Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_27.102638.839ON74372235640.0
KLTH0C03894g8.839ON74562028680.0
SAKL0D01496g8.839ON68862124870.0
Ecym_46108.839ON75163423040.0
ABL127W8.839ON72860422980.0
KLLA0D01595g8.839ON71962920840.0
TDEL0B005808.839ON71362720610.0
ZYRO0G14168g8.839ON76463620430.0
NCAS0C004208.839ON72563520040.0
KAFR0B039108.839ON72462619870.0
CAGL0M02959g8.839ON75859919650.0
Kpol_1068.98.839ON74560319300.0
TPHA0I002408.839ON73261419080.0
TBLA0D032608.839ON76866719020.0
YMR277W (FCP1)8.839ON73264718540.0
Skud_13.4498.839ON73464818530.0
Suva_13.4658.839ON73262218520.0
Smik_13.4908.839ON73264618510.0
NDAI0K004208.839ON77857818430.0
KNAG0J002808.839ON74262918260.0
TPHA0E030705.202ON494147960.007
Kpol_1010.615.94ON93289950.011
NDAI0D018605.202ON514123940.012
NCAS0A068005.202ON473117910.030
SAKL0G12870g5.202ON39960890.045
SAKL0G15620g5.94ON879168890.052
Kpol_2002.1005.202ON477120880.056
Skud_8.492.530ON447130880.065
NDAI0C032305.94ON1034109880.066
TBLA0C060905.202ON484124830.25
KAFR0E021405.94ON95176820.34
YLR019W (PSR2)5.202ON39745810.36
Smik_8.532.530ON446103810.36
ZYRO0B10428g5.202ON48240810.36
Kpol_478.165.202ON350125800.46
YHR004C (NEM1)2.530ON446103800.53
Suva_16.2498.527ON480163800.54
Smik_12.825.202ON39245790.66
TPHA0N006705.202ON452115790.73
YLL010C (PSR1)5.202ON42740790.74
Suva_10.655.202ON41540780.78
Smik_16.1728.527ON477100790.79
YPL063W (TIM50)8.527ON476162780.83
Smik_12.535.202ON41440780.83
Skud_12.575.202ON41540780.84
Skud_12.875.202ON39245780.97
Ecym_47027.373ON402154780.99
NDAI0I021705.202ON39145771.2
AAL158W5.202ON478117771.2
NCAS0D027405.202ON398112771.3
Suva_10.995.202ON38545761.3
TPHA0H010705.94ON101568771.6
Suva_8.582.530ON452103761.7
CAGL0D05610g5.202ON44792761.8
KLLA0E23101g8.527ON480100751.9
KNAG0C058502.530ON443125742.4
KAFR0A065604.156ON55566733.4
Suva_8.4007.46ON985109743.4
Skud_16.2188.527ON480162733.6
KLLA0F21164g3.111aON42092724.3
ZYRO0B15026g5.94ON116276734.4
Kwal_33.151405.202ON41060724.5
TBLA0A089504.90ON819177724.9
CAGL0L06644g5.94ON82874725.5
TBLA0A005408.527ON48580715.7
NCAS0C022108.527ON491100707.5
ZYRO0G20988g1.306ON88695708.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_27.10263
         (743 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_27.10263 s27 complement(268744..270975) [2232 bp, 743 aa] {...  1377   0.0  
KLTH0C03894g Chr3 complement(339897..342134) [2238 bp, 745 aa] {...  1109   0.0  
SAKL0D01496g Chr4 complement(120202..122268) [2067 bp, 688 aa] {...   962   0.0  
Ecym_4610 Chr4 (1188871..1191126) [2256 bp, 751 aa] {ON} similar...   892   0.0  
ABL127W Chr2 (156798..158984) [2187 bp, 728 aa] {ON} Syntenic ho...   889   0.0  
KLLA0D01595g Chr4 complement(141459..143618) [2160 bp, 719 aa] {...   807   0.0  
TDEL0B00580 Chr2 complement(111408..113549) [2142 bp, 713 aa] {O...   798   0.0  
ZYRO0G14168g Chr7 (1128601..1130895) [2295 bp, 764 aa] {ON} simi...   791   0.0  
NCAS0C00420 Chr3 complement(65252..67429) [2178 bp, 725 aa] {ON}...   776   0.0  
KAFR0B03910 Chr2 (811940..814114) [2175 bp, 724 aa] {ON} Anc_8.8...   769   0.0  
CAGL0M02959g Chr13 (332990..335266) [2277 bp, 758 aa] {ON} simil...   761   0.0  
Kpol_1068.9 s1068 complement(15966..18203) [2238 bp, 745 aa] {ON...   748   0.0  
TPHA0I00240 Chr9 (43854..46052) [2199 bp, 732 aa] {ON} Anc_8.839...   739   0.0  
TBLA0D03260 Chr4 (810350..812656) [2307 bp, 768 aa] {ON} Anc_8.8...   737   0.0  
YMR277W Chr13 (820256..822454) [2199 bp, 732 aa] {ON}  FCP1Carbo...   718   0.0  
Skud_13.449 Chr13 (793592..795796) [2205 bp, 734 aa] {ON} YMR277...   718   0.0  
Suva_13.465 Chr13 (802947..805145) [2199 bp, 732 aa] {ON} YMR277...   717   0.0  
Smik_13.490 Chr13 (803288..805486) [2199 bp, 732 aa] {ON} YMR277...   717   0.0  
NDAI0K00420 Chr11 complement(94101..96437) [2337 bp, 778 aa] {ON...   714   0.0  
KNAG0J00280 Chr10 complement(41831..44059) [2229 bp, 742 aa] {ON...   707   0.0  
TPHA0E03070 Chr5 (644651..646135) [1485 bp, 494 aa] {ON} Anc_5.2...    42   0.007
Kpol_1010.61 s1010 (148944..151325,151327..151743) [2799 bp, 932...    41   0.011
NDAI0D01860 Chr4 (437370..438914) [1545 bp, 514 aa] {ON} Anc_5.202     41   0.012
NCAS0A06800 Chr1 (1346677..1348098) [1422 bp, 473 aa] {ON} Anc_5...    40   0.030
SAKL0G12870g Chr7 (1100535..1101734) [1200 bp, 399 aa] {ON} simi...    39   0.045
SAKL0G15620g Chr7 (1342049..1344688) [2640 bp, 879 aa] {ON} some...    39   0.052
Kpol_2002.100 s2002 complement(238947..240380) [1434 bp, 477 aa]...    39   0.056
Skud_8.49 Chr8 complement(93604..94947) [1344 bp, 447 aa] {ON} Y...    39   0.065
NDAI0C03230 Chr3 (734531..737635) [3105 bp, 1034 aa] {ON} Anc_5....    39   0.066
TBLA0C06090 Chr3 complement(1478726..1480180) [1455 bp, 484 aa] ...    37   0.25 
KAFR0E02140 Chr5 (426065..428920) [2856 bp, 951 aa] {ON} Anc_5.9...    36   0.34 
YLR019W Chr12 (180288..181481) [1194 bp, 397 aa] {ON}  PSR2Funct...    36   0.36 
Smik_8.53 Chr8 complement(90635..91975) [1341 bp, 446 aa] {ON} Y...    36   0.36 
ZYRO0B10428g Chr2 (823155..824603) [1449 bp, 482 aa] {ON} simila...    36   0.36 
Kpol_478.16 s478 complement(58800..59852) [1053 bp, 350 aa] {ON}...    35   0.46 
YHR004C Chr8 complement(111754..113094) [1341 bp, 446 aa] {ON}  ...    35   0.53 
Suva_16.249 Chr16 (440525..441967) [1443 bp, 480 aa] {ON} YPL063...    35   0.54 
Smik_12.82 Chr12 (167115..168293) [1179 bp, 392 aa] {ON} YLR019W...    35   0.66 
TPHA0N00670 Chr14 complement(147329..148687) [1359 bp, 452 aa] {...    35   0.73 
YLL010C Chr12 complement(129330..130613) [1284 bp, 427 aa] {ON} ...    35   0.74 
Suva_10.65 Chr10 complement(134276..135523) [1248 bp, 415 aa] {O...    35   0.78 
Smik_16.172 Chr16 (313129..314562) [1434 bp, 477 aa] {ON} YPL063...    35   0.79 
YPL063W Chr16 (429939..431369) [1431 bp, 476 aa] {ON}  TIM50Esse...    35   0.83 
Smik_12.53 Chr12 complement(116428..117672) [1245 bp, 414 aa] {O...    35   0.83 
Skud_12.57 Chr12 complement(120706..121953) [1248 bp, 415 aa] {O...    35   0.84 
Skud_12.87 Chr12 (172096..173274) [1179 bp, 392 aa] {ON} YLR019W...    35   0.97 
Ecym_4702 Chr4 complement(1372595..1373803) [1209 bp, 402 aa] {O...    35   0.99 
NDAI0I02170 Chr9 (498399..499574) [1176 bp, 391 aa] {ON} Anc_5.202     34   1.2  
AAL158W Chr1 (67892..69328) [1437 bp, 478 aa] {ON} Syntenic homo...    34   1.2  
NCAS0D02740 Chr4 complement(525116..526312) [1197 bp, 398 aa] {O...    34   1.3  
Suva_10.99 Chr10 (186341..187498) [1158 bp, 385 aa] {ON} YLR019W...    34   1.3  
TPHA0H01070 Chr8 (229632..232679) [3048 bp, 1015 aa] {ON} Anc_5....    34   1.6  
Suva_8.58 Chr8 complement(108197..109555) [1359 bp, 452 aa] {ON}...    34   1.7  
CAGL0D05610g Chr4 complement(534849..536192) [1344 bp, 447 aa] {...    34   1.8  
KLLA0E23101g Chr5 complement(2059506..2060948) [1443 bp, 480 aa]...    33   1.9  
KNAG0C05850 Chr3 (1138155..1139486) [1332 bp, 443 aa] {ON} Anc_2...    33   2.4  
KAFR0A06560 Chr1 complement(1329583..1331250) [1668 bp, 555 aa] ...    33   3.4  
Suva_8.400 Chr8 (717697..720654) [2958 bp, 985 aa] {ON} YOR346W ...    33   3.4  
Skud_16.218 Chr16 (401347..402789) [1443 bp, 480 aa] {ON} YPL063...    33   3.6  
KLLA0F21164g Chr6 complement(1973018..1974280) [1263 bp, 420 aa]...    32   4.3  
ZYRO0B15026g Chr2 complement(1222480..1225968) [3489 bp, 1162 aa...    33   4.4  
Kwal_33.15140 s33 complement(975769..977001) [1233 bp, 410 aa] {...    32   4.5  
TBLA0A08950 Chr1 complement(2200024..2202483) [2460 bp, 819 aa] ...    32   4.9  
CAGL0L06644g Chr12 (750307..752793) [2487 bp, 828 aa] {ON} some ...    32   5.5  
TBLA0A00540 Chr1 complement(104887..106344) [1458 bp, 485 aa] {O...    32   5.7  
NCAS0C02210 Chr3 (411245..412720) [1476 bp, 491 aa] {ON} Anc_8.527     32   7.5  
ZYRO0G20988g Chr7 complement(1723533..1726193) [2661 bp, 886 aa]...    32   8.4  

>Kwal_27.10263 s27 complement(268744..270975) [2232 bp, 743 aa] {ON}
           YMR277W (FCP1) - TFIIF interacting component of CTD
           phosphatase [contig 37] FULL
          Length = 743

 Score = 1377 bits (3564), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 674/722 (93%), Positives = 674/722 (93%)

Query: 1   MTTPIRLPPNLPFPITIAKLYVSKGESVTKGQRLFVYKYWELQDVITAPNEEASKKKRRV 60
           MTTPIRLPPNLPFPITIAKLYVSKGESVTKGQRLFVYKYWELQDVITAPNEEASKKKRRV
Sbjct: 1   MTTPIRLPPNLPFPITIAKLYVSKGESVTKGQRLFVYKYWELQDVITAPNEEASKKKRRV 60

Query: 61  DLIGTFDSPIEGTLVSLKVRVGDEFVNDSNIIAELRQPCSHEVTYGALCVVCGKAVDEDD 120
           DLIGTFDSPIEGTLVSLKVRVGDEFVNDSNIIAELRQPCSHEVTYGALCVVCGKAVDEDD
Sbjct: 61  DLIGTFDSPIEGTLVSLKVRVGDEFVNDSNIIAELRQPCSHEVTYGALCVVCGKAVDEDD 120

Query: 121 SNMSGSGVSNGKLTVAHNNTNIKVSERQAASIEKTAQKELRERKKLVLVVDLDQTVIHCG 180
           SNMSGSGVSNGKLTVAHNNTNIKVSERQAASIEKTAQKELRERKKLVLVVDLDQTVIHCG
Sbjct: 121 SNMSGSGVSNGKLTVAHNNTNIKVSERQAASIEKTAQKELRERKKLVLVVDLDQTVIHCG 180

Query: 181 VDPTIKEWANDPSNPNYDALKNVKTFSLDEDPILPPFYMGXXXXXXXCQYYVKLRPGLQE 240
           VDPTIKEWANDPSNPNYDALKNVKTFSLDEDPILPPFYMG       CQYYVKLRPGLQE
Sbjct: 181 VDPTIKEWANDPSNPNYDALKNVKTFSLDEDPILPPFYMGPRPPPRRCQYYVKLRPGLQE 240

Query: 241 FFDKVAPHFELHIYTMATRAYALEIAKIIDPTSALFGDRILSRDENGSLTHKSLERLFPM 300
           FFDKVAPHFELHIYTMATRAYALEIAKIIDPTSALFGDRILSRDENGSLTHKSLERLFPM
Sbjct: 241 FFDKVAPHFELHIYTMATRAYALEIAKIIDPTSALFGDRILSRDENGSLTHKSLERLFPM 300

Query: 301 DQSMVVIIDDRGDVWSWCENLIKVVPYNFFVGVGDINSNFLPRQQNSMLHMGRRHRKKAE 360
           DQSMVVIIDDRGDVWSWCENLIKVVPYNFFVGVGDINSNFLPRQQNSMLHMGRRHRKKAE
Sbjct: 301 DQSMVVIIDDRGDVWSWCENLIKVVPYNFFVGVGDINSNFLPRQQNSMLHMGRRHRKKAE 360

Query: 361 EEELLTDIMDTEKKLQEKIDQEVKKQEEKFNKISEENQPDRSMSKEDLTKKLEHNASLEV 420
           EEELLTDIMDTEKKLQEKIDQEVKKQEEKFNKISEENQPDRSMSKEDLTKKLEHNASLEV
Sbjct: 361 EEELLTDIMDTEKKLQEKIDQEVKKQEEKFNKISEENQPDRSMSKEDLTKKLEHNASLEV 420

Query: 421 QQQNRPLAELQKHMNNQKLLIDDDDELPHLSEILLNVHRTYYEELAKTEVFPDIKLLMPQ 480
           QQQNRPLAELQKHMNNQKLLIDDDDELPHLSEILLNVHRTYYEELAKTEVFPDIKLLMPQ
Sbjct: 421 QQQNRPLAELQKHMNNQKLLIDDDDELPHLSEILLNVHRTYYEELAKTEVFPDIKLLMPQ 480

Query: 481 MKAKVFAQCHFVFSGLIPLGTNIRHADIVLWTNMFGAQTSSDIDENTTHVITKTPGTFKA 540
           MKAKVFAQCHFVFSGLIPLGTNIRHADIVLWTNMFGAQTSSDIDENTTHVITKTPGTFKA
Sbjct: 481 MKAKVFAQCHFVFSGLIPLGTNIRHADIVLWTNMFGAQTSSDIDENTTHVITKTPGTFKA 540

Query: 541 RLAKSYNPDIKIVHPDWIFECLVKWVRADEKPYELIIEQEVSSDELEEFQRNLKKRQMAE 600
           RLAKSYNPDIKIVHPDWIFECLVKWVRADEKPYELIIEQEVSSDELEEFQRNLKKRQMAE
Sbjct: 541 RLAKSYNPDIKIVHPDWIFECLVKWVRADEKPYELIIEQEVSSDELEEFQRNLKKRQMAE 600

Query: 601 KAARESLQQETGEELNLLAGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 660
           KAARESLQQETGEELNLLAG                                        
Sbjct: 601 KAARESLQQETGEELNLLAGNDMWLDNDDDEMDEFLNDENGNDEEEDDDEEDSDGKDDEK 660

Query: 661 XFAAGNEEQDRDLEKYSREASHEGITYSPELDSNSREEPEVNTNKRPIPPSVSETPKKRR 720
            FAAGNEEQDRDLEKYSREASHEGITYSPELDSNSREEPEVNTNKRPIPPSVSETPKKRR
Sbjct: 661 SFAAGNEEQDRDLEKYSREASHEGITYSPELDSNSREEPEVNTNKRPIPPSVSETPKKRR 720

Query: 721 QT 722
           QT
Sbjct: 721 QT 722

>KLTH0C03894g Chr3 complement(339897..342134) [2238 bp, 745 aa] {ON}
           similar to uniprot|Q03254 Saccharomyces cerevisiae
           YMR277W FCP1 Carboxy-terminal domain (CTD) phosphatase
          Length = 745

 Score = 1109 bits (2868), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 524/620 (84%), Positives = 568/620 (91%)

Query: 1   MTTPIRLPPNLPFPITIAKLYVSKGESVTKGQRLFVYKYWELQDVITAPNEEASKKKRRV 60
           MTTPIRLP NLPFP+TIAKL VS G+SV KGQRLFVYKYWELQD+ITAPNEEA KKKRRV
Sbjct: 1   MTTPIRLPSNLPFPVTIAKLCVSTGDSVKKGQRLFVYKYWELQDIITAPNEEAPKKKRRV 60

Query: 61  DLIGTFDSPIEGTLVSLKVRVGDEFVNDSNIIAELRQPCSHEVTYGALCVVCGKAVDEDD 120
           DLIGTFDSP+EGTLVSL + +GDEFVND+N+IAE+ Q CSHEVTYG LCVVCGK V+EDD
Sbjct: 61  DLIGTFDSPVEGTLVSLNIGLGDEFVNDANVIAEVNQLCSHEVTYGGLCVVCGKTVEEDD 120

Query: 121 SNMSGSGVSNGKLTVAHNNTNIKVSERQAASIEKTAQKELRERKKLVLVVDLDQTVIHCG 180
            N+S +G+SN KLTVAHNNTNIKVSERQAA+IEKTAQK LRE KKLVLVVDLDQTVIHCG
Sbjct: 121 QNVSDNGISNSKLTVAHNNTNIKVSERQAATIEKTAQKHLREHKKLVLVVDLDQTVIHCG 180

Query: 181 VDPTIKEWANDPSNPNYDALKNVKTFSLDEDPILPPFYMGXXXXXXXCQYYVKLRPGLQE 240
           VDPTI EWANDPSNPNYDALKNVKTFSLDEDPILPPFYMG       CQYYVKLRPGLQE
Sbjct: 181 VDPTIHEWANDPSNPNYDALKNVKTFSLDEDPILPPFYMGPRPPPRKCQYYVKLRPGLQE 240

Query: 241 FFDKVAPHFELHIYTMATRAYALEIAKIIDPTSALFGDRILSRDENGSLTHKSLERLFPM 300
           FFDK+APHFELHIYTMATRAYALEIAKIIDP   LFGDRILSRDENGSLTHKSLERLFPM
Sbjct: 241 FFDKIAPHFELHIYTMATRAYALEIAKIIDPKGELFGDRILSRDENGSLTHKSLERLFPM 300

Query: 301 DQSMVVIIDDRGDVWSWCENLIKVVPYNFFVGVGDINSNFLPRQQNSMLHMGRRHRKKAE 360
           DQSMVVIIDDRGDVWSWCENLIKVVPYNFFVGVGDINSNFLPRQQNSMLH+GRR+RKKAE
Sbjct: 301 DQSMVVIIDDRGDVWSWCENLIKVVPYNFFVGVGDINSNFLPRQQNSMLHLGRRNRKKAE 360

Query: 361 EEELLTDIMDTEKKLQEKIDQEVKKQEEKFNKISEENQPDRSMSKEDLTKKLEHNASLEV 420
           EEELLTDIMDTEKKLQEKIDQEVKKQEEKFNKI+EENQP+R +SKEDLTKKLEHNASLEV
Sbjct: 361 EEELLTDIMDTEKKLQEKIDQEVKKQEEKFNKINEENQPERPISKEDLTKKLEHNASLEV 420

Query: 421 QQQNRPLAELQKHMNNQKLLIDDDDELPHLSEILLNVHRTYYEELAKTEVFPDIKLLMPQ 480
           QQQNRPLAELQKHMNNQKLL DDDDELPHLS ILLNVH+TYY++LA+    PDIK LMPQ
Sbjct: 421 QQQNRPLAELQKHMNNQKLLTDDDDELPHLSNILLNVHKTYYDKLAEQGQPPDIKTLMPQ 480

Query: 481 MKAKVFAQCHFVFSGLIPLGTNIRHADIVLWTNMFGAQTSSDIDENTTHVITKTPGTFKA 540
           MK++VF +CHFVFSGLIPLGTN+R ADIVLWT+MFGA TS D+DE TTHVITKTPGTFKA
Sbjct: 481 MKSQVFKRCHFVFSGLIPLGTNVRQADIVLWTSMFGATTSVDVDEATTHVITKTPGTFKA 540

Query: 541 RLAKSYNPDIKIVHPDWIFECLVKWVRADEKPYELIIEQEVSSDELEEFQRNLKKRQMAE 600
           RLAK+YNP+IK++HPDWIFECLVKWVR +EKPYEL  EQ+VS +ELEEF++ L K++ +E
Sbjct: 541 RLAKTYNPNIKVIHPDWIFECLVKWVRVNEKPYELTTEQDVSPEELEEFKKRLDKKKQSE 600

Query: 601 KAARESLQQETGEELNLLAG 620
           KA  ES+QQE  +ELNLL G
Sbjct: 601 KALSESIQQEATQELNLLTG 620

>SAKL0D01496g Chr4 complement(120202..122268) [2067 bp, 688 aa] {ON}
           similar to uniprot|Q03254 Saccharomyces cerevisiae
           YMR277W FCP1 Carboxy-terminal domain (CTD) phosphatase
          Length = 688

 Score =  962 bits (2487), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 450/621 (72%), Positives = 540/621 (86%), Gaps = 3/621 (0%)

Query: 1   MTTPIRLPPNLPFPITIAKLYVSKGESVTKGQRLFVYKYWELQDVITAPNEEASK-KKRR 59
           MTT ++LP NLP+PITIA+L  S G+ + KGQRLF YKYWE QDV+T+PN+ ++K KK+R
Sbjct: 1   MTTALKLPDNLPYPITIAQLCASTGDPIKKGQRLFAYKYWEFQDVVTSPNDTSTKPKKQR 60

Query: 60  VDLIGTFDSPIEGTLVSLKVRVGDEFVNDSNIIAELRQPCSHEVTYGALCVVCGKAVDED 119
           VDLIGTFDSP+EG LVS  + +GDEFVN ++++AE++Q C+H+VTYG LCV+CGK+V+E 
Sbjct: 61  VDLIGTFDSPVEGALVSFNLSLGDEFVNSNHVVAEIKQACTHDVTYGGLCVICGKSVEEY 120

Query: 120 DSNMSGSGVSNGKLTVAHNNTNIKVSERQAASIEKTAQKELRERKKLVLVVDLDQTVIHC 179
            SN S S  S  KLT++H NTNIK+SERQAA+IE+TAQK+LR+ KKLVLVVDLDQTVIHC
Sbjct: 121 SSN-SASDPSQNKLTMSHTNTNIKISERQAAAIEETAQKQLRKLKKLVLVVDLDQTVIHC 179

Query: 180 GVDPTIKEWANDPSNPNYDALKNVKTFSLDEDPILPPFYMGXXXXXXXCQYYVKLRPGLQ 239
           GVDPTI EW+ DP NPNY+ALK++K+F+L E+PILPPFYMG       C YYVKLRPGL+
Sbjct: 180 GVDPTIGEWSRDPKNPNYEALKDIKSFALVEEPILPPFYMGPKPPARKCWYYVKLRPGLK 239

Query: 240 EFFDKVAPHFELHIYTMATRAYALEIAKIIDPTSALFGDRILSRDENGSLTHKSLERLFP 299
           EFF+K+APHFELHIYTMATRAYALEIAKIIDP   LFGDRILSRDENGS+THKSLERLFP
Sbjct: 240 EFFEKIAPHFELHIYTMATRAYALEIAKIIDPDGKLFGDRILSRDENGSITHKSLERLFP 299

Query: 300 MDQSMVVIIDDRGDVWSWCENLIKVVPYNFFVGVGDINSNFLPRQQNSMLHMGRRHRKKA 359
           MDQSMVVIIDDRGDVW+WCENLIKVVPY+FFVGVGDINSNFLPRQQNSMLH+GRRHRKKA
Sbjct: 300 MDQSMVVIIDDRGDVWNWCENLIKVVPYSFFVGVGDINSNFLPRQQNSMLHLGRRHRKKA 359

Query: 360 EEEELLTDIMDTEKKLQEKIDQEVKKQEEKFNKISEENQPDRSMSKEDLTKKLEHNASLE 419
           EEEELLTDI+DTEKKLQEKID+EVK+QEEK +K++EE QP+ + SKEDL KKLEH+ASLE
Sbjct: 360 EEEELLTDILDTEKKLQEKIDEEVKRQEEKLSKMTEEKQPEDTNSKEDLAKKLEHSASLE 419

Query: 420 VQQQNRPLAELQKHMNNQKLLIDDDDELPHLSEILLNVHRTYYEELAKTEVFPDIKLLMP 479
           VQQQNRPLAELQKH++NQKLLIDDDDELPHLS ILL VH  YYE+L+K    P+IK LMP
Sbjct: 420 VQQQNRPLAELQKHLHNQKLLIDDDDELPHLSRILLQVHGKYYEDLSKHSSPPNIKNLMP 479

Query: 480 QMKAKVFAQCHFVFSGLIPLGTNIRHADIVLWTNMFGAQTSSDIDENTTHVITKTPGTFK 539
           Q+K +VF +C FVFSGLIPLGT++R ADI LWT+MFGA+T++DIDE TTH+ITKTPGTFK
Sbjct: 480 QLKKRVFCKCSFVFSGLIPLGTDVRKADIALWTSMFGAKTTADIDEATTHIITKTPGTFK 539

Query: 540 ARLAKSYNPDIKIVHPDWIFECLVKWVRADEKPYELIIEQEVSSDELEEFQRNLKKRQMA 599
           ARLAK++NP+IK+VHPDWIFECLV W R DEK YEL+IEQ VS +EL++F++ L+  +  
Sbjct: 540 ARLAKAFNPEIKVVHPDWIFECLVNWKRVDEKAYELLIEQPVSEEELDDFKKKLENEK-K 598

Query: 600 EKAARESLQQETGEELNLLAG 620
           +   +E + + + +E+NLLAG
Sbjct: 599 DAQIQEEVDRVSSDEINLLAG 619

>Ecym_4610 Chr4 (1188871..1191126) [2256 bp, 751 aa] {ON} similar to
           Ashbya gossypii ABL127W
          Length = 751

 Score =  892 bits (2304), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 420/634 (66%), Positives = 517/634 (81%), Gaps = 16/634 (2%)

Query: 1   MTTPIRLPPNLPFPITIAKLYVSKGESVTKGQRLFVYKYWELQDVITAPNEEAS---KKK 57
           M+TPIRLP NLP+PIT+A+L VS G+ V +GQRLF YKYW+ + ++T+P +E++    K+
Sbjct: 1   MSTPIRLPDNLPYPITVAQLAVSAGDMVERGQRLFAYKYWDFEQIVTSPGDESAGGKSKR 60

Query: 58  RRVDLIGTFDSPIEGTLVSLKVRVGDEFVNDSNIIAELRQPCSHEVTYGALCVVCGKAVD 117
           +R+DL+GTFDSP+ G +VSL + +GDEFVN    +AE++QPC+H+VTYG LCV CG+ V+
Sbjct: 61  QRIDLVGTFDSPVSGQVVSLNITLGDEFVNSQCTVAEIKQPCTHDVTYGGLCVQCGQTVE 120

Query: 118 EDDSNMSGSGVSN-GKLTVAHNNTNIKVSERQAASIEKTAQKELRERKKLVLVVDLDQTV 176
             D   SGS + N  KLT++H N NI++SE+QA ++EK+AQK+LRE +KLVLVVDLDQTV
Sbjct: 121 --DEQTSGSLLDNQAKLTMSHTNMNIRISEKQAYTLEKSAQKQLREARKLVLVVDLDQTV 178

Query: 177 IHCGVDPTIKEWANDPSNPNYDALKNVKTFSLDEDPILPPFYMGXXXXXXXCQYYVKLRP 236
           IHCGVDPTI EW+ DP NPNY++LK+V++FSL E+P+LPPFYMG       C YYVKLRP
Sbjct: 179 IHCGVDPTIGEWSKDPDNPNYESLKDVRSFSLHEEPVLPPFYMGPKPPTRKCWYYVKLRP 238

Query: 237 GLQEFFDKVAPHFELHIYTMATRAYALEIAKIIDPTSALFGDRILSRDENGSLTHKSLER 296
           GLQ+FF  +APHFELHIYTMATR YALEIAKIIDP   LFGDRILSRDENGSLT KSLER
Sbjct: 239 GLQDFFSNIAPHFELHIYTMATRTYALEIAKIIDPDGTLFGDRILSRDENGSLTQKSLER 298

Query: 297 LFPMDQSMVVIIDDRGDVWSWCENLIKVVPYNFFVGVGDINSNFLPRQQNSMLHMGRRHR 356
           LFPMDQSMVVIIDDRGDVW+WCENLIKVVPY+FFVG+GDINSNFLPRQQNSMLH+GRR+R
Sbjct: 299 LFPMDQSMVVIIDDRGDVWNWCENLIKVVPYDFFVGIGDINSNFLPRQQNSMLHLGRRNR 358

Query: 357 KK-AEEEELLTDIMDTEKKLQEKIDQEVKKQEEKFNKISEENQPDRSMSKEDLTKKLEHN 415
           KK  ++EELLTDI+DTEKKL+ KI +EVK+QEE+  K+SEE  PD + SKED+ KKLEHN
Sbjct: 359 KKLKQDEELLTDILDTEKKLKVKISEEVKRQEEEMQKLSEEKIPDHTTSKEDIAKKLEHN 418

Query: 416 ASLEVQQQNRPLAELQKHMNNQKLLIDDDDELPHLSEILLNVHRTYYEELAK-----TEV 470
           ASLEVQQQNRPLAELQKH++N++LLIDDDDELPHL++ILL VH  YY++L K     TE+
Sbjct: 419 ASLEVQQQNRPLAELQKHLHNERLLIDDDDELPHLTDILLRVHSAYYDQLEKNKHGATEL 478

Query: 471 FPDIKLLMPQMKAKVFAQCHFVFSGLIPLGTNIRHADIVLWTNMFGAQTSSDIDENTTHV 530
            PDIK L+P +K  VF  C+FVFSGLIPL TNI  ADIVLWTN FGA+T+ +ID NTTH+
Sbjct: 479 SPDIKHLIPSLKEIVFKGCNFVFSGLIPLHTNIDRADIVLWTNTFGAKTTINIDYNTTHL 538

Query: 531 ITKTPGTFKARLAKSYNPDIKIVHPDWIFECLVKWVRADEKPYELIIEQEVSSDELEEFQ 590
           ITKTPGT KARLA S+N DIKIVHPDWIFEC+V W R DEKPYELI+E+ VS + LE F+
Sbjct: 539 ITKTPGTMKARLASSFNRDIKIVHPDWIFECIVNWKRVDEKPYELIVEEPVSKEYLENFK 598

Query: 591 RNLKKRQMAEKAARESLQQETGEELN----LLAG 620
           + L++ + ++ +   ++  +  E  N    LL G
Sbjct: 599 KELEETEKSKNSVDANISSQKYETFNDAMILLGG 632

>ABL127W Chr2 (156798..158984) [2187 bp, 728 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR277W (FCP1)
          Length = 728

 Score =  889 bits (2298), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 422/604 (69%), Positives = 501/604 (82%), Gaps = 13/604 (2%)

Query: 1   MTTPIRLPPNLPFPITIAKLYVSKGESVTKGQRLFVYKYWELQDVITAPNEEASKK--KR 58
           M+TPIRLP +LP+PITIA+L VS G++V KGQRL  YKYW+L DVITAP EE + K  K+
Sbjct: 1   MSTPIRLPDSLPYPITIAQLGVSTGDTVEKGQRLLAYKYWDLVDVITAPGEEEAGKARKQ 60

Query: 59  RVDLIGTFDSPIEGTLVSLKVRVGDEFVNDSNIIAELRQPCSHEVTYGALCVVCGKAVDE 118
           RVDL+GTFDSP+ GT+VSL VRVGDEFVN    + E+RQ C H+VTYG LCV CG+AV+ 
Sbjct: 61  RVDLVGTFDSPVAGTVVSLDVRVGDEFVNSQRPVVEIRQACPHDVTYGGLCVQCGQAVE- 119

Query: 119 DDSNMSGSGVSNGKLTVAHNNTNIKVSERQAASIEKTAQKELRERKKLVLVVDLDQTVIH 178
            D   +  GV   KLTV+H NT+I+VSERQAAS+ ++AQ +LRE +KLVLVVDLDQTVIH
Sbjct: 120 -DEAGAADGVEQAKLTVSHTNTHIRVSERQAASLGQSAQLKLREARKLVLVVDLDQTVIH 178

Query: 179 CGVDPTIKEWANDPSNPNYDALKNVKTFSLDEDPILPPFYMGXXXXXXXCQYYVKLRPGL 238
           CGVDPTI EW+ DP+NPNY+ALK+V++FSLDE+P+LPPFYMG       C YYVKLRPGL
Sbjct: 179 CGVDPTIGEWSKDPNNPNYEALKDVQSFSLDEEPVLPPFYMGPKPPTRKCWYYVKLRPGL 238

Query: 239 QEFFDKVAPHFELHIYTMATRAYALEIAKIIDPTSALFGDRILSRDENGSLTHKSLERLF 298
           +EFF K+APHFELHIYTMATRAYALEIAKIIDP   LFGDRILSRDENGSLT KSLERLF
Sbjct: 239 KEFFAKIAPHFELHIYTMATRAYALEIAKIIDPDGKLFGDRILSRDENGSLTQKSLERLF 298

Query: 299 PMDQSMVVIIDDRGDVWSWCENLIKVVPYNFFVGVGDINSNFLPRQQNSMLHMGRRHRKK 358
           PMDQSMVV+IDDRGDVW+WCENLIKVVPY+FFVG+GDINSNFLP QQNSMLH+GRR+RKK
Sbjct: 299 PMDQSMVVVIDDRGDVWNWCENLIKVVPYDFFVGIGDINSNFLPIQQNSMLHLGRRNRKK 358

Query: 359 A-EEEELLTDIMDTEKKLQEKIDQEVKKQEEKFNKISEENQPDRSMSKEDLTKKLEHNAS 417
             +EEELLTDI+DTEKKL+EKI++EVK+QE++ +++++E  PD      D+ KKLEHNAS
Sbjct: 359 PKQEEELLTDILDTEKKLKEKINEEVKRQEDQMHRLTDEKLPD----TRDIAKKLEHNAS 414

Query: 418 LEVQQQNRPLAELQKHMNNQKLLIDDDDELPHLSEILLNVHRTYYEELAK----TEVFPD 473
           LEVQQQNRPLAELQKHM N++LL DDDDELPHL  ILL VH  YY++L +     +  PD
Sbjct: 415 LEVQQQNRPLAELQKHMRNERLLFDDDDELPHLGNILLKVHSAYYDQLQRYNSGEDPIPD 474

Query: 474 IKLLMPQMKAKVFAQCHFVFSGLIPLGTNIRHADIVLWTNMFGAQTSSDIDENTTHVITK 533
           IK+LMP++K  VF  C FVFSGLIPL TNI  ADIVLWTNMFGA T++++D NTTH+IT+
Sbjct: 475 IKILMPKLKETVFEGCRFVFSGLIPLHTNIERADIVLWTNMFGASTTANLDYNTTHLITR 534

Query: 534 TPGTFKARLAKSYNPDIKIVHPDWIFECLVKWVRADEKPYELIIEQEVSSDELEEFQRNL 593
           TPGT KARLAKS+NP IKIVHPDWIFECLV W R +E PYELI+E+ V  + LE F+R+L
Sbjct: 535 TPGTMKARLAKSFNPAIKIVHPDWIFECLVGWERVEESPYELIVEEPVGEEYLENFKRDL 594

Query: 594 KKRQ 597
            + Q
Sbjct: 595 AEAQ 598

>KLLA0D01595g Chr4 complement(141459..143618) [2160 bp, 719 aa] {ON}
           similar to uniprot|Q03254 Saccharomyces cerevisiae
           YMR277W FCP1 Carboxy-terminal domain (CTD) phosphatase ,
          Length = 719

 Score =  807 bits (2084), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 388/629 (61%), Positives = 489/629 (77%), Gaps = 19/629 (3%)

Query: 1   MTTPIRLPPNLPFPITIAKLYVSKGESVTKGQRLFVYKYWELQDVITAPNEEASKKKRRV 60
           + T +++  +LP+PIT+A+LYV  G+ V KGQRLF Y+YW+ QDV+    E+   KK+RV
Sbjct: 3   LETNVKVTSDLPYPITVAQLYVKPGDHVEKGQRLFAYEYWDFQDVLVKYEEKT--KKQRV 60

Query: 61  DLIGTFDSPIEGTLVSLKVRVGDEFVNDSNIIAELRQPCSHEVTYGALCVVCGKAVDEDD 120
           D + TFDSP+ GT+      V DEF + ++ +  +RQ C+H++TYG LCV CG  VDE+D
Sbjct: 61  DRVATFDSPVSGTVKEWHCSVKDEFASANHEVITIRQDCNHDITYGGLCVQCGNTVDEED 120

Query: 121 SNMSGSGVSNGKLTVAHNNTNIKVSERQAASIEKTAQKELRERKKLVLVVDLDQTVIHCG 180
           ++ +        LT++H NTNIKVSE+QA ++E+++   LRE KKLVLVVDLDQTVIHCG
Sbjct: 121 NSKN--------LTISHVNTNIKVSEQQAETLERSSLTRLREEKKLVLVVDLDQTVIHCG 172

Query: 181 VDPTIKEWANDPSNPNYDALKNVKTFSLDEDPILPPFYMGXXXXXXXCQYYVKLRPGLQE 240
           VDPTI EW  DP NPNY AL++VK+F+L+++PI+P FY G         YYVKLRPGL+E
Sbjct: 173 VDPTIGEWMRDPKNPNYKALQDVKSFTLEDEPIIPSFYFGPKPPARKSWYYVKLRPGLKE 232

Query: 241 FFDKVAPHFELHIYTMATRAYALEIAKIIDPTSALFGDRILSRDENGSLTHKSLERLFPM 300
           FF+ V+PHFE+HIYTMATR+YA EIAKIIDPT  LFGDRILSRDENGSLT KSLERLFPM
Sbjct: 233 FFEAVSPHFEMHIYTMATRSYAHEIAKIIDPTGELFGDRILSRDENGSLTTKSLERLFPM 292

Query: 301 DQSMVVIIDDRGDVWSWCENLIKVVPYNFFVGVGDINSNFLPRQQNSMLHMGRRHRKKAE 360
           DQSMVV+IDDRGDVW+W ENLIKVVPY+FFVG+GDINSNFLPRQQNS+LH+GR HR+K E
Sbjct: 293 DQSMVVVIDDRGDVWNWFENLIKVVPYSFFVGIGDINSNFLPRQQNSVLHLGRHHRRKQE 352

Query: 361 EEELLTDIMDTEKKLQEKIDQEVKKQEEKFNKISEENQPDRSM--SKEDLTKKLEHNASL 418
           EE+L++DI+D EKKL+EKID+EVK+QEE  + I ++N        +KED++KKLEH+ASL
Sbjct: 353 EEKLISDIIDNEKKLKEKIDEEVKRQEEIISHIGDDNTRKEGGPPNKEDISKKLEHSASL 412

Query: 419 EVQQQNRPLAELQKHMNNQKLLIDDDDELPHLSEILLNVHRTYYEELAKT-EVFPDIKLL 477
           EVQQQNRPLAELQKH++NQ LLIDDDDELPHLS+ILL VH+ Y+ +  +  +  PDIK L
Sbjct: 413 EVQQQNRPLAELQKHLHNQTLLIDDDDELPHLSQILLRVHKEYFNQYTEAPKNPPDIKYL 472

Query: 478 MPQMKAKVFAQCHFVFSGLIPLGTNIRHADIVLWTNMFGAQTSSDIDENTTHVITKTPGT 537
           +PQMK KVF  CHFVFSGLIPL T++R ADIVLWT+MFGA TSSDI+  TTH+IT T  T
Sbjct: 473 LPQMKYKVFQGCHFVFSGLIPLETDVRKADIVLWTDMFGATTSSDINYKTTHIITTTSRT 532

Query: 538 FKARLAKSYNPDIKIVHPDWIFECLVKWVRADEKPYELIIEQEVSSDELEEFQRNLKKRQ 597
           FKARLAKS+NPDIKIVHPDW+FECLV+W R  E PYEL+I+  V  D+++EF+  L K+ 
Sbjct: 533 FKARLAKSFNPDIKIVHPDWLFECLVQWERVKESPYELLIQDPVDEDKVKEFKEKLDKKI 592

Query: 598 MAEKAARESL------QQETGEELNLLAG 620
               ++          ++  G+E +LLAG
Sbjct: 593 SNPSSSVNPFEDGNEDEEVLGDEFHLLAG 621

>TDEL0B00580 Chr2 complement(111408..113549) [2142 bp, 713 aa] {ON}
           Anc_8.839 YMR277W
          Length = 713

 Score =  798 bits (2061), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 387/627 (61%), Positives = 479/627 (76%), Gaps = 14/627 (2%)

Query: 1   MTTPIRLPPNLPFPITIAKLYVSKGESVTKGQRLFVYKYWELQDVITAP--NEEASKKKR 58
           MTTP+  P  LP+PITI +L    G  V KGQRLF +K+W + ++ ++P  NE   +KK 
Sbjct: 1   MTTPVFSPEVLPYPITIDQLIAPIGSHVEKGQRLFAFKFWYMVEIASSPDENEGGHRKKT 60

Query: 59  RVDLIGTFDSPIEGTLVSLKVRVGDEFVNDSNIIAELRQPCSHEVTYGALCVVCGKAVDE 118
             + I  F++P EG L+S  V VGDE V  +  I E+ +PC+H++ YG LC +CGK VDE
Sbjct: 61  VRESIEFFEAPFEGDLMSWNVDVGDEVVAPNQAICEISRPCNHDIVYGGLCTLCGKEVDE 120

Query: 119 DDSNMSGSGVSNGKLTVAHNNTNIKVSERQAASIEKTAQKELRERKKLVLVVDLDQTVIH 178
            +         NG L ++H + N+KVS ++A  IE   +  LRE KKLVLVVDLDQTVIH
Sbjct: 121 SEQ-------FNGNLAISHTDVNLKVSRKEATDIENNLKTRLRESKKLVLVVDLDQTVIH 173

Query: 179 CGVDPTIKEWANDPSNPNYDALKNVKTFSLDEDPILPPFYMGXXXXXXXCQYYVKLRPGL 238
           CGVDPTI EW  D SNPNY+ALK+V++F+LDE+PILP  YMG       C YYVK+RPGL
Sbjct: 174 CGVDPTIGEWKRDSSNPNYEALKDVQSFALDEEPILPLLYMGPKPPVRKCWYYVKVRPGL 233

Query: 239 QEFFDKVAPHFELHIYTMATRAYALEIAKIIDPTSALFGDRILSRDENGSLTHKSLERLF 298
           +EFFDKVAP FE+HIYTMATRAYALEIAKIIDP  +LFGDRILSRDENGS+T KSLERLF
Sbjct: 234 KEFFDKVAPLFEMHIYTMATRAYALEIAKIIDPDGSLFGDRILSRDENGSITQKSLERLF 293

Query: 299 PMDQSMVVIIDDRGDVWSWCENLIKVVPYNFFVGVGDINSNFLPRQQNSMLHMGRRHRKK 358
           P DQSMVV+IDDRGDVW+WC NLIKVVPYNFFVGVGDINSNFLPRQQN+ML +GR  RKK
Sbjct: 294 PTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPRQQNTMLQLGRGARKK 353

Query: 359 AEE-EELLTDIMDTEKKLQEKIDQEVKKQEEKFN-KISEENQPDRSMSKEDLTKKLEHNA 416
            +E +EL+TDIMDTEKKLQEKID+EVK+QEEK N +++   +     SK+ L KKLE++A
Sbjct: 354 TQESDELITDIMDTEKKLQEKIDEEVKRQEEKLNHQMASGEEVPAPESKDQLAKKLEYSA 413

Query: 417 SLEVQQQNRPLAELQKHMNNQKLLIDDDDELPHLSEILLNVHRTYYEELAK-TEVFPDIK 475
           SLEVQQQNRPLA LQKHM+NQ+LL+DDDDEL +L EIL  VH  YY+ L + +E   DIK
Sbjct: 414 SLEVQQQNRPLATLQKHMHNQRLLVDDDDELNYLREILAKVHDEYYKTLGQDSEKKADIK 473

Query: 476 LLMPQMKAKVFAQCHFVFSGLIPLGTNIRHADIVLWTNMFGAQTSSDIDENTTHVITKTP 535
            L+P MK+KVF  CHFVFSGLIPLGTNI  ADIVLWTNMFGAQ+S +ID++TTHVIT+TP
Sbjct: 474 TLLPLMKSKVFEDCHFVFSGLIPLGTNINRADIVLWTNMFGAQSSPEIDDSTTHVITRTP 533

Query: 536 GTFKARLAKSYNPDIKIVHPDWIFECLVKWVRADEKPYELIIEQEVSSDELEEFQRNLKK 595
           GT+KAR+AK++N +IK+VHPDW+FECLV W   DEKPYELI+EQ  + +EL ++++ L +
Sbjct: 534 GTYKARIAKAFNENIKVVHPDWVFECLVSWKHVDEKPYELIVEQTATDEELGDYKQKLAR 593

Query: 596 RQ--MAEKAARESLQQETGEELNLLAG 620
           R   +AE+    +++      +NL AG
Sbjct: 594 RSSALAEQEMELAMESAKNGTINLFAG 620

>ZYRO0G14168g Chr7 (1128601..1130895) [2295 bp, 764 aa] {ON} similar
           to uniprot|Q03254 Saccharomyces cerevisiae YMR277W FCP1
           Carboxy-terminal domain (CTD) phosphatase
          Length = 764

 Score =  791 bits (2043), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/636 (59%), Positives = 482/636 (75%), Gaps = 24/636 (3%)

Query: 1   MTTPIRLPPNLPFPITIAKLYVSKGESVTKGQRLFVYKYWELQDVITAPNE-------EA 53
           M TP+  P +LP+PITI +L    G +V KGQRLF YK+W + ++ ++P+E       + 
Sbjct: 1   MATPVIAPESLPYPITIDQLIAPIGSTVKKGQRLFAYKFWYMVEIASSPDENDGNGGAQH 60

Query: 54  SKKKRRVDLIGTFDSPIEGTLVSLKVRVGDEFVNDSNIIAELRQPCSHEVTYGALCVVCG 113
           SKK  R + I  F+SP EG LVS +V  GDE  +   +I E+ +PC+H+V YG LC +CG
Sbjct: 61  SKKTVR-ESIEFFESPFEGDLVSWEVDRGDEVASARQVICEIMRPCNHDVVYGGLCTMCG 119

Query: 114 KAVDEDDSNMSGSGVSNGKLTVAHNNTNIKVSERQAASIEKTAQKELRERKKLVLVVDLD 173
           K VDE+D            L ++H +TN+KVS ++A  +E   ++ LR+ KKLVLVVDLD
Sbjct: 120 KEVDENDQ-------MEANLAISHTDTNLKVSRKEAEDMEHFLKQRLRQSKKLVLVVDLD 172

Query: 174 QTVIHCGVDPTIKEWANDPSNPNYDALKNVKTFSLDEDPILPPFYMGXXXXXXXCQYYVK 233
           QTVIHCGVDPTI EW  DPSNPNY+ LK+V+ FSL+E+PI+PP YMG       C Y+VK
Sbjct: 173 QTVIHCGVDPTIGEWKKDPSNPNYETLKDVQMFSLEEEPIVPPMYMGPRLPERKCWYFVK 232

Query: 234 LRPGLQEFFDKVAPHFELHIYTMATRAYALEIAKIIDPTSALFGDRILSRDENGSLTHKS 293
           +RPGL+EFF ++AP +E+HIYTMATR YALEIAKIIDP  +LFGDRILSRDENGSLT KS
Sbjct: 233 VRPGLREFFAQLAPLYEMHIYTMATRTYALEIAKIIDPDGSLFGDRILSRDENGSLTQKS 292

Query: 294 LERLFPMDQSMVVIIDDRGDVWSWCENLIKVVPYNFFVGVGDINSNFLPRQQNSMLHMGR 353
           LERLFP DQSMV++IDDRGDVW+WC NLIKVVPYNFFVGVGDINSNFLPRQQ+ +L +GR
Sbjct: 293 LERLFPTDQSMVIVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPRQQSGLLQLGR 352

Query: 354 R-HRKKAEEEELLTDIMDTEKKLQEKIDQEVKKQEEKF-NKISEENQPDRSMSKEDLTKK 411
           R H+K  E +ELLTDIMDTEK+LQEKID+EVK+QEEK  ++++  ++P +  SKE LTKK
Sbjct: 353 RTHKKPQESDELLTDIMDTEKRLQEKIDEEVKRQEEKLSHQLTTNDEPVQGESKEQLTKK 412

Query: 412 LEHNASLEVQQQNRPLAELQKHMNNQKLLIDDDDELPHLSEILLNVHRTYYEELAK-TEV 470
           LE++ASLEVQQQNRPLA LQKHM+NQ+LL+DDDDEL +L + L  +HR YY+ L +  E 
Sbjct: 413 LEYSASLEVQQQNRPLATLQKHMHNQRLLVDDDDELYYLKDTLAKIHRKYYKLLDEGNEN 472

Query: 471 FPDIKLLMPQMKAKVFAQCHFVFSGLIPLGTNIRHADIVLWTNMFGAQTSSDIDENTTHV 530
             DI+ L+P MK +VF  C+FVFSGLIPLGTNIR ADIVLWT MFGA TSS+IDENTTHV
Sbjct: 473 SADIQSLVPTMKGQVFKDCYFVFSGLIPLGTNIRRADIVLWTGMFGAITSSEIDENTTHV 532

Query: 531 ITKTPGTFKARLAKSYNPDIKIVHPDWIFECLVKWVRADEKPYELIIEQEVSSDELEEFQ 590
           ITKTPGT+KAR+AK +N ++K+VHPDW+FECLV W   DEKPYELII+   + +E+++F+
Sbjct: 533 ITKTPGTYKARIAKGFNENVKVVHPDWVFECLVTWTHVDEKPYELIIQDPATEEEIQDFK 592

Query: 591 RNLKKRQMAEKAARESLQQET------GEELNLLAG 620
           R +++R + E+  RE  + E          LNL AG
Sbjct: 593 RKIEQRHLIEEQRREQFESEALMKTAQDSTLNLFAG 628

>NCAS0C00420 Chr3 complement(65252..67429) [2178 bp, 725 aa] {ON}
           Anc_8.839 YMR277W
          Length = 725

 Score =  776 bits (2004), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 383/635 (60%), Positives = 477/635 (75%), Gaps = 20/635 (3%)

Query: 1   MTTPIRLPPNLPFPITIAKLYVSKGESVTKGQRLFVYKYWELQDVITAPNEE-------A 53
           M+T I  P  LP+PITI +L    G+ V KG RL  YK+W + DV ++P++        A
Sbjct: 1   MSTQILAPIGLPYPITIDQLITHVGDEVQKGDRLLAYKFWFVVDVASSPDDNDVSSPPTA 60

Query: 54  SKKKRRVDLIGTFDSPIEGTLVSLKVRVGDEFVNDSNIIAELRQPCSHEVTYGALCVVCG 113
            KK  R + I  F+SP +G L+S  V +GDE  + + ++AE+ +PC+H+V YG LC +CG
Sbjct: 61  GKKSIR-ESIEFFESPYKGQLISWNVDIGDEIASPNQVLAEIIRPCNHDVVYGGLCTLCG 119

Query: 114 KAVDEDDSNMSGSGVSNGKLTVAHNNTNIKVSERQAASIEKTAQKELRERKKLVLVVDLD 173
           + VDEDD++ SGSG +   LT++H +TN+K+S R+A  I    +  LR+ KKLVLVVDLD
Sbjct: 120 EEVDEDDNDASGSGAN---LTISHTDTNLKISTREALDIGLNVRTRLRKEKKLVLVVDLD 176

Query: 174 QTVIHCGVDPTIKEWANDPSNPNYDALKNVKTFSLDEDPILPPFYMGXXXXXXXCQYYVK 233
           QTVIHCGVDPTI EW NDP NPN++ LK+VK FSL+E+PILP  YMG       C YYVK
Sbjct: 177 QTVIHCGVDPTIGEWKNDPKNPNFETLKDVKQFSLEEEPILPTLYMGPKPPLRKCWYYVK 236

Query: 234 LRPGLQEFFDKVAPHFELHIYTMATRAYALEIAKIIDPTSALFGDRILSRDENGSLTHKS 293
           +RPGL+EF +K+AP FE+HIYTMATRAYA EIAKIIDP   LFGDRILSRDENGS+T KS
Sbjct: 237 VRPGLKEFLEKIAPLFEMHIYTMATRAYASEIAKIIDPNGDLFGDRILSRDENGSMTTKS 296

Query: 294 LERLFPMDQSMVVIIDDRGDVWSWCENLIKVVPYNFFVGVGDINSNFLPRQQNSMLHMGR 353
           LERLFP DQSMV++IDDRGDVW+W  NLIKVVPYNFFVGVGDINSNFLP+QQ +ML +GR
Sbjct: 297 LERLFPTDQSMVIVIDDRGDVWNWSPNLIKVVPYNFFVGVGDINSNFLPKQQATMLQLGR 356

Query: 354 RHRKKAEE-EELLTDIMDTEKKLQEKIDQEVKKQEEKF---NKISEENQPDRSMSKEDLT 409
           R R+K+++ E+LL DIMD+EKKL+EKIDQEVK+QEE+    +  +EE       +KE+++
Sbjct: 357 RSREKSKDTEDLLIDIMDSEKKLKEKIDQEVKRQEEELSHQSATTEEPPTSAGENKEEIS 416

Query: 410 KKLEHNASLEVQQQNRPLAELQKHMNNQKLLIDDDDELPHLSEILLNVHRTYYEELAK-T 468
           KK+E++ASLEVQQQNRPLA LQKH ++Q+LLIDDDDEL HL + L+ +H  YY  L K  
Sbjct: 417 KKIEYSASLEVQQQNRPLAALQKHFHDQRLLIDDDDELYHLKDTLVRIHDKYYNVLKKDG 476

Query: 469 EVFPDIKLLMPQMKAKVFAQCHFVFSGLIPLGTNIRHADIVLWTNMFGAQTSSDIDENTT 528
           E+  DIKL+MP MK  V   C FVFSGLIPLGT+I+ ADIV+WTN FGA ++SDIDE TT
Sbjct: 477 ELKADIKLIMPAMKQNVLDNCRFVFSGLIPLGTDIQRADIVIWTNTFGAISTSDIDEKTT 536

Query: 529 HVITKTPGTFKARLAKSYNPDIKIVHPDWIFECLVKWVRADEKPYELIIEQEVSSDELEE 588
           HVITKTPGT+KARLAKS+NP IKI+HPDW+FECL  W   DEKPYELI+EQ VS  ELEE
Sbjct: 537 HVITKTPGTYKARLAKSFNPKIKILHPDWVFECLTSWKHVDEKPYELIVEQPVSETELEE 596

Query: 589 FQRNLKKRQMAEKAARESLQQETG---EELNLLAG 620
           F++ L KRQ+    A E+L    G    EL L +G
Sbjct: 597 FKKKLAKRQLL-ATANENLSPANGTNSAELELFSG 630

>KAFR0B03910 Chr2 (811940..814114) [2175 bp, 724 aa] {ON} Anc_8.839
           YMR277W
          Length = 724

 Score =  769 bits (1987), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/626 (59%), Positives = 476/626 (76%), Gaps = 19/626 (3%)

Query: 1   MTTPIRLPPNLPFPITIAKLYVSKGESVTKGQRLFVYKYWELQDVITAPNE--------E 52
           MTTP+  P  LP+PITI +L    G  + KG RLF YK+W + ++ ++P++        +
Sbjct: 1   MTTPVLAPEGLPYPITIDELICPIGTYIEKGIRLFAYKFWYMVEIASSPDDNDPANTDTQ 60

Query: 53  ASKKKRRV-DLIGTFDSPIEGTLVSLKVRVGDEFVNDSNIIAELRQPCSHEVTYGALCVV 111
           AS  K+++ + I  FD+P EGTL+S  + VGDE  + S +I E+++PC+H++ YG LC  
Sbjct: 61  ASHPKKKIRESIEFFDAPFEGTLISWNIDVGDELSSASQVICEIKRPCNHDIVYGGLCTQ 120

Query: 112 CGKAVDEDDSNMSGSGVSNGKLTVAHNNTNIKVSERQAASIEKTAQKELRERKKLVLVVD 171
           CGK VDE + +  GS       TV+H +TN+K+S ++A  I +  +K LR  KKLVLVVD
Sbjct: 121 CGKEVDESEQSQFGSN-----FTVSHTDTNLKISRKEALDIGEDFKKRLRNEKKLVLVVD 175

Query: 172 LDQTVIHCGVDPTIKEWANDPSNPNYDALKNVKTFSLDEDPILPPFYMGXXXXXXXCQYY 231
           LDQTVIHCGVDPTI EW +DP+NPNYD LK+V+ F+L+E+P+LP  YMG       C YY
Sbjct: 176 LDQTVIHCGVDPTIGEWKSDPNNPNYDTLKDVQMFALEEEPVLPFMYMGPKPTPRKCWYY 235

Query: 232 VKLRPGLQEFFDKVAPHFELHIYTMATRAYALEIAKIIDPTSALFGDRILSRDENGSLTH 291
           VK+RPGL+EFF KVAP FE+HIYTMATRAYALEI KIIDPT  LFG+RILSRDENGSLT 
Sbjct: 236 VKVRPGLKEFFKKVAPLFEMHIYTMATRAYALEITKIIDPTGELFGNRILSRDENGSLTS 295

Query: 292 KSLERLFPMDQSMVVIIDDRGDVWSWCENLIKVVPYNFFVGVGDINSNFLPRQQNSMLHM 351
           KSLERLFP DQSMV+IIDDRGDVW+W  NLIKVVPY+FFVGVGDINSNFLP+QQ +ML +
Sbjct: 296 KSLERLFPTDQSMVIIIDDRGDVWNWSPNLIKVVPYSFFVGVGDINSNFLPKQQTTMLQL 355

Query: 352 GRRHRKKAEE-EELLTDIMDTEKKLQEKIDQEVKKQEEKF-NKISEENQPDRSMSKEDLT 409
           GRR R+KA+E +ELLTDIMDTEKKLQEKID+EVK+QE+   +++    +   + +KE+ T
Sbjct: 356 GRRSREKAKEADELLTDIMDTEKKLQEKIDEEVKRQEKNLSHQVVPTEESVSNETKEEWT 415

Query: 410 KKLEHNASLEVQQQNRPLAELQKHMNNQKLLIDDDDELPHLSEILLNVHRTYY---EELA 466
           KKLEH+AS+EVQQQNRPLA LQ+H++NQ+LLIDDDDEL  L + L  VH  YY   E  +
Sbjct: 416 KKLEHSASVEVQQQNRPLAALQEHLHNQRLLIDDDDELYFLKDTLAKVHNEYYSILENKS 475

Query: 467 KTEVFPDIKLLMPQMKAKVFAQCHFVFSGLIPLGTNIRHADIVLWTNMFGAQTSSDIDEN 526
             E   DIKL+MP++K  VF  CHFVFSGLIPL T+IR ADIV+WT+MFGA++SS+I+E 
Sbjct: 476 LDESGADIKLIMPKLKQSVFEGCHFVFSGLIPLHTDIRRADIVVWTSMFGAESSSEINEV 535

Query: 527 TTHVITKTPGTFKARLAKSYNPDIKIVHPDWIFECLVKWVRADEKPYELIIEQEVSSDEL 586
           TTHVITKTPGTFKARLAKS+N DIKIVHPDW+FECL++W   DEKPY LI+E+ +S  EL
Sbjct: 536 TTHVITKTPGTFKARLAKSFNSDIKIVHPDWVFECLIRWTHVDEKPYTLIVEEPISDREL 595

Query: 587 EEFQRNLKKRQMAEKAARESLQQETG 612
           ++F+ +L  R++ E+   ++    TG
Sbjct: 596 KKFREDLNNRKLTERNNEQNSGDITG 621

>CAGL0M02959g Chr13 (332990..335266) [2277 bp, 758 aa] {ON} similar
           to uniprot|Q03254 Saccharomyces cerevisiae YMR277w FCP1
          Length = 758

 Score =  761 bits (1965), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 366/599 (61%), Positives = 461/599 (76%), Gaps = 20/599 (3%)

Query: 1   MTTPIRLPPNLPFPITIAKLYVSKGESVTKGQRLFVYKYWELQDVITAPNE--------E 52
           M+TP+  P  LP+PIT+ +L V  G  V KGQRLF YK+W + ++  +P++        E
Sbjct: 1   MSTPVLTPMGLPYPITVDELMVPIGSYVEKGQRLFAYKFWYMVEIANSPDDNDIDYEGPE 60

Query: 53  ASKKKRRV-DLIGTFDSPIEGTLVSLKVRVGDEFVNDSNIIAELRQPCSHEVTYGALCVV 111
             K KR+V + I  +++P EG L+S  V   DE    +  + E+++PC+H++ YG LC +
Sbjct: 61  IEKSKRKVRESIEFYEAPFEGDLLSWNVDEKDEIAGPNMAVCEIKRPCNHDIVYGGLCTM 120

Query: 112 CGKAVDEDDSNMSGSGVSNGKLTVAHNNTNIKVSERQAASIEKTAQKELRERKKLVLVVD 171
           CGK VDE D         +  LT++H +TN++VS ++A  ++K     L+  KKLVLVVD
Sbjct: 121 CGKEVDEYDQ-------VDANLTISHTDTNLRVSRKEAIDLDKQITTRLKNEKKLVLVVD 173

Query: 172 LDQTVIHCGVDPTIKEWANDPSNPNYDALKNVKTFSLDEDPILPPFYMGXXXXXXXCQYY 231
           LDQTVIHCGVDPTI EW  DPSNPNY+ LK+VK FSL+E+PILP  YMG       C YY
Sbjct: 174 LDQTVIHCGVDPTIGEWKADPSNPNYETLKDVKCFSLEEEPILPLIYMGPKPPVRTCWYY 233

Query: 232 VKLRPGLQEFFDKVAPHFELHIYTMATRAYALEIAKIIDPTSALFGDRILSRDENGSLTH 291
           VK+RPGL+EFF+K+AP +E+HIYTMATRAYALEIAKIIDP  +LFGDRILSRDENGSLT 
Sbjct: 234 VKIRPGLKEFFEKIAPLYEMHIYTMATRAYALEIAKIIDPDKSLFGDRILSRDENGSLTQ 293

Query: 292 KSLERLFPMDQSMVVIIDDRGDVWSWCENLIKVVPYNFFVGVGDINSNFLPRQQNSMLHM 351
           KSL RLFP DQSMVV+IDDRGDVW+WC NLIKVVPYNFFVGVGDINSNFLP+QQ +ML +
Sbjct: 294 KSLTRLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPKQQTTMLQL 353

Query: 352 GRRHRKKAEE-EELLTDIMDTEKKLQEKIDQEVKKQEEKFN-KISEENQPDRSMSKEDLT 409
           GRR R+K +E EELLTDIMDTEKKLQEKID+EVK+QEEK N +++   +     SKE + 
Sbjct: 354 GRRTRQKIKESEELLTDIMDTEKKLQEKIDEEVKRQEEKLNHQMATAEESTDQESKEKIA 413

Query: 410 KKLEHNASLEVQQQNRPLAELQKHMNNQKLLIDDDDELPHLSEILLNVHRTYYEEL--AK 467
           KKLE +ASLEVQQQNRPLA+LQKH+++Q+LLIDDDDEL +L + L  +H+ +Y  L  A 
Sbjct: 414 KKLEFSASLEVQQQNRPLAKLQKHLHDQRLLIDDDDELFYLKDTLAYIHKEFYHLLEDAS 473

Query: 468 TEVFPDIKLLMPQMKAKVFAQCHFVFSGLIPLGTNIRHADIVLWTNMFGAQTSSDIDENT 527
            +   DI +L+P++K KVF +CHFVFSGLIPLGT+I+ ADIV+WT++FGA+++SDIDE+T
Sbjct: 474 DQNEADITMLLPKLKKKVFKECHFVFSGLIPLGTDIKRADIVIWTSLFGAESTSDIDEHT 533

Query: 528 THVITKTPGTFKARLAKSYNPDIKIVHPDWIFECLVKWVRADEKPYELIIEQEVSSDEL 586
           THV+TKTPGT+KARLAK++NPDIK+VHPDWIFECL  W R DEKPY LI+EQ VS DEL
Sbjct: 534 THVVTKTPGTYKARLAKAFNPDIKVVHPDWIFECLASWKRIDEKPYLLIVEQPVSEDEL 592

>Kpol_1068.9 s1068 complement(15966..18203) [2238 bp, 745 aa] {ON}
           complement(15966..18203) [2238 nt, 746 aa]
          Length = 745

 Score =  748 bits (1930), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 367/603 (60%), Positives = 453/603 (75%), Gaps = 19/603 (3%)

Query: 1   MTTPIRLPPNLPFPITIAKLYVSKGESVTKGQRLFVYKYWELQDVITAP-------NEEA 53
           M+TP+  P  LP+PITI+KL  S G  V KGQRLF YK+W + ++  +P       N+E 
Sbjct: 1   MSTPVSAPLGLPYPITISKLIASIGSHVEKGQRLFAYKFWYIVEIAKSPDENDDGVNDEH 60

Query: 54  SKKKRRVDLIGTFDSPIEGTLVSLKVRVGDEFVNDSNIIAELRQPCSHEVTYGALCVVCG 113
           SKK  R + I  FDSP EG LVS  V VGDE V  +  I E+ +PC+H++ Y  +C +CG
Sbjct: 61  SKKSIR-ESIEFFDSPFEGDLVSWNVDVGDEIVEPNQTICEIVRPCNHDIVYAGICTMCG 119

Query: 114 KAVDEDDSNMSGSGVSNGKLTVAHNNTNIKVSERQAASIEKTAQKELRERKKLVLVVDLD 173
           K VDE D         +  LT++H +TN+KVS R+A  I +  +K L   KKL+LVVDLD
Sbjct: 120 KEVDESDQ-------VSANLTISHTDTNLKVSRREANDIGQGIKKRLIREKKLILVVDLD 172

Query: 174 QTVIHCGVDPTIKEWANDPSNPNYDALKNVKTFSLDEDPILPPFYMGXXXXXXXCQYYVK 233
           QTVIHCGVDPTI EW NDP+NPN++ L++VK+F L+E+PILPP YMG       C YYVK
Sbjct: 173 QTVIHCGVDPTIAEWKNDPTNPNFETLRDVKSFVLEEEPILPPMYMGPKPPTHKCWYYVK 232

Query: 234 LRPGLQEFFDKVAPHFELHIYTMATRAYALEIAKIIDPTSALFGDRILSRDENGSLTHKS 293
           +RPGL+EFF++V+  +E+HIYTMATR+YA EIAKIIDP   LF DRILSR+ENGSLTHKS
Sbjct: 233 IRPGLKEFFEEVSKLYEMHIYTMATRSYAQEIAKIIDPDGTLFADRILSRNENGSLTHKS 292

Query: 294 LERLFPMDQSMVVIIDDRGDVWSWCENLIKVVPYNFFVGVGDINSNFLPRQQNSMLHMGR 353
           LERLFP DQSMVV+IDDRGDVW+WC NLIKV PYNFFVG+GDINSNFLPRQQ +ML +GR
Sbjct: 293 LERLFPTDQSMVVVIDDRGDVWNWCPNLIKVTPYNFFVGIGDINSNFLPRQQTTMLQLGR 352

Query: 354 RHRKKAEE-EELLTDIMDTEKKLQEKIDQEVKKQEEKFNKISEE--NQPDRSMSKEDLTK 410
           R+ KK E+ +ELLTDIMDTEKKLQEKID+EVK+QEE  +  S     +    + KED+TK
Sbjct: 353 RNHKKTEDTDELLTDIMDTEKKLQEKIDEEVKRQEENLSHQSAALGEEISSQVRKEDITK 412

Query: 411 KLEHNASLEVQQQNRPLAELQKHMNNQKLLIDDDDELPHLSEILLNVHRTYYEELAKTEV 470
           K+E +ASLEVQQQNRPLAELQKHM+NQ+LL DDDDEL +L +IL NV + YYEEL KT+ 
Sbjct: 413 KIEFSASLEVQQQNRPLAELQKHMHNQQLLTDDDDELFYLKDILKNVQQKYYEEL-KTDK 471

Query: 471 FPDIKLLMPQMKAKVFAQCHFVFSGLIPLGTNIRHADIVLWTNMFGAQTSSDIDENTTHV 530
              I+ LMP++K KV   C+FVFSGLIPLGTNI+ ADIVLWTNMFGAQ+S+DI E+TTHV
Sbjct: 472 EIQIQTLMPKLKKKVLEGCNFVFSGLIPLGTNIQKADIVLWTNMFGAQSSADITEDTTHV 531

Query: 531 ITKTPGTFKARLAKSYNPDIKIVHPDWIFECLVKWVRADEKPYELIIEQEVSSDELEEFQ 590
           ITKTP T+KA++AK++  DIK++HPDW+FECL+ W    E PYE  I    +  EL EF+
Sbjct: 532 ITKTPHTYKAKIAKAFKSDIKVLHPDWVFECLLNWKYMPEFPYEYNIIPTATDKELNEFK 591

Query: 591 RNL 593
             L
Sbjct: 592 EAL 594

>TPHA0I00240 Chr9 (43854..46052) [2199 bp, 732 aa] {ON} Anc_8.839
           YMR277W
          Length = 732

 Score =  739 bits (1908), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 367/614 (59%), Positives = 450/614 (73%), Gaps = 26/614 (4%)

Query: 1   MTTPIRLPPNLPFPITIAKLYVSKGESVTKGQRLFVYKYWELQDVITAPNE--------- 51
           M TP++ P  +P+PITI+KL    G  + KG RLF YK+W L ++  +P+E         
Sbjct: 1   MATPVKFPDGMPYPITISKLIAPVGSYINKGDRLFAYKFWYLVEIAKSPDELDVNGNVQD 60

Query: 52  -EASKKKRRVDLIGTFDSPIEGTLVSLKVRVGDEFVNDSNIIAELRQPCSHEVTYGALCV 110
            E SKK  R + I  FD+P EGT++   V VGDE V    I+ E+++PC H++ Y  +C 
Sbjct: 61  GEQSKKTIR-ESIDFFDAPFEGTIIGWNVDVGDEIVEPGRIVCEVKRPCDHDIVYAGICT 119

Query: 111 VCGKAVDEDDSNMSGSGVSNGKLTVAHNNTNIKVSERQAASIEKTAQKELRERKKLVLVV 170
           +CGK VDE D         +  LT++H +TN+KVS ++A +I +T +  L   KKL+LVV
Sbjct: 120 MCGKEVDERDQ-------VSANLTISHTDTNLKVSRQEANNIGQTNKSRLIRSKKLILVV 172

Query: 171 DLDQTVIHCGVDPTIKEWANDPSNPNYDALKNVKTFSLDEDPILPPFYMGXXXXXXXCQY 230
           DLDQTVIHCGVDPTI EW NDPSNPNY+ L+NVK+F L+E+ ILPP YMG       C Y
Sbjct: 173 DLDQTVIHCGVDPTISEWKNDPSNPNYETLRNVKSFVLEEEAILPPMYMGPKPPVHKCSY 232

Query: 231 YVKLRPGLQEFFDKVAPHFELHIYTMATRAYALEIAKIIDPTSALFGDRILSRDENGSLT 290
           YVK+RPGL+EFF+KVAP +E+HIYTMATRAYA EIAKIIDP  +LFG+RILSRDENGSLT
Sbjct: 233 YVKVRPGLKEFFEKVAPIYEMHIYTMATRAYAEEIAKIIDPDGSLFGNRILSRDENGSLT 292

Query: 291 HKSLERLFPMDQSMVVIIDDRGDVWSWCENLIKVVPYNFFVGVGDINSNFLPRQQNSMLH 350
           HKSLERLFP DQSMVVIIDDRGDVW+W  NLIKV PYNFFVG+GDINSNFLPRQQ +ML 
Sbjct: 293 HKSLERLFPTDQSMVVIIDDRGDVWNWSPNLIKVTPYNFFVGIGDINSNFLPRQQATMLQ 352

Query: 351 MGRRHRK---KAEEEELLTDIMDTEKKLQEKIDQEVKKQEEKFNKISEE--NQPDRSMSK 405
           MGRR+     + E EELLTDI+DTEKKLQEKID+EVK+QE      S     +    +  
Sbjct: 353 MGRRNHNAEKEKESEELLTDIIDTEKKLQEKIDKEVKRQEADLTHKSAALGEEAVAQVRN 412

Query: 406 EDLTKKLEHNASLEVQQQNRPLAELQKHMNNQKLLIDDDDELPHLSEILLNVHRTYYEEL 465
            D+TKK+E +ASLEVQQQNRPLAELQKHM+NQ+LL DDDDEL +L EIL  V   +Y+ L
Sbjct: 413 GDITKKIEFSASLEVQQQNRPLAELQKHMHNQQLLRDDDDELSYLKEILATVQSEFYKAL 472

Query: 466 AKTEVFPD---IKLLMPQMKAKVFAQCHFVFSGLIPLGTNIRHADIVLWTNMFGAQTSSD 522
                  D   I+ LMP++K  VF  C+FVFSGLIPLGT+I+ ADIVLWT MFGA ++S+
Sbjct: 473 ELKNGNSDDTSIQELMPKLKRSVFKDCNFVFSGLIPLGTDIQKADIVLWTKMFGASSTSN 532

Query: 523 IDENTTHVITKTPGTFKARLAKSYNPDIKIVHPDWIFECLVKWVRADEKPYELIIEQEVS 582
           I ENTTHVITKTPGT KAR+AKS+NP IK+VHPDW+FECL  W   DEK +EL ++Q  S
Sbjct: 533 ITENTTHVITKTPGTLKARIAKSFNPSIKVVHPDWVFECLSTWKHVDEKSFELKVDQVAS 592

Query: 583 SDELEEFQRNLKKR 596
             ELEEF++NL+KR
Sbjct: 593 ERELEEFKKNLEKR 606

>TBLA0D03260 Chr4 (810350..812656) [2307 bp, 768 aa] {ON} Anc_8.839
           YMR277W
          Length = 768

 Score =  737 bits (1902), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/667 (55%), Positives = 476/667 (71%), Gaps = 70/667 (10%)

Query: 1   MTTPIRLPPNLPFPITIAKLYVSKGESVTKGQRLFVYKYWELQDVITAPNEEASKKKRRV 60
           M+TP+  P +LPFPITI +L    G  V KGQRLF YK+W + ++  +P+      +   
Sbjct: 1   MSTPVLSPADLPFPITIDQLITPIGSHVEKGQRLFAYKFWYMVEIAQSPDNNDPTSENSS 60

Query: 61  DLIGT------------------------FDSPIEGTLVSLKVRVGDEFVNDSNIIAELR 96
           DL G                         F+SP EG L+   V  GDE ++++ ++ +++
Sbjct: 61  DLSGNNSDSNENGNNASHQKKSIRESIEFFESPFEGDLIGWNVDKGDEIISENQLLCDIK 120

Query: 97  QPCSHEVTYGALCVVCGKAVDEDDSNMSGSGVSNGKLTVAHNNTNIKVSERQAASIEKTA 156
           +PC+H++ Y  +C  CGK VD+ D       + +  L+++H +TN+K+S ++A  I++++
Sbjct: 121 RPCNHDIVYAGICTQCGKEVDDSD-------IMDASLSISHTDTNLKISRKEARDIDQSS 173

Query: 157 QKELRERKKLVLVVDLDQTVIHCGVDPTIKEWANDPSNPNYDALKNVKTFSLDEDPILPP 216
              L++ KKL+LVVDLDQTVIHCGVDPTI EW NDP NPNY+ LK+V++FSLDE+PILPP
Sbjct: 174 MSRLKKIKKLILVVDLDQTVIHCGVDPTIGEWKNDPKNPNYETLKDVRSFSLDEEPILPP 233

Query: 217 FYMGXXXXXXXCQYYVKLRPGLQEFFDKVAPHFELHIYTMATRAYALEIAKIIDPTSALF 276
            YMG       C YYVK+RPGL+EFF K+AP +E+HIYTMATRAYALEIAKIIDP  +LF
Sbjct: 234 SYMGPRPPVRKCWYYVKVRPGLKEFFAKIAPLYEMHIYTMATRAYALEIAKIIDPDGSLF 293

Query: 277 GDRILSRDENGSLTHKSLERLFPMDQSMVVIIDDRGDVWSWCENLIKVVPYNFFVGVGDI 336
           G RILSRDENGSLT KSLERLFP DQSMV+IIDDRGDVW+WC NLIKV+PYNFFVG+GDI
Sbjct: 294 GSRILSRDENGSLTQKSLERLFPTDQSMVIIIDDRGDVWNWCNNLIKVIPYNFFVGIGDI 353

Query: 337 NSNFLPRQQNSMLHMG-RRHRKKA----------------------EEEELLTDIMDTEK 373
           NSNFLPRQQ++ML +G R H+KK                       + EELLTDIMDTEK
Sbjct: 354 NSNFLPRQQSTMLQLGIRSHKKKNTNETLNSEDDKSDSTLSVHEKDKTEELLTDIMDTEK 413

Query: 374 KLQEKIDQEVKKQEEKFNKISEENQPDRSMSKE----DLTKKLEHNASLEVQQQNRPLAE 429
           KLQ+KID+EV++QE+K   I +E    +S+S E    +L+KK+E +ASLEVQQQNRPLA 
Sbjct: 414 KLQKKIDEEVRRQEKKL--IKDEMPKRKSISDESSNNELSKKIEFSASLEVQQQNRPLAT 471

Query: 430 LQKHMNNQKLLIDDDDELPHLSEILLNVHRTYYEEL--AKTEVFPDIKLLMPQMKAKVFA 487
           LQ+H  NQ+LLIDDDDEL +L +IL  VH T+YE+L   K E    I+ LMP++K  VF+
Sbjct: 472 LQRHRQNQRLLIDDDDELFYLKDILTEVHDTFYEQLDEDKNESV-SIQTLMPRLKFSVFS 530

Query: 488 QCHFVFSGLIPLGTNIRHADIVLWTNMFGAQTSSDIDENTTHVITKTPGTFKARLAKSYN 547
             +FVFSGLIPLGT+IR ADIVLWTNMFGA +++DIDENTTHVITKT GT+KARLAK++N
Sbjct: 531 GYNFVFSGLIPLGTDIRRADIVLWTNMFGANSTADIDENTTHVITKTAGTYKARLAKAFN 590

Query: 548 PDIKIVHPDWIFECLVKWVRADEKPYELIIEQEVSSDELEEFQRN-------LKKRQMAE 600
           P+IK+VHPDWIFECLV W R  EKPYELIIEQ  S +ELEEF++        L+KR+M  
Sbjct: 591 PEIKVVHPDWIFECLVSWKRMPEKPYELIIEQPASEEELEEFKKKLELKNELLEKREMET 650

Query: 601 KAARESL 607
           +A  E+L
Sbjct: 651 EAQFEAL 657

>YMR277W Chr13 (820256..822454) [2199 bp, 732 aa] {ON}
           FCP1Carboxy-terminal domain (CTD) phosphatase, essential
           for dephosphorylation of the repeated C-terminal domain
           of the RNA polymerase II large subunit (Rpo21p)
          Length = 732

 Score =  718 bits (1854), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 364/647 (56%), Positives = 463/647 (71%), Gaps = 35/647 (5%)

Query: 1   MTTPIRLPPNLPFPITIAKLYVSKGESVTKGQRLFVYKYWEL-------------QDVI- 46
           MTT IR P  LP+PI I KL  S G  + +G RL VYK+W L              DV  
Sbjct: 1   MTTQIRSPQGLPYPIQIDKLIPSVGSYLHEGDRLLVYKFWYLVERASDTGDDDNEHDVSP 60

Query: 47  ---TAPNEEASKKKRRVDLIGTFDSPIEGTLVSLKVRVGDEFVNDSNIIAELRQPCSHEV 103
                 N  +   K+  + I  F+SP EG L+S  V VGDE    + +I E+++PC+H++
Sbjct: 61  GGSAGSNGVSPPTKQLRESIEFFESPYEGDLISWNVDVGDEVATANQVICEIKRPCNHDI 120

Query: 104 TYGALCVVCGKAVDEDDSNMSGSGVSNGKLTVAHNNTNIKVSERQAASIEKTAQKELRER 163
            YG LC  CGK V  D    +  GV    L V   + ++++SE +A    K  ++ LR  
Sbjct: 121 VYGGLCTQCGKEVSAD----AFDGVP---LDVV-GDVDLQISETEAIRTGKALKEHLRRD 172

Query: 164 KKLVLVVDLDQTVIHCGVDPTIKEWANDPSNPNYDALKNVKTFSLDEDPILPPFYMGXXX 223
           KKL+LVVDLDQT+IHCGVDPTI EW NDP+NPN++ L++VK+F+LDE+ +LP  YM    
Sbjct: 173 KKLILVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNDDG 232

Query: 224 XX------XXCQYYVKLRPGLQEFFDKVAPHFELHIYTMATRAYALEIAKIIDPTSALFG 277
                     C YYVK+RPGL+EFF KVAP FE+HIYTMATRAYAL+IAKI+DPT  LFG
Sbjct: 233 SMLRPPPVRKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGELFG 292

Query: 278 DRILSRDENGSLTHKSLERLFPMDQSMVVIIDDRGDVWSWCENLIKVVPYNFFVGVGDIN 337
           DRILSRDENGSLT KSL +LFP DQSMVV+IDDRGDVW+WC NLIKVVPYNFFVGVGDIN
Sbjct: 293 DRILSRDENGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDIN 352

Query: 338 SNFLPRQQNSMLHMGRRHRKKAEE-EELLTDIMDTEKKLQEKIDQEVKKQEEKFN-KISE 395
           SNFLP+Q   ML +GR+ R+K++E +ELLTDIMD EKKLQEKID+EVK+QEEK N +++ 
Sbjct: 353 SNFLPKQSTGMLQLGRKTRQKSQESQELLTDIMDNEKKLQEKIDKEVKRQEEKLNHQLAT 412

Query: 396 ENQPDRSMSKEDLTKKLEHNASLEVQQQNRPLAELQKHMNNQKLLIDDDDELPHLSEILL 455
             +P  + SKE+LTKKLE++ASLEVQQQNRPLA+LQKH+++QKLL+DDDDEL +L   L 
Sbjct: 413 AEEPPANESKEELTKKLEYSASLEVQQQNRPLAKLQKHLHDQKLLVDDDDELYYLMGTLS 472

Query: 456 NVHRTYYEELA-KTEVFPDIKLLMPQMKAKVFAQCHFVFSGLIPLGTNIRHADIVLWTNM 514
           N+H+TYY+ L+ + E  P++  ++P +K KVF  C+FVFSGLIPLGT+I+ +DIV+WT+ 
Sbjct: 473 NIHKTYYDMLSQQNEPEPNLMEIIPSLKQKVFQNCYFVFSGLIPLGTDIQRSDIVIWTST 532

Query: 515 FGAQTSSDIDENTTHVITKTPGTFKARLAKSYNPDIKIVHPDWIFECLVKWVRADEKPYE 574
           FGA ++ DID  TTH+ITK P T+KARLAK +NP IKIVHPDWIFECLV W + DEKPY 
Sbjct: 533 FGATSTPDIDYLTTHLITKNPSTYKARLAKKFNPQIKIVHPDWIFECLVNWKKVDEKPYT 592

Query: 575 LIIEQEVSSDELEEFQRNLKKRQMAEKAARESLQQETGEE-LNLLAG 620
           LI++  +S +EL+ FQ  L+KRQ   +  +E     T +E LNL A 
Sbjct: 593 LIVDSPISDEELQNFQTQLQKRQEYLEETQEQQHMLTSQENLNLFAA 639

>Skud_13.449 Chr13 (793592..795796) [2205 bp, 734 aa] {ON} YMR277W
           (REAL)
          Length = 734

 Score =  718 bits (1853), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 361/648 (55%), Positives = 465/648 (71%), Gaps = 36/648 (5%)

Query: 1   MTTPIRLPPNLPFPITIAKLYVSKGESVTKGQRLFVYKYWEL----QDVITAPNEEASKK 56
           MTT IR P  LP+PI I KL  S G  + +G RL VYK+W L     D     + E    
Sbjct: 1   MTTQIRSPEGLPYPIQIDKLVPSVGSYLHEGDRLIVYKFWYLVERASDTTGDDDNEHDAT 60

Query: 57  --------------KRRVDLIGTFDSPIEGTLVSLKVRVGDEFVNDSNIIAELRQPCSHE 102
                         K+  + I  F+SP EG L+S  V VGDE    + +I E+++PC+H+
Sbjct: 61  PGGGAGSGSVSPPTKQLRESIEFFESPYEGDLISWNVDVGDEIATANQVICEIKRPCNHD 120

Query: 103 VTYGALCVVCGKAVDEDDSNMSGSGVSNGKLTVAHNNTNIKVSERQAASIEKTAQKELRE 162
           + YG LC  CGK V  D    +  GV    L V   + ++++SE +A    +  ++ LR 
Sbjct: 121 IVYGGLCTQCGKEVSAD----AFDGVP---LDVV-GDMDLQISETEAIRSGEALKEHLRR 172

Query: 163 RKKLVLVVDLDQTVIHCGVDPTIKEWANDPSNPNYDALKNVKTFSLDEDPILPPFYMGXX 222
            KKL+LVVDLDQT+IHCGVDPTI EW NDP+NPN++ L++VK+F+LDE+ +LP  YM   
Sbjct: 173 DKKLILVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNED 232

Query: 223 XXX------XXCQYYVKLRPGLQEFFDKVAPHFELHIYTMATRAYALEIAKIIDPTSALF 276
                      C YYVK+RPGL+EFFDKVAP FE+HIYTMATRAYA++IAKI+DPT  LF
Sbjct: 233 GSVLKPPPVRKCWYYVKVRPGLKEFFDKVAPLFEMHIYTMATRAYAIQIAKIVDPTGELF 292

Query: 277 GDRILSRDENGSLTHKSLERLFPMDQSMVVIIDDRGDVWSWCENLIKVVPYNFFVGVGDI 336
           GDRILSRDENGSLT KSL +LFP DQSMVV+IDDRGDVW+WC NLIKVVPYNFFVGVGDI
Sbjct: 293 GDRILSRDENGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDI 352

Query: 337 NSNFLPRQQNSMLHMGRRHRKKAEE-EELLTDIMDTEKKLQEKIDQEVKKQEEKFN-KIS 394
           NSNFLP+Q   ML +GR+ R+K++E +ELLTDIMD EKKLQEKID+EVK+QEEK N +++
Sbjct: 353 NSNFLPKQSTGMLQLGRKTRQKSQESQELLTDIMDNEKKLQEKIDKEVKRQEEKLNHQLA 412

Query: 395 EENQPDRSMSKEDLTKKLEHNASLEVQQQNRPLAELQKHMNNQKLLIDDDDELPHLSEIL 454
              +P  + SKE+LTKKLE++ASLEVQQQNRPLA+LQKH+++QKLL+DDDDEL +L   L
Sbjct: 413 TAEEPSANESKEELTKKLEYSASLEVQQQNRPLAKLQKHLHDQKLLVDDDDELYYLMGTL 472

Query: 455 LNVHRTYYEELAKT-EVFPDIKLLMPQMKAKVFAQCHFVFSGLIPLGTNIRHADIVLWTN 513
            N+H TYY+ ++++ E  P++  ++P +K KVF  CHFVFSGLIPLGT+I+ +DIV+WT+
Sbjct: 473 SNIHNTYYQMISQSNEPEPNLMEIIPSLKQKVFQNCHFVFSGLIPLGTDIQRSDIVIWTS 532

Query: 514 MFGAQTSSDIDENTTHVITKTPGTFKARLAKSYNPDIKIVHPDWIFECLVKWVRADEKPY 573
            FGA ++SDID  TTH+ITK P T+KARLAK +NP+IKI+HPDWIFECLV W + DEKPY
Sbjct: 533 TFGATSTSDIDYLTTHLITKNPSTYKARLAKKFNPEIKIIHPDWIFECLVNWKKVDEKPY 592

Query: 574 ELIIEQEVSSDELEEFQRNLKKRQ-MAEKAARESLQQETGEELNLLAG 620
            LI++  +S +EL+ FQ+ L+KRQ   E+  ++       E LNL A 
Sbjct: 593 TLIVDSPISDEELQNFQKQLQKRQEYLEENQQQQHMLTPQENLNLFAA 640

>Suva_13.465 Chr13 (802947..805145) [2199 bp, 732 aa] {ON} YMR277W
           (REAL)
          Length = 732

 Score =  717 bits (1852), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 352/622 (56%), Positives = 456/622 (73%), Gaps = 33/622 (5%)

Query: 1   MTTPIRLPPNLPFPITIAKLYVSKGESVTKGQRLFVYKYWELQD---------------- 44
           MTT IR P  LP+PI I KL  S G  + +G RL VYK+W L +                
Sbjct: 1   MTTQIRSPEGLPYPIQIDKLIPSVGSFLQEGDRLLVYKFWYLVERPSDAGDDDNDHDSSP 60

Query: 45  VITAPNEEASKKKRRVDLIGTFDSPIEGTLVSLKVRVGDEFVNDSNIIAELRQPCSHEVT 104
                   +   K+  + I  F+SP EG L+S  V VGDE    + +I E+++PC+H++ 
Sbjct: 61  GGGGGGSVSPPTKQLRESIEFFESPYEGDLISWNVDVGDEIATANQVICEIKRPCNHDIV 120

Query: 105 YGALCVVCGKAVDEDDSNMSGSGVSNGKLTVAHNNTNIKVSERQAASIEKTAQKELRERK 164
           YG LC  CGK V  D    +  GV    L V   + ++++SE +A    +  ++ LR  K
Sbjct: 121 YGGLCTQCGKEVSAD----AFDGVP---LDVV-GDMDLQISETEAIRTGRALKEHLRRDK 172

Query: 165 KLVLVVDLDQTVIHCGVDPTIKEWANDPSNPNYDALKNVKTFSLDEDPILPPFYMGXXXX 224
           KL+LVVDLDQT+IHCGVDPTI EW NDP+NPN++ L++VK+F+LDE+ +LP  YM     
Sbjct: 173 KLILVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMAEDGS 232

Query: 225 X------XXCQYYVKLRPGLQEFFDKVAPHFELHIYTMATRAYALEIAKIIDPTSALFGD 278
                    C YYVK+RPGL+EFF KVAP FE+HIYTMATRAYAL+IAKI+DPT  LFGD
Sbjct: 233 VPKPPPVRKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGELFGD 292

Query: 279 RILSRDENGSLTHKSLERLFPMDQSMVVIIDDRGDVWSWCENLIKVVPYNFFVGVGDINS 338
           RILSRDENGSLT KSL +LFP DQSMVV+IDDRGDVW+WC NLIKVVPYNFFVGVGDINS
Sbjct: 293 RILSRDENGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINS 352

Query: 339 NFLPRQQNSMLHMGRRHRKKAEE-EELLTDIMDTEKKLQEKIDQEVKKQEEKFN-KISEE 396
           NFLP+Q   ML +GR+ R+K++E +EL+TDIMD EKKLQEKID EVK+QEE+ N +++  
Sbjct: 353 NFLPKQSTGMLQLGRKTRQKSQESQELITDIMDNEKKLQEKIDIEVKRQEEQLNHQLATA 412

Query: 397 NQPDRSMSKEDLTKKLEHNASLEVQQQNRPLAELQKHMNNQKLLIDDDDELPHLSEILLN 456
            +P  + SKE+LTKKLE++ASLEVQQQNRPLA+LQKH+++QKLL+DDDDEL +L   LLN
Sbjct: 413 EEPSANESKEELTKKLEYSASLEVQQQNRPLAKLQKHLHDQKLLVDDDDELHYLMSTLLN 472

Query: 457 VHRTYYEELAK-TEVFPDIKLLMPQMKAKVFAQCHFVFSGLIPLGTNIRHADIVLWTNMF 515
           +H+TYY+ L++  E+ P++  ++P +K KVF  C+FVFSGLIPLGT+I+ +DIV+WT+ F
Sbjct: 473 IHKTYYQMLSQPGEIEPNLMEIIPSLKQKVFQNCYFVFSGLIPLGTDIQRSDIVIWTSTF 532

Query: 516 GAQTSSDIDENTTHVITKTPGTFKARLAKSYNPDIKIVHPDWIFECLVKWVRADEKPYEL 575
           GA ++SDI+  TTH+ITK PGT+KARLAK +NP+IK+VHPDWIFECLV W + DEKPY L
Sbjct: 533 GATSTSDINYLTTHLITKNPGTYKARLAKKFNPEIKVVHPDWIFECLVNWKKVDEKPYTL 592

Query: 576 IIEQEVSSDELEEFQRNLKKRQ 597
           I++  +S DEL+ FQ+ L+K+Q
Sbjct: 593 IVDSPISDDELQSFQKQLQKKQ 614

>Smik_13.490 Chr13 (803288..805486) [2199 bp, 732 aa] {ON} YMR277W
           (REAL)
          Length = 732

 Score =  717 bits (1851), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 363/646 (56%), Positives = 463/646 (71%), Gaps = 35/646 (5%)

Query: 1   MTTPIRLPPNLPFPITIAKLYVSKGESVTKGQRLFVYKYWELQDVIT------------- 47
           MTT IR P  LP+PI I KL  S G  + +G RL VYK+W L +  +             
Sbjct: 1   MTTQIRSPEGLPYPIQIDKLIPSVGSYLHEGDRLLVYKFWYLVERASETGVDDNEHDASP 60

Query: 48  ----APNEEASKKKRRVDLIGTFDSPIEGTLVSLKVRVGDEFVNDSNIIAELRQPCSHEV 103
                 N  +   K+  + I  F+SP EG L+S  V VGDE    + +I E+++PC+H++
Sbjct: 61  GGGAGSNGVSPPTKQLRESIEFFESPYEGDLISWNVDVGDEVATANQVICEIKRPCNHDI 120

Query: 104 TYGALCVVCGKAVDEDDSNMSGSGVSNGKLTVAHNNTNIKVSERQAASIEKTAQKELRER 163
            YG LC  CGK V  D    +  GV    L V   + ++++SE +A    K  ++ LR  
Sbjct: 121 VYGGLCTQCGKEVSAD----AFDGVP---LDVV-GDMDLQISETEAIRTGKALKEHLRRD 172

Query: 164 KKLVLVVDLDQTVIHCGVDPTIKEWANDPSNPNYDALKNVKTFSLDEDPILPPFYMGXXX 223
           KKL+LVVDLDQT+IHCGVDPTI EW NDP+NPN++ L++VK+F+LDE+ +LP  YM    
Sbjct: 173 KKLILVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNEDG 232

Query: 224 XX------XXCQYYVKLRPGLQEFFDKVAPHFELHIYTMATRAYALEIAKIIDPTSALFG 277
                     C YYVK+RPGL+EFF KVAP FE+HIYTMATRAYAL+IAKI+DPT  LFG
Sbjct: 233 SVLRPPPVRKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGKLFG 292

Query: 278 DRILSRDENGSLTHKSLERLFPMDQSMVVIIDDRGDVWSWCENLIKVVPYNFFVGVGDIN 337
           DRILSRDENGSLT KSL +LFP DQSMVV+IDDRGDVW+WC NLIKVVPYNFFVGVGDIN
Sbjct: 293 DRILSRDENGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDIN 352

Query: 338 SNFLPRQQNSMLHMGRRHRKKAEE-EELLTDIMDTEKKLQEKIDQEVKKQEEKFN-KISE 395
           SNFLP+Q   ML +GR+ R+K++E +ELLTDIMD EKKLQEKID+EVK+QEEK N +++ 
Sbjct: 353 SNFLPKQSTGMLQLGRKTRQKSQESQELLTDIMDNEKKLQEKIDKEVKRQEEKLNHQLAT 412

Query: 396 ENQPDRSMSKEDLTKKLEHNASLEVQQQNRPLAELQKHMNNQKLLIDDDDELPHLSEILL 455
             +P  + SKE+LTKKLE++ASLEVQQQNRPLA+LQKH+++QKLL+DDDDEL +L   L 
Sbjct: 413 AEEPPANESKEELTKKLEYSASLEVQQQNRPLAKLQKHLHDQKLLVDDDDELYYLMGTLS 472

Query: 456 NVHRTYYEELAK-TEVFPDIKLLMPQMKAKVFAQCHFVFSGLIPLGTNIRHADIVLWTNM 514
           N+H TYY+ L++  E  P++  ++P +K KVF  C FVFSGLIPLGT+I+ +DIV+WT+ 
Sbjct: 473 NIHMTYYQMLSQENEPEPNLMEIIPSLKQKVFQNCFFVFSGLIPLGTDIQRSDIVIWTST 532

Query: 515 FGAQTSSDIDENTTHVITKTPGTFKARLAKSYNPDIKIVHPDWIFECLVKWVRADEKPYE 574
           FGA ++SDID  TTH+ITK P T+KARLAK +NP+IKIVHPDWIFECLV W + DEKPY 
Sbjct: 533 FGATSTSDIDFLTTHLITKNPSTYKARLAKKFNPEIKIVHPDWIFECLVNWKKVDEKPYT 592

Query: 575 LIIEQEVSSDELEEFQRNLKKRQMAEKAARESLQQETGEE-LNLLA 619
           LI++  +S +EL+ FQ  L+KRQ   +  +E     T +E LNL A
Sbjct: 593 LIVDSPISDEELQNFQSQLQKRQEYLEENQEQQHMLTSQENLNLFA 638

>NDAI0K00420 Chr11 complement(94101..96437) [2337 bp, 778 aa] {ON}
           Anc_8.839 YMR277W
          Length = 778

 Score =  714 bits (1843), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 348/578 (60%), Positives = 434/578 (75%), Gaps = 24/578 (4%)

Query: 63  IGTFDSPIEGTLVSLKVRVGDEFVNDSNIIAELRQPCSHEVTYGALCVVCGKAVDEDDSN 122
           I  FD P +G L S  V  GD+ V  +  + E+++PC+H+V YG LC +CGK VDE+D +
Sbjct: 113 IEFFDCPYDGILTSWLVEKGDQIVGPNQPLCEIQRPCNHDVIYGGLCTLCGKEVDENDID 172

Query: 123 MSGSGVSNGKLTVAHNNTNIKVSERQAASIEKTAQKELRERKKLVLVVDLDQTVIHCGVD 182
                +S   LT++H +TN+K+S R+A  I ++ +K LR+ KKL+LVVDLDQTVIHCGVD
Sbjct: 173 ----DLSGPNLTISHTDTNLKISTREAVDIGQSVKKRLRDDKKLILVVDLDQTVIHCGVD 228

Query: 183 PTIKEWANDPSNPNYDALKNVKTFSLDEDPILPPFYMGXXXXXXXCQYYVKLRPGLQEFF 242
           PTI EW  DP+NPN++ LK+VK F+L+E+PILP  YMG       C YYVK+RPGL++FF
Sbjct: 229 PTIGEWKRDPTNPNFETLKDVKEFALEEEPILPLMYMGPKPPARKCWYYVKVRPGLKDFF 288

Query: 243 DKVAPHFELHIYTMATRAYALEIAKIIDPTSALFGDRILSRDENGSLTHKSLERLFPMDQ 302
            KVAP FE+HIYTMATRAYA EIAKIIDPT  LFG+RILSRDENGSLT KSLERLFP DQ
Sbjct: 289 QKVAPLFEMHIYTMATRAYASEIAKIIDPTGDLFGNRILSRDENGSLTTKSLERLFPTDQ 348

Query: 303 SMVVIIDDRGDVWSWCENLIKVVPYNFFVGVGDINSNFLPRQQNSMLHMGRRHRK----- 357
           SMV+IIDDRGDVW+W  NLIKV+PYNFFVGVGDINSNFLP+QQ +ML +GRR  +     
Sbjct: 349 SMVIIIDDRGDVWNWSPNLIKVIPYNFFVGVGDINSNFLPKQQATMLQLGRRSSRGESKV 408

Query: 358 -KAEEEELLTDIMDTEKKLQEKIDQEVKKQEEKFN---KISEENQPDRSMSKEDLTKKLE 413
              E ++LLTDIMDTEK LQ KI++EVK+QEEK N      EE       +KE+++KK+E
Sbjct: 409 STKENDDLLTDIMDTEKVLQRKINEEVKRQEEKLNHQLATIEEPPTTAGENKEEISKKIE 468

Query: 414 HNASLEVQQQNRPLAELQKHMNNQKLLIDDDDELPHLSEILLNVHRTYYEELAKT----- 468
           ++ASLEVQQ+NRPLA LQKH ++Q+LLIDDD+EL HL + L  +H  YYE L K      
Sbjct: 469 YSASLEVQQKNRPLATLQKHFHDQRLLIDDDEELYHLKDTLSKIHSKYYEMLQKANENKD 528

Query: 469 EVFPDIKLLMPQMKAKVFAQCHFVFSGLIPLGTNIRHADIVLWTNMFGAQTSSDIDENTT 528
            + PDIK +MPQMK  V   CHFVFSGLIPLGTNI+ +DIV+WTNMFGA++++DIDENTT
Sbjct: 529 SIEPDIKYIMPQMKQTVLQDCHFVFSGLIPLGTNIQKSDIVIWTNMFGARSTADIDENTT 588

Query: 529 HVITKTPGTFKARLAKSYNPDIKIVHPDWIFECLVKWVRADEKPYELIIEQEVSSDELEE 588
           HVITKTPGT+KARLAKSY+PDIKIVHPDW+FECL++W   +EKPYEL++EQ VS  EL +
Sbjct: 589 HVITKTPGTYKARLAKSYDPDIKIVHPDWVFECLMRWKHVEEKPYELLVEQLVSDKELAD 648

Query: 589 FQRNLKKRQMAEKAARESLQQETGE------ELNLLAG 620
           F R L++R    +   E L  +  +      E+NL AG
Sbjct: 649 FNRKLERRIQLSELKDEGLYNKLPDGNIDINEVNLFAG 686

 Score = 48.1 bits (113), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 32/53 (60%), Gaps = 2/53 (3%)

Query: 1  MTTP--IRLPPNLPFPITIAKLYVSKGESVTKGQRLFVYKYWELQDVITAPNE 51
          M TP  IR P  LP+PITI +L    G  + K  RL  YK+W + ++ T+P+E
Sbjct: 1  MATPTVIRAPLGLPYPITIDELMKPIGTEMNKDDRLLAYKFWYVVEIATSPDE 53

>KNAG0J00280 Chr10 complement(41831..44059) [2229 bp, 742 aa] {ON}
           Anc_8.839 YMR277W
          Length = 742

 Score =  707 bits (1826), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/629 (56%), Positives = 460/629 (73%), Gaps = 27/629 (4%)

Query: 3   TPIRLPPNLPFPITIAKLYVSKGESVTKGQRLFVYKYW---ELQDVITAPNEEA-----S 54
           TP+     LP+P+T+ +L    G+ V++G RLF YK+W   EL  V  A   ++     +
Sbjct: 7   TPVVSGAGLPYPVTVDELIPQVGDRVSRGDRLFAYKFWYVVELAGVDAAAEGDSDGTGTT 66

Query: 55  KKKRRVDLIGTFDSPIEGTLVSLKVRVGDEFVNDSNIIAELRQPCSHEVTYGALCVVCGK 114
            KK   + +  F+SP EGT+VS  V  GDE       +  LR+PC+H+V Y  LC +CG+
Sbjct: 67  AKKSVRESVEFFESPFEGTVVSWDVDAGDEIPGPGAPLCLLRRPCNHDVVYNGLCTLCGR 126

Query: 115 AVDEDD--SNMSGSGVSNGKLTVAHNNTNIKVSERQAASIEKTAQKELRERKKLVLVVDL 172
            VDE +  +  + SG     LTV+H +TN+++S  +A  ++   Q+ LR  +KLVLVVDL
Sbjct: 127 EVDEYEIQAAAAASGGVGPNLTVSHRDTNLQISRVEAQQLDLQLQQRLRAAQKLVLVVDL 186

Query: 173 DQTVIHCGVDPTIKEWANDPSNPNYDALKNVKTFSLDEDPILPPFYMGXXXXX-XXCQYY 231
           DQTV+HCGVDPTI EW  DP NPNY+AL++V++F+L+E+PILP  Y+G        C YY
Sbjct: 187 DQTVVHCGVDPTIGEWKRDPRNPNYEALRDVQSFALEEEPILPFLYVGGKRPAPRKCWYY 246

Query: 232 VKLRPGLQEFFDKVAPHFELHIYTMATRAYALEIAKIIDPTSALFGDRILSRDENGSLTH 291
           VK+RPGL++FF ++AP FE+HIYTMATRAYALEIAKIIDP  +LFGDRILSRDENGSLTH
Sbjct: 247 VKVRPGLKQFFKRLAPLFEMHIYTMATRAYALEIAKIIDPDKSLFGDRILSRDENGSLTH 306

Query: 292 KSLERLFPMDQSMVVIIDDRGDVWSWCENLIKVVPYNFFVGVGDINSNFLPRQQNSMLHM 351
           KSLERLFP DQSMV +IDDRGDVW+WC NLIKVVPYNFFVGVGDINSNFLP+QQ +ML M
Sbjct: 307 KSLERLFPTDQSMVTVIDDRGDVWNWCANLIKVVPYNFFVGVGDINSNFLPKQQPTMLQM 366

Query: 352 GRR-------HRKKAEEEE-----LLTDIMDTEKKLQEKIDQEVKKQEEKFNK--ISEEN 397
           GRR       H  K ++++     LLTDIM+TEK+LQEKIDQEVK+QE K NK   + + 
Sbjct: 367 GRRSKLNERGHESKQQQDDVKDDLLLTDIMNTEKQLQEKIDQEVKRQEHKLNKGNAAGDE 426

Query: 398 QPDRSMSKEDLTKKLEHNASLEVQQQNRPLAELQKHMNNQKLLIDDDDELPHLSEILLNV 457
           Q     SKE+ TKKLE +AS+EVQQ+NRPLA LQKH++NQKLL+D+DDEL +L + L ++
Sbjct: 427 QQTPGQSKEEWTKKLEFSASVEVQQKNRPLATLQKHLHNQKLLVDNDDELFYLKDRLADL 486

Query: 458 HRTYYEELAKTEVFPDIKLLMPQMKAKVFAQCHFVFSGLIPLGTNIRHADIVLWTNMFGA 517
           H+ YY  L +     +I+ +M Q+K +VF  CHFVFSGLIPL TN++ ADIV+WTN FGA
Sbjct: 487 HKRYYSTLKENPQDTNIQSIMTQLKTRVFQDCHFVFSGLIPLNTNVQAADIVIWTNKFGA 546

Query: 518 QTSSDIDENTTHVITKTPGTFKARLAKSYNPDIKIVHPDWIFECLVKWVRADEKPYELII 577
            T++D+DE TTH+ITKTPGT KARLAK++NPDIKIVHPDWIFECL+KW R D KPY LI+
Sbjct: 547 TTTNDLDETTTHLITKTPGTNKARLAKAFNPDIKIVHPDWIFECLIKWERVDVKPYLLIV 606

Query: 578 EQEVSSDELEEFQRNLKKRQMAEKAARES 606
           E  VS  ++ EF+  L +++  E+A R++
Sbjct: 607 EDPVSEAQVREFKEKLTRQK--ERAERQT 633

>TPHA0E03070 Chr5 (644651..646135) [1485 bp, 494 aa] {ON} Anc_5.202
           YLL010C
          Length = 494

 Score = 41.6 bits (96), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 32/147 (21%), Positives = 58/147 (39%), Gaps = 35/147 (23%)

Query: 142 IKVSERQAASIEKTAQKEL-------RERKKLVLVVDLDQTVIHCGVDPTIKEWANDPSN 194
           I +S+ QA  +  T  + L       R  +K  L++DLD+T++H                
Sbjct: 293 IDLSKLQANQVSATGYETLLAPKEIKRFGRKKCLILDLDETLVHS--------------- 337

Query: 195 PNYDALKNVKTFSLDEDPILPPFYMGXXXXXXXCQYYVKLRPGLQEFFDKVAPHFELHIY 254
               + K V +           F +           YV  RPG+ EF  +V+  +E+ ++
Sbjct: 338 ----SFKYVDS---------ADFVIPVTIDNQTHHVYVIKRPGVDEFLKRVSELYEVVVF 384

Query: 255 TMATRAYALEIAKIIDPTSALFGDRIL 281
           T +   Y   +  I+DP + +   R+ 
Sbjct: 385 TASVSRYGDPLLNILDPANTIIHHRLF 411

>Kpol_1010.61 s1010 (148944..151325,151327..151743) [2799 bp, 932
           aa] {ON} (148944..151325,151327..151743) [2799 nt, 933
           aa]
          Length = 932

 Score = 41.2 bits (95), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 46/89 (51%), Gaps = 7/89 (7%)

Query: 502 NIRHADIVLWTNMFGAQTSSDIDENTTHVITKTPG--TFKARLAKSYNPDIKIVHPDWIF 559
           NI +++++   N  G   S  I   TTH+I+  P      A +A   +  IK V+P W+ 
Sbjct: 140 NILYSELI---NALGGSVSDMISNKTTHLISSDPTDPALIAIVASDCHSRIKQVYPAWLC 196

Query: 560 ECLVKWVRADEKPYELIIEQEVSSDELEE 588
           +C ++    DEK +  I++  +S ++ EE
Sbjct: 197 QCFLEVKYVDEKNF--ILDSSLSPEDAEE 223

>NDAI0D01860 Chr4 (437370..438914) [1545 bp, 514 aa] {ON} Anc_5.202
          Length = 514

 Score = 40.8 bits (94), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 32/123 (26%), Positives = 49/123 (39%), Gaps = 28/123 (22%)

Query: 159 ELRERKKLVLVVDLDQTVIHCGVDPTIKEWANDPSNPNYDALKNVKTFSLDEDPILPPFY 218
           E++ + K  LV+DLD+T++H           N P N + D + NV               
Sbjct: 337 EIKFKHKKCLVLDLDETLVHSSFKYLPNADFNLPVNID-DQIHNV--------------- 380

Query: 219 MGXXXXXXXCQYYVKLRPGLQEFFDKVAPHFELHIYTMATRAYALEIAKIIDPTSALFGD 278
                       YV  RPG+ EF +KV   FE+ I+T +   Y   +   +DP       
Sbjct: 381 ------------YVIKRPGVDEFLEKVGKLFEVVIFTASVSRYGDPLLDRLDPKGKSIHH 428

Query: 279 RIL 281
           R+ 
Sbjct: 429 RLF 431

>NCAS0A06800 Chr1 (1346677..1348098) [1422 bp, 473 aa] {ON}
           Anc_5.202
          Length = 473

 Score = 39.7 bits (91), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 28/117 (23%), Positives = 46/117 (39%), Gaps = 28/117 (23%)

Query: 165 KLVLVVDLDQTVIHCGVDPTIKEWANDPSNPNYDALKNVKTFSLDEDPILPPFYMGXXXX 224
           K  LV+DLD+T++H                    + K ++T           F +     
Sbjct: 302 KKCLVLDLDETLVHS-------------------SFKYLQTAD---------FVLPVNID 333

Query: 225 XXXCQYYVKLRPGLQEFFDKVAPHFELHIYTMATRAYALEIAKIIDPTSALFGDRIL 281
                 YV  RPG++EF  +V   FE+ ++T +   Y   +  I+DP   L   R+ 
Sbjct: 334 EQIHNVYVIKRPGVEEFLKRVGELFEVVVFTASVARYGDPLLDILDPGRQLIHHRLF 390

>SAKL0G12870g Chr7 (1100535..1101734) [1200 bp, 399 aa] {ON} similar
           to uniprot|Q07800 Saccharomyces cerevisiae YLL010C
          Length = 399

 Score = 38.9 bits (89), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 31/60 (51%), Gaps = 4/60 (6%)

Query: 231 YVKLRPGLQEFFDKVAPHFELHIYTMATRAYALEIAKIIDPTSA----LFGDRILSRDEN 286
           YV  RPG+ EF ++V   +E+ ++T +   Y   +  I+DP  A    LF D   + D N
Sbjct: 267 YVIKRPGVDEFLERVGKLYEVVVFTASVSRYGDPLLDILDPRGAVHHRLFRDSCYNYDGN 326

>SAKL0G15620g Chr7 (1342049..1344688) [2640 bp, 879 aa] {ON} some
           similarities with uniprot|P38850 Saccharomyces
           cerevisiae YHR154W RTT107 Regulator of Ty1 Transposition
           Establishes Silent Chromatin involved in silencing
          Length = 879

 Score = 38.9 bits (89), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 35/168 (20%), Positives = 76/168 (45%), Gaps = 9/168 (5%)

Query: 456 NVHRTYYEELAKTEVFPDIKLLMPQMKAKVFAQCHFVFSGLIPLGTNIRHADIVLWTNMF 515
           NV   ++    +  + P  KLL+  ++ K+F +   + S    LG    +   ++     
Sbjct: 311 NVAWIFFMWSMQEFISPSSKLLLSPLRPKIFHKNELLLSYTNYLGQQRFYIQKLV--EAL 368

Query: 516 GAQTSSDIDENTTHVITKTPGTFKARLAKSYNPDIKIVHPDWIFEC--LVKWVRADEKPY 573
           G  +++++ +  THV++  P   K + A  ++   K+V+  W+ EC    K +  D   Y
Sbjct: 369 GGASTTELSKKNTHVLSCMPYGQKYQAAVRWSDTCKVVNHLWLEECYKFAKKLDTDTTRY 428

Query: 574 ELI-----IEQEVSSDELEEFQRNLKKRQMAEKAARESLQQETGEELN 616
             I     ++  +    LE+++ N  K+++ E+  + S   +T E  +
Sbjct: 429 REIPVRGGLKNVLGQLSLEDYEENTGKQELHEEKEQLSTITDTQENFD 476

>Kpol_2002.100 s2002 complement(238947..240380) [1434 bp, 477 aa]
           {ON} complement(238947..240380) [1434 nt, 478 aa]
          Length = 477

 Score = 38.5 bits (88), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 30/120 (25%), Positives = 51/120 (42%), Gaps = 28/120 (23%)

Query: 156 AQKELRERKKLVLVVDLDQTVIHCGVDPTIKEWANDPSNPNYDALKNVKTFSLDEDPILP 215
           A+K+   + K  LV+DLD+T++H                    + K + T     D +LP
Sbjct: 298 AKKDPVFKNKKCLVLDLDETLVHS-------------------SFKYIDT----ADFVLP 334

Query: 216 PFYMGXXXXXXXCQYYVKLRPGLQEFFDKVAPHFELHIYTMATRAYALEIAKIIDPTSAL 275
                        Q YV  RPG+ EF  +V   FE+ ++T +   Y   +  I+D + ++
Sbjct: 335 -----VTIDDQTHQVYVIKRPGVDEFLKRVGKIFEVVVFTASVSRYGDPLLDILDSSKSI 389

>Skud_8.49 Chr8 complement(93604..94947) [1344 bp, 447 aa] {ON}
           YHR004C (REAL)
          Length = 447

 Score = 38.5 bits (88), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 37/130 (28%), Positives = 55/130 (42%), Gaps = 26/130 (20%)

Query: 137 HNNTNIKVSERQAASI---EKTAQKE-LRERKKLVLVVDLDQTVIHCGVDPTIKEWANDP 192
           H+NTN     ++       +K   K  L  +KK  LV+DLD+T+IH     T        
Sbjct: 219 HSNTNTVFGTKRMGRFLFPKKLIPKSILNTQKKKKLVIDLDETLIHSASRSTTH------ 272

Query: 193 SNPNYDALKNVKTFSLDEDPILPPFYMGXXXXXXXCQYYVKLRPGLQEFFDKVAPHFELH 252
           SN +   L  VK F +   P L               Y++  RP    F  KV+  ++L 
Sbjct: 273 SNSSQGHLVEVK-FGISGIPTL---------------YFIHKRPYCDFFLTKVSRWYDLI 316

Query: 253 IYTMATRAYA 262
           I+T + + YA
Sbjct: 317 IFTASMKEYA 326

>NDAI0C03230 Chr3 (734531..737635) [3105 bp, 1034 aa] {ON} Anc_5.94
           YHR154W
          Length = 1034

 Score = 38.5 bits (88), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 28/109 (25%), Positives = 52/109 (47%), Gaps = 8/109 (7%)

Query: 490 HFVFSGLIPLGT-NIRHADIVLWT---NMFGAQTSSDIDENTTHVIT---KTPGTFKARL 542
           HF  +  I + T +++ ++ + ++   N  G   +  I+  TTH+I      P     + 
Sbjct: 131 HFFRNFQICISTYSMKFSEYIFYSELINSLGGTITHVINNKTTHLIAIAIDDPAIIAIKE 190

Query: 543 AKSYNPDIKIVHPDWIFECLVKWVRADEKPYELIIEQEVSSDELEEFQR 591
               N  IK V+P W+ +C  +    DE P+ LI E + +S+ L++  R
Sbjct: 191 KGQNNTIIKSVYPTWLVQCFKERKYIDESPH-LITEDQNNSEHLDDIWR 238

 Score = 38.5 bits (88), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 25/119 (21%), Positives = 55/119 (46%), Gaps = 13/119 (10%)

Query: 472 PDIKLLMPQMKAKVFAQCHFVFSGLIPLGTNIRHADIVLWTNMFGAQTSSDIDENTTHVI 531
           P+  LL    K K+F     + +     G   + + I   T M G  +++++ +  TH++
Sbjct: 343 PNTNLLFEPFKKKIFKSSELILTYTNYFGR--QRSYIQRLTEMLGGISTTELSKRNTHLV 400

Query: 532 TKTPGTFKARLAKSYNPDIKIVHPDWIFECLVKWVRADEKPYELIIEQEVSSDELEEFQ 590
           ++ P   K   AK +    ++++  W+           E+ Y+  I+Q+ +S E ++F+
Sbjct: 401 SRMPVGKKFFQAKKWKDRCQVINHLWL-----------ERTYKTGIKQDPNSSEFQDFK 448

>TBLA0C06090 Chr3 complement(1478726..1480180) [1455 bp, 484 aa]
           {ON} Anc_5.202 YLL010C
          Length = 484

 Score = 36.6 bits (83), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 29/124 (23%), Positives = 51/124 (41%), Gaps = 27/124 (21%)

Query: 158 KELRERKKLVLVVDLDQTVIHCGVDPTIKEWANDPSNPNYDALKNVKTFSLDEDPILPPF 217
           K+ +++ K  L++DLD+T++H        ++ N+P                  D ILP  
Sbjct: 305 KDSKDKHKKCLILDLDETLVHSSF-----KFINNP------------------DFILPI- 340

Query: 218 YMGXXXXXXXCQYYVKLRPGLQEFFDKVAPHFELHIYTMATRAYALEIAKIIDPTSALFG 277
                        YV  RPG+  F  +V   +E+ I+T +   YA  +  ++D    L  
Sbjct: 341 ---EIEDGQIHNVYVIKRPGVDRFLREVKKWYEIVIFTASLSRYANPLLDLLDKDHNLIN 397

Query: 278 DRIL 281
            R+ 
Sbjct: 398 HRLF 401

>KAFR0E02140 Chr5 (426065..428920) [2856 bp, 951 aa] {ON} Anc_5.94
           YHR154W
          Length = 951

 Score = 36.2 bits (82), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 20/76 (26%), Positives = 39/76 (51%), Gaps = 6/76 (7%)

Query: 506 ADIVLWTNM---FGAQTSSDIDENTTHVITKTP--GTFKARLAKSYNPDIKIVHPDWIFE 560
           ++ +L+T +    G     +I+  TTH+IT  P    F+  L ++    IK ++P W+  
Sbjct: 140 SEYLLYTELIHSMGGTCVENINNKTTHIITTNPKESCFEI-LKRNGTTSIKYIYPTWLIH 198

Query: 561 CLVKWVRADEKPYELI 576
           C+ +    DE  +E++
Sbjct: 199 CVKESQLIDESEHEIV 214

>YLR019W Chr12 (180288..181481) [1194 bp, 397 aa] {ON}
           PSR2Functionally redundant Psr1p homolog, a plasma
           membrane phosphatase involved in the general stress
           response; required with Psr1p and Whi2p for full
           activation of STRE-mediated gene expression, possibly
           through dephosphorylation of Msn2p
          Length = 397

 Score = 35.8 bits (81), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 14/45 (31%), Positives = 26/45 (57%)

Query: 231 YVKLRPGLQEFFDKVAPHFELHIYTMATRAYALEIAKIIDPTSAL 275
           YV  RPG+ EF ++V+  +E+ ++T +   YA  +   +DP   +
Sbjct: 265 YVIKRPGVDEFLNRVSQLYEVVVFTASVSRYANPLLDTLDPNGTI 309

>Smik_8.53 Chr8 complement(90635..91975) [1341 bp, 446 aa] {ON}
           YHR004C (REAL)
          Length = 446

 Score = 35.8 bits (81), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 31/103 (30%), Positives = 44/103 (42%), Gaps = 22/103 (21%)

Query: 160 LRERKKLVLVVDLDQTVIHCGVDPTIKEWANDPSNPNYDALKNVKTFSLDEDPILPPFYM 219
           L  +KK  LV+DLD+T+IH     T        SN +   L  VK F +     L     
Sbjct: 246 LNTQKKKKLVIDLDETLIHSASRSTTH------SNSSQGHLVEVK-FGISGIRTL----- 293

Query: 220 GXXXXXXXCQYYVKLRPGLQEFFDKVAPHFELHIYTMATRAYA 262
                     Y++  RP    F  KV+  +EL I+T + + YA
Sbjct: 294 ----------YFIHKRPYCDLFLTKVSKWYELIIFTASMKEYA 326

>ZYRO0B10428g Chr2 (823155..824603) [1449 bp, 482 aa] {ON} similar
           to uniprot|Q07800 Saccharomyces cerevisiae YLL010C
          Length = 482

 Score = 35.8 bits (81), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 22/40 (55%)

Query: 231 YVKLRPGLQEFFDKVAPHFELHIYTMATRAYALEIAKIID 270
           YV  RPG+ EF  KV   FE+ I+T +   Y   +  I+D
Sbjct: 350 YVMKRPGVDEFLKKVGSLFEVVIFTASVARYGDPLLDILD 389

>Kpol_478.16 s478 complement(58800..59852) [1053 bp, 350 aa] {ON}
           complement(58800..59852) [1053 nt, 351 aa]
          Length = 350

 Score = 35.4 bits (80), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 34/125 (27%), Positives = 50/125 (40%), Gaps = 30/125 (24%)

Query: 157 QKELRERKKLVLVVDLDQTVIHCGVDPTIKEWANDPSNPNYDALKNVKTFSLDEDPILPP 216
           Q+ L+ RK LVL  DLD+T++H                    + K V T     D +LP 
Sbjct: 173 QQSLQNRKCLVL--DLDETLVH-------------------SSFKYVST----ADFVLP- 206

Query: 217 FYMGXXXXXXXCQYYVKLRPGLQEFFDKVAPHFELHIYTMATRAYALEIAKIIDPTSALF 276
                         YV  RPG+  F    +  FE+ I+T +   Y   +  I+D T+ L 
Sbjct: 207 ----VDIDDQFQNVYVIKRPGVDAFLQYTSKLFEVVIFTASVEKYGNPLLDILDSTNDLV 262

Query: 277 GDRIL 281
             R+ 
Sbjct: 263 HHRLF 267

>YHR004C Chr8 complement(111754..113094) [1341 bp, 446 aa] {ON}
           NEM1Probable catalytic subunit of Nem1p-Spo7p
           phosphatase holoenzyme; regulates nuclear growth by
           controlling phospholipid biosynthesis, required for
           normal nuclear envelope morphology and sporulation;
           homolog of the human protein Dullard
          Length = 446

 Score = 35.4 bits (80), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 31/103 (30%), Positives = 44/103 (42%), Gaps = 22/103 (21%)

Query: 160 LRERKKLVLVVDLDQTVIHCGVDPTIKEWANDPSNPNYDALKNVKTFSLDEDPILPPFYM 219
           L  +KK  LV+DLD+T+IH     T        SN +   L  VK F L     L     
Sbjct: 246 LNTQKKKKLVIDLDETLIHSASRSTTH------SNSSQGHLVEVK-FGLSGIRTL----- 293

Query: 220 GXXXXXXXCQYYVKLRPGLQEFFDKVAPHFELHIYTMATRAYA 262
                     Y++  RP    F  KV+  ++L I+T + + YA
Sbjct: 294 ----------YFIHKRPYCDLFLTKVSKWYDLIIFTASMKEYA 326

>Suva_16.249 Chr16 (440525..441967) [1443 bp, 480 aa] {ON} YPL063W
           (REAL)
          Length = 480

 Score = 35.4 bits (80), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 43/163 (26%), Positives = 75/163 (46%), Gaps = 19/163 (11%)

Query: 235 RPGLQEFFDKVAPHFELHIYTMATRAYALEIAKIIDPTSA-----LFGDRILSRDENGSL 289
           RPG   F   ++ +FE+ +++     Y+ +IA+ +DP  A     LF +  + +D    +
Sbjct: 223 RPGADYFLGYLSQYFEIVLFSSNYMMYSEKIAEKLDPIHAFVSYNLFKEHCVYKD---GV 279

Query: 290 THKSLERLFPMDQSMVVIIDDRGDVWSWC-ENLIKVVPYNFFVGVGDINSNFLPRQQNSM 348
             K L +L   D S V+IID   + +    EN I + P+N   G  D   + L R    +
Sbjct: 280 HIKDLSKL-NRDLSKVIIIDTDPNSYKLQPENAIPMEPWN---GEAD---DKLVRLIPFL 332

Query: 349 LHMGRRHRKKAEEEELLTDIMDTEKKLQEKIDQEVKKQEEKFN 391
            ++  +  K       + D    +K L  + D  VKK ++KF+
Sbjct: 333 EYLATQQTKDVRP---ILDSFQDKKNLATEFDHRVKKLKDKFH 372

>Smik_12.82 Chr12 (167115..168293) [1179 bp, 392 aa] {ON} YLR019W
           (REAL)
          Length = 392

 Score = 35.0 bits (79), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 14/45 (31%), Positives = 24/45 (53%)

Query: 231 YVKLRPGLQEFFDKVAPHFELHIYTMATRAYALEIAKIIDPTSAL 275
           YV  RPG+ EF  +V   +E+ ++T +   YA  +   +DP   +
Sbjct: 260 YVIKRPGVDEFLSRVCQLYEVVVFTASVSRYANPLLDTLDPNGTI 304

>TPHA0N00670 Chr14 complement(147329..148687) [1359 bp, 452 aa] {ON}
           Anc_5.202 YLL010C
          Length = 452

 Score = 35.0 bits (79), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 27/115 (23%), Positives = 45/115 (39%), Gaps = 30/115 (26%)

Query: 157 QKELRERKKLVLVVDLDQTVIHCGVDPTIKEWANDPSNPNYDALKNVKTFSLDEDPILPP 216
           +K+  +RK LVL  DLD+T++H        ++ N                       +  
Sbjct: 276 EKKFADRKCLVL--DLDETLVHSSF-----KYLN-----------------------IAD 305

Query: 217 FYMGXXXXXXXCQYYVKLRPGLQEFFDKVAPHFELHIYTMATRAYALEIAKIIDP 271
           F +           YV  RPG+ EF   V   +E+ ++T +   Y   +  I+DP
Sbjct: 306 FVLPVDIDNQVQNVYVSKRPGVDEFLKIVGDLYEVIVFTASVSRYGNPLMDILDP 360

>YLL010C Chr12 complement(129330..130613) [1284 bp, 427 aa] {ON}
           PSR1Plasma membrane associated protein phosphatase
           involved in the general stress response; required along
           with binding partner Whi2p for full activation of
           STRE-mediated gene expression, possibly through
           dephosphorylation of Msn2p
          Length = 427

 Score = 35.0 bits (79), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 24/40 (60%)

Query: 231 YVKLRPGLQEFFDKVAPHFELHIYTMATRAYALEIAKIID 270
           YV  RPG++EF ++V   FE+ ++T +   Y   +  I+D
Sbjct: 295 YVIKRPGVEEFLERVGKLFEVVVFTASVSRYGDPLLDILD 334

>Suva_10.65 Chr10 complement(134276..135523) [1248 bp, 415 aa] {ON}
           YLL010C (REAL)
          Length = 415

 Score = 34.7 bits (78), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 24/40 (60%)

Query: 231 YVKLRPGLQEFFDKVAPHFELHIYTMATRAYALEIAKIID 270
           YV  RPG++EF ++V   FE+ ++T +   Y   +  I+D
Sbjct: 283 YVIKRPGVEEFLERVGKLFEVVVFTASVSRYGDPLLDILD 322

>Smik_16.172 Chr16 (313129..314562) [1434 bp, 477 aa] {ON} YPL063W
           (REAL)
          Length = 477

 Score = 35.0 bits (79), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 29/100 (29%), Positives = 50/100 (50%), Gaps = 10/100 (10%)

Query: 235 RPGLQEFFDKVAPHFELHIYTMATRAYALEIAKIIDPTSA-----LFGDRILSRDENGSL 289
           RPG   F   ++ +FE+ +++     Y+ +IA+ +DP  A     LF +  + +D    +
Sbjct: 218 RPGADYFLGYLSQYFEIVLFSSNYMMYSDKIAEKLDPIHAFVSYNLFKEHCVYKD---GV 274

Query: 290 THKSLERLFPMDQSMVVIIDDRGDVWSWC-ENLIKVVPYN 328
             K L +L   D S V+IID   + +    EN I + P+N
Sbjct: 275 HIKDLSKL-NRDLSKVIIIDTEPNSYKLQPENAIPMDPWN 313

>YPL063W Chr16 (429939..431369) [1431 bp, 476 aa] {ON}
           TIM50Essential component of the Translocase of the Inner
           Mitochondrial membrane (TIM23 complex); acts as receptor
           for the TIM23 complex guiding incoming precursors from
           the TOM complex; may control the gating of the
           Tim23p-Tim17p channel
          Length = 476

 Score = 34.7 bits (78), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 42/162 (25%), Positives = 76/162 (46%), Gaps = 19/162 (11%)

Query: 235 RPGLQEFFDKVAPHFELHIYTMATRAYALEIAKIIDPTSA-----LFGDRILSRDENGSL 289
           RPG   F   ++ ++E+ +++     Y+ +IA+ +DP  A     LF +  + +D    +
Sbjct: 218 RPGADYFLGYLSQYYEIVLFSSNYMMYSDKIAEKLDPIHAFVSYNLFKEHCVYKD---GV 274

Query: 290 THKSLERLFPMDQSMVVIIDDRGDVWSWC-ENLIKVVPYNFFVGVGDINSNFLPRQQNSM 348
             K L +L   D S V+IID   + +    EN I + P+N   G  D   + L R    +
Sbjct: 275 HIKDLSKL-NRDLSKVIIIDTDPNSYKLQPENAIPMEPWN---GEAD---DKLVRLIPFL 327

Query: 349 LHMGRRHRKKAEEEELLTDIMDTEKKLQEKIDQEVKKQEEKF 390
            ++  +  K       + +  + +K L E+ D  VKK ++KF
Sbjct: 328 EYLATQQTKDVRP---ILNSFEDKKNLAEEFDHRVKKLKDKF 366

>Smik_12.53 Chr12 complement(116428..117672) [1245 bp, 414 aa] {ON}
           YLL010C (REAL)
          Length = 414

 Score = 34.7 bits (78), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 24/40 (60%)

Query: 231 YVKLRPGLQEFFDKVAPHFELHIYTMATRAYALEIAKIID 270
           YV  RPG++EF ++V   FE+ ++T +   Y   +  I+D
Sbjct: 282 YVIKRPGVEEFLERVGKLFEVVVFTASVSRYGDPLLDILD 321

>Skud_12.57 Chr12 complement(120706..121953) [1248 bp, 415 aa] {ON}
           YLL010C (REAL)
          Length = 415

 Score = 34.7 bits (78), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 24/40 (60%)

Query: 231 YVKLRPGLQEFFDKVAPHFELHIYTMATRAYALEIAKIID 270
           YV  RPG++EF ++V   FE+ ++T +   Y   +  I+D
Sbjct: 283 YVIKRPGVEEFLERVGKLFEVVVFTASVSRYGDPLLDILD 322

>Skud_12.87 Chr12 (172096..173274) [1179 bp, 392 aa] {ON} YLR019W
           (REAL)
          Length = 392

 Score = 34.7 bits (78), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 14/45 (31%), Positives = 25/45 (55%)

Query: 231 YVKLRPGLQEFFDKVAPHFELHIYTMATRAYALEIAKIIDPTSAL 275
           YV  RPG+ EF  +V+  +E+ ++T +   YA  +   +DP   +
Sbjct: 260 YVIKRPGVDEFLHRVSQVYEVVVFTASVSRYANPLLDTLDPNGTI 304

>Ecym_4702 Chr4 complement(1372595..1373803) [1209 bp, 402 aa] {ON}
           similar to Ashbya gossypii ACR238W
          Length = 402

 Score = 34.7 bits (78), Expect = 0.99,   Method: Compositional matrix adjust.
 Identities = 40/154 (25%), Positives = 60/154 (38%), Gaps = 37/154 (24%)

Query: 427 LAELQKHMNNQKLLIDDDDELPHLSEILLNVHRTYY-----------EELAKTEVFPDIK 475
           L EL + M  ++   + D  L  + EI L+  R YY           E+L  + +FPDI 
Sbjct: 132 LVELYQLMRERQ---EHDGRLRAIGEIGLDYDRFYYSGKNMQLLFFKEQLKLSCMFPDIP 188

Query: 476 LLMPQMKAKVFAQCHFVFSGLIP-----------------LGTNIRHADIVLWTNMFGAQ 518
           L +  M+      CH  F G++                  L  +  H D +L  N +   
Sbjct: 189 LFL-HMR-----NCHSDFIGILGQFVEGFPDSEDRFRLKELILDTEHKDRMLDANGYPYY 242

Query: 519 TSSDIDENTTHVITKTPGTFKARLAKSYNPDIKI 552
             SD+ +   H  T TP   +  LA S N  I +
Sbjct: 243 KFSDVRKFVVHSFTGTPNEMEEYLALSPNCYIGM 276

>NDAI0I02170 Chr9 (498399..499574) [1176 bp, 391 aa] {ON} Anc_5.202
          Length = 391

 Score = 34.3 bits (77), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 14/45 (31%), Positives = 27/45 (60%)

Query: 231 YVKLRPGLQEFFDKVAPHFELHIYTMATRAYALEIAKIIDPTSAL 275
           YV  RPG+ EF  +VA  +E+ ++T +   Y   +  I+D ++++
Sbjct: 259 YVIKRPGVDEFLRRVAQLYEVVVFTASVSRYGDPLLDILDSSNSI 303

>AAL158W Chr1 (67892..69328) [1437 bp, 478 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YLL010C (PSR1) and YLR019W
           (PSR2)
          Length = 478

 Score = 34.3 bits (77), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 30/117 (25%), Positives = 45/117 (38%), Gaps = 30/117 (25%)

Query: 159 ELRERKKLVLVVDLDQTVIHCGVDPTIKEWANDPSNPNYDALKNVKTFSLDEDPILPPFY 218
           E R RK LVL  DLD+T++H                    + K + T           F 
Sbjct: 304 EFRGRKCLVL--DLDETLVH-------------------SSFKYLHTAD---------FV 333

Query: 219 MGXXXXXXXCQYYVKLRPGLQEFFDKVAPHFELHIYTMATRAYALEIAKIIDPTSAL 275
           +           YV  RPG+ EF  +V   FE+ ++T +   Y   +  I+D   A+
Sbjct: 334 IPVEIDNQVHNVYVIKRPGVDEFLKRVGELFEVVVFTASVSRYGDPLLDILDQYKAV 390

>NCAS0D02740 Chr4 complement(525116..526312) [1197 bp, 398 aa] {ON}
           Anc_5.202
          Length = 398

 Score = 34.3 bits (77), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 25/112 (22%), Positives = 45/112 (40%), Gaps = 28/112 (25%)

Query: 164 KKLVLVVDLDQTVIHCGVDPTIKEWANDPSNPNYDALKNVKTFSLDEDPILPPFYMGXXX 223
            K  LV+DLD+T++H                    + K V+T           F +    
Sbjct: 227 NKKCLVLDLDETLVHS-------------------SFKYVRTAD---------FVLPVEI 258

Query: 224 XXXXCQYYVKLRPGLQEFFDKVAPHFELHIYTMATRAYALEIAKIIDPTSAL 275
                  YV  RPG+ EF  +V   +E+ ++T +   Y   +  I+D ++++
Sbjct: 259 EDQIHNVYVIKRPGVDEFLKRVGELYEVVVFTASVSRYGDPLLNILDQSNSV 310

>Suva_10.99 Chr10 (186341..187498) [1158 bp, 385 aa] {ON} YLR019W
           (REAL)
          Length = 385

 Score = 33.9 bits (76), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 14/45 (31%), Positives = 25/45 (55%)

Query: 231 YVKLRPGLQEFFDKVAPHFELHIYTMATRAYALEIAKIIDPTSAL 275
           YV  RPG+ EF  +V+  +E+ ++T +   YA  +   +DP   +
Sbjct: 253 YVIKRPGVDEFLHRVSQLYEVVVFTASVSRYANPLLDTLDPNRTI 297

>TPHA0H01070 Chr8 (229632..232679) [3048 bp, 1015 aa] {ON} Anc_5.94
           YHR154W
          Length = 1015

 Score = 34.3 bits (77), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 19/68 (27%), Positives = 29/68 (42%), Gaps = 2/68 (2%)

Query: 513 NMFGAQTSSDIDENTTHVITKTPG--TFKARLAKSYNPDIKIVHPDWIFECLVKWVRADE 570
           N  G  T   I   TTH+IT  P      A +A     +I  V+P W+ +C       +E
Sbjct: 145 NALGGTTVDHISTLTTHLITNDPTDQAVIATIASEQKQNISFVYPTWLCQCFKSMTLVNE 204

Query: 571 KPYELIIE 578
             + + I+
Sbjct: 205 SDHLINIQ 212

>Suva_8.58 Chr8 complement(108197..109555) [1359 bp, 452 aa] {ON}
           YHR004C (REAL)
          Length = 452

 Score = 33.9 bits (76), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 29/103 (28%), Positives = 43/103 (41%), Gaps = 22/103 (21%)

Query: 160 LRERKKLVLVVDLDQTVIHCGVDPTIKEWANDPSNPNYDALKNVKTFSLDEDPILPPFYM 219
           L  +KK  LV+DLD+T+IH     T        SN +   L  VK F +     L     
Sbjct: 251 LNTQKKKKLVIDLDETLIHSASRGTTH------SNSSQGHLVEVK-FGISGISTL----- 298

Query: 220 GXXXXXXXCQYYVKLRPGLQEFFDKVAPHFELHIYTMATRAYA 262
                     Y++  RP    F  K +  ++L I+T + + YA
Sbjct: 299 ----------YFIHKRPYCDLFLTKASKWYDLIIFTASMKEYA 331

>CAGL0D05610g Chr4 complement(534849..536192) [1344 bp, 447 aa] {ON}
           similar to uniprot|Q07800 Saccharomyces cerevisiae
           YLL010c PSR1 or uniprot|Q07949 Saccharomyces cerevisiae
           YLR019w PSR2
          Length = 447

 Score = 33.9 bits (76), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 22/92 (23%), Positives = 38/92 (41%), Gaps = 10/92 (10%)

Query: 194 NPNYDALKNVKTFSLDEDPIL----------PPFYMGXXXXXXXCQYYVKLRPGLQEFFD 243
           +P  DA K+ K   LD D  L            F +           YV  RPG+ EF  
Sbjct: 268 SPKGDAFKHKKCLVLDLDETLVHSSFKYLHTADFVLPVDIDDQIHNVYVIKRPGVDEFLQ 327

Query: 244 KVAPHFELHIYTMATRAYALEIAKIIDPTSAL 275
           +V   +E+ ++T +   Y   +  ++D ++ +
Sbjct: 328 RVGELYEVVVFTASVSRYGDPLLDVLDKSNNI 359

>KLLA0E23101g Chr5 complement(2059506..2060948) [1443 bp, 480 aa]
           {ON} similar to uniprot|Q02776 Saccharomyces cerevisiae
           YPL063W TIM50 Protein of the inner mitochondrial
           membrane required for import of mitochondrial matrix
           proteins
          Length = 480

 Score = 33.5 bits (75), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 29/100 (29%), Positives = 49/100 (49%), Gaps = 10/100 (10%)

Query: 235 RPGLQEFFDKVAPHFELHIYTMATRAYALEIAKIIDPTSA-----LFGDRILSRDENGSL 289
           RPG+  F   ++ ++E+ +++     YA +IA+ +DP  A     LF +  L +D    +
Sbjct: 221 RPGVDYFLGYLSQYYEIVLFSSNYMMYAEKIAEKLDPIHAFITYNLFKEHCLYKD---GV 277

Query: 290 THKSLERLFPMDQSMVVIID-DRGDVWSWCENLIKVVPYN 328
             K L +L   D   V+IID D        EN I + P++
Sbjct: 278 HIKDLSKL-NRDLGKVLIIDTDENSFKLQPENAIYLEPWD 316

>KNAG0C05850 Chr3 (1138155..1139486) [1332 bp, 443 aa] {ON}
           Anc_2.530 YHR004C
          Length = 443

 Score = 33.1 bits (74), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 35/125 (28%), Positives = 57/125 (45%), Gaps = 23/125 (18%)

Query: 161 RERKKLVLVVDLDQTVIHCGVDPTIKEWANDPSNPNYDALKNVKTFSLDEDPILPPFYMG 220
           RE+KK  LV+DLD+T+IH     ++      P N +   +  VK FS+     L      
Sbjct: 246 REKKK-TLVMDLDETLIH-----SVSRGTTHP-NSSQGHIVEVK-FSISGVSTL------ 291

Query: 221 XXXXXXXCQYYVKLRPGLQEFFDKVAPHFELHIYTMATRAYALEIAKIIDPTSALFGDRI 280
                    YYV  RP    F  KV+  +++ I+T + + YA  +   ++ + A    R 
Sbjct: 292 ---------YYVFKRPYCDLFLTKVSKWYDIVIFTASMKEYADPVIDWLESSFAGKFSRR 342

Query: 281 LSRDE 285
           L R++
Sbjct: 343 LYRND 347

>KAFR0A06560 Chr1 complement(1329583..1331250) [1668 bp, 555 aa]
           {ON} Anc_4.156 YLR330W
          Length = 555

 Score = 32.7 bits (73), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 29/66 (43%), Gaps = 5/66 (7%)

Query: 502 NIRHADIVLWTNMFGA---QTSSDIDENTTHVITKTPGTFKARLAKSYNPDIKIVHPDWI 558
           NI    I     + GA   Q    ID  TTH I        A L ++ N +I IV P+WI
Sbjct: 186 NISEEQIEKCLQVIGAKPLQKHVSID--TTHFICNDEEEEDAELIRAKNSNIPIVRPEWI 243

Query: 559 FECLVK 564
             C V+
Sbjct: 244 RACAVE 249

>Suva_8.400 Chr8 (717697..720654) [2958 bp, 985 aa] {ON} YOR346W
           (REAL)
          Length = 985

 Score = 33.1 bits (74), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 27/109 (24%), Positives = 46/109 (42%), Gaps = 12/109 (11%)

Query: 460 TYYEELAKTEVFPD------IKLLMPQMKAKVFAQCHFVFSGLIPLGTNIRHADIVLWTN 513
           TY+++ A+ +   D       K L+      +F  C    +G    G    H  IVL   
Sbjct: 135 TYFQDKAQGQSVQDQILKNQYKGLISSQNGNLFKNCVIYINGYTKPGRLQLHEMIVLHGG 194

Query: 514 MFGAQTSSDIDENTTHVITKTPGTFKARLAKSYNPDIKIVHPDWIFECL 562
            F    S+   +  TH++       K R+  +   + K+V+PDWI +C+
Sbjct: 195 KFLHHLSAK--KRVTHIVASNL-PLKKRIEFA---NYKVVNPDWITDCI 237

>Skud_16.218 Chr16 (401347..402789) [1443 bp, 480 aa] {ON} YPL063W
           (REAL)
          Length = 480

 Score = 32.7 bits (73), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 41/162 (25%), Positives = 74/162 (45%), Gaps = 19/162 (11%)

Query: 235 RPGLQEFFDKVAPHFELHIYTMATRAYALEIAKIIDPTSA-----LFGDRILSRDENGSL 289
           RPG + F   ++ ++E+ +++     Y+ + A+ +DP  A     LF +  + +D    +
Sbjct: 221 RPGAEYFLGYLSQYYEIVLFSSNYMMYSEKTAEKLDPIHAFVSYNLFKEHCVYKD---GV 277

Query: 290 THKSLERLFPMDQSMVVIIDDRGDVWSWC-ENLIKVVPYNFFVGVGDINSNFLPRQQNSM 348
             K L +L   D S V+IID   + +    EN I + P+N   G  D   + L R    +
Sbjct: 278 HIKDLSKL-KRDLSKVIIIDTDPNSYKLQPENAIPMDPWN---GEAD---DKLVRLIPFL 330

Query: 349 LHMGRRHRKKAEEEELLTDIMDTEKKLQEKIDQEVKKQEEKF 390
            ++  +  K       + D    +K L  + D  VKK ++KF
Sbjct: 331 EYLATQQTKDVRP---ILDSFQDKKNLATEFDHRVKKLKDKF 369

>KLLA0F21164g Chr6 complement(1973018..1974280) [1263 bp, 420 aa]
           {ON} conserved hypothetical protein
          Length = 420

 Score = 32.3 bits (72), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 44/92 (47%), Gaps = 1/92 (1%)

Query: 319 ENLIKVVPYNFFVGVGDINSNFLPRQQNSMLHMGRRHRKKAEEEELLTDIMDTEKKLQEK 378
           E+L  V  Y F   +GDI+       +   L  G++H K  +E+    D  D EKK Q K
Sbjct: 178 EDLYYVGGYGFQAYIGDIDGELYHESEPLKLKWGKKHHKGHKEDREHDDKGDDEKK-QPK 236

Query: 379 IDQEVKKQEEKFNKISEENQPDRSMSKEDLTK 410
            +++  K E+K +K  +++  D     +D  K
Sbjct: 237 DEKKQPKDEKKHSKDEKKHSKDEKKQPKDEKK 268

>ZYRO0B15026g Chr2 complement(1222480..1225968) [3489 bp, 1162 aa]
           {ON} weakly similar to uniprot|P38850 Saccharomyces
           cerevisiae YHR154W RTT107 Regulator of Ty1 Transposition
           Establishes Silent Chromatin involved in silencing
          Length = 1162

 Score = 32.7 bits (73), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 20/76 (26%), Positives = 32/76 (42%), Gaps = 14/76 (18%)

Query: 508 IVLWTNMFGAQ--------------TSSDIDENTTHVITKTPGTFKARLAKSYNPDIKIV 553
           I  +TN FG Q              T+S++    TH++ + P   K   AK++     I 
Sbjct: 353 ITAYTNFFGQQRFYIQRLVNALGGFTTSELSRRNTHLLCRFPFGKKFETAKNWGDKCVIT 412

Query: 554 HPDWIFECLVKWVRAD 569
           +  W+ EC  +  R D
Sbjct: 413 NYLWLEECYRQSTRLD 428

>Kwal_33.15140 s33 complement(975769..977001) [1233 bp, 410 aa] {ON}
           YLR019W (PSR2) - Plasma membrane Sodium Response 2
           [contig 94] FULL
          Length = 410

 Score = 32.3 bits (72), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 28/60 (46%), Gaps = 4/60 (6%)

Query: 231 YVKLRPGLQEFFDKVAPHFELHIYTMATRAYALEIAKIIDPTSA----LFGDRILSRDEN 286
           YV  RPG+ EF   V   +E+ ++T +   Y   +  ++D T      LF D   + D N
Sbjct: 278 YVIKRPGVDEFLKLVGQLYEVVVFTASVSRYGDPLLDVLDQTQCIHHRLFRDSCYNYDGN 337

>TBLA0A08950 Chr1 complement(2200024..2202483) [2460 bp, 819 aa]
           {ON} Anc_4.90 YGL027C
          Length = 819

 Score = 32.3 bits (72), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 47/177 (26%), Positives = 73/177 (41%), Gaps = 23/177 (12%)

Query: 311 RGDVWSWCENLIKVVPYNFFVGVGDINSNFLPRQQNSM-----LHMGRRHRKKAEEEELL 365
           RG  W     L++++ Y+F +    I S F   + +S      + +G   R +  EE  +
Sbjct: 406 RGFYWDEGFQLLQIMEYDFDLAFEIITSWFDLIEDDSGWVAREVILGAEARSRVPEEFTV 465

Query: 366 ---------TDIMDTEKKLQEKIDQEVKKQEEKFNKISEENQPDRSMSKEDLTKKLEHNA 416
                    T +M   + L   ID +       FN+  E N       +ED T +LE N+
Sbjct: 466 QSPNVANPPTLLMTFSEMLSRAIDYQ---NSVNFNQDKESNDNQEKTLRED-TNQLEQNS 521

Query: 417 SLEVQQQNRPLAELQKHM----NNQKLLIDDDDELPHLSEILLNVHRTY-YEELAKT 468
            L V+   R   +L KH      +QK L +D  E+     IL  VH  + Y  L +T
Sbjct: 522 KLLVKYAKRIYPKLLKHYEWFTTSQKGLTEDYVEVFEEEGILSKVHLDHVYRWLGRT 578

>CAGL0L06644g Chr12 (750307..752793) [2487 bp, 828 aa] {ON} some
           similarities with uniprot|P38850 Saccharomyces
           cerevisiae YHR154w
          Length = 828

 Score = 32.3 bits (72), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 32/74 (43%), Gaps = 17/74 (22%)

Query: 512 TNMFGAQTSSDIDENTTHVITKTPGTFKARLAKSY----------NPDIKIVHPDWIFEC 561
           T   G  T + I + TTH++ KT   F   L K            NP +KIV   W+ +C
Sbjct: 146 TQTLGGITQNFISDKTTHIVIKT---FDDPLVKEMDDNVILKEVLNPTMKIVSYQWLLDC 202

Query: 562 L--VKWVRADEKPY 573
              V W  A+E  Y
Sbjct: 203 FKTVSW--ANEIKY 214

>TBLA0A00540 Chr1 complement(104887..106344) [1458 bp, 485 aa] {ON}
           Anc_8.527 YPL063W
          Length = 485

 Score = 32.0 bits (71), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 41/80 (51%), Gaps = 9/80 (11%)

Query: 235 RPGLQEFFDKVAPHFELHIYTMATRAYALEIAKIIDPTSA-----LFGDRILSRDENGSL 289
           RPG+  F   ++ ++E+ +++     Y+  IA+ +DP  A     LF +  L +D    +
Sbjct: 222 RPGVDYFLGYLSQYYEIVLFSSNYMMYSDRIAEKLDPIHAFVSYNLFKEHCLYKD---GV 278

Query: 290 THKSLERLFPMDQSMVVIID 309
             K L +L   D+  V+IID
Sbjct: 279 HIKDLSKL-NRDEKKVLIID 297

>NCAS0C02210 Chr3 (411245..412720) [1476 bp, 491 aa] {ON} Anc_8.527
          Length = 491

 Score = 31.6 bits (70), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 27/100 (27%), Positives = 50/100 (50%), Gaps = 10/100 (10%)

Query: 235 RPGLQEFFDKVAPHFELHIYTMATRAYALEIAKIIDPTSA-----LFGDRILSRDENGSL 289
           RPG+  F   ++ ++E+ +++     Y  +IA+ +DP  A     LF +  + +D    +
Sbjct: 229 RPGVDYFLGYLSQYYEIVLFSSNYMMYGEKIAEKLDPLHAFISYNLFKEHCVYKD---GV 285

Query: 290 THKSLERLFPMDQSMVVIIDDRGDVWSWC-ENLIKVVPYN 328
             K L +L   D + V+IID   + +    EN I V P++
Sbjct: 286 HIKDLSKL-NRDVNKVLIIDTEPNNYKLQPENAIPVKPWD 324

>ZYRO0G20988g Chr7 complement(1723533..1726193) [2661 bp, 886 aa]
           {ON} similar to uniprot|P38149 Saccharomyces cerevisiae
           YBR281C Hypothetical ORF
          Length = 886

 Score = 31.6 bits (70), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 42/95 (44%), Gaps = 7/95 (7%)

Query: 122 NMSGSGVSNGKLTVAHNNTNIKVSERQAASIEKTAQKELRERKKLVLVVDLDQTVIHCGV 181
           N+SG G     +TV   +  I VS R     ++  + E   RK L+   D   +  H  +
Sbjct: 738 NISGPG----NITVIPQSATIGVSIRLVPE-QEVGKIEESLRKYLMQCFDRLSSGNHLEI 792

Query: 182 DPT--IKEWANDPSNPNYDALKNVKTFSLDEDPIL 214
                 + W  DP+N  Y+ LK   TF   ++P+L
Sbjct: 793 SIVNEAEAWLGDPTNHAYEVLKEALTFKWGKEPLL 827

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.133    0.383 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 77,610,602
Number of extensions: 3569199
Number of successful extensions: 21838
Number of sequences better than 10.0: 575
Number of HSP's gapped: 21935
Number of HSP's successfully gapped: 744
Length of query: 743
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 626
Effective length of database: 40,065,477
Effective search space: 25080988602
Effective search space used: 25080988602
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 70 (31.6 bits)