Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_27.102468.842ON33933918280.0
KLTH0C03828g8.842ON40433816020.0
SAKL0D01430g8.842ON44733714360.0
ZYRO0G14234g8.842ON50934014390.0
KNAG0G034208.842ON51134014380.0
YML115C (VAN1)8.842ON53533814280.0
Suva_13.288.842ON53033814260.0
NCAS0B003008.842ON52333914250.0
KAFR0A028308.842ON50733914200.0
NDAI0E002908.842ON52234014090.0
TDEL0B005608.842ON50933814070.0
Smik_13.198.842ON53632814080.0
Skud_13.268.842ON53932814020.0
Kpol_541.158.842ON49833713920.0
KLLA0D01529g8.842ON50133813890.0
ABL124W8.842ON48534013860.0
Ecym_46138.842ON52434313810.0
CAGL0B02321g8.842ON51233313630.0
TBLA0B032708.842ON52034113420.0
TPHA0C047808.842ON52533813300.0
Ecym_35731.479ON4473389231e-122
KNAG0I003001.479ON4573389151e-120
KLTH0C03432g1.479ON4893389161e-120
Kwal_27.101571.479ON4763389131e-120
SAKL0D11792g1.479ON4833389091e-119
AFR357W1.479ON4343399011e-119
TBLA0B021701.479ON5723389111e-118
CAGL0L01331g1.479ON4473388931e-117
NCAS0G041101.479ON4943388921e-117
TPHA0O004301.479ON5483258931e-116
KLLA0E22155g1.479ON4503388841e-116
KAFR0I027701.479ON4553388841e-116
YEL036C (ANP1)1.479ON5003258871e-116
NDAI0B012501.479ON4463368821e-116
Smik_5.571.479ON4913258841e-115
Skud_5.541.479ON4913258831e-115
NDAI0G003401.479ON5043258841e-115
TDEL0C026001.479ON4623398791e-115
Suva_5.331.479ON4953258811e-115
Kpol_370.51.479ON6453258921e-115
ZYRO0F05170g1.479ON6083278801e-113
KLLA0E12849g8.500ON3923324577e-53
SAKL0H11110g8.500ON3933104454e-51
TDEL0B013708.500ON3963104421e-50
NDAI0E030208.500ON3963274403e-50
KAFR0H013908.500ON3983094369e-50
NCAS0C023308.500ON3933164351e-49
KNAG0A021508.500ON3963104341e-49
KLTH0E11616g8.500ON3943074315e-49
TBLA0H033408.500ON3933084307e-49
TPHA0L013708.500ON3923074297e-49
Smik_16.1868.500ON3953074272e-48
Suva_16.2658.500ON3953104254e-48
YPL050C (MNN9)8.500ON3953104244e-48
Skud_16.2328.500ON3953104228e-48
ZYRO0F08492g8.500ON3963074211e-47
Kwal_27.118648.500ON4533094232e-47
Kpol_1031.788.500ON3923124183e-47
CAGL0L12804g8.500ON3933104167e-47
Ecym_25508.500ON3903294123e-46
AGL259C8.500ON3893054081e-45
NCAS0B024408.500ON4003043634e-39
NDAI0C052508.500ON4023063592e-38
KNAG0A039908.500ON3573152387e-22
SAKL0H20438gsingletonON5652031612e-11
Suva_12.945.154ON51164722.1
Smik_13.4528.780ON43764703.5
CAGL0J04026g8.648ON119879694.6
YCR019W (MAK32)1.440ON363133685.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_27.10246
         (339 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_27.10246 s27 complement(260882..261901) [1020 bp, 339 aa] {...   708   0.0  
KLTH0C03828g Chr3 complement(334500..335714) [1215 bp, 404 aa] {...   621   0.0  
SAKL0D01430g Chr4 complement(113921..115264) [1344 bp, 447 aa] {...   557   0.0  
ZYRO0G14234g Chr7 (1134555..1136084) [1530 bp, 509 aa] {ON} simi...   558   0.0  
KNAG0G03420 Chr7 (733195..734730) [1536 bp, 511 aa] {ON} Anc_8.8...   558   0.0  
YML115C Chr13 complement(40187..41794) [1608 bp, 535 aa] {ON}  V...   554   0.0  
Suva_13.28 Chr13 complement(39946..41538) [1593 bp, 530 aa] {ON}...   553   0.0  
NCAS0B00300 Chr2 complement(35915..37418,37529..37596) [1572 bp,...   553   0.0  
KAFR0A02830 Chr1 (586557..588080) [1524 bp, 507 aa] {ON} Anc_8.8...   551   0.0  
NDAI0E00290 Chr5 complement(39735..41238,41371..41435) [1569 bp,...   547   0.0  
TDEL0B00560 Chr2 complement(107343..108872) [1530 bp, 509 aa] {O...   546   0.0  
Smik_13.19 Chr13 complement(36444..38054) [1611 bp, 536 aa] {ON}...   546   0.0  
Skud_13.26 Chr13 complement(39821..41440) [1620 bp, 539 aa] {ON}...   544   0.0  
Kpol_541.15 s541 (41403..42899) [1497 bp, 498 aa] {ON} (41403..4...   540   0.0  
KLLA0D01529g Chr4 complement(135998..137503) [1506 bp, 501 aa] {...   539   0.0  
ABL124W Chr2 (162889..164346) [1458 bp, 485 aa] {ON} Syntenic ho...   538   0.0  
Ecym_4613 Chr4 (1195057..1196631) [1575 bp, 524 aa] {ON} similar...   536   0.0  
CAGL0B02321g Chr2 (220222..221760) [1539 bp, 512 aa] {ON} simila...   529   0.0  
TBLA0B03270 Chr2 (762231..763793) [1563 bp, 520 aa] {ON} Anc_8.8...   521   0.0  
TPHA0C04780 Chr3 (1031751..1033328) [1578 bp, 525 aa] {ON} Anc_1...   516   0.0  
Ecym_3573 Chr3 complement(1085088..1086431) [1344 bp, 447 aa] {O...   360   e-122
KNAG0I00300 Chr9 complement(39873..41246) [1374 bp, 457 aa] {ON}...   357   e-120
KLTH0C03432g Chr3 complement(297214..298683) [1470 bp, 489 aa] {...   357   e-120
Kwal_27.10157 s27 complement(219928..221358) [1431 bp, 476 aa] {...   356   e-120
SAKL0D11792g Chr4 (979538..980989) [1452 bp, 483 aa] {ON} simila...   354   e-119
AFR357W Chr6 (1086069..1087373) [1305 bp, 434 aa] {ON} Syntenic ...   351   e-119
TBLA0B02170 Chr2 complement(499391..501109) [1719 bp, 572 aa] {O...   355   e-118
CAGL0L01331g Chr12 complement(151156..152499) [1344 bp, 447 aa] ...   348   e-117
NCAS0G04110 Chr7 (766896..768380) [1485 bp, 494 aa] {ON} Anc_1.479    348   e-117
TPHA0O00430 Chr15 (76318..77964) [1647 bp, 548 aa] {ON} Anc_1.47...   348   e-116
KLLA0E22155g Chr5 complement(1976362..1977714) [1353 bp, 450 aa]...   345   e-116
KAFR0I02770 Chr9 (559196..560563) [1368 bp, 455 aa] {ON} Anc_1.4...   345   e-116
YEL036C Chr5 complement(83050..84552) [1503 bp, 500 aa] {ON}  AN...   346   e-116
NDAI0B01250 Chr2 complement(293756..295096) [1341 bp, 446 aa] {O...   344   e-116
Smik_5.57 Chr5 complement(85152..86627) [1476 bp, 491 aa] {ON} Y...   345   e-115
Skud_5.54 Chr5 complement(81169..82644) [1476 bp, 491 aa] {ON} Y...   344   e-115
NDAI0G00340 Chr7 complement(56898..58412) [1515 bp, 504 aa] {ON}...   345   e-115
TDEL0C02600 Chr3 complement(450202..451590) [1389 bp, 462 aa] {O...   343   e-115
Suva_5.33 Chr5 complement(58480..59967) [1488 bp, 495 aa] {ON} Y...   343   e-115
Kpol_370.5 s370 (7329..9266) [1938 bp, 645 aa] {ON} (7329..9266)...   348   e-115
ZYRO0F05170g Chr6 (432802..434628) [1827 bp, 608 aa] {ON} simila...   343   e-113
KLLA0E12849g Chr5 complement(1138282..1139460) [1179 bp, 392 aa]...   180   7e-53
SAKL0H11110g Chr8 complement(957784..958965) [1182 bp, 393 aa] {...   176   4e-51
TDEL0B01370 Chr2 complement(242546..243736) [1191 bp, 396 aa] {O...   174   1e-50
NDAI0E03020 Chr5 complement(643198..644388) [1191 bp, 396 aa] {O...   174   3e-50
KAFR0H01390 Chr8 complement(258984..260180) [1197 bp, 398 aa] {O...   172   9e-50
NCAS0C02330 Chr3 complement(437234..438415) [1182 bp, 393 aa] {O...   172   1e-49
KNAG0A02150 Chr1 complement(187175..188365) [1191 bp, 396 aa] {O...   171   1e-49
KLTH0E11616g Chr5 (1035396..1036580) [1185 bp, 394 aa] {ON} high...   170   5e-49
TBLA0H03340 Chr8 (820028..821209) [1182 bp, 393 aa] {ON} Anc_8.5...   170   7e-49
TPHA0L01370 Chr12 (286001..287179) [1179 bp, 392 aa] {ON} Anc_8....   169   7e-49
Smik_16.186 Chr16 complement(336170..337357) [1188 bp, 395 aa] {...   169   2e-48
Suva_16.265 Chr16 complement(463836..465023) [1188 bp, 395 aa] {...   168   4e-48
YPL050C Chr16 complement(460779..461966) [1188 bp, 395 aa] {ON} ...   167   4e-48
Skud_16.232 Chr16 complement(424904..426091) [1188 bp, 395 aa] {...   167   8e-48
ZYRO0F08492g Chr6 (684329..685519) [1191 bp, 396 aa] {ON} highly...   166   1e-47
Kwal_27.11864 s27 (981923..983284) [1362 bp, 453 aa] {ON} YPL050...   167   2e-47
Kpol_1031.78 s1031 (197094..198272) [1179 bp, 392 aa] {ON} (1970...   165   3e-47
CAGL0L12804g Chr12 (1371568..1372749) [1182 bp, 393 aa] {ON} hig...   164   7e-47
Ecym_2550 Chr2 (1066925..1068097) [1173 bp, 390 aa] {ON} similar...   163   3e-46
AGL259C Chr7 complement(221445..222614) [1170 bp, 389 aa] {ON} S...   161   1e-45
NCAS0B02440 Chr2 complement(408198..409400) [1203 bp, 400 aa] {O...   144   4e-39
NDAI0C05250 Chr3 (1217841..1219049) [1209 bp, 402 aa] {ON} Anc_8...   142   2e-38
KNAG0A03990 Chr1 complement(535490..536563) [1074 bp, 357 aa] {O...    96   7e-22
SAKL0H20438g Chr8 (1793911..1793929,1794594..1796272) [1698 bp, ...    67   2e-11
Suva_12.94 Chr12 (139444..140979) [1536 bp, 511 aa] {ON} YJR010W...    32   2.1  
Smik_13.452 Chr13 complement(734312..735625) [1314 bp, 437 aa] {...    32   3.5  
CAGL0J04026g Chr10 complement(379502..383098) [3597 bp, 1198 aa]...    31   4.6  
YCR019W Chr3 (152837..153928) [1092 bp, 363 aa] {ON}  MAK32Prote...    31   5.4  

>Kwal_27.10246 s27 complement(260882..261901) [1020 bp, 339 aa] {ON}
           YML115C (VAN1) - mannosyltransferase [contig 38] FULL
          Length = 339

 Score =  708 bits (1828), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 339/339 (100%), Positives = 339/339 (100%)

Query: 1   MVPLRNAQKVLPLMFKNLMNLTYPHELIDLAFLVSDCSEDDRTFEALLEYAKELQSGTLS 60
           MVPLRNAQKVLPLMFKNLMNLTYPHELIDLAFLVSDCSEDDRTFEALLEYAKELQSGTLS
Sbjct: 1   MVPLRNAQKVLPLMFKNLMNLTYPHELIDLAFLVSDCSEDDRTFEALLEYAKELQSGTLS 60

Query: 61  QVFASHNSGENVLREEGSSDLFLKYMRPSYLKMVKDAFTPPFHKNYDKPFRSVQIFQKNF 120
           QVFASHNSGENVLREEGSSDLFLKYMRPSYLKMVKDAFTPPFHKNYDKPFRSVQIFQKNF
Sbjct: 61  QVFASHNSGENVLREEGSSDLFLKYMRPSYLKMVKDAFTPPFHKNYDKPFRSVQIFQKNF 120

Query: 121 GQVIGQTFSDRHAVKVQGTRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIED 180
           GQVIGQTFSDRHAVKVQGTRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIED
Sbjct: 121 GQVIGQTFSDRHAVKVQGTRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIED 180

Query: 181 LMATGYDVTVPNVWRPLPEFLSGEQAYDLNSWVESDIALDLAKQLDEDDVIVEGYAEYPT 240
           LMATGYDVTVPNVWRPLPEFLSGEQAYDLNSWVESDIALDLAKQLDEDDVIVEGYAEYPT
Sbjct: 181 LMATGYDVTVPNVWRPLPEFLSGEQAYDLNSWVESDIALDLAKQLDEDDVIVEGYAEYPT 240

Query: 241 WRVHLGYIREEDGDPKSTIDLDGVGGVSILAKAQLFRNGVHFPAFTFENHAETEAFGKMA 300
           WRVHLGYIREEDGDPKSTIDLDGVGGVSILAKAQLFRNGVHFPAFTFENHAETEAFGKMA
Sbjct: 241 WRVHLGYIREEDGDPKSTIDLDGVGGVSILAKAQLFRNGVHFPAFTFENHAETEAFGKMA 300

Query: 301 KKMGYSVAGLPHYTLWHIYEPSDDDLIQVRERERESKRQ 339
           KKMGYSVAGLPHYTLWHIYEPSDDDLIQVRERERESKRQ
Sbjct: 301 KKMGYSVAGLPHYTLWHIYEPSDDDLIQVRERERESKRQ 339

>KLTH0C03828g Chr3 complement(334500..335714) [1215 bp, 404 aa] {ON}
           similar to uniprot|P23642 Saccharomyces cerevisiae
           YML115C VAN1 Mannosyltransferase with a role in protein
           N- glycosylation
          Length = 404

 Score =  621 bits (1602), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/338 (85%), Positives = 314/338 (92%)

Query: 1   MVPLRNAQKVLPLMFKNLMNLTYPHELIDLAFLVSDCSEDDRTFEALLEYAKELQSGTLS 60
           +VPLRNA++VLPLMFKNLMNLTYPHELIDLAFLVSDCSEDD+T EALLEY KELQSGTLS
Sbjct: 66  LVPLRNAEQVLPLMFKNLMNLTYPHELIDLAFLVSDCSEDDKTLEALLEYCKELQSGTLS 125

Query: 61  QVFASHNSGENVLREEGSSDLFLKYMRPSYLKMVKDAFTPPFHKNYDKPFRSVQIFQKNF 120
            VFA+H+S E +++E+G+ DLFLKYMRPSYLKMVKDA++PPFHK YDKPFRSVQIFQK+F
Sbjct: 126 DVFAAHSSDEELIKEKGTHDLFLKYMRPSYLKMVKDAYSPPFHKGYDKPFRSVQIFQKDF 185

Query: 121 GQVIGQTFSDRHAVKVQGTRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIED 180
           GQ+IGQ FSDRHAVKVQG RRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVI+D
Sbjct: 186 GQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIQD 245

Query: 181 LMATGYDVTVPNVWRPLPEFLSGEQAYDLNSWVESDIALDLAKQLDEDDVIVEGYAEYPT 240
           LM+T +DV VPNVWRPLPEFL GEQ YDLNSW+ESD AL LA+ LDEDDVIVEGYAEYPT
Sbjct: 246 LMSTDFDVAVPNVWRPLPEFLQGEQPYDLNSWIESDPALQLAQTLDEDDVIVEGYAEYPT 305

Query: 241 WRVHLGYIREEDGDPKSTIDLDGVGGVSILAKAQLFRNGVHFPAFTFENHAETEAFGKMA 300
           WRVHL Y+R+ D +PK  I+LDGVGGVSILAKA+LFRNGVHFPAFTFENHAETEAFGKMA
Sbjct: 306 WRVHLAYLRDPDSNPKDIIELDGVGGVSILAKAKLFRNGVHFPAFTFENHAETEAFGKMA 365

Query: 301 KKMGYSVAGLPHYTLWHIYEPSDDDLIQVRERERESKR 338
           KKMGY VAGLPHYTLWHIYEPSDDDLIQ+ ERERE KR
Sbjct: 366 KKMGYRVAGLPHYTLWHIYEPSDDDLIQIAEREREKKR 403

>SAKL0D01430g Chr4 complement(113921..115264) [1344 bp, 447 aa] {ON}
           similar to uniprot|P23642 Saccharomyces cerevisiae
           YML115C VAN1 Mannosyltransferase with a role in protein
           N- glycosylation
          Length = 447

 Score =  557 bits (1436), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 263/337 (78%), Positives = 288/337 (85%)

Query: 2   VPLRNAQKVLPLMFKNLMNLTYPHELIDLAFLVSDCSEDDRTFEALLEYAKELQSGTLSQ 61
           VPLRNA  VLPLMFK+LMNLTYPHELIDLAFLVSDCSEDD T +AL+ Y+KELQ+GTLS+
Sbjct: 110 VPLRNAGNVLPLMFKHLMNLTYPHELIDLAFLVSDCSEDDDTLDALIAYSKELQNGTLSE 169

Query: 62  VFASHNSGENVLREEGSSDLFLKYMRPSYLKMVKDAFTPPFHKNYDKPFRSVQIFQKNFG 121
           +FA  +        +GS DL+LKYM   YL MV+ AF PPFHK+YDKPFRSVQ+FQK+FG
Sbjct: 170 LFAEQDEMRRKASIKGSPDLYLKYMNQDYLNMVEMAFKPPFHKDYDKPFRSVQVFQKDFG 229

Query: 122 QVIGQTFSDRHAVKVQGTRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIEDL 181
           QVIGQ FSDRHAV VQG RRKLMGRARNWLTANALKPYHSWVYWRD D+ELCPGSVIEDL
Sbjct: 230 QVIGQGFSDRHAVTVQGIRRKLMGRARNWLTANALKPYHSWVYWRDVDIELCPGSVIEDL 289

Query: 182 MATGYDVTVPNVWRPLPEFLSGEQAYDLNSWVESDIALDLAKQLDEDDVIVEGYAEYPTW 241
           M+   DV VPNVWRPLPEFL GEQAYDLNSWVES  AL LA  LDEDDVIVEGYAEYPTW
Sbjct: 290 MSLNLDVAVPNVWRPLPEFLGGEQAYDLNSWVESGEALKLANTLDEDDVIVEGYAEYPTW 349

Query: 242 RVHLGYIREEDGDPKSTIDLDGVGGVSILAKAQLFRNGVHFPAFTFENHAETEAFGKMAK 301
           RVHLGYIR  D +P   +DLDGVGGVSILAKA+LFR GVHFPAFTFENHAETEAFGKMAK
Sbjct: 350 RVHLGYIRNPDANPYEILDLDGVGGVSILAKAKLFRAGVHFPAFTFENHAETEAFGKMAK 409

Query: 302 KMGYSVAGLPHYTLWHIYEPSDDDLIQVRERERESKR 338
           KM Y V GLPHYT+WHIYEPSDDDL ++ ++ERE +R
Sbjct: 410 KMHYRVGGLPHYTVWHIYEPSDDDLKEIAKKEREKRR 446

>ZYRO0G14234g Chr7 (1134555..1136084) [1530 bp, 509 aa] {ON} similar
           to uniprot|P23642 Saccharomyces cerevisiae YML115C VAN1
           Mannosyltransferase with a role in protein N-
           glycosylation
          Length = 509

 Score =  558 bits (1439), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 260/340 (76%), Positives = 296/340 (87%), Gaps = 2/340 (0%)

Query: 2   VPLRNAQKVLPLMFKNLMNLTYPHELIDLAFLVSDCSEDDRTFEALLEYAKELQSGTLSQ 61
           VPLR+A+KVLPLMFK+LMNLTYPHELIDLAFLVSDC+EDD+T +AL+ Y+++LQSGTLSQ
Sbjct: 170 VPLRDAEKVLPLMFKHLMNLTYPHELIDLAFLVSDCTEDDKTLDALIAYSRQLQSGTLSQ 229

Query: 62  VFASHNSGENVLR--EEGSSDLFLKYMRPSYLKMVKDAFTPPFHKNYDKPFRSVQIFQKN 119
           VFA  +          +G+  L+LKYM P YL+ VK++F+PPFH+NYDKPFRSVQ+FQK+
Sbjct: 230 VFADMDQAAAEAEQASKGTEKLYLKYMNPDYLETVKESFSPPFHENYDKPFRSVQVFQKD 289

Query: 120 FGQVIGQTFSDRHAVKVQGTRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIE 179
           FGQ+IGQ FSDRHAVKVQG RRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIE
Sbjct: 290 FGQMIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIE 349

Query: 180 DLMATGYDVTVPNVWRPLPEFLSGEQAYDLNSWVESDIALDLAKQLDEDDVIVEGYAEYP 239
           DLM+  YDV VPNVWRPLP+FL GEQ YDLNSW+ES  AL+LAK LDEDDVIVEGYAEYP
Sbjct: 350 DLMSKDYDVAVPNVWRPLPQFLDGEQPYDLNSWMESGEALNLAKTLDEDDVIVEGYAEYP 409

Query: 240 TWRVHLGYIREEDGDPKSTIDLDGVGGVSILAKAQLFRNGVHFPAFTFENHAETEAFGKM 299
           T+RVHL YIR+   DP   +DLDGVGGVSILAKA+LFR G+ FPAFTFENHAETE FGKM
Sbjct: 410 TYRVHLAYIRDPTQDPNEILDLDGVGGVSILAKAELFRRGIQFPAFTFENHAETEGFGKM 469

Query: 300 AKKMGYSVAGLPHYTLWHIYEPSDDDLIQVRERERESKRQ 339
           AKKMGY V GLPHYTLWHIYEPSDDDL ++  +ERES+R+
Sbjct: 470 AKKMGYRVGGLPHYTLWHIYEPSDDDLREIANKERESRRE 509

>KNAG0G03420 Chr7 (733195..734730) [1536 bp, 511 aa] {ON} Anc_8.842
           YML115C
          Length = 511

 Score =  558 bits (1438), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 254/340 (74%), Positives = 301/340 (88%), Gaps = 2/340 (0%)

Query: 2   VPLRNAQKVLPLMFKNLMNLTYPHELIDLAFLVSDCSEDDRTFEALLEYAKELQSGTLSQ 61
           VPLR+A++VLPLMFK+LMNLTYPHELID+AFLVSDCS+DD T EAL+ Y+++LQ+GTLSQ
Sbjct: 172 VPLRDAEEVLPLMFKHLMNLTYPHELIDVAFLVSDCSDDDNTLEALIAYSRQLQNGTLSQ 231

Query: 62  VFASHNSGENVL--REEGSSDLFLKYMRPSYLKMVKDAFTPPFHKNYDKPFRSVQIFQKN 119
           +F   ++  + L  ++  ++ L+LKYM+  YL  V+ AFTPP+H+NYDKPFRSVQIF+KN
Sbjct: 232 IFGEMDAVTDYLNAKDRKNNKLYLKYMKQEYLNKVEKAFTPPYHENYDKPFRSVQIFEKN 291

Query: 120 FGQVIGQTFSDRHAVKVQGTRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIE 179
           FGQ+IGQ FSDRHAVKVQG RRKLMGR+RNWLTANALKPYHSWVYWRDAD+ELCPGSVI+
Sbjct: 292 FGQIIGQGFSDRHAVKVQGIRRKLMGRSRNWLTANALKPYHSWVYWRDADIELCPGSVIQ 351

Query: 180 DLMATGYDVTVPNVWRPLPEFLSGEQAYDLNSWVESDIALDLAKQLDEDDVIVEGYAEYP 239
           D+MA  YDV VPNVWRPLPEFL+GEQ YDLNSW+ES  AL+LA+ LDEDDVIVEGYAEYP
Sbjct: 352 DMMAKDYDVLVPNVWRPLPEFLNGEQPYDLNSWMESPEALELAETLDEDDVIVEGYAEYP 411

Query: 240 TWRVHLGYIREEDGDPKSTIDLDGVGGVSILAKAQLFRNGVHFPAFTFENHAETEAFGKM 299
           TWRVHL YIR+E+GDP   +DLDGVGGVSILA+A+LFRNGV FPAFTFENHAETEAFGKM
Sbjct: 412 TWRVHLAYIRDEEGDPSEVVDLDGVGGVSILARAKLFRNGVQFPAFTFENHAETEAFGKM 471

Query: 300 AKKMGYSVAGLPHYTLWHIYEPSDDDLIQVRERERESKRQ 339
           A+K+G+ V GLPHYTLWHIYEPSDDDL ++  +ERE +R+
Sbjct: 472 ARKLGFRVGGLPHYTLWHIYEPSDDDLREIANKEREKRRE 511

>YML115C Chr13 complement(40187..41794) [1608 bp, 535 aa] {ON}
           VAN1Component of the mannan polymerase I, which contains
           Van1p and Mnn9p and is involved in the first steps of
           mannan synthesis; mutants are vanadate-resistant
          Length = 535

 Score =  554 bits (1428), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 258/338 (76%), Positives = 289/338 (85%), Gaps = 1/338 (0%)

Query: 2   VPLRNAQKVLPLMFKNLMNLTYPHELIDLAFLVSDCSEDDRTFEALLEYAKELQSGTLSQ 61
           +PLRNA  VLPLMFK+LMNLTYPHELIDLAFLVSDCSE D T +AL+ Y++ LQ+GTLSQ
Sbjct: 197 IPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSDCSEGDTTLDALIAYSRHLQNGTLSQ 256

Query: 62  VFASHNSGENVLREEGSSDLFLKYMRPSYLKMVKDAFTPPFHKNYDKPFRSVQIFQKNFG 121
           +F   ++  +  + +G+  L+LKYM   Y+  V  AF+PPFH+NYDKPFRSVQIFQK+FG
Sbjct: 257 IFQEIDAVIDS-QTKGTDKLYLKYMDEGYINRVHQAFSPPFHENYDKPFRSVQIFQKDFG 315

Query: 122 QVIGQTFSDRHAVKVQGTRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIEDL 181
           QVIGQ FSDRHAVKVQG RRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVI+DL
Sbjct: 316 QVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIQDL 375

Query: 182 MATGYDVTVPNVWRPLPEFLSGEQAYDLNSWVESDIALDLAKQLDEDDVIVEGYAEYPTW 241
           M+  YDV VPNVWRPLP FL  EQ YDLNSW+ES  AL LAK LDEDDVIVEGYAEYPTW
Sbjct: 376 MSKNYDVIVPNVWRPLPTFLGTEQPYDLNSWMESQEALALAKTLDEDDVIVEGYAEYPTW 435

Query: 242 RVHLGYIREEDGDPKSTIDLDGVGGVSILAKAQLFRNGVHFPAFTFENHAETEAFGKMAK 301
           RVHL YIR+ +GDP   +DLDGVGGVSILAKA++FRNGV FPAFTFENHAETEAFGKMAK
Sbjct: 436 RVHLAYIRDAEGDPNEAVDLDGVGGVSILAKAKIFRNGVQFPAFTFENHAETEAFGKMAK 495

Query: 302 KMGYSVAGLPHYTLWHIYEPSDDDLIQVRERERESKRQ 339
           KMGY V GLPHYT+WHIYEPSDDDL ++  RERE +RQ
Sbjct: 496 KMGYRVGGLPHYTIWHIYEPSDDDLKEIASREREKRRQ 533

>Suva_13.28 Chr13 complement(39946..41538) [1593 bp, 530 aa] {ON}
           YML115C (REAL)
          Length = 530

 Score =  553 bits (1426), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 257/338 (76%), Positives = 290/338 (85%), Gaps = 1/338 (0%)

Query: 2   VPLRNAQKVLPLMFKNLMNLTYPHELIDLAFLVSDCSEDDRTFEALLEYAKELQSGTLSQ 61
           +PLRNA  VLPLMFK+LMNLTYPHELIDLAFLVSDCSE D T +AL+ Y+++LQ+GTLS+
Sbjct: 193 IPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSDCSEGDTTLDALIAYSRQLQNGTLSE 252

Query: 62  VFASHNSGENVLREEGSSDLFLKYMRPSYLKMVKDAFTPPFHKNYDKPFRSVQIFQKNFG 121
           +F   ++  +  + +G+  L+LKYM   Y+  V  AF+PPFH NYDKPFRSVQ+FQK+FG
Sbjct: 253 IFQEIDAVIDS-QTKGTDKLYLKYMDEDYINRVHQAFSPPFHDNYDKPFRSVQVFQKDFG 311

Query: 122 QVIGQTFSDRHAVKVQGTRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIEDL 181
           QVIGQ FSDRHAVKVQG RRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVI+DL
Sbjct: 312 QVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIQDL 371

Query: 182 MATGYDVTVPNVWRPLPEFLSGEQAYDLNSWVESDIALDLAKQLDEDDVIVEGYAEYPTW 241
           M+  YDV VPNVWRPLP FL+ EQ YDLNSW+ES  ALDLAK LDEDDVIVEGYAEYPTW
Sbjct: 372 MSKNYDVIVPNVWRPLPTFLNSEQPYDLNSWMESGEALDLAKTLDEDDVIVEGYAEYPTW 431

Query: 242 RVHLGYIREEDGDPKSTIDLDGVGGVSILAKAQLFRNGVHFPAFTFENHAETEAFGKMAK 301
           RVHL YIR+  GDP   +DLDGVGGVSILAKA++FRNGV FPAFTFENHAETEAFGKMAK
Sbjct: 432 RVHLAYIRDAGGDPNEVVDLDGVGGVSILAKAKIFRNGVQFPAFTFENHAETEAFGKMAK 491

Query: 302 KMGYSVAGLPHYTLWHIYEPSDDDLIQVRERERESKRQ 339
           KMGY V GLPHYT+WHIYEPSDDDL ++  RERE +RQ
Sbjct: 492 KMGYRVGGLPHYTIWHIYEPSDDDLKEIATREREKRRQ 529

>NCAS0B00300 Chr2 complement(35915..37418,37529..37596) [1572 bp,
           523 aa] {ON} Anc_8.842
          Length = 523

 Score =  553 bits (1425), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 255/339 (75%), Positives = 291/339 (85%), Gaps = 2/339 (0%)

Query: 2   VPLRNAQKVLPLMFKNLMNLTYPHELIDLAFLVSDCSEDDRTFEALLEYAKELQSGTLSQ 61
           VPLR+A+ VLPLMFK+LMNLTYPHELIDLAFLVSDCSE DRT +ALL Y+K LQ+GTLSQ
Sbjct: 184 VPLRDAEHVLPLMFKHLMNLTYPHELIDLAFLVSDCSEGDRTLDALLAYSKHLQNGTLSQ 243

Query: 62  VFASHNSGE--NVLREEGSSDLFLKYMRPSYLKMVKDAFTPPFHKNYDKPFRSVQIFQKN 119
           VF   +  E  +  + +G+ +L LKYM P YLK+V  +F    H NYDKPFRS+Q+FQK+
Sbjct: 244 VFTEMDQYEMDHSKKSKGTKNLHLKYMNPDYLKLVDTSFKKRKHSNYDKPFRSIQVFQKD 303

Query: 120 FGQVIGQTFSDRHAVKVQGTRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIE 179
           FGQ+IGQ FSDRHAVKVQG RRKLMGRARNWL ANALKPYH+WVYWRDAD+ELCPGSVIE
Sbjct: 304 FGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLMANALKPYHAWVYWRDADIELCPGSVIE 363

Query: 180 DLMATGYDVTVPNVWRPLPEFLSGEQAYDLNSWVESDIALDLAKQLDEDDVIVEGYAEYP 239
           DLM+  YDV VPNVWRPLPEFL GEQ YDLNSW+ESD AL LAK LDEDDVIVEGYAEYP
Sbjct: 364 DLMSKDYDVIVPNVWRPLPEFLDGEQPYDLNSWIESDEALKLAKTLDEDDVIVEGYAEYP 423

Query: 240 TWRVHLGYIREEDGDPKSTIDLDGVGGVSILAKAQLFRNGVHFPAFTFENHAETEAFGKM 299
           TWRVHL YIR+  GDP   +DLDGVGGVSILAKA++FR+GV FPAFTFENHAETEAFGKM
Sbjct: 424 TWRVHLAYIRDAAGDPNEVVDLDGVGGVSILAKAKIFRSGVQFPAFTFENHAETEAFGKM 483

Query: 300 AKKMGYSVAGLPHYTLWHIYEPSDDDLIQVRERERESKR 338
           A+KMG+ V GLPHYT+WHIYEPSDDDL+++  +ER++KR
Sbjct: 484 ARKMGFRVGGLPHYTIWHIYEPSDDDLMEIANKERQNKR 522

>KAFR0A02830 Chr1 (586557..588080) [1524 bp, 507 aa] {ON} Anc_8.842
           YML115C
          Length = 507

 Score =  551 bits (1420), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 261/339 (76%), Positives = 292/339 (86%), Gaps = 5/339 (1%)

Query: 2   VPLRNAQKVLPLMFKNLMNLTYPHELIDLAFLVSDCSEDDRTFEALLEYAKELQSGTLSQ 61
           +PLR+A  VLPLMF++LMNLTYPHELIDLAFLVSDCSE+D T +AL+E++K LQ+GTLSQ
Sbjct: 172 IPLRDASHVLPLMFRHLMNLTYPHELIDLAFLVSDCSENDNTLDALIEFSKNLQNGTLSQ 231

Query: 62  VFASHNSGENVLREEGS--SDLFLKYMRPSYLKMVKDAFTPPFHKNYDKPFRSVQIFQKN 119
           V    N  +   +EE S  S+L LKYM P YLK V+ AF+PPFH++YDKPFRSVQIF+KN
Sbjct: 232 VL---NEIDAFTKEETSTKSNLHLKYMDPEYLKRVQKAFSPPFHEDYDKPFRSVQIFEKN 288

Query: 120 FGQVIGQTFSDRHAVKVQGTRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIE 179
           FGQ+IGQ FSDRHAVKVQG RRKLMGRARNWLTANALKPYHSWVYWRDAD+ELCPGSVIE
Sbjct: 289 FGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADIELCPGSVIE 348

Query: 180 DLMATGYDVTVPNVWRPLPEFLSGEQAYDLNSWVESDIALDLAKQLDEDDVIVEGYAEYP 239
           DLMA  YDV VPNVWRPLP FLSGEQ YDLNSW ES  AL LA+ LDEDDVIVEGYAEYP
Sbjct: 349 DLMAKDYDVIVPNVWRPLPAFLSGEQPYDLNSWRESAEALKLAQTLDEDDVIVEGYAEYP 408

Query: 240 TWRVHLGYIREEDGDPKSTIDLDGVGGVSILAKAQLFRNGVHFPAFTFENHAETEAFGKM 299
           TWRVHL YIR+  G+P   +D+DGVGGVSILAKA+LFR+GV FPAFTFENHAETEAFGKM
Sbjct: 409 TWRVHLAYIRDPQGNPDEVVDIDGVGGVSILAKAKLFRSGVQFPAFTFENHAETEAFGKM 468

Query: 300 AKKMGYSVAGLPHYTLWHIYEPSDDDLIQVRERERESKR 338
           AKKMGY V GLPHYTLWHIYEPSDDDL ++  +ERE +R
Sbjct: 469 AKKMGYKVGGLPHYTLWHIYEPSDDDLKEMANKEREERR 507

>NDAI0E00290 Chr5 complement(39735..41238,41371..41435) [1569 bp,
           522 aa] {ON} Anc_8.842
          Length = 522

 Score =  547 bits (1409), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 255/340 (75%), Positives = 289/340 (85%), Gaps = 2/340 (0%)

Query: 2   VPLRNAQKVLPLMFKNLMNLTYPHELIDLAFLVSDCSEDDRTFEALLEYAKELQSGTLSQ 61
           VPLR+A+ VLPLMFK+LMN+TYPHELIDLAFLVSDCS+ D T EALL+Y++ LQ+GTLSQ
Sbjct: 182 VPLRDAESVLPLMFKHLMNMTYPHELIDLAFLVSDCSDGDNTLEALLQYSRHLQNGTLSQ 241

Query: 62  VFASHN--SGENVLREEGSSDLFLKYMRPSYLKMVKDAFTPPFHKNYDKPFRSVQIFQKN 119
           VF   +    E+     G+ +L LKYM   YLKMV+ AF  P H+NYDKPFRSVQIF+K+
Sbjct: 242 VFQDMDEYQYEHSDDTRGTKNLHLKYMNQEYLKMVETAFNTPPHENYDKPFRSVQIFRKD 301

Query: 120 FGQVIGQTFSDRHAVKVQGTRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIE 179
           FGQVIGQ FSDRHAVKVQG RRKLMGRARNWL ANALKPYHSWVYWRDAD+ELCPG+++E
Sbjct: 302 FGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLMANALKPYHSWVYWRDADIELCPGTIVE 361

Query: 180 DLMATGYDVTVPNVWRPLPEFLSGEQAYDLNSWVESDIALDLAKQLDEDDVIVEGYAEYP 239
           D+MA  YDV VPNVWRPLPEFL  EQ YDLNSW+ESD AL LAK L EDDVIVEGYAEYP
Sbjct: 362 DMMANDYDVLVPNVWRPLPEFLDSEQPYDLNSWIESDEALKLAKTLPEDDVIVEGYAEYP 421

Query: 240 TWRVHLGYIREEDGDPKSTIDLDGVGGVSILAKAQLFRNGVHFPAFTFENHAETEAFGKM 299
           TWRVHL YIRE  GDP S +DLDGVGGVSILAKA+LFR+GVHFPAFTFENHAETE FGKM
Sbjct: 422 TWRVHLAYIREAQGDPTSVVDLDGVGGVSILAKAKLFRSGVHFPAFTFENHAETEGFGKM 481

Query: 300 AKKMGYSVAGLPHYTLWHIYEPSDDDLIQVRERERESKRQ 339
           AK+MGY V GLPHYT+WHIYEPSDDDL ++  +ER+S+ +
Sbjct: 482 AKRMGYRVGGLPHYTIWHIYEPSDDDLKEIANKERQSRHK 521

>TDEL0B00560 Chr2 complement(107343..108872) [1530 bp, 509 aa] {ON}
           Anc_8.842 YML115C
          Length = 509

 Score =  546 bits (1407), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 255/338 (75%), Positives = 291/338 (86%), Gaps = 1/338 (0%)

Query: 2   VPLRNAQKVLPLMFKNLMNLTYPHELIDLAFLVSDCSEDDRTFEALLEYAKELQSGTLSQ 61
           VPLR+A+ VLPLMFK+LMN+TYPHELIDLAFLVSDCSE D T +AL+ Y+++LQ+GTLSQ
Sbjct: 173 VPLRDAENVLPLMFKHLMNITYPHELIDLAFLVSDCSEGDHTLDALIAYSRQLQNGTLSQ 232

Query: 62  VFASHNSGENVLREEGSSDLFLKYMRPSYLKMVKDAFTPPFHKNYDKPFRSVQIFQKNFG 121
           VFA     E   R++G  +L+L+YM   YL+ VKD+F+PPFH+NYDK FRSVQIFQK+FG
Sbjct: 233 VFAEVEMSEKE-RKKGGENLYLQYMDQDYLQRVKDSFSPPFHENYDKSFRSVQIFQKDFG 291

Query: 122 QVIGQTFSDRHAVKVQGTRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIEDL 181
           Q IGQ FSDRHAVKVQG RRKLM RARNWLTANALKPYHSWVYWRDADVELCPGSVI+DL
Sbjct: 292 QKIGQGFSDRHAVKVQGLRRKLMARARNWLTANALKPYHSWVYWRDADVELCPGSVIQDL 351

Query: 182 MATGYDVTVPNVWRPLPEFLSGEQAYDLNSWVESDIALDLAKQLDEDDVIVEGYAEYPTW 241
           MA  YDV VPNVWRPLP FL G+Q YDLNSW+ES  ALDLAK LDEDDVIVEGYAEYPTW
Sbjct: 352 MAKDYDVMVPNVWRPLPVFLDGQQPYDLNSWIESREALDLAKTLDEDDVIVEGYAEYPTW 411

Query: 242 RVHLGYIREEDGDPKSTIDLDGVGGVSILAKAQLFRNGVHFPAFTFENHAETEAFGKMAK 301
           R HL Y R+ +GDP   ++LDGVGGVSILA+A+LFR G+HFPAFTFENHAETEAFGKMAK
Sbjct: 412 RGHLAYFRDANGDPNEVVNLDGVGGVSILARARLFRLGIHFPAFTFENHAETEAFGKMAK 471

Query: 302 KMGYSVAGLPHYTLWHIYEPSDDDLIQVRERERESKRQ 339
           KMG+ V GLPHYTLWHIYEPSDDDL ++  +ERE +R+
Sbjct: 472 KMGFRVGGLPHYTLWHIYEPSDDDLKEIGNKEREKRRE 509

>Smik_13.19 Chr13 complement(36444..38054) [1611 bp, 536 aa] {ON}
           YML115C (REAL)
          Length = 536

 Score =  546 bits (1408), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 253/328 (77%), Positives = 286/328 (87%), Gaps = 1/328 (0%)

Query: 2   VPLRNAQKVLPLMFKNLMNLTYPHELIDLAFLVSDCSEDDRTFEALLEYAKELQSGTLSQ 61
           VPLRNA  VLPLMFK+LMNLTYPHELIDLAFLVSDCSEDD T +AL+ Y+++LQ+GTLSQ
Sbjct: 197 VPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSDCSEDDTTLDALIAYSRQLQNGTLSQ 256

Query: 62  VFASHNSGENVLREEGSSDLFLKYMRPSYLKMVKDAFTPPFHKNYDKPFRSVQIFQKNFG 121
           +F   ++  +  + +G+  L+L+YM  +Y+  V+ AF+PPFH+NYDKPFRSVQIFQK+FG
Sbjct: 257 IFQEIDAVIDS-QTKGTDKLYLQYMDQNYINRVRQAFSPPFHENYDKPFRSVQIFQKDFG 315

Query: 122 QVIGQTFSDRHAVKVQGTRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIEDL 181
           QVIGQ FSDRHAVKVQG RRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGS+I+DL
Sbjct: 316 QVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSIIQDL 375

Query: 182 MATGYDVTVPNVWRPLPEFLSGEQAYDLNSWVESDIALDLAKQLDEDDVIVEGYAEYPTW 241
           M+  YDV VPNVWRPLP FL  EQ YDLNSW+ES   L+LAK LDEDDVIVEGYAEYPTW
Sbjct: 376 MSKNYDVIVPNVWRPLPTFLESEQPYDLNSWMESKEGLELAKTLDEDDVIVEGYAEYPTW 435

Query: 242 RVHLGYIREEDGDPKSTIDLDGVGGVSILAKAQLFRNGVHFPAFTFENHAETEAFGKMAK 301
           RVHL YIR+ +GDP   IDLDGVGGVSILAKA+LFRNGV FPAFTFENHAETEAFGKMAK
Sbjct: 436 RVHLAYIRDAEGDPNEVIDLDGVGGVSILAKAKLFRNGVQFPAFTFENHAETEAFGKMAK 495

Query: 302 KMGYSVAGLPHYTLWHIYEPSDDDLIQV 329
           KMGY V GLPHYT+WHIYEPSDDDL ++
Sbjct: 496 KMGYRVGGLPHYTIWHIYEPSDDDLKEI 523

>Skud_13.26 Chr13 complement(39821..41440) [1620 bp, 539 aa] {ON}
           YML115C (REAL)
          Length = 539

 Score =  544 bits (1402), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 253/328 (77%), Positives = 285/328 (86%), Gaps = 1/328 (0%)

Query: 2   VPLRNAQKVLPLMFKNLMNLTYPHELIDLAFLVSDCSEDDRTFEALLEYAKELQSGTLSQ 61
           +PLRNA  VLPLMFK+LMNLTYPHELIDLAFLVSDCSE D T +AL+ Y+++LQ+GTLSQ
Sbjct: 197 IPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSDCSEGDTTLDALIAYSRQLQNGTLSQ 256

Query: 62  VFASHNSGENVLREEGSSDLFLKYMRPSYLKMVKDAFTPPFHKNYDKPFRSVQIFQKNFG 121
           +F   ++  +  + +G+  L+LKYM   Y+  V  AF+PPFH NYDKPFRSVQIFQK+FG
Sbjct: 257 IFQDIDAIIDS-QTKGTDKLYLKYMDEDYINRVHQAFSPPFHDNYDKPFRSVQIFQKDFG 315

Query: 122 QVIGQTFSDRHAVKVQGTRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIEDL 181
           QVIGQ FSDRHAVKVQG RRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIEDL
Sbjct: 316 QVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIEDL 375

Query: 182 MATGYDVTVPNVWRPLPEFLSGEQAYDLNSWVESDIALDLAKQLDEDDVIVEGYAEYPTW 241
           M+  YDV VPNVWRPLP FL+ EQAYDLNSW+ES  AL+LAK LDEDDVIVEGYAEYPTW
Sbjct: 376 MSKNYDVVVPNVWRPLPTFLNSEQAYDLNSWMESREALELAKTLDEDDVIVEGYAEYPTW 435

Query: 242 RVHLGYIREEDGDPKSTIDLDGVGGVSILAKAQLFRNGVHFPAFTFENHAETEAFGKMAK 301
           RVHL YIR+ +G+P   +DLDGVGGVSILAKA++FRNGV FPAFTFENHAETEAFGKMAK
Sbjct: 436 RVHLAYIRDAEGNPNEVVDLDGVGGVSILAKAKIFRNGVQFPAFTFENHAETEAFGKMAK 495

Query: 302 KMGYSVAGLPHYTLWHIYEPSDDDLIQV 329
           KMGY V GLPHYT+WHIYEPSDDDL ++
Sbjct: 496 KMGYRVGGLPHYTIWHIYEPSDDDLKEI 523

>Kpol_541.15 s541 (41403..42899) [1497 bp, 498 aa] {ON}
           (41403..42899) [1497 nt, 499 aa]
          Length = 498

 Score =  540 bits (1392), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 245/337 (72%), Positives = 291/337 (86%), Gaps = 3/337 (0%)

Query: 2   VPLRNAQKVLPLMFKNLMNLTYPHELIDLAFLVSDCSEDDRTFEALLEYAKELQSGTLSQ 61
           VPLR+A+ VLPLMFKN+MNLTYPHELIDLAFLVSDC+E D T E+L+ Y++ LQ GTL+ 
Sbjct: 164 VPLRDAEDVLPLMFKNIMNLTYPHELIDLAFLVSDCTEGDHTLESLIAYSRHLQDGTLAG 223

Query: 62  VFASHNSGENVLREEGSSDLFLKYMRPSYLKMVKDAFTPPFHKNYDKPFRSVQIFQKNFG 121
           +F   +  ++   ++ S  L+LKYM   YLKMV+DA++PPFH +Y+KPFRSVQIFQK+FG
Sbjct: 224 LFQEMDKDDS---KKDSEKLYLKYMNKDYLKMVEDAYSPPFHNDYEKPFRSVQIFQKDFG 280

Query: 122 QVIGQTFSDRHAVKVQGTRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIEDL 181
           Q +GQ F++RH+VKVQG RRKLMGRARNWL  NALKPYH+WVYWRDADVELCPG+VIEDL
Sbjct: 281 QEVGQGFTERHSVKVQGIRRKLMGRARNWLMTNALKPYHAWVYWRDADVELCPGTVIEDL 340

Query: 182 MATGYDVTVPNVWRPLPEFLSGEQAYDLNSWVESDIALDLAKQLDEDDVIVEGYAEYPTW 241
           M+  +DV VPNVWRPLPEFL+ EQ YDLNSW+ES+ AL LAK LDEDDVIVEGYAEYPTW
Sbjct: 341 MSKNFDVMVPNVWRPLPEFLNSEQPYDLNSWMESNEALKLAKNLDEDDVIVEGYAEYPTW 400

Query: 242 RVHLGYIREEDGDPKSTIDLDGVGGVSILAKAQLFRNGVHFPAFTFENHAETEAFGKMAK 301
           RVHL YIRE++G+P   +DLDGVGGVSIL KA+LFR+G+HFPAFTFENHAETEAFGKMAK
Sbjct: 401 RVHLAYIREKNGNPNQVVDLDGVGGVSILVKAKLFRSGIHFPAFTFENHAETEAFGKMAK 460

Query: 302 KMGYSVAGLPHYTLWHIYEPSDDDLIQVRERERESKR 338
           KMG+ V GLPHYTLWHIYEPSDDDL+++  +ERE+ R
Sbjct: 461 KMGFRVGGLPHYTLWHIYEPSDDDLLEIASKERENNR 497

>KLLA0D01529g Chr4 complement(135998..137503) [1506 bp, 501 aa] {ON}
           similar to uniprot|P23642 Saccharomyces cerevisiae
           YML115C VAN1 Mannosyltransferase with a role in protein
           N- glycosylation
          Length = 501

 Score =  539 bits (1389), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 248/338 (73%), Positives = 289/338 (85%), Gaps = 2/338 (0%)

Query: 2   VPLRNAQKVLPLMFKNLMNLTYPHELIDLAFLVSDCSEDDRTFEALLEYAKELQSGTLSQ 61
           VPLR+A  +LP++FKNLMNLTYPHELID+AFLVSDC+++ RT  +LL+++KELQ+GTLS+
Sbjct: 164 VPLRDAASLLPMLFKNLMNLTYPHELIDIAFLVSDCTDNGRTMSSLLDFSKELQNGTLSK 223

Query: 62  VFASHNSGENVLREEGSSDLFLKYMRPSYLKMVKDAFTPPFHKNYDKPFRSVQIFQKNFG 121
                 + ++  +   +  L+LKYM   YLKMVK+AF PPFH +YDKPFRS+QIF+K+FG
Sbjct: 224 TLQDFEADKD--KGNSAEQLYLKYMGKDYLKMVKNAFNPPFHDDYDKPFRSIQIFEKDFG 281

Query: 122 QVIGQTFSDRHAVKVQGTRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIEDL 181
           Q IGQ FSDRHAVKVQG RRKLMGRARNWLTANALKPYHSWVYWRD DVELCPG+VIEDL
Sbjct: 282 QQIGQGFSDRHAVKVQGVRRKLMGRARNWLTANALKPYHSWVYWRDVDVELCPGTVIEDL 341

Query: 182 MATGYDVTVPNVWRPLPEFLSGEQAYDLNSWVESDIALDLAKQLDEDDVIVEGYAEYPTW 241
           M   YDV VPNVWRPLP FL G QAYDLNSWVES+ A+ LAK LDEDDVIVEGYAEYPTW
Sbjct: 342 MKHDYDVIVPNVWRPLPTFLGGAQAYDLNSWVESNEAIKLAKTLDEDDVIVEGYAEYPTW 401

Query: 242 RVHLGYIREEDGDPKSTIDLDGVGGVSILAKAQLFRNGVHFPAFTFENHAETEAFGKMAK 301
           RVHLGY+R+++G+P   +DLDGVGGVSILA+AQLFR G+HFPAFTFENHAETEAFGKMAK
Sbjct: 402 RVHLGYLRKDNGNPDDLLDLDGVGGVSILARAQLFRKGIHFPAFTFENHAETEAFGKMAK 461

Query: 302 KMGYSVAGLPHYTLWHIYEPSDDDLIQVRERERESKRQ 339
           KMG+ V GL HYTLWHIYEPSDDDL ++ + ERES+R 
Sbjct: 462 KMGFKVGGLMHYTLWHIYEPSDDDLREIAKLERESRRN 499

>ABL124W Chr2 (162889..164346) [1458 bp, 485 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YML115C (VAN1)
          Length = 485

 Score =  538 bits (1386), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 249/340 (73%), Positives = 287/340 (84%), Gaps = 3/340 (0%)

Query: 2   VPLRNAQKVLPLMFKNLMNLTYPHELIDLAFLVSDCSEDDRTFEALLEYAKELQSGTLSQ 61
           +PLRNA  VLP+MFK+LMNLTYPHELID+AFLVSDCSE+D+T ++L+EYA  LQ GTL+ 
Sbjct: 145 IPLRNAHPVLPMMFKHLMNLTYPHELIDVAFLVSDCSENDKTLQSLMEYATYLQKGTLNN 204

Query: 62  VFASHNSGENVLREE---GSSDLFLKYMRPSYLKMVKDAFTPPFHKNYDKPFRSVQIFQK 118
           V A   +    L+ +   G  DL+LKYM   YL+MV+DAF+PP+H+NY+KPFRSVQ+F+K
Sbjct: 205 VLAREEAEIKRLKAKHGNGGGDLYLKYMDQEYLQMVRDAFSPPYHENYEKPFRSVQVFKK 264

Query: 119 NFGQVIGQTFSDRHAVKVQGTRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVI 178
           +FGQ IGQ FSDRH VKVQG RR+LMGRARNWLTANALKPYHSWVYWRD DVELCPGSVI
Sbjct: 265 DFGQKIGQGFSDRHHVKVQGIRRRLMGRARNWLTANALKPYHSWVYWRDVDVELCPGSVI 324

Query: 179 EDLMATGYDVTVPNVWRPLPEFLSGEQAYDLNSWVESDIALDLAKQLDEDDVIVEGYAEY 238
           EDLM+ GYDV VPNVWRPLPEFL G+Q YDLNSW+ES  AL+LAK+L+EDDVIVEGYAEY
Sbjct: 325 EDLMSIGYDVIVPNVWRPLPEFLGGKQGYDLNSWIESTDALNLAKKLEEDDVIVEGYAEY 384

Query: 239 PTWRVHLGYIREEDGDPKSTIDLDGVGGVSILAKAQLFRNGVHFPAFTFENHAETEAFGK 298
            TWR HL   RE  G+P+  IDLDGVGGVSILAKA+LFR G HF AF FENHAETEAFGK
Sbjct: 385 ATWRFHLITAREAKGNPREVIDLDGVGGVSILAKAKLFRQGAHFTAFAFENHAETEAFGK 444

Query: 299 MAKKMGYSVAGLPHYTLWHIYEPSDDDLIQVRERERESKR 338
           MAKKMGY V GLPHYTLWHIYEPSDDD++ +  RERE++R
Sbjct: 445 MAKKMGYKVGGLPHYTLWHIYEPSDDDIMDIARRERENRR 484

>Ecym_4613 Chr4 (1195057..1196631) [1575 bp, 524 aa] {ON} similar to
           Ashbya gossypii ABL124W
          Length = 524

 Score =  536 bits (1381), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 253/343 (73%), Positives = 284/343 (82%), Gaps = 9/343 (2%)

Query: 2   VPLRNAQKVLPLMFKNLMNLTYPHELIDLAFLVSDCSEDDRTFEALLEYAKELQSGTLSQ 61
           VPLRNA+ VLPLMF++LMNLTYPHELIDLAFLVSDCS+DD T ++L+ YA+ELQ GTLS+
Sbjct: 184 VPLRNAENVLPLMFRHLMNLTYPHELIDLAFLVSDCSKDDHTMDSLISYAEELQKGTLSK 243

Query: 62  ------VFASHNSGENVLREEGSSDLFLKYMRPSYLKMVKDAFTPPFHKNYDKPFRSVQI 115
                  +  H   ++  +E    DL LKYM   YL MV++A   PFHKNYDKPFRSVQI
Sbjct: 244 SLKLQDAYKMHKKSKSKNKE---GDLHLKYMNKDYLNMVENALKEPFHKNYDKPFRSVQI 300

Query: 116 FQKNFGQVIGQTFSDRHAVKVQGTRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPG 175
           FQK+FGQ+IGQ FSDRH VKVQGTRRKLMG+ARNWLTANALKPYHSWVYWRDADVELCPG
Sbjct: 301 FQKDFGQIIGQGFSDRHHVKVQGTRRKLMGKARNWLTANALKPYHSWVYWRDADVELCPG 360

Query: 176 SVIEDLMATGYDVTVPNVWRPLPEFLSGEQAYDLNSWVESDIALDLAKQLDEDDVIVEGY 235
           SVIEDLM+ GYDV VPNVWRPLPEFL  EQ YDLNSW+ESD AL+LAK LDEDDVIVEGY
Sbjct: 361 SVIEDLMSVGYDVIVPNVWRPLPEFLGSEQEYDLNSWIESDNALNLAKTLDEDDVIVEGY 420

Query: 236 AEYPTWRVHLGYIREEDGDPKSTIDLDGVGGVSILAKAQLFRNGVHFPAFTFENHAETEA 295
           AEY TWR HL   R+  G+    +DLDGVGGVSILAKA+LFRNGVHF AF FENHAETEA
Sbjct: 421 AEYATWRFHLANNRDPQGNTMDVLDLDGVGGVSILAKAKLFRNGVHFAAFAFENHAETEA 480

Query: 296 FGKMAKKMGYSVAGLPHYTLWHIYEPSDDDLIQVRERERESKR 338
           FGKMAKKMGY V GL HYTLWHIYEPS+DDL+++  +ER S+R
Sbjct: 481 FGKMAKKMGYRVGGLSHYTLWHIYEPSNDDLMEIARKERSSRR 523

>CAGL0B02321g Chr2 (220222..221760) [1539 bp, 512 aa] {ON} similar
           to uniprot|P23642 Saccharomyces cerevisiae YML115c VAN1
           Vanadate resistance protein
          Length = 512

 Score =  529 bits (1363), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 250/333 (75%), Positives = 280/333 (84%), Gaps = 3/333 (0%)

Query: 2   VPLRNAQKVLPLMFKNLMNLTYPHELIDLAFLVSDCSEDDRTFEALLEYAKELQSGTLSQ 61
           VPLR+A++VLPLMFKNLMNLTYPHELIDLAFLVSDCSE D+T EAL  Y++ LQ G L  
Sbjct: 181 VPLRDAEEVLPLMFKNLMNLTYPHELIDLAFLVSDCSEGDKTLEALETYSQLLQEGILPD 240

Query: 62  VFASHNSGENVLREEGSSDLFLKYMRPSYLKMVKDAFTPPFHKNYDKPFRSVQIFQKNFG 121
           + A  +   N  + + +  + LKYM P YLK VK A+ PPFH NY KPFRSVQIFQK+FG
Sbjct: 241 ILADMD---NYNKGKSNESIHLKYMEPDYLKRVKAAYKPPFHPNYSKPFRSVQIFQKDFG 297

Query: 122 QVIGQTFSDRHAVKVQGTRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIEDL 181
           QVIGQ FSDRHAVKVQG RRKLMGRARNWL +NALKPYHSWVYWRDADVELCPGSVIEDL
Sbjct: 298 QVIGQGFSDRHAVKVQGIRRKLMGRARNWLMSNALKPYHSWVYWRDADVELCPGSVIEDL 357

Query: 182 MATGYDVTVPNVWRPLPEFLSGEQAYDLNSWVESDIALDLAKQLDEDDVIVEGYAEYPTW 241
           M   YDV VPNVWRPLP+FL+  Q YDLNSW+ES+ AL LAK LDEDDVIVEGYAEYPT+
Sbjct: 358 MLQDYDVIVPNVWRPLPKFLNSAQPYDLNSWMESNEALQLAKTLDEDDVIVEGYAEYPTY 417

Query: 242 RVHLGYIREEDGDPKSTIDLDGVGGVSILAKAQLFRNGVHFPAFTFENHAETEAFGKMAK 301
           RVHL YIREEDGDP   +DLDGVGGVSILA+A++FR GVHF AFTFENHAETEAFGKMAK
Sbjct: 418 RVHLAYIREEDGDPTQVVDLDGVGGVSILARARVFREGVHFSAFTFENHAETEAFGKMAK 477

Query: 302 KMGYSVAGLPHYTLWHIYEPSDDDLIQVRERER 334
           K+G+ V GLPHYTLWHIYEPSDDDL+ + + E+
Sbjct: 478 KVGFRVGGLPHYTLWHIYEPSDDDLLAMAKLEK 510

>TBLA0B03270 Chr2 (762231..763793) [1563 bp, 520 aa] {ON} Anc_8.842
           YML115C
          Length = 520

 Score =  521 bits (1342), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 243/341 (71%), Positives = 283/341 (82%), Gaps = 2/341 (0%)

Query: 1   MVPLRNAQKVLPLMFKNLMNLTYPHELIDLAFLVSDCSEDDRTFEALLEYAKELQSGTLS 60
           + PLR+A+ VLP+MFK+LMNLTYPHELID+AFLVSDCSE D+T + L+ +A+ LQ GTL 
Sbjct: 179 LTPLRDAEHVLPMMFKHLMNLTYPHELIDIAFLVSDCSEGDKTLDTLITFARHLQDGTLV 238

Query: 61  QVFASHNS--GENVLREEGSSDLFLKYMRPSYLKMVKDAFTPPFHKNYDKPFRSVQIFQK 118
            +F   ++   ++  + E  +  +LK+M  +Y+KM   +F  P H  Y+KPFRSVQIFQK
Sbjct: 239 DIFKDMDASIAKSEKKNENPNKHYLKFMDQNYIKMADASFAGPHHNEYNKPFRSVQIFQK 298

Query: 119 NFGQVIGQTFSDRHAVKVQGTRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVI 178
           +FGQ+IGQ FSDRHAVKVQG RRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVI
Sbjct: 299 DFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVI 358

Query: 179 EDLMATGYDVTVPNVWRPLPEFLSGEQAYDLNSWVESDIALDLAKQLDEDDVIVEGYAEY 238
           +DLM+  YDV VPNVWRPLPEFL+ EQ YDLNSW+ES  AL+LAK LDEDDVIVEGYAEY
Sbjct: 359 QDLMSKNYDVIVPNVWRPLPEFLNKEQPYDLNSWMESGEALELAKTLDEDDVIVEGYAEY 418

Query: 239 PTWRVHLGYIREEDGDPKSTIDLDGVGGVSILAKAQLFRNGVHFPAFTFENHAETEAFGK 298
           PTWRVHL Y+R+ +GDP  T+D+DGVGGVSILAKA+LFR+GVHFPAFTFENHAETEAFGK
Sbjct: 419 PTWRVHLAYLRDPNGDPNQTLDIDGVGGVSILAKAKLFRHGVHFPAFTFENHAETEAFGK 478

Query: 299 MAKKMGYSVAGLPHYTLWHIYEPSDDDLIQVRERERESKRQ 339
           MAKKMGYSV GLP+Y LWHIYEPSDDDL  +   ER    Q
Sbjct: 479 MAKKMGYSVGGLPNYMLWHIYEPSDDDLKDMAAIERGEYNQ 519

>TPHA0C04780 Chr3 (1031751..1033328) [1578 bp, 525 aa] {ON}
           Anc_1.479 YEL036C
          Length = 525

 Score =  516 bits (1330), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 244/338 (72%), Positives = 287/338 (84%), Gaps = 4/338 (1%)

Query: 2   VPLRNAQKVLPLMFKNLMNLTYPHELIDLAFLVSDCSEDDRTFEALLEYAKELQSGTLSQ 61
           +PLR+A+ VLPLMFKNLMNLTYPHELID+AFLVSDCSE+D T E+LL+Y + LQ+GTL  
Sbjct: 185 IPLRDAEDVLPLMFKNLMNLTYPHELIDVAFLVSDCSENDHTLESLLQYTRFLQNGTLPD 244

Query: 62  VFASHNS----GENVLREEGSSDLFLKYMRPSYLKMVKDAFTPPFHKNYDKPFRSVQIFQ 117
           VF   +      + V+     S L+LKYM+  YL+ VK+AF  PFH+NYDKPFRS+QI++
Sbjct: 245 VFEEMDKLDEMTDKVVENADDSKLYLKYMKKEYLQRVKEAFKSPFHENYDKPFRSIQIYK 304

Query: 118 KNFGQVIGQTFSDRHAVKVQGTRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSV 177
           K+FGQ +GQ+FSDRH VKVQG RRKLMGRARNWL  NALKPYHSWVYWRDADVELCPG+V
Sbjct: 305 KDFGQTVGQSFSDRHDVKVQGIRRKLMGRARNWLMTNALKPYHSWVYWRDADVELCPGTV 364

Query: 178 IEDLMATGYDVTVPNVWRPLPEFLSGEQAYDLNSWVESDIALDLAKQLDEDDVIVEGYAE 237
           IEDLM+  +DV VPNVWRPLPEF++ EQ YDLNSW+ES  A+DLAK+L ED+VIVEGYAE
Sbjct: 365 IEDLMSKDFDVIVPNVWRPLPEFMNSEQPYDLNSWMESREAIDLAKKLHEDEVIVEGYAE 424

Query: 238 YPTWRVHLGYIREEDGDPKSTIDLDGVGGVSILAKAQLFRNGVHFPAFTFENHAETEAFG 297
           YPTWRVHL Y+RE+DGDP   +D+DGVGGVSILA+A+LFR GVHFPAFTFENHAETEAFG
Sbjct: 425 YPTWRVHLAYLREKDGDPNQVVDVDGVGGVSILARARLFRAGVHFPAFTFENHAETEAFG 484

Query: 298 KMAKKMGYSVAGLPHYTLWHIYEPSDDDLIQVRERERE 335
           KMAKKMG+ V GLPHYTLWHIYEPSDDDL+ +  +E+E
Sbjct: 485 KMAKKMGFRVGGLPHYTLWHIYEPSDDDLMAIATKEKE 522

>Ecym_3573 Chr3 complement(1085088..1086431) [1344 bp, 447 aa] {ON}
           similar to Ashbya gossypii AFR357W
          Length = 447

 Score =  360 bits (923), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 178/338 (52%), Positives = 226/338 (66%), Gaps = 48/338 (14%)

Query: 2   VPLRNAQKVLPLMFKNLMNLTYPHELIDLAFLVSDCSEDDRTFEALLEYAKELQSGTLSQ 61
           VPLR+A   LP+ FK+L ++TYPH LIDL+FLVSD ++D  T   LL    +LQS     
Sbjct: 75  VPLRDAANHLPMFFKHLKSMTYPHNLIDLSFLVSDSTDD--TMGVLLNSLHDLQS----- 127

Query: 62  VFASHNSGENVLREEGSSDLFLKYMRPSYLKMVKDAFTPPFHKNYDKPFRSVQIFQKNFG 121
                       + +G+                             K F  ++IFQK+FG
Sbjct: 128 ------------QADGT-----------------------------KRFGDIEIFQKDFG 146

Query: 122 QVIGQTFSDRHAVKVQGTRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIEDL 181
           Q+IGQ+FSDRH    QG RRKLM RARNWL + A+KPYHSWVYWRD DVE  P +++EDL
Sbjct: 147 QIIGQSFSDRHGFAAQGPRRKLMARARNWLGSAAIKPYHSWVYWRDVDVEYVPETILEDL 206

Query: 182 MATGYDVTVPNVWRPLPEFLSGEQAYDLNSWVESDIALDLAKQLDEDDVIVEGYAEYPTW 241
           M    D+ VPNVWRPLP++L+  Q YDLNSWVES+  L LA  L EDDVIVEGY EY TW
Sbjct: 207 MHHDKDIIVPNVWRPLPKWLNYIQPYDLNSWVESEGGLQLAASLKEDDVIVEGYPEYATW 266

Query: 242 RVHLGYIREEDGDPKSTIDLDGVGGVSILAKAQLFRNGVHFPAFTFENHAETEAFGKMAK 301
           RVHL Y+R+ +GDP++ ++LDG+GGVSIL+KA++FR G HFPAF+FE HAETEAFGK+++
Sbjct: 267 RVHLAYMRDPNGDPETEMELDGIGGVSILSKAKVFRTGSHFPAFSFEKHAETEAFGKLSR 326

Query: 302 KMGYSVAGLPHYTLWHIYEPSDDDLIQVRERERESKRQ 339
           +M YSV GLPHY +WH+YEPS DDL  +     E +R+
Sbjct: 327 RMKYSVVGLPHYVIWHVYEPSSDDLKHMAWMAEEEQRK 364

>KNAG0I00300 Chr9 complement(39873..41246) [1374 bp, 457 aa] {ON}
           Anc_1.479 YEL036C
          Length = 457

 Score =  357 bits (915), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 176/338 (52%), Positives = 222/338 (65%), Gaps = 48/338 (14%)

Query: 2   VPLRNAQKVLPLMFKNLMNLTYPHELIDLAFLVSDCSEDDRTFEALLEYAKELQSGTLSQ 61
           VPLR+A + LP+ FK+L  +TYPH L+DL+FLVSD  +D  T   LL   +  QS     
Sbjct: 92  VPLRDAAEHLPMFFKHLNEMTYPHNLVDLSFLVSDSKDD--TMGVLLSNLQTAQS----- 144

Query: 62  VFASHNSGENVLREEGSSDLFLKYMRPSYLKMVKDAFTPPFHKNYDKPFRSVQIFQKNFG 121
                                                     K+  K F +++ F+K+FG
Sbjct: 145 -----------------------------------------QKDRSKRFGNIEFFEKDFG 163

Query: 122 QVIGQTFSDRHAVKVQGTRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIEDL 181
           Q+IGQ+FSDRH    QG RRKLM RARNWL + A+KPYHSWVYWRD DVE  P +++EDL
Sbjct: 164 QIIGQSFSDRHGFAAQGPRRKLMARARNWLGSVAIKPYHSWVYWRDVDVETAPVTIMEDL 223

Query: 182 MATGYDVTVPNVWRPLPEFLSGEQAYDLNSWVESDIALDLAKQLDEDDVIVEGYAEYPTW 241
           M  G DV VPNVWRPLPE+L   Q YDLNSW ESD  L+LA  LD+D VIVEGY EY TW
Sbjct: 224 MHHGKDVIVPNVWRPLPEWLGNIQPYDLNSWQESDAGLELADSLDDDAVIVEGYPEYATW 283

Query: 242 RVHLGYIREEDGDPKSTIDLDGVGGVSILAKAQLFRNGVHFPAFTFENHAETEAFGKMAK 301
           R HL Y+R+ +GDP+  ++LDG+GGVSIL+KA++FR+G HFPAF+FE HAETEAFGK+++
Sbjct: 284 RPHLAYMRDPNGDPEVEMELDGIGGVSILSKARVFRSGSHFPAFSFEKHAETEAFGKLSR 343

Query: 302 KMGYSVAGLPHYTLWHIYEPSDDDLIQVRERERESKRQ 339
           +MGYSV GLPHY +WHIYEPS +DL  +     E +R+
Sbjct: 344 RMGYSVVGLPHYVIWHIYEPSTEDLKHMAWMAEEEQRK 381

>KLTH0C03432g Chr3 complement(297214..298683) [1470 bp, 489 aa] {ON}
           similar to uniprot|P32629 Saccharomyces cerevisiae
           YEL036C ANP1 Mannan 8 Protein of the endoplasmic
           reticulum with a role in retention of
           glycosyltransferases in the Golgi also involved in
           osmotic sensitivity and resistance to aminonitrophenyl
           propanediol subunit of mannosyltransferase complex
          Length = 489

 Score =  357 bits (916), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 177/338 (52%), Positives = 223/338 (65%), Gaps = 48/338 (14%)

Query: 2   VPLRNAQKVLPLMFKNLMNLTYPHELIDLAFLVSDCSEDDRTFEALLEYAKELQSGTLSQ 61
           VPLR+A + LP+ F ++  ++YPH LIDL+FLVSD S+D  T   LLEY ++ QS     
Sbjct: 78  VPLRDAAEHLPMFFDHMDRISYPHNLIDLSFLVSDSSDD--TMGVLLEYLQKAQS----- 130

Query: 62  VFASHNSGENVLREEGSSDLFLKYMRPSYLKMVKDAFTPPFHKNYDKPFRSVQIFQKNFG 121
                                    +P   +                 F +++I++K+FG
Sbjct: 131 -------------------------KPDRTQR----------------FGNIEIYEKDFG 149

Query: 122 QVIGQTFSDRHAVKVQGTRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIEDL 181
           Q IGQ+FSDRH    QG RRKLMGRARNWL + ALKPYHSWVYWRD DVE  P +++EDL
Sbjct: 150 QAIGQSFSDRHGFAAQGPRRKLMGRARNWLGSVALKPYHSWVYWRDVDVETIPPTILEDL 209

Query: 182 MATGYDVTVPNVWRPLPEFLSGEQAYDLNSWVESDIALDLAKQLDEDDVIVEGYAEYPTW 241
           M    DV VPNVWRPLP++L   Q YDLNSW ES+  L LA+ LDED VIVEGY EY TW
Sbjct: 210 MHHDRDVIVPNVWRPLPDWLGNIQPYDLNSWQESEGGLQLAESLDEDSVIVEGYPEYATW 269

Query: 242 RVHLGYIREEDGDPKSTIDLDGVGGVSILAKAQLFRNGVHFPAFTFENHAETEAFGKMAK 301
           R HL Y+R+  GDP+  ++LDG+GGVSIL+KA++FR G HFPAF+FE HAETEAFGK+++
Sbjct: 270 RTHLAYMRDPSGDPEDEMELDGIGGVSILSKAKVFRAGSHFPAFSFEKHAETEAFGKLSR 329

Query: 302 KMGYSVAGLPHYTLWHIYEPSDDDLIQVRERERESKRQ 339
           ++GYSV GLPHY +WHIYEPS DDL  +     E KR+
Sbjct: 330 RLGYSVVGLPHYVIWHIYEPSSDDLKHMAWMAEEEKRK 367

>Kwal_27.10157 s27 complement(219928..221358) [1431 bp, 476 aa] {ON}
           YEL036C (ANP1) - subunit of mannosyltransferase complex
           [contig 41] FULL
          Length = 476

 Score =  356 bits (913), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 176/338 (52%), Positives = 223/338 (65%), Gaps = 48/338 (14%)

Query: 2   VPLRNAQKVLPLMFKNLMNLTYPHELIDLAFLVSDCSEDDRTFEALLEYAKELQSGTLSQ 61
           VPLR+A + LP+ F ++  ++YPH LIDL+FLVSD S+D  T   LL++ K+ QS T   
Sbjct: 78  VPLRDAAEHLPMFFDHMDKISYPHNLIDLSFLVSDSSDD--TMGVLLDHLKKAQSKT--- 132

Query: 62  VFASHNSGENVLREEGSSDLFLKYMRPSYLKMVKDAFTPPFHKNYDKPFRSVQIFQKNFG 121
                                                      +  K F +++IF+K+FG
Sbjct: 133 -------------------------------------------DRKKRFGNIEIFEKDFG 149

Query: 122 QVIGQTFSDRHAVKVQGTRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIEDL 181
           Q IGQ+FSDRH    QG RRKLMGRARNWL + ALKPYHSWVYWRD DVE  P +++EDL
Sbjct: 150 QAIGQSFSDRHGFAAQGPRRKLMGRARNWLGSVALKPYHSWVYWRDVDVETIPRTILEDL 209

Query: 182 MATGYDVTVPNVWRPLPEFLSGEQAYDLNSWVESDIALDLAKQLDEDDVIVEGYAEYPTW 241
           M    DV VPNVWRPLP++L   Q YDLNSW ES+  + LA+ LDED VIVEGY EY TW
Sbjct: 210 MHHDRDVIVPNVWRPLPDWLGNIQPYDLNSWQESEGGMQLAESLDEDAVIVEGYPEYATW 269

Query: 242 RVHLGYIREEDGDPKSTIDLDGVGGVSILAKAQLFRNGVHFPAFTFENHAETEAFGKMAK 301
           R HL Y+R+  G+P+  ++LDG+GGVSIL+KA++FR G HFPAF+FE HAETEAFGK+++
Sbjct: 270 RTHLAYMRDPSGNPEDEMELDGIGGVSILSKAKVFRAGSHFPAFSFEKHAETEAFGKLSR 329

Query: 302 KMGYSVAGLPHYTLWHIYEPSDDDLIQVRERERESKRQ 339
           ++GYSV GLPHY +WHIYEPS DDL  +     E KR+
Sbjct: 330 RLGYSVIGLPHYVIWHIYEPSSDDLKHMAWMAEEEKRK 367

>SAKL0D11792g Chr4 (979538..980989) [1452 bp, 483 aa] {ON} similar
           to uniprot|P32629 Saccharomyces cerevisiae YEL036C ANP1
           Mannan 8 Protein of the endoplasmic reticulum with a
           role in retention of glycosyltransferases in the Golgi
           also involved in osmotic sensitivity and resistance to
           aminonitrophenyl propanediol subunit of
           mannosyltransferase complex
          Length = 483

 Score =  354 bits (909), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 175/338 (51%), Positives = 222/338 (65%), Gaps = 48/338 (14%)

Query: 2   VPLRNAQKVLPLMFKNLMNLTYPHELIDLAFLVSDCSEDDRTFEALLEYAKELQSGTLSQ 61
           VPLR+A + LP+ FK++  ++YPH LIDL+FLVSD S+D  T   LL   K+ QS     
Sbjct: 107 VPLRDAAEHLPMFFKHMDEISYPHNLIDLSFLVSDSSDD--TMGVLLSSLKKAQS----- 159

Query: 62  VFASHNSGENVLREEGSSDLFLKYMRPSYLKMVKDAFTPPFHKNYDKPFRSVQIFQKNFG 121
                                                    +++  + F +++IF+K+FG
Sbjct: 160 -----------------------------------------NQDKSQRFGNIEIFEKDFG 178

Query: 122 QVIGQTFSDRHAVKVQGTRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIEDL 181
           QVIGQ+FSDRH    QG RRKLM RARNWL + ALKPYHSWVYWRD DVE  P +++EDL
Sbjct: 179 QVIGQSFSDRHGFAAQGPRRKLMARARNWLGSVALKPYHSWVYWRDVDVETIPRTILEDL 238

Query: 182 MATGYDVTVPNVWRPLPEFLSGEQAYDLNSWVESDIALDLAKQLDEDDVIVEGYAEYPTW 241
           M    DV VPNVWRPLP++L   Q YDLNSW ES+  L LA  L+ED VIVEGY EY TW
Sbjct: 239 MHHNKDVIVPNVWRPLPDWLGNIQPYDLNSWKESEGGLQLADSLEEDAVIVEGYPEYATW 298

Query: 242 RVHLGYIREEDGDPKSTIDLDGVGGVSILAKAQLFRNGVHFPAFTFENHAETEAFGKMAK 301
           R HL Y+R+  GDP++ ++LDG+GGVSIL+KA++FR G HFPAF+FE HAETEAFGK+++
Sbjct: 299 RTHLAYMRDPSGDPEAEMELDGIGGVSILSKAKVFRTGSHFPAFSFEKHAETEAFGKLSR 358

Query: 302 KMGYSVAGLPHYTLWHIYEPSDDDLIQVRERERESKRQ 339
           +M YSV GLPHY +WH+YEPS DDL  +     E KR+
Sbjct: 359 RMKYSVVGLPHYVIWHVYEPSSDDLKHMAWMAEEEKRK 396

>AFR357W Chr6 (1086069..1087373) [1305 bp, 434 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL036C (ANP1)
          Length = 434

 Score =  351 bits (901), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 176/339 (51%), Positives = 221/339 (65%), Gaps = 49/339 (14%)

Query: 2   VPLRNAQKVLPLMFKNLMNLTYPHELIDLAFLVSDCSEDDRTFEALLEYAKELQSGTLSQ 61
           VPLR+A + LP+ FK+L  +TYPH L+DL+FLVSD    D T   L ++ +ELQS     
Sbjct: 67  VPLRDAAEHLPMFFKHLSEMTYPHNLVDLSFLVSDSK--DETMSVLRQHVRELQS----- 119

Query: 62  VFASHNSGENVLREEGSSDLFLKYMRPSYLKMVKDAFTPPFHKNYDKPFRSVQIFQKNFG 121
                                                      +  + F +++IFQK+FG
Sbjct: 120 -----------------------------------------QPDNARQFGNIEIFQKDFG 138

Query: 122 QVIGQTFSDRHAVKVQGTRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIEDL 181
           Q IGQ+FSDRH    QG RRKLM RARNWL + ALKPYHSWVYWRD DVE  P ++IEDL
Sbjct: 139 QAIGQSFSDRHGFAAQGPRRKLMARARNWLGSVALKPYHSWVYWRDVDVETVPQTIIEDL 198

Query: 182 MATGYDVTVPNVWRPLPEFLSGEQAYDLNSWVESDIALDLAKQL-DEDDVIVEGYAEYPT 240
           M    DV VPNVWRPLP++L   Q YDLNSWVES+  L LA    DED VIVEGY EY T
Sbjct: 199 MHHDKDVIVPNVWRPLPDWLGDIQPYDLNSWVESEGGLQLAADTPDEDAVIVEGYPEYAT 258

Query: 241 WRVHLGYIREEDGDPKSTIDLDGVGGVSILAKAQLFRNGVHFPAFTFENHAETEAFGKMA 300
           WRVHL Y+R+ +GDP++ ++LDG+GGVSIL++A++FR+G HFPAF+F+ HAETE FGK++
Sbjct: 259 WRVHLAYMRDPNGDPETEMELDGIGGVSILSRARVFRSGSHFPAFSFQKHAETEGFGKLS 318

Query: 301 KKMGYSVAGLPHYTLWHIYEPSDDDLIQVRERERESKRQ 339
           + MGYSV GLPHY +WHIYEPS DDL  +     E +R+
Sbjct: 319 RAMGYSVVGLPHYVIWHIYEPSSDDLKHMAWMAEEEQRR 357

>TBLA0B02170 Chr2 complement(499391..501109) [1719 bp, 572 aa] {ON}
           Anc_1.479 YEL036C
          Length = 572

 Score =  355 bits (911), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 176/338 (52%), Positives = 221/338 (65%), Gaps = 48/338 (14%)

Query: 2   VPLRNAQKVLPLMFKNLMNLTYPHELIDLAFLVSDCSEDDRTFEALLEYAKELQSGTLSQ 61
           VPLR+A + LP  F +L  +TYPH LIDL+FLVSD  +D  T   LL + +  QS     
Sbjct: 97  VPLRDAAQHLPRFFNHLNTMTYPHNLIDLSFLVSDSKDD--TMGVLLSHLQTAQS----- 149

Query: 62  VFASHNSGENVLREEGSSDLFLKYMRPSYLKMVKDAFTPPFHKNYDKPFRSVQIFQKNFG 121
                                                     +N  K F +++I++K+FG
Sbjct: 150 -----------------------------------------QQNKLKRFGNIEIYEKDFG 168

Query: 122 QVIGQTFSDRHAVKVQGTRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIEDL 181
           Q+IGQ+FSDRH    QG RRKLM RARNWL + ALKPYHSWVYWRD DVE CP +++EDL
Sbjct: 169 QIIGQSFSDRHGFAAQGPRRKLMARARNWLGSVALKPYHSWVYWRDVDVETCPVTIMEDL 228

Query: 182 MATGYDVTVPNVWRPLPEFLSGEQAYDLNSWVESDIALDLAKQLDEDDVIVEGYAEYPTW 241
           M  G DV VPNVWRPLP++L   Q YDLNSW ES+  L LA  LDED VIVEGY EY TW
Sbjct: 229 MHHGKDVIVPNVWRPLPDWLGNIQPYDLNSWQESEGGLQLADSLDEDAVIVEGYPEYATW 288

Query: 242 RVHLGYIREEDGDPKSTIDLDGVGGVSILAKAQLFRNGVHFPAFTFENHAETEAFGKMAK 301
           R HL Y+R+ +GDP+  ++LDG+GGVSIL+KA++FR+G HFPAF+FE HAETEAFGK+++
Sbjct: 289 RPHLAYMRDPNGDPEEEMELDGIGGVSILSKAKVFRSGSHFPAFSFEKHAETEAFGKLSR 348

Query: 302 KMGYSVAGLPHYTLWHIYEPSDDDLIQVRERERESKRQ 339
           +M Y+V GLPHY +WHIYEPS +DL  +     E KR+
Sbjct: 349 RMNYNVVGLPHYVVWHIYEPSTEDLKHMAWMAEEEKRK 386

>CAGL0L01331g Chr12 complement(151156..152499) [1344 bp, 447 aa]
           {ON} highly similar to uniprot|P32629 Saccharomyces
           cerevisiae YEL036c ANP1 required for protein
           glycosylation in the golgi
          Length = 447

 Score =  348 bits (893), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 173/338 (51%), Positives = 220/338 (65%), Gaps = 50/338 (14%)

Query: 2   VPLRNAQKVLPLMFKNLMNLTYPHELIDLAFLVSDCSEDDRTFEALLEYAKELQSGTLSQ 61
           VPLR+A + LP+ F +L  +TYPH LIDL+FLVSD S  D T   L+ + ++ Q      
Sbjct: 79  VPLRDAAEHLPMFFDHLNAMTYPHHLIDLSFLVSDSS--DNTMGVLMHHLQQAQ------ 130

Query: 62  VFASHNSGENVLREEGSSDLFLKYMRPSYLKMVKDAFTPPFHKNYDKPFRSVQIFQKNFG 121
                                                     K+ +K F +++IF+K+FG
Sbjct: 131 ------------------------------------------KDKNKRFGNIEIFEKDFG 148

Query: 122 QVIGQTFSDRHAVKVQGTRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIEDL 181
           Q+IGQ+FSDRH    QG RRKLM RARNWL + A+KPYHSWVYWRD DVE+ P S++EDL
Sbjct: 149 QIIGQSFSDRHGFAAQGPRRKLMARARNWLGSVAIKPYHSWVYWRDVDVEVIPRSIMEDL 208

Query: 182 MATGYDVTVPNVWRPLPEFLSGEQAYDLNSWVESDIALDLAKQLDEDDVIVEGYAEYPTW 241
           M    DV VPNVWRPLP++L   Q YDLNSWVES+  L LA  L ED VIVEGY EY TW
Sbjct: 209 MHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWVESEGGLQLADTLSEDSVIVEGYPEYATW 268

Query: 242 RVHLGYIREEDGDPKSTIDLDGVGGVSILAKAQLFRNGVHFPAFTFENHAETEAFGKMAK 301
           R HL Y+R+ +G+P+  + LDG+GGVSIL+KA++FR G HFPAF+F+ HAETEAFGK+++
Sbjct: 269 RTHLAYMRDPNGNPEDEMMLDGIGGVSILSKARVFRAGSHFPAFSFQKHAETEAFGKLSR 328

Query: 302 KMGYSVAGLPHYTLWHIYEPSDDDLIQVRERERESKRQ 339
           +MG+ V GLPHY +WHIYEPS DDL  +     E KR+
Sbjct: 329 RMGFDVVGLPHYVIWHIYEPSTDDLKYMAWMAEEEKRK 366

>NCAS0G04110 Chr7 (766896..768380) [1485 bp, 494 aa] {ON} Anc_1.479
          Length = 494

 Score =  348 bits (892), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 172/338 (50%), Positives = 220/338 (65%), Gaps = 48/338 (14%)

Query: 2   VPLRNAQKVLPLMFKNLMNLTYPHELIDLAFLVSDCSEDDRTFEALLEYAKELQSGTLSQ 61
           VPLR+A + LP+ F +L  +TYPH LIDL+FLVSD S  D T   LL   +  QS     
Sbjct: 107 VPLRDAAEHLPMFFDHLNKMTYPHNLIDLSFLVSDSS--DNTMGVLLSNLQNAQS----- 159

Query: 62  VFASHNSGENVLREEGSSDLFLKYMRPSYLKMVKDAFTPPFHKNYDKPFRSVQIFQKNFG 121
                                                     ++  K F +++IF+K+FG
Sbjct: 160 -----------------------------------------QQDRSKRFGNIEIFEKDFG 178

Query: 122 QVIGQTFSDRHAVKVQGTRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIEDL 181
           Q+IGQ+FSDRH  K QG RRKLM RARNWL + A+KPYHSWVYWRD DVE  P +++EDL
Sbjct: 179 QIIGQSFSDRHGFKAQGPRRKLMARARNWLGSVAIKPYHSWVYWRDVDVETIPRTIMEDL 238

Query: 182 MATGYDVTVPNVWRPLPEFLSGEQAYDLNSWVESDIALDLAKQLDEDDVIVEGYAEYPTW 241
           M    DV VPNVWRPLP++L   Q YDLNSW ES+  L LA  LDED VIVEGY EY TW
Sbjct: 239 MHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWQESEGGLQLANSLDEDAVIVEGYPEYATW 298

Query: 242 RVHLGYIREEDGDPKSTIDLDGVGGVSILAKAQLFRNGVHFPAFTFENHAETEAFGKMAK 301
           R HL Y+R+ +G+P+  ++L+G+GGVSIL+KA++FR+G HFPAF+FE HAETEAFGK+++
Sbjct: 299 RPHLAYMRDPNGNPEDEMELNGIGGVSILSKAKVFRSGSHFPAFSFEKHAETEAFGKLSR 358

Query: 302 KMGYSVAGLPHYTLWHIYEPSDDDLIQVRERERESKRQ 339
           +M ++V GLPHY +WHIYEPS +DL  +     E KR+
Sbjct: 359 RMNFNVIGLPHYVIWHIYEPSKEDLKHMAWMAEEEKRK 396

>TPHA0O00430 Chr15 (76318..77964) [1647 bp, 548 aa] {ON} Anc_1.479
           YEL036C
          Length = 548

 Score =  348 bits (893), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 170/325 (52%), Positives = 215/325 (66%), Gaps = 48/325 (14%)

Query: 2   VPLRNAQKVLPLMFKNLMNLTYPHELIDLAFLVSDCSEDDRTFEALLEYAKELQSGTLSQ 61
           VPLR+A + LP  F +L  ++YPH LIDL+FLVSD S+D  T   LL   +  QS     
Sbjct: 90  VPLRDAAQHLPRFFDHLDKMSYPHNLIDLSFLVSDSSDD--TMGVLLSNLQTAQS----- 142

Query: 62  VFASHNSGENVLREEGSSDLFLKYMRPSYLKMVKDAFTPPFHKNYDKPFRSVQIFQKNFG 121
                                                     ++  K F +++I++K+FG
Sbjct: 143 -----------------------------------------QRDKSKRFGNIEIYEKDFG 161

Query: 122 QVIGQTFSDRHAVKVQGTRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIEDL 181
           QVIGQ+FSDRH    QG RRKLM RARNWL + ALKPYHSWVYWRD D+E  P +++EDL
Sbjct: 162 QVIGQSFSDRHGFAGQGPRRKLMARARNWLGSVALKPYHSWVYWRDVDIETAPRTIMEDL 221

Query: 182 MATGYDVTVPNVWRPLPEFLSGEQAYDLNSWVESDIALDLAKQLDEDDVIVEGYAEYPTW 241
           M    D+ VPNVWRPLP++L   Q YDLNSW ES+  L LA QL+ED VIVEGY EY TW
Sbjct: 222 MHHDKDIIVPNVWRPLPDWLGNIQPYDLNSWQESEGGLQLANQLNEDAVIVEGYPEYATW 281

Query: 242 RVHLGYIREEDGDPKSTIDLDGVGGVSILAKAQLFRNGVHFPAFTFENHAETEAFGKMAK 301
           R HL Y+R+ +GDP+  ++LDG+GGVSIL+KA +FR+G HFPAF+FE HAETEAFGK+++
Sbjct: 282 RPHLAYMRDPNGDPEVEMELDGIGGVSILSKANVFRSGSHFPAFSFEKHAETEAFGKLSR 341

Query: 302 KMGYSVAGLPHYTLWHIYEPSDDDL 326
           +MGY+V GLPHY +WHIYEPS +DL
Sbjct: 342 RMGYNVIGLPHYVVWHIYEPSTEDL 366

>KLLA0E22155g Chr5 complement(1976362..1977714) [1353 bp, 450 aa]
           {ON} similar to uniprot|P32629 Saccharomyces cerevisiae
           YEL036C ANP1 Mannan 8 Protein of the endoplasmic
           reticulum with a role in retention of
           glycosyltransferases in the Golgi also involved in
           osmotic sensitivity and resistance to aminonitrophenyl
           propanediol subunit of mannosyltransferase complex
          Length = 450

 Score =  345 bits (884), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 172/338 (50%), Positives = 216/338 (63%), Gaps = 48/338 (14%)

Query: 2   VPLRNAQKVLPLMFKNLMNLTYPHELIDLAFLVSDCSEDDRTFEALLEYAKELQSGTLSQ 61
           VPLR+A   L + F  L  LTYPH LIDL+FLVSD S+D  T + LL + +  QS     
Sbjct: 82  VPLRDAAAHLDMFFDTLDKLTYPHNLIDLSFLVSDSSDD--TMKTLLSHLRRAQS----- 134

Query: 62  VFASHNSGENVLREEGSSDLFLKYMRPSYLKMVKDAFTPPFHKNYDKPFRSVQIFQKNFG 121
                                                    +++  + F +++IF+K+FG
Sbjct: 135 -----------------------------------------NQDKSRRFANIEIFEKDFG 153

Query: 122 QVIGQTFSDRHAVKVQGTRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIEDL 181
           Q +GQ+FSDRH    QG RRK M RARNWL + ALKPYHS+VYWRD DV+  P +++EDL
Sbjct: 154 QSVGQSFSDRHGFAAQGPRRKSMARARNWLGSAALKPYHSYVYWRDVDVQTIPNTILEDL 213

Query: 182 MATGYDVTVPNVWRPLPEFLSGEQAYDLNSWVESDIALDLAKQLDEDDVIVEGYAEYPTW 241
           M    DV VPNVWRPLP++L   Q YDLNSWVES+  L LA  LDED  IVEGY EY TW
Sbjct: 214 MHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWVESEGGLQLADSLDEDACIVEGYPEYATW 273

Query: 242 RVHLGYIREEDGDPKSTIDLDGVGGVSILAKAQLFRNGVHFPAFTFENHAETEAFGKMAK 301
           R HL Y+R+  GDP+  ++LDG+GGVSIL+KA++FR G HFPAF+FE HAETEAFGK+++
Sbjct: 274 RTHLAYMRDPSGDPEVEMELDGIGGVSILSKAKVFRTGSHFPAFSFEKHAETEAFGKLSR 333

Query: 302 KMGYSVAGLPHYTLWHIYEPSDDDLIQVRERERESKRQ 339
           +M YSV GLPHY +WHIYEPS DDL  +     E KR+
Sbjct: 334 RMQYSVVGLPHYVIWHIYEPSSDDLKHMAWMAEEEKRR 371

>KAFR0I02770 Chr9 (559196..560563) [1368 bp, 455 aa] {ON} Anc_1.479
           YEL036C
          Length = 455

 Score =  345 bits (884), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 171/338 (50%), Positives = 220/338 (65%), Gaps = 48/338 (14%)

Query: 2   VPLRNAQKVLPLMFKNLMNLTYPHELIDLAFLVSDCSEDDRTFEALLEYAKELQSGTLSQ 61
           VPLR+A + LP+ F++L  +TYPH  IDL+FLVSD S+D  T   LL + +  QS     
Sbjct: 87  VPLRDAAEHLPMFFEHLNLMTYPHNFIDLSFLVSDSSDD--TMGVLLSHLQSAQS----- 139

Query: 62  VFASHNSGENVLREEGSSDLFLKYMRPSYLKMVKDAFTPPFHKNYDKPFRSVQIFQKNFG 121
                                                      +  K F +++I++K+FG
Sbjct: 140 -----------------------------------------QMDKSKRFGNIEIYEKDFG 158

Query: 122 QVIGQTFSDRHAVKVQGTRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIEDL 181
           Q+IGQ+FSDRH    QG RRKLM RARNWL + ALKPYHSWVYWRD DVE  P +++EDL
Sbjct: 159 QIIGQSFSDRHGFAAQGPRRKLMARARNWLGSVALKPYHSWVYWRDVDVETVPRTIMEDL 218

Query: 182 MATGYDVTVPNVWRPLPEFLSGEQAYDLNSWVESDIALDLAKQLDEDDVIVEGYAEYPTW 241
           M    DV VPNVWRPLP++L   Q YDLNSW ES+  L LA+ L+ED VIVEGY EY TW
Sbjct: 219 MHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWQESEGGLQLAEALEEDAVIVEGYPEYATW 278

Query: 242 RVHLGYIREEDGDPKSTIDLDGVGGVSILAKAQLFRNGVHFPAFTFENHAETEAFGKMAK 301
           R HL Y+R+ +GDP+  ++LDG+GGVSIL+KA++FR G HFPAF+FE HAETEAFG++++
Sbjct: 279 RPHLAYMRDPNGDPEEEMELDGIGGVSILSKAKVFRTGSHFPAFSFEKHAETEAFGRLSR 338

Query: 302 KMGYSVAGLPHYTLWHIYEPSDDDLIQVRERERESKRQ 339
           +M Y+V GLPHY +WHIYEPS +DL  +     E KR+
Sbjct: 339 RMNYNVVGLPHYVIWHIYEPSTEDLKHMAWMAEEEKRR 376

>YEL036C Chr5 complement(83050..84552) [1503 bp, 500 aa] {ON}
           ANP1Subunit of the alpha-1,6 mannosyltransferase
           complex; type II membrane protein; has a role in
           retention of glycosyltransferases in the Golgi; involved
           in osmotic sensitivity and resistance to
           aminonitrophenyl propanediol
          Length = 500

 Score =  346 bits (887), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 171/325 (52%), Positives = 213/325 (65%), Gaps = 48/325 (14%)

Query: 2   VPLRNAQKVLPLMFKNLMNLTYPHELIDLAFLVSDCSEDDRTFEALLEYAKELQSGTLSQ 61
           VPLR+A + LP+ F +L  +TYPH LIDL+FLVSD S  D T   LL   +  QS     
Sbjct: 87  VPLRDASEHLPMFFNHLNTMTYPHNLIDLSFLVSDSS--DNTMGVLLSNLQMAQS----- 139

Query: 62  VFASHNSGENVLREEGSSDLFLKYMRPSYLKMVKDAFTPPFHKNYDKPFRSVQIFQKNFG 121
                                                     ++  K F +++I++K+FG
Sbjct: 140 -----------------------------------------QQDKSKRFGNIEIYEKDFG 158

Query: 122 QVIGQTFSDRHAVKVQGTRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIEDL 181
           Q+IGQ+FSDRH    QG RRKLM RARNWL + ALKPYHSWVYWRD DVE  P +++EDL
Sbjct: 159 QIIGQSFSDRHGFGAQGPRRKLMARARNWLGSVALKPYHSWVYWRDVDVETIPTTIMEDL 218

Query: 182 MATGYDVTVPNVWRPLPEFLSGEQAYDLNSWVESDIALDLAKQLDEDDVIVEGYAEYPTW 241
           M    DV VPNVWRPLP++L   Q YDLNSW ES+  L LA  LDED VIVEGY EY TW
Sbjct: 219 MHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWKESEGGLQLADSLDEDAVIVEGYPEYATW 278

Query: 242 RVHLGYIREEDGDPKSTIDLDGVGGVSILAKAQLFRNGVHFPAFTFENHAETEAFGKMAK 301
           R HL Y+R+ +G+P+  ++LDG+GGVSILAKA++FR G HFPAF+FE HAETEAFG++++
Sbjct: 279 RPHLAYMRDPNGNPEDEMELDGIGGVSILAKAKVFRTGSHFPAFSFEKHAETEAFGRLSR 338

Query: 302 KMGYSVAGLPHYTLWHIYEPSDDDL 326
           +M Y+V GLPHY +WHIYEPS DDL
Sbjct: 339 RMNYNVIGLPHYVIWHIYEPSSDDL 363

>NDAI0B01250 Chr2 complement(293756..295096) [1341 bp, 446 aa] {ON}
           Anc_1.479
          Length = 446

 Score =  344 bits (882), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 175/336 (52%), Positives = 217/336 (64%), Gaps = 51/336 (15%)

Query: 2   VPLRNAQKVLPLMFKNLMNLTYPHELIDLAFLVSDCSEDDRTFEALLEYAKELQSGTLSQ 61
           VPL++A   LPL FK L  +TYPHELIDL+FLVSD S  D T   LL   K LQ      
Sbjct: 80  VPLKDASNALPLFFKTLEKMTYPHELIDLSFLVSDSS--DNTMYNLLNMLKRLQ------ 131

Query: 62  VFASHNSGENVLREEGSSDLFLKYMRPSYLKMVKDAFTPPFHKNYDKPFRSVQIFQKNFG 121
                 SG+                                       F +++I++K+FG
Sbjct: 132 -IDGGTSGK---------------------------------------FGNIEIYEKDFG 151

Query: 122 QVIGQTFSDRHAVKVQGTRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIEDL 181
           QVIGQ FSDRH    QG RRKLMG+ARNWL   A+KPYHSWVYWRD DVE+ P +++EDL
Sbjct: 152 QVIGQGFSDRHGFAAQGPRRKLMGKARNWLNTVAIKPYHSWVYWRDVDVEIIPETILEDL 211

Query: 182 MATGYDVTVPNVWRPLPEFLSGEQAYDLNSWVESDIALDLAKQLDEDDVIVEGYAEYPTW 241
           M    DV VPNVWRPLP++L   Q YDLNSW ES+  L L+  L ED VIVEGY EY TW
Sbjct: 212 MHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWKESEAGLALSNSLGEDAVIVEGYPEYATW 271

Query: 242 RVHLGYIREEDGDPKSTIDLDGVGGVSILAKAQLFRNGVHFPAFTFENHAETEAFGKMAK 301
           R HL Y+R+ +GDP+  ++LDGVGGVSIL+KA +FR+G HFPAF+F+ HAETEAFGK++K
Sbjct: 272 RSHLAYMRDPNGDPEREMELDGVGGVSILSKANVFRSGSHFPAFSFKKHAETEAFGKLSK 331

Query: 302 KMGYSVAGLPHYTLWHIYEPSDDDL---IQVRERER 334
            M ++V GLP+Y +WHIYEPS +DL    ++ E+ER
Sbjct: 332 HMNFTVIGLPNYVVWHIYEPSKEDLQYMAKLEEKER 367

>Smik_5.57 Chr5 complement(85152..86627) [1476 bp, 491 aa] {ON}
           YEL036C (REAL)
          Length = 491

 Score =  345 bits (884), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 170/325 (52%), Positives = 213/325 (65%), Gaps = 48/325 (14%)

Query: 2   VPLRNAQKVLPLMFKNLMNLTYPHELIDLAFLVSDCSEDDRTFEALLEYAKELQSGTLSQ 61
           VPLR+A + LP+ F +L  +TYPH LIDL+FLVSD S  D T   LL    + QS     
Sbjct: 87  VPLRDASEHLPMFFNHLNTMTYPHNLIDLSFLVSDSS--DNTMGVLLSNLHKAQS----- 139

Query: 62  VFASHNSGENVLREEGSSDLFLKYMRPSYLKMVKDAFTPPFHKNYDKPFRSVQIFQKNFG 121
                                                     ++  K F +++I++K+FG
Sbjct: 140 -----------------------------------------QQDKSKRFGNIEIYEKDFG 158

Query: 122 QVIGQTFSDRHAVKVQGTRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIEDL 181
           Q+IGQ+FSDRH    QG RRKLM RARNWL + ALKPYHSWVYWRD DVE  P +++EDL
Sbjct: 159 QIIGQSFSDRHGFGAQGPRRKLMARARNWLGSVALKPYHSWVYWRDVDVETIPTTIMEDL 218

Query: 182 MATGYDVTVPNVWRPLPEFLSGEQAYDLNSWVESDIALDLAKQLDEDDVIVEGYAEYPTW 241
           M    DV VPNVWRPLP++L   Q YDLNSW ES+  L LA  L+ED VIVEGY EY TW
Sbjct: 219 MHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWKESEGGLQLADALEEDAVIVEGYPEYATW 278

Query: 242 RVHLGYIREEDGDPKSTIDLDGVGGVSILAKAQLFRNGVHFPAFTFENHAETEAFGKMAK 301
           R HL Y+R+ +G+P+  ++LDG+GGVSILAKA++FR G HFPAF+FE HAETEAFG++++
Sbjct: 279 RPHLAYMRDPNGNPEDEMELDGIGGVSILAKAKVFRTGSHFPAFSFEKHAETEAFGRLSR 338

Query: 302 KMGYSVAGLPHYTLWHIYEPSDDDL 326
           +M Y+V GLPHY +WHIYEPS DDL
Sbjct: 339 RMNYNVIGLPHYVIWHIYEPSSDDL 363

>Skud_5.54 Chr5 complement(81169..82644) [1476 bp, 491 aa] {ON}
           YEL036C (REAL)
          Length = 491

 Score =  344 bits (883), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 169/325 (52%), Positives = 213/325 (65%), Gaps = 48/325 (14%)

Query: 2   VPLRNAQKVLPLMFKNLMNLTYPHELIDLAFLVSDCSEDDRTFEALLEYAKELQSGTLSQ 61
           VPLR+A + LP+ F +L  ++YPH LIDL+FLVSD S  D T   LL   +  QS     
Sbjct: 87  VPLRDASEHLPMFFNHLNTMSYPHNLIDLSFLVSDSS--DNTMGVLLSSLQTAQS----- 139

Query: 62  VFASHNSGENVLREEGSSDLFLKYMRPSYLKMVKDAFTPPFHKNYDKPFRSVQIFQKNFG 121
                                                     ++  K F +++I++K+FG
Sbjct: 140 -----------------------------------------QQDKSKRFGNIEIYEKDFG 158

Query: 122 QVIGQTFSDRHAVKVQGTRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIEDL 181
           Q+IGQ+FSDRH    QG RRKLM RARNWL + ALKPYHSWVYWRD DV+  P +++EDL
Sbjct: 159 QIIGQSFSDRHGFGAQGPRRKLMARARNWLGSVALKPYHSWVYWRDVDVQTIPTTIMEDL 218

Query: 182 MATGYDVTVPNVWRPLPEFLSGEQAYDLNSWVESDIALDLAKQLDEDDVIVEGYAEYPTW 241
           M    DV VPNVWRPLP++L   Q YDLNSW ES+  L LA  LDED VIVEGY EY TW
Sbjct: 219 MHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWKESEGGLQLADALDEDAVIVEGYPEYATW 278

Query: 242 RVHLGYIREEDGDPKSTIDLDGVGGVSILAKAQLFRNGVHFPAFTFENHAETEAFGKMAK 301
           R HL Y+R+ +G+P+  ++LDG+GGVSILAKA++FR G HFPAF+FE HAETEAFG++++
Sbjct: 279 RPHLAYMRDPNGNPEDEMELDGIGGVSILAKAKVFRTGSHFPAFSFEKHAETEAFGRLSR 338

Query: 302 KMGYSVAGLPHYTLWHIYEPSDDDL 326
           +M Y+V GLPHY +WHIYEPS DDL
Sbjct: 339 RMNYNVIGLPHYVIWHIYEPSSDDL 363

>NDAI0G00340 Chr7 complement(56898..58412) [1515 bp, 504 aa] {ON}
           Anc_1.479 YEL036C
          Length = 504

 Score =  345 bits (884), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 171/325 (52%), Positives = 213/325 (65%), Gaps = 48/325 (14%)

Query: 2   VPLRNAQKVLPLMFKNLMNLTYPHELIDLAFLVSDCSEDDRTFEALLEYAKELQSGTLSQ 61
           VPLR+A + LP+ F +L  ++YPH  IDL+FLVSD S+D  T   LL   +  QS     
Sbjct: 112 VPLRDAAEHLPMFFDHLNKMSYPHNSIDLSFLVSDSSDD--TMGVLLSNLQNAQS----- 164

Query: 62  VFASHNSGENVLREEGSSDLFLKYMRPSYLKMVKDAFTPPFHKNYDKPFRSVQIFQKNFG 121
                                                     ++  K F +++IF+K+FG
Sbjct: 165 -----------------------------------------QQDKSKRFGNIEIFEKDFG 183

Query: 122 QVIGQTFSDRHAVKVQGTRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIEDL 181
           QVIGQ+FSDRH    QG RRKLM RARNWL + A+KPYHSWVYWRD DVE  P +++EDL
Sbjct: 184 QVIGQSFSDRHGFAAQGPRRKLMARARNWLGSVAIKPYHSWVYWRDVDVETIPRTIMEDL 243

Query: 182 MATGYDVTVPNVWRPLPEFLSGEQAYDLNSWVESDIALDLAKQLDEDDVIVEGYAEYPTW 241
           M    DV VPNVWRPLP++L   Q YDLNSW ES+  L LA  L EDDVIVEGY EY TW
Sbjct: 244 MHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWKESEGGLQLADTLGEDDVIVEGYPEYATW 303

Query: 242 RVHLGYIREEDGDPKSTIDLDGVGGVSILAKAQLFRNGVHFPAFTFENHAETEAFGKMAK 301
           R HL Y+R+ +G+P+  ++LDG+GGVSILAKA++FR G HFPAF+FE HAETEAFGK+++
Sbjct: 304 RSHLAYMRDPNGNPEDEMELDGIGGVSILAKAKVFRTGSHFPAFSFEKHAETEAFGKLSR 363

Query: 302 KMGYSVAGLPHYTLWHIYEPSDDDL 326
           KM Y+V GLPHY +WHIYEPS +DL
Sbjct: 364 KMNYNVIGLPHYVIWHIYEPSKEDL 388

>TDEL0C02600 Chr3 complement(450202..451590) [1389 bp, 462 aa] {ON}
           Anc_1.479 YEL036C
          Length = 462

 Score =  343 bits (879), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 172/339 (50%), Positives = 219/339 (64%), Gaps = 49/339 (14%)

Query: 1   MVPLRNAQKVLPLMFKNLMNLTYPHELIDLAFLVSDCSEDDRTFEALLEYAKELQSGTLS 60
           +VPLR+A + LP  F ++  L+YPH LID++FLVSD S+D  T   LL + +  QS    
Sbjct: 81  LVPLRDAAQHLPRFFGHMSELSYPHNLIDMSFLVSDSSDD--TMGELLHHLQIAQS---- 134

Query: 61  QVFASHNSGENVLREEGSSDLFLKYMRPSYLKMVKDAFTPPFHKNYDKPFRSVQIFQKNF 120
                                                      K+ +K F +++IF+K+F
Sbjct: 135 ------------------------------------------QKDRNKRFGNIEIFEKDF 152

Query: 121 GQVIGQTFSDRHAVKVQGTRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIED 180
           GQ IGQ+FSDRH    QG RRKLM RARNWL +  LKPYHSWVYWRD DVE+ P S++ED
Sbjct: 153 GQAIGQSFSDRHGFAAQGPRRKLMARARNWLGSVTLKPYHSWVYWRDVDVEIAPISIMED 212

Query: 181 LMATGYDVTVPNVWRPLPEFLSGEQAYDLNSWVESDIALDLAKQL-DEDDVIVEGYAEYP 239
           LM    DV VPNVWRPLP++L   Q YDLNSW ES+  + LA  L DED VIVEGY E+ 
Sbjct: 213 LMHHDRDVIVPNVWRPLPDWLGNIQPYDLNSWKESEAGIQLANTLTDEDSVIVEGYPEFA 272

Query: 240 TWRVHLGYIREEDGDPKSTIDLDGVGGVSILAKAQLFRNGVHFPAFTFENHAETEAFGKM 299
           TWR HL Y+R+ +G+P+  ++LDG+GGVSILAKA++FR G HFPAF+FE HAETEAFGK+
Sbjct: 273 TWRTHLAYMRDPNGNPEDEMELDGIGGVSILAKAKVFRTGSHFPAFSFEKHAETEAFGKL 332

Query: 300 AKKMGYSVAGLPHYTLWHIYEPSDDDLIQVRERERESKR 338
           +++M Y+V GLPHY +WHIYEPS +DL  +     E KR
Sbjct: 333 SRRMNYNVVGLPHYVIWHIYEPSTEDLKHMAWMAEEEKR 371

>Suva_5.33 Chr5 complement(58480..59967) [1488 bp, 495 aa] {ON}
           YEL036C (REAL)
          Length = 495

 Score =  343 bits (881), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 170/325 (52%), Positives = 213/325 (65%), Gaps = 48/325 (14%)

Query: 2   VPLRNAQKVLPLMFKNLMNLTYPHELIDLAFLVSDCSEDDRTFEALLEYAKELQSGTLSQ 61
           VPLR+A + LP+ F +L  ++YPH LIDL+FLVSD S  D T   LL   +  QS     
Sbjct: 87  VPLRDASEHLPMFFDHLNAMSYPHNLIDLSFLVSDSS--DNTMGVLLSKLQMAQS----- 139

Query: 62  VFASHNSGENVLREEGSSDLFLKYMRPSYLKMVKDAFTPPFHKNYDKPFRSVQIFQKNFG 121
                                                     ++  K F +++I++K+FG
Sbjct: 140 -----------------------------------------QQDKTKRFGNIEIYEKDFG 158

Query: 122 QVIGQTFSDRHAVKVQGTRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIEDL 181
           Q+IGQ+FSDRH    QG RRKLM RARNWL + ALKPYHSWVYWRD DVE  P +++EDL
Sbjct: 159 QIIGQSFSDRHGFGAQGPRRKLMARARNWLGSVALKPYHSWVYWRDVDVETIPTTIMEDL 218

Query: 182 MATGYDVTVPNVWRPLPEFLSGEQAYDLNSWVESDIALDLAKQLDEDDVIVEGYAEYPTW 241
           M    DV VPNVWRPLP++L   Q YDLNSW ES+  L LA  LDED VIVEGY EY TW
Sbjct: 219 MHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWKESEGGLQLANALDEDAVIVEGYPEYATW 278

Query: 242 RVHLGYIREEDGDPKSTIDLDGVGGVSILAKAQLFRNGVHFPAFTFENHAETEAFGKMAK 301
           R HL Y+R+ +G+P+  ++LDG+GGVSILAKA++FR G HFPAF+FE HAETEAFG++++
Sbjct: 279 RPHLAYMRDPNGNPEDEMELDGIGGVSILAKAKVFRTGSHFPAFSFEKHAETEAFGRLSR 338

Query: 302 KMGYSVAGLPHYTLWHIYEPSDDDL 326
           +M Y+V GLPHY +WHIYEPS DDL
Sbjct: 339 RMNYNVIGLPHYVIWHIYEPSSDDL 363

>Kpol_370.5 s370 (7329..9266) [1938 bp, 645 aa] {ON} (7329..9266)
           [1938 nt, 646 aa]
          Length = 645

 Score =  348 bits (892), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 165/325 (50%), Positives = 218/325 (67%), Gaps = 48/325 (14%)

Query: 2   VPLRNAQKVLPLMFKNLMNLTYPHELIDLAFLVSDCSEDDRTFEALLEYAKELQSGTLSQ 61
           +PLR+A + LP+ F ++  +TYPH L+DL+FLVSD S+D  T   LL + + +QS     
Sbjct: 91  IPLRDAAQHLPMFFDHMNKMTYPHNLVDLSFLVSDSSDD--TMGVLLSHLQTVQS----- 143

Query: 62  VFASHNSGENVLREEGSSDLFLKYMRPSYLKMVKDAFTPPFHKNYDKPFRSVQIFQKNFG 121
                                                     ++  K F +++I++K+FG
Sbjct: 144 -----------------------------------------QQDKSKRFGNIEIYEKDFG 162

Query: 122 QVIGQTFSDRHAVKVQGTRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIEDL 181
           Q+IGQ+FSDRH    QG RRKLM +ARNWL + ALKPYHSWVYWRD D+E  P +++EDL
Sbjct: 163 QIIGQSFSDRHGFAAQGPRRKLMAKARNWLGSVALKPYHSWVYWRDVDIETAPVTIMEDL 222

Query: 182 MATGYDVTVPNVWRPLPEFLSGEQAYDLNSWVESDIALDLAKQLDEDDVIVEGYAEYPTW 241
           M    D+ VPNVWRPLP++L   Q YDLNSW ES+  L LA QLDE+ VIVEGY EY TW
Sbjct: 223 MHHDKDIIVPNVWRPLPDWLGNIQPYDLNSWQESEGGLQLANQLDENAVIVEGYPEYATW 282

Query: 242 RVHLGYIREEDGDPKSTIDLDGVGGVSILAKAQLFRNGVHFPAFTFENHAETEAFGKMAK 301
           R HL Y+R+ +GDP+  ++LDG+GGVSIL+KA++FR+G HFPAF+FE HAETEAFGK+++
Sbjct: 283 RPHLAYMRDPNGDPEDEMELDGIGGVSILSKAKVFRSGSHFPAFSFEKHAETEAFGKLSR 342

Query: 302 KMGYSVAGLPHYTLWHIYEPSDDDL 326
           +M Y+V GLPHY +WHIYEPS +DL
Sbjct: 343 RMNYNVVGLPHYVVWHIYEPSTEDL 367

>ZYRO0F05170g Chr6 (432802..434628) [1827 bp, 608 aa] {ON} similar
           to uniprot|P32629 Saccharomyces cerevisiae YEL036C ANP1
           Mannan 8 Protein of the endoplasmic reticulum with a
           role in retention of glycosyltransferases in the Golgi
           also involved in osmotic sensitivity and resistance to
           aminonitrophenyl propanediol subunit of
           mannosyltransferase complex
          Length = 608

 Score =  343 bits (880), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 168/327 (51%), Positives = 217/327 (66%), Gaps = 49/327 (14%)

Query: 1   MVPLRNAQKVLPLMFKNLMNLTYPHELIDLAFLVSDCSEDDRTFEALLEYAKELQSGTLS 60
           +VPLR+A + LP  F ++  +TYPH LID +FLVSD S+D  T  ALL + ++ QS    
Sbjct: 87  LVPLRDAAEHLPRFFNHMDKMTYPHNLIDFSFLVSDSSDD--TMGALLSHLEKAQS---- 140

Query: 61  QVFASHNSGENVLREEGSSDLFLKYMRPSYLKMVKDAFTPPFHKNYDKPFRSVQIFQKNF 120
                                                     +K+  + F +++I++K+F
Sbjct: 141 ------------------------------------------NKDKTRRFGNIEIYEKDF 158

Query: 121 GQVIGQTFSDRHAVKVQGTRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIED 180
           GQ IGQ+FSDRH    QG RRKLM RARNWL   ALK YHSWVYWRD DVELCP S++ED
Sbjct: 159 GQAIGQSFSDRHGFDAQGPRRKLMARARNWLGTVALKAYHSWVYWRDVDVELCPQSIMED 218

Query: 181 LMATGYDVTVPNVWRPLPEFLSGEQAYDLNSWVESDIALDLAKQLDEDD-VIVEGYAEYP 239
           LM    DV VPNVWRPLP++L   Q YDLNSW ES++ + LA  L +DD VIVEGY +Y 
Sbjct: 219 LMHHDRDVIVPNVWRPLPDWLGNIQPYDLNSWKESEVGVQLADSLPDDDAVIVEGYPDYS 278

Query: 240 TWRVHLGYIREEDGDPKSTIDLDGVGGVSILAKAQLFRNGVHFPAFTFENHAETEAFGKM 299
           TWR HL Y+R+ +G+P+  ++LDG+GGVSIL+K ++FR G HFPAF+FE HAETEAFGK+
Sbjct: 279 TWRTHLAYMRDPNGNPEDELELDGIGGVSILSKGKVFRTGSHFPAFSFEKHAETEAFGKL 338

Query: 300 AKKMGYSVAGLPHYTLWHIYEPSDDDL 326
           +++MGY+V GLPHY +WHIYEPS +DL
Sbjct: 339 SRRMGYNVVGLPHYVIWHIYEPSTEDL 365

>KLLA0E12849g Chr5 complement(1138282..1139460) [1179 bp, 392 aa]
           {ON} highly similar to uniprot|P39107 Saccharomyces
           cerevisiae YPL050C MNN9 Subunit of Golgi
           mannosyltransferase complex also containing Anp1p Mnn10p
           Mnn11p and Hoc1p that mediates elongation of the
           polysaccharide mannan backbone forms a separate complex
           with Van1p that is also involved in backbone elongation
          Length = 392

 Score =  180 bits (457), Expect = 7e-53,   Method: Compositional matrix adjust.
 Identities = 113/332 (34%), Positives = 171/332 (51%), Gaps = 65/332 (19%)

Query: 4   LRNAQKVLPLM---------FKNLMNLTYPHELIDLAFLVSDCSEDDRTFEALLEYAKEL 54
           L N ++VL L          + NL++LTYP  LI+L F++   +  D   + L    +E+
Sbjct: 111 LVNKERVLILTPMQTFHQQYWNNLLSLTYPRALIELGFIIPRTASGDAALQKLESAVREV 170

Query: 55  QSGTLSQVFASHNSGENVLREEGSSDLFLKYMRPSYLKMVKDAFTPPFHKNYDKPFRSVQ 114
           Q+G   + FA       +LR+   S                          +D+      
Sbjct: 171 QTGKQDKRFAK----ITILRQASQS--------------------------FDR------ 194

Query: 115 IFQKNFGQVIGQTFSDRHAVKVQGTRRKLMGRARNWLTANALKPYHSWVYWRDADVELCP 174
                    +G+   DRHA++VQ  RR  M  ARN L  + + P+ SW+ W DAD+   P
Sbjct: 195 ---------LGE--KDRHALEVQKERRAAMALARNELLFSTIGPHTSWILWLDADIVETP 243

Query: 175 GSVIEDLMATGYDVTVPNVWRPLPEFLSGEQA------YDLNSWVESDIALDLAKQLDED 228
            +VI+DL +    V   NV++   +F   +Q       YD N+W ES+I L LA+QL ++
Sbjct: 244 VTVIQDLTSHNKPVLAANVYQ---KFYDKDQKKESIRPYDFNNWAESEIGLKLAQQLGDN 300

Query: 229 DVIVEGYAEYPTWRVHLGYIREEDGDPKSTIDLDGVGGVSILAKAQLFRNGVHFPAFTFE 288
           ++IVEGY+E  T+R  + +  + +G   S ++LDGVGG   L KA++ R+G  F  F F 
Sbjct: 301 EIIVEGYSEIATYRPLMAHFYDANGATNSLMELDGVGGGCTLVKAEVHRDGAMFTNFPFY 360

Query: 289 NHAETEAFGKMAKKMGYSVAGLPHYTLWHIYE 320
           +  ETEAF KMAK++GYSV GLP+Y ++HI E
Sbjct: 361 HLIETEAFAKMAKRLGYSVFGLPNYLVYHIEE 392

>SAKL0H11110g Chr8 complement(957784..958965) [1182 bp, 393 aa] {ON}
           highly similar to uniprot|P39107 Saccharomyces
           cerevisiae YPL050C MNN9 Subunit of Golgi
           mannosyltransferase complex also containing Anp1p Mnn10p
           Mnn11p and Hoc1p that mediates elongation of the
           polysaccharide mannan backbone forms a separate complex
           with Van1p that is also involved in backbone elongation
          Length = 393

 Score =  176 bits (445), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 110/310 (35%), Positives = 152/310 (49%), Gaps = 56/310 (18%)

Query: 17  NLMNLTYPHELIDLAFLVSDCSEDDRTFEALLEYAKELQSGTLSQVFASHNSGENVLREE 76
           NL+ LTYP ELI+L F+V      +   E L    K++Q+G     F        +LR+ 
Sbjct: 132 NLLQLTYPRELIELGFIVPRTGSGNVALEQLEAAVKKVQTGKKEDRFGK----ITILRQA 187

Query: 77  GSSDLFLKYMRPSYLKMVKDAFTPPFHKNYDKPFRSVQIFQKNFGQVIGQTFSDRHAVKV 136
             S                          +DK      + +K           +RHA++V
Sbjct: 188 SQS--------------------------FDK------LLEK-----------ERHALEV 204

Query: 137 QGTRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIEDLMATGYDVTVPNVWRP 196
           Q  RR  M  ARN L  + + PY SW+ W DAD+   P SVIED+ A    V   NV++ 
Sbjct: 205 QKERRAAMALARNELLFSTIGPYTSWILWLDADIVETPPSVIEDMTAHNKPVLAANVYQ- 263

Query: 197 LPEFLSGEQA------YDLNSWVESDIALDLAKQLDEDDVIVEGYAEYPTWRVHLGYIRE 250
              +   EQ       YD N+W ESDI L LA Q+  D+++VEGY E  T+R  + +  E
Sbjct: 264 --RYYDQEQKKESIRPYDYNNWAESDIGLQLASQMSADEILVEGYPEIATYRPLMAHFYE 321

Query: 251 EDGDPKSTIDLDGVGGVSILAKAQLFRNGVHFPAFTFENHAETEAFGKMAKKMGYSVAGL 310
           +       ++LDGVGG   L KA + R+G  FP F F +  ETE F KMAK++GY V GL
Sbjct: 322 DSAPATVEMELDGVGGGCTLVKADVHRDGAMFPNFPFYHLIETEGFAKMAKRLGYEVFGL 381

Query: 311 PHYTLWHIYE 320
           P+Y ++HI E
Sbjct: 382 PNYLVYHIDE 391

>TDEL0B01370 Chr2 complement(242546..243736) [1191 bp, 396 aa] {ON}
           Anc_8.500 YPL050C
          Length = 396

 Score =  174 bits (442), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 108/310 (34%), Positives = 157/310 (50%), Gaps = 50/310 (16%)

Query: 17  NLMNLTYPHELIDLAFLVSDCSEDDRTFEALLEYAKELQSGTLSQVFASHNSGENVLREE 76
           NL+ LTYP ELI+L F+V      D     L E  K++Q+   +Q F        +LR++
Sbjct: 134 NLLQLTYPRELIELGFIVPRTQSGDVALAKLEEAVKKVQTDKKNQRFVK----VTILRQD 189

Query: 77  GSSDLFLKYMRPSYLKMVKDAFTPPFHKNYDKPFRSVQIFQKNFGQVIGQTFSDRHAVKV 136
             S                      F K  +K                     +RHA+ V
Sbjct: 190 SKS----------------------FDKLQEK---------------------ERHALAV 206

Query: 137 QGTRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIEDLMATGYDVTVPNVWRP 196
           Q  RR  M  ARN L  + + P+ SWV W DAD+   P ++I+D+ A    V   NV++ 
Sbjct: 207 QKERRAAMALARNELLFSTIGPHTSWVLWLDADIVEAPPNLIQDMTAHNKPVLAANVYQR 266

Query: 197 LPEFLSGE---QAYDLNSWVESDIALDLAKQLDEDDVIVEGYAEYPTWRVHLGYIREEDG 253
             +    E   +AYD N+W ES+  L+LA Q+ ED++IVEGY+E  T+R  + Y  + +G
Sbjct: 267 YYDEEKKESSIRAYDFNNWAESETGLELASQMAEDEIIVEGYSELATYRPLMAYYYDANG 326

Query: 254 DPKSTIDLDGVGGVSILAKAQLFRNGVHFPAFTFENHAETEAFGKMAKKMGYSVAGLPHY 313
            P + + LDGVGG   L +A + R+G  FP F F +  ETE F KMAK++ + V GLP+Y
Sbjct: 327 SPGAEMALDGVGGGCTLVQADVHRDGAMFPNFPFYHLIETEGFAKMAKRLNHEVFGLPNY 386

Query: 314 TLWHIYEPSD 323
            ++HI E +D
Sbjct: 387 LVYHIEEWND 396

>NDAI0E03020 Chr5 complement(643198..644388) [1191 bp, 396 aa] {ON}
           Anc_8.500
          Length = 396

 Score =  174 bits (440), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 107/327 (32%), Positives = 166/327 (50%), Gaps = 59/327 (18%)

Query: 6   NAQKVLPLM---------FKNLMNLTYPHELIDLAFLVSDCSEDDRTFEALLEYAKELQS 56
           N +KVL L          ++N++ L+YP ELI+L F+V      D   ++L +  ++ Q+
Sbjct: 114 NKEKVLILTPLQKFHQEYWENILQLSYPRELIELGFIVPRTQTGDLALQSLEKAVEKTQT 173

Query: 57  GTLSQVFASHNSGENVLREEGSSDLFLKYMRPSYLKMVKDAFTPPFHKNYDKPFRSVQIF 116
              +Q FA       +LR++  S                      F+K  +K        
Sbjct: 174 DKKNQRFAK----VTILRQDSES----------------------FNKLAEK-------- 199

Query: 117 QKNFGQVIGQTFSDRHAVKVQGTRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGS 176
                        +RHA+ VQ  RR  M  ARN L  + + P+ SWV W DAD+   P +
Sbjct: 200 -------------ERHALNVQKERRSSMALARNELLFSTIGPHTSWVLWLDADIVETPST 246

Query: 177 VIEDLMATGYDVTVPNVWRPL---PEFLSGEQAYDLNSWVESDIALDLAKQLDEDDVIVE 233
           +I+D+ A    V   NV++      +  S  + YD N+W ES+I L+LA ++++D++IVE
Sbjct: 247 LIQDMTAHDKSVLAANVFQRYYDDEKKASATRPYDFNNWQESEIGLELASKMNDDEIIVE 306

Query: 234 GYAEYPTWRVHLGYIREEDGDPKSTIDLDGVGGVSILAKAQLFRNGVHFPAFTFENHAET 293
           GY+E  T+R  + Y  +        + LDGVGG   L KA++ R+G  FP+F F +  ET
Sbjct: 307 GYSEIATYRPLMAYFHDTTKPVSEEMILDGVGGGCTLVKAEVHRDGAMFPSFPFYHLIET 366

Query: 294 EAFGKMAKKMGYSVAGLPHYTLWHIYE 320
           E F KMAK++GY + GLP+Y ++HI E
Sbjct: 367 EGFAKMAKRLGYEIFGLPNYLVYHIEE 393

>KAFR0H01390 Chr8 complement(258984..260180) [1197 bp, 398 aa] {ON}
           Anc_8.500 YPL050C
          Length = 398

 Score =  172 bits (436), Expect = 9e-50,   Method: Compositional matrix adjust.
 Identities = 105/309 (33%), Positives = 156/309 (50%), Gaps = 50/309 (16%)

Query: 15  FKNLMNLTYPHELIDLAFLVSDCSEDDRTFEALLEYAKELQSGTLSQVFASHNSGENVLR 74
           ++NL+ LTYP ELI+L F++      +   + L    K++QS   +Q FA       +LR
Sbjct: 134 WENLLQLTYPRELIELGFIIPRTKTGENALKELEIAIKKVQSDKKNQRFAK----ITILR 189

Query: 75  EEGSSDLFLKYMRPSYLKMVKDAFTPPFHKNYDKPFRSVQIFQKNFGQVIGQTFSDRHAV 134
           ++  S                                        F Q+  +   DRH++
Sbjct: 190 QDSQS----------------------------------------FDQLAEK---DRHSI 206

Query: 135 KVQGTRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIEDLMATGYDVTVPNVW 194
            VQ  RR  M  ARN L  + L P+ +WV W DAD+   P +VI+D+ +    V   NV+
Sbjct: 207 LVQKERRAAMALARNELLFSTLGPHTAWVLWLDADIIETPPTVIQDMTSHDKSVLAANVY 266

Query: 195 RPLPEFLSGEQA---YDLNSWVESDIALDLAKQLDEDDVIVEGYAEYPTWRVHLGYIREE 251
           +   +    + A   YD N+W ESDI L++A  +DE+++IVEGY+E  T+R  + +    
Sbjct: 267 QKYFDNDEKKMAIRPYDFNNWRESDIGLEIAANMDENEIIVEGYSEIATYRPLMAHFYNA 326

Query: 252 DGDPKSTIDLDGVGGVSILAKAQLFRNGVHFPAFTFENHAETEAFGKMAKKMGYSVAGLP 311
           DG     ++LDGVGG   L KA + R+G  FP F F +  ETE F KMAK++ Y V GLP
Sbjct: 327 DGQVTDEMELDGVGGGCTLVKADVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYGVFGLP 386

Query: 312 HYTLWHIYE 320
           +Y ++HI E
Sbjct: 387 NYLVYHIEE 395

>NCAS0C02330 Chr3 complement(437234..438415) [1182 bp, 393 aa] {ON}
           Anc_8.500
          Length = 393

 Score =  172 bits (435), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 109/316 (34%), Positives = 158/316 (50%), Gaps = 50/316 (15%)

Query: 8   QKVLPLMFKNLMNLTYPHELIDLAFLVSDCSEDDRTFEALLEYAKELQSGTLSQVFASHN 67
           QK     ++NL+ LTYP ELI+L F+       D+   AL     ++QS   +Q F    
Sbjct: 122 QKFHQEYWENLLQLTYPRELIELGFIAPRTPTGDQALAALEAAVDKVQSDKKNQRF---- 177

Query: 68  SGENVLREEGSSDLFLKYMRPSYLKMVKDAFTPPFHKNYDKPFRSVQIFQKNFGQVIGQT 127
           S   +LR++                         F+K  +K                   
Sbjct: 178 SKVTILRQDSVG----------------------FNKLTEK------------------- 196

Query: 128 FSDRHAVKVQGTRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIEDLMATGYD 187
             +RHA++VQ  RR  M  ARN L  + + P+ SWV W DAD+   P S+I+D+ A    
Sbjct: 197 --ERHALEVQKERRASMALARNELLFSTIGPHTSWVLWLDADIIETPASLIQDMTAHDRA 254

Query: 188 VTVPNVWRPLPEFLSGEQA---YDLNSWVESDIALDLAKQLDEDDVIVEGYAEYPTWRVH 244
           V   NV++   +    ++A   YD N+W ESD  L+LA ++ +D++IVEGYAE  T+R  
Sbjct: 255 VLSANVFQRYYDEEKKQKAIRPYDFNNWQESDTGLELASKMKDDEIIVEGYAEIATYRPL 314

Query: 245 LGYIREEDGDPKSTIDLDGVGGVSILAKAQLFRNGVHFPAFTFENHAETEAFGKMAKKMG 304
           + Y  + D      + LDGVGG   L KA++ R+G  FP F F +  ETE F KMAK++ 
Sbjct: 315 MAYFHDPDNSVAEEMRLDGVGGGCTLVKAEVHRDGAMFPNFPFYHLIETEGFAKMAKRLN 374

Query: 305 YSVAGLPHYTLWHIYE 320
           Y V GLP+Y ++HI E
Sbjct: 375 YEVFGLPNYLVYHIEE 390

>KNAG0A02150 Chr1 complement(187175..188365) [1191 bp, 396 aa] {ON}
           Anc_8.500 YPL050C
          Length = 396

 Score =  171 bits (434), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 109/310 (35%), Positives = 153/310 (49%), Gaps = 56/310 (18%)

Query: 17  NLMNLTYPHELIDLAFLVSDCSEDDRTFEALLEYAKELQSGTLSQVFASHNSGENVLREE 76
           N++++TYP ELI+L F+       D   + L    K++QSG  ++ FA       +LR+E
Sbjct: 134 NILHMTYPRELIELGFIAPRTPTGDAALKKLEAAIKKIQSGKKNERFAK----IIILRQE 189

Query: 77  GSSDLFLKYMRPSYLKMVKDAFTPPFHKNYDKPFRSVQIFQKNFGQVIGQTFSDRHAVKV 136
             S             M+ +                                 DRHA+ V
Sbjct: 190 SQS-----------FDMLAE--------------------------------KDRHALAV 206

Query: 137 QGTRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIEDLMATGYDVTVPNVWRP 196
           Q  RR  M  ARN L  + L P+ SWV W DAD+   P +VI+DL A    V   NV++ 
Sbjct: 207 QKQRRSAMALARNELLFSTLGPHTSWVLWLDADIVETPPTVIQDLAAHDKPVLAANVYQ- 265

Query: 197 LPEFLSGE------QAYDLNSWVESDIALDLAKQLDEDDVIVEGYAEYPTWRVHLGYIRE 250
              F + E      + YD N+W ES+  L+LA  L  D++IVEGYAE  T+R  + +  +
Sbjct: 266 --RFFNDELSKADIRPYDFNNWQESETGLELANSLPADEIIVEGYAEMATFRPLMAHFFD 323

Query: 251 EDGDPKSTIDLDGVGGVSILAKAQLFRNGVHFPAFTFENHAETEAFGKMAKKMGYSVAGL 310
           E       + LDGVGG   L KA++ R+G  FP F F +  ETE F KMAK++GY V GL
Sbjct: 324 ESKPVSEEMALDGVGGGCTLVKAEVHRDGAMFPNFPFYHLIETEGFAKMAKRLGYEVFGL 383

Query: 311 PHYTLWHIYE 320
           P+Y ++HI E
Sbjct: 384 PNYLVYHIEE 393

>KLTH0E11616g Chr5 (1035396..1036580) [1185 bp, 394 aa] {ON} highly
           similar to uniprot|P39107 Saccharomyces cerevisiae
           YPL050C MNN9 Subunit of Golgi mannosyltransferase
           complex also containing Anp1p Mnn10p Mnn11p and Hoc1p
           that mediates elongation of the polysaccharide mannan
           backbone forms a separate complex with Van1p that is
           also involved in backbone elongation
          Length = 394

 Score =  170 bits (431), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 102/307 (33%), Positives = 153/307 (49%), Gaps = 50/307 (16%)

Query: 17  NLMNLTYPHELIDLAFLVSDCSEDDRTFEALLEYAKELQSGTLSQVFASHNSGENVLREE 76
           NL+ LTYP +LI+L F++   +  D     L    K  Q G   Q F    S   +LR++
Sbjct: 133 NLLQLTYPRDLIELGFIIPRTATGDTALRKLEAAVKRTQLGKKDQRF----SKITILRQD 188

Query: 77  GSSDLFLKYMRPSYLKMVKDAFTPPFHKNYDKPFRSVQIFQKNFGQVIGQTFSDRHAVKV 136
             S                              F S+Q               +RHA+KV
Sbjct: 189 SQS------------------------------FDSLQE-------------KERHALKV 205

Query: 137 QGTRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIEDLMATGYDVTVPNVWRP 196
           Q  RR  M  ARN L  + + P+ SW+ W DAD+   P S+I+D+ A    V   NV++ 
Sbjct: 206 QKERRAAMALARNELLFSTIGPHTSWILWLDADIIETPPSLIQDMTAHNKPVLAANVYQK 265

Query: 197 LPEFLS---GEQAYDLNSWVESDIALDLAKQLDEDDVIVEGYAEYPTWRVHLGYIREEDG 253
                +    E+ YD N+W +S+ AL +A  + +D+V+ EGYAE PT+R  + ++ +  G
Sbjct: 266 YMNEETKKIAERPYDFNNWADSEKALQMAAGMADDEVLFEGYAELPTYRTLMAHMYDASG 325

Query: 254 DPKSTIDLDGVGGVSILAKAQLFRNGVHFPAFTFENHAETEAFGKMAKKMGYSVAGLPHY 313
              + + LDGVGG   L KA++ R+G  FP+F F +  ETE F KMA+++ Y + GLP+Y
Sbjct: 326 SQAAEMSLDGVGGGCTLVKAEVHRDGAMFPSFPFYHLIETEGFAKMARRLEYEIFGLPNY 385

Query: 314 TLWHIYE 320
            ++HI E
Sbjct: 386 LVYHIEE 392

>TBLA0H03340 Chr8 (820028..821209) [1182 bp, 393 aa] {ON} Anc_8.500
           YPL050C
          Length = 393

 Score =  170 bits (430), Expect = 7e-49,   Method: Compositional matrix adjust.
 Identities = 104/308 (33%), Positives = 156/308 (50%), Gaps = 50/308 (16%)

Query: 16  KNLMNLTYPHELIDLAFLVSDCSEDDRTFEALLEYAKELQSGTLSQVFASHNSGENVLRE 75
           +NL+ LTYP ELI+L F++      D   +AL    K++Q+   +Q F    S   +LR+
Sbjct: 130 QNLLQLTYPRELIELGFILPRSDSGDAALKALEAAVKKVQTDKKNQRF----SKITILRQ 185

Query: 76  EGSSDLFLKYMRPSYLKMVKDAFTPPFHKNYDKPFRSVQIFQKNFGQVIGQTFSDRHAVK 135
           +                                         + FGQ++ +   +RHA+ 
Sbjct: 186 DS----------------------------------------QGFGQLMEK---ERHALH 202

Query: 136 VQGTRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIEDLMATGYDVTVPNVWR 195
           VQ  RR  M  ARN L  + + P+ SWV W DAD+   P +VI+D+ A    V   NV++
Sbjct: 203 VQKERRAAMALARNELLFSTIGPHTSWVLWLDADIVETPPTVIQDMTAHDKAVLAANVYQ 262

Query: 196 PLPEFLSGEQ---AYDLNSWVESDIALDLAKQLDEDDVIVEGYAEYPTWRVHLGYIREED 252
              +    E+   AYD N+W ESD  L +A  +++D++IVEGY+E  T+R  + +  +  
Sbjct: 263 RYFDEEKKEKSIRAYDFNNWQESDTGLQIAAGMNDDEIIVEGYSEIATYRPLMAHFYDPT 322

Query: 253 GDPKSTIDLDGVGGVSILAKAQLFRNGVHFPAFTFENHAETEAFGKMAKKMGYSVAGLPH 312
               S + LDGVGG   L KA + R+G  FP F F +  ETE F KMAK++ Y V GLP+
Sbjct: 323 ASVNSEMMLDGVGGGCTLVKADVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYEVFGLPN 382

Query: 313 YTLWHIYE 320
           Y ++H+ E
Sbjct: 383 YLVYHMEE 390

>TPHA0L01370 Chr12 (286001..287179) [1179 bp, 392 aa] {ON} Anc_8.500
           YPL050C
          Length = 392

 Score =  169 bits (429), Expect = 7e-49,   Method: Compositional matrix adjust.
 Identities = 100/307 (32%), Positives = 156/307 (50%), Gaps = 50/307 (16%)

Query: 17  NLMNLTYPHELIDLAFLVSDCSEDDRTFEALLEYAKELQSGTLSQVFASHNSGENVLREE 76
           NL+ ++YP  L++L F++      D T + L    K +Q+G +   FA       +LR++
Sbjct: 133 NLLKMSYPRSLLELGFIIPRTPTGDETLKKLEAAVKNVQTGKVEDRFAK----ITILRQD 188

Query: 77  GSSDLFLKYMRPSYLKMVKDAFTPPFHKNYDKPFRSVQIFQKNFGQVIGQTFSDRHAVKV 136
             S                          +DK               +G+   +RH++ V
Sbjct: 189 SQS--------------------------FDK---------------LGE--KERHSLAV 205

Query: 137 QGTRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIEDLMATGYDVTVPNVWRP 196
           Q  RR  M  ARN L  +++ P  SWV W DAD+   P +VI+D+      V   NV++ 
Sbjct: 206 QKERRSAMALARNELLFSSIGPSTSWVLWLDADIVETPATVIQDMTNHNKPVLAANVYQR 265

Query: 197 LPEFLSGEQA---YDLNSWVESDIALDLAKQLDEDDVIVEGYAEYPTWRVHLGYIREEDG 253
             +    E +   YD N+W ES+  L++AK ++ED++IVEGYAE  T+R  + +  ++ G
Sbjct: 266 FFDKEKNENSIRPYDFNNWAESEKGLEIAKNMNEDEIIVEGYAEIATYRPLMAHFYDKAG 325

Query: 254 DPKSTIDLDGVGGVSILAKAQLFRNGVHFPAFTFENHAETEAFGKMAKKMGYSVAGLPHY 313
              + + LDGVGG   L KA++ R+G  FP F F +  ETE F KMAK++ Y + GLP+Y
Sbjct: 326 KIDALMALDGVGGGCTLVKAEVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYEIFGLPNY 385

Query: 314 TLWHIYE 320
            ++HI E
Sbjct: 386 LVYHIEE 392

>Smik_16.186 Chr16 complement(336170..337357) [1188 bp, 395 aa] {ON}
           YPL050C (REAL)
          Length = 395

 Score =  169 bits (427), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 103/307 (33%), Positives = 151/307 (49%), Gaps = 50/307 (16%)

Query: 17  NLMNLTYPHELIDLAFLVSDCSEDDRTFEALLEYAKELQSGTLSQVFASHNSGENVLREE 76
           NL+ LTYP ELI+L F+    +  D   + L    K++Q+   +Q F    S   ++R+ 
Sbjct: 133 NLLQLTYPRELIELGFITPRTATGDLALKKLENAVKKVQADKKAQRF----SKITIMRQN 188

Query: 77  GSSDLFLKYMRPSYLKMVKDAFTPPFHKNYDKPFRSVQIFQKNFGQVIGQTFSDRHAVKV 136
             S  F K M                                           +RHA+ V
Sbjct: 189 SQS--FDKLME-----------------------------------------KERHALDV 205

Query: 137 QGTRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIEDLMATGYDVTVPNVWRP 196
           Q  RR  M  ARN L  + + P+ SWV W DAD+   P ++I+D+      V   N+++ 
Sbjct: 206 QKERRAAMALARNELLFSTIGPHTSWVLWLDADIIETPTTLIQDMTQHNKAVLAANIYQR 265

Query: 197 L---PEFLSGEQAYDLNSWVESDIALDLAKQLDEDDVIVEGYAEYPTWRVHLGYIREEDG 253
                +  S  + YD N+W ESD  L++A Q+D+D++IVEGYAE  T+R  + +    + 
Sbjct: 266 FYDQEKKQSSIRPYDFNNWQESDTGLEIASQMDDDEIIVEGYAEIATYRPLMAHFYSANE 325

Query: 254 DPKSTIDLDGVGGVSILAKAQLFRNGVHFPAFTFENHAETEAFGKMAKKMGYSVAGLPHY 313
            P   + LDGVGG   L KA++ R+G  FP F F +  ETE F KMAK++ Y V GLP+Y
Sbjct: 326 LPSKEMVLDGVGGGCTLVKAEVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYEVFGLPNY 385

Query: 314 TLWHIYE 320
            ++HI E
Sbjct: 386 LVYHIEE 392

>Suva_16.265 Chr16 complement(463836..465023) [1188 bp, 395 aa] {ON}
           YPL050C (REAL)
          Length = 395

 Score =  168 bits (425), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 105/310 (33%), Positives = 150/310 (48%), Gaps = 56/310 (18%)

Query: 17  NLMNLTYPHELIDLAFLVSDCSEDDRTFEALLEYAKELQSGTLSQVFASHNSGENVLREE 76
           NL+ L YP ELI+L F+    +  D   + L    K++Q+   +Q F    S   +LR+ 
Sbjct: 133 NLLQLNYPRELIELGFITPRTATGDSALKKLESAIKKVQTDKKTQRF----SKITILRQN 188

Query: 77  GSSDLFLKYMRPSYLKMVKDAFTPPFHKNYDKPFRSVQIFQKNFGQVIGQTFSDRHAVKV 136
             S  F K M                                           +RHA++V
Sbjct: 189 SQS--FDKLME-----------------------------------------KERHALEV 205

Query: 137 QGTRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIEDLMATGYDVTVPNVWRP 196
           Q  RR  M  ARN L  + + P+ SWV W DAD+   P S+I+D+      V   N+++ 
Sbjct: 206 QKERRAAMALARNELLFSTIGPHTSWVLWLDADIIETPTSLIQDMTQHNKAVLAANIYQ- 264

Query: 197 LPEFLSGEQA------YDLNSWVESDIALDLAKQLDEDDVIVEGYAEYPTWRVHLGYIRE 250
              F   E+       YD N+W ESDI LD+A Q+ +D++IVEGYAE  T+R  + +  +
Sbjct: 265 --RFYDQEKKQASIRPYDFNNWQESDIGLDIASQMGDDEIIVEGYAEIATYRPLMAHFFD 322

Query: 251 EDGDPKSTIDLDGVGGVSILAKAQLFRNGVHFPAFTFENHAETEAFGKMAKKMGYSVAGL 310
                   + LDGVGG   L KA++ R+G  FP F F +  ETE F KMAK++ Y V GL
Sbjct: 323 ASKPQNEEMALDGVGGGCTLVKAEVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYDVFGL 382

Query: 311 PHYTLWHIYE 320
           P+Y ++HI E
Sbjct: 383 PNYLVYHIEE 392

>YPL050C Chr16 complement(460779..461966) [1188 bp, 395 aa] {ON}
           MNN9Subunit of Golgi mannosyltransferase complex also
           containing Anp1p, Mnn10p, Mnn11p, and Hoc1p that
           mediates elongation of the polysaccharide mannan
           backbone; forms a separate complex with Van1p that is
           also involved in backbone elongation
          Length = 395

 Score =  167 bits (424), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 104/310 (33%), Positives = 151/310 (48%), Gaps = 56/310 (18%)

Query: 17  NLMNLTYPHELIDLAFLVSDCSEDDRTFEALLEYAKELQSGTLSQVFASHNSGENVLREE 76
           NL+ L YP ELI+L F+    +  D   + L    K++Q+   +Q F    S   +LR+ 
Sbjct: 133 NLLQLNYPRELIELGFITPRTATGDLALKKLENAIKKVQTDKKTQRF----SKITILRQN 188

Query: 77  GSSDLFLKYMRPSYLKMVKDAFTPPFHKNYDKPFRSVQIFQKNFGQVIGQTFSDRHAVKV 136
             S  F K M                                           +RHA+ V
Sbjct: 189 SQS--FDKLME-----------------------------------------KERHALDV 205

Query: 137 QGTRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIEDLMATGYDVTVPNVWRP 196
           Q  RR  M  ARN L  + + P+ SWV W DAD+   P S+I+D+      +   N+++ 
Sbjct: 206 QKERRAAMALARNELLFSTIGPHTSWVLWLDADIIETPPSLIQDMTKHNKAILAANIYQ- 264

Query: 197 LPEFLSGEQA------YDLNSWVESDIALDLAKQLDEDDVIVEGYAEYPTWRVHLGYIRE 250
              F   E+       YD N+W ESD  L++A Q+ +D++IVEGYAE  T+R  + +  +
Sbjct: 265 --RFYDEEKKQPSIRPYDFNNWQESDTGLEIASQMGDDEIIVEGYAEIATYRPLMAHFYD 322

Query: 251 EDGDPKSTIDLDGVGGVSILAKAQLFRNGVHFPAFTFENHAETEAFGKMAKKMGYSVAGL 310
            +G P   + LDGVGG   L KA++ R+G  FP F F +  ETE F KMAK++ Y V GL
Sbjct: 323 ANGVPGEEMALDGVGGGCTLVKAEVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYDVFGL 382

Query: 311 PHYTLWHIYE 320
           P+Y ++HI E
Sbjct: 383 PNYLVYHIEE 392

>Skud_16.232 Chr16 complement(424904..426091) [1188 bp, 395 aa] {ON}
           YPL050C (REAL)
          Length = 395

 Score =  167 bits (422), Expect = 8e-48,   Method: Compositional matrix adjust.
 Identities = 105/310 (33%), Positives = 151/310 (48%), Gaps = 56/310 (18%)

Query: 17  NLMNLTYPHELIDLAFLVSDCSEDDRTFEALLEYAKELQSGTLSQVFASHNSGENVLREE 76
           NL+ L+YP ELI+L F+    +  D   + L    K++Q+   +Q F    S   +LR+ 
Sbjct: 133 NLLQLSYPRELIELGFITPRTATGDLALKNLENAIKKVQTDKKTQRF----SKITILRQN 188

Query: 77  GSSDLFLKYMRPSYLKMVKDAFTPPFHKNYDKPFRSVQIFQKNFGQVIGQTFSDRHAVKV 136
             S  F K M                                           +RHA+ V
Sbjct: 189 SQS--FDKLME-----------------------------------------KERHALDV 205

Query: 137 QGTRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIEDLMATGYDVTVPNVWRP 196
           Q  RR  M  ARN L  + + P+ SW+ W DAD+   P S+I+D+      V   N+++ 
Sbjct: 206 QKERRAAMALARNELLFSTIGPHTSWILWLDADIIETPVSLIQDMTQHDKAVLAANIYQ- 264

Query: 197 LPEFLSGEQA------YDLNSWVESDIALDLAKQLDEDDVIVEGYAEYPTWRVHLGYIRE 250
              F   E+       YD N+W ESD  L++A Q+ +D++IVEGYAE  T+R  + +   
Sbjct: 265 --RFYDQEKKQPSIRPYDFNNWQESDTGLEIASQMGDDEIIVEGYAEIATYRPLMAHHYN 322

Query: 251 EDGDPKSTIDLDGVGGVSILAKAQLFRNGVHFPAFTFENHAETEAFGKMAKKMGYSVAGL 310
            DG P   + LDGVGG   L KA + R+G  FP F F +  ETE F KMAK++ Y+V GL
Sbjct: 323 ADGLPNEEMALDGVGGGCTLVKADVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYNVFGL 382

Query: 311 PHYTLWHIYE 320
           P+Y ++HI E
Sbjct: 383 PNYLVYHIEE 392

>ZYRO0F08492g Chr6 (684329..685519) [1191 bp, 396 aa] {ON} highly
           similar to uniprot|P39107 Saccharomyces cerevisiae
           YPL050C MNN9 Subunit of Golgi mannosyltransferase
           complex also containing Anp1p Mnn10p Mnn11p and Hoc1p
           that mediates elongation of the polysaccharide mannan
           backbone forms a separate complex with Van1p that is
           also involved in backbone elongation
          Length = 396

 Score =  166 bits (421), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 101/307 (32%), Positives = 153/307 (49%), Gaps = 50/307 (16%)

Query: 17  NLMNLTYPHELIDLAFLVSDCSEDDRTFEALLEYAKELQSGTLSQVFASHNSGENVLREE 76
           NL+ LTYP E  +L F++   S  D     L    K++Q+   +Q F    S   +LR+ 
Sbjct: 134 NLLQLTYPREFTELGFILPRTSSGDIALSKLEAAVKKVQTDKKNQRF----SKITILRQN 189

Query: 77  GSSDLFLKYMRPSYLKMVKDAFTPPFHKNYDKPFRSVQIFQKNFGQVIGQTFSDRHAVKV 136
            +   F K M                                           +RHA++V
Sbjct: 190 SAG--FDKLME-----------------------------------------KERHALEV 206

Query: 137 QGTRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIEDLMATGYDVTVPNVWRP 196
           Q  RR  M  ARN L  ++L P  SWV W DAD+   P ++I+D+ +    V   NV++ 
Sbjct: 207 QKERRSAMASARNELLFSSLGPKTSWVLWLDADIVETPPNLIQDMTSHNKAVLSANVYQK 266

Query: 197 LPEFLSGE---QAYDLNSWVESDIALDLAKQLDEDDVIVEGYAEYPTWRVHLGYIREEDG 253
             +  + +   + YD N+W ESD AL+LAKQ+ +D+++VEGY +  T+R  + Y  +  G
Sbjct: 267 YYDDQAKKVQIRPYDFNNWQESDTALELAKQMGDDEILVEGYGDLATYRALMAYFYDATG 326

Query: 254 DPKSTIDLDGVGGVSILAKAQLFRNGVHFPAFTFENHAETEAFGKMAKKMGYSVAGLPHY 313
              + ++LDGVGG   L KA + R+G  FP F F +  ETE F KMA+++ Y + GLP+Y
Sbjct: 327 ATNAEMNLDGVGGGCTLVKADVHRDGAMFPTFPFYHLIETEGFAKMAQRLNYDIFGLPNY 386

Query: 314 TLWHIYE 320
            ++HI E
Sbjct: 387 LVYHIEE 393

>Kwal_27.11864 s27 (981923..983284) [1362 bp, 453 aa] {ON} YPL050C
           (MNN9) - Protein required for complex glycosylation
           [contig 27] FULL
          Length = 453

 Score =  167 bits (423), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 100/309 (32%), Positives = 150/309 (48%), Gaps = 50/309 (16%)

Query: 15  FKNLMNLTYPHELIDLAFLVSDCSEDDRTFEALLEYAKELQSGTLSQVFASHNSGENVLR 74
           + NL+ LTYP EL++L F++   +  D     L    K+ Q     Q F        +LR
Sbjct: 190 WNNLLQLTYPRELLELGFIIPRTTSGDNALRKLEAAVKKTQLSKKDQRFLKIT----ILR 245

Query: 75  EEGSSDLFLKYMRPSYLKMVKDAFTPPFHKNYDKPFRSVQIFQKNFGQVIGQTFSDRHAV 134
           ++  S   LK                                             DRHA+
Sbjct: 246 QDSQSFDLLKE-------------------------------------------KDRHAL 262

Query: 135 KVQGTRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIEDLMATGYDVTVPNVW 194
           +VQ  RR  M  ARN L  + + PY SWV W DAD+   P ++I+D+ A    V   NV+
Sbjct: 263 EVQKKRRSAMALARNELLFSTIGPYTSWVLWLDADIIETPPTLIQDMTAHDKAVLAANVY 322

Query: 195 RPLPEFLSGEQA---YDLNSWVESDIALDLAKQLDEDDVIVEGYAEYPTWRVHLGYIREE 251
           +   +  +G++    YD N+W +SD AL +A  + +D V+ EGY E  T+R  + +  +E
Sbjct: 323 QHSIDKKTGQKTKGPYDFNNWADSDTALQMAASMPDDGVLFEGYGEMATYRTLMAHFYKE 382

Query: 252 DGDPKSTIDLDGVGGVSILAKAQLFRNGVHFPAFTFENHAETEAFGKMAKKMGYSVAGLP 311
              P + + LDGVGG   L KA++ R+G  FP+F F +  ETE F KMA+++ Y + GLP
Sbjct: 383 GESPSAEMVLDGVGGGCTLVKAEVHRDGAMFPSFPFYHLIETEGFAKMAQRLDYEIYGLP 442

Query: 312 HYTLWHIYE 320
           +Y ++HI E
Sbjct: 443 NYLVYHIEE 451

>Kpol_1031.78 s1031 (197094..198272) [1179 bp, 392 aa] {ON}
           (197094..198272) [1179 nt, 393 aa]
          Length = 392

 Score =  165 bits (418), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 105/312 (33%), Positives = 151/312 (48%), Gaps = 56/312 (17%)

Query: 15  FKNLMNLTYPHELIDLAFLVSDCSEDDRTFEALLEYAKELQSGTLSQVFASHNSGENVLR 74
           ++NL+ L+YP ELI+L F++      D   + L    K +QS   +  F    S   +LR
Sbjct: 131 WENLLKLSYPRELIELGFIIPRSDAGDAALKKLETAVKNVQSDKKNNRF----SKITILR 186

Query: 75  EEGSSDLFLKYMRPSYLKMVKDAFTPPFHKNYDKPFRSVQIFQKNFGQVIGQTFSDRHAV 134
           +E  S                      F K  +K                     +RH++
Sbjct: 187 QESQS----------------------FDKLEEK---------------------ERHSL 203

Query: 135 KVQGTRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIEDLMATGYDVTVPNVW 194
            VQ  RR  M  ARN L  + L P+ SWV W D+D+   P +VIE +      V   NV+
Sbjct: 204 AVQKERRAAMALARNELLFSTLGPHTSWVLWLDSDIVETPTTVIESMTKHDKPVLAANVY 263

Query: 195 RPLPEFLSGEQA------YDLNSWVESDIALDLAKQLDEDDVIVEGYAEYPTWRVHLGYI 248
           +    F   ++       YD N+W ESDI L LA ++ +D++IVEGYAE  T+R  + + 
Sbjct: 264 Q---RFFDNDKQQDSIRPYDFNNWAESDIGLQLASKMGDDEIIVEGYAEIATYRPLMAHF 320

Query: 249 REEDGDPKSTIDLDGVGGVSILAKAQLFRNGVHFPAFTFENHAETEAFGKMAKKMGYSVA 308
               GD    + LDGVGG   L KA++ R+G  FP F F +  ETE F KMAK++ Y V 
Sbjct: 321 YNPSGDVGEEMALDGVGGGCTLVKAEVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYEVF 380

Query: 309 GLPHYTLWHIYE 320
           GLP++ ++HI E
Sbjct: 381 GLPNFLVYHIEE 392

>CAGL0L12804g Chr12 (1371568..1372749) [1182 bp, 393 aa] {ON} highly
           similar to uniprot|P39107 Saccharomyces cerevisiae
           YPL050c required for complex N-glycosylation
          Length = 393

 Score =  164 bits (416), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 102/310 (32%), Positives = 151/310 (48%), Gaps = 50/310 (16%)

Query: 17  NLMNLTYPHELIDLAFLVSDCSEDDRTFEALLEYAKELQSGTLSQVFASHNSGENVLREE 76
           NL+ LTYP +L++L F++   +  D   + L    K  Q+   +  F        +LR++
Sbjct: 131 NLLQLTYPRDLLELGFIIPKSASGDAALKQLEAAVKRAQTDKKNNRFGK----VTILRQD 186

Query: 77  GSSDLFLKYMRPSYLKMVKDAFTPPFHKNYDKPFRSVQIFQKNFGQVIGQTFSDRHAVKV 136
                                      K +DK        Q+           +RHA+ V
Sbjct: 187 S--------------------------KGFDK-------LQE----------KERHALAV 203

Query: 137 QGTRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIEDLMATGYDVTVPNVWRP 196
           Q  RR  M  ARN L  + + P+ SWV W DAD+     S+I+D+ A    V   NV++ 
Sbjct: 204 QKERRSAMALARNELLFSTIGPHTSWVLWLDADIIETKPSLIQDMTALNKPVLAANVYQR 263

Query: 197 L---PEFLSGEQAYDLNSWVESDIALDLAKQLDEDDVIVEGYAEYPTWRVHLGYIREEDG 253
                E     + YD N+W +S IA +L  ++ +D++IVEGYAE  T+R  + +    DG
Sbjct: 264 YFDEAENKPSIRPYDFNNWADSQIAQELGDKMGDDEIIVEGYAEIATYRPLMAHFYTPDG 323

Query: 254 DPKSTIDLDGVGGVSILAKAQLFRNGVHFPAFTFENHAETEAFGKMAKKMGYSVAGLPHY 313
            P   + LDGVGG   L KA++ R+G  FP F F +  ETE F KMAK++ Y V GLP+Y
Sbjct: 324 PPNELMSLDGVGGGCTLVKAEVHRDGAMFPTFPFYHLIETEGFAKMAKRLNYEVFGLPNY 383

Query: 314 TLWHIYEPSD 323
            ++HI E +D
Sbjct: 384 LVFHIEERND 393

>Ecym_2550 Chr2 (1066925..1068097) [1173 bp, 390 aa] {ON} similar to
           Ashbya gossypii AGL259C
          Length = 390

 Score =  163 bits (412), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 105/329 (31%), Positives = 159/329 (48%), Gaps = 58/329 (17%)

Query: 3   PLRNAQKVLPLM---------FKNLMNLTYPHELIDLAFLVSDCSEDDRTFEALLEYAKE 53
           PL N + VL L          ++NL++LTYP +L  L F++      D   + L +  K+
Sbjct: 109 PLANKEIVLILTPMQKFHDKYWENLLSLTYPRKLTQLGFIIPRTPTGDVAMKRLEDAVKK 168

Query: 54  LQSGTLSQVFASHNSGENVLREEGSSDLFLKYMRPSYLKMVKDAFTPPFHKNYDKPFRSV 113
           +QSG  +Q F        +LR++  S                      F+K  +K     
Sbjct: 169 VQSGKENQRFLK----ITILRQDSQS----------------------FNKLDEK----- 197

Query: 114 QIFQKNFGQVIGQTFSDRHAVKVQGTRRKLMGRARNWLTANALKPYHSWVYWRDADVELC 173
                           +RHA  VQ  RR  M  ARN L  + + P  SW+ W DAD+   
Sbjct: 198 ----------------ERHAFNVQKERRAAMALARNELVFSTIGPSTSWILWLDADIVET 241

Query: 174 PGSVIEDLMATGYDVTVPNVWRPLPEFLSGE--QAYDLNSWVESDIALDLAKQLDEDDVI 231
           P +VI+D+ A    +   NV++   +  + E  + YD N+W ES   L++A  + +D++I
Sbjct: 242 PATVIQDMAAHDKAILAANVFQRYIDDQNQENIRPYDFNNWQESQTGLEIAASMKDDEII 301

Query: 232 VEGYAEYPTWRVHLGYIREEDGDPKSTIDLDGVGGVSILAKAQLFRNGVHFPAFTFENHA 291
           VE Y E  T+R  +  + + +G P + + LDGVGG   L KAQ+ R+G  FP F F +  
Sbjct: 302 VESYHEIVTYRPLMAKLYDPNGSPSAEMSLDGVGGGCTLVKAQVHRDGAMFPNFPFYHLI 361

Query: 292 ETEAFGKMAKKMGYSVAGLPHYTLWHIYE 320
           ETE F  MAK++ Y V GLP+Y ++H  E
Sbjct: 362 ETEGFAHMAKRLNYEVFGLPNYLVYHFNE 390

>AGL259C Chr7 complement(221445..222614) [1170 bp, 389 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL050C
           (MNN9)
          Length = 389

 Score =  161 bits (408), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 98/305 (32%), Positives = 149/305 (48%), Gaps = 53/305 (17%)

Query: 17  NLMNLTYPHELIDLAFLVSDCSEDDRTFEALLEYAKELQSGTLSQVFASHNSGENVLREE 76
           NL+ LTYP + I L FL+   S  +     L +  +++Q+G                   
Sbjct: 131 NLLLLTYPRKYIHLGFLLPRTSSGNTALRKLEKAVRKVQTG------------------- 171

Query: 77  GSSDLFLKYMRPSYLKMVKDAFTPPFHKNYDKPFRSVQIFQKNFGQVIGQTFSDRHAVKV 136
                      P                  D+ F  + I +++F      + S RH   V
Sbjct: 172 -----------PK-----------------DQRFGKITILRQDFASFNKLSQSARHRFHV 203

Query: 137 QGTRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIEDLMATGYDVTVPNVWRP 196
           Q  RR  M  ARN L  + + PY SWV W D+D+   P ++IED+ +    +   NV++ 
Sbjct: 204 QKERRSAMALARNELLFSTIGPYTSWVLWLDSDIVETPNTLIEDMTSHNKPILAANVYQR 263

Query: 197 LPEFLSGE---QAYDLNSWVESDIALDLAKQLDEDDVIVEGYA-EYPTWRVHLGYIREED 252
             E  +GE   +AYDLN+W ES++ L +A +L ED +IVEGY  E+ T+R  + ++  + 
Sbjct: 264 YVE--NGEPAIRAYDLNNWAESELGLKIASELPEDQIIVEGYGDEFATYRPLMAHMYSDK 321

Query: 253 GDPKSTIDLDGVGGVSILAKAQLFRNGVHFPAFTFENHAETEAFGKMAKKMGYSVAGLPH 312
                 + LDGVGG   L KA++ R+G  FP F F +  ETE F KMAK++ Y + GLP+
Sbjct: 322 RPKDELMALDGVGGGCTLVKAEVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYEIYGLPN 381

Query: 313 YTLWH 317
           Y ++H
Sbjct: 382 YLVYH 386

>NCAS0B02440 Chr2 complement(408198..409400) [1203 bp, 400 aa] {ON}
           Anc_8.500
          Length = 400

 Score =  144 bits (363), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 92/304 (30%), Positives = 143/304 (47%), Gaps = 49/304 (16%)

Query: 17  NLMNLTYPHELIDLAFLVSDCSEDDRTFEALLEYAKELQSGTLSQVFASHNSGENVLREE 76
           NL+ L+YP + I+L F++    + D + + L    K++Q+      F    S   +LR+ 
Sbjct: 140 NLLKLSYPRDAIELGFIIPRTKKGDHSLKKLESAIKKVQTAKQGDKF----SKITILRQN 195

Query: 77  GSSDLFLKYMRPSYLKMVKDAFTPPFHKNYDKPFRSVQIFQKNFGQVIGQTFSDRHAVKV 136
                                                    K F  V  +   +   ++ 
Sbjct: 196 S----------------------------------------KGFETVPEK--KEVSEIEY 213

Query: 137 QGTRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIEDLMATGYDVTVPNVWRP 196
           +   R  M  ARN L A+ L P  +W+ W D+D+   P S+I+D+      V   NV+  
Sbjct: 214 EKQIRAEMALARNELLASTLGPQTAWILWLDSDIVETPPSLIQDMTHHDKPVLAANVYER 273

Query: 197 LPEFLSGE---QAYDLNSWVESDIALDLAKQLDEDDVIVEGYAEYPTWRVHLGYIREEDG 253
             +  SGE   + YD  +W+ES  AL LA  + ED++IVEG A   T R  + +  ++DG
Sbjct: 274 YKDRESGELSIRPYDFRNWIESTEALQLASGMQEDEIIVEGLAGISTNRQLMTHFYQQDG 333

Query: 254 DPKSTIDLDGVGGVSILAKAQLFRNGVHFPAFTFENHAETEAFGKMAKKMGYSVAGLPHY 313
            P S I LDGVG   +L K+++ R+G  FP F F +  E+E F KMAK++ Y V GLP+Y
Sbjct: 334 SPSSEISLDGVGASCLLVKSEVHRDGAMFPNFPFYHLIESEGFAKMAKRLTYEVYGLPNY 393

Query: 314 TLWH 317
            ++H
Sbjct: 394 LVYH 397

>NDAI0C05250 Chr3 (1217841..1219049) [1209 bp, 402 aa] {ON}
           Anc_8.500
          Length = 402

 Score =  142 bits (359), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 89/306 (29%), Positives = 153/306 (50%), Gaps = 46/306 (15%)

Query: 15  FKNLMNLTYPHELIDLAFLVSDCSEDDRTFEALLEYAKELQSGTLSQVFASHNSGENVLR 74
           ++NL+NL+YP +LI+L F+V +  + D+  + L    K +Q G   ++ ++  +   +LR
Sbjct: 137 WENLLNLSYPRDLIELGFMVPNTKKGDQILKQLENAVKNVQ-GIDKKLGSNKFAKITILR 195

Query: 75  EEGSSDLFLKYMRPSYLKMVKDAFTPPFHKNYDKPFRSVQIFQKNFGQVIGQTFSDRHAV 134
           ++ S                       FHK  D+  +                  + + +
Sbjct: 196 QKDSG----------------------FHKFNDRKDKK-----------------EMNDI 216

Query: 135 KVQGTRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIEDLMATGYDVTVPNVW 194
           +++  +R  M  ARN L ++ L    +W+ W D++V   P ++I+D+      V   NV+
Sbjct: 217 ELEKEKRAEMALARNELLSSTLSHSTAWILWLDSNVIETPNTLIQDMTQHDKPVLATNVY 276

Query: 195 RPLPEFLSGEQA----YDLNSWVESDIALDLAKQLDEDDVIVEGYAEYPTWRVHLGYIRE 250
             + +    ++A    YD  +W+ESD AL LA ++ ED++IVEG A   T R  +    E
Sbjct: 277 --MKDSNDKDKANIRPYDFRNWIESDTALQLASEMPEDEIIVEGMAGLATNRQLMTNFYE 334

Query: 251 EDGDPKSTIDLDGVGGVSILAKAQLFRNGVHFPAFTFENHAETEAFGKMAKKMGYSVAGL 310
            DG P   + LDG+G    L K+++ R+G  FP F F +  E+E F KMAK++ Y V GL
Sbjct: 335 SDGSPTEELALDGIGAACTLVKSEVHRDGAMFPNFPFYHLIESEGFAKMAKRLTYEVVGL 394

Query: 311 PHYTLW 316
           P+Y ++
Sbjct: 395 PNYLVF 400

>KNAG0A03990 Chr1 complement(535490..536563) [1074 bp, 357 aa] {ON} 
          Length = 357

 Score = 96.3 bits (238), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 81/315 (25%), Positives = 132/315 (41%), Gaps = 63/315 (20%)

Query: 1   MVPLRNAQKVLPLMFKNLMNLTYPHELIDLAFLVSDCSEDDRTFEALLEYAKELQSGTLS 60
           ++PL N        F+NL  LTYP +LIDL  +V     D +    +L+  +E    TL+
Sbjct: 103 LIPLINFNS---RFFENLFALTYPKQLIDLGVIV----PDSKNATGILQALQE----TLA 151

Query: 61  QVFASHNSGENVLREEGSSDLFLKYMRPSYLKMVKDAFTPPFHKNYDKPFRSVQIFQKNF 120
           +V A+ ++                  R + + ++KD        N D P           
Sbjct: 152 KVQANDST------------------RYNKITVLKDDNK---WGNTDDPV---------- 180

Query: 121 GQVIGQTFSDRHAVKVQGTRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIED 180
                               RK +   +N L  + L PY SWV W D+ +   P ++++D
Sbjct: 181 ------------------AYRKQLAALKNQLLFSTLPPYCSWVLWLDSQITGTPTTLVQD 222

Query: 181 LMATGYDVTVPNVWRPLPEFLSGEQAYDLNSWVESDIALDLAKQLDEDDVIVEGYAEYPT 240
           L   G  +   +++         E    LN+WV SD    LA  +    V++EG +   T
Sbjct: 223 LANHGKAILTTHIFNNSDGSPDSET---LNNWVASDTWRSLATGMPHSRVVIEGVSHVYT 279

Query: 241 WRVHLGYIREEDGDPKSTIDLDGVGGVSILAKAQLFRNGVHFPAFTFENHAETEAFGKMA 300
            R  +G   +      + ++LD V     L KA++ R+G  FP F F +  ETE F +MA
Sbjct: 280 DRPLMGQFYDAAASVLTEMELDSVSTACTLVKAEVHRDGAMFPNFAFHHLVETEGFARMA 339

Query: 301 KKMGYSVAGLPHYTL 315
           + + +   GLP+Y +
Sbjct: 340 RLLKHQAFGLPNYVV 354

>SAKL0H20438g Chr8 (1793911..1793929,1794594..1796272) [1698 bp, 565
           aa] {ON} weakly similar to gnl|GLV|DEHA0C12881g
           Debaryomyces hansenii DEHA0C12881g
          Length = 565

 Score = 66.6 bits (161), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 51/203 (25%), Positives = 88/203 (43%), Gaps = 21/203 (10%)

Query: 130 DRHAVKVQGTRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIEDLMATGYDVT 189
           DRH   VQ  RRK + + RN+L  N       +    D+D+ + P  ++E  +  G ++ 
Sbjct: 368 DRHKDSVQRARRKTIAKVRNFL-YNRSHMDEKYTLTIDSDMMVIPSDMLEKFVKMGKELI 426

Query: 190 VPNVWRPLPEFLSGEQAYDLNSWV-ESDIALDLAKQLDEDDVI---VEGYAEYPTWRVHL 245
           VP + R     +  ++ YD N+W+ E     D +KQ + +  +   V G  ++    V  
Sbjct: 427 VPRILR-----VGSDREYDKNTWIGERTKPEDTSKQNNYESYVPRPVNGKTKFLQDCVDE 481

Query: 246 GY-IREEDGDPKSTIDLDGVGGVSILAKAQLFRNGVHFPAFTF----------ENHAETE 294
              +   +    + ++LD VGG  +    ++F  G+ FP F             +  ETE
Sbjct: 482 KITLNSPEAYTDNVVELDSVGGAILFWDNKIFDQGIQFPVFYLIGSDWDHSEGYDGVETE 541

Query: 295 AFGKMAKKMGYSVAGLPHYTLWH 317
                AK +GY   G+P+    H
Sbjct: 542 GLCYQAKTLGYKCYGVPNVICRH 564

>Suva_12.94 Chr12 (139444..140979) [1536 bp, 511 aa] {ON} YJR010W
           (REAL)
          Length = 511

 Score = 32.3 bits (72), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 18/64 (28%), Positives = 35/64 (54%), Gaps = 3/64 (4%)

Query: 163 VYWRDADVELCPGSVIEDLMATGYDVTVPNVWRPLPEFLSGEQ-AYDLNSWVESDIALDL 221
           ++  D   EL   S+++D + +G  + +PN W    + ++G+Q  Y L+S   +DI L+ 
Sbjct: 430 IFEHDNKTELL--SLVQDFIGSGTGLIIPNQWESEKDSVAGKQNIYLLDSSSSADIKLES 487

Query: 222 AKQL 225
             +L
Sbjct: 488 GDEL 491

>Smik_13.452 Chr13 complement(734312..735625) [1314 bp, 437 aa] {ON}
           YMR240C (REAL)
          Length = 437

 Score = 31.6 bits (70), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 30/64 (46%), Gaps = 4/64 (6%)

Query: 140 RRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIEDLMATGYDVTVPNVWRPLPE 199
           RRKL   + + L +    PY   + W D D      S++  +  T   + VPN W+   E
Sbjct: 127 RRKLEKPSLSQLKSQV--PYPQVIEWYDCDARY--PSLLASIKCTKNVIPVPNHWQSKKE 182

Query: 200 FLSG 203
           +LSG
Sbjct: 183 YLSG 186

>CAGL0J04026g Chr10 complement(379502..383098) [3597 bp, 1198 aa]
           {ON} similar to uniprot|Q12276 Saccharomyces cerevisiae
           YOR227w or uniprot|Q03016 Saccharomyces cerevisiae
           YPL137c
          Length = 1198

 Score = 31.2 bits (69), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 20/79 (25%), Positives = 34/79 (43%), Gaps = 16/79 (20%)

Query: 214 ESDIALDLAKQLDEDDVIVEGYAEYPTWRVHLGYIREEDGDPKSTIDLDGVGGVSILAKA 273
           +S I LDL++   + D+  E Y     W++    +RE  G P                  
Sbjct: 533 KSIIRLDLSQTKIKPDLPAECYRHNMNWKLFCNVLRERTGRPLE---------------- 576

Query: 274 QLFRNGVHFPAFTFENHAE 292
           +L  NGVHF   +F+++ +
Sbjct: 577 ELLLNGVHFDEMSFDDYQD 595

>YCR019W Chr3 (152837..153928) [1092 bp, 363 aa] {ON}  MAK32Protein
           necessary for structural stability of L-A
           double-stranded RNA-containing particles
          Length = 363

 Score = 30.8 bits (68), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 31/133 (23%), Positives = 62/133 (46%), Gaps = 12/133 (9%)

Query: 172 LCPGS----VIEDLM-ATGYDVTVPNV-WRPLPEFLSGEQAYDLNSWVE-SDIALDLAKQ 224
           LC GS    +I DL+       T P V W P P+    +   D+ S ++ +D+ + L+  
Sbjct: 145 LCSGSRCLDIINDLLRVKSSKGTKPIVIWEPFPDLCDFDHQNDIKSVMQRNDVTVILSPN 204

Query: 225 LDEDDVIVEGYAEYPTWRVHLGYI--REEDGDPKSTIDLDGVGGVSILAKAQLFRNGV-- 280
            +E   +    ++ PT       +  R +D   ++ + +   G +  ++ ++ F+NG   
Sbjct: 205 AEESSRLFGLSSKEPTSLEECLALAHRFDDFMDENNMCILRCGALGSISVSEKFKNGRTY 264

Query: 281 -HFPAFTFENHAE 292
            HFPA+ F+  ++
Sbjct: 265 DHFPAYHFKTQSK 277

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.136    0.415 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 38,098,715
Number of extensions: 1681752
Number of successful extensions: 4005
Number of sequences better than 10.0: 73
Number of HSP's gapped: 4051
Number of HSP's successfully gapped: 117
Length of query: 339
Length of database: 53,481,399
Length adjustment: 110
Effective length of query: 229
Effective length of database: 40,868,139
Effective search space: 9358803831
Effective search space used: 9358803831
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 66 (30.0 bits)