Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_27.102728.838ON55155127320.0
KLTH0C03916g8.838ON57039715290.0
SAKL0D01518g8.838ON57440210011e-129
ABL128W8.838ON4743918131e-102
Ecym_46098.838ON5204107626e-94
KLLA0D01617g8.838ON5624196183e-72
ZYRO0G14146g8.838ON5074065942e-69
TDEL0B005908.838ON5413625936e-69
Kpol_1068.108.838ON6174135294e-59
TPHA0I002308.838ON6143835033e-55
NCAS0B003108.838ON5643604759e-52
Suva_13.298.838ON5093794534e-49
YML114C (TAF8)8.838ON5103574421e-47
Skud_13.278.838ON5143624315e-46
Smik_13.208.838ON5103604104e-43
NDAI0E003008.838ON6644463981e-40
TBLA0D032508.838ON6835183857e-39
KAFR0A028208.838ON4533483635e-37
CAGL0B02299g8.838ON6432152845e-26
KNAG0G034108.838ON5262752091e-16
NCAS0J017204.290ON40686770.90
KAFR0A057704.290ON379151714.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_27.10272
         (551 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_27.10272 s27 complement(271405..273060) [1656 bp, 551 aa] {...  1056   0.0  
KLTH0C03916g Chr3 complement(342430..344142) [1713 bp, 570 aa] {...   593   0.0  
SAKL0D01518g Chr4 complement(122448..124172) [1725 bp, 574 aa] {...   390   e-129
ABL128W Chr2 (155096..156520) [1425 bp, 474 aa] {ON} Syntenic ho...   317   e-102
Ecym_4609 Chr4 (1186861..1188423) [1563 bp, 520 aa] {ON} similar...   298   6e-94
KLLA0D01617g Chr4 complement(143940..145628) [1689 bp, 562 aa] {...   242   3e-72
ZYRO0G14146g Chr7 (1126767..1128290) [1524 bp, 507 aa] {ON} weak...   233   2e-69
TDEL0B00590 Chr2 complement(113785..115410) [1626 bp, 541 aa] {O...   233   6e-69
Kpol_1068.10 s1068 complement(18964..20817) [1854 bp, 617 aa] {O...   208   4e-59
TPHA0I00230 Chr9 (41435..43279) [1845 bp, 614 aa] {ON} Anc_8.838...   198   3e-55
NCAS0B00310 Chr2 complement(37876..39570) [1695 bp, 564 aa] {ON}...   187   9e-52
Suva_13.29 Chr13 complement(41778..43307) [1530 bp, 509 aa] {ON}...   179   4e-49
YML114C Chr13 complement(42043..43575) [1533 bp, 510 aa] {ON}  T...   174   1e-47
Skud_13.27 Chr13 complement(41670..43214) [1545 bp, 514 aa] {ON}...   170   5e-46
Smik_13.20 Chr13 complement(38299..39831) [1533 bp, 510 aa] {ON}...   162   4e-43
NDAI0E00300 Chr5 complement(41787..43781) [1995 bp, 664 aa] {ON}...   157   1e-40
TBLA0D03250 Chr4 (807946..809997) [2052 bp, 683 aa] {ON} Anc_8.8...   152   7e-39
KAFR0A02820 Chr1 (584984..586345) [1362 bp, 453 aa] {ON} Anc_8.8...   144   5e-37
CAGL0B02299g Chr2 (217341..219272) [1932 bp, 643 aa] {ON} some s...   114   5e-26
KNAG0G03410 Chr7 (731420..733000) [1581 bp, 526 aa] {ON} Anc_8.8...    85   1e-16
NCAS0J01720 Chr10 complement(315996..317216) [1221 bp, 406 aa] {...    34   0.90 
KAFR0A05770 Chr1 complement(1168705..1169844) [1140 bp, 379 aa] ...    32   4.2  

>Kwal_27.10272 s27 complement(271405..273060) [1656 bp, 551 aa] {ON}
           YML114C (TAF8) - TAF65, subunit of transcription factor
           TFIID [contig 37] FULL
          Length = 551

 Score = 1056 bits (2732), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 523/551 (94%), Positives = 523/551 (94%)

Query: 1   MTKPAPDAQTVSPDLQRVVQLKNLPTLHEIPKADMDDPLKKLLEKAIAIQLKSINADASI 60
           MTKPAPDAQTVSPDLQRVVQLKNLPTLHEIPKADMDDPLKKLLEKAIAIQLKSINADASI
Sbjct: 1   MTKPAPDAQTVSPDLQRVVQLKNLPTLHEIPKADMDDPLKKLLEKAIAIQLKSINADASI 60

Query: 61  SQLAFENLIILVEEMLSNMLMDLHKMANIQRRHCISKKDLLLIIEGYNLSSSDLMLELER 120
           SQLAFENLIILVEEMLSNMLMDLHKMANIQRRHCISKKDLLLIIEGYNLSSSDLMLELER
Sbjct: 61  SQLAFENLIILVEEMLSNMLMDLHKMANIQRRHCISKKDLLLIIEGYNLSSSDLMLELER 120

Query: 121 SRYVRSRHLEQIKKVEEDSKYVEKQEHTPLTQNELLSSTHPEFFVLDKDVLTLVPPSVKD 180
           SRYVRSRHLEQIKKVEEDSKYVEKQEHTPLTQNELLSSTHPEFFVLDKDVLTLVPPSVKD
Sbjct: 121 SRYVRSRHLEQIKKVEEDSKYVEKQEHTPLTQNELLSSTHPEFFVLDKDVLTLVPPSVKD 180

Query: 181 TKHVPRWLPDFPPDHTYRFTAQYNKPITDERLMKRKLAEEANLSEKALIHLSMLSHEEAS 240
           TKHVPRWLPDFPPDHTYRFTAQYNKPITDERLMKRKLAEEANLSEKALIHLSMLSHEEAS
Sbjct: 181 TKHVPRWLPDFPPDHTYRFTAQYNKPITDERLMKRKLAEEANLSEKALIHLSMLSHEEAS 240

Query: 241 SGPIDSDTIYEEAQQETQLLFGPVKKKKTAAINEVNDLLRTLPQQNFSVEEYARNRVEIA 300
           SGPIDSDTIYEEAQQETQLLFGPVKKKKTAAINEVNDLLRTLPQQNFSVEEYARNRVEIA
Sbjct: 241 SGPIDSDTIYEEAQQETQLLFGPVKKKKTAAINEVNDLLRTLPQQNFSVEEYARNRVEIA 300

Query: 301 RRRVNEYERHQLQLQKGAFIKAAHLLSPFSKKRTSCKQVEKEIRTLLHRSRIGLLKSAPS 360
           RRRVNEYERHQLQLQKGAFIKAAHLLSPFSKKRTSCKQVEKEIRTLLHRSRIGLLKSAPS
Sbjct: 301 RRRVNEYERHQLQLQKGAFIKAAHLLSPFSKKRTSCKQVEKEIRTLLHRSRIGLLKSAPS 360

Query: 361 LKERRKREIALAXXXXXXXXXXXXXXXXARSKSSNEFDVLDLNNLNEDPFFGGLGXXXXX 420
           LKERRKREIALA                ARSKSSNEFDVLDLNNLNEDPFFGGLG     
Sbjct: 361 LKERRKREIALAEENRRLRDEKLRKEREARSKSSNEFDVLDLNNLNEDPFFGGLGSSDSE 420

Query: 421 XXXXXXXKATDGVSESEKQQITQDEAALDTVKASPPTEPHVSNTNDQAPEASVADSPKPE 480
                  KATDGVSESEKQQITQDEAALDTVKASPPTEPHVSNTNDQAPEASVADSPKPE
Sbjct: 421 DEQQQEEKATDGVSESEKQQITQDEAALDTVKASPPTEPHVSNTNDQAPEASVADSPKPE 480

Query: 481 SNMPALQEGDTKQKDLESATPKPDSTDVQQEAEDTPTDADLPKSEDIGATELSDNQSHST 540
           SNMPALQEGDTKQKDLESATPKPDSTDVQQEAEDTPTDADLPKSEDIGATELSDNQSHST
Sbjct: 481 SNMPALQEGDTKQKDLESATPKPDSTDVQQEAEDTPTDADLPKSEDIGATELSDNQSHST 540

Query: 541 QISPEPGHQDI 551
           QISPEPGHQDI
Sbjct: 541 QISPEPGHQDI 551

>KLTH0C03916g Chr3 complement(342430..344142) [1713 bp, 570 aa] {ON}
           weakly similar to uniprot|Q03750 Saccharomyces
           cerevisiae YML114C TAF8 TFIID subunit (65 kDa) involved
           in RNA polymerase II transcription initiation
          Length = 570

 Score =  593 bits (1529), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/397 (71%), Positives = 342/397 (86%), Gaps = 1/397 (0%)

Query: 19  VQLKNLPTLHEIPKADMDDPLKKLLEKAIAIQLKSINADASISQLAFENLIILVEEMLSN 78
           VQL++LP L EIP+  +DDPL+KLLEKA+AIQLK++N++ SISQ AFENLIILVE+MLSN
Sbjct: 19  VQLRHLPNLEEIPRTALDDPLRKLLEKAVAIQLKAVNSNVSISQFAFENLIILVEQMLSN 78

Query: 79  MLMDLHKMANIQRRHCISKKDLLLIIEGYNLSSSDLMLELERSRYVRSRHLEQIKKVEED 138
           ML+DLHKM NIQRRHCISKKDLLLII+GYNL+ +DLM+ELERS+YVRS +LE+++KV E+
Sbjct: 79  MLVDLHKMVNIQRRHCISKKDLLLIIDGYNLTCADLMVELERSQYVRSHNLERVRKVREE 138

Query: 139 SKYVEKQEHTPLTQNELLSSTHPEFFVLDKDVLTLVPPSVKDTKHVPRWLPDFPPDHTYR 198
           S+ VE +E TPL++ ELL S H EFF+ DK++LTLVPP+ K+TK+VPRWLP+FPPDHTYR
Sbjct: 139 SEVVEAKEKTPLSEKELLESKHLEFFIQDKEILTLVPPTPKNTKYVPRWLPEFPPDHTYR 198

Query: 199 FTAQYNKPITDERLMKRKLAEEANLSEKALIHLSMLSHEEASSGPIDSDTIYEEAQQETQ 258
           FT+Q+N+PITDERLMKRKLAEEA+LSEKALIHLS LSHEE+ S   DSD I++E+QQ+TQ
Sbjct: 199 FTSQFNRPITDERLMKRKLAEEADLSEKALIHLSKLSHEESPSEGADSDEIFKESQQDTQ 258

Query: 259 LLFGPVKKKKTAAINEVNDLLRTLPQQNFSVEEYARNRVEIARRRVNEYERHQLQLQKGA 318
           L+FGP KK K AAIN  +DLLRTLPQQN++VEEYARNRVEIARR+V EYERHQL LQKGA
Sbjct: 259 LIFGPAKKTKIAAINGASDLLRTLPQQNYNVEEYARNRVEIARRKVEEYERHQLLLQKGA 318

Query: 319 FIKAAHLLSPFSKKRTSCKQVEKEIRTLLHRSRIGLLKSAPSLKERRKREIALAXXXXXX 378
           FIKAAHLLSPF+KKR +CKQVEKE+RTLLHRS IGLLKSAP L+E+RKRE+ LA      
Sbjct: 319 FIKAAHLLSPFAKKR-NCKQVEKEVRTLLHRSYIGLLKSAPLLREQRKREVELAEENRRL 377

Query: 379 XXXXXXXXXXARSKSSNEFDVLDLNNLNEDPFFGGLG 415
                      R K+S ++DVLDL+NLNEDPFFGGLG
Sbjct: 378 REEQIRQEREERLKNSKDYDVLDLDNLNEDPFFGGLG 414

>SAKL0D01518g Chr4 complement(122448..124172) [1725 bp, 574 aa] {ON}
           weakly similar to uniprot|Q03750 Saccharomyces
           cerevisiae YML114C TAF8 TFIID subunit (65 kDa) involved
           in RNA polymerase II transcription initiation
          Length = 574

 Score =  390 bits (1001), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 201/402 (50%), Positives = 282/402 (70%), Gaps = 9/402 (2%)

Query: 19  VQLKNLPTLHEIPKADMDDPLKKLLEKAIAIQLKSINADASISQLAFENLIILVEEMLSN 78
           ++LK LPTLH  P   ++ P+ K+L +A+AI+LK +N D ++SQ AFENL+ LV E LS 
Sbjct: 19  IRLKKLPTLHAAPHDSLEQPMHKILSQAVAIRLKPMNKDVAMSQFAFENLVQLVSENLSF 78

Query: 79  MLMDLHKMANIQRRHCISKKDLLLIIEGYNLSSSDLMLELERSRYVRSRHLEQIKKVEED 138
           ML  LH+  +IQRR  ISKKDLLL+++GY+LS+S+LM ELE S+Y+ S H E++ K+ + 
Sbjct: 79  MLTTLHRFVDIQRRREISKKDLLLLLKGYDLSNSELMRELESSQYIVSNHPEKVNKIAQK 138

Query: 139 SKYVEKQEHTPLTQNELLSSTHPEFFVLDKDVLTLVPPSVKDTKHVPRWLPDFPPDHTYR 198
           SK ++ +   P+T+ ELL+S H EFF  D D+L LVPP+ K+ +++P+WLP+FPPDHTYR
Sbjct: 139 SKELKSKLLKPMTEKELLNSAHSEFFFKDMDILDLVPPTNKNNQYIPKWLPEFPPDHTYR 198

Query: 199 FTAQYNKPITDERLMKRKLAEEANLSEKALIHLSMLSHEEASSGPIDSD------TIYEE 252
           FT+QYNKP+ DER ++RKL EE   SE+AL++L  L H ++++  + ++      ++YEE
Sbjct: 199 FTSQYNKPVVDERQLRRKLVEEGKQSERALVNL--LKHHDSTNQDLGNNERVEKRSLYEE 256

Query: 253 AQQETQLLFGPVKKKKTAAINEVNDLLRTLPQQNFSVEEYARNRVEIARRRVNEYERHQL 312
            Q+ET L+FGP +KK     N  ++LLRTLP +NFSVEEYARNRVEIARR+V EYE++QL
Sbjct: 257 TQEETFLIFGPERKKSHTTENS-HELLRTLPLKNFSVEEYARNRVEIARRKVLEYEQYQL 315

Query: 313 QLQKGAFIKAAHLLSPFSKKRTSCKQVEKEIRTLLHRSRIGLLKSAPSLKERRKREIALA 372
           +LQK  FIKAA+L SP  K   S K ++KE++++L RS IGLL+S P L E + RE  LA
Sbjct: 316 RLQKNPFIKAANLCSPLKKSTMSRKAIDKELKSMLQRSYIGLLRSVPKLNEVKARERELA 375

Query: 373 XXXXXXXXXXXXXXXXARSKSSNEFDVLDLNNLNEDPFFGGL 414
                            ++++    +VLDLNNLNEDP   G 
Sbjct: 376 NERRREMLEKLNEERQRQAEAGGGDEVLDLNNLNEDPLLAGF 417

>ABL128W Chr2 (155096..156520) [1425 bp, 474 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YML114C (TAF65)
          Length = 474

 Score =  317 bits (813), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 164/391 (41%), Positives = 242/391 (61%), Gaps = 15/391 (3%)

Query: 19  VQLKNLPTLHEIPKADMDDPLKKLLEKAIAIQLKSINADASISQLAFENLIILVEEMLSN 78
           +QLK LP L E+ K++   P++KLL +A+ + LK++ +D  I+QL FENL+  VE  L +
Sbjct: 19  IQLKKLPDLTEVTKSN---PMQKLLAQAVGLHLKTMRSDVGITQLGFENLVQFVELQLDD 75

Query: 79  MLMDLHKMANIQRRHCISKKDLLLIIEGYNLSSSDLMLELERSRYVRSRHLEQIKKVEED 138
           ML  LH+ AN+QRR+ +S KD+ L + G  +    L  E  RS+YVR +H   ++ +EE 
Sbjct: 76  MLQILHRFANVQRRNEVSLKDVRLFLHGCGVEEESLYEEYVRSQYVRQQHAGAVRSIEEQ 135

Query: 139 SKYVEKQEHTPLTQNELLSSTHPEFFVLDKDVLTLVPPSVKDTKHVPRWLPDFPPDHTYR 198
           S  +    H P+++ ELLSS+H EFF  D D+L LVPP+  +  +VP+WLP+FPPDHTY+
Sbjct: 136 SASLMGHWHQPMSEEELLSSSHAEFFFKDVDILNLVPPTNNNNHYVPKWLPEFPPDHTYK 195

Query: 199 FTAQYNKPITDERLMKRKLAEEANLSEKALIHLSMLSHEEASSGPIDSDTIYEEAQQETQ 258
           FT+ YN+PITDER MKRKL EE+ LSEKAL+H+   + ++  +       I  + QQE  
Sbjct: 196 FTSIYNQPITDERQMKRKLFEESKLSEKALLHMLGTATKKPRADDAQLPQIISDGQQENL 255

Query: 259 LLFGPVKKKKTAAINEVNDLLRTLPQQNFSVEEYARNRVEIARRRVNEYERHQLQLQKGA 318
           L++GP +++               P + F++E+YAR RVE+ARRRV E+E+ +LQ+QK  
Sbjct: 256 LIYGPERRRLAP---------EPAPTRGFNIEDYARCRVELARRRVEEFEQQKLQVQKNP 306

Query: 319 FIKAAHLLSPFSKKRTSCKQVEKEIRTLLHRSRIGLLKSAPSLKERRKREIALAXXXXXX 378
           FI+AA   SP++  R S K +E+E   LLHRS IG+L + P L+  + RE+A A      
Sbjct: 307 FIRAAAACSPYATTRLSRKAIEREFGVLLHRSYIGVLHAIPRLRRTKARELAAAYERERA 366

Query: 379 XXXXXXXXXXARSKSSNEFDVLDLNNLNEDP 409
                         +  +  VLDL+ L++DP
Sbjct: 367 RQESMRNNTDL---TQQQHGVLDLSALHDDP 394

>Ecym_4609 Chr4 (1186861..1188423) [1563 bp, 520 aa] {ON} similar to
           Ashbya gossypii ABL128W
          Length = 520

 Score =  298 bits (762), Expect = 6e-94,   Method: Compositional matrix adjust.
 Identities = 168/410 (40%), Positives = 248/410 (60%), Gaps = 21/410 (5%)

Query: 18  VVQLKNLPTLHEIPKADMDDPLKKLLEKAIAIQLKSINADASISQLAFENLIILVEEMLS 77
            +QLK LP L E+ K    +P++ LL +++A+QLK++ +D SI++L F N++  +E  ++
Sbjct: 18  FIQLKKLPGLQEVAK---HNPMQILLSQSVALQLKTMKSDFSITELGFNNMMQFIEMQMN 74

Query: 78  NMLMDLHKMANIQRRHCISKKDLLLIIEGYNLSSSDLMLELERSRYVRSRHLEQIKKVEE 137
           +M   LH+ ANIQRR+ IS KDL L ++G  +    L  E E+SRY++  +  + K +E 
Sbjct: 75  DMFQILHRFANIQRRNEISIKDLKLFLKGTGIEVQSLYDEFEKSRYIKKTYEAEFKNIER 134

Query: 138 DSKYVEKQEHTPLTQNELLSSTHPEFFVLDKDVLTLVPPSVKDTKHVPRWLPDFPPDHTY 197
            S  + ++   PL   ELLSS H EFF  D D+L LVPP+  +  +VP WLP+FPPDHTY
Sbjct: 135 QSLDLVEKWQKPLRDEELLSSNHAEFFFKDVDILNLVPPTNINNSYVPTWLPEFPPDHTY 194

Query: 198 RFTAQYNKPITDERLMKRKLAEEANLSEKALIHLSMLSHEEASSGPI-DSDTI---YEEA 253
           +FTA YNKPI+DER MKR L EE  LSEKAL  L+ML   +A    + D +TI   Y+E+
Sbjct: 195 KFTAIYNKPISDERQMKRMLFEEGKLSEKAL--LNMLGSAQAKMLKVEDEETIAQTYKES 252

Query: 254 QQETQLLFG-----PVKKKKTAAINEVN--DL-LRTLPQQNFSVEEYARNRVEIARRRVN 305
           Q+ETQL++G     P ++      N  N  DL L +   + F+++EYAR+R+ +ARR+V 
Sbjct: 253 QEETQLIYGVEKQRPRRENAYVGGNSTNNDDLPLNSSHSKGFNIQEYARSRIGLARRKVE 312

Query: 306 EYERHQLQLQKGAFIKAAHLLSPFSK-KRTSCKQVEKEIRTLLHRSRIGLLKSAPSLKER 364
           E+E H+LQ QK  FI+A+ + SP+   ++T+ K  E+E   LL RS +G+LKS P L++ 
Sbjct: 313 EFENHKLQAQKNPFIRASSICSPYGNAQKTTRKAAEREFNILLRRSYVGVLKSIPKLRQL 372

Query: 365 RKREIALAXXXXXXXXXXXXXXXXARSKSSNEFDVLDLNNLNEDPFFGGL 414
           +  E+A A                 +        V+DLN L+ED     L
Sbjct: 373 KANEMAAAIERERIKQKEREMELEKKHLQQG---VVDLNALHEDALLADL 419

>KLLA0D01617g Chr4 complement(143940..145628) [1689 bp, 562 aa] {ON}
           weakly similar to uniprot|Q03750 Saccharomyces
           cerevisiae YML114C TAF8 TFIID subunit (65 kDa) involved
           in RNA polymerase II transcription initiation
          Length = 562

 Score =  242 bits (618), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 161/419 (38%), Positives = 231/419 (55%), Gaps = 30/419 (7%)

Query: 16  QRVVQLKNLPTLHEIPKADMDDPLKKLLEKAIAIQLKSINADASISQLAFENLIILVEEM 75
           QR V+L  LP L+E+P A+   P+++L  +A+ +QLK++N +  ISQLAF++L  +    
Sbjct: 18  QRRVRLDKLPNLNEVPHAN---PMERLFAQAVLLQLKTLNKNVVISQLAFDDLCYVSLLQ 74

Query: 76  LSNMLMDLHKMANIQRRHCISKKDLLLIIEGYNLSSSDLMLELERSRYVRSRHLEQIKKV 135
           L ++L  L K+  +QRR  ISK DL L  +G  +   DL  ++E S +V  +  ++   +
Sbjct: 75  LDDLLQSLKKITQVQRRTKISKLDLNLYFKGIGMDLKDLNGQVEISNFVHGKFKDEANAL 134

Query: 136 EEDSKYVEKQEHTPLTQNELLSSTHPEFFVLDKDVLTLVPPSVKDTKHVPRWLPDFPPDH 195
            E    V++Q    L + ELLSS H EFFV D D+L L+P S K  K+VP WLP+ PPDH
Sbjct: 135 NETVLKVKQQFMKELEEKELLSSKHSEFFVQDVDILNLLPSSNKSNKYVPSWLPELPPDH 194

Query: 196 TYRFTAQYNKPITDERLMKRKLAEEANLSEKALIHLSMLSHEEASSGPI-----DSDTI- 249
           TY+FT+ Y +PITDERLMK+KL EE  LSEKAL  L+MLS +  +  P+     DSD   
Sbjct: 195 TYKFTSLYKRPITDERLMKKKLLEEGRLSEKAL--LNMLS-QVVNQDPLVALNKDSDQSA 251

Query: 250 --------YEEAQQETQLLFGPVKKKKTAAINEVNDLLRTL------PQQNFSVEEYARN 295
                    +E+Q ET L+F P K   T        +L  +      P +NF+V EY + 
Sbjct: 252 NNAALSEHIKESQLETDLIFDPHKTIPTDKEWGTTTVLHGIESFNLSPVKNFNVLEYCKK 311

Query: 296 RVEIARRRVNEYERHQLQLQKGAFIKAAHLLSPFSKKRT-SCKQVEKEIRTLLHRSRIGL 354
           R  I +RR    E      ++  FI+ A + SP+ +  T S K VE +++T+L RS +GL
Sbjct: 312 RDAIVKRRAERAENQVSNKRRNPFIRGAMICSPYGQGSTKSRKSVENQLKTMLRRSYLGL 371

Query: 355 LKSAPSLKERRKREIALAXXXXXXXXXXXXXXXXARSKSSNEFDVLDLNNLNEDPFFGG 413
           + S P +KE R+R    A                 + K   E ++LDLNNL  DP   G
Sbjct: 372 IDSIPRVKEVRERARKEAEERERLLQEQRRIE---KEKKMAEQEILDLNNLQTDPLLHG 427

>ZYRO0G14146g Chr7 (1126767..1128290) [1524 bp, 507 aa] {ON} weakly
           similar to uniprot|Q03750 Saccharomyces cerevisiae
           YML114C TAF8 TFIID subunit (65 kDa) involved in RNA
           polymerase II transcription initiation
          Length = 507

 Score =  233 bits (594), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 151/406 (37%), Positives = 222/406 (54%), Gaps = 31/406 (7%)

Query: 19  VQLKNLPTLHEIPKADMDDPLKKLLEKAIAIQLKSINADASISQLAFENLIILVEEMLSN 78
           +Q+  LPTL E+   D +  + K+L K++A+QLK +NA   I+Q AF+ L+ LV+  L++
Sbjct: 5   IQITKLPTLQELQHEDREPNVVKVLAKSVALQLKPMNA--QITQFAFDRLLQLVDGQLND 62

Query: 79  MLMDLHKMANIQRRHCISKKDLLLIIEGYNLSSSDLMLELERSRYVRSRHLEQIKKVE-- 136
           M+  LH+M+N+QRR  I+K D+ +++EG+N+S S + L+   S +   ++ ++   +   
Sbjct: 63  MISQLHRMSNLQRRETIAKGDISMLMEGFNISPSSIELQSRISEFYSQKYFKEFNHLHSL 122

Query: 137 EDSKYVEKQEHTPLTQNELLSSTHPEFFVLDKDVLT-LVPPSVKDTKHVPRWLPDFPPDH 195
            D +     E  P    E           + ++V T LVPP+      +P+WLPDFPPDH
Sbjct: 123 RDLQSSLAHEMVPFEDQE----------AVRQNVSTVLVPPTNPLQDFLPKWLPDFPPDH 172

Query: 196 TYRFTAQYNKPITDERLMKRKLAEEANLSEKALIHLSMLSHEEASSGPID-----SDTIY 250
           TY+FT QY+ PITDE  ++R++ EEA  SE AL HLS          P D     S    
Sbjct: 173 TYKFTPQYSHPITDETTIRRQIVEEAKQSELALSHLSQ------KKNPTDDIVNRSQYDS 226

Query: 251 EEAQQETQLLFGPVKKKKTAAINEVN--DLLRTLPQQNFSVEEYARNRVEIARRRVNEYE 308
           E A+QET  ++G   KK+     + N  DLL  LPQ NFSVEEYA NR+E+AR++V E+E
Sbjct: 227 ELAEQETLAIYGSQLKKRKTQHPQANSADLLSKLPQTNFSVEEYAHNRIEVARKKVLEFE 286

Query: 309 RHQLQLQKGAFIKAAHLLSPFSKKRTSCKQVEKEIRTLLHRSRIGLLKSAPSLKERRKRE 368
             QLQ Q+  F+K + +       + + KQV +E +  L RS I L+KS P L ER K E
Sbjct: 287 ERQLQSQQDPFLKLSRIAFTQCNDKFTKKQVHREFQLALQRSFIHLVKSIPEL-ERNKLE 345

Query: 369 IALAXXXXXXXXXXXXXXXXARSKSSNEFDVLDLNNL--NEDPFFG 412
                                  +   E DVLDL+ L  N++ FF 
Sbjct: 346 TEEKAKEERSKRLQELRAQREEQEKKGERDVLDLDELDQNQEDFFA 391

>TDEL0B00590 Chr2 complement(113785..115410) [1626 bp, 541 aa] {ON}
           Anc_8.838 YML114C
          Length = 541

 Score =  233 bits (593), Expect = 6e-69,   Method: Compositional matrix adjust.
 Identities = 143/362 (39%), Positives = 225/362 (62%), Gaps = 27/362 (7%)

Query: 16  QRVVQLKNLPTLHEIPKADMDDPLKKLLEKAIAIQLKSINADASISQLAFENLIILVEEM 75
           +R +QL +LPTL EI     +  + K+L KA+A+QLK + AD  IS+ AFE+L+IL+++ 
Sbjct: 7   ERHIQLTHLPTLDEIDHGKTEAAVVKILSKAVALQLKPMKAD--ISKFAFEHLMILIDDQ 64

Query: 76  LSNMLMDLHKMANIQRRHCISKKDLLLIIEGYNLSSSDLMLELERSRYVRSRHLEQIKKV 135
           L++M+  LH+ +N+QRR  I+K D+ L ++GYNL+ +DL  + + S+Y    + ++    
Sbjct: 65  LNDMIGQLHRFSNVQRRESIAKGDVHLFLQGYNLTPADLDKQHQASQYYSKTYGKEF--- 121

Query: 136 EEDSKYVEKQEHTPLTQNELLSSTHPEFFVLDKDVLT-LVPPSVKDTKHVPRWLPDFPPD 194
             DS +  K+  T    +E   S         +DV+  LV P+    +++P+W+P FPPD
Sbjct: 122 --DSLHSLKETFTDAVVDEDNGS---------EDVINELVRPNNPLIRYIPKWMPAFPPD 170

Query: 195 HTYRFTAQYNKPITDERLMKRKLAEEANLSEKALIHLSMLSHEEASSGPIDSDTI-YEEA 253
           HTY+FT QYN+PITDE +++R++ +E   SE AL+HL  L +    +   D+D   Y+EA
Sbjct: 171 HTYKFTPQYNQPITDETIIRRRIVDEGKQSEVALLHL--LKNMNPPTPSSDADGASYDEA 228

Query: 254 --QQETQLLFGPVKKKKTAAINEVNDLLRTLPQQNFSVEEYARNRVEIARRRVNEYERHQ 311
             ++ET  ++G  +KK+    +  +DLL  LPQ NFS+EEYAR+RVEIAR++V EYE  Q
Sbjct: 229 LVREETAAIYGNEQKKRKKNASSSSDLLSKLPQTNFSIEEYARSRVEIARKKVVEYEERQ 288

Query: 312 LQLQKGAFIKAAHLLSPFSKKRTSCKQVEKEIRTLLHRSRIGLLKSAPSLK-----ERRK 366
           ++LQ+  FIK + +    S  ++  +Q  +EI ++L RS   L+KS P L+      RRK
Sbjct: 289 MKLQRNPFIKYSKIALSNSSDKSGRRQATREIHSMLQRSLQHLIKSIPELQMTKQDARRK 348

Query: 367 RE 368
            E
Sbjct: 349 AE 350

>Kpol_1068.10 s1068 complement(18964..20817) [1854 bp, 617 aa] {ON}
           complement(18964..20817) [1854 nt, 618 aa]
          Length = 617

 Score =  208 bits (529), Expect = 4e-59,   Method: Compositional matrix adjust.
 Identities = 142/413 (34%), Positives = 220/413 (53%), Gaps = 30/413 (7%)

Query: 17  RVVQLKNLPTLHEIPKADMDDPLKKLLEKAIAIQLKSINADASISQLAFENLIILVEEML 76
           + +QL  LPTL E    + +  ++K+L KA+A+QLKS+N D SI++ AFE+L+ LV   +
Sbjct: 7   KYIQLTELPTLTEYKYEETEPAIEKILAKAVALQLKSMNCDTSITKFAFEHLMSLVVGQI 66

Query: 77  SNMLMDLHKMANIQRRHCISKKDLLLIIEGYNLSSSDLMLELERSRYVRSRHLEQIKKVE 136
            +M+++LH+++++QRR+ ++K D+ + + G+NL+  DL  + ++S+Y+   +     K  
Sbjct: 67  DDMVLELHRLSSLQRRNTVAKADISVWLRGFNLTPEDLEEQNQKSQYLSKLY----DKDY 122

Query: 137 EDSKYVEKQEHTPLTQNELLSSTHPEFFVLDKDVLT-----LVPPSVKDTKHVPRWLPDF 191
           E    +       L+  + L  TH       KD  T     LVP S    K +P WLPDF
Sbjct: 123 ESLTKIATTTTRTLSTYQKLDLTH-------KDTSTAQTSKLVPISNPLQKLIPSWLPDF 175

Query: 192 PPDHTYRFTAQYNKPITDERLMKRKLAEEANLSEKALIHLSMLSHEEASSGPID-SDTIY 250
           PPD+TY+FT QYN PITDE +++RK+ EE   SEKAL++L     E+  S  +  S +  
Sbjct: 176 PPDYTYKFTPQYNTPITDETIIRRKVVEEGKQSEKALLNLLRGGQEDRISRDLKFSSSEM 235

Query: 251 EEAQQETQLLFGPVKKKKTAAINEVNDLLRTLPQQN-FSVEEYARNRVEIARRRVNEYER 309
           E A +ET   +  +    T     +       P QN  +VEEYAR RVEI R++V  YE 
Sbjct: 236 ELATEETLATYSAI----TLRNKHLTSFFEKEPIQNSLNVEEYARTRVEIERKKVLGYEE 291

Query: 310 HQLQLQKGAFIKAAHLLSPFSKKRTSCKQVEKEIRTLLHRSRIGLLKSAPSLKERRKREI 369
            QLQ+Q+  F+K + L+S  +  + S      EIR  L RS +  + S P  ++ RK   
Sbjct: 292 RQLQIQRNPFLKISRLISANNDNKVSKSVANTEIRKYLKRSLLNFIHSIPKTQQERKEAR 351

Query: 370 ALAXXXXXXXXXXXXXXXXAR-----SKSSNEFDVLDLNNLNEDP---FFGGL 414
             A                 +     +K S++F++LDL+N   D    FF  L
Sbjct: 352 ERAEEEKERRLAEIKALKEEKLKEMEAKKSSDFNLLDLSNYPNDSHGGFFAAL 404

>TPHA0I00230 Chr9 (41435..43279) [1845 bp, 614 aa] {ON} Anc_8.838
           YML114C
          Length = 614

 Score =  198 bits (503), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 130/383 (33%), Positives = 206/383 (53%), Gaps = 46/383 (12%)

Query: 16  QRVVQLKNLPTLHEIPKADMDDPLKKLLEKAIAIQLKSINADASISQLAFENLIILVEEM 75
           ++ VQL  LPTL E    D   P++ +L KAIA+QLK +N D +I++ AF +L  LV+E 
Sbjct: 43  KKYVQLTKLPTLTEFKYEDTKGPMEVILAKAIALQLKLMNRDTTITKFAFTHLTSLVDEQ 102

Query: 76  LSNMLMDLHKMANIQRRHCISKKDLLLIIEGYNLSSSDLMLELERSRYVRSRHLEQIKKV 135
           LS+M+  + K+A +QRR  ++KKD+ L + G+NL  SDL +  ++S Y++ ++  ++  +
Sbjct: 103 LSDMVNQMEKLAALQRRKEVAKKDIDLWLRGFNLQPSDLTITHQQSEYIKEKYGGEVTLL 162

Query: 136 EEDSKYVEKQEHTPLTQNELLSSTHPEFFVLDK-----------DVLTLVPPSVKDTKHV 184
                            N L + T+    V  K           + L LVP +      +
Sbjct: 163 -----------------NRLATDTNEVLTVFKKTDKTLKDDSTLETLKLVPITNTLENII 205

Query: 185 PRWLPDFPPDHTYRFTAQYNKPITDERLMKRKLAEEANLSEKALIHLSMLSHEEASSGPI 244
           P WLP FPPD+TY+FT Q+NK ITD  ++++K+A E   SEKAL+HL  L  E+ ++  +
Sbjct: 206 PDWLPSFPPDYTYKFTPQFNKHITDATVIRKKVAAEGKKSEKALLHL--LESEKITTSKL 263

Query: 245 ------DSDTIYEEAQQETQLLF--GPV-KKKKTAAINEVNDLL----RTLPQQNFSVEE 291
                 DSD + + A+ E   L+  G   +KK+TA   +  D +           F +E+
Sbjct: 264 LNLDKFDSDDM-DTAKLEMDALYSGGSCDRKKRTAFFEDEEDRMVDEHGNSTSNKFDIEK 322

Query: 292 YARNRVEIARRRVNEYERHQLQLQKGAFIKAAHLLSPFSKKRTSCKQVEKEIRTLLHRSR 351
           Y   R+ I R +V +YE  QL+LQ   F+K   LLS  + K+ S + +   I  +L RS 
Sbjct: 323 YVHKRINIVRNKVKQYEDKQLRLQNDPFLKMTALLSEQTDKKVSREVINTNIENVLKRSF 382

Query: 352 IGLLKSAPSLKERRK--REIALA 372
           + L+ S P+L + +K  RE A+ 
Sbjct: 383 LQLINSIPTLNQNKKDTRERAMV 405

>NCAS0B00310 Chr2 complement(37876..39570) [1695 bp, 564 aa] {ON}
           Anc_8.838 YML114C
          Length = 564

 Score =  187 bits (475), Expect = 9e-52,   Method: Compositional matrix adjust.
 Identities = 124/360 (34%), Positives = 208/360 (57%), Gaps = 35/360 (9%)

Query: 29  EIPKADMDDPLKKLLEKAIAIQLKSINADASISQLAFENLIILVEEMLSNMLMDLHKMAN 88
           EIP    D+ ++KLL K+IA+QLK +N +  +SQLAF  L +LV + L  ++ +LH+M+ 
Sbjct: 38  EIPSNSSDEQVRKLLNKSIALQLKPLNLE--LSQLAFNELSLLVNDQLDFLISELHRMSV 95

Query: 89  IQRRHCISKKDLLLIIEGYNLSSSDLMLELERSRYVRSRHLEQIKKVEEDSKYVEKQEHT 148
           IQRR+  +K D+ L++ G NL+ S+L  +L+ S +++S++ +    + +DS  +     T
Sbjct: 96  IQRRNAAAKTDIELLLRGLNLNMSELHYQLQVSNFMKSKNGKDYDTLIKDSSTIFDSSDT 155

Query: 149 PLTQNELLSSTHPEFFVLDKDVLTLVPPSVKDTKHVPRWLPDFPPDHTYRFTAQYNKPIT 208
                 + +  H    +++     L+ P+      +P WLP FPPDHTY+FT Q+NKPIT
Sbjct: 156 ------MANPGHDS--MVNNPSNILIKPNNPFEISIPNWLPAFPPDHTYKFTPQFNKPIT 207

Query: 209 DERLMKRKLAEEANLSEKALIHL-------SMLSHEEASSGPIDSDTIYEEAQQETQLLF 261
           D+ L+K+KL EE   SEK+L++L       S + +EE S+   DS    E A++E   ++
Sbjct: 208 DQVLIKQKLIEEGKKSEKSLLNLLNDITEQSSIENEETSN--FDS----ELAREENIAIY 261

Query: 262 G----PVKKKKTAAINEVNDLLRTL---PQ--QNFSVEEYARNRVEIARRRVNEYERHQL 312
           G      KK+K   +  ++D  +     PQ  ++F+V  YA  RVE+ R+RV E+E  QL
Sbjct: 262 GYDAMSRKKRKPPHLISIHDTEQNFFNHPQGSKHFNVGNYAHFRVELTRKRVEEFELEQL 321

Query: 313 QLQKGAFIKAAHLLSPFSKKRTSCKQVEKEIRTLLHRSRIGLLKSAPSLKERRKREIALA 372
           + +K  F++ + ++   + K+ S   ++ EI+  L RS   + ++ P LK+ R R + LA
Sbjct: 322 KWEKNPFLRLSRMI---NDKKVSRSDLKLEIKNSLQRSYKSIFRNYPKLKQERDRRLELA 378

>Suva_13.29 Chr13 complement(41778..43307) [1530 bp, 509 aa] {ON}
           YML114C (REAL)
          Length = 509

 Score =  179 bits (453), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 116/379 (30%), Positives = 211/379 (55%), Gaps = 29/379 (7%)

Query: 1   MTKPAPDAQTVSPDLQRVVQLKNLPTLHEIPKADMDDPLKKLLEKAIAIQLKSINADASI 60
           MT   P++ + +   Q +VQL NLP L E+   ++D P+ ++L+K++  QL S+N    I
Sbjct: 1   MTSATPESGSGAS--QTMVQLTNLPDLTEVSHLEIDAPVLEILKKSVLFQLNSLNI--CI 56

Query: 61  SQLAFENLIILVEEMLSNMLMDLHKMANIQRRHCISKKDLLLIIEGYNLSSSDLMLELER 120
           S  A + ++ LV   +  M  +LH +A +QRR  +S+ DL L+   +NL+S+ L  +L+ 
Sbjct: 57  SNFALDEMVNLVAVQMDGMFRNLHNLALLQRRSQVSQADLKLLFREFNLNSASLFQQLQI 116

Query: 121 SRYVRSRHLEQIKKVEEDSKYVEKQEHTPLTQNELLSSTHPEFFVLDKDVLTLVPPSVKD 180
           S +++S+H  + +K+ + S +          ++E+ +    +      ++  L+PPS   
Sbjct: 117 SEHIKSKHSVEYEKLVKSSSFTAVSHIEDDEEDEINNIEEQQ-----NEINVLLPPSNPL 171

Query: 181 TKHVPRWLPDFPPDHTYRFTAQYNKPITDERLMKRKLAEEANLSEKALIHL-------SM 233
            K +P WLP+FPPDHTY+FT ++N PITD + +KR++ +E+  SE+AL++L       S 
Sbjct: 172 EKLIPSWLPNFPPDHTYKFTPEFNHPITDLKTIKREIVKESGESERALLNLNKRLFRISS 231

Query: 234 LSHEEASSGPIDSDTIYEEAQQETQLLFGPVKKKKTAAINEVNDLLRTLPQQNFSVEEYA 293
            SH  +   P  SD     A +  ++    + ++K A I       ++  ++N  +E+YA
Sbjct: 232 ASHTPSPRLPDASD-----ASERLEIWGNTLHERKPAII------AKSFNEKN--IEQYA 278

Query: 294 RNRVEIARRRVNEYERHQLQLQKGAFIKAAHLLSPFSKKRTSCKQVEKEIRTLLHRSRIG 353
           + R+E+AR RV+++E +QL+  K  F+K +  L  F     S K +++ I   L +S   
Sbjct: 279 KYRIELARERVSKFEVNQLKRTKNPFLKISESLYSFKNPHQSHKVIQRSIDLQLRKSVTL 338

Query: 354 LLKSAPSLKERRKREIALA 372
            + + P +++ +K +I LA
Sbjct: 339 FMHNLPKVQKLKKEKIQLA 357

>YML114C Chr13 complement(42043..43575) [1533 bp, 510 aa] {ON}
           TAF8TFIID subunit (65 kDa), involved in RNA polymerase
           II transcription initiation
          Length = 510

 Score =  174 bits (442), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 112/357 (31%), Positives = 199/357 (55%), Gaps = 16/357 (4%)

Query: 18  VVQLKNLPTLHEIPKADMDDPLKKLLEKAIAIQLKSINADASISQLAFENLIILVEEMLS 77
           +VQL+NLP L EI   ++D P+ ++L+K +  QL S+N    IS  A + L+ LV   + 
Sbjct: 16  IVQLRNLPDLTEISHLEIDAPVVEILKKTVLFQLNSLNI--CISNFALDELVNLVTVQMD 73

Query: 78  NMLMDLHKMANIQRRHCISKKDLLLIIEGYNLSSSDLMLELERSRYVRSRHLEQIKKVEE 137
            M  +LH +  +QRR   S+ DL L++  +NL +  L  + + S +++S+H  + +K+  
Sbjct: 74  GMFRNLHNLTLLQRRSQASQADLKLLLREFNLDAPSLYQQFQASEFIKSKHSTEYEKLMS 133

Query: 138 DSKYVEKQEHTPLTQNELLSSTHPEFFVLDKDVLTLVPPSVKDTKHVPRWLPDFPPDHTY 197
            S  +    H    + + L++   +      ++  L+PPS    K +P WLP+FPPDHTY
Sbjct: 134 WSS-LAALPHNEEDEEDELNNIEEQ----QNEINVLLPPSNPLEKQIPSWLPNFPPDHTY 188

Query: 198 RFTAQYNKPITDERLMKRKLAEEANLSEKALIHLS-MLSHEEASSGPIDSDTIYEEAQQE 256
           +FT ++N PITD + +K+++ +E+  SEKAL++L+  LSH  ++S       + +E   E
Sbjct: 189 KFTPEFNHPITDLKTIKKEIVKESQESEKALLNLNKSLSHISSASNTPQPPGLDDEDAIE 248

Query: 257 TQL-LFGPVKKKKTAAINEVNDLLRTLPQQNFSVEEYARNRVEIARRRVNEYERHQLQLQ 315
            QL ++G   +++   I E     ++  + N  +E+YA+ RVE+AR RV ++E +QL+  
Sbjct: 249 QQLEIWGNALEERKPTITE-----KSFNENN--IEQYAKYRVELARERVTKFEVNQLKRT 301

Query: 316 KGAFIKAAHLLSPFSKKRTSCKQVEKEIRTLLHRSRIGLLKSAPSLKERRKREIALA 372
           K  F+K +  L        S K ++K I     +S    + + P +++ +K +I +A
Sbjct: 302 KNPFLKISETLYLPESPHQSHKTIQKTIELQFRKSMTLFMHNLPKVQKLKKEKIRMA 358

>Skud_13.27 Chr13 complement(41670..43214) [1545 bp, 514 aa] {ON}
           YML114C (REAL)
          Length = 514

 Score =  170 bits (431), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 111/362 (30%), Positives = 197/362 (54%), Gaps = 26/362 (7%)

Query: 18  VVQLKNLPTLHEIPKADMDDPLKKLLEKAIAIQLKSINADASISQLAFENLIILVEEMLS 77
           +VQLKNLP L EI    +D P+ ++L K +  QL S+  D  IS  A + L+ LV   + 
Sbjct: 16  LVQLKNLPDLTEISHLKIDAPVVEILRKTVLFQLNSL--DICISNFALDELVNLVAVQMD 73

Query: 78  NMLMDLHKMANIQRRHCISKKDLLLIIEGYNLSSSDLMLELERSRYVRSRHLEQIKKVEE 137
            M  +LH +A +QRR   ++ DL L+ + +NL  + L  +L+ S +++S H  + +K+  
Sbjct: 74  GMFRNLHNLALLQRRSRATQADLKLLFKEFNLDPASLYQQLQISEFIKSNHSVEYEKLVS 133

Query: 138 DSKYVEKQEHTPLTQNELLSSTHPEFFVLDKDVLTLVPPSVKDTKHVPRWLPDFPPDHTY 197
            S       H    + + L++   +      ++  L+PPS    K +P WLP+FPPDHTY
Sbjct: 134 SSS-FSASSHNEEDEEDELNNIEEQ----QNEISVLLPPSNPLEKLMPSWLPNFPPDHTY 188

Query: 198 RFTAQYNKPITDERLMKRKLAEEANLSEKA-------LIHLSMLSHEEASSGPIDSDTIY 250
           RFT ++N PITD + +KR++ +E+  SEKA       L+H+S+ SH      P D+D   
Sbjct: 189 RFTPEFNHPITDLKTIKREIVKESKESEKALLNLNKRLLHISLASHAPPPRLPDDADA-- 246

Query: 251 EEAQQETQLLFGPVKKKKTAAINEVNDLLRTLPQQNFSVEEYARNRVEIARRRVNEYERH 310
              +Q+ ++    ++++K  AI+      ++  + N  +E+YA+ RVE+AR RV+++E +
Sbjct: 247 --GEQQLEIWGNALQEEKRTAIS------KSFNENN--IEQYAKYRVELARERVSKFEVN 296

Query: 311 QLQLQKGAFIKAAHLLSPFSKKRTSCKQVEKEIRTLLHRSRIGLLKSAPSLKERRKREIA 370
           QL+  K  F++ +  L          + +++ I     +S +    + P +++ +K +I 
Sbjct: 297 QLKRTKNPFLRISETLYSSKSPHQPHRAIQRAIDLQFRKSMMLFAHNLPKVQKLKKEKIR 356

Query: 371 LA 372
           +A
Sbjct: 357 MA 358

>Smik_13.20 Chr13 complement(38299..39831) [1533 bp, 510 aa] {ON}
           YML114C (REAL)
          Length = 510

 Score =  162 bits (410), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 111/360 (30%), Positives = 193/360 (53%), Gaps = 22/360 (6%)

Query: 18  VVQLKNLPTLHEIPKADMDDPLKKLLEKAIAIQLKSINADASISQLAFENLIILVEEMLS 77
           +VQL+ LP L EI   ++D P+ ++L+K +  QL S+N    IS  A + L+ LV   + 
Sbjct: 16  IVQLRRLPDLTEISHLEIDAPVVEILKKTVLFQLNSLNI--CISNFALDELVNLVAVQMD 73

Query: 78  NMLMDLHKMANIQRRHCISKKDLLLIIEGYNLSSSDLMLELERSRYVRSRHLEQIKKVEE 137
            M  +LH +  +QRR   S+ DL L+   +N+ ++ L  + + S +++S H  +  K+  
Sbjct: 74  GMFRNLHNLTLLQRRSEASQADLKLLFREFNVDAASLYQQFQVSEFIKSNHAVEYGKLVR 133

Query: 138 DSKYVEKQEHTPLTQNELLSSTHPEFFVLDKDVLTLVPPSVKDTKHVPRWLPDFPPDHTY 197
            S +     H    + + LS+   +      ++  L+PPS    K +P WLP+FPPDHTY
Sbjct: 134 LSSF-PALAHNEEDEEDELSNIEEQ----QSEINVLLPPSNPLEKLIPSWLPNFPPDHTY 188

Query: 198 RFTAQYNKPITDERLMKRKLAEEANLSEKALIHLS-MLSHEEASSG----PIDSDTIYEE 252
           +FT ++N PITD + +K+++ +E+  SEKAL++L+  LSH  ++S     P+  D    E
Sbjct: 189 KFTPEFNHPITDLKTIKKEIVKESEESEKALLNLNKRLSHLSSASHTSPPPVLDDADATE 248

Query: 253 AQQETQLLFGPVKKKKTAAINEVNDLLRTLPQQNFSVEEYARNRVEIARRRVNEYERHQL 312
            Q E   ++G   +++   I        +L + N  +E+YA+ RVE+AR RV ++E +QL
Sbjct: 249 QQLE---IWGNALQERKPTITAT-----SLNESN--IEQYAKYRVELARERVAKFELNQL 298

Query: 313 QLQKGAFIKAAHLLSPFSKKRTSCKQVEKEIRTLLHRSRIGLLKSAPSLKERRKREIALA 372
           +  K  F+K +  L        S K ++  I     +S    + + P +++ +K  I +A
Sbjct: 299 KRTKNPFLKLSETLYFSEGPHQSHKTIQSAIDLQFRKSMTLFMHNLPKVQKLKKERIRMA 358

>NDAI0E00300 Chr5 complement(41787..43781) [1995 bp, 664 aa] {ON}
           Anc_8.838 YML114C
          Length = 664

 Score =  157 bits (398), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 128/446 (28%), Positives = 215/446 (48%), Gaps = 115/446 (25%)

Query: 29  EIPKADMDDPLKKLLEKAIAIQLKSINADASISQLAFENLIILVEEMLSNMLMDLHKMAN 88
           EI    MD  ++KLL+K+IAIQLK+   D   S+LAF  L +LV++ L++++ +LH+++ 
Sbjct: 20  EIAHNHMDMQIEKLLQKSIAIQLKAFKVD--FSKLAFNQLTLLVDDQLNSLITELHRLSL 77

Query: 89  IQRRHCISKKDLLLIIEGYNLSSSDLMLELERSRYVRSRHLEQIKKVEED--SKYVEKQE 146
           +QRR+ ++K DL L + G+N++ SDL  + E S+Y++ +   +  ++  D   + V+++ 
Sbjct: 78  LQRRNSMAKVDLELWMRGFNINPSDLNYQYESSKYIQEKLSGKEYRILRDLNEEVVKQRT 137

Query: 147 HTPLTQNELLSSTHPEFFVLDKDV-----------LTLVPPSVKDTKHVPRWLPDFPPDH 195
           H       + SST  + + L K             + + P +     ++  WLP FPPDH
Sbjct: 138 HI------MESSTSDDNYDLTKQFRNISDATDSSNILIKPTNPFKGINISSWLPSFPPDH 191

Query: 196 TYRFTAQYNKPITDERLMKRKLAEEANLSEKALIH-LSMLSHEE---------------- 238
           TY+FT Q+N PITDE+L+K+KL EE   SEKAL++ L  +S+ +                
Sbjct: 192 TYKFTPQFNNPITDEKLIKQKLVEEGTKSEKALLNFLKNISNAKKGTSIAPMTIPPSPSL 251

Query: 239 ASSGPIDSDTIYEE-------------------------AQQETQLLFG----------- 262
           ++ GPI +DT  EE                         A +ET  ++G           
Sbjct: 252 SNEGPI-TDTDEEEKQAKNEKEKEQEDTVIIPKDIDMNLANEETLAIYGTKSQSYEIERD 310

Query: 263 PVKKKKTAAINE---VNDLLRTLPQQNFSVEEYARNRVEIARRRVNEYERHQLQLQKGAF 319
              K    +I++   VN    +   + F V +Y+ +RVE+ R++V  +E  +L+L+K  F
Sbjct: 311 SSSKPNIISIHDEKIVNFFGHSSSDKKFDVNKYSHHRVELVRKKVEAFENKKLRLEKNPF 370

Query: 320 IKAAHL---------------------------------LSPFSKKRTSCKQVEKEIRTL 346
           +K + L                                 LSP  K+     Q+  EI + 
Sbjct: 371 LKLSKLVCLEKEDYYDYDNDEDDLEERKNYNNNNDNDNRLSPIRKR----AQINNEIISN 426

Query: 347 LHRSRIGLLKSAPSLKERRKREIALA 372
           L RS   +L + P LK+ +K+ + LA
Sbjct: 427 LKRSFYSILNNYPKLKKAKKQRVKLA 452

>TBLA0D03250 Chr4 (807946..809997) [2052 bp, 683 aa] {ON} Anc_8.838
           YML114C
          Length = 683

 Score =  152 bits (385), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 146/518 (28%), Positives = 225/518 (43%), Gaps = 99/518 (19%)

Query: 21  LKNLPTLHEIPKADMDDPLKKLLEKAIAIQLKSINADASISQLAFENLIILVEEMLSNML 80
           LKNLP L + P       + +LL K+IA+QLK +N + SIS +AF  L+ LV+  L++M+
Sbjct: 42  LKNLPDLIQSPNRLESSCIGQLLAKSIALQLKPMNDNTSISTVAFNRLLTLVDLQLNDMI 101

Query: 81  MDLHKMANIQRRHCISKKDLLLIIEGYNLSSSDLMLELERSRYVRSRHLEQIKKVEEDSK 140
             L +++  QRR  I+  DL L +  +NL+ SDL L LE S +++S+  +    +     
Sbjct: 102 YQLARLSITQRRLTIASNDLSLWLRSFNLNPSDLTLYLEESNFIKSKFNKDYNLL----- 156

Query: 141 YVEKQEHTPLTQNELLSSTHPEFFVLDKDVLT-----LVPPSVKDTKHVPRWLPDFPPDH 195
           Y   +++   T +   +  +    +L+          +VPPS    + +P WLP  PPDH
Sbjct: 157 YELLRDYNTETNHNFKNPNYSTSDLLNNKSSESSSSRIVPPSNTILRSMPEWLPSLPPDH 216

Query: 196 TYRFTAQYNKPITDERLMKRKLAEEANLSEKALIHLSMLS-HEEASSGP----------- 243
           TY+FT  YN+PITDE +MK+ L  E  L+E ALI L   S   E +S P           
Sbjct: 217 TYKFTPLYNEPITDETVMKKILVNEGKLAESALIKLLEASTTSEINSLPTPETDRENDLE 276

Query: 244 ----IDSDT---------IYEE--------------AQQETQLLFGP------VKKKKTA 270
               ID++T         + E               AQ ET+ ++G       +KK+   
Sbjct: 277 QNINIDTNTNGNSMTLKSVSENEKTNTNERLNDELLAQDETKAIYGSALQVRKIKKRFEL 336

Query: 271 AIN---EVNDLLRTLPQQNFSVEEYARNRVEIARRRVNEYERHQLQLQKGAFIKAAHLL- 326
            I+   E       +    F+VEEYAR +V+  R +V  YE  QLQ QK  F K + ++ 
Sbjct: 337 MIDPKAETQLSEEFVYPSTFNVEEYARKQVQKIREQVLFYEEKQLQAQKNPFWKYSKMIV 396

Query: 327 --SPFSKKR---------------------------------TSCKQVEKEIRTLLHRSR 351
             S F                                      S KQ+  +I+ + +RS 
Sbjct: 397 GPSQFHHGPHHHHHHHHHHHRRYSNSSTSSVSSSPSPGLFGGVSKKQINHDIQQMFNRSL 456

Query: 352 IGLLKSAPSLKERR--KREIALAXXXXXXXXXXXXXXXXARSKSSNEFDVLDLNNLNE-- 407
             L+ S P+L + +   REIA                     K S+    LDL++L +  
Sbjct: 457 NNLINSLPNLAKEKASAREIAENEREKKVQEMLKKKQKELNEKQSSA-GALDLHDLQKEN 515

Query: 408 DPFFGGLGXXXXXXXXXXXXKATDGVSESEKQQITQDE 445
           D  F  LG              +D   E+   +++Q+E
Sbjct: 516 DGLFADLGSSDDDESSTRHQNTSDKTQETHSPKLSQNE 553

>KAFR0A02820 Chr1 (584984..586345) [1362 bp, 453 aa] {ON} Anc_8.838
           YML114C
          Length = 453

 Score =  144 bits (363), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 108/348 (31%), Positives = 188/348 (54%), Gaps = 56/348 (16%)

Query: 39  LKKLLEKAIAIQLKSINADASISQLAFENLIILVEEMLSNMLMDLHKMANIQRRHC-ISK 97
           L  LL K++A++LK +N    +   AF+ LI L++  L++++  L +++ +QRR+   +K
Sbjct: 26  LDNLLVKSVAMRLKPVNLHTQLPNSAFDYLIYLMDVQLNDLIKQLGRLSLLQRRNSNATK 85

Query: 98  KDLLLIIEGYNLSSSDLMLELERSRYVRSRHLEQIKKVEEDSKYVEKQEHTPL------T 151
            D+LL+++G+NLS S+L  ELE S +++  + E  KK+ EDS  +   +HT        +
Sbjct: 86  SDILLLLKGFNLSESELNTELEISNHIKRLYSEDEKKLSEDS--IHYNQHTDFVGPVETS 143

Query: 152 QNELLSSTHPEFFVLDKDVLTLVPPSVKDTKHVPRWLPDFPPDHTYRFTAQYNKPITDER 211
             +LL+ T+P                +KD   +P W P  PPDHTY+FT +YN  I D +
Sbjct: 144 SFQLLNPTNP----------------LKDA--IPSWFPSLPPDHTYKFTPKYNNFINDPK 185

Query: 212 LMKRKLAEEANLSEKALIHL--SMLSHEEASSGPIDSDTIYEE--AQQETQLLFGPVKKK 267
           ++K+K  +E+   + AL +L   + S+EE       +D  Y+E  A+ E+Q LFG V++K
Sbjct: 186 IIKQKRFDESKTVKTALFNLINKIESNEER------NDLHYDETLAKLESQALFGTVEEK 239

Query: 268 KTA---AINEVNDLLRTLPQQNFSVEEYARNRVEIARRRVNEYERHQLQLQKGAFIKAAH 324
                     +N ++  +P   F +EEY+  RV IAR +V+++E   L L+   FI   +
Sbjct: 240 MNTNKKVYKSLNSII--VPITKFDIEEYSHKRVNIARNKVSKFENKMLALKYNPFI---N 294

Query: 325 LLSPFSKKRTSCKQVEKEIRTLLHRSRIGLLKSAPSLKERRKREIALA 372
           L++            + ++++ L+RS   ++ S P L   +K+ I  A
Sbjct: 295 LIND-----------QTDVKSYLNRSFQLMINSIPELTLEKKKAIRQA 331

>CAGL0B02299g Chr2 (217341..219272) [1932 bp, 643 aa] {ON} some
           similarities with uniprot|Q03750 Saccharomyces
           cerevisiae YML114c TAF65 TBP Associated Factor
          Length = 643

 Score =  114 bits (284), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 62/215 (28%), Positives = 120/215 (55%), Gaps = 18/215 (8%)

Query: 35  MDDPLKKLLEKAIAIQLKSINADASISQLAFENLIILVEEMLSNMLMDLHKMANIQRRHC 94
           MD  + +LL++A+ +QL++I+ D +++++A + L++  E+ L+ ++  LH+++ +QRR  
Sbjct: 30  MDYQMGELLKRAVGVQLQTIDKDVTVTRMAMDQLVLFAEDQLNALVDGLHRISLLQRRQS 89

Query: 95  ISKKDLLLIIEGYNLSSSDLMLELERSRYVRSRHLEQIKKVEEDSKY------------V 142
           I+  DL + + GYNL  SDL +  E S+++R  +      V +D               +
Sbjct: 90  IAVSDLEIWMRGYNLLPSDLYMTAEESKFIRENYRNDTSVVFKDINIDNPMESALGRINI 149

Query: 143 EKQEHTPLTQNELLSSTHPEFFVLD------KDVLTLVPPSVKDTKHVPRWLPDFPPDHT 196
           + +E+   T N++      ++ +++      + +        ++ ++ P WLPDFPPDHT
Sbjct: 150 QNKENIEPTDNDVDIDEDDDYELIELQQHAMEQLFKTDTGRGRNLRYKPGWLPDFPPDHT 209

Query: 197 YRFTAQYNKPITDERLMKRKLAEEANLSEKALIHL 231
           Y++T  Y   +  E  +++KL EE  LSEKAL+ L
Sbjct: 210 YKYTPSYVNVVKPETEIRQKLVEEGRLSEKALVKL 244

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 48/82 (58%), Gaps = 4/82 (4%)

Query: 285 QNFSVEEYARNRVEIARRRVNEYERHQLQLQKGAFIKAAHLLSPFSKKRTSCKQVEKEIR 344
           ++F VE YAR R+EIARR+V ++E  QL L+    ++ A +    +++     + +K I+
Sbjct: 396 KDFDVEAYARQRIEIARRKVVDFEYEQLYLKYNPLLRLAKMKYYDAEESDFETEYQKCIK 455

Query: 345 TLLHRSRIGLLKSAPSLKERRK 366
             + R +    ++ P +KE+RK
Sbjct: 456 RTMDRFK----RNIPIIKEKRK 473

>KNAG0G03410 Chr7 (731420..733000) [1581 bp, 526 aa] {ON} Anc_8.838
           YML114C
          Length = 526

 Score = 85.1 bits (209), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 70/275 (25%), Positives = 138/275 (50%), Gaps = 39/275 (14%)

Query: 77  SNMLMDLHKMANIQRRHCISKKDLLLIIEGYNLSSSDLMLELERSRYVRSRHL----EQI 132
           S M+ +LH++A +QRR   +  D+ L+++G+ L+  D+  ++  S+ +    +    EQ 
Sbjct: 79  SGMVTELHRIATVQRRQHATHDDVALLLQGFQLTPEDIEEQMYLSKKIGYNRMQVPREQT 138

Query: 133 KKVEEDSKYVEKQEHTPLTQNELLSSTHPEFFVLDKDVLTLVPPSVKDTKHVPRWLPDFP 192
            ++++ +   ++ +   L +N+ L ++     +   D+   +P + K    +P WLP  P
Sbjct: 139 VQLQDATGSYDRFK---LVENQQLIASG----LSGSDMSQELPIAEK----IPAWLPKLP 187

Query: 193 PDHTYRFTAQYNKPITDERLMKRKLAEEANLSEKALIHLSMLSHEEASSGPIDSDTIYEE 252
           P+HTY+FT +YNK + DE+++K K+ +E+   E +L +L         +   D+DT  +E
Sbjct: 188 PNHTYKFTTEYNKLLNDEKVLKEKIIKESMEIEVSLSNL-------VRNCDRDADTKVDE 240

Query: 253 AQQETQ------------LLFGPVKKKKTAAINEVNDLLRTLP---QQNFSVEEYARNRV 297
             +ET              L+GP+  ++ A  +E     R  P   +++F V+ Y+  RV
Sbjct: 241 RARETPPEELKRIDDEIVALYGPL--EEIAERHEGPRTKRRTPLYLKKSFDVQAYSLGRV 298

Query: 298 EIARRRVNEYERHQLQLQKGAFIKAAHLLSPFSKK 332
           ++AR  V  +E       +  F+ +   +   SKK
Sbjct: 299 KLARNAVQRFEWETKYRPRNPFLCSHRAVPENSKK 333

>NCAS0J01720 Chr10 complement(315996..317216) [1221 bp, 406 aa] {ON}
           Anc_4.290 YLR418C
          Length = 406

 Score = 34.3 bits (77), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 40/86 (46%), Gaps = 13/86 (15%)

Query: 129 LEQIKKVEEDSKYVEKQEHTPLTQNELLSS-------THPEFFVLDKDVLTLVPPSVKDT 181
           +  IKK  +DS+YV  Q+ +   QN+L++        T P  F++  +      P   D 
Sbjct: 264 INNIKKFLQDSEYVHPQQISISQQNDLVTVEKKFDRLTKPVRFIVVNNTRMFTKPEYWD- 322

Query: 182 KHVPRWLPDFPPDHTYRF-TAQYNKP 206
               R +  F   HT++F T Q+N P
Sbjct: 323 ----RVVAVFTTGHTWQFNTYQWNTP 344

>KAFR0A05770 Chr1 complement(1168705..1169844) [1140 bp, 379 aa]
           {ON} Anc_4.290 YLR418C
          Length = 379

 Score = 32.0 bits (71), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 38/151 (25%), Positives = 68/151 (45%), Gaps = 37/151 (24%)

Query: 71  LVEEMLSNML-----MDLH--KMANIQRRHCISKKDLLLIIEGYNLSSSDLMLELERSRY 123
           LV+ M S+M       D H  K ANI ++  +S+KD +++I     ++S ++        
Sbjct: 189 LVQSMKSSMRSKTRKTDGHVSKTANISKQ--VSRKDPIILIPS---AASSILT------- 236

Query: 124 VRSRHLEQIKKVEEDSKYVEKQEHTPLTQNELLS-------STHPEFFVLDKDVLTLVPP 176
                +  IKK  E+S+YV   + +   QN+L++        T P  F++  +      P
Sbjct: 237 -----ISNIKKFLEESQYVTSSDFSSSLQNDLVTIEKKFDRITRPIRFIVVNNTRMFTKP 291

Query: 177 SVKDTKHVPRWLPDFPPDHTYRFTA-QYNKP 206
              D     R +  F   H+++F + Q+N P
Sbjct: 292 EYWD-----RVVAIFTTGHSWQFNSYQWNTP 317

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.310    0.128    0.348 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 56,457,825
Number of extensions: 2457518
Number of successful extensions: 11621
Number of sequences better than 10.0: 249
Number of HSP's gapped: 12168
Number of HSP's successfully gapped: 347
Length of query: 551
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 436
Effective length of database: 40,294,809
Effective search space: 17568536724
Effective search space used: 17568536724
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 68 (30.8 bits)