Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_27.102588.840ON62062032620.0
KLTH0C03872g8.840ON62162023490.0
SAKL0D01474g8.840ON62461821390.0
YMR278W (PGM3)8.840ON62263018850.0
TPHA0I002508.840ON62963318480.0
TDEL0B005708.840ON63062618410.0
Suva_13.4668.840ON62262318350.0
KLLA0D01573g8.840ON60762018320.0
Smik_13.4918.840ON62262318320.0
NCAS0C004108.840ON62562418310.0
Ecym_46118.840ON63062118260.0
CAGL0M02981g8.840ON61762218240.0
ABL126W8.840ON62462318130.0
Skud_13.4508.840ON62262318050.0
NDAI0K004108.840ON62662517920.0
ZYRO0G14190g8.840ON61061817890.0
KNAG0J002708.840ON62562117800.0
TBLA0B032508.840ON64363617810.0
KAFR0B039208.840ON62462217460.0
Kpol_1068.88.840ON63263017450.0
TDEL0A022102.445ON5725931233e-06
KNAG0E023902.445ON5696101092e-04
Kwal_26.76282.445ON5704501038e-04
KNAG0E009406.11ON5381211020.001
ZYRO0G02508g2.445ON569437990.002
CAGL0B03597g6.11ON54075970.004
TPHA0G029002.445ON569586950.007
TDEL0E00210singletonON570454950.008
Smik_13.2912.445ON569453940.009
Kpol_1033.542.445ON570587930.012
NCAS0F002006.11ON54932930.014
KLTH0D04796g2.445ON570456920.016
Kpol_1018.1612.445ON569431920.016
TBLA0G009806.11ON55830920.017
KLLA0B12694g2.445ON568430910.023
Kpol_1032.26.11ON53930900.026
TDEL0G046006.11ON52831900.032
KAFR0L003406.11ON54031880.050
KAFR0D030102.445ON569432880.054
SAKL0E03630g2.445ON571454870.062
ACR015W6.11ON55277870.063
YEL058W (PCM1)6.11ON55731860.079
Smik_5.296.11ON55531860.080
TBLA0B090102.445ON569442860.085
Skud_5.316.11ON55731860.087
Suva_5.106.11ON55331860.092
NDAI0K028906.11ON56130860.092
Kwal_56.223556.11ON54141850.100
KLTH0C11506g6.11ON54441840.14
Skud_13.2632.445ON569453840.15
ZYRO0F00506g6.11ON55027830.19
NCAS0F014702.445ON569343830.22
ABL029W2.445ON568453820.24
SAKL0E00902g6.11ON54422820.28
KLLA0D00858g6.11ON54137800.50
TPHA0M002106.11ON54530790.58
NDAI0H023502.445ON569344790.59
TBLA0B040208.644ON29893760.98
KNAG0A062802.445ON570132771.0
Ecym_30146.11ON55122751.7
KLLA0B04994g4.328ON398114714.6
Kwal_23.45882.51ON54664715.9
TPHA0F017702.169ON42542706.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_27.10258
         (620 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_27.10258 s27 complement(265612..267474) [1863 bp, 620 aa] {...  1261   0.0  
KLTH0C03872g Chr3 complement(337765..339630) [1866 bp, 621 aa] {...   909   0.0  
SAKL0D01474g Chr4 complement(117178..119052) [1875 bp, 624 aa] {...   828   0.0  
YMR278W Chr13 (822763..824631) [1869 bp, 622 aa] {ON}  PGM3Phosp...   730   0.0  
TPHA0I00250 Chr9 (46554..48443) [1890 bp, 629 aa] {ON} Anc_8.840...   716   0.0  
TDEL0B00570 Chr2 complement(109270..111162) [1893 bp, 630 aa] {O...   713   0.0  
Suva_13.466 Chr13 (805414..807282) [1869 bp, 622 aa] {ON} YMR278...   711   0.0  
KLLA0D01573g Chr4 complement(139183..141006) [1824 bp, 607 aa] {...   710   0.0  
Smik_13.491 Chr13 (805767..807635) [1869 bp, 622 aa] {ON} YMR278...   710   0.0  
NCAS0C00410 Chr3 complement(62893..64770) [1878 bp, 625 aa] {ON}...   709   0.0  
Ecym_4611 Chr4 (1191367..1193259) [1893 bp, 630 aa] {ON} similar...   707   0.0  
CAGL0M02981g Chr13 (335863..337716) [1854 bp, 617 aa] {ON} simil...   707   0.0  
ABL126W Chr2 (159207..161081) [1875 bp, 624 aa] {ON} Syntenic ho...   702   0.0  
Skud_13.450 Chr13 (796030..797898) [1869 bp, 622 aa] {ON} YMR278...   699   0.0  
NDAI0K00410 Chr11 complement(91807..93687) [1881 bp, 626 aa] {ON...   694   0.0  
ZYRO0G14190g Chr7 (1131206..1133038) [1833 bp, 610 aa] {ON} simi...   693   0.0  
KNAG0J00270 Chr10 complement(39750..41627) [1878 bp, 625 aa] {ON...   690   0.0  
TBLA0B03250 Chr2 (757928..759859) [1932 bp, 643 aa] {ON} Anc_8.8...   690   0.0  
KAFR0B03920 Chr2 (814394..816268) [1875 bp, 624 aa] {ON} Anc_8.8...   677   0.0  
Kpol_1068.8 s1068 complement(13542..15440) [1899 bp, 632 aa] {ON...   676   0.0  
TDEL0A02210 Chr1 (400375..402093) [1719 bp, 572 aa] {ON} Anc_2.4...    52   3e-06
KNAG0E02390 Chr5 (475467..477176) [1710 bp, 569 aa] {ON} Anc_2.4...    47   2e-04
Kwal_26.7628 s26 (449302..451014) [1713 bp, 570 aa] {ON} YMR105C...    44   8e-04
KNAG0E00940 Chr5 (176887..178503) [1617 bp, 538 aa] {ON} Anc_6.1...    44   0.001
ZYRO0G02508g Chr7 (192411..194120) [1710 bp, 569 aa] {ON} highly...    43   0.002
CAGL0B03597g Chr2 complement(359018..360640) [1623 bp, 540 aa] {...    42   0.004
TPHA0G02900 Chr7 (622303..624012) [1710 bp, 569 aa] {ON}               41   0.007
TDEL0E00210 Chr5 (28244..29956) [1713 bp, 570 aa] {ON} Anc_2.445...    41   0.008
Smik_13.291 Chr13 complement(460399..462108) [1710 bp, 569 aa] {...    41   0.009
Kpol_1033.54 s1033 (136243..137955) [1713 bp, 570 aa] {ON} (1362...    40   0.012
NCAS0F00200 Chr6 complement(30474..32123) [1650 bp, 549 aa] {ON}...    40   0.014
KLTH0D04796g Chr4 (437416..439128) [1713 bp, 570 aa] {ON} highly...    40   0.016
Kpol_1018.161 s1018 (412372..414081) [1710 bp, 569 aa] {ON} (412...    40   0.016
TBLA0G00980 Chr7 complement(248484..250160) [1677 bp, 558 aa] {O...    40   0.017
KLLA0B12694g Chr2 (1107696..1109402) [1707 bp, 568 aa] {ON} high...    40   0.023
Kpol_1032.2 s1032 complement(1049..2668) [1620 bp, 539 aa] {ON} ...    39   0.026
TDEL0G04600 Chr7 (838381..839967) [1587 bp, 528 aa] {ON} Anc_6.1...    39   0.032
KAFR0L00340 Chr12 complement(62157..63779) [1623 bp, 540 aa] {ON...    39   0.050
KAFR0D03010 Chr4 (594118..595827) [1710 bp, 569 aa] {ON} Anc_2.4...    39   0.054
SAKL0E03630g Chr5 complement(294321..296036) [1716 bp, 571 aa] {...    38   0.062
ACR015W Chr3 (383130..384788) [1659 bp, 552 aa] {ON} Syntenic ho...    38   0.063
YEL058W Chr5 (43252..44925) [1674 bp, 557 aa] {ON}  PCM1Essentia...    38   0.079
Smik_5.29 Chr5 (45538..47205) [1668 bp, 555 aa] {ON} YEL058W (REAL)    38   0.080
TBLA0B09010 Chr2 complement(2135961..2137670) [1710 bp, 569 aa] ...    38   0.085
Skud_5.31 Chr5 (42262..43935) [1674 bp, 557 aa] {ON} YEL058W (REAL)    38   0.087
Suva_5.10 Chr5 (19280..20941) [1662 bp, 553 aa] {ON} YEL058W (REAL)    38   0.092
NDAI0K02890 Chr11 (655311..656996) [1686 bp, 561 aa] {ON} Anc_6....    38   0.092
Kwal_56.22355 s56 complement(62955..64580) [1626 bp, 541 aa] {ON...    37   0.100
KLTH0C11506g Chr3 (944869..946503) [1635 bp, 544 aa] {ON} simila...    37   0.14 
Skud_13.263 Chr13 complement(451194..452903) [1710 bp, 569 aa] {...    37   0.15 
ZYRO0F00506g Chr6 complement(49579..51231) [1653 bp, 550 aa] {ON...    37   0.19 
NCAS0F01470 Chr6 complement(293218..294927) [1710 bp, 569 aa] {O...    37   0.22 
ABL029W Chr2 (343850..345556) [1707 bp, 568 aa] {ON} Syntenic ho...    36   0.24 
SAKL0E00902g Chr5 complement(68682..70316) [1635 bp, 544 aa] {ON...    36   0.28 
KLLA0D00858g Chr4 complement(80327..81952) [1626 bp, 541 aa] {ON...    35   0.50 
TPHA0M00210 Chr13 complement(42336..43973) [1638 bp, 545 aa] {ON...    35   0.58 
NDAI0H02350 Chr8 complement(571624..573333) [1710 bp, 569 aa] {O...    35   0.59 
TBLA0B04020 Chr2 complement(920523..921419) [897 bp, 298 aa] {ON...    34   0.98 
KNAG0A06280 Chr1 (955994..957706) [1713 bp, 570 aa] {ON}               34   1.0  
Ecym_3014 Chr3 complement(28261..29916) [1656 bp, 551 aa] {ON} s...    33   1.7  
KLLA0B04994g Chr2 complement(453048..454244) [1197 bp, 398 aa] {...    32   4.6  
Kwal_23.4588 s23 (779393..781033) [1641 bp, 546 aa] {ON} YDL225W...    32   5.9  
TPHA0F01770 Chr6 (408734..410011) [1278 bp, 425 aa] {ON} Anc_2.1...    32   6.6  

>Kwal_27.10258 s27 complement(265612..267474) [1863 bp, 620 aa] {ON}
           YMR278W - Hypothetical ORF [contig 37] FULL
          Length = 620

 Score = 1261 bits (3262), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 608/620 (98%), Positives = 608/620 (98%)

Query: 1   MESIKVEIPADLKSSVESWFEHDKNEETRNEILQLVTEQNWNELHKRLDQRISFGTAGLR 60
           MESIKVEIPADLKSSVESWFEHDKNEETRNEILQLVTEQNWNELHKRLDQRISFGTAGLR
Sbjct: 1   MESIKVEIPADLKSSVESWFEHDKNEETRNEILQLVTEQNWNELHKRLDQRISFGTAGLR 60

Query: 61  SKMEAGFSRMNTLTVLQASQGLAKYIAEKFPENKTVAVGHDHRFNSRDFAEVTSVAFLQL 120
           SKMEAGFSRMNTLTVLQASQGLAKYIAEKFPENKTVAVGHDHRFNSRDFAEVTSVAFLQL
Sbjct: 61  SKMEAGFSRMNTLTVLQASQGLAKYIAEKFPENKTVAVGHDHRFNSRDFAEVTSVAFLQL 120

Query: 121 RFKVYSLGFNADPKKDAFVHTPMVPFAIDRLGASAGVMITASHNPKMDNGYKVYYSNGCQ 180
           RFKVYSLGFNADPKKDAFVHTPMVPFAIDRLGASAGVMITASHNPKMDNGYKVYYSNGCQ
Sbjct: 121 RFKVYSLGFNADPKKDAFVHTPMVPFAIDRLGASAGVMITASHNPKMDNGYKVYYSNGCQ 180

Query: 181 IIPPHDRLIAQSILDNLNPWERAWDCKAVIAEATEKGYFVDMKKPMVDHYVKEISDKLVS 240
           IIPPHDRLIAQSILDNLNPWERAWDCKAVIAEATEKGYFVDMKKPMVDHYVKEISDKLVS
Sbjct: 181 IIPPHDRLIAQSILDNLNPWERAWDCKAVIAEATEKGYFVDMKKPMVDHYVKEISDKLVS 240

Query: 241 SDIGDRSKPWFVYTPLHGVGFEIFERIASEVLGLVEGRDYWCVSEHKQPDPAFPTVSFPN 300
           SDIGDRSKPWFVYTPLHGVGFEIFERIASEVLGLVEGRDYWCVSEHKQPDPAFPTVSFPN
Sbjct: 241 SDIGDRSKPWFVYTPLHGVGFEIFERIASEVLGLVEGRDYWCVSEHKQPDPAFPTVSFPN 300

Query: 301 PEEXXXXXXXXXXXXKNGISFVLGNDPDADRFSAAVKHQGKWRQLTGNEIGFLFAQFVWE 360
           PEE            KNGISFVLGNDPDADRFSAAVKHQGKWRQLTGNEIGFLFAQFVWE
Sbjct: 301 PEEAGALDLAIALADKNGISFVLGNDPDADRFSAAVKHQGKWRQLTGNEIGFLFAQFVWE 360

Query: 361 KYQKESSEFKLENPLALINSTVSSQMIKKLAGVEKFHYEDTLTGFKWLGNRARQLESSGY 420
           KYQKESSEFKLENPLALINSTVSSQMIKKLAGVEKFHYEDTLTGFKWLGNRARQLESSGY
Sbjct: 361 KYQKESSEFKLENPLALINSTVSSQMIKKLAGVEKFHYEDTLTGFKWLGNRARQLESSGY 420

Query: 421 YVPFAYEEAIGFMFSDIVHDKDGVSAAVVFLQMLWSWKKQALSPIDVLQSAFGKYGVFKE 480
           YVPFAYEEAIGFMFSDIVHDKDGVSAAVVFLQMLWSWKKQALSPIDVLQSAFGKYGVFKE
Sbjct: 421 YVPFAYEEAIGFMFSDIVHDKDGVSAAVVFLQMLWSWKKQALSPIDVLQSAFGKYGVFKE 480

Query: 481 YNGYYTVPDLSLTDRIFSDIRSSYDSYPKHIGNQFDVVSFTDLTKGFQSDTADNTPRLPV 540
           YNGYYTVPDLSLTDRIFSDIRSSYDSYPKHIGNQFDVVSFTDLTKGFQSDTADNTPRLPV
Sbjct: 481 YNGYYTVPDLSLTDRIFSDIRSSYDSYPKHIGNQFDVVSFTDLTKGFQSDTADNTPRLPV 540

Query: 541 DPSSQMIQATLVPSTSGGSGAPLEIVRFTARGSGTEPKLKVYIEATSVEETRASDLARTT 600
           DPSSQMIQATLVPSTSGGSGAPLEIVRFTARGSGTEPKLKVYIEATSVEETRASDLARTT
Sbjct: 541 DPSSQMIQATLVPSTSGGSGAPLEIVRFTARGSGTEPKLKVYIEATSVEETRASDLARTT 600

Query: 601 WNVLRDEWFKPKETGLSTKF 620
           WNVLRDEWFKPKETGLSTKF
Sbjct: 601 WNVLRDEWFKPKETGLSTKF 620

>KLTH0C03872g Chr3 complement(337765..339630) [1866 bp, 621 aa] {ON}
           similar to uniprot|Q03262 Saccharomyces cerevisiae
           YMR278W Hypothetical ORF
          Length = 621

 Score =  909 bits (2349), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 429/620 (69%), Positives = 494/620 (79%)

Query: 1   MESIKVEIPADLKSSVESWFEHDKNEETRNEILQLVTEQNWNELHKRLDQRISFGTAGLR 60
           M     E+P DLK  VE+W ++DKNE+TR++I++LV +++W EL  RL+ RI+FGTAGLR
Sbjct: 2   MSLTNAEVPEDLKLGVEAWLKYDKNEQTRDQIIKLVEDKSWTELRNRLNFRITFGTAGLR 61

Query: 61  SKMEAGFSRMNTLTVLQASQGLAKYIAEKFPENKTVAVGHDHRFNSRDFAEVTSVAFLQL 120
           S+MEAGF+RMNTLTVLQASQGLAKYIA  FP+N +V VGHDHRFNS+DFAEVT VAFLQL
Sbjct: 62  SRMEAGFNRMNTLTVLQASQGLAKYIASNFPDNLSVVVGHDHRFNSKDFAEVTIVAFLQL 121

Query: 121 RFKVYSLGFNADPKKDAFVHTPMVPFAIDRLGASAGVMITASHNPKMDNGYKVYYSNGCQ 180
            FKVY LGF  D  +D  VHTPMVPF ID L AS G+MITASHNPKMDNGYKVYYSNGCQ
Sbjct: 122 GFKVYDLGFTEDASQDVVVHTPMVPFGIDHLRASGGIMITASHNPKMDNGYKVYYSNGCQ 181

Query: 181 IIPPHDRLIAQSILDNLNPWERAWDCKAVIAEATEKGYFVDMKKPMVDHYVKEISDKLVS 240
           IIPPHD+ I+QSIL NL PW+RAWDC AV AEA +    +D KK +VD YV  +   LV 
Sbjct: 182 IIPPHDQRISQSILANLEPWDRAWDCAAVKAEAVQSEMLIDAKKVLVDQYVDTVRRSLVI 241

Query: 241 SDIGDRSKPWFVYTPLHGVGFEIFERIASEVLGLVEGRDYWCVSEHKQPDPAFPTVSFPN 300
           +++     PWFVYTPLHGVGFEIFE+I S    L +GRDY CV E K PDP FPTVSFPN
Sbjct: 242 TNVNHTKAPWFVYTPLHGVGFEIFEKILSSAWRLGQGRDYLCVEEQKYPDPNFPTVSFPN 301

Query: 301 PEEXXXXXXXXXXXXKNGISFVLGNDPDADRFSAAVKHQGKWRQLTGNEIGFLFAQFVWE 360
           PEE            K+ I+FVLGNDPDADRFS A KH G+WRQLTGNEIGFLFAQ+ WE
Sbjct: 302 PEEKGALDKAIELAEKHDITFVLGNDPDADRFSVAAKHNGQWRQLTGNEIGFLFAQYKWE 361

Query: 361 KYQKESSEFKLENPLALINSTVSSQMIKKLAGVEKFHYEDTLTGFKWLGNRARQLESSGY 420
            Y+ ES +FK  NPLA+INSTVSSQMIKK+A VE FHYEDTLTGFKWLGNRAR+LE++GY
Sbjct: 362 TYRLESDKFKGTNPLAMINSTVSSQMIKKMAEVEGFHYEDTLTGFKWLGNRARELENAGY 421

Query: 421 YVPFAYEEAIGFMFSDIVHDKDGVSAAVVFLQMLWSWKKQALSPIDVLQSAFGKYGVFKE 480
           +VPFAYEEAIG+MFSD+VHDKDG+SAAVVFLQMLWSWK QAL+P DVLQ A+ KYGVFKE
Sbjct: 422 FVPFAYEEAIGYMFSDVVHDKDGISAAVVFLQMLWSWKAQALTPFDVLQRAYQKYGVFKE 481

Query: 481 YNGYYTVPDLSLTDRIFSDIRSSYDSYPKHIGNQFDVVSFTDLTKGFQSDTADNTPRLPV 540
           YNGYY VPDLSLTD++FS IRS +   P HIG +F V S+TDLT G+QS+T D+ PRLPV
Sbjct: 482 YNGYYIVPDLSLTDKVFSGIRSGFSLQPTHIGQEFRVESYTDLTTGYQSNTPDSEPRLPV 541

Query: 541 DPSSQMIQATLVPSTSGGSGAPLEIVRFTARGSGTEPKLKVYIEATSVEETRASDLARTT 600
           DPSSQMI ATL P++S G     E VRFTARGSGTEPKLKVYIEA S  E  AS LA+  
Sbjct: 542 DPSSQMITATLTPTSSTGRQGFSESVRFTARGSGTEPKLKVYIEAVSSSEELASALAKKA 601

Query: 601 WNVLRDEWFKPKETGLSTKF 620
           W+VLR EWFKP++TGL+T F
Sbjct: 602 WDVLRREWFKPEQTGLATNF 621

>SAKL0D01474g Chr4 complement(117178..119052) [1875 bp, 624 aa] {ON}
           similar to uniprot|Q03262 Saccharomyces cerevisiae
           YMR278W Hypothetical ORF
          Length = 624

 Score =  828 bits (2139), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 401/618 (64%), Positives = 464/618 (75%), Gaps = 6/618 (0%)

Query: 8   IPADLKSSVESWFEHDKNEETRNEILQLVTEQNWNELHKRLDQRISFGTAGLRSKMEAGF 67
           +P DLK SV  W  +DKN ETR+E+L LV  ++W ELH RLD+RISFGTAGLRS+MEAGF
Sbjct: 8   VPDDLKESVNLWLTYDKNPETRSELLNLVEGKHWEELHGRLDERISFGTAGLRSRMEAGF 67

Query: 68  SRMNTLTVLQASQGLAKYIAEKFPENKTVAVGHDHRFNSRDFAEVTSVAFLQLRFKVYSL 127
           SRMNTLTVLQASQGLA YI  +FPEN +V VGHDHR++S +FA VT  AFLQL FKVY L
Sbjct: 68  SRMNTLTVLQASQGLASYIKSQFPENLSVIVGHDHRYHSNEFARVTVTAFLQLGFKVYYL 127

Query: 128 GFNADPKKDAFVHTPMVPFAIDRLGASAGVMITASHNPKMDNGYKVYYSNGCQIIPPHDR 187
             ++    + FVHTPMVPF I++L ASAG+MITASHNPKMDNGYKVYYSNGCQIIPPHDR
Sbjct: 128 NLSSKDSTETFVHTPMVPFTINQLNASAGIMITASHNPKMDNGYKVYYSNGCQIIPPHDR 187

Query: 188 LIAQSILDNLNPWERAWDCKAVIAEATEKGYFVDMKKPMVDHYVKEISDKLVSSDIGDRS 247
           LI+++I  NL PW +AWDC  VI  A E G+  D+K+ +   Y+K +SD+LV   + D  
Sbjct: 188 LISETIDQNLVPWNKAWDCDEVIKTAIESGFLFDVKEKVTSKYIKTVSDELVRVPMLDCD 247

Query: 248 KPWFVYTPLHGVGFEIFERIASEVLGLVEGRDYWCVSEHKQPDPAFPTVSFPNPEEXXXX 307
           KPWFVYTP+HGVGFEIFE+IA   LGL EG+ Y CV E + PDPAFPTVSFPNPEE    
Sbjct: 248 KPWFVYTPMHGVGFEIFEQIALLALGLKEGKHYVCVPEQRCPDPAFPTVSFPNPEEKGAL 307

Query: 308 XXXXXXXXKNGISFVLGNDPDADRFSAAVKHQGKWRQLTGNEIGFLFAQFVWEKYQKESS 367
                   +  I  V+ NDPDADRFS AVK+  +W QLTGNEIGFLFA + W+ YQK   
Sbjct: 308 DLSIALAEEQDIRLVIANDPDADRFSVAVKNGDRWSQLTGNEIGFLFAYYQWQDYQKLGE 367

Query: 368 EFKLENPLALINSTVSSQMIKKLAGVEKFHYEDTLTGFKWLGNRARQLESSGYYVPFAYE 427
            FK ++PLA+INSTVSSQMIK LA  EKFHYEDTLTGFKWLGNRA +LE+ GYYVPFAYE
Sbjct: 368 SFKKQHPLAMINSTVSSQMIKSLAEAEKFHYEDTLTGFKWLGNRAFELETQGYYVPFAYE 427

Query: 428 EAIGFMFSDIVHDKDGVSAAVVFLQMLWSW-KKQALSPIDVLQSAFGKYGVFKEYNGYYT 486
           EAIG+MF ++ HDKDG+SAAVVFLQM   W  K  ++P+ VL   FGKYGVFKEYNGYY 
Sbjct: 428 EAIGYMFPEVEHDKDGISAAVVFLQMYCEWLSKDRMTPLQVLDEGFGKYGVFKEYNGYYI 487

Query: 487 VPDLSLTDRIFSDIRSSY----DSYPKHIGNQFDVVSFTDLTKGFQSDTADNTPRLPVDP 542
           VP LSLT  +F  IR  Y     +YP  IG++F V+SF DLT G+QSDT DN P LPVD 
Sbjct: 488 VPRLSLTKEVFDYIREDYTPSGHAYPPAIGSEFSVISFRDLTTGYQSDTIDNVPNLPVDA 547

Query: 543 SSQMIQATLVPSTSGGSGAPLEIVRFTARGSGTEPKLKVYIEATSVEETRASDLARTTWN 602
           SSQMI ATL PS +G      E VRFT RGSGTEPKLKVYIEA S +E RA  LAR TW 
Sbjct: 548 SSQMITATLRPS-NGKESTSGEQVRFTIRGSGTEPKLKVYIEAKSTDEKRAQHLARETWQ 606

Query: 603 VLRDEWFKPKETGLSTKF 620
           VLR EWF+P+ TGL TKF
Sbjct: 607 VLRREWFRPERTGLETKF 624

>YMR278W Chr13 (822763..824631) [1869 bp, 622 aa] {ON}
           PGM3Phosphoglucomutase, catalyzes interconversion of
           glucose-1-phosphate and glucose-6-phospate;
           transcription induced in response to stress; green
           fluorescent protein (GFP)-fusion protein localizes to
           the cytoplasm and nucleus; non-essential
          Length = 622

 Score =  730 bits (1885), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/630 (56%), Positives = 452/630 (71%), Gaps = 19/630 (3%)

Query: 1   MESIKVEIPADLKSSVESWFEHDKNEETRNEILQLVTEQNWNELHKRLDQRISFGTAGLR 60
           ++ I   +P+DLK  +  WF+ D+N +T  E+  L  + +WNELHKR D RI FGTAGLR
Sbjct: 2   LQGILETVPSDLKDPISLWFKQDRNPKTIEEVTALCKKSDWNELHKRFDSRIQFGTAGLR 61

Query: 61  SKMEAGFSRMNTLTVLQASQGLAKYIAEKFPENKTVAVGHDHRFNSRDFAEVTSVAFLQL 120
           S+M+AGFSRMNTL V+QASQGLA Y+ ++FP+N    VGHDHRF+S++FA  T+ AFL  
Sbjct: 62  SQMQAGFSRMNTLVVIQASQGLATYVRQQFPDNLVAVVGHDHRFHSKEFARATAAAFLLK 121

Query: 121 RFKVYSLGFNADPKKDAFVHTPMVPFAIDRLGASAGVMITASHNPKMDNGYKVYYSNGCQ 180
            FKV+ L  N D +   FVHTP+VPFA+D+L AS GVMITASHNPKMDNGYKVYYSNGCQ
Sbjct: 122 GFKVHYL--NPDHE---FVHTPLVPFAVDKLKASVGVMITASHNPKMDNGYKVYYSNGCQ 176

Query: 181 IIPPHDRLIAQSILDNLNPWERAWDCKAVIAEATEKGYFVDMKKPMVDHYVKEISDKLVS 240
           IIPPHD  I+ SI  NL PW   WD   V+ +A ++G  +  ++ M+  Y++E+S  LV 
Sbjct: 177 IIPPHDHAISDSIDANLEPWANVWDFDDVLNKALKQGKLMYSREEMLKLYLEEVSKNLVE 236

Query: 241 SD---IGDRSKPWFVYTPLHGVGFEIFERIASEVLGLVEGRDYWCVSEHKQPDPAFPTVS 297
            +   +  ++KPWFVYTP+HGVGF+IF  I  + L LVEG+DY CV E + PDP+FPTV 
Sbjct: 237 INPLKLEVKAKPWFVYTPMHGVGFDIFSTIVKKTLCLVEGKDYLCVPEQQNPDPSFPTVG 296

Query: 298 FPNPEEXXXXXXXXXXXXKNGISFVLGNDPDADRFSAAVK--HQGKWRQLTGNEIGFLFA 355
           FPNPEE            K+ I  ++ NDPDADRFS AVK    G+WRQLTGNEIGFLFA
Sbjct: 297 FPNPEEKGALDIGINLAEKHDIDLLVANDPDADRFSVAVKDMQSGEWRQLTGNEIGFLFA 356

Query: 356 QFVWEKYQKESSEFKLENPLALINSTVSSQMIKKLAGVEKFHYEDTLTGFKWLGNRARQL 415
            + ++KY+    EF+  +PLA++NSTVSSQMIKK+A +E FHYEDTLTGFKW+GNRA  L
Sbjct: 357 FYEYQKYKSMDKEFQHVHPLAMLNSTVSSQMIKKMAEIEGFHYEDTLTGFKWIGNRAILL 416

Query: 416 ESSGYYVPFAYEEAIGFMFSDIVHDKDGVSAAVVFLQMLWSWK-KQALSPIDVLQSAFGK 474
           E  GYYVPF +EEAIG+MF  + HDKDG+SA++VFLQ    WK    L P++VL++ F K
Sbjct: 417 EKKGYYVPFGFEEAIGYMFPAMEHDKDGISASIVFLQAYCKWKIDHNLDPLNVLENGFKK 476

Query: 475 YGVFKEYNGYYTVPDLSLTDRIFSDIRSSYD----SYPKHIGNQFDVVSFTDLTKGFQSD 530
           YGVFKEYNGYY VP+ ++T  IF  IR+ Y     SYP  IG + +V+ + DLT G+QSD
Sbjct: 477 YGVFKEYNGYYVVPNPTVTKDIFDYIRNVYTPEGASYPSSIGEEIEVLYYRDLTTGYQSD 536

Query: 531 TADNTPRLPVDPSSQMIQATLVPSTSGGSGAPLEIVRFTARGSGTEPKLKVYIEATSVEE 590
           T ++ P LPVDP+SQMI  +  PS    +G+  E +RFT RGSGTEPKLKVYIEA + EE
Sbjct: 537 TINHKPTLPVDPTSQMITVSARPS----NGSENEHIRFTIRGSGTEPKLKVYIEACANEE 592

Query: 591 TRASDLARTTWNVLRDEWFKPKETGLSTKF 620
            RAS LA+ TWNVLR EWF+P E  + TKF
Sbjct: 593 QRASFLAKLTWNVLRREWFRPDEMNIVTKF 622

>TPHA0I00250 Chr9 (46554..48443) [1890 bp, 629 aa] {ON} Anc_8.840
           YMR278W
          Length = 629

 Score =  716 bits (1848), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 352/633 (55%), Positives = 449/633 (70%), Gaps = 24/633 (3%)

Query: 1   MESIKVEIPADLKSSVESWFEHDKNEETRNEILQLVTEQNWNELHKRLDQRISFGTAGLR 60
           +E++   IP DLK  +  WF +D N+ET +E+ +L   ++ +ELHKR DQRI FGTAGLR
Sbjct: 8   IENLLSSIPEDLKEKIRVWFRYDDNQETVDEVKELCVNKSLDELHKRFDQRIVFGTAGLR 67

Query: 61  SKMEAGFSRMNTLTVLQASQGLAKYIAEKFPENKTVAVGHDHRFNSRDFAEVTSVAFLQL 120
           S+MEAGF+RMN LTVLQ++QGLA YI  +FP N T  VGHDHR++S++FA++T+  FL  
Sbjct: 68  SRMEAGFNRMNALTVLQSTQGLASYIKSQFPSNLTAVVGHDHRYHSKEFAQITAAVFLNA 127

Query: 121 RFKVYSLGFNADPKKDAFVHTPMVPFAIDRLGASAGVMITASHNPKMDNGYKVYYSNGCQ 180
            FKVY L  N     D FVHTPMVPF I+   AS GVMITASHNP+MDNGYKVYY+NGCQ
Sbjct: 128 GFKVYYLNPN-----DEFVHTPMVPFGINLYSASIGVMITASHNPEMDNGYKVYYNNGCQ 182

Query: 181 IIPPHDRLIAQSILDNLNPWERAWDCKAVIAEATEKGYFVDMKKPMVDHYVKEISDKLVS 240
           IIPPHD+ IA+ I  NL P    W+ +AVI++A E    +  K+ ++  Y+  +   ++ 
Sbjct: 183 IIPPHDKNIAECIEKNLEPLSDNWNTEAVISKAIENVKLIYSKEDVLQQYMLNLDKYIIP 242

Query: 241 SDIG-----DRSKPWFVYTPLHGVGFEIFERIASEVLGLVEGRDYWCVSEHKQPDPAFPT 295
            +I         KPWFVYTP+HGVG++IF RI+S  L LVE  DY CV E   PDP+FPT
Sbjct: 243 KNISLGTTIKGKKPWFVYTPMHGVGYQIFHRISSTCLNLVEDIDYVCVKEQIVPDPSFPT 302

Query: 296 VSFPNPEEXXXXXXXXXXXXKNGISFVLGNDPDADRFSAAVKH--QGKWRQLTGNEIGFL 353
           VSFPNPEE            K+ I  V+ NDPDADRFS AV++    +++QLTGNEIGFL
Sbjct: 303 VSFPNPEEKGALDLGIKYAKKHNIDLVVANDPDADRFSVAVRNPLTDEFQQLTGNEIGFL 362

Query: 354 FAQFVWEKYQKESSEFKLENPLALINSTVSSQMIKKLAGVEKFHYEDTLTGFKWLGNRAR 413
           FA F+WE+Y    ++FK + PLA+INSTVSSQMIKK+A VE F+YEDTLTGFKW+GN+AR
Sbjct: 363 FAYFLWEQYSMLPADFKDKFPLAMINSTVSSQMIKKMAEVEGFYYEDTLTGFKWIGNKAR 422

Query: 414 QLESSGYYVPFAYEEAIGFMFSDIVHDKDGVSAAVVFLQMLWSW---KKQALSPIDVLQS 470
           +LE  GYYVPF +EEAIG+MF  +  DKDG++A VVFLQ  + W    KQ+L   D++++
Sbjct: 423 ELEKEGYYVPFGFEEAIGYMFPKMECDKDGITATVVFLQAYYGWCMNNKQSL--FDIIET 480

Query: 471 AFGKYGVFKEYNGYYTVPDLSLTDRIFSDIRSSYD---SYPKHIGNQFDVVSFTDLTKGF 527
            F KYGVFKEYNGYY V DLSLT  IF +IR + +    Y  HIG +F V++F DLT G+
Sbjct: 481 GFKKYGVFKEYNGYYIVNDLSLTKIIFDNIRENKNDKEKYVSHIGTEFKVITFRDLTLGY 540

Query: 528 QSDTADNTPRLPVDPSSQMIQATLVPSTSGGSGAPLEIVRFTARGSGTEPKLKVYIEATS 587
           QSDT  N P LPVDPSSQMI  T++P++   +G+    VRFT RGSGTEPKLKVYIEA +
Sbjct: 541 QSDTIGNVPTLPVDPSSQMITMTIIPTSLPENGS----VRFTIRGSGTEPKLKVYIEANA 596

Query: 588 VEETRASDLARTTWNVLRDEWFKPKETGLSTKF 620
             E  A+ LA+ TW+VL+ EWF  ++TGL+T F
Sbjct: 597 KTEAEANRLAKLTWDVLKREWFSSEKTGLTTNF 629

>TDEL0B00570 Chr2 complement(109270..111162) [1893 bp, 630 aa] {ON}
           Anc_8.840 YMR278W
          Length = 630

 Score =  713 bits (1841), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 360/626 (57%), Positives = 432/626 (69%), Gaps = 25/626 (3%)

Query: 8   IPADLKSSVESWFEHDKNEETRNEILQLVTEQNWNELHKRLDQRISFGTAGLRSKMEAGF 67
           +P DL   V SW   D N++TR EIL L   ++W ELHKRLD RI FGTAGLRS+MEAGF
Sbjct: 17  VPTDLSQLVASWLSQDGNKQTRLEILNLCKAKDWLELHKRLDTRILFGTAGLRSRMEAGF 76

Query: 68  SRMNTLTVLQASQGLAKYIAEKFPENKTVAVGHDHRFNSRDFAEVTSVAFLQLRFKVYSL 127
           SRMNTL VLQA+QGLA++I ++FP+  T  VGHDHRFNS++FA  T   FLQ  FKV  L
Sbjct: 77  SRMNTLVVLQATQGLAQHIKKQFPDALTAVVGHDHRFNSQEFALATVATFLQAGFKVIFL 136

Query: 128 GFNADPKKDAFVHTPMVPFAIDRLGASAGVMITASHNPKMDNGYKVYYSNGCQIIPPHDR 187
                   D FVHTP+VPF ++ +GAS GVMITASHNPKMDNGYKVYYSNGCQIIPPHD 
Sbjct: 137 N-----DGDKFVHTPIVPFTVNEVGASVGVMITASHNPKMDNGYKVYYSNGCQIIPPHDS 191

Query: 188 LIAQSILDNLNPWERAWDCKAVIAEATEKGYFVDMKKPMVDHYVKEISDKLV---SSDIG 244
            IAQSI +NL  W +AW    ++ E  +    V   + M++ Y K++   LV   +    
Sbjct: 192 EIAQSIEENLTLWPKAWKWDELLKEGLDTKCLVYAGEEMIERYTKKMGQSLVDRTTISAE 251

Query: 245 DRSKPWFVYTPLHGVGFEIFERIASEVLGLVEGRDYWCVSEHKQPDPAFPTVSFPNPEEX 304
              KPWFVYTP+HGVG++IF +IA E + L+ GRDY CV E + PDP+FPTV FPNPEE 
Sbjct: 252 KEGKPWFVYTPIHGVGYDIFRQIAEETMNLINGRDYLCVKEQQLPDPSFPTVPFPNPEEK 311

Query: 305 XXXXXXXXXXXKNGISFVLGNDPDADRFSAAVKHQ--GKWRQLTGNEIGFLFAQFVWEKY 362
                      KNGIS VL NDPDADRFSAAVK    G WRQLTGNEIG LFA + ++KY
Sbjct: 312 GALDMAISVADKNGISLVLANDPDADRFSAAVKDNKTGTWRQLTGNEIGALFAFYEFQKY 371

Query: 363 QKESSEFKLENPLALINSTVSSQMIKKLAGVEKFHYEDTLTGFKWLGNRARQLESSGYYV 422
           QK++ E+K ++PLA++NSTVSSQ+I K+A +E+FHY DTLTGFKW+GNR   LE+  YYV
Sbjct: 372 QKKNEEYKEKHPLAMLNSTVSSQLIMKMAEIEQFHYIDTLTGFKWIGNRTLDLEAMNYYV 431

Query: 423 PFAYEEAIGFMFSDIVHDKDGVSAAVVFLQMLWSW----KKQALSPIDVLQSAFGKYGVF 478
           PF +EEAIG+MF  + HDKDG+SAA VFLQM   W    KK  L+   VL+  F KYGVF
Sbjct: 432 PFGFEEAIGYMFPVMEHDKDGISAASVFLQMYRKWLVGSKKTLLT---VLEDIFEKYGVF 488

Query: 479 KEYNGYYTVPDLSLTDRIFSDIRSSY----DSYPKHIGNQFDVVSFTDLTKGFQSDTADN 534
           KEYNGYY+V D  +   +F  IR+ Y    D YP  IG +  V  F DLT G+QSDT + 
Sbjct: 489 KEYNGYYSVNDPKVIKEVFDFIRNDYSETHDPYPSRIGEELKVNKFRDLTLGYQSDTVNQ 548

Query: 535 TPRLPVDPSSQMIQATLVPSTSGGSGAPLEIVRFTARGSGTEPKLKVYIEATSVEETRAS 594
            P LPVDP+SQMI A     T      P E VRFT RGSGTEPKLKVYIEA S  E RAS
Sbjct: 549 RPDLPVDPNSQMITAW----TKVNGAKPYESVRFTIRGSGTEPKLKVYIEACSKSEERAS 604

Query: 595 DLARTTWNVLRDEWFKPKETGLSTKF 620
           +LA+ TW VL+ EWF+P  TGL+T F
Sbjct: 605 ELAQLTWRVLKREWFRPDVTGLTTTF 630

>Suva_13.466 Chr13 (805414..807282) [1869 bp, 622 aa] {ON} YMR278W
           (REAL)
          Length = 622

 Score =  711 bits (1835), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 352/623 (56%), Positives = 440/623 (70%), Gaps = 19/623 (3%)

Query: 8   IPADLKSSVESWFEHDKNEETRNEILQLVTEQNWNELHKRLDQRISFGTAGLRSKMEAGF 67
           +P+DLK  +  WF+ D+N ET  E+  L    +W+ELHKR D RI FGTAGLRS+M+AGF
Sbjct: 9   VPSDLKGPISLWFDQDRNPETIEEVTTLCKNSDWDELHKRFDTRIQFGTAGLRSEMQAGF 68

Query: 68  SRMNTLTVLQASQGLAKYIAEKFPENKTVAVGHDHRFNSRDFAEVTSVAFLQLRFKVYSL 127
           SRMNTL ++QA+QGLA YI ++FP+N  V VGHDHRF+S++FA  T+ AFL   FKV+ L
Sbjct: 69  SRMNTLVIIQATQGLATYIKQQFPDNLVVVVGHDHRFHSKEFARATATAFLLKGFKVHYL 128

Query: 128 GFNADPKKDAFVHTPMVPFAIDRLGASAGVMITASHNPKMDNGYKVYYSNGCQIIPPHDR 187
             N D     FVHTP+VPFA+D+L AS GVMITASHNPKMDNGYKVYYSNGCQIIPPHD 
Sbjct: 129 --NPD---HEFVHTPLVPFAVDKLKASVGVMITASHNPKMDNGYKVYYSNGCQIIPPHDH 183

Query: 188 LIAQSILDNLNPWERAWDCKAVIAEATEKGYFVDMKKPMVDHYVKEISDKLVSSD---IG 244
            I+ SI  NL PW   W    V+ +A ++G  +  ++ M++ Y KE+S  LV ++   + 
Sbjct: 184 AISDSIDMNLEPWANVWKFSDVLNKALKQGKLMYSREEMLNLYSKEVSKTLVETNPLKLE 243

Query: 245 DRSKPWFVYTPLHGVGFEIFERIASEVLGLVEGRDYWCVSEHKQPDPAFPTVSFPNPEEX 304
            ++KPWFVYTP+HGVGF IF  I  + + LVEG DY CV E + PDP+FPTV FPNPEE 
Sbjct: 244 IKAKPWFVYTPMHGVGFNIFSTIVKKTMSLVEGEDYLCVPEQQNPDPSFPTVGFPNPEEK 303

Query: 305 XXXXXXXXXXXKNGISFVLGNDPDADRFSAAVK--HQGKWRQLTGNEIGFLFAQFVWEKY 362
                      ++ I+ ++ NDPDADRFS AVK     KWRQLTGNEIGFLFA F +++Y
Sbjct: 304 GALDIGMRLAEEHDINLLVANDPDADRFSIAVKDTQSSKWRQLTGNEIGFLFAFFEFQRY 363

Query: 363 QKESSEFKLENPLALINSTVSSQMIKKLAGVEKFHYEDTLTGFKWLGNRARQLESSGYYV 422
           + +  EF+  +PLA+++STVSSQMIKK+A VE F YEDTLTGFKW+GNRA  LE  GYYV
Sbjct: 364 KNKDEEFQRSHPLAMLSSTVSSQMIKKMAEVEGFLYEDTLTGFKWIGNRAIILEKEGYYV 423

Query: 423 PFAYEEAIGFMFSDIVHDKDGVSAAVVFLQMLWSWKKQA-LSPIDVLQSAFGKYGVFKEY 481
           PF +EEAIG+MF  + HDKDG+SAAVV LQ    WK  + L PID+L++ F KYGVFKEY
Sbjct: 424 PFGFEEAIGYMFPAMEHDKDGISAAVVLLQAYCKWKIDSNLDPIDILENGFQKYGVFKEY 483

Query: 482 NGYYTVPDLSLTDRIFSDIRSSYD----SYPKHIGNQFDVVSFTDLTKGFQSDTADNTPR 537
           NGYY VP   +T  IF  IR+ Y      YP  IG + +VV + DLT G+QSDT D+ P 
Sbjct: 484 NGYYVVPSPLVTTEIFEYIRNVYTPTGVPYPPSIGEEIEVVYYRDLTTGYQSDTPDHKPV 543

Query: 538 LPVDPSSQMIQATLVPSTSGGSGAPLEIVRFTARGSGTEPKLKVYIEATSVEETRASDLA 597
           LPVDP+SQMI  +  PS   G+    E +RFT RGSGTEPKLKVYIEA +  E RAS LA
Sbjct: 544 LPVDPTSQMITLSGKPSDGNGN----EHIRFTIRGSGTEPKLKVYIEACADNEKRASYLA 599

Query: 598 RTTWNVLRDEWFKPKETGLSTKF 620
           + TW+VLR  WF+P+   ++T F
Sbjct: 600 KLTWDVLRRGWFRPEIMNITTDF 622

>KLLA0D01573g Chr4 complement(139183..141006) [1824 bp, 607 aa] {ON}
           similar to uniprot|Q03262 Saccharomyces cerevisiae
           YMR278W Hypothetical ORF
          Length = 607

 Score =  710 bits (1832), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/620 (56%), Positives = 437/620 (70%), Gaps = 30/620 (4%)

Query: 8   IPADLKSSVESWFEHDKNEETRNEILQLVTEQNWNELHKRLDQRISFGTAGLRSKMEAGF 67
           +P+DL+  V +W ++DK EETRNEILQL  + +  ELHKRLD  I+FGTAGLR +MEAGF
Sbjct: 10  LPSDLQGKVRNWLKYDKVEETRNEILQLCLKGDITELHKRLDTMIAFGTAGLRGRMEAGF 69

Query: 68  SRMNTLTVLQASQGLAKYIAEKFPENKTVAVGHDHRFNSRDFAEVTSVAFLQLRFKVYSL 127
           +RMN LTV QASQGLAKYI ++FPEN TV VGHDHR NSR F +VT   FLQL FKV+ L
Sbjct: 70  NRMNALTVKQASQGLAKYIKKQFPENLTVVVGHDHRHNSRLFGKVTVDTFLQLGFKVFHL 129

Query: 128 GFNADPKKDAFVHTPMVPFAIDRLGASAGVMITASHNPKMDNGYKVYYSNGCQIIPPHDR 187
             N + +K + VHTP+VPF ++  GAS G+MITASHNPKMDNGYKVYY+NGCQIIPPHD+
Sbjct: 130 --NHENEK-SLVHTPLVPFTVNATGASVGIMITASHNPKMDNGYKVYYTNGCQIIPPHDK 186

Query: 188 LIAQSILDNLNPWERAWDCKAVIAEATEKGYFVDMKKPMVDHYVKEISDKLVSSDIGDRS 247
           LIA+SI+ NL P+            + + G  +D K+ M   Y+  I   L+   +  ++
Sbjct: 187 LIAESIIHNLEPFS-----------SPQTGTIIDCKEKMTKKYIDAIGSTLIDGAVNKKT 235

Query: 248 -KPWFVYTPLHGVGFEIFERIASEVLGLVEGRDYWCVSEHKQPDPAFPTVSFPNPEEXXX 306
            +PWFVYTP+HGVGFEIFE I+ ++L L EG+DY  V E K PD  FPTVSFPNPEE   
Sbjct: 236 NEPWFVYTPMHGVGFEIFESISKQLLSLEEGKDYLVVEEQKYPDADFPTVSFPNPEEKGA 295

Query: 307 XXXXXXXXXKNG-ISFVLGNDPDADRFSAAVKHQGK-----WRQLTGNEIGFLFAQFVWE 360
                    KN  +  ++ NDPDADRFS AV+   +     WRQLTGNEIGFLFA + WE
Sbjct: 296 LDLAVEYGRKNDTVDLIIANDPDADRFSVAVRDNDQNTTTAWRQLTGNEIGFLFAYYEWE 355

Query: 361 KYQKESSEFKLENPLALINSTVSSQMIKKLAGVEKFHYEDTLTGFKWLGNRARQLESSGY 420
           +Y+       ++ PLA++NSTVSSQMIK++A +E FHYEDTLTGFKWLGNRA +LE  GY
Sbjct: 356 RYKHSP----IDEPLAMLNSTVSSQMIKRMAEIEGFHYEDTLTGFKWLGNRALELEQEGY 411

Query: 421 YVPFAYEEAIGFMFSDIVHDKDGVSAAVVFLQMLWSWKKQALSPIDVLQSAFGKYGVFKE 480
           Y PFAYEEAIG+MFS +VHDKDG+SAA+VFLQ    W+    + +D+L +A  KYG FKE
Sbjct: 412 YTPFAYEEAIGYMFSSVVHDKDGISAAIVFLQAYSKWRASGQTVLDILATASLKYGHFKE 471

Query: 481 YNGYYTVPDLSLTDRIFSDIRSSYDSYPKHIGNQFDVVSFTDLTKGFQSDTADNTPRLPV 540
           +NGYY VPDL++T ++F  IRS    YPK +G+ F+++ F DLT G+QSDT D+ P L  
Sbjct: 472 FNGYYIVPDLAITKQVFDAIRSIESPYPKKLGSSFEIIKFRDLTNGYQSDTPDHIPELAS 531

Query: 541 DPSSQMIQATLVPSTSGGSGAPLEIVRFTARGSGTEPKLKVYIEATSVEETRASDLARTT 600
           DPSSQMI   ++         P   VRFT RGSGTEPKLKVYIEA +  E  +  LA+ T
Sbjct: 532 DPSSQMITCEMLLVEQ-----PTSRVRFTIRGSGTEPKLKVYIEARTNTEPNSIALAKFT 586

Query: 601 WNVLRDEWFKPKETGLSTKF 620
           W+VLR EWFKP+ TGL T F
Sbjct: 587 WDVLRQEWFKPELTGLLTPF 606

>Smik_13.491 Chr13 (805767..807635) [1869 bp, 622 aa] {ON} YMR278W
           (REAL)
          Length = 622

 Score =  710 bits (1832), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/623 (55%), Positives = 447/623 (71%), Gaps = 19/623 (3%)

Query: 8   IPADLKSSVESWFEHDKNEETRNEILQLVTEQNWNELHKRLDQRISFGTAGLRSKMEAGF 67
           +P++LK ++  WFE D+N ET  E+  L  + +WNELH+R D RI FGTAGLRS+M+AGF
Sbjct: 9   VPSNLKEAISLWFEQDQNPETIEEVTALCKKSDWNELHRRFDSRIQFGTAGLRSQMQAGF 68

Query: 68  SRMNTLTVLQASQGLAKYIAEKFPENKTVAVGHDHRFNSRDFAEVTSVAFLQLRFKVYSL 127
           +RMNTL ++QASQGLA Y  ++FP N    VGHDHRF+S++FA  T+ AFL   FKV+ L
Sbjct: 69  NRMNTLVIIQASQGLATYAKQQFPNNLVAVVGHDHRFHSKEFARATATAFLLKGFKVHYL 128

Query: 128 GFNADPKKDAFVHTPMVPFAIDRLGASAGVMITASHNPKMDNGYKVYYSNGCQIIPPHDR 187
             N D +   FVHTP+VPFA+D+L AS GVM+TASHNPKMDNGYKVYYSNGCQIIPPHD 
Sbjct: 129 --NPDHE---FVHTPLVPFAVDKLKASVGVMVTASHNPKMDNGYKVYYSNGCQIIPPHDH 183

Query: 188 LIAQSILDNLNPWERAWDCKAVIAEATEKGYFVDMKKPMVDHYVKEISDKLVSSD---IG 244
            I+ SI  NL PW   W+   V+ +  ++G  +  ++ ++  Y+ E+S  LV +D     
Sbjct: 184 AISDSIDMNLEPWANVWNFDDVLNKGLKQGKLMYSREEILKLYLGEVSKNLVGTDPLKFE 243

Query: 245 DRSKPWFVYTPLHGVGFEIFERIASEVLGLVEGRDYWCVSEHKQPDPAFPTVSFPNPEEX 304
            ++KPWFVYTP+HGVGF+IF  I  + + LVEG+DY CV E ++PDP+FPTV+FPNPEE 
Sbjct: 244 VKAKPWFVYTPMHGVGFDIFSTIVKKTMSLVEGKDYLCVPEQQEPDPSFPTVAFPNPEEK 303

Query: 305 XXXXXXXXXXXKNGISFVLGNDPDADRFSAAVK--HQGKWRQLTGNEIGFLFAQFVWEKY 362
                       +GI+ ++ NDPDADRFS A+K    G+WRQLTGNEIGFLFA F ++K+
Sbjct: 304 GALDLGINLAENHGINLLIANDPDADRFSVAIKDIRSGEWRQLTGNEIGFLFAIFEFQKF 363

Query: 363 QKESSEFKLENPLALINSTVSSQMIKKLAGVEKFHYEDTLTGFKWLGNRARQLESSGYYV 422
           +    +F+  +PLA+++STVSSQMIKK+A VE FHYE+TLTGFKW+GNRA  LE  GYYV
Sbjct: 364 KSMEKQFQHAHPLAMLSSTVSSQMIKKMAEVEGFHYEETLTGFKWIGNRAILLEKEGYYV 423

Query: 423 PFAYEEAIGFMFSDIVHDKDGVSAAVVFLQMLWSWK-KQALSPIDVLQSAFGKYGVFKEY 481
           PF +EEAIG+MF  + HDKDG+SA++VFLQ    WK    L PI +L+  F KYGVFKEY
Sbjct: 424 PFGFEEAIGYMFPAMEHDKDGLSASIVFLQAYCQWKIDHNLDPISILEDGFKKYGVFKEY 483

Query: 482 NGYYTVPDLSLTDRIFSDIRSSYD----SYPKHIGNQFDVVSFTDLTKGFQSDTADNTPR 537
           NGYY V    +T+ IF  IR++Y     SYP  IG + +V+++ DLT G+QSDT+++ P 
Sbjct: 484 NGYYIVSSPIVTNEIFDYIRNAYTPKGVSYPSSIGKEIEVLNYRDLTIGYQSDTSNHKPT 543

Query: 538 LPVDPSSQMIQATLVPSTSGGSGAPLEIVRFTARGSGTEPKLKVYIEATSVEETRASDLA 597
           LP+DPSSQMI  +  PS  G  G   E +RFT RGSGTEPK+KVYIEA + EE RA+ LA
Sbjct: 544 LPIDPSSQMITVSAKPS-DGNEG---EHIRFTIRGSGTEPKIKVYIEACADEEQRATFLA 599

Query: 598 RTTWNVLRDEWFKPKETGLSTKF 620
           + TWNVL+ EWF+P++  + T F
Sbjct: 600 KLTWNVLKREWFRPEKMDIVTHF 622

>NCAS0C00410 Chr3 complement(62893..64770) [1878 bp, 625 aa] {ON}
           Anc_8.840 YMR278W
          Length = 625

 Score =  709 bits (1831), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 349/624 (55%), Positives = 432/624 (69%), Gaps = 20/624 (3%)

Query: 8   IPADLKSSVESWFEHDKNEETRNEILQLVTEQNWNELHKRLDQRISFGTAGLRSKMEAGF 67
            P +L+  +  W   D+NEETR E+LQL   +NW ELH+R D RI FGTAGLRS+MEAGF
Sbjct: 11  CPENLREPINLWLRLDQNEETRKEVLQLCENKNWPELHQRFDTRIVFGTAGLRSRMEAGF 70

Query: 68  SRMNTLTVLQASQGLAKYIAEKFPENKTVAVGHDHRFNSRDFAEVTSVAFLQLRFKVYSL 127
           SRMN+L +LQ++QGLA YI E+FP N T  VGHDHRF+S++FA VT+  FL+  FKV+ L
Sbjct: 71  SRMNSLIILQSTQGLANYIKEQFPNNLTAVVGHDHRFHSKEFAIVTASIFLRAGFKVFYL 130

Query: 128 GFNADPKKDAFVHTPMVPFAIDRLGASAGVMITASHNPKMDNGYKVYYSNGCQIIPPHDR 187
                   D FVHTP+VPF++  L AS GVMITASHNPKMDNGYKVYY N CQIIPPHD+
Sbjct: 131 T-----PDDQFVHTPLVPFSVLNLKASVGVMITASHNPKMDNGYKVYYDNACQIIPPHDK 185

Query: 188 LIAQSILDNLNPWERAWDCKAVIAEATEKGYFVDMKKPMVDHYVKEISDKLVSSD---IG 244
            IA+ I  NL PW  +WD  A   +  E    V +K  M + Y+ ++   L+ S    + 
Sbjct: 186 NIAEMIQKNLEPWSTSWDWDATFKKGLETNKLVFIKDLMTEKYLMQMKRVLIHSSHLSLK 245

Query: 245 DRSKPWFVYTPLHGVGFEIFERIASEVLGLVEGRDYWCVSEHKQPDPAFPTVSFPNPEEX 304
           D   P+FVYTP+HGVG EIF +++SE+L L E  DY  VSE + PDP+FPTVSFPNPEE 
Sbjct: 246 DVKTPFFVYTPMHGVGAEIFAKVSSELLNLHENVDYLVVSEQRLPDPSFPTVSFPNPEEK 305

Query: 305 XXXXXXXXXXXKNGISFVLGNDPDADRFSAAV--KHQGKWRQLTGNEIGFLFAQFVWEKY 362
                      +NG+S V+ NDPDADRFSAAV  K  GKWRQLTGNEIGFL   + ++ Y
Sbjct: 306 GALSLAIKLAQENGLSLVIANDPDADRFSAAVLNKKTGKWRQLTGNEIGFLLGYYEFQLY 365

Query: 363 QKESSEFKLENPLALINSTVSSQMIKKLAGVEKFHYEDTLTGFKWLGNRARQLESSGYYV 422
           +++   F+  +PLA+INSTVSSQMIK++A +  FHYEDTLTGFKW+GN+A  L   GYYV
Sbjct: 366 EQQDVAFRKTHPLAMINSTVSSQMIKRMADMNGFHYEDTLTGFKWIGNKAIDLRQEGYYV 425

Query: 423 PFAYEEAIGFMFSDIVHDKDGVSAAVVFLQMLWSWKKQ-ALSPIDVLQSAFGKYGVFKEY 481
           PF +EEAIG+MF D+  DKDG+SAA VFLQ    W  Q  +SP D+++  FGK+GVFKEY
Sbjct: 426 PFGFEEAIGYMFPDMECDKDGISAATVFLQAYCHWMNQYQMSPFDIMEEGFGKFGVFKEY 485

Query: 482 NGYYTVPDLSLTDRIFSDIRSSYDS----YPKHIGNQFDVVSFTDLTKGFQSDTADNTPR 537
           NGYY + DLS+T  +F  IR  Y S    YP  IGN+  V  F DLT G+QS+T DN P 
Sbjct: 486 NGYYILKDLSITKTVFDFIRHEYPSTNKKYPSEIGNELIVTVFRDLTVGYQSNTKDNIPN 545

Query: 538 LPVDPSSQMIQATLVPST-SGGSGAPLEIVRFTARGSGTEPKLKVYIEATSVEETRASDL 596
           LPVDP+SQMI     PS  S   G     VR T RGSGTEPKLKVYIEA S  E  A++L
Sbjct: 546 LPVDPTSQMITVEAKPSEFSNLEGT----VRLTMRGSGTEPKLKVYIEACSKSEESATNL 601

Query: 597 ARTTWNVLRDEWFKPKETGLSTKF 620
           AR+TW++L+ EWF+P+ TGL+T F
Sbjct: 602 ARSTWDILKREWFRPEVTGLTTSF 625

>Ecym_4611 Chr4 (1191367..1193259) [1893 bp, 630 aa] {ON} similar to
           Ashbya gossypii ABL126W
          Length = 630

 Score =  707 bits (1826), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 347/621 (55%), Positives = 433/621 (69%), Gaps = 11/621 (1%)

Query: 8   IPADLKSSVESWFEHDKNEETRNEILQLVTEQNWNELHKRLDQRISFGTAGLRSKMEAGF 67
           IP DL+  ++ WF++DKN +T  EI  LV  QNWNEL  RL QRISFGTAGLR++MEAGF
Sbjct: 13  IPDDLRDKIDKWFKYDKNPQTTAEIRSLVDSQNWNELRGRLCQRISFGTAGLRARMEAGF 72

Query: 68  SRMNTLTVLQASQGLAKYIAEKFPENKTVAVGHDHRFNSRDFAEVTSVAFLQLRFKVYSL 127
           +RMNTLTV+QASQGLA YI  +FP N  V VGHDHR+NS+ FAEV   AFLQL F+VY L
Sbjct: 73  ARMNTLTVIQASQGLATYIKSQFPNNLKVVVGHDHRYNSKSFAEVAIAAFLQLGFEVYYL 132

Query: 128 GFNADPKK-DAFVHTPMVPFAIDRL--GASAGVMITASHNPKMDNGYKVYYSNGCQIIPP 184
            +    K  +++VHTPMVPF +  +  GAS G+MITASHNPKMDNGYKVYYSNGCQI PP
Sbjct: 133 NYVPSNKDVESYVHTPMVPFTVSNIEGGASCGIMITASHNPKMDNGYKVYYSNGCQITPP 192

Query: 185 HDRLIAQSILDNLNPWERAWDCKAVIAEATEKGYFVDMKKPMVDHYVKEISDKLVSSD-I 243
           HD+ IA  I  NL PW++AWD + +I +A       D+K+ ++ +YV+ I   LV+++ +
Sbjct: 193 HDKKIASEIDANLVPWDQAWDAQKLIEDARNNNRLHDVKQELIKNYVQRIQSSLVTTNSL 252

Query: 244 GDRSKPWFVYTPLHGVGFEIFERIASEVLGLVEGRDYWCVSEHKQPDPAFPTVSFPNPEE 303
            D  K WFVYTP+HGVG+EIF  I +  L L E   Y  V   K PDP F TVSFPNPEE
Sbjct: 253 ADCGKNWFVYTPMHGVGYEIFNNIVTNTLHLKEDEHYLVVGAQKFPDPEFTTVSFPNPEE 312

Query: 304 XXXXXXXXXXXXKNGISFVLGNDPDADRFSAAVKHQGKWRQLTGNEIGFLFAQFVWEKYQ 363
                       ++G   VL NDPDADRFSAAVK   KW+QLTGN++G+LFA    EK+ 
Sbjct: 313 EGALNLAIELAARSGAELVLANDPDADRFSAAVKDGNKWKQLTGNQLGYLFAVGQLEKFS 372

Query: 364 KESSEFKLENPLALINSTVSSQMIKKLAGVEKFHYEDTLTGFKWLGNRARQLESSGYYVP 423
            ++   K   PLA++ STVSSQMI K+A VE F + +TLTGFKWL NRA  LE+ G+YVP
Sbjct: 373 NQNENKK---PLAMLGSTVSSQMIAKMADVEGFTFVETLTGFKWLANRAIDLENDGFYVP 429

Query: 424 FAYEEAIGFMFSDIVHDKDGVSAAVVFLQMLWSWKKQALSPIDVLQSAFGKYGVFKEYNG 483
           FAYEEAIG+MFS + HDKDGVSAA  FLQM   WKK+  +P+DVL + + KYG F EYNG
Sbjct: 430 FAYEEAIGYMFSSVTHDKDGVSAATEFLQMAARWKKEGKTPLDVLNAGYEKYGNFVEYNG 489

Query: 484 YYTVPDLSLTDRIFSDIRSSYDS----YPKHIGNQFDVVSFTDLTKGFQSDTADNTPRLP 539
           YY+V DLS+   +F  IR++ +     YP  IGN+F V SF DLT G+QSDT ++ P LP
Sbjct: 490 YYSVQDLSIIGDVFKYIRNACNGNDVPYPSTIGNEFAVASFRDLTVGYQSDTGNHIPNLP 549

Query: 540 VDPSSQMIQATLVPSTSGGSGAPLEIVRFTARGSGTEPKLKVYIEATSVEETRASDLART 599
           V P S MI   L P     +    + VRFT RGSGTEPKLKVYIE+ ++++  A+ LA+ 
Sbjct: 550 VSPGSHMITCVLKPLIKETAQTSSDYVRFTIRGSGTEPKLKVYIESNALDKEYATKLAKL 609

Query: 600 TWNVLRDEWFKPKETGLSTKF 620
           TW+VL+ EWF+P+ TGL TKF
Sbjct: 610 TWDVLKREWFRPEVTGLQTKF 630

>CAGL0M02981g Chr13 (335863..337716) [1854 bp, 617 aa] {ON} similar
           to uniprot|Q03262 Saccharomyces cerevisiae YMR278w
          Length = 617

 Score =  707 bits (1824), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/622 (55%), Positives = 433/622 (69%), Gaps = 15/622 (2%)

Query: 6   VEIPADLKSSVESWFEHDKNEETRNEILQLVTEQNWNELHKRLDQRISFGTAGLRSKMEA 65
            +IP +L++++ESW + DKNEETRNE+++L  +QNW+ELHKR D RI FGTAGLR++MEA
Sbjct: 4   TDIPVELRTAIESWLQLDKNEETRNEVIKLCNDQNWDELHKRFDSRIVFGTAGLRARMEA 63

Query: 66  GFSRMNTLTVLQASQGLAKYIAEKFPENKTVAVGHDHRFNSRDFAEVTSVAFLQLRFKVY 125
           G +R+N L +LQASQGLA YI +KFP+N T  VGHDHR++S++FA+VT+  F++  FKVY
Sbjct: 64  GTNRLNKLVILQASQGLATYIKDKFPQNLTAVVGHDHRYHSQEFAQVTAATFIRAGFKVY 123

Query: 126 SLGFNADPKKDAFVHTPMVPFAIDRLGASAGVMITASHNPKMDNGYKVYYSNGCQIIPPH 185
            L        D FVHTPMVP+++D L AS GVMITASHNPKMDNGYKVYY+NGCQIIPPH
Sbjct: 124 YLN-----PHDEFVHTPMVPYSVDHLNASVGVMITASHNPKMDNGYKVYYTNGCQIIPPH 178

Query: 186 DRLIAQSILDNLNPWERAWDCKAVIAEATEKGYFVDMKKPMVDHYVKEISDKLVSSDIG- 244
           D  IA++I +NL PW   W+   +++ A   G    ++K M+  Y+  + ++L+  D   
Sbjct: 179 DHGIAETINNNLEPWSTDWNFTKILSNAETDGKIEYVRKRMLTSYLNSVVNQLIQRDFAA 238

Query: 245 DRSKPWFVYTPLHGVGFEIFERIASEVLGLVEGRDYWCVSEHKQPDPAFPTVSFPNPEEX 304
              KPWFVYTP+HGVG +IF  I +E L L +  DY  V E K PDP+F TVSFPNPEE 
Sbjct: 239 PDEKPWFVYTPMHGVGHQIFSTILNESLNLKDNIDYITVPEQKDPDPSFRTVSFPNPEEK 298

Query: 305 XXXXXXXXXXXKNGISFVLGNDPDADRFSAAVKHQGK--WRQLTGNEIGFLFAQFVWEKY 362
                       NGI  VL NDP+ADRFS AV+   K  W+QLTGNEIG LFA + ++ Y
Sbjct: 299 GALNLAITLAEANGIKLVLANDPNADRFSVAVRDDSKNEWKQLTGNEIGLLFAFYEFKMY 358

Query: 363 QKESSEFKLENPLALINSTVSSQMIKKLAGVEKFHYEDTLTGFKWLGNRARQLESSGYYV 422
           QK + +     PLA++NSTVS+Q+IK++A  E F Y+DTLTGFKW+GN A +LE  GY+V
Sbjct: 359 QKAADKGIKNKPLAMLNSTVSAQVIKRMAEKEGFLYKDTLTGFKWIGNEAAKLEEKGYFV 418

Query: 423 PFAYEEAIGFMFSDIVHDKDGVSAAVVFLQMLWSWKKQALSPIDVLQSAFGKYGVFKEYN 482
           PF YEEAIG+MF  + HDKDGVSAA+VFLQ   +W + + +PID++   + KYGV  EYN
Sbjct: 419 PFGYEEAIGYMFPAMEHDKDGVSAAIVFLQAYANWLQSSSNPIDIIHECYDKYGVSAEYN 478

Query: 483 GYYTVPDLSLTDRIFSDIRSSYD----SYPKHIGNQFDVVSFTDLTKGFQSDTADNTPRL 538
           GYY V D S TD++F  IRSSY     S+P+ IG  F V  F DLT GF S TAD  P L
Sbjct: 479 GYYIVSDPSKTDKVFESIRSSYTSMGLSFPESIGEHFRVTEFRDLTIGFDSTTADKKPLL 538

Query: 539 PVDPSSQMIQATLVPSTSGGSGAPLEIVRFTARGSGTEPKLKVYIEATSVEETRASDLAR 598
           PVD +SQMI  T VPS +  +G   E VRFT RGSGTEPKLKVYIE  S  E RA  LA+
Sbjct: 539 PVDKNSQMITITAVPSGASNTG---ESVRFTIRGSGTEPKLKVYIEGISSTEGRARILAK 595

Query: 599 TTWNVLRDEWFKPKETGLSTKF 620
           + W  L+ EWFKP   GLST F
Sbjct: 596 SLWETLKHEWFKPSSNGLSTDF 617

>ABL126W Chr2 (159207..161081) [1875 bp, 624 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR278W
          Length = 624

 Score =  702 bits (1813), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 353/623 (56%), Positives = 429/623 (68%), Gaps = 16/623 (2%)

Query: 8   IPADLKSSVESWFEHDKNEETRNEILQLVTEQNWNELHKRLDQRISFGTAGLRSKMEAGF 67
           +P+ LK S+  W   DKN ET++EI +LV+   W+EL KRL  RI+FGTAGLR++MEAGF
Sbjct: 8   VPSSLKDSLMEWLTFDKNSETQHEICELVSNHQWDELRKRLLPRITFGTAGLRARMEAGF 67

Query: 68  SRMNTLTVLQASQGLAKYIAEKFPENKTVAVGHDHRFNSRDFAEVTSVAFLQLRFKVYSL 127
           SRMNTLTV+QASQGLA+YI  +FP++  V +GHDHRF+SR+FAE T  AFLQL + +Y L
Sbjct: 68  SRMNTLTVIQASQGLARYIKSQFPDDLKVVIGHDHRFHSREFAEATIAAFLQLDYDIYYL 127

Query: 128 GF-NADPKKDAFVHTPMVPFAIDRLGA---SAGVMITASHNPKMDNGYKVYYSNGCQIIP 183
            +      +D FVHTPMVPFAI+ +     S GVMITASHNPKMDNGYKVYY+NGCQIIP
Sbjct: 128 NYVPPGSDEDVFVHTPMVPFAINNVEGGPTSCGVMITASHNPKMDNGYKVYYANGCQIIP 187

Query: 184 PHDRLIAQSILDNLNPWERAWDCKAVIAEATEKGYFVDMKKPMVDHYVKEISDKLV-SSD 242
           PHD LI + I  NL PW RAWD KA+I EA + G   D++K M+  Y   I   LV  S+
Sbjct: 188 PHDELIGRHIDANLEPWTRAWDSKALIEEAIKSGKLHDVRKEMLQKYKDSIQTMLVKQSN 247

Query: 243 IGDRSKPWFVYTPLHGVGFEIFERIASEVLGLVEGRDYWCVSEHKQPDPAFPTVSFPNPE 302
           +     PWFVYTP+HGVG+E F+   + VLG+ E +DY  V E K PDP FPTVSFPNPE
Sbjct: 248 LKFAGGPWFVYTPMHGVGYEFFKEAVASVLGIEEDKDYIVVPEQKYPDPEFPTVSFPNPE 307

Query: 303 EXXXXXXXXXXXXKNGISFVLGNDPDADRFSAAVKHQGKWRQLTGNEIGFLFAQFVWEKY 362
           E             NGI+ VL NDPDADRFS AVK+ G+W QLTGN+IG LFAQ   + Y
Sbjct: 308 ERGALDMAMKVADANGITVVLANDPDADRFSVAVKYHGEWNQLTGNQIGILFAQAEMQSY 367

Query: 363 QKESSEFKLENP-LALINSTVSSQMIKKLAGVEKFHYEDTLTGFKWLGNRARQLESSGYY 421
            KE    KL+   LA++ S VSSQ+++K+A  E F   +TLTGFKWLGNRAR+LE  GYY
Sbjct: 368 FKEP---KLDRKQLAMLTSAVSSQLLRKMAEEEGFLAVETLTGFKWLGNRARELELEGYY 424

Query: 422 VPFAYEEAIGFMFSDIVHDKDGVSAAVVFLQMLWSWKKQALSPIDVLQSAFGKYGVFKEY 481
           VPFAYEEAIG+MFS +VHDKDG++AA VFLQM + WKK A S  +VLQ  + KYG F +Y
Sbjct: 425 VPFAYEEAIGYMFSQVVHDKDGIAAAAVFLQMCYEWKKVAKSSQEVLQECYEKYGYFVDY 484

Query: 482 NGYYTVPDLSLTDRIFSDIRSSY----DSYPKHIGNQFDVVSFTDLTKGFQSDTADNTPR 537
           NGYY     ++T  +F   R+ Y      YP HIG +F+V    DLT G+QSDTA N P 
Sbjct: 485 NGYYISSAPAVTKEVFDYFRNEYTPAGKPYPSHIGCEFEVEYLRDLTVGYQSDTATNIPD 544

Query: 538 LPVDPSSQMIQATLVPSTSGGSGAPLEIVRFTARGSGTEPKLKVYIEATSVEETRASDLA 597
           LPVD +SQMI   L P          E VRFTARGSGTEPKLKVYIE+ +    RAS L+
Sbjct: 545 LPVDHNSQMITCVLKPVKMETD---CESVRFTARGSGTEPKLKVYIESCAANHQRASHLS 601

Query: 598 RTTWNVLRDEWFKPKETGLSTKF 620
              W+VL+ EWF+P ETGL T F
Sbjct: 602 HLAWDVLKREWFRPTETGLQTNF 624

>Skud_13.450 Chr13 (796030..797898) [1869 bp, 622 aa] {ON} YMR278W
           (REAL)
          Length = 622

 Score =  699 bits (1805), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/623 (56%), Positives = 446/623 (71%), Gaps = 19/623 (3%)

Query: 8   IPADLKSSVESWFEHDKNEETRNEILQLVTEQNWNELHKRLDQRISFGTAGLRSKMEAGF 67
           IP+DLK  +  WF+ D++ ET  E+  L  + +W+ELHKR D RI FGTAGLRS+M+AGF
Sbjct: 9   IPSDLKGPISLWFDQDRDPETIEEVTALCKKSDWDELHKRFDTRIQFGTAGLRSQMQAGF 68

Query: 68  SRMNTLTVLQASQGLAKYIAEKFPENKTVAVGHDHRFNSRDFAEVTSVAFLQLRFKVYSL 127
           SRMN L ++QASQGLA YI ++FP N    VGHDHRF+S+ FA  T+ AFL   FKV+ L
Sbjct: 69  SRMNNLVIIQASQGLATYIRQQFPNNLVAVVGHDHRFHSKKFARATATAFLLKGFKVHYL 128

Query: 128 GFNADPKKDAFVHTPMVPFAIDRLGASAGVMITASHNPKMDNGYKVYYSNGCQIIPPHDR 187
               +P ++ FVHTP+VPFA+D L AS GVMITASHNPKMDNGYKVYYSNGCQIIPPHD+
Sbjct: 129 ----NPGQE-FVHTPLVPFAVDELNASVGVMITASHNPKMDNGYKVYYSNGCQIIPPHDQ 183

Query: 188 LIAQSILDNLNPWERAWDCKAVIAEATEKGYFVDMKKPMVDHYVKEISDKLVSS---DIG 244
            I+ +I  NL PW  AW+   ++++  ++G  +  ++ M+  Y+++ISD LV +    + 
Sbjct: 184 AISNAIDMNLEPWANAWNFDDILSKNLKQGKLMYSREEMLKLYLEKISDNLVETTPLKLE 243

Query: 245 DRSKPWFVYTPLHGVGFEIFERIASEVLGLVEGRDYWCVSEHKQPDPAFPTVSFPNPEEX 304
            RSKPWFVYTP+HGVGF+IF  I  + + LVEG+DY CV E + PDP+FPTV FPNPEE 
Sbjct: 244 VRSKPWFVYTPMHGVGFDIFSTIVKKSMCLVEGKDYLCVPEQQNPDPSFPTVGFPNPEEK 303

Query: 305 XXXXXXXXXXXKNGISFVLGNDPDADRFSAAVK--HQGKWRQLTGNEIGFLFAQFVWEKY 362
                      K+ IS ++ NDPDADRFS A+K    G W+QLTGNEIGFLFA F +EK+
Sbjct: 304 GALNIGMRLAEKHDISLLIANDPDADRFSVAIKDMQSGMWQQLTGNEIGFLFAFFEFEKF 363

Query: 363 QKESSEFKLENPLALINSTVSSQMIKKLAGVEKFHYEDTLTGFKWLGNRARQLESSGYYV 422
           +    +F+  +PLA+++STVSSQMIK++A VE FHYEDTLTGFKW+GNRA  LE  GYYV
Sbjct: 364 KSMDEQFQQTHPLAMLSSTVSSQMIKRMAEVEGFHYEDTLTGFKWIGNRAIILEKEGYYV 423

Query: 423 PFAYEEAIGFMFSDIVHDKDGVSAAVVFLQMLWSWK-KQALSPIDVLQSAFGKYGVFKEY 481
           PF +EEAIG+MF  + HDKDG+SA+VVFLQ    WK    L PI+VL++ F KYGVFKEY
Sbjct: 424 PFGFEEAIGYMFPAMEHDKDGISASVVFLQAYCKWKLANNLDPINVLENGFKKYGVFKEY 483

Query: 482 NGYYTVPDLSLTDRIFSDIRSSYD----SYPKHIGNQFDVVSFTDLTKGFQSDTADNTPR 537
           NGYY VP+  +T  IF  IR  Y      YP +IG +  V+ + DLT G+QSDT D+ P 
Sbjct: 484 NGYYIVPNPIVTKEIFKYIRDVYTPRNVPYPPYIGEEIRVLCYRDLTTGYQSDTLDHKPT 543

Query: 538 LPVDPSSQMIQATLVPSTSGGSGAPLEIVRFTARGSGTEPKLKVYIEATSVEETRASDLA 597
           LPVDP+SQMI     P+ S G+    E +RFT RGSGTEPKLKVYIE  + EE RAS LA
Sbjct: 544 LPVDPTSQMITVFARPNDSNGN----EHIRFTIRGSGTEPKLKVYIETRANEERRASFLA 599

Query: 598 RTTWNVLRDEWFKPKETGLSTKF 620
           + TW+VLR EWF+P++T ++T F
Sbjct: 600 KLTWDVLRREWFRPEKTNITTNF 622

>NDAI0K00410 Chr11 complement(91807..93687) [1881 bp, 626 aa] {ON}
           Anc_8.840 YMR278W
          Length = 626

 Score =  694 bits (1792), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/625 (56%), Positives = 432/625 (69%), Gaps = 20/625 (3%)

Query: 7   EIPADLKSSVESWFEHDKNEETRNEILQLVTEQNWNELHKRLDQRISFGTAGLRSKMEAG 66
           + PA+L+ +++ W   DK EETRNE++QL  + NW ELHKR D RI FGTAGLRS+MEAG
Sbjct: 11  DCPANLRENIDLWLRQDKCEETRNEVIQLCKDSNWIELHKRFDSRIVFGTAGLRSRMEAG 70

Query: 67  FSRMNTLTVLQASQGLAKYIAEKFPENKTVAVGHDHRFNSRDFAEVTSVAFLQLRFKVYS 126
           FSRMN L +LQASQGLAKYI  +FP N T  VGHDHRF+S+ FA +T+  FL++ FKVY 
Sbjct: 71  FSRMNPLVILQASQGLAKYIKAQFPTNLTAVVGHDHRFHSKQFAMITASVFLRVGFKVYY 130

Query: 127 LGFNADPKKDAFVHTPMVPFAIDRLGASAGVMITASHNPKMDNGYKVYYSNGCQIIPPHD 186
           L       +D+FVHTP+VPF+++ L AS GVMITASHNPKMDNGYKVYYSNGCQIIPPHD
Sbjct: 131 LN-----PEDSFVHTPLVPFSVNHLNASIGVMITASHNPKMDNGYKVYYSNGCQIIPPHD 185

Query: 187 RLIAQSILDNLNPWERAWDCKAVIAEATEKGYFVDMKKPMVDHYVKEISDKLVSSDI--- 243
           + IA +I +NL PW   W+  +   +  ++   V +++ M + Y++ + D LVSS I   
Sbjct: 186 KNIAATIDENLEPWSSDWNWDSTFEKNLKEKKLVYVREEMTNKYLQAMKDILVSSSISRP 245

Query: 244 -GDRSKPWFVYTPLHGVGFEIFERIASEVLGLVEGRDYWCVSEHKQPDPAFPTVSFPNPE 302
             +  KPWFVYTP+HGVG+ IF +I+  +L   E  DY+ V E   PDPAFPTVSFPNPE
Sbjct: 246 NNNGKKPWFVYTPMHGVGYNIFTKISKNILHYEENMDYFVVKEQMYPDPAFPTVSFPNPE 305

Query: 303 EXXXXXXXXXXXXKNGISFVLGNDPDADRFSAAVKHQ--GKWRQLTGNEIGFLFAQFVWE 360
           E            +N IS V+ NDPDADRFS A K++  G+W+QL+GNEIGFLFA F  E
Sbjct: 306 EKGALSLATKLAEENNISLVIANDPDADRFSVASKNEKTGQWQQLSGNEIGFLFASFELE 365

Query: 361 KYQKESSEFKLENPLALINSTVSSQMIKKLAGVEKFHYEDTLTGFKWLGNRARQLESSGY 420
           KY  +  E++  +PLA+INSTVSSQMIKK+A VE FHYEDTLTGFKW+GNRA  L+  GY
Sbjct: 366 KYMSQDIEWRRTHPLAMINSTVSSQMIKKMAQVESFHYEDTLTGFKWIGNRALDLQGQGY 425

Query: 421 YVPFAYEEAIGFMFSDIVHDKDGVSAAVVFLQMLWSWKKQALS-PIDVLQSAFGKYGVFK 479
           YVPF +EEAIG+MF  +V DKDGVSAAVVFL     W     S P D+L+  F K+G FK
Sbjct: 426 YVPFGFEEAIGYMFPTMVTDKDGVSAAVVFLLAYSYWLNNDGSYPFDILEKGFKKFGFFK 485

Query: 480 EYNGYYTVPDLSLTDRIFSDIRSSYDS----YPKHIGNQFDVVSFTDLTKGFQSDTADNT 535
           EYNGYY   D   T +IF  +R  YD+    YPK+IG +F +  F DLT G+QS+T DN 
Sbjct: 486 EYNGYYIYDDPKTTKQIFDFVRYQYDTSGNPYPKNIGKEFKIEVFRDLTTGYQSNTIDNL 545

Query: 536 PRLPVDPSSQMIQATLVPSTSGGSGAPLEIVRFTARGSGTEPKLKVYIEATSVEETRASD 595
           P LPVDP S+MI    VP    G       VRFT RGSGTEPKLK+YIEA +  E  A D
Sbjct: 546 PNLPVDPHSEMITIEAVPKQDIGKSK----VRFTMRGSGTEPKLKLYIEAVADNEKCAID 601

Query: 596 LARTTWNVLRDEWFKPKETGLSTKF 620
           LA   WNVL+ EW +P  TGL+T F
Sbjct: 602 LAYEMWNVLKKEWIRPDVTGLTTTF 626

>ZYRO0G14190g Chr7 (1131206..1133038) [1833 bp, 610 aa] {ON} similar
           to uniprot|Q03262 Saccharomyces cerevisiae YMR278W
           Hypothetical ORF
          Length = 610

 Score =  693 bits (1789), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 338/618 (54%), Positives = 436/618 (70%), Gaps = 17/618 (2%)

Query: 8   IPADLKSSVESWFEHDKNEETRNEILQLVTEQNWNELHKRLDQRISFGTAGLRSKMEAGF 67
           IP +LK  +  W   D+NE+T  EI +L   +NW+ELH+RL+ R+ FGTAGLR++MEAGF
Sbjct: 5   IPENLKQPISLWLAQDRNEKTCKEIAELCDAENWSELHERLNSRLQFGTAGLRARMEAGF 64

Query: 68  SRMNTLTVLQASQGLAKYIAEKFPENKTVAVGHDHRFNSRDFAEVTSVAFLQLRFKVYSL 127
           SRMNTL V+QA+QGLA+YI ++FP++    VGHDHRFNS DFA+ T+   L+  F+V+ L
Sbjct: 65  SRMNTLVVIQATQGLAQYIKKQFPDHLVAVVGHDHRFNSMDFAKATATVLLKAGFEVHYL 124

Query: 128 GFNADPKKDAFVHTPMVPFAIDRLGASAGVMITASHNPKMDNGYKVYYSNGCQIIPPHDR 187
                 + D++VHTPMVPF +DR+ AS GVMITASHNPK+DNGYKVYY+NGCQIIPPHD 
Sbjct: 125 N-----QGDSYVHTPMVPFTVDRVKASVGVMITASHNPKLDNGYKVYYANGCQIIPPHDS 179

Query: 188 LIAQSILDNLNPWERAWDCKAVIAEATEKGYFVDMKKPMVDHYVKEISDKLVSS-DIGDR 246
            IA+SI  NL P    WD    + +A ++G  +  +  M++ Y+  + D  V+  D   +
Sbjct: 180 AIARSIESNLEPGNGVWDWDQTMQQAADEGKLIYGRDKMLEQYISCVKDSFVTELDSLPK 239

Query: 247 SKPWFVYTPLHGVGFEIFERIASEVLGLVEGRDYWCVSEHKQPDPAFPTVSFPNPEEXXX 306
            KPWFVYTP+HGVG+++F++IAS++L L   RD+  VSE   PDP FPTV FPNPEE   
Sbjct: 240 GKPWFVYTPMHGVGYQVFDQIASKILQLEVNRDFLVVSEQLNPDPEFPTVQFPNPEEKGA 299

Query: 307 XXXXXXXXXKNGISFVLGNDPDADRFSAAVKHQGKWRQLTGNEIGFLFAQFVWEKYQKES 366
                     +GI  V+ +DPDADRFS A K    W+QL+GN+IGFLFA +  +KY+   
Sbjct: 300 LDLAIKLAENHGIKLVIASDPDADRFSVAFKGPHGWQQLSGNDIGFLFAYYELQKYRGFD 359

Query: 367 SEFKLENPLALINSTVSSQMIKKLAGVEKFHYEDTLTGFKWLGNRARQLESSGYYVPFAY 426
           +E++  +PLA++NSTVSSQMI  +A +E FH+EDTLTGFKW+GNRA +LE+ GYYVPF +
Sbjct: 360 AEYQKSHPLAMLNSTVSSQMINSMAALEGFHHEDTLTGFKWIGNRALELEARGYYVPFGF 419

Query: 427 EEAIGFMFSDIVHDKDGVSAAVVFLQMLWSWKKQALSPIDVLQSAFGKYGVFKEYNGYYT 486
           EEAIG+MF    HDKDG+SAAVVFLQ   SW  Q  SP+D+L  A  KYGVF+EYNGYY 
Sbjct: 420 EEAIGYMFPATEHDKDGISAAVVFLQAYHSWISQGKSPLDILDEASAKYGVFREYNGYYL 479

Query: 487 VPDLSLTDRIFSDIRSSY----DSYPKHIGNQFDVVSFTDLTKGFQSDTADNTPRLPVDP 542
           V + SLT++ F+ IR  Y    ++YP+ IG+   V +F DLT G+QSDT +N P L VDP
Sbjct: 480 VDEPSLTNKTFAYIREDYTPKGENYPRTIGD-LQVKTFRDLTTGYQSDTPNNIPNLHVDP 538

Query: 543 SSQMIQATLVPSTSGGSGAPLEIVRFTARGSGTEPKLKVYIEATSVEETRASDLARTTWN 602
           SSQMI     P   GGSG   E VRFT RGSGTEPKLKVYIEA +  + RA +LAR TW+
Sbjct: 539 SSQMITIVAQPK-GGGSG---EHVRFTLRGSGTEPKLKVYIEAGAQSDPRARELARQTWD 594

Query: 603 VLRDEWFKPKETGLSTKF 620
           +LR+EWF     GL+TKF
Sbjct: 595 ILREEWF--NRPGLTTKF 610

>KNAG0J00270 Chr10 complement(39750..41627) [1878 bp, 625 aa] {ON}
           Anc_8.840 YMR278W
          Length = 625

 Score =  690 bits (1780), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/621 (55%), Positives = 423/621 (68%), Gaps = 17/621 (2%)

Query: 9   PADLKSSVESWFEHDKNEETRNEILQLVTEQNWNELHKRLDQRISFGTAGLRSKMEAGFS 68
           P  L+  +  W   DKNEETR E+L L   Q+W+EL+ R  QRI FGTAGLRS+MEAG +
Sbjct: 13  PEGLQHRILEWLRLDKNEETRREVLDLCQRQDWSELNSRFSQRILFGTAGLRSRMEAGTN 72

Query: 69  RMNTLTVLQASQGLAKYIAEKFPENKTVAVGHDHRFNSRDFAEVTSVAFLQLRFKVYSLG 128
           R+N+L +LQA+QGLA+YIA +FP+NK   VGHDHRF+S++FA VT+  FL+  FKV  L 
Sbjct: 73  RLNSLVILQATQGLARYIASQFPKNKVAVVGHDHRFHSKEFATVTAAVFLRAGFKVLYLN 132

Query: 129 FNADPKKDAFVHTPMVPFAIDRLGASAGVMITASHNPKMDNGYKVYYSNGCQIIPPHDRL 188
                  D  VHTP+VPF +D L AS GVMITASHNPKMDNGYKVY++NGCQIIPPHD  
Sbjct: 133 -----PGDTLVHTPLVPFTVDHLNASVGVMITASHNPKMDNGYKVYFANGCQIIPPHDLN 187

Query: 189 IAQSILDNLNPWERAWDCKAVIAEATEKGYFVDMKKPMVDHYVKEISDKLVSSDIGDR-- 246
           IA+SI  NL PWE +WD   VI  A ++   V +K  M   Y K    +L+      R  
Sbjct: 188 IARSIDQNLEPWEPSWDWPTVIQAAEKEDRIVYVKDQMTQLYTKTAELQLIGGRKVLRNP 247

Query: 247 -SKPWFVYTPLHGVGFEIFERIASEVLGLVEGRDYWCVSEHKQPDPAFPTVSFPNPEEXX 305
            S PWFVYTP+HGVG EIF RI+ +VLG+ E  DY CV E K PDP+FPTVSFPNPEE  
Sbjct: 248 GSGPWFVYTPMHGVGSEIFSRISEDVLGIKENEDYLCVPEQKHPDPSFPTVSFPNPEEKG 307

Query: 306 XXXXXXXXXXKNGISFVLGNDPDADRFSAAV--KHQGKWRQLTGNEIGFLFAQFVWEKYQ 363
                     +NGI+ V+ NDPDADRFS AV       WRQLTGNEIGFLFA   +E Y+
Sbjct: 308 ALDKAIELASQNGINLVIANDPDADRFSLAVFDSKTANWRQLTGNEIGFLFAYQQFEMYK 367

Query: 364 KESSEFKLENPLALINSTVSSQMIKKLAGVEKFHYEDTLTGFKWLGNRARQLESSGYYVP 423
                F+ E+PL L+NSTVSSQMIKK+A VE FHYEDTLTGFKW+GNRAR LE  G++ P
Sbjct: 368 AMDDIFQKEHPLVLLNSTVSSQMIKKMAEVEGFHYEDTLTGFKWIGNRARDLEKKGFFAP 427

Query: 424 FAYEEAIGFMFSDIVHDKDGVSAAVVFLQMLWSWKKQALS-PIDVLQSAFGKYGVFKEYN 482
           F YEEAIG+MF+ + HDKDG+SA+++FL   + W   A   P+D+L+  + KYGVFKEYN
Sbjct: 428 FGYEEAIGYMFTQMEHDKDGISASLMFLLSYYHWVYDAHKFPLDILEDGYKKYGVFKEYN 487

Query: 483 GYYTVPDLSLTDRIFSDIRSSYD---SYPKHIGNQFDVVSFTDLTKGFQSDTADNTPRLP 539
           GYY V +  +    F  IR+       YP+ IG++F VVSF DLT GFQSDT+D+ P LP
Sbjct: 488 GYYIVDNPKIMKETFDYIRNDRKPGTQYPEAIGSEFQVVSFRDLTLGFQSDTSDHIPTLP 547

Query: 540 VDPSSQMIQATLVPSTSGGSGAPLEIVRFTARGSGTEPKLKVYIEATSVEETRASDLART 599
           VDP+SQMI     P+         + VRFT RGSGTEPKLKVYIEA S  ET A  LA+ 
Sbjct: 548 VDPNSQMITVCAKPTH---DNVERDHVRFTIRGSGTEPKLKVYIEACSGSETGAQQLAKQ 604

Query: 600 TWNVLRDEWFKPKETGLSTKF 620
            W+ L++ WF+P+ TGL T F
Sbjct: 605 MWDTLQEVWFRPQTTGLVTDF 625

>TBLA0B03250 Chr2 (757928..759859) [1932 bp, 643 aa] {ON} Anc_8.840
           YMR278W
          Length = 643

 Score =  690 bits (1781), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 339/636 (53%), Positives = 431/636 (67%), Gaps = 31/636 (4%)

Query: 9   PADLKSSVESWFEHDKNEETRNEILQLVTEQNWNELHKRLDQRISFGTAGLRSKMEAGFS 68
           P DL+  V  W E DK++ TR EI+ L    N  ELH+R D RI+FGTAGLRS MEAGFS
Sbjct: 15  PEDLQKKVLLWLEQDKDDSTRKEIIDLCKSANVKELHERFDSRITFGTAGLRSTMEAGFS 74

Query: 69  RMNTLTVLQASQGLAKYI---AEKFPENKTVAVGHDHRFNSRDFAEVTSVAFLQLRFKVY 125
           RMNTLTVLQASQGLA Y+   A+   +     +GHDHR++S++FA++ +  FL   FKVY
Sbjct: 75  RMNTLTVLQASQGLATYMKNDAKNTGQKLIAVIGHDHRYHSKEFAKIAATVFLIAGFKVY 134

Query: 126 SLGFNA--DPKKDAFVHTPMVPFAIDRLGASAGVMITASHNPKMDNGYKVYYSNGCQIIP 183
            L  ++  DP+ + FVHTPMVPF +  L AS GVM+TASHNPKMDNGYKVYYSNGCQIIP
Sbjct: 135 YLNDDSLEDPRDNKFVHTPMVPFTVKNLKASVGVMVTASHNPKMDNGYKVYYSNGCQIIP 194

Query: 184 PHDRLIAQSILDNLNPWERAWDCKAVIAEATEKGYFVDMKKPMVDHYVKEISDKLVSSD- 242
           PHD  I+Q I  NL PWE +W+ K ++A A  KG  +  +  M++ Y+ ++ +KL S D 
Sbjct: 195 PHDSGISQCIDANLEPWENSWNYKEIMANAESKGDLIYHRDVMLNDYITQLEEKLTSKDI 254

Query: 243 ------IGDRSKPWFVYTPLHGVGFEIFERIASEVLGLVEGRDYWCVSEHKQPDPAFPTV 296
                 I  +SKPWFVYTP+HGVG+EIF +I++E+L + EG D+  V E K PDP FPTV
Sbjct: 255 IHLSKKIDVKSKPWFVYTPMHGVGYEIFTKISNEILHMKEGEDFIVVEEQKHPDPGFPTV 314

Query: 297 SFPNPEEXXXXXXXXXXXXKNGISFVLGNDPDADRFSAAVK---HQGKWRQLTGNEIGFL 353
           SFPNPEE             NGIS V+ NDPDADRFS AVK    QG W Q TGNEIG+L
Sbjct: 315 SFPNPEEKGAIDMGIKLAEDNGISLVIANDPDADRFSIAVKSKGSQGTWHQFTGNEIGYL 374

Query: 354 FAQFVWEKYQKESSEFKLENPLALINSTVSSQMIKKLAGVEKFHYEDTLTGFKWLGNRAR 413
           FA F ++KY+    +    + L ++NSTVSSQMIKK+A +E F+YE+TLTGFKW+GNRA 
Sbjct: 375 FAYFEFQKYKISKQDL---HRLYMVNSTVSSQMIKKMAEIEGFNYEETLTGFKWIGNRAI 431

Query: 414 QLESSGYYVPFAYEEAIGFMFSDIVHDKDGVSAAVVFLQMLWSWKK-QALSPIDVLQSAF 472
            L + G  VPF YEEAIG+MF  +  DKDG++A V+F+Q    W +   + P +++Q  F
Sbjct: 432 DLINKGNIVPFGYEEAIGYMFPTMEIDKDGIAATVIFIQAFMYWNQIDKMDPYEIIQLGF 491

Query: 473 GKYGVFKEYNGYYTVPDLSLTDRIFSDIRSSYD--------SYPKHIGNQFDVVSFTDLT 524
            KYGVF EYNGYY   DL +T +IF  +R  YD         YP HIG +F ++ + DLT
Sbjct: 492 KKYGVFIEYNGYYRYTDLGITKKIFDYVRYDYDKGVSEGNKKYPDHIGEEFKIIKYRDLT 551

Query: 525 KGFQSDTADNTPRLPVDPSSQMIQATLVPSTSGGSGAPLEIVRFTARGSGTEPKLKVYIE 584
            G+QSDT DN P LPVDPSSQMI   ++P+ +   G+    +R T RGSGTEPKLKVYIE
Sbjct: 552 TGYQSDTPDNKPLLPVDPSSQMITVEMIPTDNESDGS----IRLTIRGSGTEPKLKVYIE 607

Query: 585 ATSVEETRASDLARTTWNVLRDEWFKPKETGLSTKF 620
           A S   T AS LA+  WNVL+ EW +P++TG++T F
Sbjct: 608 ACSRSATEASFLAKQAWNVLKREWMRPEQTGITTAF 643

>KAFR0B03920 Chr2 (814394..816268) [1875 bp, 624 aa] {ON} Anc_8.840
           YMR278W
          Length = 624

 Score =  677 bits (1746), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 338/622 (54%), Positives = 437/622 (70%), Gaps = 21/622 (3%)

Query: 8   IPADLKSSVESWFEHDKNEETRNEILQLVTEQNWNELHKRLDQRISFGTAGLRSKMEAGF 67
           +P  LK S + W  +D+NEETR+EIL ++  ++W EL  RL+ RI FGTAGLR +MEAGF
Sbjct: 15  VPERLKVSCDRWLRYDQNEETRSEILTIIGRKDWKELGNRLEGRIPFGTAGLRGRMEAGF 74

Query: 68  SRMNTLTVLQASQGLAKYIAEKFPENKTVAVGHDHRFNSRDFAEVTSVAFLQLRFKVYSL 127
           +RMN+L +LQ SQGLA+YI EKFP+N +V VGHDHR++S++FA++T   FL   FKV+ L
Sbjct: 75  TRMNSLVILQTSQGLAQYIMEKFPQNLSVVVGHDHRYHSKEFADITVATFLNAGFKVFYL 134

Query: 128 GFNADPKKDAFVHTPMVPFAIDRLGASAGVMITASHNPKMDNGYKVYYSNGCQIIPPHDR 187
                  ++ FVHTP+VP+++D+L ++ GVMITASHNPK DNGYKVYYSNGCQIIPPHD+
Sbjct: 135 N-----TENEFVHTPLVPYSVDKLRSACGVMITASHNPKDDNGYKVYYSNGCQIIPPHDK 189

Query: 188 LIAQSILDNLNPWERAWDCKAVIAEATEKGYFVDMKKPMVDHYVKEISDKLVS--SDIGD 245
            IA +I  NL PW + W+ K + +     G        M   YV++I+  + +  S +  
Sbjct: 190 NIALTIEKNLTPWSKDWNWKDLFSTEERNGNLEFNGNKMFLAYVQDITRYVFTNGSPMLK 249

Query: 246 RSKPWFVYTPLHGVGFEIFERIASEVLGLVEGRDYWCVSEHKQPDPAFPTVSFPNPEEXX 305
             KPWFVYTP+HGVG +IF +IA +VLGL E  DY+ V E  +PDP+FPTVSFPNPEE  
Sbjct: 250 TGKPWFVYTPMHGVGHKIFGQIAKQVLGLSENVDYFSVPEQIKPDPSFPTVSFPNPEEKG 309

Query: 306 XXXXXXXXXXKNGISFVLGNDPDADRFSAAVKHQ--GKWRQLTGNEIGFLFAQFVWEKYQ 363
                     + G++ ++ NDPDADRFSAAVK +   +WRQL+GNEIG LFA F  ++++
Sbjct: 310 ALDMAIQLAEREGLTLIIANDPDADRFSAAVKDKRSHEWRQLSGNEIGSLFAIFKLQEHK 369

Query: 364 KESSEFKLENPLALINSTVSSQMIKKLAGVEKFHYEDTLTGFKWLGNRARQLESSGYYVP 423
           ++++  K   PLA++NSTVSSQM+KK+A VE FHYE+TLTGFKW+GNRA QLE  GY V 
Sbjct: 370 EKAASRK---PLAMLNSTVSSQMLKKMAQVEGFHYEETLTGFKWIGNRALQLEQQGYDVC 426

Query: 424 FAYEEAIGFMFSDIVHDKDGVSAAVVFLQMLWSW-KKQALSPIDVLQSAFGKYGVFKEYN 482
           F YEEAIG+MF  + HDKDG+ A+VVFL M   W + + L P+DVL   F KYGVF EYN
Sbjct: 427 FGYEEAIGYMFPCMEHDKDGIIASVVFLHMYSKWLELEGLGPLDVLDLCFEKYGVFSEYN 486

Query: 483 GYYTVPDLSLTDRIFSDIRSSY----DSYPKHIGNQFDVVSFTDLTKGFQSDTADNTPRL 538
           GYYTV + +L + +FS IR  Y      YP+ +G +F + SF DLT G+QSDT D  P L
Sbjct: 487 GYYTVEEPALIESVFSYIRDEYCPKARPYPEKLGREFFLTSFRDLTLGYQSDTIDFKPTL 546

Query: 539 PVDPSSQMIQATLVPSTSGGSGAPLEIVRFTARGSGTEPKLKVYIEATSVEETRASDLAR 598
           PVD SSQMI ATL P  + G     E +RFT RGSGTEPKLKVYIE+ +  +  A++LA 
Sbjct: 547 PVDASSQMITATLKPERTVGH----EEIRFTIRGSGTEPKLKVYIESHAANKEAAANLAH 602

Query: 599 TTWNVLRDEWFKPKETGLSTKF 620
            TWNVLR EWF+P+ TGL T F
Sbjct: 603 LTWNVLRREWFRPEITGLKTSF 624

>Kpol_1068.8 s1068 complement(13542..15440) [1899 bp, 632 aa] {ON}
           complement(13542..15440) [1899 nt, 633 aa]
          Length = 632

 Score =  676 bits (1745), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 330/630 (52%), Positives = 421/630 (66%), Gaps = 17/630 (2%)

Query: 2   ESIKVEIPADLKSSVESWFEHDKNEETRNEILQLVTEQNWNELHKRLDQRISFGTAGLRS 61
           +S+   +P DL+  V +W   DKN ET NE+++L    + NELHKR D RI FGTAGLRS
Sbjct: 9   DSVLETLPVDLRDKVGTWLAQDKNPETINEVIRLCKANSLNELHKRFDNRILFGTAGLRS 68

Query: 62  KMEAGFSRMNTLTVLQASQGLAKYIAEKFPENKTVAVGHDHRFNSRDFAEVTSVAFLQLR 121
           KMEAGFSRMNTL VLQA+QGLA YI ++FP N    +GHDHR++S++FAE+ +  FL   
Sbjct: 69  KMEAGFSRMNTLVVLQATQGLATYIKQQFPSNLKAVIGHDHRYHSKEFAEIATSVFLSAG 128

Query: 122 FKVYSLGFNADPKKDAFVHTPMVPFAIDRLGASAGVMITASHNPKMDNGYKVYYSNGCQI 181
           F VY+L          FVHTP+VPF +D++GAS GVMITASHNPKMDNGYKVYYSNGCQI
Sbjct: 129 FTVYNLN-----PPGTFVHTPLVPFTVDQIGASVGVMITASHNPKMDNGYKVYYSNGCQI 183

Query: 182 IPPHDRLIAQSILDNLNPWERAWDCKAVIAEATEKGYFVDMKKPMVDHYVKEISDKLVSS 241
           IPP D  IA+ I +NL PW  +WD    I         + ++  M+  Y  ++ + ++  
Sbjct: 184 IPPVDASIAKCIDENLEPWSNSWDSSKAIEAGLSNKKLIYLRNEMLLAYSDKVDNNIIDK 243

Query: 242 ----DIGDRSKPWFVYTPLHGVGFEIFERIASEVLGLVEGRDYWCVSEHKQPDPAFPTVS 297
               +  +  KPWFVYTP+HGVG+EIF  +  E + L E RDY  V E   PDPAFPT+S
Sbjct: 244 KTIREFDEHRKPWFVYTPMHGVGYEIFTSLVLEKVNLKENRDYLTVKEQIVPDPAFPTIS 303

Query: 298 FPNPEEXXXXXXXXXXXXKNGISFVLGNDPDADRFSAAV--KHQGKWRQLTGNEIGFLFA 355
           FPNPEE            +N IS V+ NDPDADRFSAA+   H G+W+QLTGNEIGFLF 
Sbjct: 304 FPNPEEKGALDMAIALAKENDISLVIANDPDADRFSAAIYNSHSGEWQQLTGNEIGFLFG 363

Query: 356 QFVWEKYQKESSEFKLENPLALINSTVSSQMIKKLAGVEKFHYEDTLTGFKWLGNRARQL 415
            +++ KY     EFK  +PLA++NSTVSS+M+K +A  E F + DTLTGFKW+GN+A  L
Sbjct: 364 YYLFNKYTNMDPEFKKNHPLAMLNSTVSSRMLKSMADTENFKFIDTLTGFKWIGNKAIDL 423

Query: 416 ESSGYYVPFAYEEAIGFMFSDIVHDKDGVSAAVVFLQMLWSWKKQA-LSPIDVLQSAFGK 474
           +  GY+V F YEEAIG+MF  + HDKDG++A+VVFLQ  + W   + ++ ID+L+    K
Sbjct: 424 KKEGYHVVFGYEEAIGYMFPAMEHDKDGITASVVFLQAYFEWDNLSKVTVIDILEQGIEK 483

Query: 475 YGVFKEYNGYYTVPDLSLTDRIFSDIRSSY----DSYPKHIGNQFDVVSFTDLTKGFQSD 530
           YG FKEYNGYY V +  +T+ IF  IR+ Y    + YPK IG   +V SF DLT GFQSD
Sbjct: 484 YGAFKEYNGYYVVSNPQVTNDIFHYIRNEYPKNGNQYPKMIGTLLEVCSFRDLTTGFQSD 543

Query: 531 TADNTPRLPVDPSSQMIQATLVPSTSGGSGAPLEIVRFTARGSGTEPKLKVYIEATSVEE 590
           T DN P LPVDPSSQMI  T          +   IVRFT RGSGTEPKLK+YIE  S + 
Sbjct: 544 TVDNIPSLPVDPSSQMITITAKICDDEYQKSD-SIVRFTMRGSGTEPKLKLYIEGHSKDP 602

Query: 591 TRASDLARTTWNVLRDEWFKPKETGLSTKF 620
             AS +A+ TW+VL+ EW +P+ TG++T +
Sbjct: 603 IAASKIAKLTWDVLKKEWIRPEVTGVTTSY 632

>TDEL0A02210 Chr1 (400375..402093) [1719 bp, 572 aa] {ON} Anc_2.445
           YKL127W
          Length = 572

 Score = 52.0 bits (123), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 137/593 (23%), Positives = 233/593 (39%), Gaps = 99/593 (16%)

Query: 55  GTAGLRSKMEAGFSRMNTLTVLQASQGLAKYIAEKFPE---NKTVAVGHDHRFNSRDFAE 111
           GT+GLR K +    +         ++   + I +  PE   + T+ VG D R+ +    +
Sbjct: 19  GTSGLRKKTKVFMEKP------HYTENFIQSILDAIPEGSKDATLVVGGDGRYYNDKILQ 72

Query: 112 VT---SVAFLQLRFKVYSLGFNADPKKDAFVHTPMVPFAIDRLG--ASAGVMITASHN-- 164
           +    S A    +  +   G  + P     + T       D+ G   + G+++TASHN  
Sbjct: 73  IIASISAANGVGKLVIGQHGLLSTPAASHIIRTYQ-----DKSGKKVTGGIILTASHNPG 127

Query: 165 -PKMDNGYKVYYSNGC--------QIIPPHDRLIAQSILDNLNPWERAWDCKAVIAEATE 215
            P  D G K   SNG          I     +L +  I+ NL   + +   +  +     
Sbjct: 128 GPDNDIGIKYNLSNGGPAPESVTNAIWEISKKLTSYKIIKNLPQLDLSTKGEKKLGNLEI 187

Query: 216 KGYFVDMKKPMVDHYVKEISD-KLVSS--DIGDRSKPW-FVYTPLHGVGFEIFERIASEV 271
               VD+ +  V+ ++KEI D  L+    D    +K W  ++  L+GV     + I  + 
Sbjct: 188 D--VVDVTQAYVE-FLKEIFDFDLIKKFVDTQRSTKHWKLLFDGLNGVTGPYGKAIFVDE 244

Query: 272 LGLVEGRDYWCVSEHKQPDPAFPTVSFPNPEEXXXXXXXXXXXXKNGISFVLGNDPDADR 331
           LGL E      V ++  P P F  +  P+P              K  I F   +D D DR
Sbjct: 245 LGLPENE----VLQNCHPKPDFGGIH-PDP-NLTYARTLVERVDKEKIEFGAASDGDGDR 298

Query: 332 FSAAVKHQGKWRQLTGNEIGFLFAQFVWEKYQKESSEFKLENPLALINSTVSSQMIKKLA 391
               +   G      G+ +  +       +Y KE   F  +    L  S  +S  I ++A
Sbjct: 299 --NMIYGYGPAFVSPGDSVAII------AEYAKEIPYFAKQGIYGLARSFPTSSAIDRVA 350

Query: 392 GVEKFHYEDTLTGFKWLGN--RARQLESSGYYVPFAYEEAIGFMFSDIVHDKDGVSAAVV 449
             +  +  +  TG+K+      A++L   G       EE+ G   S+ V +KDGV A + 
Sbjct: 351 AEQGLNCYEVPTGWKFFCALFDAKKLSICG-------EESFG-TGSNHVREKDGVWAIIA 402

Query: 450 FLQMLWSWKK---QALSPIDVLQSAF-GKYGVFKEYNGYYTVPDLS-LTDRIFSDIRSSY 504
           +L +L  + K   Q  + I  +Q  F  KYG       ++T  D   +T    ++I    
Sbjct: 403 WLNILAIYNKHHPQKEASIKTIQDEFWLKYG-----RTFFTRYDFEHVTTEKANEIVKHL 457

Query: 505 DSY---PKHIGNQFDVVSFTDLTKGFQSDTADNTPRLPVDPSSQMIQATLVPSTSGGSGA 561
           DS+   P  +G++F   +   + +       D      +D S    Q   V  +SG    
Sbjct: 458 DSFVNSPNVVGSKFPSDNSVTVAEAGDFQYTD------LDGSVSSNQGLYVKLSSG---- 507

Query: 562 PLEIVRFTARGSGTEPK---LKVYIEATSVEETRASDLARTTWNVLRDEWFKP 611
                RF  R SGT      +++YIE  S ++T+        + +  +E+ +P
Sbjct: 508 ----ARFVLRLSGTGSSGATIRLYIEKYSDDKTK--------YGLTAEEYLRP 548

>KNAG0E02390 Chr5 (475467..477176) [1710 bp, 569 aa] {ON} Anc_2.445
           YKL127W
          Length = 569

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 149/610 (24%), Positives = 242/610 (39%), Gaps = 126/610 (20%)

Query: 49  DQRISFGTAGLRSKMEAGFSRMNTLTVLQASQGLAKYIAEKFPEN---KTVAVGHDHRFN 105
           DQR   GT+GLR K  A F+     T     +   + + E  PE     T+ VG D R+ 
Sbjct: 15  DQRP--GTSGLRKKT-AVFTNEPHYT-----ENFIQAVMEAIPEGCKGATLVVGGDGRY- 65

Query: 106 SRDFAEVTSVAFLQLRFKVYSLGFNADPKK-----DAFVHTPMVPFAID--RLGASAGVM 158
              + +V       +  K+ ++G     +K     +  + TP     +   +   + G++
Sbjct: 66  ---YNDV-------ILHKIAAIGAANGVRKLVIGQNGLLSTPAASHIMRTYKEKCTGGII 115

Query: 159 ITASHN---PKMDNGYKVYYSNGCQIIPP--------HDRLIAQSILDNLNPWERAWDCK 207
           +TASHN   PK D G K   SNG     P          +L    I+ +L   E A D  
Sbjct: 116 LTASHNPGGPKNDMGIKYNLSNGGPAPEPVTNKIWEVSKQLDHYKIIPDLP--ELALD-- 171

Query: 208 AVIAEATEKG-YFVDMKKPMVDH--YVKEISD-KLVSSDIGDR--SKPW-FVYTPLHGV- 259
             +AE  + G   VD+     D+  ++KEI D  L+ S I  +   K W  ++  ++GV 
Sbjct: 172 -TLAENVQYGPLLVDVVDTTRDYVEFLKEIFDFPLIKSFIHKQRSQKHWKLLFDGMNGVT 230

Query: 260 ---GFEI----FERIASEVLGLVEGRDYWCVSEHKQPDPAFPTVSFPNPEEXXXXXXXXX 312
              G  I    FE  A EVL        W    H QPD  F  +  P+P           
Sbjct: 231 GPYGKAIFVDEFELPAEEVL------QNW----HPQPD--FGGIH-PDPNLTYARSLVDR 277

Query: 313 XXXKNGISFVLGNDPDADRFSAAVKHQGKWRQLTGNEIGFLFAQFVWEKYQKESSEFKLE 372
              +N I F   +D D DR    +   G      G+ +  +       +Y  E   F  +
Sbjct: 278 VDREN-IEFGAASDGDGDR--NMIYGAGPAFVSPGDSVAII------AEYAAEIPYFAKQ 328

Query: 373 NPLALINSTVSSQMIKKLAGVEKFHYEDTLTGFKWLGN--RARQLESSGYYVPFAYEEAI 430
               L  S  ++  I ++A        +  TG+K+      A++L   G       EE+ 
Sbjct: 329 GIYGLARSFPTASAIDRVAEKHGLKCYEVPTGWKFFCALFDAKKLSICG-------EESF 381

Query: 431 GFMFSDIVHDKDGVSAAVVFLQMLWSWKKQALS---PIDVLQSAF-GKYG--VFKEYNGY 484
           G   S+ V +KDGV A + +L +L  + ++       I ++Q  F  KYG   F  Y+  
Sbjct: 382 G-TGSNHVREKDGVWAIIAWLNLLAIYNRRHPDRDVSIKIIQEEFWKKYGRVFFTRYD-- 438

Query: 485 YTVPDLSLTDRIFSDIRSSYDSYPKHIGNQFDVVSFTDLTKGFQSDTADNTPRLPVDPSS 544
           Y   D +   ++  ++R SY   P  +G++F   +   +T+       D      +D S 
Sbjct: 439 YEHVDSNSAKKVIDNLR-SYTEKPGVVGSKFPTDTTLTVTESGDFSYKD------LDGSV 491

Query: 545 QMIQATLVPSTSGGSGAPLEIVRFTARGSGTEPK---LKVYIEATSVEETRASDLARTTW 601
              Q   V  ++G         RF  R SGT      +++Y+E    +E++        +
Sbjct: 492 SEHQGLYVRLSNG--------ARFVVRLSGTGSSGATIRLYLEKYCDDESK--------Y 535

Query: 602 NVLRDEWFKP 611
            +  +E+ KP
Sbjct: 536 GLTAEEYLKP 545

>Kwal_26.7628 s26 (449302..451014) [1713 bp, 570 aa] {ON} YMR105C
           (PGM2) - Phosphoglucomutase [contig 55] FULL
          Length = 570

 Score = 44.3 bits (103), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 112/450 (24%), Positives = 172/450 (38%), Gaps = 66/450 (14%)

Query: 55  GTAGLRSKMEAGFSRMNTLTVLQASQGLAKYIAEKFPE---NKTVAVGHDHRFNSRDFAE 111
           GT+GLR K +  F      T     +   + I E  PE   N T+ VG D R+ + +  +
Sbjct: 19  GTSGLRKKTKV-FKDEPHYT-----ENFIQAILEAIPEGSENATLVVGGDGRYYNNEVMQ 72

Query: 112 VTSVAFLQLRFKVYSLGFNADPKKDAFVHTPMVPFAIDRL--GASAGVMITASHN---PK 166
           +          +   LG N        + TP     I       + G+++TASHN   P+
Sbjct: 73  IIGAIAAANGVRKMILGQNG------ILSTPAASHIIRSYPEKCTGGIILTASHNPGGPE 126

Query: 167 MDNGYKVYYSNGC--------QIIPPHDRLIAQSILDNLNPWERAWDCKAVIAEATEKGY 218
            D G K   SNG          I     +L    I+ N        D   +  +      
Sbjct: 127 NDFGIKYNLSNGGPAPESVTNAIFEKSKQLTHYKIVKNF----PKIDFSKIGKDQKYGPL 182

Query: 219 FVDMKKPMVDH--YVKEISD-KLVSSDIGD-RSKPWF--VYTPLHGVGFEIFERIASEVL 272
            VD+     D+   +KEI D  L+   I + RS   F  ++  L+GV     E I  + L
Sbjct: 183 LVDVVDSTADYVALMKEIFDFDLIKKFIDNQRSTKGFKILFDSLNGVTGPYGEAIFVKEL 242

Query: 273 GLVEGRDYWCVSEHKQPDPAFPTVSFPNPEEXXXXXXXXXXXXKNGISFVLGNDPDADRF 332
           GL        V ++  P P F  +  P+P              K  I+F   +D D DR 
Sbjct: 243 GLPAEE----VLQNYVPKPDFGGLH-PDP-NLTYAHTLVERVDKEQIAFGAASDGDGDR- 295

Query: 333 SAAVKHQGKWRQLTGNEIGFLFAQFVWEKYQKESSEFKLENPLALINSTVSSQMIKKLAG 392
              +   G      G+ +  +       +Y  E   FK +    L  S  +S  I ++A 
Sbjct: 296 -NMIYGCGPAFVSPGDSVAII------AEYASEIPYFKKQGIYGLARSFPTSAAIDRVAK 348

Query: 393 VEKFHYEDTLTGFKWLGN--RARQLESSGYYVPFAYEEAIGFMFSDIVHDKDGVSAAVVF 450
            +     +  TG+K+      A++L   G       EE+ G   S+ V +KDGV A V +
Sbjct: 349 EQGLACYEVPTGWKFFCALFDAKKLSICG-------EESFG-TGSNHVREKDGVWAIVAW 400

Query: 451 LQMLWSWKK---QALSPIDVLQSAF-GKYG 476
           L +L  + +    +   I V+Q  F  KYG
Sbjct: 401 LNILAIYNRDHPDSDVSIKVIQEKFWAKYG 430

>KNAG0E00940 Chr5 (176887..178503) [1617 bp, 538 aa] {ON} Anc_6.11
           YEL058W
          Length = 538

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 47/121 (38%), Gaps = 21/121 (17%)

Query: 152 GASAGVMITASHNPKMDNGYKVYYSNGC----QIIPPHDRLIAQSILDNLNPWERAWDCK 207
           GA  GVM+TASHNP  DNG KV    G     Q  P   RL   +     + W   W   
Sbjct: 55  GAQVGVMVTASHNPPEDNGVKVVDPEGGMLPEQWEPLATRLANLAANGTFDQWWEYW--- 111

Query: 208 AVIAEATEKGYFVDMKKPMVDHYVKEISDKL----------VSSDIGDRSKPWFVYTP-L 256
                  E+G +    +  V H  +E S +L          VS      SKPW    P L
Sbjct: 112 ---TSLVEEGNYTGGARLCVGHDTRESSPRLLKNLMDAALAVSGGSITISKPWITNHPQL 168

Query: 257 H 257
           H
Sbjct: 169 H 169

>ZYRO0G02508g Chr7 (192411..194120) [1710 bp, 569 aa] {ON} highly
           similar to uniprot|P37012 Saccharomyces cerevisiae
           YMR105C PGM2 Phosphoglucomutase catalyzes the conversion
           from glucose-1-phosphate to glucose-6-phosphate which is
           a key step in hexose metabolism functions as the
           acceptor for a Glc-phosphotransferase and to YKL127W
           uniprot|P33401 Saccharomyces cerevisiae YKL127W PGM1
           Phosphoglucomutase, minor isoform; catalyzes the
           conversion from glucose-1-phosphate to glucose-6-
           phosphate, which is a key step in hexose metabolism
          Length = 569

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 106/437 (24%), Positives = 177/437 (40%), Gaps = 76/437 (17%)

Query: 55  GTAGLRSKMEAGFSRMN-TLTVLQASQGLAKYIAEKFPE---NKTVAVGHDHRFNSRDFA 110
           GT+GLR + +      N T   +QA       I E  PE   +  + VG D R+    + 
Sbjct: 19  GTSGLRKRTKVFAEEPNYTENFIQA-------ILEAIPEGVKDSVLLVGGDGRY----YN 67

Query: 111 EVTSVAFLQLRFKVYSLGFNADPKK-----DAFVHTPMVPFAI---DRLGASAGVMITAS 162
           +V     LQ   K+ ++G     K+     +  + TP     I    +   + G+++TAS
Sbjct: 68  DVV----LQ---KIAAIGAANGVKRLVVGQNGILSTPAASHVIRSYSKAKVTGGIILTAS 120

Query: 163 HNPKMDN---GYKVYYSNGCQIIPPHDRLIAQSILD---NLNPWERAWDCKAV-IAEATE 215
           HNP   N   G K   +NG     P    +  ++ +    L  ++   D   V ++   E
Sbjct: 121 HNPGGPNNDFGIKYNLANGG----PAPENVTNAMWEASKRLTSYKIVTDFPHVDLSALGE 176

Query: 216 KGY------FVDMKKPMVDHYVKEISD-KLVSSDIGDR--SKPW-FVYTPLHGVGFEIFE 265
           K Y       +D  K  VD ++K I D  L+ S +  +  +K W  ++  L+GV      
Sbjct: 177 KQYGSLTVDVIDSTKAYVD-FLKTIFDFPLIKSFVNHQRETKNWKLLFDGLNGVTGPYGR 235

Query: 266 RIASEVLGLVEGRDYWCVSEHKQPDPAFPTVSFPNPEEXXXXXXXXXXXXKNGISFVLGN 325
            I ++ LGL E      V ++  P P F  +  P+P              +N I+F   +
Sbjct: 236 AIFADELGLPEDE----VLQNCHPKPDFGGLH-PDPNLTYARTLVDRVDREN-IAFGAAS 289

Query: 326 DPDADRFSAAVKHQGKWRQLTGNEIGFLFAQFVWEKYQKESSEFKLENPLALINSTVSSQ 385
           D D DR    +   G      G+ +  +       +Y  E   F+ E    L  S  +SQ
Sbjct: 290 DGDGDR--NMIYGAGPAFVSPGDSVAII------AEYASEIPYFQREGIYGLARSFPTSQ 341

Query: 386 MIKKLAGVEKFHYEDTLTGFKWLGN--RARQLESSGYYVPFAYEEAIGFMFSDIVHDKDG 443
            I  +A        +  TG+K+      A++L   G       EE+ G   S+ + +KDG
Sbjct: 342 AIDLVAKHHNLSCYEVPTGWKFFCALFDAKKLSICG-------EESFG-TGSNHIREKDG 393

Query: 444 VSAAVVFLQMLWSWKKQ 460
           + A + +L +L  + K+
Sbjct: 394 LWAIIAWLNILAIYHKR 410

>CAGL0B03597g Chr2 complement(359018..360640) [1623 bp, 540 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058w PCM1 phosphoacetylglucosamine mutase
          Length = 540

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 29/75 (38%), Positives = 40/75 (53%), Gaps = 7/75 (9%)

Query: 128 GFNADPK-KDAFVHTPMVPFAIDRLG---ASAGVMITASHNPKMDNGYKVYYSNGCQII- 182
           GF AD +  D+ + T  V  A+  +    A  GVMITASHNP  DNG K+  S+G  ++ 
Sbjct: 23  GFRADARILDSVMFTTGVIAALRSISCQCAPVGVMITASHNPPRDNGVKIVESDGSMLLQ 82

Query: 183 --PPHDRLIAQSILD 195
              P    +A S+ D
Sbjct: 83  DWEPLATRLANSVAD 97

>TPHA0G02900 Chr7 (622303..624012) [1710 bp, 569 aa] {ON} 
          Length = 569

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 135/586 (23%), Positives = 223/586 (38%), Gaps = 108/586 (18%)

Query: 55  GTAGLRSKMEAGFSRMN-TLTVLQASQGLAKYIAEKFPE---NKTVAVGHDHRFNS---- 106
           GT+GLR K +   +  N T   +QA       I +  PE   N T+ VG D RF +    
Sbjct: 19  GTSGLRKKSKVFMNEPNYTENFIQA-------ILDAIPEGSENSTLVVGGDGRFYNDVIL 71

Query: 107 RDFAEVTSVAFLQLRFKVYSLGFNADPKKDAFVHTPMVPFAIDRLGASAGVMITASHN-- 164
           +  AE+ +   ++ +  +   G  + P     + T            + G+++TASHN  
Sbjct: 72  QLIAEIGAANGVR-KLIIGQAGILSTPAASHIIRTY-------HEEVTGGIILTASHNPG 123

Query: 165 -PKMDNGYKVYYSNGCQIIPPHDRLIAQSILD---NLNPWERAWDCKAV----IAEATEK 216
            P+ D G K   +NG     P    +  +I +   NL  ++   D   +    I+E  + 
Sbjct: 124 GPENDIGIKYNLANGG----PAPESVTNAIWEASKNLTTYKTMKDFPKIDINTISENVKY 179

Query: 217 G-YFVDMKKPMVDH--YVKEISD-KLVSSDIGDRSKP--W-FVYTPLHGVGFEIFERIAS 269
           G   +D+     D+  ++KEI D  L+   I  + K   W  ++  L+GV     + I  
Sbjct: 180 GPLLIDIIDSTEDYVKFLKEIFDFPLIKKFIETQRKTNNWKLLFDSLNGVTGPYGKAIFV 239

Query: 270 EVLGLVEGRDYWCVSEHKQPDPAFPTVSFPNPEEXXXXXXXXXXXXKNGISFVLGNDPDA 329
           +  GL        V ++  P P F  +  P+P              K  I F   +D D 
Sbjct: 240 DEFGLPADE----VLQNWHPQPDFGGLH-PDP-NLTYARTLVDRVDKEKIEFGAASDGDG 293

Query: 330 DRFSAAVKHQGKWRQLTGNEIGFLFAQFVWEKYQKESSEFKLENPLALINSTVSSQMIKK 389
           DR    +   G      G+ +  +       +Y  E   F  +    +  S  +S  I  
Sbjct: 294 DR--NMIYGYGPAFVSPGDSVAII------AEYANEIPYFAKQGIYGVARSFPTSSAIDL 345

Query: 390 LAGVEKFHYEDTLTGFKWLGN--RARQLESSGYYVPFAYEEAIGFMFSDIVHDKDGVSAA 447
           +A  +     +  TG+K+      A++L   G       EE+ G   S+ V +KDGV A 
Sbjct: 346 VAKHKGLDCYEVPTGWKFFCALFDAKKLSICG-------EESFG-TGSNHVREKDGVWAI 397

Query: 448 VVFLQMLWSWKK---QALSPIDVLQSAF-GKYGVFKEYNGYYTVPDLSLTDRIFSDIRSS 503
           + +L +L  + K   +  + I  +Q+ F  KYG                  R F   R  
Sbjct: 398 IAWLNILAIYNKHHPEKDASIKTIQTEFWQKYG------------------RTFF-TRYD 438

Query: 504 YDSYPKHIGNQFDVVSFTDLTKGFQSDTADNTPRLPVDPSSQMIQA------TLVPSTSG 557
           Y+S P       D     D    F ++        P DP+  ++         L  S S 
Sbjct: 439 YESLPSA-----DAAKVVDFLNAFVTNPKTKNAAFPGDPNLTVVDCGDFSYTDLDGSVSD 493

Query: 558 GSGAPLEI---VRFTARGSGTEPK---LKVYIEATSVEETRASDLA 597
             G   ++    R   R SGT      +++Y E  S ++T+ +D A
Sbjct: 494 HQGLFFKLSNGARIVLRLSGTGSSGATIRLYAEQYSDDQTKYNDSA 539

>TDEL0E00210 Chr5 (28244..29956) [1713 bp, 570 aa] {ON} Anc_2.445
           YKL127W
          Length = 570

 Score = 41.2 bits (95), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 108/454 (23%), Positives = 173/454 (38%), Gaps = 71/454 (15%)

Query: 55  GTAGLRSKMEAGFSRMNTLTVLQASQGLAKYIAEKFPE---NKTVAVGHDHRFNSRDFAE 111
           GT+GLR K       MN +     ++   + I +  PE   +  + VG D R+ +    +
Sbjct: 17  GTSGLRKKTAV---FMNNV---HYTENFIQSILDAIPESSKDAILVVGGDGRYYNDKILQ 70

Query: 112 VTSVAFLQLRFKVYSLGFNADPKKDAFVHTPMVPFAI----DRLG--ASAGVMITASHN- 164
           + +        +   +G      +   + TP     I    D+ G   + G+++TASHN 
Sbjct: 71  IIAAISAANGVRKLVIG------QHGLLSTPAASHIIRSYQDKDGKKVTGGIILTASHNP 124

Query: 165 --PKMDNGYKVYYSNGCQIIPPHDRLIAQSILDNLNPWERAWDCKAV----IAEATEKGY 218
             P+ D G K   SNG     P    +  +I D           K      ++   EK Y
Sbjct: 125 GGPENDIGIKYNLSNGG----PAPESVTNAIWDISKKLTHYKIVKGFPEINLSVKGEKSY 180

Query: 219 ------FVDMKKPMVDHYVKEISD-KLVSS--DIGDRSKPW-FVYTPLHGVGFEIFERIA 268
                  VD  +  VD ++K I D  L+    D    +K W  ++  L+GV       I 
Sbjct: 181 GSLVIDVVDTTQEYVD-FLKGIFDFDLIKKFVDTQRSTKNWKLLFDGLNGVTGPYGRAIF 239

Query: 269 SEVLGLVEGRDYWCVSEHKQPDPAFPTVSFPNPEEXXXXXXXXXXXXKNGISFVLGNDPD 328
            + LGL E      V ++  P P F  +  P+P              K  I F   +D D
Sbjct: 240 VDELGLPENE----VLQNCHPKPDFGGIH-PDP-NLTYARTLVDRVDKEKIEFGAASDGD 293

Query: 329 ADRFSAAVKHQGKWRQLTGNEIGFLFAQFVWEKYQKESSEFKLENPLALINSTVSSQMIK 388
            DR    +   G      G+ +  +       +Y  E   F       L  S  +S  I 
Sbjct: 294 GDR--NMIYGYGPAFVSPGDSVAII------AEYASEIPYFAQNGIYGLARSFPTSTAID 345

Query: 389 KLAGVEKFHYEDTLTGFKWLGN--RARQLESSGYYVPFAYEEAIGFMFSDIVHDKDGVSA 446
           ++A  +  +     TG+K+      A++L   G       EE+ G   S+ V +KDGV A
Sbjct: 346 RVAKAKGLNCYVVPTGWKFFCALFDAKKLSICG-------EESFG-TGSNHVREKDGVWA 397

Query: 447 AVVFLQMLWSWKK---QALSPIDVLQSAF-GKYG 476
            + +L +L  + K   +  + I  +Q  F  KYG
Sbjct: 398 VIAWLNILAIYNKHNPEKEASIKTIQEEFWLKYG 431

>Smik_13.291 Chr13 complement(460399..462108) [1710 bp, 569 aa] {ON}
           YKL127W (REAL)
          Length = 569

 Score = 40.8 bits (94), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 108/453 (23%), Positives = 180/453 (39%), Gaps = 72/453 (15%)

Query: 55  GTAGLRSKMEAGFSRMNTLTVLQASQGLAKYIAEKFPENK---TVAVGHDHRFNSRDFAE 111
           GT+GLR K +    + N       ++   + I E  PE     T+ VG D R+    + +
Sbjct: 19  GTSGLRKKTKVFKDQPNY------TENFIQSIMEAIPEGSKGATLVVGGDGRY----YND 68

Query: 112 VTSVAFLQLRFKVYSLGFNADPKK-----DAFVHTPMVPFAIDRL--GASAGVMITASHN 164
           V       +  K+ ++G     KK        + TP     +       + G+++TASHN
Sbjct: 69  V-------ILHKIAAIGAANGVKKLVIGQHGLLSTPAASHIMRTYEEKCTGGIILTASHN 121

Query: 165 ---PKMDNGYKVYYSNGCQIIPPHDRLIAQSILDNLNPWERAWDCK----AVIAEATEKG 217
              P+ D G K   SNG    P     +   I   L  ++   D      A I +  + G
Sbjct: 122 PGGPENDMGIKYNLSNGGP-APESVTNVIWDISKKLTSYKIIKDFPELDLATIGKNKKYG 180

Query: 218 YF----VDMKKPMVDHYVKEISD-KLVSSDIGDR--SKPW-FVYTPLHGVGFEIFERIAS 269
                 +D+ K  VD ++KEI D KL+   I ++  +K W  ++  ++GV     + I  
Sbjct: 181 PLLVDIIDITKDYVD-FLKEIFDFKLIKKFIDNQRSTKNWKLLFDSMNGVTGPYGKAIFV 239

Query: 270 EVLGLVEGRDYWCVSEHKQPDPAFPTVSFPNPEEXXXXXXXXXXXXKNGISFVLGNDPDA 329
           +  GL        V ++  P P F  +  P+P              +  I F   +D D 
Sbjct: 240 DEFGLPADE----VLQNWHPSPDFGGMH-PDP-NLTYASTLVKRVDREKIEFGAASDGDG 293

Query: 330 DRFSAAVKHQGKWRQLTGNEIGFLFAQFVWEKYQKESSEFKLENPLALINSTVSSQMIKK 389
           DR    +   G      G+ +  +       +Y  E   F  +    L  S  +S  I +
Sbjct: 294 DR--NMIYGYGPSFVSPGDSVAII------AEYAAEIPYFAKQGIYGLARSFPTSAAIDR 345

Query: 390 LAGVEKFHYEDTLTGFKWLGN--RARQLESSGYYVPFAYEEAIGFMFSDIVHDKDGVSAA 447
           +A     +  +  TG+K+      A++L   G       EE+ G   S+ V +KDGV A 
Sbjct: 346 VAKAHGLNCYEVPTGWKFFCALFDAKKLSICG-------EESFG-TGSNHVREKDGVWAI 397

Query: 448 VVFLQMLWSWKK---QALSPIDVLQSAF-GKYG 476
           + +L +L  + K   +  + I  +Q+ F  KYG
Sbjct: 398 MAWLNILAIYNKHHPENEASIKTIQNEFWAKYG 430

>Kpol_1033.54 s1033 (136243..137955) [1713 bp, 570 aa] {ON}
           (136243..137955) [1713 nt, 571 aa]
          Length = 570

 Score = 40.4 bits (93), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 134/587 (22%), Positives = 221/587 (37%), Gaps = 119/587 (20%)

Query: 55  GTAGLRSKMEAGFSRMNTLTVLQASQGLAKYIAEKFP---ENKTVAVGHDHRFNSRDFAE 111
           GT+GLR K +   S  N       ++   + I    P   +N T+ VG D RF    + +
Sbjct: 19  GTSGLRKKTKIFMSEKN------YTENFIQSILNSIPNGVKNSTIVVGGDGRF----YND 68

Query: 112 VTSVAFLQLR----FKVYSLGFNADPKKDAFVHTPMVPFAIDRLGASA---GVMITASHN 164
           +     +Q+      +   +G      ++  + TP   + I     S    G+++TASHN
Sbjct: 69  IILDKIMQISAANGVRKLVIG------QNGILSTPAASYIIRNYKESCNGGGIILTASHN 122

Query: 165 ---PKMDNGYKVYYSNGC--------QIIPPHDRLIAQSILDNLNPWERAWDCKAVIAEA 213
              P+ D G K   SNG         +I      L    I++NL   +        ++E 
Sbjct: 123 PGGPENDIGIKYNLSNGGPAPESITDEIWEASKHLTHYKIIENLPQLD-----TTKVSEN 177

Query: 214 TEKGYF----VDMKKPMVDHYVKEISD-KLVSSDIGDRSKP--W-FVYTPLHGVGFEIFE 265
            + G      +D  K  V+  +KEI D  L+ + I  + +   W  ++  L+GV     +
Sbjct: 178 VKYGPLLVDIIDSTKSYVE-LMKEIFDFPLIRNFIHTQREKNNWKLLFDSLNGVTGPYGK 236

Query: 266 RIASEVLGLV--EGRDYWCVSEHKQPDPAFPTVSFPNPEEXXXXXXXXXXXXKNGISFVL 323
            I  + LGL+  E    W       P P F  +  P+P              +  I+F  
Sbjct: 237 TIFVDELGLLADETLQNW------HPLPDFGGLH-PDP-NLTYAHTLVERVDREMINFGA 288

Query: 324 GNDPDADRFSAAVKHQGKWRQLTGNEIGFLFAQFVWEKYQKESSEFKLENPLALINSTVS 383
            +D D DR    +   G      G+ +  +       +Y  E   F  +    +  S  +
Sbjct: 289 ASDGDGDR--NMIYGYGPSFVSPGDSLAII------SEYADEIPYFAKQGMFGVARSFPT 340

Query: 384 SQMIKKLAGVEKFHYEDTLTGFKWLGN--RARQLESSGYYVPFAYEEAIGFMFSDIVHDK 441
           S  I ++A  +  +  +  TG+K+      A++L   G       EE+ G   S+ + +K
Sbjct: 341 SSAIDRVAKAKGLNCYEVPTGWKFFCALFDAQKLSICG-------EESFG-TGSNHIREK 392

Query: 442 DGVSAAVVFLQMLWSWKK---QALSPIDVLQSAF-GKYGVFKEYNGYYTVPDLSLTDRIF 497
           DG+ A V +L +L  + K   +  S I  +Q  F  KYG                     
Sbjct: 393 DGLWAIVAWLNILAIYNKRNPEKESSIKNIQMDFWLKYG--------------------- 431

Query: 498 SDIRSSYDSYPKHIGNQFDVVSFTDLTKGFQSDTADNTPRLPVDPSSQMIQA------TL 551
              R+ +  Y     +  D      L K + SD      R P D S  + +        L
Sbjct: 432 ---RTFFTRYDYENLSSEDAEKVVKLLKDYVSDPQTLNSRFPEDDSITVTECGDFEYTDL 488

Query: 552 VPSTSGGSGAPLEI---VRFTARGSGTEPK---LKVYIEATSVEETR 592
             + S   G  L++    RF  R SGT      L++Y E  S +ET+
Sbjct: 489 DGTVSKNQGLYLKLSNGARFVIRLSGTGSSGATLRLYTEQYSNDETK 535

>NCAS0F00200 Chr6 complement(30474..32123) [1650 bp, 549 aa] {ON}
           Anc_6.11 YEL058W
          Length = 549

 Score = 40.4 bits (93), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 17/32 (53%), Positives = 20/32 (62%)

Query: 151 LGASAGVMITASHNPKMDNGYKVYYSNGCQII 182
            G   GVM+TASHNP +DNG KV    G  +I
Sbjct: 56  CGTPVGVMVTASHNPPLDNGVKVVEPTGAMLI 87

>KLTH0D04796g Chr4 (437416..439128) [1713 bp, 570 aa] {ON} highly
           similar to uniprot|P37012 Saccharomyces cerevisiae
           YMR105C PGM2 Phosphoglucomutase catalyzes the conversion
           from glucose-1-phosphate to glucose-6-phosphate which is
           a key step in hexose metabolism functions as the
           acceptor for a Glc-phosphotransferase and to YKL127W
           uniprot|P33401 Saccharomyces cerevisiae YKL127W PGM1
           Phosphoglucomutase, minor isoform; catalyzes the
           conversion from glucose-1-phosphate to glucose-6-
           phosphate, which is a key step in hexose metabolism
          Length = 570

 Score = 40.0 bits (92), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 110/456 (24%), Positives = 183/456 (40%), Gaps = 78/456 (17%)

Query: 55  GTAGLRSKMEAGFSRMN-TLTVLQASQGLAKYIAEKFPE---NKTVAVGHDHRFNSRDFA 110
           GT+GLR K +   +  + T   +QA       I E  PE   +  + VG D R+ + +  
Sbjct: 19  GTSGLRKKTKVFMNEPHYTENFIQA-------IMEAIPEGSQDAVLVVGGDGRYYNNEVL 71

Query: 111 EVTSVAFLQLRFKVYSLGFNADPKK-----DAFVHTPMVPFAIDRL--GASAGVMITASH 163
           +           K+  +G     KK     +  + TP     I      ++ G+++TASH
Sbjct: 72  Q-----------KIGEIGAANGVKKLIVGQNGLLSTPAASHIIRSYPEKSTGGIILTASH 120

Query: 164 N---PKMDNGYKVYYSNGCQIIPPHDRLIAQSILD---NLNPWERAWDCKAV----IAEA 213
           N   P+ D G K   SNG     P    +  SI +    L  ++   +   +    I + 
Sbjct: 121 NPGGPENDFGIKYNLSNGG----PAPESVTNSIFEKSKQLASYKTVKNFPKINLSKIGKN 176

Query: 214 TEKG-YFVDMKKPMVDH--YVKEISD-KLVSSDIG-DRSKPWF--VYTPLHGVGFEIFER 266
            E G   VD+     ++   +KEI D  L+   I   RS   F  ++  L+G+     + 
Sbjct: 177 QEYGSLLVDVIDVTAEYVKLMKEIFDFDLIKKFIDHQRSTKGFKILFDALNGITGPYGKA 236

Query: 267 IASEVLGLVEGRDYWCVSEHKQPDPAFPTVSFPNPEEXXXXXXXXXXXXKNGISFVLGND 326
           I ++ LGL        V ++ +P P F  +  P+P              K  I+F   +D
Sbjct: 237 IFADELGLPAEE----VLQNYEPKPDFGGLH-PDP-NLTYAHTLVERVDKEQIAFGAASD 290

Query: 327 PDADRFSAAVKHQGKWRQLTGNEIGFLFAQFVWEKYQKESSEFKLENPLALINSTVSSQM 386
            D DR    +   G      G+ +  +       +Y  E   FK +    L  S  +S  
Sbjct: 291 GDGDR--NMIYGCGPAFVSPGDSVAII------AEYASEIPYFKKQGIYGLARSFPTSAA 342

Query: 387 IKKLAGVEKFHYEDTLTGFKWLGN--RARQLESSGYYVPFAYEEAIGFMFSDIVHDKDGV 444
           I ++A  +  +  +  TG+K+      A++L   G       EE+ G   S+ V +KDGV
Sbjct: 343 IDRVAKAQGLNCYEVPTGWKFFCALFDAKKLSICG-------EESFG-TGSNHVREKDGV 394

Query: 445 SAAVVFLQMLWSWKKQA----LSPIDVLQSAFGKYG 476
            A V +L +L  + ++     +S   VL   + KYG
Sbjct: 395 WAIVAWLNILAIYNREHPDSDVSIKVVLDEFWAKYG 430

>Kpol_1018.161 s1018 (412372..414081) [1710 bp, 569 aa] {ON}
           (412372..414081) [1710 nt, 570 aa]
          Length = 569

 Score = 40.0 bits (92), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 102/431 (23%), Positives = 168/431 (38%), Gaps = 64/431 (14%)

Query: 55  GTAGLRSKMEAGFSRMN-TLTVLQASQGLAKYIAEKFPEN---KTVAVGHDHRF-NSRDF 109
           GT+GLR K +      N T   +QA+        +  PE     T+ VG D R+ N    
Sbjct: 19  GTSGLRKKTKVFAEEPNYTENFIQATM-------DAIPEGCKGATLVVGGDGRYYNDVIM 71

Query: 110 AEVTSVAFLQLRFKVYSLGFNADPKKDAFVHTPMVPFAID--RLGASAGVMITASHN--- 164
            ++ S+A      K+  +G N        + TP     I   +   + G+++TASHN   
Sbjct: 72  NKIVSIAGANGVRKLI-IGHNG------ILSTPAASHVIRSYKEKCTGGIILTASHNPGG 124

Query: 165 PKMDNGYKVYYSNGC--------QIIPPHDRLIAQSILDNLNPWERAWDCKAVIAEATEK 216
           PK D G K   +NG          I     +L    +++ L       D   +  +    
Sbjct: 125 PKNDIGIKYNLANGGPAPESVTNAIWEASKKLTEYKVIEGL----PELDTSKIAVDIKYG 180

Query: 217 GYFVDM---KKPMVDHYVKEISD-KLVSSDIGDR--SKPW-FVYTPLHGVGFEIFERIAS 269
              VD+    +  VD Y+KEI D KL+   +  +  +K W  ++  L+GV     E I  
Sbjct: 181 PLLVDIIDSTEAYVD-YLKEIFDFKLIKEFVTKQRETKGWKLLFDSLNGVTGPYGEAIFV 239

Query: 270 EVLGLVEGRDYWCVSEHKQPDPAFPTVSFPNPEEXXXXXXXXXXXXKNGISFVLGNDPDA 329
           + LGL        V ++  P P F  +  P+P              +N I F   +D D 
Sbjct: 240 KELGLPADE----VLQNWHPLPDFGGLH-PDPNLTYAHTLVERVDKEN-IQFGAASDGDG 293

Query: 330 DRFSAAVKHQGKWRQLTGNEIGFLFAQFVWEKYQKESSEFKLENPLALINSTVSSQMIKK 389
           DR    +   G      G+ +  +       +Y  E   F  +    +  S  +S  + +
Sbjct: 294 DR--NMIYGAGPAFVSPGDSVAII------SEYADEIPYFAKQGIYGVARSFPTSSALDR 345

Query: 390 LAGVEKFHYEDTLTGFKWLGNRARQLESSGYYVPFAYEEAIGFMFSDIVHDKDGVSAAVV 449
           +A  +  +  +  TG+K+        +     V    EE+ G   S+ + +KDGV A V 
Sbjct: 346 VAKAKGLNCYEVPTGWKFFCALFDDQK-----VSICGEESFG-TGSNHIREKDGVWAIVA 399

Query: 450 FLQMLWSWKKQ 460
           +L +L  + K 
Sbjct: 400 WLNILAIYNKH 410

>TBLA0G00980 Chr7 complement(248484..250160) [1677 bp, 558 aa] {ON}
           Anc_6.11 YEL058W
          Length = 558

 Score = 40.0 bits (92), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 16/30 (53%), Positives = 21/30 (70%)

Query: 152 GASAGVMITASHNPKMDNGYKVYYSNGCQI 181
           G + GVM+TASHNP +DNG K+   NG  +
Sbjct: 59  GKAVGVMVTASHNPPVDNGVKIVEPNGSML 88

>KLLA0B12694g Chr2 (1107696..1109402) [1707 bp, 568 aa] {ON} highly
           similar to uniprot|P37012 Saccharomyces cerevisiae
           YMR105C PGM2 Phosphoglucomutase catalyzes the conversion
           from glucose-1-phosphate to glucose-6-phosphate which is
           a key step in hexose metabolism functions as the
           acceptor for a Glc-phosphotransferase and to YKL127W
           uniprot|P33401 Saccharomyces cerevisiae YKL127W PGM1
           Phosphoglucomutase, minor isoform; catalyzes the
           conversion from glucose-1-phosphate to glucose-6-
           phosphate, which is a key step in hexose metabolism
          Length = 568

 Score = 39.7 bits (91), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 100/430 (23%), Positives = 169/430 (39%), Gaps = 64/430 (14%)

Query: 55  GTAGLRSKMEAGFSRMNTLTVLQASQGLAKYIAEKFPENK---TVAVGHDHRF-NSRDFA 110
           GT+GLR K +  F      T     +   + I E  PE     T+ +G D R+ N     
Sbjct: 19  GTSGLRKKTKV-FEETPNYT-----ENFIQAIMEAIPEGSQGATLVIGGDGRYYNDVVIQ 72

Query: 111 EVTSVAFLQLRFKVYSLGFNADPKKDAFVHTPMVPFAIDRL--GASAGVMITASHN---P 165
           ++ ++       K+  +G N        + TP     I       + G+++TASHN   P
Sbjct: 73  KIAAIGSANGVRKIV-IGHNG------ILSTPAASHIIRAYHEKCTGGIILTASHNPGGP 125

Query: 166 KMDNGYKVYYSNGCQIIPPHDRLIAQSILDN---LNPWERAWDCKAV-IAEATEKGYFVD 221
             D G K   +NG     P    +  SI      L  ++      A+ + +  +   + D
Sbjct: 126 TNDFGIKYNLANGG----PAPESVTNSIWHKSRELTHYKIVESFPAIDLTKIGQDQKYGD 181

Query: 222 MKKPMVD------HYVKEISD-KLVSSDIGDRSKPWF--VYTPLHGVGFEIFERIASEVL 272
           +   +VD        +KEI D  L+ S I  ++K  F  ++  ++GV     E +  + L
Sbjct: 182 LLVDIVDSTAAYVELMKEIFDFPLIKSFIDTQAKNGFKILFDAMNGVTGPYGEALFVKEL 241

Query: 273 GLVEGRDYWCVSEHKQPDPAFPTVSFPNPEEXXXXXXXXXXXXKNGISFVLGNDPDADRF 332
           GL E        ++  P P F  +  P+P              K GI F   +D D DR 
Sbjct: 242 GLPESS-----LQNYHPKPDFGGLH-PDP-NLTYAHTLVERVDKYGIQFGAASDGDGDR- 293

Query: 333 SAAVKHQGKWRQLTGNEIGFLFAQFVWEKYQKESSEFKLENPLALINSTVSSQMIKKLAG 392
              +   G      G+ +  +       +Y      FK +    L  S  +S  I ++A 
Sbjct: 294 -NMIYGAGPAFVSPGDSVAII------AEYASAIPYFKKQGIYGLARSFPTSSAIDRVAK 346

Query: 393 VEKFHYEDTLTGFKWLGN--RARQLESSGYYVPFAYEEAIGFMFSDIVHDKDGVSAAVVF 450
            +  +  +  TG+K+      A++L   G       EE+ G   S+ V +KDGV A + +
Sbjct: 347 EQGLNCYEVPTGWKFFCALFDAKKLSICG-------EESFG-TGSNHVREKDGVWAIMAW 398

Query: 451 LQMLWSWKKQ 460
           L +L  + ++
Sbjct: 399 LNILAIYNQR 408

>Kpol_1032.2 s1032 complement(1049..2668) [1620 bp, 539 aa] {ON}
           complement(1049..2668) [1620 nt, 540 aa]
          Length = 539

 Score = 39.3 bits (90), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 17/30 (56%), Positives = 20/30 (66%)

Query: 152 GASAGVMITASHNPKMDNGYKVYYSNGCQI 181
           G + GVMITASHNP  DNG K+   NG  +
Sbjct: 51  GKAVGVMITASHNPPEDNGVKIVEPNGAML 80

>TDEL0G04600 Chr7 (838381..839967) [1587 bp, 528 aa] {ON} Anc_6.11
           YEL058W
          Length = 528

 Score = 39.3 bits (90), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 20/31 (64%)

Query: 152 GASAGVMITASHNPKMDNGYKVYYSNGCQII 182
           G   GVMITASHNP  DNG KV   +G  +I
Sbjct: 54  GKPVGVMITASHNPSGDNGVKVVEPDGSMLI 84

>KAFR0L00340 Chr12 complement(62157..63779) [1623 bp, 540 aa] {ON}
           Anc_6.11 YEL058W
          Length = 540

 Score = 38.5 bits (88), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 17/31 (54%), Positives = 20/31 (64%)

Query: 152 GASAGVMITASHNPKMDNGYKVYYSNGCQII 182
           G   GVMITASHNP  DNG K+   +G  +I
Sbjct: 56  GKYIGVMITASHNPPQDNGVKIVEPSGAMLI 86

>KAFR0D03010 Chr4 (594118..595827) [1710 bp, 569 aa] {ON} Anc_2.445
           YKL127W
          Length = 569

 Score = 38.5 bits (88), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 105/432 (24%), Positives = 165/432 (38%), Gaps = 66/432 (15%)

Query: 55  GTAGLRSKMEAGFSRMN-TLTVLQASQGLAKYIAEKFPENK---TVAVGHDHRFNSRDFA 110
           GT+GLR K        N T   +QA       I E  PE     T+ VG D R+ +    
Sbjct: 19  GTSGLRKKTVIFKDEPNYTENFIQA-------IMESIPEGSDGATLVVGGDGRYYNDVIL 71

Query: 111 EVTSVAFLQLRFKVYSLGFNADPKKDAFVHTPMVPFAIDRL--GASAGVMITASHN---P 165
           E  +        K   +G N        + TP     I       + G+++TASHN   P
Sbjct: 72  EKIAKIGAANGVKKLVVGQNG------LLSTPAASHIIRSYHEKVTGGIILTASHNPGGP 125

Query: 166 KMDNGYKVYYSNGCQIIPPHDRLIAQSILDN---LNPWERAWDCKAV----IAEATEKGY 218
           K D G K   +NG     P    +   I +N   L  ++   D   +    I E  + G 
Sbjct: 126 KNDMGIKYNLANGG----PAPESVTDKIWENSKKLTSYKIIKDLPTLDTSKIGENQKYGP 181

Query: 219 F----VDMKKPMVDHYVKEISD-KLVSSDIGD--RSKPW-FVYTPLHGVGFEIFERIASE 270
                +D+ K  V+ ++KEI D +L+   I    ++K W  ++  L+G+     + I  +
Sbjct: 182 ILIDVIDVTKAYVE-FLKEIFDFELIKKFIHTQRKTKNWKLLFDGLNGITGPYGKAIFVD 240

Query: 271 VLGLVEGRDYWCVSEHKQPDPAFPTVSFPNPEEXXXXXXXXXXXXKNGISFVLGNDPDAD 330
              L E      V ++  P P F  +  P+P              K  I F   +D D D
Sbjct: 241 EFELPENE----VLQNYHPQPDFGGLH-PDP-NLTYARSLVDRVDKEKIEFGAASDGDGD 294

Query: 331 RFSAAVKHQGKWRQLTGNEIGFLFAQFVWEKYQKESSEFKLENPLALINSTVSSQMIKKL 390
           R    +   G      G+ +  +       +Y  E   F  +    L  S  +S  I ++
Sbjct: 295 R--NMIYGYGPAFVSPGDSVAII------AEYASEIPYFAKQGIYGLARSFPTSAAIDRV 346

Query: 391 AGVEKFHYEDTLTGFKWLGN--RARQLESSGYYVPFAYEEAIGFMFSDIVHDKDGVSAAV 448
           A        +  TG+K+      A++L   G       EE+ G   S+ V +KDG+ A V
Sbjct: 347 AKAHGLECYEVPTGWKFFCALFDAKKLSICG-------EESFG-TGSNHVREKDGLWAIV 398

Query: 449 VFLQMLWSWKKQ 460
            +L +L  + K 
Sbjct: 399 AWLNVLAIFNKH 410

>SAKL0E03630g Chr5 complement(294321..296036) [1716 bp, 571 aa] {ON}
           highly similar to uniprot|P37012 Saccharomyces
           cerevisiae YMR105C PGM2 Phosphoglucomutase catalyzes the
           conversion from glucose-1-phosphate to
           glucose-6-phosphate which is a key step in hexose
           metabolism functions as the acceptor for a
           Glc-phosphotransferase and to YKL127W uniprot|P33401
           Saccharomyces cerevisiae YKL127W PGM1
           Phosphoglucomutase, minor isoform; catalyzes the
           conversion from glucose-1-phosphate to glucose-6-
           phosphate, which is a key step in hexose metabolism
          Length = 571

 Score = 38.1 bits (87), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 105/454 (23%), Positives = 179/454 (39%), Gaps = 73/454 (16%)

Query: 55  GTAGLRSKMEAGFSRMN-TLTVLQASQGLAKYIAEKFPE---NKTVAVGHDHRFNSRDFA 110
           GT+GLR K +      N T   +QA       + +  PE   + T+ VG D RF +    
Sbjct: 19  GTSGLRKKTKVFMEEPNYTENFIQA-------VMDAIPEGSQDATLVVGGDGRFYND--V 69

Query: 111 EVTSVAFLQLRFKVYSLGFNADPKKDAFVHTPMVPFAID---RLGASAGVMITASHNP-- 165
            V  +A +     V+ L       ++  + TP     I        + G+++TASHNP  
Sbjct: 70  VVQKIAAIGAANGVHKLVIG----QNGILSTPAASHIIRTYPHAKITGGIILTASHNPGG 125

Query: 166 -KMDNGYKVYYSNGC--------QIIPPHDRLIAQSILDN---LNPWERAWDCK-----A 208
            K D G K   SNG         +I     +L +  I+ N   L+  ++  D +      
Sbjct: 126 AKNDFGIKYNLSNGGPAPESVTNKIFEKSKQLTSYKIVANFPQLDLSKKGTDQRYGPLLV 185

Query: 209 VIAEATEKGYFVDMKKPMVDHYVKEISDKLVSSDIGDRSKPWFVYTPLHGVGFEIFERIA 268
            I ++TE   +V + K + D  + +   K     +G +     ++  L+GV     + + 
Sbjct: 186 DIIDSTEA--YVKLMKSIFDFDLIKKFIKTQKETVGFK----LLFDSLNGVTGPYGKALF 239

Query: 269 SEVLGLVEGRDYWCVSEHKQPDPAFPTVSFPNPEEXXXXXXXXXXXXKNGISFVLGNDPD 328
            + LGL          ++  P P F  +  P+P              K+ I+F   +D D
Sbjct: 240 VDELGLSAEESL----QNYVPKPDFGGLH-PDP-NLTYAHTLVERVDKDKIAFGAASDGD 293

Query: 329 ADRFSAAVKHQGKWRQLTGNEIGFLFAQFVWEKYQKESSEFKLENPLALINSTVSSQMIK 388
            DR    +   G      G+ +  +       +Y  E   F  +    L  S  +S  I 
Sbjct: 294 GDR--NMIYGYGPAFVSPGDSVAII------AEYASEIPYFAKQGIYGLARSFPTSAAID 345

Query: 389 KLAGVEKFHYEDTLTGFKWLGN--RARQLESSGYYVPFAYEEAIGFMFSDIVHDKDGVSA 446
           ++A     +  +  TG+K+      A++L   G       EE+ G   S+ V +KDGV A
Sbjct: 346 RVAKAHGLNCYEVPTGWKFFCALFDAKKLSICG-------EESFG-TGSNHVREKDGVWA 397

Query: 447 AVVFLQMLWSWKKQ---ALSPIDVLQSAF-GKYG 476
            + +L +L  + ++     + I  +Q  F  KYG
Sbjct: 398 IMAWLNILAIYNRKNPTKEASIKTIQEEFWNKYG 431

>ACR015W Chr3 (383130..384788) [1659 bp, 552 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL058W (PCM1)
          Length = 552

 Score = 38.1 bits (87), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 29/77 (37%), Positives = 38/77 (49%), Gaps = 19/77 (24%)

Query: 123 KVYSLGFNADPKKDAFVHTPMVPFAIDRL---------GASAGVMITASHNPKMDNGYKV 173
           +VY+ G  A  +  A V  P+V FA   L         GA  GVM+TASHNP  DNG K 
Sbjct: 19  RVYAYG-TAGFRSRAEVLAPVV-FATGLLACLRSLYLGGAYVGVMLTASHNPPEDNGVK- 75

Query: 174 YYSNGCQIIPPHDRLIA 190
                  ++ PH  ++A
Sbjct: 76  -------LVDPHGEMLA 85

>YEL058W Chr5 (43252..44925) [1674 bp, 557 aa] {ON}  PCM1Essential
           N-acetylglucosamine-phosphate mutase; converts
           GlcNAc-6-P to GlcNAc-1-P, which is a precursor for the
           biosynthesis of chitin and for the formation of
           N-glycosylated mannoproteins and
           glycosylphosphatidylinositol anchors
          Length = 557

 Score = 37.7 bits (86), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 20/31 (64%)

Query: 152 GASAGVMITASHNPKMDNGYKVYYSNGCQII 182
           G   GVMITASHNP  DNG K+   +G  ++
Sbjct: 57  GQYVGVMITASHNPYQDNGVKIVEPDGSMLL 87

>Smik_5.29 Chr5 (45538..47205) [1668 bp, 555 aa] {ON} YEL058W (REAL)
          Length = 555

 Score = 37.7 bits (86), Expect = 0.080,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 20/31 (64%)

Query: 152 GASAGVMITASHNPKMDNGYKVYYSNGCQII 182
           G   GVMITASHNP  DNG K+   +G  ++
Sbjct: 57  GQYVGVMITASHNPYQDNGVKIVEPDGSMLL 87

>TBLA0B09010 Chr2 complement(2135961..2137670) [1710 bp, 569 aa]
           {ON} Anc_2.445 YKL127W
          Length = 569

 Score = 37.7 bits (86), Expect = 0.085,   Method: Compositional matrix adjust.
 Identities = 104/442 (23%), Positives = 169/442 (38%), Gaps = 86/442 (19%)

Query: 55  GTAGLRSKMEAGFSRMN-TLTVLQASQGLAKYIAEKFPE---NKTVAVGHDHRFNSRDFA 110
           GT+GLR K +      N T   +QA       I +  PE   + T+ VG D RF    + 
Sbjct: 19  GTSGLRKKTKVFMDEPNYTENFIQA-------IMDAIPEGSKDATLVVGGDGRF----YN 67

Query: 111 EVTSVAFLQLRFKVYSLGFNADPKK-----DAFVHTPMVPFAID--RLGASAGVMITASH 163
           +V       +  K+ ++G     KK     +  + TP     I   +   + G+++TASH
Sbjct: 68  DV-------IMNKIAAIGAANGVKKLIIGQNGILSTPAASHIIRTYKDKVTGGIILTASH 120

Query: 164 N---PKMDNGYKVYYSNGCQIIPPHDRLIAQSILDNLNPWE---RAWDCKAV-------I 210
           N   P  D G K    NG     P    +  +I      WE   +  D K V       +
Sbjct: 121 NPGGPTNDLGIKYNLGNGA----PAPEAVTDAI------WEASKKLTDYKIVNDFPELDL 170

Query: 211 AEATEKGYFVDMKKPMVD------HYVKEISD-----KLVSSDIGDRSKPW-FVYTPLHG 258
           A   E   + ++   ++D       Y+KEI D     K + S     +K W  ++  L+G
Sbjct: 171 ATIVENKKYGNLLVDIIDSTEAYVKYMKEIFDFPLIKKFIVSQ--RETKNWKLLFDSLNG 228

Query: 259 VGFEIFERIASEVLGLVEGRDYWCVSEHKQPDPAFPTVSFPNPEEXXXXXXXXXXXXKNG 318
           V     + I ++  GL        V ++  P P F  +  P+P              K  
Sbjct: 229 VTGPYGKAIFADEFGLPADE----VLQNYVPKPDFGGLH-PDP-NLTYAKTLVSRVDKEK 282

Query: 319 ISFVLGNDPDADRFSAAVKHQGKWRQLTGNEIGFLFAQFVWEKYQKESSEFKLENPLALI 378
           I F   +D D DR    +   G      G+ +  +       +Y  E   F  +    L 
Sbjct: 283 IEFGAASDGDGDR--NMIYGYGPTFVSPGDSVAII------AEYASEIPYFAKQGIYGLA 334

Query: 379 NSTVSSQMIKKLAGVEKFHYEDTLTGFKWLGNRARQLESSGYYVPFAYEEAIGFMFSDIV 438
            S  +S  I ++A     +  +  TG+K+      + + S        EE+ G   S+ V
Sbjct: 335 RSFPTSSAIDRVAKEHNLNCYEVPTGWKFFCKLFDENKLS-----ICGEESFG-TGSNHV 388

Query: 439 HDKDGVSAAVVFLQMLWSWKKQ 460
            +KDGV A + +L +L  + K+
Sbjct: 389 REKDGVWAIMAWLNILAIYNKK 410

>Skud_5.31 Chr5 (42262..43935) [1674 bp, 557 aa] {ON} YEL058W (REAL)
          Length = 557

 Score = 37.7 bits (86), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 20/31 (64%)

Query: 152 GASAGVMITASHNPKMDNGYKVYYSNGCQII 182
           G   GVMITASHNP  DNG K+   +G  ++
Sbjct: 57  GQYVGVMITASHNPYQDNGVKIVEPDGSMLL 87

>Suva_5.10 Chr5 (19280..20941) [1662 bp, 553 aa] {ON} YEL058W (REAL)
          Length = 553

 Score = 37.7 bits (86), Expect = 0.092,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 20/31 (64%)

Query: 152 GASAGVMITASHNPKMDNGYKVYYSNGCQII 182
           G   GVMITASHNP  DNG K+   +G  ++
Sbjct: 57  GQYVGVMITASHNPYQDNGVKIVEPDGSMLL 87

>NDAI0K02890 Chr11 (655311..656996) [1686 bp, 561 aa] {ON} Anc_6.11
           YEL058W
          Length = 561

 Score = 37.7 bits (86), Expect = 0.092,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 21/30 (70%)

Query: 153 ASAGVMITASHNPKMDNGYKVYYSNGCQII 182
           ++ GVM+TASHNP  DNG K+   NG  ++
Sbjct: 66  SAIGVMVTASHNPPEDNGVKIIEPNGSMLL 95

>Kwal_56.22355 s56 complement(62955..64580) [1626 bp, 541 aa] {ON}
           YEL058W (PCM1) - Phosphoacetylglucosamine Mutase [contig
           186] FULL
          Length = 541

 Score = 37.4 bits (85), Expect = 0.100,   Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 23/41 (56%), Gaps = 8/41 (19%)

Query: 152 GASAGVMITASHNPKMDNGYKVYYSNGCQIIPPHDRLIAQS 192
           G + GVMITASHNP  DNG K        I+ P   ++ QS
Sbjct: 55  GKTVGVMITASHNPPEDNGVK--------IVDPKGEMLEQS 87

>KLTH0C11506g Chr3 (944869..946503) [1635 bp, 544 aa] {ON} similar
           to uniprot|P38628 Saccharomyces cerevisiae YEL058W PCM1
           Essential N-acetylglucosamine- phosphate mutase a
           hexosephosphate mutase involved in the biosynthesis of
           chitin
          Length = 544

 Score = 37.0 bits (84), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 23/41 (56%), Gaps = 8/41 (19%)

Query: 152 GASAGVMITASHNPKMDNGYKVYYSNGCQIIPPHDRLIAQS 192
           G + GVMITASHNP  DNG K        I+ P   ++ QS
Sbjct: 55  GRTVGVMITASHNPPEDNGVK--------IVDPKGEMLEQS 87

>Skud_13.263 Chr13 complement(451194..452903) [1710 bp, 569 aa] {ON}
           YKL127W (REAL)
          Length = 569

 Score = 37.0 bits (84), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 103/453 (22%), Positives = 177/453 (39%), Gaps = 72/453 (15%)

Query: 55  GTAGLRSKMEAGFSRMNTLTVLQASQGLAKYIAEKFPENK---TVAVGHDHRFNS----R 107
           GT+GLR K +    + N       ++   + I E  PE     T+ VG D R+ +     
Sbjct: 19  GTSGLRKKTKVFKDQPNY------TENFIQSIMEAIPEGSKGATLVVGGDGRYYNDVILN 72

Query: 108 DFAEVTSVAFLQLRFKVYSLGFNADPKKDAFVHTPMVPFAIDRLGASAGVMITASHN--- 164
             A + S   ++ +  +   G  + P     + T            + G+++TASHN   
Sbjct: 73  KIAAIGSANGIK-KLVIGQYGLLSTPAASHIMRTY-------EEECTGGIILTASHNPGG 124

Query: 165 PKMDNGYKVYYSNGCQIIPPHDRLIAQSILD---NLNPWERAWDCKAVIAEATEKGY--- 218
           P+ D G K   SNG     P    +  +I D    L  ++   D   +  +   K     
Sbjct: 125 PENDMGIKYNLSNGG----PAPESVTNAIWDISKKLTNYKIVKDFPELDLKTIGKNKKYG 180

Query: 219 -----FVDMKKPMVDHYVKEISD-KLVSSDIGDR--SKPW-FVYTPLHGVGFEIFERIAS 269
                 +D+ K  VD ++K+I D  L+   I ++  +K W  ++  ++GV     + I  
Sbjct: 181 PLLIDVIDITKAYVD-FLKKIFDFDLIKKFIDNQRSTKNWKLLFDSMNGVTGPYGKAIFV 239

Query: 270 EVLGLVEGRDYWCVSEHKQPDPAFPTVSFPNPEEXXXXXXXXXXXXKNGISFVLGNDPDA 329
           +  GL        V ++  P P F  +  P+P              +  I F   +D D 
Sbjct: 240 DEFGLPAEE----VLQNWHPSPDFGGMH-PDP-NLTYASSLVKRVDREKIEFGAASDGDG 293

Query: 330 DRFSAAVKHQGKWRQLTGNEIGFLFAQFVWEKYQKESSEFKLENPLALINSTVSSQMIKK 389
           DR    +   G      G+ +  +       +Y  E   F  +    L  S  +S  I +
Sbjct: 294 DR--NMIYGYGPSFVSPGDSVAII------AEYAAEIPYFAKQGIYGLARSFPTSAAIDR 345

Query: 390 LAGVEKFHYEDTLTGFKWLGN--RARQLESSGYYVPFAYEEAIGFMFSDIVHDKDGVSAA 447
           +A     +  +  TG+K+      A++L   G       EE+ G   S+ V +KDGV A 
Sbjct: 346 VAKAHGLNCYEVPTGWKFFCALFDAKKLSICG-------EESFG-TGSNHVREKDGVWAV 397

Query: 448 VVFLQMLWSWKK---QALSPIDVLQSAF-GKYG 476
           + +L +L  + K   +  + I  +Q+ F  KYG
Sbjct: 398 MAWLNILAIYNKHHPENEASIKTIQNEFWAKYG 430

>ZYRO0F00506g Chr6 complement(49579..51231) [1653 bp, 550 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058W PCM1 Essential N-acetylglucosamine-phosphate
           mutase a hexosephosphate mutase involved in the
           biosynthesis of chitin
          Length = 550

 Score = 36.6 bits (83), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 16/27 (59%), Positives = 19/27 (70%)

Query: 152 GASAGVMITASHNPKMDNGYKVYYSNG 178
           G   GVM+TASHNP +DNG KV   +G
Sbjct: 56  GDVIGVMVTASHNPPVDNGVKVVEPDG 82

>NCAS0F01470 Chr6 complement(293218..294927) [1710 bp, 569 aa] {ON}
           Anc_2.445 YKL127W
          Length = 569

 Score = 36.6 bits (83), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 84/343 (24%), Positives = 135/343 (39%), Gaps = 45/343 (13%)

Query: 155 AGVMITASHNP---KMDNGYKVYYSNGCQIIPPHDRLIAQSILDNLNPWERAWDCKAVIA 211
            G+++TASHNP   K D G K   SNG     P    I + I   +  ++   D   +  
Sbjct: 112 GGIILTASHNPGGIKNDMGIKFNLSNGGPAPEPVTNKIWE-ISKKMTSFKIIKDFPELEL 170

Query: 212 EATEKGY--------FVDMKKPMVDHYVKEISD-KLVSSDIGDR--SKPW-FVYTPLHGV 259
           E   K           +D  K  V+ +VK+I D  L+   +  +  +K W  ++  ++GV
Sbjct: 171 ETLGKNKKYGPLLVDVIDTTKAYVE-FVKQIFDFDLIKKFVHKQRDTKHWKLLFDGMNGV 229

Query: 260 GFEIFERIASEVLGLVEGRDYWCVSEHKQPDPAFPTVSFPNPEEXXXXXXXXXXXXKNGI 319
                + I  + LGL        V +   P P F  V  P+P              +N I
Sbjct: 230 TGPYGKAIFVDELGLPADE----VLQQWHPSPDFGGVH-PDPNLTYAKALVDRVDREN-I 283

Query: 320 SFVLGNDPDADRFSAAVKHQGKWRQLTGNEIGFLFAQFVWEKYQKESSEFKLENPLALIN 379
            F   +D D DR    +   G      G+ +  +       +Y  E   F  +    L  
Sbjct: 284 EFGAASDGDGDR--NMIYGAGPAFVSPGDSVAII------AEYAAEIPYFAKQGIYGLAR 335

Query: 380 STVSSQMIKKLAGVEKFHYEDTLTGFKWLGN--RARQLESSGYYVPFAYEEAIGFMFSDI 437
           S  +S  I ++A     +  +  TG+K+      A++L   G       EE+ G   S+ 
Sbjct: 336 SFPTSSAIDRVAKAHGLNCYEVPTGWKFFCALFDAKKLSICG-------EESFG-TGSNH 387

Query: 438 VHDKDGVSAAVVFLQMLWSWKKQALS---PIDVLQSAF-GKYG 476
           V +KDG+ A + +L +L  + K        I ++Q  F  KYG
Sbjct: 388 VREKDGIWAILAWLNLLAIYNKHHPDRDVSIKIIQDEFWNKYG 430

>ABL029W Chr2 (343850..345556) [1707 bp, 568 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YKL127W (PGM1) and
           YMR105C (PGM2)
          Length = 568

 Score = 36.2 bits (82), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 108/453 (23%), Positives = 181/453 (39%), Gaps = 73/453 (16%)

Query: 55  GTAGLRSKMEAGFSRMNTLTVLQASQGLAKYIAEKFPE---NKTVAVGHDHRFNS----R 107
           GT+GLR K +  F +    T     +   + I E  PE   N  + +G D R+ +    +
Sbjct: 19  GTSGLRKKTKV-FEQTEHYT-----ENFIQAIMESIPEGSENAVLVIGGDGRYYNDAVMQ 72

Query: 108 DFAEVTSVAFLQLRFKVYSLGFNADPKKDAFVHTPMVPFAIDRLGASAGVMITASHNPKM 167
             AEV S   ++ +  +   G  + P     + T       D++  + G+++TASHNP  
Sbjct: 73  KIAEVGSANGVR-KLIIGQNGLLSTPAASHIIRTYH-----DKV--TGGIILTASHNPGG 124

Query: 168 -DNGYKVYY--SNGCQIIPPHDRLIAQSILD---NLNPWERAWDCKAV----IAEATEKG 217
            DN + + Y  +NG     P    +  S+ +   NL  ++       +    I E  + G
Sbjct: 125 PDNDFGIKYNLANGA----PAPEKVTNSMFERSRNLTHYKITRGMPKLDLGKIGENQQYG 180

Query: 218 -YFVDMKKPMVDHYV---KEISD-KLVSSDIGDRSKPW---FVYTPLHGVGFEIFERIAS 269
              VD+  P  + YV   KEI D  L+   +    K +    ++  L+G+     + I  
Sbjct: 181 NLLVDVIDP-TEAYVRLMKEIFDFPLIKKFLEHAQKEYGLKVLFDALNGITGPYGKAIFV 239

Query: 270 EVLGLVEGRDYWCVSEHKQPDPAFPTVSFPNPEEXXXXXXXXXXXXKNGISFVLGNDPDA 329
           + LGL E        ++  P P F  +  P+P              +N I+F   +D D 
Sbjct: 240 DELGLSEDS-----LQNFVPKPDFGGLH-PDPNLTYAHTLVSRVDREN-IAFGAASDGDG 292

Query: 330 DRFSAAVKHQGKWRQLTGNEIGFLFAQFVWEKYQKESSEFKLENPLALINSTVSSQMIKK 389
           DR    +   G      G+ +  +       +Y  E   F       L  S  +S  I  
Sbjct: 293 DR--NMIYGAGPAFVSPGDSVAII------AEYASEIPYFIKNGIHGLARSFPTSGAIDL 344

Query: 390 LAGVEKFHYEDTLTGFKWLGN--RARQLESSGYYVPFAYEEAIGFMFSDIVHDKDGVSAA 447
           +A  +     +  TG+K+  N   +++L   G       EE+ G   SD V +KDG+ A 
Sbjct: 345 VAKEKNLDCYEVPTGWKFFCNLFDSKKLSICG-------EESFG-TGSDHVREKDGLWAI 396

Query: 448 VVFLQMLWSWKKQALS---PIDVLQSAF-GKYG 476
           V +L +L  + ++       I  +Q  F  KYG
Sbjct: 397 VAWLNVLAIYHRRHPDREPSIKTIQEEFWAKYG 429

>SAKL0E00902g Chr5 complement(68682..70316) [1635 bp, 544 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058W PCM1 Essential N-acetylglucosamine-phosphate
           mutase a hexosephosphate mutase involved in the
           biosynthesis of chitin
          Length = 544

 Score = 36.2 bits (82), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 15/22 (68%), Positives = 16/22 (72%)

Query: 152 GASAGVMITASHNPKMDNGYKV 173
           G   GVMITASHNP  DNG K+
Sbjct: 55  GQYVGVMITASHNPPQDNGVKI 76

>KLLA0D00858g Chr4 complement(80327..81952) [1626 bp, 541 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058W PCM1 Essential N-acetylglucosamine-phosphate
           mutase a hexosephosphate mutase involved in the
           biosynthesis of chitin
          Length = 541

 Score = 35.4 bits (80), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 22/37 (59%), Gaps = 8/37 (21%)

Query: 156 GVMITASHNPKMDNGYKVYYSNGCQIIPPHDRLIAQS 192
           GVMITASHNP  DNG KV        + P+  ++ Q+
Sbjct: 55  GVMITASHNPPEDNGVKV--------VEPYGEMLVQN 83

>TPHA0M00210 Chr13 complement(42336..43973) [1638 bp, 545 aa] {ON}
           Anc_6.11 YEL058W
          Length = 545

 Score = 35.0 bits (79), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 19/30 (63%)

Query: 152 GASAGVMITASHNPKMDNGYKVYYSNGCQI 181
           G + GVMITASHN   DNG K+   +G  +
Sbjct: 55  GKAVGVMITASHNQPCDNGVKIVEPDGSML 84

>NDAI0H02350 Chr8 complement(571624..573333) [1710 bp, 569 aa] {ON}
           Anc_2.445 YKL127W
          Length = 569

 Score = 35.0 bits (79), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 83/344 (24%), Positives = 135/344 (39%), Gaps = 45/344 (13%)

Query: 154 SAGVMITASHNP---KMDNGYKVYYSNGCQIIPPHDRLIAQSILDNLNPWERAWDCKAVI 210
           + G+++TASHNP   + D G K   SNG     P    I + I   +  ++   D   + 
Sbjct: 111 TGGIILTASHNPGGLENDMGIKYNLSNGGPAPEPVTNKIWE-ISKKMTHYKIIKDFPELE 169

Query: 211 AEATEKGY--------FVDMKKPMVDHYVKEISD-KLVSSDIGDR--SKPW-FVYTPLHG 258
            E   K           +D+ K  VD ++KEI D +L+   I ++   K W  ++  ++G
Sbjct: 170 LETLGKNKKYGPLLVDVIDITKAYVD-FLKEIFDFELIKKFIHNQREKKHWKLLFDGMNG 228

Query: 259 VGFEIFERIASEVLGLVEGRDYWCVSEHKQPDPAFPTVSFPNPEEXXXXXXXXXXXXKNG 318
           V     + I  +  GL        V +   P P F  V  P+P              +  
Sbjct: 229 VTGPYGKAIFVDEFGLPADE----VLQQWHPQPDFGGVH-PDP-NLTYAKALVDRVNREK 282

Query: 319 ISFVLGNDPDADRFSAAVKHQGKWRQLTGNEIGFLFAQFVWEKYQKESSEFKLENPLALI 378
           I F   +D D DR    +   G      G+ +  +       +Y  E   FK +    L 
Sbjct: 283 IEFGAASDGDGDR--NMIYGAGPAFVSPGDSVAII------AEYASEIPYFKKQGIYGLA 334

Query: 379 NSTVSSQMIKKLAGVEKFHYEDTLTGFKWLGN--RARQLESSGYYVPFAYEEAIGFMFSD 436
            S  ++  I ++A     +     TG+K+      A +L   G       EE+ G   S+
Sbjct: 335 RSFPTASSIDRVAKAHGLNCYQVPTGWKFFCALFDANKLSICG-------EESFG-TGSN 386

Query: 437 IVHDKDGVSAAVVFLQMLWSWKKQALS---PIDVLQSAF-GKYG 476
            V +KDG+ A + +L +L  + K        I ++Q  F  KYG
Sbjct: 387 HVREKDGLWAIIAWLNVLAIYNKHNPEKDVSIKIIQDEFWNKYG 430

>TBLA0B04020 Chr2 complement(920523..921419) [897 bp, 298 aa] {ON}
           Anc_8.644 YOR222W
          Length = 298

 Score = 33.9 bits (76), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 29/93 (31%), Positives = 38/93 (40%), Gaps = 11/93 (11%)

Query: 463 SPIDVLQSAFGKYGVFKEYNGY------YTVPDLSLTDRIFSDIRSSYDSYPKHIGNQFD 516
            P+DVL++   K GVF  YNG        +V +      IF  IRS  + YP    N   
Sbjct: 148 GPLDVLRNLIKKEGVFSIYNGLESTLWRQSVWNAGYFGSIF-QIRSILNQYPSMEKN--- 203

Query: 517 VVSFTDLTKGFQSDTADNTPRLPVDPSSQMIQA 549
            V+  DL  G    T      +P D     IQ+
Sbjct: 204 -VTIRDLIAGMIGGTIGVLLNIPFDVVKSRIQS 235

>KNAG0A06280 Chr1 (955994..957706) [1713 bp, 570 aa] {ON} 
          Length = 570

 Score = 34.3 bits (77), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 37/132 (28%), Positives = 59/132 (44%), Gaps = 20/132 (15%)

Query: 55  GTAGLRSKMEAGFSRMNTLTVLQASQGLAKYIAEKFPE---NKTVAVGHDHRFNSRDFAE 111
           GT+GLR K  A F +    T     +   + I E  PE   + T+ +G D RF +     
Sbjct: 20  GTSGLRKKT-AVFMKEPHYT-----ENFIQAILEAIPEGCKDATLVIGGDGRFYND--VV 71

Query: 112 VTSVAFLQLRFKVYSLGFNADPKKDAFVHTPMVPFAID--RLGASAGVMITASHN---PK 166
           +  +A +     V  L       ++  + TP   + I   +  A+ G+++TASHN   P+
Sbjct: 72  INKIAAISAANGVRKLVIG----QNGLLSTPATSYIIRSYKDKATGGIILTASHNPGGPE 127

Query: 167 MDNGYKVYYSNG 178
            D G K   +NG
Sbjct: 128 NDMGIKYNLANG 139

>Ecym_3014 Chr3 complement(28261..29916) [1656 bp, 551 aa] {ON}
           similar to Ashbya gossypii ACR015W
          Length = 551

 Score = 33.5 bits (75), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 14/22 (63%), Positives = 15/22 (68%)

Query: 152 GASAGVMITASHNPKMDNGYKV 173
           G   G MITASHNP  DNG K+
Sbjct: 55  GQYVGAMITASHNPPQDNGVKL 76

>KLLA0B04994g Chr2 complement(453048..454244) [1197 bp, 398 aa] {ON}
           similar to uniprot|Q2VQX1 Saccharomyces cerevisiae
           YLR443W ECM7
          Length = 398

 Score = 32.0 bits (71), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 29/114 (25%), Positives = 54/114 (47%), Gaps = 16/114 (14%)

Query: 485 YTVPDLSLTDRIFSDIRSSYDSYPKHIGNQ----------FDVVSFTDLTKGFQSDTADN 534
           +T+  +++  +I +++ S   SY  H+G            F+++S    T GF+    +N
Sbjct: 277 FTILSINIRQKISNELDSFGFSY--HLGTGWFTCLWIFAFFNIISCLVWT-GFEWCITNN 333

Query: 535 TPRLPVDPSSQMIQATLVP---STSGGSGAPLEIVRFTARGSGTEPKLKVYIEA 585
            P +P + +S M+   ++P   S+S   G  L+++  T   S TE  L  Y  A
Sbjct: 334 DPPVPAEETSSMLGVHMIPLQESSSRDDGKDLDLLAPTITLSRTESNLTAYSRA 387

>Kwal_23.4588 s23 (779393..781033) [1641 bp, 546 aa] {ON} YDL225W
           (SHS1) - Septin homolog [contig 5] FULL
          Length = 546

 Score = 32.0 bits (71), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 35/64 (54%), Gaps = 2/64 (3%)

Query: 532 ADNTPRLPVDPSSQMIQATLVPSTSGGSGAPLEIVRFTARGSGTEPKLKVYIEATSVEET 591
           A + P+LP +P  ++++ T+V S +  +G P  + +F A     EP   + I +TS E +
Sbjct: 45  AMDAPQLPYNPRVKVVKPTMVVSYNSKNGIPSHMAQFDASREHFEP--GITITSTSAEIS 102

Query: 592 RASD 595
             S+
Sbjct: 103 TGSE 106

>TPHA0F01770 Chr6 (408734..410011) [1278 bp, 425 aa] {ON} Anc_2.169
           YOR110W
          Length = 425

 Score = 31.6 bits (70), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 24/42 (57%), Gaps = 2/42 (4%)

Query: 338 HQGKWRQLTGNEIGFLFAQFVWEKYQKESSEFKLENPLALIN 379
           ++G+W++L G E+ F  A  V  K  K S E  +  PL LIN
Sbjct: 334 YEGQWKKLVGTELAFPNAAKVMNK--KVSLEHTIPKPLDLIN 373

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.134    0.402 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 65,150,022
Number of extensions: 2752939
Number of successful extensions: 7427
Number of sequences better than 10.0: 70
Number of HSP's gapped: 7469
Number of HSP's successfully gapped: 70
Length of query: 620
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 504
Effective length of database: 40,180,143
Effective search space: 20250792072
Effective search space used: 20250792072
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 69 (31.2 bits)