Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_27.102558.841ON32932917670.0
KLTH0C03850g8.841ON32932915240.0
SAKL0D01452g8.841ON32732713620.0
YPL273W (SAM4)8.841ON32532613310.0
NCAS0D049408.841ON32732713290.0
Suva_13.515na 1ON32532613060.0
TPHA0G03760singletonON33132513030.0
KAFR0B00210singletonON32632512761e-177
Smik_6.4848.841ON32532612761e-177
Ecym_46128.841ON32632812711e-177
KNAG0B06970singletonON33231612701e-176
NDAI0F00250singletonON32932712551e-174
KLLA0D01551g8.841ON33132512521e-174
TDEL0E05690singletonON32832611861e-164
Suva_16.17singletonON32432611561e-159
TDEL0E00240singletonON32832611401e-157
Suva_64.1singletonON27327511291e-156
Skud_12.4na 2ON32532611171e-153
Smik_12.1na 2ON32432610961e-150
YLL062C (MHT1)na 2ON32432610901e-149
ABL125W8.841ON33632610511e-143
KAFR0F04420singletonON32632610491e-143
KAFR0L00150singletonON32632510401e-142
Suva_16.328.841ON25924810071e-137
TPHA0I002608.841ON3233229441e-127
TBLA0B032608.841ON3263239081e-121
Kpol_1068.78.841ON3233268861e-118
ZYRO0G14212g8.841ON3253298761e-117
Skud_101.1singletonON2002008431e-113
Skud_100.1singletonON2002008331e-112
SAKL0D09306gna 3ON3263387272e-94
Kwal_0.322na 3ON3323386222e-78
AFR410WsingletonON3703336235e-78
KLTH0H12716gna 3ON3483416102e-76
YMR321Cna 1ON1051013882e-46
Skud_47.2singletonON96983812e-45
TDEL0B035208.758ON146275722.0
YAL017W (PSK1)7.86ON135635703.3
SAKL0H01980g5.60ON49251694.2
NCAS0G007105.630ON311109684.7
Suva_8.3408.758ON147288685.4
NCAS0G020402.92ON112266685.6
CAGL0B02387g8.850ON47146676.5
Kwal_14.927singletonOFF28678676.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_27.10255
         (329 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_27.10255 s27 complement(264291..265280) [990 bp, 329 aa] {O...   685   0.0  
KLTH0C03850g Chr3 complement(336417..337406) [990 bp, 329 aa] {O...   591   0.0  
SAKL0D01452g Chr4 complement(115954..116937) [984 bp, 327 aa] {O...   529   0.0  
YPL273W Chr16 (25087..26064) [978 bp, 325 aa] {ON}  SAM4S-adenos...   517   0.0  
NCAS0D04940 Chr4 (948608..949591) [984 bp, 327 aa] {ON}               516   0.0  
Suva_13.515 Chr13 complement(901226..902203) [978 bp, 325 aa] {O...   507   0.0  
TPHA0G03760 Chr7 complement(795934..796929) [996 bp, 331 aa] {ON}     506   0.0  
KAFR0B00210 Chr2 complement(50980..51960) [981 bp, 326 aa] {ON}       496   e-177
Smik_6.484 Chr6 (800680..801657) [978 bp, 325 aa] {ON} YPL273W (...   496   e-177
Ecym_4612 Chr4 (1193587..1194567) [981 bp, 326 aa] {ON} similar ...   494   e-177
KNAG0B06970 Chr2 (1387382..1388380) [999 bp, 332 aa] {ON}             493   e-176
NDAI0F00250 Chr6 complement(47567..48556) [990 bp, 329 aa] {ON}       488   e-174
KLLA0D01551g Chr4 complement(137965..138960) [996 bp, 331 aa] {O...   486   e-174
TDEL0E05690 Chr5 complement(1057559..1058545) [987 bp, 328 aa] {...   461   e-164
Suva_16.17 Chr16 complement(15787..16761) [975 bp, 324 aa] {ON} ...   449   e-159
TDEL0E00240 Chr5 complement(38804..39790) [987 bp, 328 aa] {ON}       443   e-157
Suva_64.1 Chr64 (76..894) [819 bp, 273 aa] {ON} YPL273W (REAL)        439   e-156
Skud_12.4 Chr12 complement(4676..5653) [978 bp, 325 aa] {ON} YLL...   434   e-153
Smik_12.1 Chr12 complement(885..1859) [975 bp, 324 aa] {ON} YLL0...   426   e-150
YLL062C Chr12 complement(16639..17613) [975 bp, 324 aa] {ON}  MH...   424   e-149
ABL125W Chr2 (161358..162368) [1011 bp, 336 aa] {ON} Non-synteni...   409   e-143
KAFR0F04420 Chr6 (867176..868156) [981 bp, 326 aa] {ON}               408   e-143
KAFR0L00150 Chr12 complement(16662..17642) [981 bp, 326 aa] {ON}      405   e-142
Suva_16.32 Chr16 (40969..41748) [780 bp, 259 aa] {ON} YPL273W (R...   392   e-137
TPHA0I00260 Chr9 (49179..50150) [972 bp, 323 aa] {ON} Anc_8.841 ...   368   e-127
TBLA0B03260 Chr2 (760392..761372) [981 bp, 326 aa] {ON} Anc_8.84...   354   e-121
Kpol_1068.7 s1068 complement(11996..12967) [972 bp, 323 aa] {ON}...   345   e-118
ZYRO0G14212g Chr7 (1133202..1134179) [978 bp, 325 aa] {ON} simil...   342   e-117
Skud_101.1 Chr101 complement(3..602) [600 bp, 200 aa] {ON} YPL27...   329   e-113
Skud_100.1 Chr100 complement(3..602) [600 bp, 200 aa] {ON} YPL27...   325   e-112
SAKL0D09306g Chr4 (771565..772545) [981 bp, 326 aa] {ON} similar...   284   2e-94
Kwal_0.322 s0 (152442..153440) [999 bp, 332 aa] {ON} YLL062C (MH...   244   2e-78
AFR410W Chr6 (1171334..1172446) [1113 bp, 370 aa] {ON} Non-synte...   244   5e-78
KLTH0H12716g Chr8 (1079836..1080882) [1047 bp, 348 aa] {ON} simi...   239   2e-76
YMR321C Chr13 complement(917579..917896) [318 bp, 105 aa] {ON} P...   154   2e-46
Skud_47.2 Chr47 (1368..1655) [288 bp, 96 aa] {ON} YPL273W (REAL)      151   2e-45
TDEL0B03520 Chr2 complement(626658..631046) [4389 bp, 1462 aa] {...    32   2.0  
YAL017W Chr1 (120225..124295) [4071 bp, 1356 aa] {ON}  PSK1One o...    32   3.3  
SAKL0H01980g Chr8 complement(195237..196715) [1479 bp, 492 aa] {...    31   4.2  
NCAS0G00710 Chr7 complement(120375..121310) [936 bp, 311 aa] {ON...    31   4.7  
Suva_8.340 Chr8 (601862..606280) [4419 bp, 1472 aa] {ON} YOR291W...    31   5.4  
NCAS0G02040 Chr7 complement(367514..370882) [3369 bp, 1122 aa] {...    31   5.6  
CAGL0B02387g Chr2 complement(228209..229624) [1416 bp, 471 aa] {...    30   6.5  
Kwal_14.927 s14 complement(117323..118180) [858 bp, 286 aa] {OFF...    30   6.6  

>Kwal_27.10255 s27 complement(264291..265280) [990 bp, 329 aa] {ON}
           YPL273W (SAM4) - S-adenosylmethionine:homocysteine
           S-methyltransferase [contig 37] FULL
          Length = 329

 Score =  685 bits (1767), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/329 (100%), Positives = 329/329 (100%)

Query: 1   MVRTSIKEFLEKNPREVLVLDGGQGTELENRGIKVANPVWSTIPFISESFWSAEDQSSKD 60
           MVRTSIKEFLEKNPREVLVLDGGQGTELENRGIKVANPVWSTIPFISESFWSAEDQSSKD
Sbjct: 1   MVRTSIKEFLEKNPREVLVLDGGQGTELENRGIKVANPVWSTIPFISESFWSAEDQSSKD 60

Query: 61  RQIVKEMYSDFLKAGARVLMTVTYQASFKSVSENTRIKTLEEYDSLLNRIVTFSRECIGD 120
           RQIVKEMYSDFLKAGARVLMTVTYQASFKSVSENTRIKTLEEYDSLLNRIVTFSRECIGD
Sbjct: 61  RQIVKEMYSDFLKAGARVLMTVTYQASFKSVSENTRIKTLEEYDSLLNRIVTFSRECIGD 120

Query: 121 DKFLVGCIGAWGAHNCSEFTGDYGAEPEKIDFLQYFKPQLDNFTNNENIDLIGFETIPNI 180
           DKFLVGCIGAWGAHNCSEFTGDYGAEPEKIDFLQYFKPQLDNFTNNENIDLIGFETIPNI
Sbjct: 121 DKFLVGCIGAWGAHNCSEFTGDYGAEPEKIDFLQYFKPQLDNFTNNENIDLIGFETIPNI 180

Query: 181 HELRAILSWDESIINKPFYIGLSVHENGLLRDGTTMHQVAELIKSFGDRLNPNFTLLGIN 240
           HELRAILSWDESIINKPFYIGLSVHENGLLRDGTTMHQVAELIKSFGDRLNPNFTLLGIN
Sbjct: 181 HELRAILSWDESIINKPFYIGLSVHENGLLRDGTTMHQVAELIKSFGDRLNPNFTLLGIN 240

Query: 241 CVSYNQSHDILRSLHEELPEMPLIAYPNSGEVYDTVKKIWNPKNSQTLSWEQIVKSYIDS 300
           CVSYNQSHDILRSLHEELPEMPLIAYPNSGEVYDTVKKIWNPKNSQTLSWEQIVKSYIDS
Sbjct: 241 CVSYNQSHDILRSLHEELPEMPLIAYPNSGEVYDTVKKIWNPKNSQTLSWEQIVKSYIDS 300

Query: 301 GARIIGGCCRTSPKDIEAIHEAVQKYRPN 329
           GARIIGGCCRTSPKDIEAIHEAVQKYRPN
Sbjct: 301 GARIIGGCCRTSPKDIEAIHEAVQKYRPN 329

>KLTH0C03850g Chr3 complement(336417..337406) [990 bp, 329 aa] {ON}
           highly similar to uniprot|Q08985 Saccharomyces
           cerevisiae YPL273W SAM4
           S-adenosylmethionine-homocysteine methyltransferase
           functions along with Mht1p in the conversion of
           S-adenosylmethionine (AdoMet) to methionine to control
           the methionine/AdoMet ratio
          Length = 329

 Score =  591 bits (1524), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 276/329 (83%), Positives = 304/329 (92%)

Query: 1   MVRTSIKEFLEKNPREVLVLDGGQGTELENRGIKVANPVWSTIPFISESFWSAEDQSSKD 60
           M R S+KE+L  NP EVLVLDGGQGTELENRGIKVANPVWSTIPFIS+SFW+A D SSKD
Sbjct: 1   MPRPSVKEYLASNPEEVLVLDGGQGTELENRGIKVANPVWSTIPFISDSFWTANDSSSKD 60

Query: 61  RQIVKEMYSDFLKAGARVLMTVTYQASFKSVSENTRIKTLEEYDSLLNRIVTFSRECIGD 120
           RQIVKEMY DFLKAGARVLMTVTYQASFKSVSENT I TLEEYD+LL+RIV+FSR CIGD
Sbjct: 61  RQIVKEMYEDFLKAGARVLMTVTYQASFKSVSENTSITTLEEYDALLSRIVSFSRSCIGD 120

Query: 121 DKFLVGCIGAWGAHNCSEFTGDYGAEPEKIDFLQYFKPQLDNFTNNENIDLIGFETIPNI 180
           DK+LVGCIG WGAHNCSEFTGDYG+EPEKID+LQYFKPQLDNFT N+++DLIGFETIPNI
Sbjct: 121 DKWLVGCIGPWGAHNCSEFTGDYGSEPEKIDYLQYFKPQLDNFTVNDDLDLIGFETIPNI 180

Query: 181 HELRAILSWDESIINKPFYIGLSVHENGLLRDGTTMHQVAELIKSFGDRLNPNFTLLGIN 240
           HELRAILSWD +I+ KPFYIGLSVHE+G+LRDGTTMH+VAELIKS GD++NPNF LLGIN
Sbjct: 181 HELRAILSWDTTILPKPFYIGLSVHEHGVLRDGTTMHEVAELIKSLGDKINPNFVLLGIN 240

Query: 241 CVSYNQSHDILRSLHEELPEMPLIAYPNSGEVYDTVKKIWNPKNSQTLSWEQIVKSYIDS 300
           CVSYN S +ILRSLH+E+PE+PLIAYPNSGEVYDTVKKIWNPK   TL+W+Q+VKSYIDS
Sbjct: 241 CVSYNHSPEILRSLHQEIPELPLIAYPNSGEVYDTVKKIWNPKGDHTLTWDQVVKSYIDS 300

Query: 301 GARIIGGCCRTSPKDIEAIHEAVQKYRPN 329
           GARIIGGCCRTSPKDI AI+ AV KYRPN
Sbjct: 301 GARIIGGCCRTSPKDIAAINAAVNKYRPN 329

>SAKL0D01452g Chr4 complement(115954..116937) [984 bp, 327 aa] {ON}
           highly similar to uniprot|Q08985 Saccharomyces
           cerevisiae YPL273W SAM4
           S-adenosylmethionine-homocysteine methyltransferase
           functions along with Mht1p in the conversion of
           S-adenosylmethionine (AdoMet) to methionine to control
           the methionine/AdoMet ratio
          Length = 327

 Score =  529 bits (1362), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 242/327 (74%), Positives = 289/327 (88%), Gaps = 2/327 (0%)

Query: 1   MVRTSIKEFLEKNPREVLVLDGGQGTELENRGIKVANPVWSTIPFISESFWSAEDQSSKD 60
           M R  IK+F +++P E+LV+DGGQGTELENRGIKVANPVWSTIPFISESFWS E  SS+D
Sbjct: 1   MARQPIKQFFQEHPDEILVMDGGQGTELENRGIKVANPVWSTIPFISESFWSNE--SSRD 58

Query: 61  RQIVKEMYSDFLKAGARVLMTVTYQASFKSVSENTRIKTLEEYDSLLNRIVTFSRECIGD 120
           RQIVKEM+ DF+K G+R+LMT TYQ SFKSVSENT IKTL+EY+ LL RIV FSRECIG+
Sbjct: 59  RQIVKEMFDDFIKVGSRILMTTTYQTSFKSVSENTPIKTLKEYNQLLERIVAFSRECIGE 118

Query: 121 DKFLVGCIGAWGAHNCSEFTGDYGAEPEKIDFLQYFKPQLDNFTNNENIDLIGFETIPNI 180
           DK+L+GCIGAWGAH C EFTGDYGA PE+IDFL+YF+PQL NF ++E IDLIGFETIPN+
Sbjct: 119 DKYLIGCIGAWGAHVCCEFTGDYGANPERIDFLEYFRPQLQNFNSSEQIDLIGFETIPNV 178

Query: 181 HELRAILSWDESIINKPFYIGLSVHENGLLRDGTTMHQVAELIKSFGDRLNPNFTLLGIN 240
           HEL+AILSWDESII+KPFYIGLSVHENG+LRDGTTM +VA++IKS GD+LNPN  LLGIN
Sbjct: 179 HELKAILSWDESIISKPFYIGLSVHENGVLRDGTTMKEVADIIKSLGDKLNPNLMLLGIN 238

Query: 241 CVSYNQSHDILRSLHEELPEMPLIAYPNSGEVYDTVKKIWNPKNSQTLSWEQIVKSYIDS 300
           CVS+N SH IL SLH+ELP+MP+I YPNSGE+YDTVKKIW    +Q ++W+ +VKSYI++
Sbjct: 239 CVSFNHSHLILSSLHKELPDMPMIVYPNSGEIYDTVKKIWLHNENQKVTWDDVVKSYIEN 298

Query: 301 GARIIGGCCRTSPKDIEAIHEAVQKYR 327
           GARIIGGCCRTSP+DI+ I +A++KY+
Sbjct: 299 GARIIGGCCRTSPQDIKDIVQAIEKYK 325

>YPL273W Chr16 (25087..26064) [978 bp, 325 aa] {ON}
           SAM4S-adenosylmethionine-homocysteine methyltransferase,
           functions along with Mht1p in the conversion of
           S-adenosylmethionine (AdoMet) to methionine to control
           the methionine/AdoMet ratio
          Length = 325

 Score =  517 bits (1331), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 239/326 (73%), Positives = 281/326 (86%), Gaps = 2/326 (0%)

Query: 1   MVRTSIKEFLEKNPREVLVLDGGQGTELENRGIKVANPVWSTIPFISESFWSAEDQSSKD 60
           M R  +K+FL  NP++VLVLDGGQGTELENRGIKVANPVWSTIPFISESFWS  D+SS +
Sbjct: 1   MARLPLKQFLADNPKKVLVLDGGQGTELENRGIKVANPVWSTIPFISESFWS--DESSAN 58

Query: 61  RQIVKEMYSDFLKAGARVLMTVTYQASFKSVSENTRIKTLEEYDSLLNRIVTFSRECIGD 120
           R+IVKEM++DFL AGA +LMT TYQ S+KSVSENT I+TL EY++LLNRIV FSR CIG+
Sbjct: 59  RKIVKEMFNDFLNAGAEILMTTTYQTSYKSVSENTPIRTLSEYNNLLNRIVDFSRNCIGE 118

Query: 121 DKFLVGCIGAWGAHNCSEFTGDYGAEPEKIDFLQYFKPQLDNFTNNENIDLIGFETIPNI 180
           DK+L+GCIG WGAH C EFTGDYGAEPE IDF QYFKPQL+NF  N+ +DLIGFETIPNI
Sbjct: 119 DKYLIGCIGPWGAHICREFTGDYGAEPENIDFYQYFKPQLENFNKNDKLDLIGFETIPNI 178

Query: 181 HELRAILSWDESIINKPFYIGLSVHENGLLRDGTTMHQVAELIKSFGDRLNPNFTLLGIN 240
           HEL+AILSWDESI+++PFYIGLSVHE+G+LRDGTTM ++A++IK  GD++NPNF+ LGIN
Sbjct: 179 HELKAILSWDESILSRPFYIGLSVHEHGVLRDGTTMEEIAQVIKDLGDKINPNFSFLGIN 238

Query: 241 CVSYNQSHDILRSLHEELPEMPLIAYPNSGEVYDTVKKIWNPKNSQTLSWEQIVKSYIDS 300
           CVS+NQS DIL SLH+ LP M L+AYPNSGEVYDT KKIW P + +  SW+ +VK YI S
Sbjct: 239 CVSFNQSPDILESLHQALPNMALLAYPNSGEVYDTEKKIWLPNSDKLNSWDTVVKQYISS 298

Query: 301 GARIIGGCCRTSPKDIEAIHEAVQKY 326
           GARIIGGCCRTSPKDI+ I  AV+KY
Sbjct: 299 GARIIGGCCRTSPKDIQEISAAVKKY 324

>NCAS0D04940 Chr4 (948608..949591) [984 bp, 327 aa] {ON} 
          Length = 327

 Score =  516 bits (1329), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 238/327 (72%), Positives = 284/327 (86%), Gaps = 3/327 (0%)

Query: 1   MVRTSIKEFLEKNPREVLVLDGGQGTELENRGIKVANPVWSTIPFISESFWSAEDQSSKD 60
           M R SIKE+L++NP +VLVLDGGQGTELENRGI VANPVWSTIPF+SESFWS  D+SS D
Sbjct: 1   MTRQSIKEYLQQNPDKVLVLDGGQGTELENRGINVANPVWSTIPFVSESFWS--DKSSND 58

Query: 61  RQIVKEMYSDFLKAGARVLMTVTYQASFKSVSENTRIKTLEEYDSLLNRIVTFSRECIGD 120
           RQIVKEM+ DFL AGA +LMT TYQ SFKSVSENT IKTL+EY+ LLNRIV+FSR+CIG+
Sbjct: 59  RQIVKEMFEDFLAAGAEILMTTTYQTSFKSVSENTDIKTLQEYNELLNRIVSFSRDCIGE 118

Query: 121 DKFLVGCIGAWGAHNCSEFTGDYGAEPEKIDFLQYFKPQLDNFTNNENIDLIGFETIPNI 180
            K+L+GCIG WGAH C+EF GDYGA PE ID+ QYFKPQLDNF  NEN+DLIGFET+PN+
Sbjct: 119 QKYLIGCIGPWGAHVCAEFNGDYGAHPENIDYYQYFKPQLDNFFANENLDLIGFETVPNV 178

Query: 181 HELRAILSWDESIINKPFYIGLSVHENGLLRDGTTMHQVAELIKSFGDRLNPNFTLLGIN 240
           +EL+AILSWDE I++KPFYIGLSVHENG+LRDGTTM ++  + KS G+++NPN  LLGIN
Sbjct: 179 NELKAILSWDEKILSKPFYIGLSVHENGVLRDGTTMEEIGNIFKSLGNKVNPNLLLLGIN 238

Query: 241 CVSYNQSHDILRSLHEELPEMPLIAYPNSGEVYDTVKKIWNPKNSQ-TLSWEQIVKSYID 299
           CVS+N S  IL  +H+ LP+MPLIAYPNSGEVYDTVKKIW P+NS+ +L+WEQ+VK YI+
Sbjct: 239 CVSFNHSPSILEDIHKNLPDMPLIAYPNSGEVYDTVKKIWLPQNSENSLTWEQVVKRYIE 298

Query: 300 SGARIIGGCCRTSPKDIEAIHEAVQKY 326
           +GARIIGGCCRT+PKDI  I +AV+K+
Sbjct: 299 AGARIIGGCCRTTPKDILEISKAVKKF 325

>Suva_13.515 Chr13 complement(901226..902203) [978 bp, 325 aa] {ON}
           YPL273W (REAL)
          Length = 325

 Score =  507 bits (1306), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 236/326 (72%), Positives = 276/326 (84%), Gaps = 2/326 (0%)

Query: 1   MVRTSIKEFLEKNPREVLVLDGGQGTELENRGIKVANPVWSTIPFISESFWSAEDQSSKD 60
           M R  +K+ L  +P++VLVLDGGQGTELENRGIKVANPVWSTIPFISESFWS  D+SS +
Sbjct: 1   MARIPLKQLLADDPKKVLVLDGGQGTELENRGIKVANPVWSTIPFISESFWS--DESSAN 58

Query: 61  RQIVKEMYSDFLKAGARVLMTVTYQASFKSVSENTRIKTLEEYDSLLNRIVTFSRECIGD 120
           R+IVKEM++DFL AGA +LMT+TYQ SFKSVSENT IKTL  YD+LL RIV FSR+CIG+
Sbjct: 59  RKIVKEMFNDFLAAGAEILMTITYQTSFKSVSENTPIKTLAAYDNLLTRIVDFSRDCIGE 118

Query: 121 DKFLVGCIGAWGAHNCSEFTGDYGAEPEKIDFLQYFKPQLDNFTNNENIDLIGFETIPNI 180
           +K L+GCIG WGAH C EFTG+YG  PE IDF QYFKPQLDNF  N+ +DL+GFETIPNI
Sbjct: 119 EKHLIGCIGPWGAHVCCEFTGNYGPNPESIDFYQYFKPQLDNFNKNDKLDLLGFETIPNI 178

Query: 181 HELRAILSWDESIINKPFYIGLSVHENGLLRDGTTMHQVAELIKSFGDRLNPNFTLLGIN 240
           HEL+AILSWDESI++KPFYIGLSVHE+G+LRDGTTM  VA++IK  GD++NPNF LLGIN
Sbjct: 179 HELKAILSWDESILSKPFYIGLSVHEHGVLRDGTTMEGVAKVIKDLGDKINPNFLLLGIN 238

Query: 241 CVSYNQSHDILRSLHEELPEMPLIAYPNSGEVYDTVKKIWNPKNSQTLSWEQIVKSYIDS 300
           CVS+NQS DIL SLH  LP MPL+AYPNSGEVYDT KKIW P + +  SW+ +VK YI S
Sbjct: 239 CVSFNQSPDILESLHRALPNMPLLAYPNSGEVYDTEKKIWMPNSDKLNSWDTVVKQYIGS 298

Query: 301 GARIIGGCCRTSPKDIEAIHEAVQKY 326
           GARIIGGCCRT+PKDI+ +  AV+KY
Sbjct: 299 GARIIGGCCRTTPKDIQEVSAAVKKY 324

>TPHA0G03760 Chr7 complement(795934..796929) [996 bp, 331 aa] {ON} 
          Length = 331

 Score =  506 bits (1303), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 230/325 (70%), Positives = 279/325 (85%), Gaps = 2/325 (0%)

Query: 1   MVRTSIKEFLEKNPREVLVLDGGQGTELENRGIKVANPVWSTIPFISESFWSAEDQSSKD 60
           M R  IK +L++NP +VLV+DGGQGTELENRGIKVANPVWSTIPFISESFWS  DQSS+D
Sbjct: 1   MARQCIKNYLQENPNKVLVMDGGQGTELENRGIKVANPVWSTIPFISESFWS--DQSSED 58

Query: 61  RQIVKEMYSDFLKAGARVLMTVTYQASFKSVSENTRIKTLEEYDSLLNRIVTFSRECIGD 120
           R+IVKEM++DF+ AGA +LMT TYQ SFKSVSENT IK  + Y+ LLNRI+ FSR+CIG+
Sbjct: 59  RKIVKEMFNDFINAGAEILMTTTYQTSFKSVSENTPIKNTKHYNELLNRIIDFSRDCIGE 118

Query: 121 DKFLVGCIGAWGAHNCSEFTGDYGAEPEKIDFLQYFKPQLDNFTNNENIDLIGFETIPNI 180
           +++L+GCIG+WGAH C+EF GDYG  PE IDF +YFKPQLDNF NN  +DLIGFET+PNI
Sbjct: 119 ERYLIGCIGSWGAHICAEFHGDYGEHPENIDFYEYFKPQLDNFFNNNKLDLIGFETVPNI 178

Query: 181 HELRAILSWDESIINKPFYIGLSVHENGLLRDGTTMHQVAELIKSFGDRLNPNFTLLGIN 240
           HEL+AILSWDE I++KPFYIGLSVHENGLLRDGT+M +VA LIK FG++LNPN TLLGIN
Sbjct: 179 HELKAILSWDEKILSKPFYIGLSVHENGLLRDGTSMQEVANLIKGFGEKLNPNLTLLGIN 238

Query: 241 CVSYNQSHDILRSLHEELPEMPLIAYPNSGEVYDTVKKIWNPKNSQTLSWEQIVKSYIDS 300
           CVSYN S+DI++S+H+ELP +PLIAYPNSGE+YDT KKIW P  +   +W+ IVK YI++
Sbjct: 239 CVSYNHSNDIIKSIHKELPNLPLIAYPNSGEIYDTTKKIWLPNKNPIFTWDDIVKGYIEA 298

Query: 301 GARIIGGCCRTSPKDIEAIHEAVQK 325
           G RIIGGCCRT+P DI+A+  AV++
Sbjct: 299 GVRIIGGCCRTTPNDIKAVTIAVKE 323

>KAFR0B00210 Chr2 complement(50980..51960) [981 bp, 326 aa] {ON} 
          Length = 326

 Score =  496 bits (1276), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 228/325 (70%), Positives = 274/325 (84%), Gaps = 2/325 (0%)

Query: 1   MVRTSIKEFLEKNPREVLVLDGGQGTELENRGIKVANPVWSTIPFISESFWSAEDQSSKD 60
           M R  IKE+LE+NP++VLVLDGGQGTELENRGI VANPVWSTIPFISESFWS  + SSKD
Sbjct: 1   MPRQPIKEYLEENPKKVLVLDGGQGTELENRGIHVANPVWSTIPFISESFWS--NASSKD 58

Query: 61  RQIVKEMYSDFLKAGARVLMTVTYQASFKSVSENTRIKTLEEYDSLLNRIVTFSRECIGD 120
           R+IVK M+ DFL AGA +LMT+TYQ SFKSV+ENT IKTL+EY+ LL RIV+FSR CIGD
Sbjct: 59  REIVKGMFQDFLDAGADILMTITYQTSFKSVTENTPIKTLKEYNELLERIVSFSRSCIGD 118

Query: 121 DKFLVGCIGAWGAHNCSEFTGDYGAEPEKIDFLQYFKPQLDNFTNNENIDLIGFETIPNI 180
           +K+L+GCIG WGAH C+EF GDYG  PE ID+  YFKPQLDNF  N+++DLIGFET+PN 
Sbjct: 119 EKYLIGCIGPWGAHVCAEFNGDYGGHPENIDYYAYFKPQLDNFFQNKDLDLIGFETVPNF 178

Query: 181 HELRAILSWDESIINKPFYIGLSVHENGLLRDGTTMHQVAELIKSFGDRLNPNFTLLGIN 240
           HEL+AILSWD++I++KPFYIGLSVHENG+LRDGTTM+++   IKS G ++NPNF LLGIN
Sbjct: 179 HELKAILSWDDTILSKPFYIGLSVHENGVLRDGTTMNEIGYYIKSLGSKINPNFLLLGIN 238

Query: 241 CVSYNQSHDILRSLHEELPEMPLIAYPNSGEVYDTVKKIWNPKNSQTLSWEQIVKSYIDS 300
           CVS++ S DIL S+H+ELP+MPLIAYPNSGE+YDTVKKIW P +   ++W  +V  YI +
Sbjct: 239 CVSFSDSPDILESIHKELPDMPLIAYPNSGEIYDTVKKIWLPNHYSDITWNDVVNRYIKA 298

Query: 301 GARIIGGCCRTSPKDIEAIHEAVQK 325
           GARIIGGCCRT P DIE +  AV+K
Sbjct: 299 GARIIGGCCRTMPDDIEQVSAAVKK 323

>Smik_6.484 Chr6 (800680..801657) [978 bp, 325 aa] {ON} YPL273W
           (REAL)
          Length = 325

 Score =  496 bits (1276), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 238/326 (73%), Positives = 277/326 (84%), Gaps = 2/326 (0%)

Query: 1   MVRTSIKEFLEKNPREVLVLDGGQGTELENRGIKVANPVWSTIPFISESFWSAEDQSSKD 60
           M R  +K+ L  NP++VLVLDGGQGTELENRGIKVANPVWSTIPFISES     D+SS  
Sbjct: 1   MARLPLKQLLADNPKKVLVLDGGQGTELENRGIKVANPVWSTIPFISES--FWSDESSSS 58

Query: 61  RQIVKEMYSDFLKAGARVLMTVTYQASFKSVSENTRIKTLEEYDSLLNRIVTFSRECIGD 120
           R+IVKEM++DFL AGA +LMT TYQ S+KSVSENT IKTL EY++LL RIV FSR CIG+
Sbjct: 59  RKIVKEMFNDFLDAGAEILMTTTYQTSYKSVSENTPIKTLSEYNNLLTRIVDFSRGCIGE 118

Query: 121 DKFLVGCIGAWGAHNCSEFTGDYGAEPEKIDFLQYFKPQLDNFTNNENIDLIGFETIPNI 180
           DK+L+GCIG WGAH C EFTGDYGA PE IDF QYFKPQLDNF  N+N+DLIGFETIPNI
Sbjct: 119 DKYLIGCIGPWGAHICREFTGDYGANPESIDFYQYFKPQLDNFNKNDNLDLIGFETIPNI 178

Query: 181 HELRAILSWDESIINKPFYIGLSVHENGLLRDGTTMHQVAELIKSFGDRLNPNFTLLGIN 240
           HEL+AILSWDES+++KPFYIGLSVHE+G+LRDGTTM +VA++IK  GD++NPNF+LLGIN
Sbjct: 179 HELKAILSWDESVLSKPFYIGLSVHEHGVLRDGTTMQEVAKVIKDLGDKINPNFSLLGIN 238

Query: 241 CVSYNQSHDILRSLHEELPEMPLIAYPNSGEVYDTVKKIWNPKNSQTLSWEQIVKSYIDS 300
           CVS+NQS DIL SLH+ LP+M L+AYPNSGEVYDT KKIW P + +  SW+ +VK YI S
Sbjct: 239 CVSFNQSPDILESLHQALPDMALLAYPNSGEVYDTEKKIWLPNSDKLNSWDAVVKRYISS 298

Query: 301 GARIIGGCCRTSPKDIEAIHEAVQKY 326
           GARIIGGCCRTSPKDI+ I  AV+KY
Sbjct: 299 GARIIGGCCRTSPKDIQEIFTAVKKY 324

>Ecym_4612 Chr4 (1193587..1194567) [981 bp, 326 aa] {ON} similar to
           Ashbya gossypii ABL125W
          Length = 326

 Score =  494 bits (1271), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 228/328 (69%), Positives = 275/328 (83%), Gaps = 2/328 (0%)

Query: 1   MVRTSIKEFLEKNPREVLVLDGGQGTELENRGIKVANPVWSTIPFISESFWSAEDQSSKD 60
           MVR S+K+ L+ NP ++L++DGGQGTELENRGI VANPVWSTIPFI++SFWS  D+SS+D
Sbjct: 1   MVRASVKQLLQSNPDQILIMDGGQGTELENRGINVANPVWSTIPFINDSFWS--DRSSRD 58

Query: 61  RQIVKEMYSDFLKAGARVLMTVTYQASFKSVSENTRIKTLEEYDSLLNRIVTFSRECIGD 120
           RQIV  M+ +++ AGA +LMT+TYQ+SFKSVSENT IKTLEEY+ LL+RIV FSR CIG 
Sbjct: 59  RQIVAGMFEEYIAAGANLLMTITYQSSFKSVSENTDIKTLEEYNQLLDRIVAFSRTCIGA 118

Query: 121 DKFLVGCIGAWGAHNCSEFTGDYGAEPEKIDFLQYFKPQLDNFTNNENIDLIGFETIPNI 180
           D +LVGCIG+WGAH C+EF+GDYG  PE+I +L YF+PQL+NF   E+ID+IGFETIPNI
Sbjct: 119 DNYLVGCIGSWGAHICAEFSGDYGEHPERIPYLDYFRPQLNNFNLQEDIDVIGFETIPNI 178

Query: 181 HELRAILSWDESIINKPFYIGLSVHENGLLRDGTTMHQVAELIKSFGDRLNPNFTLLGIN 240
           HEL AILSWDESII KPFYIG+SVHE+G LRDGTTM QVA+L +S G +LNPNF  LGIN
Sbjct: 179 HELTAILSWDESIIKKPFYIGMSVHEHGTLRDGTTMSQVAQLFRSLGKKLNPNFLALGIN 238

Query: 241 CVSYNQSHDILRSLHEELPEMPLIAYPNSGEVYDTVKKIWNPKNSQTLSWEQIVKSYIDS 300
           C S+  SH IL SLHEELP +PLIAYPNSGE+YDTVKKIW    +  ++W++IVKSY+ S
Sbjct: 239 CCSFRYSHMILESLHEELPYIPLIAYPNSGELYDTVKKIWLKNENCIVTWDEIVKSYLQS 298

Query: 301 GARIIGGCCRTSPKDIEAIHEAVQKYRP 328
           GARIIGGCCRT+P DI  I  AV+KY+P
Sbjct: 299 GARIIGGCCRTTPNDIRQIVTAVKKYKP 326

>KNAG0B06970 Chr2 (1387382..1388380) [999 bp, 332 aa] {ON} 
          Length = 332

 Score =  493 bits (1270), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 231/316 (73%), Positives = 268/316 (84%), Gaps = 2/316 (0%)

Query: 1   MVRTSIKEFLEKNPREVLVLDGGQGTELENRGIKVANPVWSTIPFISESFWSAEDQSSKD 60
           M R  I+E+L+ NPR+VLVLDGGQGTELENRGI VANPVWST+PFI  SFWS  ++SSKD
Sbjct: 1   MPRQPIQEYLKVNPRKVLVLDGGQGTELENRGINVANPVWSTVPFIDSSFWS--NKSSKD 58

Query: 61  RQIVKEMYSDFLKAGARVLMTVTYQASFKSVSENTRIKTLEEYDSLLNRIVTFSRECIGD 120
           R IVK M+  FL AGA +LMT TYQ SFKSVSENT I+ LEEY SLL+RIV FSR+CIG 
Sbjct: 59  RVIVKGMFDAFLDAGAEILMTTTYQTSFKSVSENTPIQNLEEYSSLLDRIVQFSRDCIGP 118

Query: 121 DKFLVGCIGAWGAHNCSEFTGDYGAEPEKIDFLQYFKPQLDNFTNNENIDLIGFETIPNI 180
           DK+L+GCIG WGAH C+EF GDYG  P +ID+L YFKPQLDNF +N+N+DLIGFETIPNI
Sbjct: 119 DKYLIGCIGPWGAHVCAEFNGDYGPNPAEIDYLSYFKPQLDNFFHNDNLDLIGFETIPNI 178

Query: 181 HELRAILSWDESIINKPFYIGLSVHENGLLRDGTTMHQVAELIKSFGDRLNPNFTLLGIN 240
           HELRAILSWDE+I++KPFYIGLSVH NGLLRDG+TM  VA+LIKSFG +LN N TLLGIN
Sbjct: 179 HELRAILSWDETILSKPFYIGLSVHNNGLLRDGSTMKDVADLIKSFGGKLNKNLTLLGIN 238

Query: 241 CVSYNQSHDILRSLHEELPEMPLIAYPNSGEVYDTVKKIWNPKNSQTLSWEQIVKSYIDS 300
           CVS++ S DIL S+H+ELP+MPLIAYPNSGEVYDTVKKIW P     ++WE++V  YI +
Sbjct: 239 CVSFSDSPDILESIHKELPDMPLIAYPNSGEVYDTVKKIWLPNRDMVMTWEEVVDRYIKA 298

Query: 301 GARIIGGCCRTSPKDI 316
           GARI+GGCCRTSPKDI
Sbjct: 299 GARIVGGCCRTSPKDI 314

>NDAI0F00250 Chr6 complement(47567..48556) [990 bp, 329 aa] {ON} 
          Length = 329

 Score =  488 bits (1255), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 223/327 (68%), Positives = 274/327 (83%), Gaps = 3/327 (0%)

Query: 1   MVRTSIKEFLEKNPREVLVLDGGQGTELENRGIKVANPVWSTIPFISESFWSAEDQSSKD 60
           M R  IK++L +NP+++L+LDGGQGTELENRGI VANPVWSTIPF+++SFWS   QSSKD
Sbjct: 1   MTRQPIKDYLSENPKKILILDGGQGTELENRGINVANPVWSTIPFVNDSFWSG--QSSKD 58

Query: 61  RQIVKEMYSDFLKAGARVLMTVTYQASFKSVSENTRIKTLEEYDSLLNRIVTFSRECIGD 120
           R+IVK+M++DFL+AGA +LMT TYQ SFKSVSENT IKTL+EYD LL RIV FSR+CIG+
Sbjct: 59  REIVKQMFNDFLEAGAEILMTTTYQTSFKSVSENTNIKTLKEYDELLTRIVNFSRDCIGE 118

Query: 121 DKFLVGCIGAWGAHNCSEFTGDYGAEPEKIDFLQYFKPQLDNFTNNENIDLIGFETIPNI 180
           +K+L+GCIG WGAH CSEFTG+YG  PE ID+ +YFKPQL NF  N+++D+IGFETIPN+
Sbjct: 119 NKYLIGCIGPWGAHICSEFTGNYGEHPELIDYYEYFKPQLVNFVQNDDLDIIGFETIPNV 178

Query: 181 HELRAILSWDESIINKPFYIGLSVHENGLLRDGTTMHQVAELIKSFGDRLNPNFTLLGIN 240
           +EL+ ILSW   I+ KPFYIGLSVHENG+LRDGTTM QVA++I S  D+LNPN  LLGIN
Sbjct: 179 YELKTILSWGTDILPKPFYIGLSVHENGVLRDGTTMSQVADIINSLSDKLNPNLVLLGIN 238

Query: 241 CVSYNQSHDILRSLHEELPEMPLIAYPNSGEVYDTVKKIWNPKNSQT-LSWEQIVKSYID 299
           CVS   S DIL S+H  LP++PLI YPNSGEVYDTVKKIW P N +T +SW+++V+ Y+ 
Sbjct: 239 CVSLAHSPDILDSIHSNLPDLPLIVYPNSGEVYDTVKKIWLPPNDETYMSWDEVVERYLK 298

Query: 300 SGARIIGGCCRTSPKDIEAIHEAVQKY 326
           +GARIIGGCCRT+P DI+ I +AV KY
Sbjct: 299 AGARIIGGCCRTTPNDIKQISDAVHKY 325

>KLLA0D01551g Chr4 complement(137965..138960) [996 bp, 331 aa] {ON}
           highly similar to uniprot|Q08985 Saccharomyces
           cerevisiae YPL273W SAM4
           S-adenosylmethionine-homocysteine methyltransferase,
          Length = 331

 Score =  486 bits (1252), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 219/325 (67%), Positives = 274/325 (84%), Gaps = 2/325 (0%)

Query: 2   VRTSIKEFLEKNPREVLVLDGGQGTELENRGIKVANPVWSTIPFISESFWSAEDQSSKDR 61
           +R  IK++ E+NP  VLV+DGGQGTELENRGI VANPVWST+PFI+ESFWS++  +SKDR
Sbjct: 1   MRVPIKKYFEENPDVVLVMDGGQGTELENRGINVANPVWSTVPFINESFWSSD--ASKDR 58

Query: 62  QIVKEMYSDFLKAGARVLMTVTYQASFKSVSENTRIKTLEEYDSLLNRIVTFSRECIGDD 121
            IVK+M+ DF++AGA +LMT+TYQ SFKSVSENT I+TLEEY+ LL+RIV+FSR CIG+D
Sbjct: 59  IIVKQMFEDFIEAGADILMTITYQTSFKSVSENTPIRTLEEYNGLLDRIVSFSRSCIGED 118

Query: 122 KFLVGCIGAWGAHNCSEFTGDYGAEPEKIDFLQYFKPQLDNFTNNENIDLIGFETIPNIH 181
           ++L+GCIGAWGAH CSEFTGDYG  P++ID+ +YF+PQL NF  +++ID+IGFETIPNIH
Sbjct: 119 RYLIGCIGAWGAHVCSEFTGDYGPHPDQIDYFEYFRPQLGNFVQSKDIDIIGFETIPNIH 178

Query: 182 ELRAILSWDESIINKPFYIGLSVHENGLLRDGTTMHQVAELIKSFGDRLNPNFTLLGINC 241
           ELRAILSWDE++++KPFYIGLSVHE G+LRDGT+M Q+A+LI S GD+LN N   +GINC
Sbjct: 179 ELRAILSWDETVLSKPFYIGLSVHEYGVLRDGTSMQQIADLISSLGDKLNSNLMFIGINC 238

Query: 242 VSYNQSHDILRSLHEELPEMPLIAYPNSGEVYDTVKKIWNPKNSQTLSWEQIVKSYIDSG 301
            ++NQSH IL SLH   P MPLI YPNSGE+YDTVKKIW    +Q  +W+ +VKSYI++G
Sbjct: 239 CAFNQSHMILESLHNSCPNMPLIVYPNSGEIYDTVKKIWLKNENQLCTWDDVVKSYIENG 298

Query: 302 ARIIGGCCRTSPKDIEAIHEAVQKY 326
           ARIIGGCCRT+  DI+ +  AV KY
Sbjct: 299 ARIIGGCCRTTVDDIKEVRLAVNKY 323

>TDEL0E05690 Chr5 complement(1057559..1058545) [987 bp, 328 aa] {ON}
           
          Length = 328

 Score =  461 bits (1186), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 209/326 (64%), Positives = 268/326 (82%), Gaps = 3/326 (0%)

Query: 1   MVRTSIKEFLEKNPREVLVLDGGQGTELENRGIKVANPVWSTIPFISESFWSAEDQSSKD 60
           MVR  IK+ + ++ +E+LVLDGGQGTELENRGI+VANPVWSTIPF+SESFW+  D SSK+
Sbjct: 1   MVRIPIKKLVIES-KEILVLDGGQGTELENRGIEVANPVWSTIPFLSESFWT--DSSSKE 57

Query: 61  RQIVKEMYSDFLKAGARVLMTVTYQASFKSVSENTRIKTLEEYDSLLNRIVTFSRECIGD 120
           R+IV+ ++ DF K+G+ +LMT+TYQ SF S+ ENT+ KTL EY++LL+RIV FSR CIGD
Sbjct: 58  RKIVESVFDDFKKSGSNILMTITYQTSFTSIVENTQFKTLAEYNTLLDRIVKFSRSCIGD 117

Query: 121 DKFLVGCIGAWGAHNCSEFTGDYGAEPEKIDFLQYFKPQLDNFTNNENIDLIGFETIPNI 180
           +++L+G +G WGAH C EFTG+YG  PE ID+ +YFKPQLDNF   + IDLIGFET+PN 
Sbjct: 118 ERYLIGSVGPWGAHVCCEFTGNYGLHPESIDYYEYFKPQLDNFNGQDEIDLIGFETVPNF 177

Query: 181 HELRAILSWDESIINKPFYIGLSVHENGLLRDGTTMHQVAELIKSFGDRLNPNFTLLGIN 240
           HEL+AILSWDE+ I KPFYIGLSVH NG+LRDGTTM ++ E IK  G++++ NF LLG+N
Sbjct: 178 HELKAILSWDETKIAKPFYIGLSVHNNGVLRDGTTMEEIGEYIKGLGEKISSNFLLLGVN 237

Query: 241 CVSYNQSHDILRSLHEELPEMPLIAYPNSGEVYDTVKKIWNPKNSQTLSWEQIVKSYIDS 300
           CVS+N S D+++S+H+ LP+MPL+AYPNSGEVYDT KKIW     +  SW+ +V+SYID+
Sbjct: 238 CVSFNDSSDMVKSIHKALPDMPLLAYPNSGEVYDTEKKIWFDNKDKLDSWDSVVRSYIDN 297

Query: 301 GARIIGGCCRTSPKDIEAIHEAVQKY 326
           GARIIGGCCRTSP+DI  +  AV+KY
Sbjct: 298 GARIIGGCCRTSPRDIAEVSAAVKKY 323

>Suva_16.17 Chr16 complement(15787..16761) [975 bp, 324 aa] {ON}
           YLL062C (REAL)
          Length = 324

 Score =  449 bits (1156), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 203/326 (62%), Positives = 262/326 (80%), Gaps = 3/326 (0%)

Query: 1   MVRTSIKEFLEKNPREVLVLDGGQGTELENRGIKVANPVWSTIPFISESFWSAEDQSSKD 60
           M R +I++ + ++P++VLVLDGGQGTELENRGI + +PVWS  PFIS+SFW   + +S D
Sbjct: 1   MGRIAIEKLILEHPQKVLVLDGGQGTELENRGIDINSPVWSAAPFISDSFW---ESTSSD 57

Query: 61  RQIVKEMYSDFLKAGARVLMTVTYQASFKSVSENTRIKTLEEYDSLLNRIVTFSRECIGD 120
           R +V+EMY DF+ AGA VLMTVTYQA+F S+SENT IKTL +Y+  L+R+V+F+R  IG+
Sbjct: 58  RTLVEEMYRDFMDAGANVLMTVTYQANFSSISENTSIKTLSDYNRFLDRVVSFTRRVIGE 117

Query: 121 DKFLVGCIGAWGAHNCSEFTGDYGAEPEKIDFLQYFKPQLDNFTNNENIDLIGFETIPNI 180
           D++L+G IG W AH  SE+TGDYG+ PE ID+LQ+FK QLDNF  +  IDLIGFET+PN 
Sbjct: 118 DRYLIGSIGPWAAHVSSEYTGDYGSHPEDIDYLQHFKAQLDNFNKHTEIDLIGFETVPNF 177

Query: 181 HELRAILSWDESIINKPFYIGLSVHENGLLRDGTTMHQVAELIKSFGDRLNPNFTLLGIN 240
           HEL+AILSWDE+II+KPFY+GLSVH+NGLLRDGTTM ++A  +KS G ++N +F LLG+N
Sbjct: 178 HELKAILSWDENIISKPFYVGLSVHDNGLLRDGTTMEEIAAYVKSLGRKINRHFLLLGVN 237

Query: 241 CVSYNQSHDILRSLHEELPEMPLIAYPNSGEVYDTVKKIWNPKNSQTLSWEQIVKSYIDS 300
           C+S+NQS  IL+SLH+ LP+MPL+AYPNSGEVYDT  K W+    +  SWE +V+ +ID+
Sbjct: 238 CISFNQSTSILKSLHQALPDMPLLAYPNSGEVYDTKTKTWHQAKGKQNSWEVVVEEFIDN 297

Query: 301 GARIIGGCCRTSPKDIEAIHEAVQKY 326
           GARIIGGCCRTS KDI  I  AV K+
Sbjct: 298 GARIIGGCCRTSAKDISEIASAVDKH 323

>TDEL0E00240 Chr5 complement(38804..39790) [987 bp, 328 aa] {ON} 
          Length = 328

 Score =  443 bits (1140), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 202/326 (61%), Positives = 260/326 (79%), Gaps = 3/326 (0%)

Query: 1   MVRTSIKEFLEKNPREVLVLDGGQGTELENRGIKVANPVWSTIPFISESFWSAEDQSSKD 60
           M R  +++ L  + R++LVLDGGQGTE+ENRGI+VANPVWS+IPF+SESFW+  D+ SK+
Sbjct: 1   MGRVPLRKVL-TDSRKILVLDGGQGTEMENRGIEVANPVWSSIPFVSESFWT--DEWSKE 57

Query: 61  RQIVKEMYSDFLKAGARVLMTVTYQASFKSVSENTRIKTLEEYDSLLNRIVTFSRECIGD 120
           R+IV+E+Y DF+ +G+ +LMTVTYQASFK+++ENT ++TL EY+SLL+RIV FSR CIGD
Sbjct: 58  RKIVEEIYKDFMSSGSDMLMTVTYQASFKAIAENTELQTLSEYNSLLDRIVAFSRRCIGD 117

Query: 121 DKFLVGCIGAWGAHNCSEFTGDYGAEPEKIDFLQYFKPQLDNFTNNENIDLIGFETIPNI 180
           +++LVG +G W A+N SE+TGDYG   + ID+  Y+KPQLDNF   E ID+IG ET+PN 
Sbjct: 118 ERYLVGSVGPWAAYNASEYTGDYGLHADSIDYYGYYKPQLDNFNKQEEIDMIGIETVPNF 177

Query: 181 HELRAILSWDESIINKPFYIGLSVHENGLLRDGTTMHQVAELIKSFGDRLNPNFTLLGIN 240
           HEL+AILSWDE  I KPFY+ L+ H++G+LRDGT M  +A+ IK  G+ LNPNF LLGIN
Sbjct: 178 HELKAILSWDEKKIAKPFYVSLTTHDSGVLRDGTAMEDIAQYIKCLGNNLNPNFMLLGIN 237

Query: 241 CVSYNQSHDILRSLHEELPEMPLIAYPNSGEVYDTVKKIWNPKNSQTLSWEQIVKSYIDS 300
           CVS+N S DIL  LH  LPEM L+AYPNSGEVY+  KKIW     +T SW+ +VKS+I+S
Sbjct: 238 CVSFNDSRDILELLHNALPEMLLLAYPNSGEVYEPKKKIWLANKCKTTSWDSVVKSFINS 297

Query: 301 GARIIGGCCRTSPKDIEAIHEAVQKY 326
           GARIIGGCCRTSP+DI  +  AV+KY
Sbjct: 298 GARIIGGCCRTSPQDIADVSIAVKKY 323

>Suva_64.1 Chr64 (76..894) [819 bp, 273 aa] {ON} YPL273W (REAL)
          Length = 273

 Score =  439 bits (1129), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 205/275 (74%), Positives = 237/275 (86%), Gaps = 2/275 (0%)

Query: 1   MVRTSIKEFLEKNPREVLVLDGGQGTELENRGIKVANPVWSTIPFISESFWSAEDQSSKD 60
           M R  +K+ L  +P++VLVLDGGQGTELENRGIKVANPVWSTIPFISESFWS  D+SS +
Sbjct: 1   MARIPLKQLLADDPKKVLVLDGGQGTELENRGIKVANPVWSTIPFISESFWS--DESSAN 58

Query: 61  RQIVKEMYSDFLKAGARVLMTVTYQASFKSVSENTRIKTLEEYDSLLNRIVTFSRECIGD 120
           R+IVKEM++DFL AGA +LMT+TYQ SFKSVSENT IKTL  YD+LL RIV FSR+CIG+
Sbjct: 59  RKIVKEMFNDFLAAGAEILMTITYQTSFKSVSENTPIKTLAAYDNLLTRIVDFSRDCIGE 118

Query: 121 DKFLVGCIGAWGAHNCSEFTGDYGAEPEKIDFLQYFKPQLDNFTNNENIDLIGFETIPNI 180
           +K L+GCIG WGAH C EFTG+YG  PE IDF QYFKPQLDNF  N+ +DL+GFETIPNI
Sbjct: 119 EKHLIGCIGPWGAHVCCEFTGNYGPNPESIDFYQYFKPQLDNFNKNDKLDLLGFETIPNI 178

Query: 181 HELRAILSWDESIINKPFYIGLSVHENGLLRDGTTMHQVAELIKSFGDRLNPNFTLLGIN 240
           HEL+AILSWDESI++KPFYIGLSVHE+G+LRDGTTM  VA++IK  GD++NPNF LLGIN
Sbjct: 179 HELKAILSWDESILSKPFYIGLSVHEHGVLRDGTTMEGVAKVIKDLGDKINPNFLLLGIN 238

Query: 241 CVSYNQSHDILRSLHEELPEMPLIAYPNSGEVYDT 275
           CVS+NQS DIL SLH  LP MPL+AYPNSGEVYDT
Sbjct: 239 CVSFNQSPDILESLHRALPNMPLLAYPNSGEVYDT 273

>Skud_12.4 Chr12 complement(4676..5653) [978 bp, 325 aa] {ON}
           YLL062C (REAL)
          Length = 325

 Score =  434 bits (1117), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 200/326 (61%), Positives = 255/326 (78%), Gaps = 3/326 (0%)

Query: 1   MVRTSIKEFLEKNPREVLVLDGGQGTELENRGIKVANPVWSTIPFISESFWSAEDQSSKD 60
           M R SI++ + + P  VLVLDGGQGTELENRGI +  PVWS  PF S+SFW   +QSS D
Sbjct: 1   MKRISIEKLILEYPTRVLVLDGGQGTELENRGINIGGPVWSATPFTSDSFW---EQSSHD 57

Query: 61  RQIVKEMYSDFLKAGARVLMTVTYQASFKSVSENTRIKTLEEYDSLLNRIVTFSRECIGD 120
           R++V+EMY DF+ AGA VLMT+TYQA+FKS+SENT I+TL  Y+  L+RIV+F+R  IG+
Sbjct: 58  REVVEEMYRDFMNAGANVLMTITYQANFKSISENTSIQTLSAYNGFLDRIVSFTRRFIGE 117

Query: 121 DKFLVGCIGAWGAHNCSEFTGDYGAEPEKIDFLQYFKPQLDNFTNNENIDLIGFETIPNI 180
           +++LVG IG W AH  SE+TG+YG  PE ID+  +FKPQLD+F  N++IDLIGFET+PN 
Sbjct: 118 ERYLVGSIGPWAAHVSSEYTGNYGPHPEDIDYYNFFKPQLDSFNENKDIDLIGFETVPNF 177

Query: 181 HELRAILSWDESIINKPFYIGLSVHENGLLRDGTTMHQVAELIKSFGDRLNPNFTLLGIN 240
           HEL+AILSW E II+KPFY+GLSVH+NGLLRDGTTM +V+  IK  G R+N +  L+G+N
Sbjct: 178 HELKAILSWGEDIISKPFYVGLSVHDNGLLRDGTTMEEVSAHIKGLGSRINKHLLLMGVN 237

Query: 241 CVSYNQSHDILRSLHEELPEMPLIAYPNSGEVYDTVKKIWNPKNSQTLSWEQIVKSYIDS 300
           C+S+N+S  ILR+LHE LP+ PL+ YPNSGEVYD  +K W+    +  SW+  VK++IDS
Sbjct: 238 CISFNRSTLILRTLHESLPDTPLLVYPNSGEVYDVKEKTWHWPTDKPESWDITVKTFIDS 297

Query: 301 GARIIGGCCRTSPKDIEAIHEAVQKY 326
           GARIIGGCCRTSPKDI  I  AV++Y
Sbjct: 298 GARIIGGCCRTSPKDIAEIATAVRRY 323

>Smik_12.1 Chr12 complement(885..1859) [975 bp, 324 aa] {ON} YLL062C
           (REAL)
          Length = 324

 Score =  426 bits (1096), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 194/326 (59%), Positives = 255/326 (78%), Gaps = 3/326 (0%)

Query: 1   MVRTSIKEFLEKNPREVLVLDGGQGTELENRGIKVANPVWSTIPFISESFWSAEDQSSKD 60
           M R  I++ L ++P++VLVLDGGQGTELENRGI + +PVWS  PF+S+SFW   ++SS++
Sbjct: 1   MKRIPIEKLLIEHPQKVLVLDGGQGTELENRGININSPVWSAAPFVSDSFW---EKSSRE 57

Query: 61  RQIVKEMYSDFLKAGARVLMTVTYQASFKSVSENTRIKTLEEYDSLLNRIVTFSRECIGD 120
           R++V+EMY DF+ AGA VLMT+TYQA+FKS+S+NT IKTL  Y   L++IV FSR  IG+
Sbjct: 58  RKVVEEMYRDFMNAGANVLMTITYQANFKSISKNTTIKTLPAYRRFLDQIVCFSRRLIGE 117

Query: 121 DKFLVGCIGAWGAHNCSEFTGDYGAEPEKIDFLQYFKPQLDNFTNNENIDLIGFETIPNI 180
           +++L+G IG W AH  SE+TG+YG  PE ID+ ++F+PQLD F  NE+IDLIGFETIPN 
Sbjct: 118 ERYLIGSIGPWAAHVSSEYTGNYGPHPEDIDYYEFFRPQLDTFNENEDIDLIGFETIPNF 177

Query: 181 HELRAILSWDESIINKPFYIGLSVHENGLLRDGTTMHQVAELIKSFGDRLNPNFTLLGIN 240
           HEL+AILSW E II++PFY+GLSVH+NGLLRDGTT+ +++  IK  G ++N NF LLG+N
Sbjct: 178 HELKAILSWGEDIISRPFYVGLSVHDNGLLRDGTTLEEISAHIKGLGSKINKNFLLLGVN 237

Query: 241 CVSYNQSHDILRSLHEELPEMPLIAYPNSGEVYDTVKKIWNPKNSQTLSWEQIVKSYIDS 300
           C+S+NQS  IL++LHE LP+ PL+ YPNSGE+YD  +K W     +  SW+  V+ +IDS
Sbjct: 238 CISFNQSTLILKALHEVLPDFPLLVYPNSGEIYDPKEKTWYHPTDKLDSWDVTVRKFIDS 297

Query: 301 GARIIGGCCRTSPKDIEAIHEAVQKY 326
           GARIIGGCCRTSPKDI  I  +V  Y
Sbjct: 298 GARIIGGCCRTSPKDIAEIAASVDTY 323

>YLL062C Chr12 complement(16639..17613) [975 bp, 324 aa] {ON}
           MHT1S-methylmethionine-homocysteine methyltransferase,
           functions along with Sam4p in the conversion of
           S-adenosylmethionine (AdoMet) to methionine to control
           the methionine/AdoMet ratio
          Length = 324

 Score =  424 bits (1090), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 195/326 (59%), Positives = 252/326 (77%), Gaps = 3/326 (0%)

Query: 1   MVRTSIKEFLEKNPREVLVLDGGQGTELENRGIKVANPVWSTIPFISESFWSAEDQSSKD 60
           M R  IKE + ++P +VL+LDGGQGTELENRGI + +PVWS  PF SESFW   + SS++
Sbjct: 1   MKRIPIKELIVEHPGKVLILDGGQGTELENRGININSPVWSAAPFTSESFW---EPSSQE 57

Query: 61  RQIVKEMYSDFLKAGARVLMTVTYQASFKSVSENTRIKTLEEYDSLLNRIVTFSRECIGD 120
           R++V+EMY DF+ AGA +LMT+TYQA+F+S+SENT IKTL  Y   L++IV+F+RE IG+
Sbjct: 58  RKVVEEMYRDFMIAGANILMTITYQANFQSISENTSIKTLAAYKRFLDKIVSFTREFIGE 117

Query: 121 DKFLVGCIGAWGAHNCSEFTGDYGAEPEKIDFLQYFKPQLDNFTNNENIDLIGFETIPNI 180
           +++L+G IG W AH   E+TGDYG  PE ID+  +FKPQL+NF  N +IDLIGFETIPN 
Sbjct: 118 ERYLIGSIGPWAAHVSCEYTGDYGPHPENIDYYGFFKPQLENFNQNRDIDLIGFETIPNF 177

Query: 181 HELRAILSWDESIINKPFYIGLSVHENGLLRDGTTMHQVAELIKSFGDRLNPNFTLLGIN 240
           HEL+AILSWDE II+KPFYIGLSV +N LLRDGTT+ +++  IK  G+++N N  L+G+N
Sbjct: 178 HELKAILSWDEDIISKPFYIGLSVDDNSLLRDGTTLEEISVHIKGLGNKINKNLLLMGVN 237

Query: 241 CVSYNQSHDILRSLHEELPEMPLIAYPNSGEVYDTVKKIWNPKNSQTLSWEQIVKSYIDS 300
           CVS+NQS  IL+ LHE LP MPL+ YPNSGE+Y+  +K W+   ++   WE  VK ++D+
Sbjct: 238 CVSFNQSALILKMLHEHLPGMPLLVYPNSGEIYNPKEKTWHRPTNKLDDWETTVKKFVDN 297

Query: 301 GARIIGGCCRTSPKDIEAIHEAVQKY 326
           GARIIGGCCRTSPKDI  I  AV KY
Sbjct: 298 GARIIGGCCRTSPKDIAEIASAVDKY 323

>ABL125W Chr2 (161358..162368) [1011 bp, 336 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YPL273W (SAM4)
          Length = 336

 Score =  409 bits (1051), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 195/326 (59%), Positives = 241/326 (73%), Gaps = 4/326 (1%)

Query: 1   MVRTSIKEFLEKNPREVLVLDGGQGTELENRGIKVANPVWSTIPFISESFWSAEDQSSKD 60
           M R  I+++LE++P  VLV+DGGQGTELENRGI VA+PVWS  PF+  + W   D  S++
Sbjct: 1   MPRIPIRQYLEEDPTRVLVMDGGQGTELENRGIVVASPVWSAAPFLDAAAWQQPD--SRE 58

Query: 61  RQIVKEMYSDFLKAGARVLMTVTYQASFKSVSENTRIKTLEEYDSLLNRIVTFSRECIGD 120
           R IV  +  DF+ AGA V+MT+TYQASF SV+ NT I TL++Y++LL+RIV F RE +GD
Sbjct: 59  RAIVASVLRDFVAAGAEVIMTITYQASFTSVTTNTGITTLQDYNALLDRIVGFCRETVGD 118

Query: 121 DKFLVGCIGAWGAHNCSEFTGDYGAEPEKIDFLQYFKPQLDNFTNNENIDLIGFETIPNI 180
           DK+LVG IGAWGAH C+EFTGDYG  P+ ID+L YFKPQLDNF     +DLIGFETIPN 
Sbjct: 119 DKYLVGSIGAWGAHVCAEFTGDYGPRPDHIDYLAYFKPQLDNFNAQPALDLIGFETIPNA 178

Query: 181 HELRAILSWDESIINKPFYIGLSVHENGLLRDGTTMHQVAELIKSFGDRLNPNFTLLGIN 240
           HELRAILSWDES+I KPFY+ LSVH+ G LRDGT M  VA ++ +    LNPNF  LGIN
Sbjct: 179 HELRAILSWDESVIAKPFYVALSVHDAGTLRDGTPMADVAAIVAAAAP-LNPNFLGLGIN 237

Query: 241 CVSYNQSHDILRSLHEELPEMPLIAYPNSGEVYDTVKKIWNPKNSQTLSWEQIVKSYIDS 300
           C S +++  IL  LH  LP +P+  YPNSGE+YD VKK+WN  +   + W  +V SYI S
Sbjct: 238 CSSLSRTPAILAELHALLPALPMTIYPNSGEIYDPVKKVWN-ASPHVVDWGAVVASYIRS 296

Query: 301 GARIIGGCCRTSPKDIEAIHEAVQKY 326
           GARIIGGCCRT P DI  I +AV+ +
Sbjct: 297 GARIIGGCCRTIPNDIRQIADAVRTH 322

>KAFR0F04420 Chr6 (867176..868156) [981 bp, 326 aa] {ON} 
          Length = 326

 Score =  408 bits (1049), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 191/326 (58%), Positives = 242/326 (74%), Gaps = 2/326 (0%)

Query: 1   MVRTSIKEFLEKNPREVLVLDGGQGTELENRGIKVANPVWSTIPFISESFWSAEDQSSKD 60
           M R  IKE+L +N  ++LVLDGGQGTELE RGI +++PVWST+PFI+ESFWS  + SS D
Sbjct: 1   MGRVPIKEYLLRNSDKILVLDGGQGTELEKRGINISSPVWSTLPFINESFWS--NSSSND 58

Query: 61  RQIVKEMYSDFLKAGARVLMTVTYQASFKSVSENTRIKTLEEYDSLLNRIVTFSRECIGD 120
           R+I+K+MYSDF+ AGA VL T TYQ SF S+SENT I+TL++Y  LLNRI  F+RECIGD
Sbjct: 59  RKIIKDMYSDFISAGADVLSTTTYQTSFASISENTNIQTLKDYHELLNRITKFTRECIGD 118

Query: 121 DKFLVGCIGAWGAHNCSEFTGDYGAEPEKIDFLQYFKPQLDNFTNNENIDLIGFETIPNI 180
            K+LVG IG + A+  +E+TGD+G   + ID+  YFKPQLDNF  +  ID+IGFETIPNI
Sbjct: 119 SKYLVGSIGTYAAYLSAEYTGDFGDAADTIDYHGYFKPQLDNFNRSTEIDIIGFETIPNI 178

Query: 181 HELRAILSWDESIINKPFYIGLSVHENGLLRDGTTMHQVAELIKSFGDRLNPNFTLLGIN 240
           HELRAILS ++  ++KPFYI LS +    LRDGT++  V ++IKSF   LNPN  LLGIN
Sbjct: 179 HELRAILSLNKKDLSKPFYISLSTNSKAQLRDGTSLKGVVDVIKSFESTLNPNLILLGIN 238

Query: 241 CVSYNQSHDILRSLHEELPEMPLIAYPNSGEVYDTVKKIWNPKNSQTLSWEQIVKSYIDS 300
           C+  N SH  +  L+  LP+ PLI YPNSGE YD V+KIW        +WE IV  Y+D+
Sbjct: 239 CIGLNSSHLTMEYLNNHLPQFPLIVYPNSGEKYDPVRKIWLADEDPAFTWEYIVHRYLDA 298

Query: 301 GARIIGGCCRTSPKDIEAIHEAVQKY 326
           GARI+GGCCRT+P DI +I EA++ Y
Sbjct: 299 GARIVGGCCRTTPSDIRSISEAIKCY 324

>KAFR0L00150 Chr12 complement(16662..17642) [981 bp, 326 aa] {ON} 
          Length = 326

 Score =  405 bits (1040), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 184/325 (56%), Positives = 244/325 (75%), Gaps = 2/325 (0%)

Query: 1   MVRTSIKEFLEKNPREVLVLDGGQGTELENRGIKVANPVWSTIPFISESFWSAEDQSSKD 60
           MVR  +K++L++NP +VLV DGGQG ELE RG+ + + +WST PF+S+SFWS  D SS D
Sbjct: 1   MVRVPLKKYLKENPEKVLVSDGGQGLELERRGLDIKHRLWSTRPFLSKSFWS--DPSSND 58

Query: 61  RQIVKEMYSDFLKAGARVLMTVTYQASFKSVSENTRIKTLEEYDSLLNRIVTFSRECIGD 120
            +IVK M+ DF+ AGA +LMT TYQ SFK+VSE+T +K+L EY+ LL++IV F+R CIGD
Sbjct: 59  IRIVKGMFEDFVNAGAEILMTTTYQTSFKAVSESTELKSLREYNELLDKIVGFTRACIGD 118

Query: 121 DKFLVGCIGAWGAHNCSEFTGDYGAEPEKIDFLQYFKPQLDNFTNNENIDLIGFETIPNI 180
           +++L+G IG++GA    E++GDYG  PE +DF  YFKPQLDNF NN+ ID++GFETI N 
Sbjct: 119 NRYLIGSIGSYGALVGGEYSGDYGDSPETVDFYSYFKPQLDNFLNNDEIDIVGFETIANF 178

Query: 181 HELRAILSWDESIINKPFYIGLSVHENGLLRDGTTMHQVAELIKSFGDRLNPNFTLLGIN 240
            EL+++LSWDE  ++KPFYI LSVH+NG LRDGT MH + + IKS    +NPN T LG+N
Sbjct: 179 TELKSLLSWDEKKVSKPFYISLSVHDNGNLRDGTPMHLITDYIKSLATAINPNLTFLGVN 238

Query: 241 CVSYNQSHDILRSLHEELPEMPLIAYPNSGEVYDTVKKIWNPKNSQTLSWEQIVKSYIDS 300
           CV+YN++ +I+ S+H  LP MPL  +PNSGEV++  K IW        SWE +VK +I S
Sbjct: 239 CVNYNKATEIIDSIHNGLPTMPLSVFPNSGEVFNVEKGIWTANPEAAASWEAVVKRFISS 298

Query: 301 GARIIGGCCRTSPKDIEAIHEAVQK 325
           G RI+GGCCRT P DIE I +AV+K
Sbjct: 299 GVRIVGGCCRTRPHDIEQISKAVKK 323

>Suva_16.32 Chr16 (40969..41748) [780 bp, 259 aa] {ON} YPL273W
           (REAL)
          Length = 259

 Score =  392 bits (1007), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 180/248 (72%), Positives = 209/248 (84%)

Query: 79  LMTVTYQASFKSVSENTRIKTLEEYDSLLNRIVTFSRECIGDDKFLVGCIGAWGAHNCSE 138
           LMT+TYQ SFKSVSENT IKTL  YD+LL RIV FSR+CIG++K L+GCIG WGAH C E
Sbjct: 11  LMTITYQTSFKSVSENTPIKTLAAYDNLLTRIVDFSRDCIGEEKHLIGCIGPWGAHVCCE 70

Query: 139 FTGDYGAEPEKIDFLQYFKPQLDNFTNNENIDLIGFETIPNIHELRAILSWDESIINKPF 198
           FTG+YG  PE IDF QYFKPQLDNF  N+ +DL+GFETIPNIHEL+AILSWDESI++KPF
Sbjct: 71  FTGNYGPNPESIDFYQYFKPQLDNFNKNDKLDLLGFETIPNIHELKAILSWDESILSKPF 130

Query: 199 YIGLSVHENGLLRDGTTMHQVAELIKSFGDRLNPNFTLLGINCVSYNQSHDILRSLHEEL 258
           YIGLSVHE+G+LRDGTTM  VA++IK  GD++NPNF LLGINCVS+NQS DIL SLH  L
Sbjct: 131 YIGLSVHEHGVLRDGTTMEGVAKVIKDLGDKINPNFLLLGINCVSFNQSPDILESLHRAL 190

Query: 259 PEMPLIAYPNSGEVYDTVKKIWNPKNSQTLSWEQIVKSYIDSGARIIGGCCRTSPKDIEA 318
           P MPL+AYPNSGEVYDT KKIW P + +  SW+ +VK YI SGARIIGGCCRT+PKDI+ 
Sbjct: 191 PNMPLLAYPNSGEVYDTEKKIWLPNSDKLNSWDTVVKQYIGSGARIIGGCCRTTPKDIQE 250

Query: 319 IHEAVQKY 326
           +  AV+KY
Sbjct: 251 VSAAVKKY 258

>TPHA0I00260 Chr9 (49179..50150) [972 bp, 323 aa] {ON} Anc_8.841
           YPL273W
          Length = 323

 Score =  368 bits (944), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 170/322 (52%), Positives = 233/322 (72%), Gaps = 2/322 (0%)

Query: 2   VRTSIKEFLEKNPREVLVLDGGQGTELENRGIKVANPVWSTIPFISESFWSAEDQSSKDR 61
           +R   ++F++++P E+LVLDGGQGTELENRG+ + +P+WSTI F+++ FW  E+  + +R
Sbjct: 1   MRVPFRKFIDEHPNEILVLDGGQGTELENRGVNINSPLWSTISFVNDKFWD-ENIENTER 59

Query: 62  QIVKEMYSDFLKAGARVLMTVTYQASFKSVSENTRIKTLEEYDSLLNRIVTFSRECIGDD 121
           + ++EM++DF  AGA V  T+TYQ SF SVSENT IK+L+EY  LL +I  F R CI DD
Sbjct: 60  KCIREMFNDFKDAGANVFSTLTYQTSFSSVSENTDIKSLQEYHELLRKITGFCRRCISDD 119

Query: 122 KFLVGCIGAWGAHNCSEFTGDYGAEPEKIDFLQYFKPQLDNFTNNENIDLIGFETIPNIH 181
            +L+GCIGA+ A   +E+ G+YG    KID+L+YFKPQLD F N+ NID+IGFETIPN H
Sbjct: 120 DYLLGCIGAYAASIGAEYDGNYGLFAGKIDYLKYFKPQLDEFNNDMNIDIIGFETIPNKH 179

Query: 182 ELRAILSWDESIINKPFYIGLSVHENGLLRDGTTMHQVAELIKSFGDRLNPNFTLLGINC 241
           EL AILSWDE IIN+PF+I LS+ +   LRDGT+  ++  L   +  R N N   +G NC
Sbjct: 180 ELEAILSWDEDIINRPFFIALSLSDKNGLRDGTSFEEMGRLFAKYKGR-NKNLVYVGGNC 238

Query: 242 VSYNQSHDILRSLHEELPEMPLIAYPNSGEVYDTVKKIWNPKNSQTLSWEQIVKSYIDSG 301
           +SY  S D +R LH+ +P + LIAYPNSGE+YD   K W+  ++  +SWE++V  Y D+G
Sbjct: 239 ISYAYSIDNIRKLHDIVPHLNLIAYPNSGEIYDQKSKQWSSTSAIKISWEEVVNEYADAG 298

Query: 302 ARIIGGCCRTSPKDIEAIHEAV 323
            +IIGGCCRT+P DI+ I +AV
Sbjct: 299 VKIIGGCCRTTPDDIKQIKKAV 320

>TBLA0B03260 Chr2 (760392..761372) [981 bp, 326 aa] {ON} Anc_8.841
           YPL273W
          Length = 326

 Score =  354 bits (908), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 165/323 (51%), Positives = 238/323 (73%), Gaps = 3/323 (0%)

Query: 2   VRTSIKEFLEKNPREVLVLDGGQGTELENRGIKVANPVWSTIPFISESFWSAEDQSSKDR 61
           +R S KE+   +P  V+V+DGGQGTELE RG+ V++ VWST+PFI   FW  +D+ S++ 
Sbjct: 1   MRQSFKEYFNTHPNAVIVMDGGQGTELERRGVDVSSKVWSTVPFIGREFWQ-KDEKSQNI 59

Query: 62  QIVKEMYSDFLKAGARVLMTVTYQASFKSVSENTRIKTLEEYDSLLNRIVTFSRECIGDD 121
            IVK+M+  F+ AG++ LM++TYQ SF ++S NT+I+ LEEY+ LLN+IV F RECIG+ 
Sbjct: 60  SIVKDMFQAFVAAGSQALMSITYQCSFSTISSNTKIQALEEYNELLNKIVKFCRECIGNS 119

Query: 122 KFLVGCIGAWGAHNCSEFTGDYGAEPEKIDFLQYFKPQLDNFTNNENIDLIGFETIPNIH 181
           K+L+G IG + +H  +E+TGDYG  PE +D+L YFKPQLDNF +N++IDLI  ET+PN +
Sbjct: 120 KYLIGSIGPYASHVSAEYTGDYGLHPENVDYLNYFKPQLDNFNDNDDIDLIAMETVPNKY 179

Query: 182 ELRAILSWDESIINKPFYIGLSVHENGLLRDGTTMHQVAELIKSFGDRLNPNFTLLGINC 241
           EL+A+LSWD + I KPFYI LSV ++G LRDGT+M  ++ + ++  +  NPN  ++G+NC
Sbjct: 180 ELKALLSWDGTTIKKPFYISLSVGDDGNLRDGTSMDTISTMFQN-REVKNPNLMMVGVNC 238

Query: 242 VSYNQSHDILRSLHEELPEMPLIAYPNSGEVYDTVKKIWNPKNSQTL-SWEQIVKSYIDS 300
           VSY+++  I++ L   +P++PL+ YPNSGEVYD + + W   N   L SWE +VK  + +
Sbjct: 239 VSYDKTLMIIKKLQIAVPDLPLVCYPNSGEVYDQITQSWKTNNDIKLDSWETLVKDLVAN 298

Query: 301 GARIIGGCCRTSPKDIEAIHEAV 323
           G R++GGCCRT+P DI  I +AV
Sbjct: 299 GVRMVGGCCRTTPDDIHKIAQAV 321

>Kpol_1068.7 s1068 complement(11996..12967) [972 bp, 323 aa] {ON}
           complement(11996..12967) [972 nt, 324 aa]
          Length = 323

 Score =  345 bits (886), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 153/326 (46%), Positives = 229/326 (70%), Gaps = 3/326 (0%)

Query: 2   VRTSIKEFLEKNPREVLVLDGGQGTELENRGIKVANPVWSTIPFISESFWSAEDQSSKDR 61
           +R  I+E +   P EVLV DGG GT LE+RGI V++P+WST+PF+ + FW +E ++S DR
Sbjct: 1   MRVPIEELIRNQPDEVLVSDGGLGTLLESRGINVSSPLWSTVPFLKDDFWDSETKTS-DR 59

Query: 62  QIVKEMYSDFLKAGARVLMTVTYQASFKSVSENTRIKTLEEYDSLLNRIVTFSRECIGDD 121
            I++ +Y D++ +G+R+L T+TYQ SF  +S +T +KT+E Y  L+  I +F R  IG+D
Sbjct: 60  NIIEGIYRDYITSGSRILSTITYQTSFALISTHTEVKTIEGYKQLIRNITSFCRSAIGED 119

Query: 122 KFLVGCIGAWGAHNCSEFTGDYGAEPEKIDFLQYFKPQLDNFTNNENIDLIGFETIPNIH 181
            +L+G IG +GA   +E+TG+YG  P  I++L+YFKPQL+ F NN++ID+IGFET+PN +
Sbjct: 120 NYLIGSIGPFGARLGAEYTGNYGDSPSNINYLEYFKPQLEEFNNNDDIDIIGFETVPNKY 179

Query: 182 ELRAILSWDESIINKPFYIGLSVHENGLLRDGTTMHQVAELIKSFGDRLNPNFTLLGINC 241
           EL AILSWD+S+I+KP+Y+ LS+ +NG LRDGT+  ++A + K + +  N N  L G NC
Sbjct: 180 ELEAILSWDKSVISKPYYVSLSLLDNGGLRDGTSFEEIATIFKKYSN--NDNLILTGANC 237

Query: 242 VSYNQSHDILRSLHEELPEMPLIAYPNSGEVYDTVKKIWNPKNSQTLSWEQIVKSYIDSG 301
           +S+  + + +  LH+ +P +PLI YPNSGE+YD + K W    +  L+WE ++K    S 
Sbjct: 238 ISFKYASENISKLHQAIPTLPLIVYPNSGEIYDPLTKKWTIDQTFGLTWEDLIKELRTSN 297

Query: 302 ARIIGGCCRTSPKDIEAIHEAVQKYR 327
            RI+GGCCRT+P DI  I + + K +
Sbjct: 298 VRIVGGCCRTTPDDINKIKDMITKVK 323

>ZYRO0G14212g Chr7 (1133202..1134179) [978 bp, 325 aa] {ON} similar
           to uniprot|Q12525 Saccharomyces cerevisiae YLL062C MHT1
           S-methylmethionine-homocysteine methyltransferase
          Length = 325

 Score =  342 bits (876), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 167/329 (50%), Positives = 224/329 (68%), Gaps = 10/329 (3%)

Query: 2   VRTSIKEFLEKNPREVLVLDGGQGTELENRGIKVANPVWSTIPFISESFWSAEDQSSKDR 61
           +R  + E L    R VLV+DGGQGTELENRG+ ++ P+WST+PF  E FW+  DQ   DR
Sbjct: 1   MRQQLLEVLRDTDR-VLVMDGGQGTELENRGMNISGPIWSTVPFTKEEFWNF-DQPYTDR 58

Query: 62  QIVKEMYSDFLKAGARVLMTVTYQASFKSVSENTRIKTLEEYDSLLNRIVTFSRECIGDD 121
            +V  M+  ++ AGA++L TVTYQ S+K++  +T I T  +YD LL+RIV F R CIGDD
Sbjct: 59  DVVNSMFKAYVDAGAQLLSTVTYQTSYKTICAHTDIHTRTQYDQLLDRIVGFCRRCIGDD 118

Query: 122 KFLVGCIGAWGAHNCSEFTGDYGAEPEKIDFLQYFKPQLDNFTNNENIDLIGFETIPNIH 181
            +LVG IG + AH  +E+TGDYG +PE+ID+ QYF+PQ+ NF  NE ID+IG ET+PN+H
Sbjct: 119 HYLVGSIGPYAAHVGAEYTGDYGPKPEEIDYWQYFEPQVANFNRNETIDIIGLETVPNVH 178

Query: 182 ELRAILSWDESIINKPFYIGLSVHENGLLRDGTTMHQVAELIKSFGDRLNPNFTLLGINC 241
           EL++ILSWDE+ I+KPFY+ L V ++G LRDGT + Q+  L   F +R N N  L+GINC
Sbjct: 179 ELKSILSWDETKISKPFYVSLCVGDDGNLRDGTPLEQLVPL---FANRSNKNLLLVGINC 235

Query: 242 VSYNQSHDILRSLHEELPEMP--LIAYPNSGEVYDTVKKIWNPK---NSQTLSWEQIVKS 296
            S + S   L  L+E L   P  L+ YPNSGE+YD   + W+     +S  LSW  +V+ 
Sbjct: 236 CSLSVSSQALSHLNEILASTPMGLLVYPNSGEIYDHKTQTWSRPTGLDSHRLSWPSLVQE 295

Query: 297 YIDSGARIIGGCCRTSPKDIEAIHEAVQK 325
           Y   GAR IGGCCRT+P DI+ I + V +
Sbjct: 296 YRKFGARAIGGCCRTTPLDIQEICKVVDR 324

>Skud_101.1 Chr101 complement(3..602) [600 bp, 200 aa] {ON} YPL273W
           (REAL)
          Length = 200

 Score =  329 bits (843), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 150/200 (75%), Positives = 177/200 (88%)

Query: 80  MTVTYQASFKSVSENTRIKTLEEYDSLLNRIVTFSRECIGDDKFLVGCIGAWGAHNCSEF 139
           MT TYQ S+KSVSENT IKTL EY++LL RIV FSR+CIG++K+L+GCIG WGAH C EF
Sbjct: 1   MTTTYQTSYKSVSENTPIKTLSEYNNLLTRIVDFSRDCIGENKYLIGCIGPWGAHICREF 60

Query: 140 TGDYGAEPEKIDFLQYFKPQLDNFTNNENIDLIGFETIPNIHELRAILSWDESIINKPFY 199
           TGDYG +PE IDF +YFKPQLDNF  N+ +DLIGFETIPN+HELRAILSWDESI++KPFY
Sbjct: 61  TGDYGPDPESIDFYEYFKPQLDNFNKNDKLDLIGFETIPNVHELRAILSWDESILSKPFY 120

Query: 200 IGLSVHENGLLRDGTTMHQVAELIKSFGDRLNPNFTLLGINCVSYNQSHDILRSLHEELP 259
           IGLSVHE+G+LRDGTTM +VA++IK  GD++NPNF+LLGINCVS+NQS DIL SLH+ LP
Sbjct: 121 IGLSVHEHGVLRDGTTMEEVAKVIKGLGDKINPNFSLLGINCVSFNQSPDILESLHQALP 180

Query: 260 EMPLIAYPNSGEVYDTVKKI 279
           +M L+AYPNSGEVYDT KKI
Sbjct: 181 DMALLAYPNSGEVYDTEKKI 200

>Skud_100.1 Chr100 complement(3..602) [600 bp, 200 aa] {ON} YPL273W
           (REAL)
          Length = 200

 Score =  325 bits (833), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 149/200 (74%), Positives = 175/200 (87%)

Query: 80  MTVTYQASFKSVSENTRIKTLEEYDSLLNRIVTFSRECIGDDKFLVGCIGAWGAHNCSEF 139
           MT TYQ S+KSVSENT IKTL EY++LL RIV FSR CIG+DK+L+GCIG WGAH C EF
Sbjct: 1   MTTTYQTSYKSVSENTPIKTLSEYNNLLTRIVDFSRVCIGEDKYLIGCIGPWGAHICCEF 60

Query: 140 TGDYGAEPEKIDFLQYFKPQLDNFTNNENIDLIGFETIPNIHELRAILSWDESIINKPFY 199
           TGDYG +P+ IDF +YFKPQLDNF  ++ +DLIGFETIPN+HELRAILSWDESI++KPFY
Sbjct: 61  TGDYGPDPQSIDFYKYFKPQLDNFNKSDKLDLIGFETIPNVHELRAILSWDESILSKPFY 120

Query: 200 IGLSVHENGLLRDGTTMHQVAELIKSFGDRLNPNFTLLGINCVSYNQSHDILRSLHEELP 259
           IGLSVHE+G+LRDGTTM +VA++IK  GD++NPNF+LLGINCVS+NQS DIL SLH+ LP
Sbjct: 121 IGLSVHEHGVLRDGTTMEEVAKVIKGLGDKINPNFSLLGINCVSFNQSPDILESLHQVLP 180

Query: 260 EMPLIAYPNSGEVYDTVKKI 279
            M L+AYPNSGEVYDT KKI
Sbjct: 181 NMALLAYPNSGEVYDTEKKI 200

>SAKL0D09306g Chr4 (771565..772545) [981 bp, 326 aa] {ON} similar to
           uniprot|Q12525 Saccharomyces cerevisiae YLL062C MHT1
           S-methylmethionine-homocysteine methyltransferase
          Length = 326

 Score =  284 bits (727), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 151/338 (44%), Positives = 215/338 (63%), Gaps = 26/338 (7%)

Query: 1   MVRTSIKEFLEKNPREVLVLDGGQGTELENRGIKVANPVWSTIPFISESFWSAEDQSSKD 60
           M R  I E+LE +   +LVLDGGQGTE+E RGI V +P+WST+PFI         ++   
Sbjct: 1   MRRQPIAEYLESS---ILVLDGGQGTEMERRGIDVIHPLWSTLPFIK--------KNPTH 49

Query: 61  RQIVKEMYSDFLKAGARVLMTVTYQASFKSVSE--NTRIKTLEEYDSLLNRIVTFSR-EC 117
              +K MY DF  +GAR L T+TYQASF ++ +  + ++ T ++Y   LN I+ F+R +C
Sbjct: 50  LNHIKGMYHDFSTSGARALSTITYQASFATLKQYSDGQVVTEQQYQQFLNDIIGFTRDQC 109

Query: 118 IGDDKFLVGCIGAWGAHNC--SEFTGDYGAEPEKIDFLQYFKPQLDNFTNNENIDLIGFE 175
           I D ++L+GC+G + A+ C  +E++GDYG+E  KIDF QYFKPQLD F+ ++ ID++GFE
Sbjct: 110 ISDSQYLIGCVGPYAAYLCNGAEYSGDYGSE--KIDFKQYFKPQLDVFSRDDRIDMVGFE 167

Query: 176 TIPNIHELRAILSWDESII--NKPFYIGLSVHENGLLRDGTTMHQVAELIKSFGDRLNPN 233
           TIPNI EL+ +LS D + +   KPFYI +S   NG LRDGT + ++ E IK       PN
Sbjct: 168 TIPNIEELKTLLSKDFTSMLGTKPFYISISTDSNGNLRDGTPVAKICETIKDADKSTPPN 227

Query: 234 FTLLGINCVSYNQSHDILRSLHEELPE----MPLIAYPNSGEVYDTVKKIW--NPKNSQT 287
              LGINCV Y+ S++IL  L+  L +    +    YPNSGE+YD     W  N + +  
Sbjct: 228 LLFLGINCVDYHHSYNILSRLNGGLGDDCSLLFKAVYPNSGEIYDGNTHTWHTNSEIAPE 287

Query: 288 LSWEQIVKSYIDSGARIIGGCCRTSPKDIEAIHEAVQK 325
           L+W  +V  + +   ++IGGCCRT+P DI+ I +AV K
Sbjct: 288 LTWNYLVSKFAEQKCQLIGGCCRTTPDDIKQIADAVNK 325

>Kwal_0.322 s0 (152442..153440) [999 bp, 332 aa] {ON} YLL062C (MHT1)
           - S-methylmethionine:homocysteine S-methyltransferase
           [contig 86] FULL
          Length = 332

 Score =  244 bits (622), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 133/338 (39%), Positives = 198/338 (58%), Gaps = 29/338 (8%)

Query: 2   VRTSIKEFLEKNPREVLVLDGGQGTELENRGIKVANPVWSTIPFISESFWSAEDQSSKDR 61
           +R  ++E+L+    E+L+LDGGQGTELE RGI +A+P+WST+P+++        +  K  
Sbjct: 1   MRLQLEEYLK---HEILLLDGGQGTELEKRGINIAHPLWSTLPYVT--------KDKKHL 49

Query: 62  QIVKEMYSDFLKAGARVLMTVTYQASFKSVSENTR--IKTLEEYDSLLNRIVTFSR-ECI 118
           +I+KEMYS F  AG   LMT+TYQASF S+  ++   I   +EY   L+ ++ ++  +CI
Sbjct: 50  KIIKEMYSAFESAGCNALMTITYQASFLSMKNHSDGLINNEKEYTRFLDYVIDYTENQCI 109

Query: 119 GDDKFLVGCIGAWGAH--NCSEFTGDYGAEPEKIDFLQYFKPQLDNFTNNENIDLIGFET 176
             + +LVG +G + A+  N +E++G Y  +   IDF+++F+PQ+ +F  +  IDLIG ET
Sbjct: 110 SPNSYLVGSVGPYAAYLSNGAEYSGHYIED--NIDFIEFFRPQVQHFAVSSRIDLIGIET 167

Query: 177 IPNIHELRAILSWDESIIN--KPFYIGLSVHENGLLRDGTTMHQVAELIKSFGDRLNPNF 234
           IPN  E +A+L  + S +   KP+YI ++    G LRDGT    + E IK     L PN 
Sbjct: 168 IPNFEEFKALLRPEFSRLCALKPYYISITTDNEGNLRDGTARQDICETIKRSAQDLPPNL 227

Query: 235 TLLGINCVSYNQSHDILRSLHEELPEMPL-------IAYPNSGEVYDTVKKIW--NPKNS 285
              GINCVS+    DIL+ L++ L ++ +         YPNSGEVY      W  NP+  
Sbjct: 228 VFFGINCVSFAHCADILKLLNDSLDDIGVENRLRFRAVYPNSGEVYHGDTHSWGPNPEIG 287

Query: 286 QTLSWEQIVKSYIDSGARIIGGCCRTSPKDIEAIHEAV 323
              +WE +    +  G  +IGGCCRTSP D+  I   V
Sbjct: 288 PADTWENLASKVVQQGCLMIGGCCRTSPADLRQIASVV 325

>AFR410W Chr6 (1171334..1172446) [1113 bp, 370 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YPL273W (SAM4)
          Length = 370

 Score =  244 bits (623), Expect = 5e-78,   Method: Compositional matrix adjust.
 Identities = 131/333 (39%), Positives = 202/333 (60%), Gaps = 24/333 (7%)

Query: 2   VRTSIKEFLEKNPREVLVLDGGQGTELENRGIKVANPVWSTIPFISESFWSAEDQSSKDR 61
            + +I EFLE+N   VLV+DGG G ELE RG+ V +P+WST PF+        D+++ D 
Sbjct: 47  AKCAITEFLERN---VLVMDGGMGVELERRGMDVKSPLWSTAPFLRG------DRAALD- 96

Query: 62  QIVKEMYSDFLKAGARVLMTVTYQASFKS-VSENTRIKTLEEYDSLLNRIVTFS-RECIG 119
             ++ +Y +F  AG+R + T+TYQASF S V  +  + +  +Y+  L ++V F+ REC+ 
Sbjct: 97  -TIRGLYREFRAAGSRGISTLTYQASFHSMVKYSGSVSSRADYEKFLEQVVDFTYRECVD 155

Query: 120 DDK-FLVGCIGAWGAHNC--SEFTGDYGAEPEKIDFLQYFKPQLDNFTNNENIDLIGFET 176
             + +++G +G + A  C  +E+TGDYG E   I+F  YF+PQ+  F  +  ID I FET
Sbjct: 156 PARDYIIGSVGPYAAFLCNGAEYTGDYGFE--TINFFNYFEPQVSKFATDPRIDAIAFET 213

Query: 177 IPNIHELRAILS--WDESIINKPFYIGLSVHENGLLRDGTTMHQVAELIKSFGDRLNPNF 234
           +PN+ EL A+L   +   + NKPFYI +S  +  +LRDGT +  V +LI+   D L PN 
Sbjct: 214 VPNVVELMAMLQPEFHALLKNKPFYISISAKDEHVLRDGTPLAVVGQLIRERMDDLPPNL 273

Query: 235 TLLGINCVSYNQSHDILRSLHEELPEMPL---IAYPNSGEVYDTVKKIWNP-KNSQTLSW 290
              G+NCV   +S  +L  L+ +L + P+     YPN   V+D     W P K++++L+W
Sbjct: 274 LCFGLNCVDLTRSAAMLAELNMQLQDCPIKFQAIYPNGTSVFDESLSAWRPSKDAESLTW 333

Query: 291 EQIVKSYIDSGARIIGGCCRTSPKDIEAIHEAV 323
            + VK Y++   R+IGGCC T+P+D+  I EA+
Sbjct: 334 AEAVKLYLNQDCRMIGGCCGTTPQDMRQIAEAL 366

>KLTH0H12716g Chr8 (1079836..1080882) [1047 bp, 348 aa] {ON} similar
           to uniprot|Q12525 Saccharomyces cerevisiae YLL062C MHT1
           S-methylmethionine-homocysteine methyltransferase
          Length = 348

 Score =  239 bits (610), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 133/341 (39%), Positives = 203/341 (59%), Gaps = 31/341 (9%)

Query: 2   VRTSIKEFLEKNPREVLVLDGGQGTELENRGIKVANPVWSTIPFISESFWSAEDQSSKDR 61
           +R  +KEF + N   +L+LDGGQGTELE +G+ +++P+WST+PFI         ++    
Sbjct: 1   MRKPLKEFFKNN---ILLLDGGQGTELEKKGVSISHPLWSTLPFII--------KNKTHL 49

Query: 62  QIVKEMYSDFLKAGARVLMTVTYQASFKSVSENTR--IKTLEEYDSLLNRIVTFS-RECI 118
           + +KEMY DF +AG+  LMT+TYQASF S+ + +   + + E+Y + L+ ++ F+ RECI
Sbjct: 50  EAIKEMYRDFAEAGSNALMTITYQASFSSMKKYSEGLVNSEEDYAAFLDYVIGFTDRECI 109

Query: 119 GDDKFLVGCIGAWGA--HNCSEFTGDYGAEPEKIDFLQYFKPQLDNFTNNENIDLIGFET 176
             DK+LVG +G +     N +E++G YG    KIDF+ Y+ PQ+ +F  +  IDLIG ET
Sbjct: 110 TPDKYLVGSVGPYAGLLSNGAEYSGYYGEG--KIDFIDYYSPQVKHFALSPRIDLIGIET 167

Query: 177 IPNIHELRAILSWDESIIN--KPFYIGLSVHENGLLRDGTTMHQVAELIKSFGDRLNPNF 234
           IPNI E +A+LS + S ++  KP+YI ++   NG LRDGT+++++   IK     L  NF
Sbjct: 168 IPNIDEFKALLSPEFSRLSFSKPYYISVTTDNNGCLRDGTSLNEICRAIKQSASLLPDNF 227

Query: 235 TLLGINCVSYNQSHDILRSLHEELPEMPLI--------AYPNSGEVYDTVKKIW--NPKN 284
               INCV +    +IL+SL++ L EM  +        AYPNSGE+Y      W  NP  
Sbjct: 228 VFFAINCVEFLHCVEILQSLNDCL-EMQGVDRRFRFRGAYPNSGEIYHGGTHSWSSNPYA 286

Query: 285 SQTLSWEQIVKSYIDSGARIIGGCCRTSPKDIEAIHEAVQK 325
               +WE +    +     ++GGCCRT  ++I  +    +K
Sbjct: 287 GPEDTWENLTLGLLSQECLMLGGCCRTGSEEIRQMALTTKK 327

>YMR321C Chr13 complement(917579..917896) [318 bp, 105 aa] {ON}
           Putative protein of unknown function; proposed to be a
           palmitoylated membrane protein
          Length = 105

 Score =  154 bits (388), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 69/101 (68%), Positives = 81/101 (80%)

Query: 226 FGDRLNPNFTLLGINCVSYNQSHDILRSLHEELPEMPLIAYPNSGEVYDTVKKIWNPKNS 285
            GD++NPN + LGINCVS+NQS DIL SLH+ LP M L+AYPNSGEVYDT KKIW P + 
Sbjct: 4   LGDKINPNLSFLGINCVSFNQSPDILESLHQALPNMALLAYPNSGEVYDTEKKIWLPNSD 63

Query: 286 QTLSWEQIVKSYIDSGARIIGGCCRTSPKDIEAIHEAVQKY 326
           +  SW+ +VK YI SGARIIGGCCRTSPKDI+ I  AV+KY
Sbjct: 64  KLNSWDTVVKQYISSGARIIGGCCRTSPKDIQEISAAVKKY 104

>Skud_47.2 Chr47 (1368..1655) [288 bp, 96 aa] {ON} YPL273W (REAL)
          Length = 96

 Score =  151 bits (381), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 73/98 (74%), Positives = 85/98 (86%), Gaps = 2/98 (2%)

Query: 1  MVRTSIKEFLEKNPREVLVLDGGQGTELENRGIKVANPVWSTIPFISESFWSAEDQSSKD 60
          MVR  +K+ LE NP++VLVLDGGQGTELENRGIKVANPVWSTIPFIS+SFWS  D+SS +
Sbjct: 1  MVRLPLKQLLEDNPKKVLVLDGGQGTELENRGIKVANPVWSTIPFISDSFWS--DESSAN 58

Query: 61 RQIVKEMYSDFLKAGARVLMTVTYQASFKSVSENTRIK 98
          R+IVK M++DFL AGA +LMT TYQ S+KSVSENT IK
Sbjct: 59 RKIVKGMFNDFLNAGAEILMTTTYQTSYKSVSENTPIK 96

>TDEL0B03520 Chr2 complement(626658..631046) [4389 bp, 1462 aa] {ON}
            Anc_8.758 YOR291W
          Length = 1462

 Score = 32.3 bits (72), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 36/75 (48%), Gaps = 11/75 (14%)

Query: 250  ILRSLH--EELPEMPLIAYPNSGEVY--------DTVKKIWNPKNSQTLSWEQIVKSYID 299
            I+RS     EL  M +I  PNS  VY        + + +I N K++    ++ ++  Y  
Sbjct: 927  IIRSFEFLSELRRMSVIVKPNSDNVYWSFTKGAPEVIAEICN-KSTLPKDYDSVLHHYTH 985

Query: 300  SGARIIGGCCRTSPK 314
            SG R+I    +T PK
Sbjct: 986  SGYRVIACAGKTLPK 1000

>YAL017W Chr1 (120225..124295) [4071 bp, 1356 aa] {ON}  PSK1One of
           two (see also PSK2) PAS domain containing S/T protein
           kinases; coordinately regulates protein synthesis and
           carbohydrate metabolism and storage in response to a
           unknown metabolite that reflects nutritional status
          Length = 1356

 Score = 31.6 bits (70), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 17/35 (48%), Positives = 19/35 (54%), Gaps = 2/35 (5%)

Query: 134 HNCSEFTGDYG--AEPEKIDFLQYFKPQLDNFTNN 166
           HN S F GDYG    PE+  F Q FK Q  N  N+
Sbjct: 272 HNNSLFRGDYGNNISPERPSFRQPFKDQTSNLRNS 306

>SAKL0H01980g Chr8 complement(195237..196715) [1479 bp, 492 aa] {ON}
           similar to uniprot|Q756H4 Ashbya gossypii AER292C
           AER292Cp and some similarities with YHR176W
           uniprot|P38866 Saccharomyces cerevisiae YHR176W FMO1
           Flavin-containing monooxygenase localized to the
           cytoplasmic face of the ER membrane catalyzes oxidation
           of biological thiols to maintain the ER redox buffer
           ratio for correct folding of disulfide-bonded proteins
          Length = 492

 Score = 31.2 bits (69), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 15/51 (29%), Positives = 30/51 (58%)

Query: 17  VLVLDGGQGTELENRGIKVANPVWSTIPFISESFWSAEDQSSKDRQIVKEM 67
           V+V +G  GT++ N+   VAN V+ ++  +S++ WS ++       ++KE 
Sbjct: 251 VVVGNGSSGTDIANQLSTVANKVFHSVTDVSKTDWSGKNPIVTAVSVIKEF 301

>NCAS0G00710 Chr7 complement(120375..121310) [936 bp, 311 aa] {ON}
           Anc_5.630 YOR036W
          Length = 311

 Score = 30.8 bits (68), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 29/109 (26%), Positives = 46/109 (42%), Gaps = 15/109 (13%)

Query: 200 IGLSVHENGLLRDGTTMHQVAELIKSFGD------RLNPNFTLLGINCVSYNQSHDILRS 253
           I   V EN + R  T +H V  L+K   D       L+PN     ++ V   Q   ++R 
Sbjct: 80  IRTKVVENVIKRASTNIHNVNSLMKQCNDVVQRIDSLDPN----ELDKVQIIQREKLVRD 135

Query: 254 LHEELPEMPLIAYPNSGEVYDTVKKIWNPKNSQTLSWEQIVKSYIDSGA 302
           +   + E     +  + + Y  + K  N KN   L  +Q VK+Y D  +
Sbjct: 136 VRYSINE-----FQETQKEYTQLVKSINDKNKSALLQDQSVKNYTDDDS 179

>Suva_8.340 Chr8 (601862..606280) [4419 bp, 1472 aa] {ON} YOR291W
            (REAL)
          Length = 1472

 Score = 30.8 bits (68), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 43/88 (48%), Gaps = 14/88 (15%)

Query: 240  NCVSYNQSHDIL---RSLH--EELPEMPLIAYPNSGEVY--------DTVKKIWNPKNSQ 286
            N  + N  H+ L   RS     EL  M +I  PN+ ++Y        + + +I N K++ 
Sbjct: 915  NTFTDNDPHNFLGVVRSFEFLSELRRMSVIVKPNNEDIYWSFTKGAPEVISEICN-KSTL 973

Query: 287  TLSWEQIVKSYIDSGARIIGGCCRTSPK 314
               +E++++SY  +G R+I    +T  K
Sbjct: 974  PADFEEVLRSYTHNGYRVIACAGKTLSK 1001

>NCAS0G02040 Chr7 complement(367514..370882) [3369 bp, 1122 aa] {ON}
           Anc_2.92 YNL163C
          Length = 1122

 Score = 30.8 bits (68), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 19/66 (28%), Positives = 37/66 (56%), Gaps = 4/66 (6%)

Query: 56  QSSKDRQIVKEMYSDFLKAGARVLMTVTYQASFKSVSENTRIKTL--EEYD--SLLNRIV 111
           +S  D+Q++K +   +L     VL+TV  +      S+ TR++T+  EE+D  S+  +++
Sbjct: 337 RSKDDKQLLKTIMGQWLPVSTAVLLTVIEKLPSPLNSQETRLETILGEEHDPTSMDPKLL 396

Query: 112 TFSREC 117
              +EC
Sbjct: 397 AAMKEC 402

>CAGL0B02387g Chr2 complement(228209..229624) [1416 bp, 471 aa] {ON}
           weakly similar to uniprot|Q03264 Saccharomyces
           cerevisiae YMR285c or uniprot|Q03210 Saccharomyces
           cerevisiae YML118w
          Length = 471

 Score = 30.4 bits (67), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 12/46 (26%), Positives = 24/46 (52%)

Query: 114 SRECIGDDKFLVGCIGAWGAHNCSEFTGDYGAEPEKIDFLQYFKPQ 159
           +R+C+   K ++   G      C  FTGD+ ++P  + +L   +P+
Sbjct: 243 TRQCLVIKKKILEFAGTVKGDYCKMFTGDFNSQPNSVPYLVLTQPR 288

>Kwal_14.927 s14 complement(117323..118180) [858 bp, 286 aa] {OFF}
           YKL014C - Protein required for cell viability [contig
           244] PARTIAL
          Length = 286

 Score = 30.4 bits (67), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 21/78 (26%), Positives = 33/78 (42%), Gaps = 3/78 (3%)

Query: 242 VSYNQSH---DILRSLHEELPEMPLIAYPNSGEVYDTVKKIWNPKNSQTLSWEQIVKSYI 298
           VS+N      D L      LP +P I  P   E+ D    + NP+ S   ++ Q   S+I
Sbjct: 145 VSFNHGQHVDDFLTYFTLSLPSLPRILAPTKAELADVSNVMKNPELSMRYNFIQFWLSFI 204

Query: 299 DSGARIIGGCCRTSPKDI 316
           ++ + I+     T    I
Sbjct: 205 ENASPILRKAILTENSQI 222

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.136    0.407 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 37,941,324
Number of extensions: 1727411
Number of successful extensions: 5007
Number of sequences better than 10.0: 54
Number of HSP's gapped: 5085
Number of HSP's successfully gapped: 54
Length of query: 329
Length of database: 53,481,399
Length adjustment: 110
Effective length of query: 219
Effective length of database: 40,868,139
Effective search space: 8950122441
Effective search space used: 8950122441
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 66 (30.0 bits)