
Sbjct: 212 NIQKESTLHLV 222

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1   MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
           M I V   +G++   + V++  T+   K+ I +   I P+ QRLI++GK L+D +TL  Y
Sbjct: 229 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 287

Query: 61  KILDGHAVHLV 71
            I     +HLV
Sbjct: 288 NIQKESTLHLV 298

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1   MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
           M I V   +G++   + V++  T+   K+ I +   I P+ QRLI++GK L+D +TL  Y
Sbjct: 305 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 363

Query: 61  KILDGHAVHLV 71
            I     +HLV
Sbjct: 364 NIQKESTLHLV 374

>KNAG0A02730 Chr1 complement(296966..297418) [453 bp, 150 aa] {ON}
          Anc_8.386 YLR167W
          Length = 150

 Score = 42.7 bits (99), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1  MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
          M I V   +G++   + V++  T+   K  I +   I P+ QRLI++GK L+D +TL  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDGHAVHLV 71
           I     +HLV
Sbjct: 60 NIQKESTLHLV 70

>KLLA0E00749g Chr5 complement(74948..76093) [1146 bp, 381 aa] {ON}
          highly similar to uniprot|P04838 Saccharomyces
          cerevisiae YLL039c UBI4 ubiquitin
          Length = 381

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1  MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
          M I V   +G++   + V++  T+   K+ I +   I P+ QRLI++GK L+D +TL  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDGHAVHLV 71
           I     +HLV
Sbjct: 60 NIQKESTLHLV 70

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1   MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
           M I V   +G++   + V++  T+   K+ I +   I P+ QRLI++GK L+D +TL  Y
Sbjct: 77  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KILDGHAVHLV 71
            I     +HLV
Sbjct: 136 NIQKESTLHLV 146

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1   MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
           M I V   +G++   + V++  T+   K+ I +   I P+ QRLI++GK L+D +TL  Y
Sbjct: 153 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 211

Query: 61  KILDGHAVHLV 71
            I     +HLV
Sbjct: 212 NIQKESTLHLV 222

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1   MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
           M I V   +G++   + V++  T+   K+ I +   I P+ QRLI++GK L+D +TL  Y
Sbjct: 229 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 287

Query: 61  KILDGHAVHLV 71
            I     +HLV
Sbjct: 288 NIQKESTLHLV 298

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1   MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
           M I V   +G++   + V++  T+   K+ I +   I P+ QRLI++GK L+D +TL  Y
Sbjct: 305 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 363

Query: 61  KILDGHAVHLV 71
            I     +HLV
Sbjct: 364 NIQKESTLHLV 374

>CAGL0L01309g Chr12 complement(148931..150109) [1179 bp, 392 aa]
          {ON} similar to uniprot|P32628 Saccharomyces cerevisiae
          YEL037c RAD23 nucleotide excision repair protein
          Length = 392

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 37/66 (56%)

Query: 11 QSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESYKILDGHAVHL 70
          + K+ + +++  ++   K A++E     P   +LI+SGK+LKD  ++ES    DG+ V  
Sbjct: 11 KEKYPLDLESSQSIVAVKEALSEKLSCDPSQIKLIFSGKVLKDGDSVESCNFKDGNEVIF 70

Query: 71 VKSGTK 76
          + S  K
Sbjct: 71 MVSAKK 76

>Smik_12.18 Chr12
          complement(49088..49552,49091..49552,49091..49546)
          [1383 bp, 460 aa] {ON} YLL039C (REAL)
          Length = 460

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1  MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
          M I V   +G++   + V++  T+   K+ I +   I P+ QRLI++GK L+D +TL  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDGHAVHLV 71
           I     +HLV
Sbjct: 60 NIQKESTLHLV 70

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1   MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
           M I V   +G++   + V++  T+   K+ I +   I P+ QRLI++GK L+D +TL  Y
Sbjct: 77  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KILDGHAVHLV 71
            I     +HLV
Sbjct: 136 NIQKESTLHLV 146

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1   MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
           M I V   +G++   + V++  T+   K+ I +   I P+ QRLI++GK L+D +TL  Y
Sbjct: 155 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 213

Query: 61  KILDGHAVHLV 71
            I     +HLV
Sbjct: 214 NIQKESTLHLV 224

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1   MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
           M I V   +G++   + V++  T+   K+ I +   I P+ QRLI++GK L+D +TL  Y
Sbjct: 231 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 289

Query: 61  KILDGHAVHLV 71
            I     +HLV
Sbjct: 290 NIQKESTLHLV 300

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1   MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
           M I V   +G++   + V++  T+   K+ I +   I P+ QRLI++GK L+D +TL  Y
Sbjct: 309 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 367

Query: 61  KILDGHAVHLV 71
            I     +HLV
Sbjct: 368 NIQKESTLHLV 378

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1   MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
           M I V   +G++   + V++  T+   K+ I +   I P+ QRLI++GK L+D +TL  Y
Sbjct: 385 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 443

Query: 61  KILDGHAVHLV 71
            I     +HLV
Sbjct: 444 NIQKESTLHLV 454

>Kpol_1070.6 s1070 complement(16980..18581) [1602 bp, 533 aa] {ON}
          complement(16980..18581) [1602 nt, 534 aa]
          Length = 533

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1  MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
          M I V   +G++   + V++  T+   K+ I +   I P+ QRLI++GK L+D +TL  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDGHAVHLV 71
           I     +HLV
Sbjct: 60 NIQKESTLHLV 70

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1   MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
           M I V   +G++   + V++  T+   K+ I +   I P+ QRLI++GK L+D +TL  Y
Sbjct: 77  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KILDGHAVHLV 71
            I     +HLV
Sbjct: 136 NIQKESTLHLV 146

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1   MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
           M I V   +G++   + V++  T+   K+ I +   I P+ QRLI++GK L+D +TL  Y
Sbjct: 153 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 211

Query: 61  KILDGHAVHLV 71
            I     +HLV
Sbjct: 212 NIQKESTLHLV 222

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1   MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
           M I V   +G++   + V++  T+   K+ I +   I P+ QRLI++GK L+D +TL  Y
Sbjct: 229 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 287

Query: 61  KILDGHAVHLV 71
            I     +HLV
Sbjct: 288 NIQKESTLHLV 298

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1   MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
           M I V   +G++   + V++  T+   K+ I +   I P+ QRLI++GK L+D +TL  Y
Sbjct: 305 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 363

Query: 61  KILDGHAVHLV 71
            I     +HLV
Sbjct: 364 NIQKESTLHLV 374

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1   MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
           M I V   +G++   + V++  T+   K+ I +   I P+ QRLI++GK L+D +TL  Y
Sbjct: 381 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 439

Query: 61  KILDGHAVHLV 71
            I     +HLV
Sbjct: 440 NIQKESTLHLV 450

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1   MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
           M I V   +G++   + V++  T+   K+ I +   I P+ QRLI++GK L+D +TL  Y
Sbjct: 457 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 515

Query: 61  KILDGHAVHLV 71
            I     +HLV
Sbjct: 516 NIQKESTLHLV 526

>Kpol_1030.5 s1030 complement(10263..10721) [459 bp, 152 aa] {ON}
          complement(10263..10721) [459 nt, 153 aa]
          Length = 152

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1  MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
          M I V   +G++   + V++  T+   K  I +   I P+ QRLI++GK L+D +TL  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDGHAVHLV 71
           I     +HLV
Sbjct: 60 NIQKESTLHLV 70

>Kpol_1024.16 s1024 complement(58683..59141) [459 bp, 152 aa] {ON}
          complement(58683..59141) [459 nt, 153 aa]
          Length = 152

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1  MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
          M I V   +G++   + V++  T+   K  I +   I P+ QRLI++GK L+D +TL  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDGHAVHLV 71
           I     +HLV
Sbjct: 60 NIQKESTLHLV 70

>ZYRO0G07854g Chr7 complement(634289..635671) [1383 bp, 460 aa]
          {ON} highly similar to uniprot|P04838 Saccharomyces
          cerevisiae YLL039c UBI4 ubiquitin
          Length = 460

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1  MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
          M I V   +G++   + V++  T+   K+ I +   I P+ QRLI++GK L+D +TL  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDGHAVHLV 71
           I     +HLV
Sbjct: 60 NIQKESTLHLV 70

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1   MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
           M I V   +G++   + V++  T+   K+ I +   I P+ QRLI++GK L+D +TL  Y
Sbjct: 77  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KILDGHAVHLV 71
            I     +HLV
Sbjct: 136 NIQKESTLHLV 146

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1   MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
           M I V   +G++   + V++  T+   K+ I +   I P+ QRLI++GK L+D +TL  Y
Sbjct: 153 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 211

Query: 61  KILDGHAVHLV 71
            I     +HLV
Sbjct: 212 NIQKESTLHLV 222

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1   MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
           M I V   +G++   + V++  T+   K+ I +   I P+ QRLI++GK L+D +TL  Y
Sbjct: 229 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 287

Query: 61  KILDGHAVHLV 71
            I     +HLV
Sbjct: 288 NIQKESTLHLV 298

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1   MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
           M I V   +G++   + V++  T+   K+ I +   I P+ QRLI++GK L+D +TL  Y
Sbjct: 305 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 363

Query: 61  KILDGHAVHLV 71
            I     +HLV
Sbjct: 364 NIQKESTLHLV 374

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1   MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
           M I V   +G++   + V++  T+   K+ I +   I P+ QRLI++GK L+D +TL  Y
Sbjct: 381 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 439

Query: 61  KILDGHAVHLV 71
            I     +HLV
Sbjct: 440 NIQKESTLHLV 450

>CAGL0D05082g Chr4 (488733..490334) [1602 bp, 533 aa] {ON} similar
          to uniprot|P04838 Saccharomyces cerevisiae YLL039c UBI4
          ubiquitin
          Length = 533

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1  MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
          M I V   +G++   + V++  T+   K+ I +   I P+ QRLI++GK L+D +TL  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDGHAVHLV 71
           I     +HLV
Sbjct: 60 NIQKESTLHLV 70

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1   MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
           M I V   +G++   + V++  T+   K+ I +   I P+ QRLI++GK L+D +TL  Y
Sbjct: 77  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KILDGHAVHLV 71
            I     +HLV
Sbjct: 136 NIQKESTLHLV 146

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1   MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
           M I V   +G++   + V++  T+   K+ I +   I P+ QRLI++GK L+D +TL  Y
Sbjct: 153 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 211

Query: 61  KILDGHAVHLV 71
            I     +HLV
Sbjct: 212 NIQKESTLHLV 222

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1   MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
           M I V   +G++   + V++  T+   K+ I +   I P+ QRLI++GK L+D +TL  Y
Sbjct: 229 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 287

Query: 61  KILDGHAVHLV 71
            I     +HLV
Sbjct: 288 NIQKESTLHLV 298

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1   MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
           M I V   +G++   + V++  T+   K+ I +   I P+ QRLI++GK L+D +TL  Y
Sbjct: 305 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 363

Query: 61  KILDGHAVHLV 71
            I     +HLV
Sbjct: 364 NIQKESTLHLV 374

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1   MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
           M I V   +G++   + V++  T+   K+ I +   I P+ QRLI++GK L+D +TL  Y
Sbjct: 381 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 439

Query: 61  KILDGHAVHLV 71
            I     +HLV
Sbjct: 440 NIQKESTLHLV 450

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1   MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
           M I V   +G++   + V++  T+   K+ I +   I P+ QRLI++GK L+D +TL  Y
Sbjct: 457 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 515

Query: 61  KILDGHAVHLV 71
            I     +HLV
Sbjct: 516 NIQKESTLHLV 526

>NCAS0C05850 Chr3 (1203331..1204497) [1167 bp, 388 aa] {ON} 
          Length = 388

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1  MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
          M I V   +G++   + V++  T+   K+ I +   I P+ QRLI++GK L+D +TL  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDGHAVHLV 71
           I     +HLV
Sbjct: 60 NIQKESTLHLV 70

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1   MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
           M I V   +G++   + V++  T+   K+ I +   I P+ QRLI++GK L+D +TL  Y
Sbjct: 77  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KILDGHAVHLV 71
            I     +HLV
Sbjct: 136 NIQKESTLHLV 146

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1   MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
           M I V   +G++   + V++  T+   K+ I +   I P+ QRLI++GK L+D +TL  Y
Sbjct: 153 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 211

Query: 61  KILDGHAVHLV 71
            I     +HLV
Sbjct: 212 NIQKESTLHLV 222

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1   MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
           M I V   +G++   + V++  T+   K+ I +   I P+ QRLI++GK L+D +TL  Y
Sbjct: 229 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 287

Query: 61  KILDGHAVHLV 71
            I     +HLV
Sbjct: 288 NIQKESTLHLV 298

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1   MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
           M I V   +G++   + V++  T+   K+ I +   I P+ QRLI++GK L+D +TL  Y
Sbjct: 305 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 363

Query: 61  KILDGHAVHLV 71
            I     +HLV
Sbjct: 364 NIQKESTLHLV 374

>Suva_10.266 Chr10 (471118..471576) [459 bp, 152 aa] {ON} YLR167W
          (REAL)
          Length = 152

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1  MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
          M I V   +G++   + V++  T+   K+ I +   I P+ QRLI++GK L+D +TL  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDGHAVHLV 71
           I     +HLV
Sbjct: 60 NIQKESTLHLV 70

>Skud_12.234 Chr12 (445677..446135) [459 bp, 152 aa] {ON} YLR167W
          (REAL)
          Length = 152

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1  MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
          M I V   +G++   + V++  T+   K+ I +   I P+ QRLI++GK L+D +TL  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDGHAVHLV 71
           I     +HLV
Sbjct: 60 NIQKESTLHLV 70

>Smik_12.229 Chr12 (446071..446529) [459 bp, 152 aa] {ON} YLR167W
          (REAL)
          Length = 152

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1  MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
          M I V   +G++   + V++  T+   K+ I +   I P+ QRLI++GK L+D +TL  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDGHAVHLV 71
           I     +HLV
Sbjct: 60 NIQKESTLHLV 70

>TBLA0H03180 Chr8 (775282..775740) [459 bp, 152 aa] {ON} Anc_8.386
          YLR167W
          Length = 152

 Score = 42.4 bits (98), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1  MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
          M I V   +G++   + V++  T+   K+ I +   I P+ QRLI++GK L+D +TL  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDGHAVHLV 71
           I     +HLV
Sbjct: 60 NIQKESTLHLV 70

>Ecym_3572 Chr3 complement(1083184..1084515) [1332 bp, 443 aa]
          {ON} similar to Ashbya gossypii AFR358W
          Length = 443

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 43/77 (55%), Gaps = 1/77 (1%)

Query: 1  MSITVHVKS-GQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLES 59
          M IT++ K   + K  + +   +T+A+ K  +A+  Q      ++I+SGK+L+D  TL++
Sbjct: 1  MHITINFKDFKKEKLPLQLSPTATIAEAKQLLAKEKQCDESQLKMIFSGKVLQDGHTLDA 60

Query: 60 YKILDGHAVHLVKSGTK 76
           K+ DG  V  + S  K
Sbjct: 61 CKLKDGDQVIFMISKKK 77

>NDAI0F00300 Chr6 (66116..66679) [564 bp, 187 aa] {ON} Anc_5.701
          Length = 187

 Score = 42.4 bits (98), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 40/77 (51%), Gaps = 6/77 (7%)

Query: 1   MSITVHVKSGQSK------WDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDD 54
           + + +H+K    K        + V++  T+   K+ I +   I P+ QRLI++GK L+D 
Sbjct: 53  LLLHIHIKYSFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDG 112

Query: 55  QTLESYKILDGHAVHLV 71
           +TL  Y I     +HLV
Sbjct: 113 RTLSDYNIQKESTLHLV 129

>KAFR0C03000 Chr3 (597127..598320) [1194 bp, 397 aa] {ON} Anc_8.142
           YGL181W
          Length = 397

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 34/55 (61%)

Query: 320 AGNNASQQPQDTRPPEERYEQQLRQLNDMGFFEFDRNVAALRRSGGSVQGALDAL 374
           +G    Q+  D    E  Y +Q+RQL +MGF + ++N+ AL++S G++  A+D L
Sbjct: 172 SGRYDDQEVSDDDRYESDYRRQVRQLKEMGFSDSEKNLKALKKSNGNMNRAIDVL 226

>KAFR0E00530 Chr5 complement(113019..114158) [1140 bp, 379 aa]
          {ON} Anc_1.480 YEL037C
          Length = 379

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 36/66 (54%)

Query: 11 QSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESYKILDGHAVHL 70
          + K  V +++ ST+   K  +A       +  +LI+SGK+LKDDQT+ S  + D   V +
Sbjct: 10 KEKIPVELESSSTILDAKNKLASIKSCDIDQIKLIFSGKVLKDDQTVSSCGLKDNDQVIM 69

Query: 71 VKSGTK 76
          + S  K
Sbjct: 70 MISKKK 75

>KLLA0E22133g Chr5 complement(1974635..1975786) [1152 bp, 383 aa]
          {ON} similar to uniprot|P32628 Saccharomyces cerevisiae
          YEL037C RAD23
          Length = 383

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 36/66 (54%)

Query: 11 QSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESYKILDGHAVHL 70
          + K  + +  D+T++  K  IAE  Q      +LIY+GKIL+D +T+    + +G  V  
Sbjct: 10 KEKLPIELADDATISHAKELIAEQKQCDASQIKLIYAGKILQDPKTVSGCNLKEGDQVIF 69

Query: 71 VKSGTK 76
          + S TK
Sbjct: 70 MISKTK 75

>TBLA0B02160 Chr2 complement(496901..498115) [1215 bp, 404 aa]
          {ON} Anc_1.480 YEL037C
          Length = 404

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 36/67 (53%), Gaps = 1/67 (1%)

Query: 11 QSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESYKILDG-HAVH 69
          + K  + +DADST+   K  IA       +  +LIYSGKILK+D T+ +  + D  H + 
Sbjct: 11 KEKIPLELDADSTIESAKGQIASEKNCDIDQIKLIYSGKILKNDATILNSGLKDNDHIIF 70

Query: 70 LVKSGTK 76
          ++    K
Sbjct: 71 MISKKKK 77

>TPHA0O00440 Chr15 (78697..79806) [1110 bp, 369 aa] {ON} Anc_1.480
          YEL037C
          Length = 369

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 35/66 (53%), Gaps = 2/66 (3%)

Query: 13 KWDVSVD--ADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESYKILDGHAVHL 70
          K  +S+D  A STV   K  +AE  +      +LIYSGK+L+D  ++E   + DG  V  
Sbjct: 11 KQKISLDLPASSTVLHAKKQLAEQKECDDSQIKLIYSGKVLQDSNSIEGCGLKDGDQVIF 70

Query: 71 VKSGTK 76
          + S  K
Sbjct: 71 MISKKK 76

>NCAS0G04120 Chr7 (768760..769938) [1179 bp, 392 aa] {ON}
          Anc_1.480 YEL037C
          Length = 392

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 34/58 (58%)

Query: 11 QSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESYKILDGHAV 68
          + K  +++++ +TV   KT +A+         +LIYSGK+L+D +TLE   + DG  V
Sbjct: 11 KEKIPLALESTNTVLDAKTQLAQNKSCEESQIKLIYSGKVLQDAKTLEDCGLKDGDQV 68

>YDR139C Chr4 complement(733618..733702,733776..733924) [234 bp,
          77 aa] {ON}  RUB1Ubiquitin-like protein with similarity
          to mammalian NEDD8; conjugation (neddylation)
          substrates include the cullins Cdc53p, Rtt101p, and
          Cul3p; activated by Ula1p and Uba3p (E1 enzyme pair);
          conjugation mediated by Ubc12p (E2 enzyme)
          Length = 77

 Score = 37.4 bits (85), Expect = 0.006,   Method: Composition-based stats.
 Identities = 23/71 (32%), Positives = 37/71 (52%), Gaps = 3/71 (4%)

Query: 3  ITVHVKSGQSKWDVSVDADST--VAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60
          + V VK+   K ++SV+   +  V   K  + E   I P  QRLI+ GK + D  T+   
Sbjct: 1  MIVKVKTLTGK-EISVELKESDLVYHIKELLEEKEGIPPSQQRLIFQGKQIDDKLTVTDA 59

Query: 61 KILDGHAVHLV 71
           +++G  +HLV
Sbjct: 60 HLVEGMQLHLV 70

>Suva_5.32 Chr5 complement(56798..58027) [1230 bp, 409 aa] {ON}
          YEL037C (REAL)
          Length = 409

 Score = 39.7 bits (91), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 37/66 (56%)

Query: 11 QSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESYKILDGHAVHL 70
          + K  + ++  +T+ + KT +A++S       +LIYSGK+L+D +T+    + DG  V  
Sbjct: 11 KEKVPLDLEPSNTIFEAKTKLAQSSSCEESQIKLIYSGKVLQDSKTVSECGLKDGDQVVF 70

Query: 71 VKSGTK 76
          + S  K
Sbjct: 71 MISQKK 76

>TBLA0D02210 Chr4 (555236..556927) [1692 bp, 563 aa] {ON} Anc_8.142
           YGL181W
          Length = 563

 Score = 39.7 bits (91), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 24/38 (63%)

Query: 337 RYEQQLRQLNDMGFFEFDRNVAALRRSGGSVQGALDAL 374
           +Y +QL++LNDMGF   D N  AL  S G +  ALD L
Sbjct: 219 KYSRQLKELNDMGFTNTDNNAEALSISRGDINRALDLL 256

>Skud_5.53 Chr5 complement(79502..80695) [1194 bp, 397 aa] {ON}
          YEL037C (REAL)
          Length = 397

 Score = 39.3 bits (90), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 19/66 (28%), Positives = 37/66 (56%)

Query: 11 QSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESYKILDGHAVHL 70
          + K  + ++  +T+ + KT +A+++       +LIYSGK+L+D +T+    + DG  V  
Sbjct: 11 KEKVPLDLEPSNTIFEAKTKLAQSTSCEESQIKLIYSGKVLQDSKTVSECGLKDGDQVVF 70

Query: 71 VKSGTK 76
          + S  K
Sbjct: 71 MISQKK 76

>NCAS0B04590 Chr2 complement(835478..836821) [1344 bp, 447 aa] {ON}
           Anc_8.142 YGL181W
          Length = 447

 Score = 38.9 bits (89), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 23/38 (60%)

Query: 337 RYEQQLRQLNDMGFFEFDRNVAALRRSGGSVQGALDAL 374
           +Y +QLR L DMGF + D NV AL    G++   ++ L
Sbjct: 155 KYSRQLRSLKDMGFNDVDNNVEALNICNGNINKTINIL 192

>CAGL0L06028g Chr12 complement(677581..679098) [1518 bp, 505 aa]
           {ON} weakly similar to uniprot|P40956 Saccharomyces
           cerevisiae YGL181w GTS1
          Length = 505

 Score = 38.9 bits (89), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 25/38 (65%)

Query: 337 RYEQQLRQLNDMGFFEFDRNVAALRRSGGSVQGALDAL 374
           +Y ++LRQL ++GF    +N+ A+  S G V GALD L
Sbjct: 211 KYGRELRQLRELGFTNEQKNIDAITYSHGDVNGALDYL 248

>NDAI0B01850 Chr2 complement(440321..441532) [1212 bp, 403 aa] {ON} 
          Length = 403

 Score = 38.1 bits (87), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 28/44 (63%), Gaps = 2/44 (4%)

Query: 337 RYEQQLRQLNDMGFFEFDRNVAALRRSGGSVQGALDALL--NGD 378
           +Y ++LR+L +MGF + D N  AL  + G + GA+D L   NGD
Sbjct: 166 KYSRELRRLQNMGFRDIDINTEALVLARGDLNGAIDILTQDNGD 209

>YEL037C Chr5 complement(81407..82603) [1197 bp, 398 aa] {ON}
          RAD23Protein with ubiquitin-like N terminus, subunit of
          Nuclear Excision Repair Factor 2 (NEF2) with Rad4p that
          binds damaged DNA; enhances protein deglycosylation
          activity of Png1p; also involved, with Rad4p, in
          ubiquitylated protein turnover
          Length = 398

 Score = 38.1 bits (87), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 19/66 (28%), Positives = 36/66 (54%)

Query: 11 QSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESYKILDGHAVHL 70
          + K  + ++  +T+ + KT +A++        +LIYSGK+L+D +T+    + DG  V  
Sbjct: 11 KEKVPLDLEPSNTILETKTKLAQSISCEESQIKLIYSGKVLQDSKTVSECGLKDGDQVVF 70

Query: 71 VKSGTK 76
          + S  K
Sbjct: 71 MVSQKK 76

>NDAI0G00330 Chr7 complement(54805..56088) [1284 bp, 427 aa] {ON}
          Anc_1.480 YEL037C
          Length = 427

 Score = 37.7 bits (86), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 17/66 (25%), Positives = 36/66 (54%)

Query: 11 QSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESYKILDGHAVHL 70
          + K  + ++  +T+   K+ +A+         ++IYSGK+L+D QT+E  ++ +G  +  
Sbjct: 11 KEKIPLDLEPSNTILDVKSQLAQAKACEESQIKIIYSGKVLQDGQTVEECQLKEGDQIIF 70

Query: 71 VKSGTK 76
          + S  K
Sbjct: 71 MISKKK 76

>SAKL0H24772g Chr8 complement(2155837..2157081) [1245 bp, 414 aa]
           {ON} weakly similar to uniprot|P40956 Saccharomyces
           cerevisiae YGL181W GTS1 Contains a zinc-finger in the N-
           terminus and a long Gln-rich region in the C-terminus
           regulates ultradian rhythm cell size cell cycle lifespan
           sporulation heat tolerance and multidrug transport
          Length = 414

 Score = 37.4 bits (85), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 24/62 (38%), Positives = 33/62 (53%), Gaps = 6/62 (9%)

Query: 323 NASQQPQDTRPPEERYE-----QQLRQLNDMGFFEFDRNVAALRRSGGSVQGALDALLNG 377
           N+ + PQ T    E YE      QLR L ++G+ + D NV AL  + G +  ALD +L  
Sbjct: 165 NSGKVPQLTHRTVEDYEIGRHSHQLRNLKELGYLDTDSNVEALVLARGDINLALD-ILEA 223

Query: 378 DV 379
           DV
Sbjct: 224 DV 225

>TDEL0C02590 Chr3 complement(448900..450006) [1107 bp, 368 aa]
          {ON} Anc_1.480 YEL037C
          Length = 368

 Score = 36.6 bits (83), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 32/58 (55%)

Query: 11 QSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESYKILDGHAV 68
          + K  + +D  S+V   K  +A+  +      +LIYSGK+L+D ++L+   + DG  V
Sbjct: 11 KEKIPLDLDLSSSVLDAKVQLAQKKECEEGQIKLIYSGKVLQDSKSLQESGLKDGDQV 68

>Smik_5.56 Chr5 complement(83505..84698) [1194 bp, 397 aa] {ON}
          YEL037C (REAL)
          Length = 397

 Score = 36.6 bits (83), Expect = 0.098,   Method: Compositional matrix adjust.
 Identities = 18/66 (27%), Positives = 36/66 (54%)

Query: 11 QSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESYKILDGHAVHL 70
          + K  + ++  +T+ + K+ +A++        +LIYSGK+L+D +T+    + DG  V  
Sbjct: 11 KEKVPLDLEPSNTIFEVKSKLAQSISCEESQIKLIYSGKVLQDSKTVSECGLKDGDQVVF 70

Query: 71 VKSGTK 76
          + S  K
Sbjct: 71 MVSQKK 76

>Smik_7.91 Chr7 (152642..153637,153905..154108) [1200 bp, 399 aa]
           {ON} YGL181W (REAL)
          Length = 399

 Score = 35.8 bits (81), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 26/38 (68%)

Query: 337 RYEQQLRQLNDMGFFEFDRNVAALRRSGGSVQGALDAL 374
           RY +QL +L DMGF + ++N+ AL  + G++  A+D L
Sbjct: 196 RYSRQLLELRDMGFSDANKNLDALSSAHGNINRAIDYL 233

>TDEL0B04690 Chr2 (832571..833899) [1329 bp, 442 aa] {ON} Anc_8.142
           YGL181W
          Length = 442

 Score = 35.8 bits (81), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 23/38 (60%)

Query: 337 RYEQQLRQLNDMGFFEFDRNVAALRRSGGSVQGALDAL 374
           RY ++LR L +MG+ + D N  AL  + G +  A+D L
Sbjct: 193 RYSRELRTLKEMGYDDIDHNAEALSHAHGDLNRAIDIL 230

>YGL181W Chr7 (157906..159096) [1191 bp, 396 aa] {ON}  GTS1Protein
           involved in Arf3p regulation and in transcription
           regulation; localizes to the nucleus and to endocytic
           patches; contains an N-terminal Zn-finger and ArfGAP
           homology domain, a C-terminal glutamine-rich region, and
           a UBA (ubiquitin associated) domain; gts1 mutations
           affect budding, cell size, heat tolerance, sporulation,
           life span, ultradian rhythms, endocytosis; expression
           oscillates in a pattern similar to metabolic
           oscillations
          Length = 396

 Score = 35.8 bits (81), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 26/38 (68%)

Query: 337 RYEQQLRQLNDMGFFEFDRNVAALRRSGGSVQGALDAL 374
           RY +QL +L DMGF + ++N+ AL  + G++  A+D L
Sbjct: 194 RYSRQLAELKDMGFGDTNKNLDALSSAHGNINRAIDYL 231

>KAFR0I02780 Chr9 (560687..561331) [645 bp, 214 aa] {ON} Anc_1.480
          YEL037C
          Length = 214

 Score = 34.3 bits (77), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 31/57 (54%), Gaps = 2/57 (3%)

Query: 11 QSKWDVSVDADSTVAQFKTAIAETSQIAPENQR--LIYSGKILKDDQTLESYKILDG 65
          +SK+ ++   + TV   K  I ++ ++        LIYSGK+L+DD TL S  + D 
Sbjct: 11 RSKFQLNGTVNDTVRDLKHHIVKSHKLVCHTDEISLIYSGKLLQDDATLNSLHLKDN 67

>ZYRO0F05192g Chr6 (434982..436136) [1155 bp, 384 aa] {ON} similar
          to uniprot|P32628 Saccharomyces cerevisiae YEL037C
          RAD23
          Length = 384

 Score = 34.7 bits (78), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 31/63 (49%)

Query: 11 QSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESYKILDGHAVHL 70
          + K  + +D  S+V   K  +A          +LIYSGK+L+D + L+   + DG  V  
Sbjct: 11 KEKISLELDPSSSVKDAKVRLATEKSCEESQIKLIYSGKVLQDAKNLQESGLKDGDQVIF 70

Query: 71 VKS 73
          + S
Sbjct: 71 MIS 73

>NCAS0C04090 Chr3 (833393..834583) [1191 bp, 396 aa] {ON} Anc_8.142
          Length = 396

 Score = 34.7 bits (78), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 29/55 (52%), Gaps = 1/55 (1%)

Query: 321 GNNASQQPQDTRPPEERYEQQLRQLNDMGF-FEFDRNVAALRRSGGSVQGALDAL 374
           G +    P D+R    +Y +QL +L DMG+  +  R   AL R+ G +  +LD +
Sbjct: 182 GGSNRHHPHDSRHGRFKYSRQLNELRDMGYSTDTQRIKDALERTHGDINRSLDII 236

>Suva_7.81 Chr7 (153418..154434,154933..155121) [1206 bp, 401 aa]
           {ON} YGL181W (REAL)
          Length = 401

 Score = 34.3 bits (77), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 26/38 (68%)

Query: 337 RYEQQLRQLNDMGFFEFDRNVAALRRSGGSVQGALDAL 374
           RY +QL +L DMGF + ++N+ AL  + G++  A+D L
Sbjct: 194 RYSRQLAELRDMGFNDKNKNLDALSSAHGNLSRAIDYL 231

>Suva_10.31 Chr10 complement(68008..68199) [192 bp, 64 aa] {ON}
          YLR167W (REAL)
          Length = 64

 Score = 30.4 bits (67), Expect = 0.92,   Method: Composition-based stats.
 Identities = 17/51 (33%), Positives = 29/51 (56%), Gaps = 1/51 (1%)

Query: 1  MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKIL 51
          M I V   +G++   + V++  T+   K+ I +   I P+ QRLI++GK L
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQL 50

>Kpol_370.6 s370 (10094..11308) [1215 bp, 404 aa] {ON}
          (10094..11308) [1215 nt, 405 aa]
          Length = 404

 Score = 32.7 bits (73), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 31/66 (46%)

Query: 11 QSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESYKILDGHAVHL 70
          + K  + ++   TV   K  IA          +LIYSGK+L++D T+    + DG  V  
Sbjct: 11 KEKIPLDLEGSVTVLDAKKQIAVKKDCEDSQIKLIYSGKVLQNDSTIGDCGLKDGDQVIF 70

Query: 71 VKSGTK 76
          + S  K
Sbjct: 71 MISKKK 76

>Skud_7.90 Chr7 (163529..164719) [1191 bp, 396 aa] {ON} YGL181W
           (REAL)
          Length = 396

 Score = 31.2 bits (69), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 25/38 (65%)

Query: 337 RYEQQLRQLNDMGFFEFDRNVAALRRSGGSVQGALDAL 374
           RY +QL +L DMG+ +  +N+ AL  + G++  ++D L
Sbjct: 194 RYSRQLIELRDMGYNDTAKNLDALSFAHGNINRSIDYL 231

>Kpol_541.50 s541 complement(162130..163665) [1536 bp, 511 aa] {ON}
           complement(162130..163665) [1536 nt, 512 aa]
          Length = 511

 Score = 30.8 bits (68), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 13/38 (34%), Positives = 22/38 (57%)

Query: 337 RYEQQLRQLNDMGFFEFDRNVAALRRSGGSVQGALDAL 374
           RY ++L +L +MGF + D N  A+  + G +  A+  L
Sbjct: 233 RYSRELNRLREMGFNDIDNNAEAMSLANGDISRAITIL 270

>KNAG0M01170 Chr13 complement(211476..212495) [1020 bp, 339 aa] {ON}
           Anc_6.21 YOR007C
          Length = 339

 Score = 30.4 bits (67), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 27/100 (27%), Positives = 46/100 (46%), Gaps = 19/100 (19%)

Query: 142 GGMTSAPNSDDMLR----MLENPVMQSQMNEMLSNPQMIDFLIQQSPQLQSMGPQARQML 197
           GG+    N+  M++    M+ NP    ++  M+           Q+P +Q M  Q +   
Sbjct: 254 GGLEGLMNNPQMMQAAQSMMSNPGAMEKIQSMM-----------QNPAIQQMAEQFKGG- 301

Query: 198 QSPFFRQMMTNPEMIRQSMQFSGVLGGAGDPSAAGANAFP 237
            +P F +MM NP +   +   S +  GAG+P+A   +A P
Sbjct: 302 NTPDFSEMMNNPAVRNMA---SSLFSGAGEPAAPKDDAKP 338

>Kwal_23.5606 s23 complement(1234938..1235555) [618 bp, 205 aa] {ON}
           YKL159C (RCN1) - calcineurin inhibitor [contig 11] FULL
          Length = 205

 Score = 30.0 bits (66), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 28/60 (46%), Gaps = 6/60 (10%)

Query: 118 LSDLTSARYAGYLNLPSADSFGPDGGMTSAPNSDDMLRMLENP------VMQSQMNEMLS 171
           L D T+A    YL LPS  SF      TS P   D  R+ E+P      V  S +NE +S
Sbjct: 87  LVDTTTASQKQYLELPSHQSFFLVSPPTSPPPEFDYSRLEEHPNREKGLVPVSHLNEKMS 146

>TPHA0H00400 Chr8 (77122..78522) [1401 bp, 466 aa] {ON} Anc_8.142
           YGL181W
          Length = 466

 Score = 30.4 bits (67), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 12/38 (31%), Positives = 21/38 (55%)

Query: 337 RYEQQLRQLNDMGFFEFDRNVAALRRSGGSVQGALDAL 374
           +Y + ++ L  MG+ + D N  AL  + G +  A+D L
Sbjct: 227 KYSRHIKNLEQMGYTDIDNNAEALSIAHGDINQAIDIL 264

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.313    0.127    0.357 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 30,999,977
Number of extensions: 1095041
Number of successful extensions: 4921
Number of sequences better than 10.0: 204
Number of HSP's gapped: 4919
Number of HSP's successfully gapped: 295
Length of query: 379
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 268
Effective length of database: 40,753,473
Effective search space: 10921930764
Effective search space used: 10921930764
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 66 (30.0 bits)