Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_27.102458.843ON51551526340.0
KLTH0C03806g8.843ON52549220560.0
SAKL0D01386g8.843ON52149817780.0
NDAI0E002808.843ON54951116200.0
CAGL0B02343g8.843ON53750016120.0
KNAG0G034308.843ON54251015890.0
YML116W (ATR1)8.843ON54251615860.0
Suva_13.278.843ON55351815780.0
KNAG0J002608.843ON55050415750.0
Skud_13.258.843ON53750215710.0
Smik_13.188.843ON54551815490.0
TDEL0B005508.843ON53751015420.0
NCAS0B002908.843ON54252715420.0
Kpol_541.168.843ON52850215100.0
Suva_13.4678.843ON54352514910.0
NCAS0A02540singletonON53950414720.0
KAFR0B03930singletonON55547614730.0
CAGL0M03003g8.843ON55848114590.0
NCAS0C004008.843ON51750614510.0
TBLA0D032708.843ON55052014360.0
Skud_13.4518.843ON53951314160.0
NDAI0K004008.843ON55351214130.0
TPHA0C047908.843ON55647714110.0
YMR279C8.843ON54050914060.0
KAFR0B039408.843ON54753013940.0
Smik_13.4928.843ON54348813800.0
TBLA0D03280singletonON58052013820.0
KAFR0A028408.843ON52048513331e-180
TBLA0C01160singletonON60048312131e-161
Smik_15.560na 1ON5165198521e-108
Skud_15.545na 1ON5165228351e-105
YOR378Wna 1ON5155198341e-105
Suva_8.435na 1ON5155228221e-103
KLTH0C10560gna 1ON5155178101e-101
KLLA0B00352gna 1ON4984837951e-99
Kwal_23.6547na 1ON5115117778e-97
TDEL0G04950singletonON5125047657e-95
KNAG0D00130na 1ON5655045455e-62
KAFR0C04860na 1ON5345184805e-53
SAKL0C06116gsingletonON1851894492e-52
CAGL0L02519gna 1ON5294834262e-45
NCAS0A05720na 1ON5635214114e-43
NDAI0K02730singletonON6045453712e-37
Smik_6.24na 2ON5444881383e-08
ZYRO0C01430g8.272ON5903541304e-07
Skud_6.16na 2ON5495381251e-06
Suva_10.11singletonON5404821197e-06
KLLA0C18931gna 3ON5531901181e-05
SAKL0E04246gna 4ON5652111143e-05
NCAS0A078102.473ON5682101091e-04
KLTH0G13464g8.272ON5933341082e-04
AGR076C8.272ON6863191072e-04
NDAI0D010202.242ON5921721063e-04
SAKL0C02178gsingletonON5651101045e-04
NDAI0H022002.473ON5712091045e-04
KLLA0E24113g8.570ON5752531045e-04
SAKL0A00726gsingletonON5982431036e-04
TDEL0D00240singletonON4962351010.001
Smik_13.2722.473ON5611311010.001
Skud_13.2442.473ON562981010.001
Kpol_543.448.272ON643451990.002
KNAG0I019102.242ON598175990.002
KLTH0D16962gsingletonON571143970.003
YMR088C (VBA1)2.473ON56273970.003
TDEL0A051308.570ON599146940.008
TPHA0I017608.570ON653144930.010
Kwal_27.121738.570ON567184930.010
TDEL0F039908.272ON631295930.010
Suva_4.4318.570ON572186930.011
NCAS0B020108.570ON530174920.013
TDEL0G03260singletonON612218920.013
TBLA0B044808.570ON608181920.013
YIL121W (QDR2)2.241ON542242920.014
Suva_13.2652.473ON561102920.015
Ecym_42988.272ON678318920.015
TBLA0F030408.272ON906308920.016
ZYRO0F14652g8.570ON566116910.016
TDEL0D06610singletonON49785910.017
CAGL0J09020g7.309ON85677910.020
KNAG0A035408.570ON538180890.026
TDEL0A024902.473ON55468890.026
ZYRO0G21868gna 5ON620160900.027
KLLA0A04631g8.272ON579138890.027
KLTH0H05456gna 5ON568156890.031
SAKL0A08228gsingletonON569143880.042
NDAI0C056708.570ON500113870.053
Smik_16.81na 6ON625213870.058
ACL172C3.245ON631137870.059
Kpol_467.242.473ON370185860.061
Kwal_56.237548.272ON589445860.077
KLTH0E13222g8.570ON566275860.078
SAKL0E02992g2.473ON57064850.080
SAKL0F00440gsingletonON544129850.085
Smik_2.3208.570ON572141850.086
ZYRO0G00352gsingletonON494224850.095
KAFR0I007108.570ON575174850.098
SAKL0H16808g8.272ON65769840.11
Kwal_56.229493.245ON64293840.12
Kwal_14.1585na 5ON57072840.12
TBLA0C01100na 7ON64995840.13
SAKL0H09328g8.570ON596159830.15
KAFR0J016202.242ON570168830.15
ZYRO0G21890gsingletonON57672830.15
CAGL0B02079gna 6ON624130830.15
SAKL0D04510gna 8ON531176830.16
CAGL0J01375g2.473ON564141830.16
KLLA0D11330gsingletonON521120820.18
SAKL0E08778g2.241ON600242830.18
KLLA0E03829g3.503ON609240820.24
ZYRO0E10230gsingletonON558227810.25
CAGL0M06281g8.570ON542174810.27
Kwal_34.15746na 3ON518184810.29
YIL120W (QDR1)2.242ON563218810.30
KNAG0E025602.473ON57868800.32
NCAS0C03460na 6ON630130800.33
Suva_9.712.241ON561229800.40
KAFR0J009302.242ON566310790.41
Skud_9.482.241ON599273790.43
Ecym_73992.473ON563130790.45
NDAI0I027703.503ON626137790.45
SAKL0E08756g2.242ON565101790.47
Kwal_14.782na 9ON491123790.52
ZYRO0G03234g2.473ON562133790.53
Kpol_1048.458.570ON648175790.55
KLTH0B10384gsingletonON551117780.59
Skud_7.560na 6ON642130780.70
Kpol_416.5singletonON607135780.71
KLTH0C08074g3.245ON64293780.73
ZYRO0F02178gsingletonON595132770.73
Smik_1.1singletonON594120770.75
KLTH0G19668gsingletonON508120770.77
TBLA0D029003.503ON691135770.80
KLLA0F13684g2.473ON57169770.81
KLTH0H16214gsingletonON551156770.82
Ecym_70638.570ON620137770.86
AGR195W8.570ON619101770.90
CAGL0G08624g2.242ON583253770.94
Skud_2.3068.570ON572168770.94
Suva_9.702.242ON565174760.96
NCAS0G029902.242ON581139761.1
TPHA0A017508.272ON636147761.1
YAL067C (SEO1)singletonON593120761.1
ABL040W2.473ON56764751.3
ZYRO0G15422gsingletonON542111751.3
ZYRO0A03564g3.245ON684210751.3
Skud_16.4503.503ON622138751.4
Suva_10.9singletonON637247751.5
Smik_6.22singletonON636137751.5
Skud_7.4483.503ON611138751.5
KLLA0E09879gsingletonON630108751.6
Skud_6.14singletonON636137751.7
NDAI0B037702.242ON571245741.7
YBR180W (DTR1)8.570ON572257741.7
KLTH0B10054gsingletonON503123741.7
KLTH0E00462gsingletonON503123741.7
TDEL0D038003.245ON640218741.9
KNAG0E01160singletonON572170741.9
KLLA0B06798g3.245ON663145742.0
TPHA0B012701.261ON740184742.2
SAKL0C05588gsingletonON677130732.2
Kpol_416.6singletonON597106732.3
Kwal_27.12832singletonON508125732.4
TBLA0G025502.242ON613102732.4
Suva_12.245na 10ON591112732.4
KLLA0F17776gna 4ON553112723.1
YPR198W (SGE1)singletonON54374723.5
ZYRO0A00330gsingletonON576229723.7
Kwal_26.7984na 11ON612160713.8
SAKL0D11000g1.451ON657156713.9
Smik_16.4083.503ON622138714.6
YGR138C (TPO2)3.503ON614138714.6
Skud_3.172na 12ON521170714.8
YPR156C (TPO3)3.503ON622138705.1
KLTH0C10142gsingletonON573126705.1
KLTH0G09372g2.242ON551135705.3
KNAG0K01020singletonON599147705.6
NCAS0D04970na 10ON582120705.7
KLLA0F03311g2.242ON542220705.9
YGR224W (AZR1)na 6ON613130696.7
TDEL0D057103.503ON616114697.5
TDEL0C023707.309ON731100697.7
KNAG0B028107.309ON798127698.2
Kwal_23.48242.242ON553102688.6
SAKL0D04070g3.245ON667114688.9
Kwal_26.9616singletonON562143689.6
ZYRO0C09614g2.77ON26466679.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_27.10245
         (515 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_27.10245 s27 (259090..260637) [1548 bp, 515 aa] {ON} YML116...  1019   0.0  
KLTH0C03806g Chr3 (332195..333772) [1578 bp, 525 aa] {ON} simila...   796   0.0  
SAKL0D01386g Chr4 (109619..111184) [1566 bp, 521 aa] {ON} unipro...   689   0.0  
NDAI0E00280 Chr5 (37676..39325) [1650 bp, 549 aa] {ON} Anc_8.843      628   0.0  
CAGL0B02343g Chr2 complement(222130..223743) [1614 bp, 537 aa] {...   625   0.0  
KNAG0G03430 Chr7 complement(734828..736456) [1629 bp, 542 aa] {O...   616   0.0  
YML116W Chr13 (38196..39824) [1629 bp, 542 aa] {ON}  ATR1Multidr...   615   0.0  
Suva_13.27 Chr13 (37895..39556) [1662 bp, 553 aa] {ON} YML116W (...   612   0.0  
KNAG0J00260 Chr10 (37950..39602) [1653 bp, 550 aa] {ON} Anc_8.84...   611   0.0  
Skud_13.25 Chr13 (37872..39485) [1614 bp, 537 aa] {ON} YML116W (...   609   0.0  
Smik_13.18 Chr13 (34422..36059) [1638 bp, 545 aa] {ON} YML116W (...   601   0.0  
TDEL0B00550 Chr2 (105483..107096) [1614 bp, 537 aa] {ON} Anc_8.8...   598   0.0  
NCAS0B00290 Chr2 (33760..35388) [1629 bp, 542 aa] {ON} Anc_8.843      598   0.0  
Kpol_541.16 s541 complement(43396..44982) [1587 bp, 528 aa] {ON}...   586   0.0  
Suva_13.467 Chr13 complement(807375..809006) [1632 bp, 543 aa] {...   578   0.0  
NCAS0A02540 Chr1 complement(481807..483426) [1620 bp, 539 aa] {O...   571   0.0  
KAFR0B03930 Chr2 complement(816351..818018) [1668 bp, 555 aa] {O...   572   0.0  
CAGL0M03003g Chr13 complement(337942..339618) [1677 bp, 558 aa] ...   566   0.0  
NCAS0C00400 Chr3 (61257..62810) [1554 bp, 517 aa] {ON} Anc_8.843      563   0.0  
TBLA0D03270 Chr4 complement(813041..814693) [1653 bp, 550 aa] {O...   557   0.0  
Skud_13.451 Chr13 complement(798006..799625) [1620 bp, 539 aa] {...   550   0.0  
NDAI0K00400 Chr11 (90040..91701) [1662 bp, 553 aa] {ON}               548   0.0  
TPHA0C04790 Chr3 complement(1033653..1035323) [1671 bp, 556 aa] ...   548   0.0  
YMR279C Chr13 complement(824729..826351) [1623 bp, 540 aa] {ON} ...   546   0.0  
KAFR0B03940 Chr2 complement(820954..822597) [1644 bp, 547 aa] {O...   541   0.0  
Smik_13.492 Chr13 complement(807726..809357) [1632 bp, 543 aa] {...   536   0.0  
TBLA0D03280 Chr4 complement(815937..817679) [1743 bp, 580 aa] {O...   536   0.0  
KAFR0A02840 Chr1 complement(588197..589759) [1563 bp, 520 aa] {O...   518   e-180
TBLA0C01160 Chr3 complement(246034..247836) [1803 bp, 600 aa] {O...   471   e-161
Smik_15.560 Chr15 (995453..997003) [1551 bp, 516 aa] {ON} YOR378...   332   e-108
Skud_15.545 Chr15 (988549..990099) [1551 bp, 516 aa] {ON} YOR378...   326   e-105
YOR378W Chr15 (1049511..1051058) [1548 bp, 515 aa] {ON} Putative...   325   e-105
Suva_8.435 Chr8 (786917..788464) [1548 bp, 515 aa] {ON} YOR378W ...   321   e-103
KLTH0C10560g Chr3 (875216..876763) [1548 bp, 515 aa] {ON} simila...   316   e-101
KLLA0B00352g Chr2 (22476..23972) [1497 bp, 498 aa] {ON} highly s...   310   1e-99
Kwal_23.6547 s23 (1635677..1637212) [1536 bp, 511 aa] {ON} YOR37...   303   8e-97
TDEL0G04950 Chr7 complement(922428..923966) [1539 bp, 512 aa] {O...   299   7e-95
KNAG0D00130 Chr4 complement(6264..7961) [1698 bp, 565 aa] {ON}  ...   214   5e-62
KAFR0C04860 Chr3 (964552..966156) [1605 bp, 534 aa] {ON}  YOR378W     189   5e-53
SAKL0C06116g Chr3 complement(571813..572370) [558 bp, 185 aa] {O...   177   2e-52
CAGL0L02519g Chr12 complement(297555..299144) [1590 bp, 529 aa] ...   168   2e-45
NCAS0A05720 Chr1 (1117491..1119182) [1692 bp, 563 aa] {ON}            162   4e-43
NDAI0K02730 Chr11 complement(612590..614404) [1815 bp, 604 aa] {...   147   2e-37
Smik_6.24 Chr6 (39520..41154) [1635 bp, 544 aa] {ON} YMR279C (REAL)    58   3e-08
ZYRO0C01430g Chr3 complement(101140..102912) [1773 bp, 590 aa] {...    55   4e-07
Skud_6.16 Chr6 (26284..27933) [1650 bp, 549 aa] {ON} YOR378W (REAL)    53   1e-06
Suva_10.11 Chr10 (18934..20556) [1623 bp, 540 aa] {ON} YOR378W (...    50   7e-06
KLLA0C18931g Chr3 (1680133..1681794) [1662 bp, 553 aa] {ON} unip...    50   1e-05
SAKL0E04246g Chr5 (336416..338113) [1698 bp, 565 aa] {ON} weakly...    49   3e-05
NCAS0A07810 Chr1 complement(1554541..1556247) [1707 bp, 568 aa] ...    47   1e-04
KLTH0G13464g Chr7 complement(1154304..1156085) [1782 bp, 593 aa]...    46   2e-04
AGR076C Chr7 complement(871564..873624) [2061 bp, 686 aa] {ON} S...    46   2e-04
NDAI0D01020 Chr4 complement(229357..231135) [1779 bp, 592 aa] {O...    45   3e-04
SAKL0C02178g Chr3 complement(191542..193239) [1698 bp, 565 aa] {...    45   5e-04
NDAI0H02200 Chr8 complement(536385..538100) [1716 bp, 571 aa] {O...    45   5e-04
KLLA0E24113g Chr5 complement(2148115..2149842) [1728 bp, 575 aa]...    45   5e-04
SAKL0A00726g Chr1 (82164..83960) [1797 bp, 598 aa] {ON} similar ...    44   6e-04
TDEL0D00240 Chr4 complement(38642..40132) [1491 bp, 496 aa] {ON}       44   0.001
Smik_13.272 Chr13 complement(427283..428968) [1686 bp, 561 aa] {...    44   0.001
Skud_13.244 Chr13 complement(417271..418959) [1689 bp, 562 aa] {...    44   0.001
Kpol_543.44 s543 (96992..98923) [1932 bp, 643 aa] {ON} (96992..9...    43   0.002
KNAG0I01910 Chr9 complement(373073..374869) [1797 bp, 598 aa] {O...    43   0.002
KLTH0D16962g Chr4 (1399514..1401229) [1716 bp, 571 aa] {ON} simi...    42   0.003
YMR088C Chr13 complement(443414..445102) [1689 bp, 562 aa] {ON} ...    42   0.003
TDEL0A05130 Chr1 complement(910315..912114) [1800 bp, 599 aa] {O...    41   0.008
TPHA0I01760 Chr9 (388160..390121) [1962 bp, 653 aa] {ON} Anc_8.5...    40   0.010
Kwal_27.12173 s27 complement(1120952..1122655) [1704 bp, 567 aa]...    40   0.010
TDEL0F03990 Chr6 (740471..742366) [1896 bp, 631 aa] {ON} Anc_8.2...    40   0.010
Suva_4.431 Chr4 (759282..761000) [1719 bp, 572 aa] {ON} YBR180W ...    40   0.011
NCAS0B02010 Chr2 (328296..329888) [1593 bp, 530 aa] {ON} Anc_8.570     40   0.013
TDEL0G03260 Chr7 (605429..607267) [1839 bp, 612 aa] {ON}               40   0.013
TBLA0B04480 Chr2 (1029953..1031779) [1827 bp, 608 aa] {ON} Anc_8...    40   0.013
YIL121W Chr9 (132244..133872) [1629 bp, 542 aa] {ON}  QDR2Multid...    40   0.014
Suva_13.265 Chr13 complement(424929..426614) [1686 bp, 561 aa] {...    40   0.015
Ecym_4298 Chr4 complement(636605..638641) [2037 bp, 678 aa] {ON}...    40   0.015
TBLA0F03040 Chr6 complement(735352..738072) [2721 bp, 906 aa] {O...    40   0.016
ZYRO0F14652g Chr6 complement(1207106..1208806) [1701 bp, 566 aa]...    40   0.016
TDEL0D06610 Chr4 complement(1195341..1196834) [1494 bp, 497 aa] ...    40   0.017
CAGL0J09020g Chr10 (889269..891839) [2571 bp, 856 aa] {ON} highl...    40   0.020
KNAG0A03540 Chr1 (450487..452103) [1617 bp, 538 aa] {ON} Anc_8.5...    39   0.026
TDEL0A02490 Chr1 (446429..448093) [1665 bp, 554 aa] {ON} Anc_2.4...    39   0.026
ZYRO0G21868g Chr7 complement(1799212..1801074) [1863 bp, 620 aa]...    39   0.027
KLLA0A04631g Chr1 complement(415070..416809) [1740 bp, 579 aa] {...    39   0.027
KLTH0H05456g Chr8 (484160..485866) [1707 bp, 568 aa] {ON} simila...    39   0.031
SAKL0A08228g Chr1 complement(732518..734227) [1710 bp, 569 aa] {...    39   0.042
NDAI0C05670 Chr3 complement(1310115..1311617) [1503 bp, 500 aa] ...    38   0.053
Smik_16.81 Chr16 complement(152022..153515,153516..153899) [1878...    38   0.058
ACL172C Chr3 complement(58313..60208) [1896 bp, 631 aa] {ON} Syn...    38   0.059
Kpol_467.24 s467 (55523..56632) [1110 bp, 370 aa] {ON} (55523..5...    38   0.061
Kwal_56.23754 s56 complement(690851..692620) [1770 bp, 589 aa] {...    38   0.077
KLTH0E13222g Chr5 complement(1175450..1177150) [1701 bp, 566 aa]...    38   0.078
SAKL0E02992g Chr5 complement(243652..245364) [1713 bp, 570 aa] {...    37   0.080
SAKL0F00440g Chr6 complement(36452..38086) [1635 bp, 544 aa] {ON...    37   0.085
Smik_2.320 Chr2 (575945..577663) [1719 bp, 572 aa] {ON} YBR180W ...    37   0.086
ZYRO0G00352g Chr7 (27042..28526) [1485 bp, 494 aa] {ON} weakly s...    37   0.095
KAFR0I00710 Chr9 (139612..141339) [1728 bp, 575 aa] {ON} Anc_8.5...    37   0.098
SAKL0H16808g Chr8 complement(1477137..1479110) [1974 bp, 657 aa]...    37   0.11 
Kwal_56.22949 s56 complement(342503..344431) [1929 bp, 642 aa] {...    37   0.12 
Kwal_14.1585 s14 (377103..378815) [1713 bp, 570 aa] {ON} YMR088C...    37   0.12 
TBLA0C01100 Chr3 (227542..229491) [1950 bp, 649 aa] {ON} Anc_1.432     37   0.13 
SAKL0H09328g Chr8 (791744..793534) [1791 bp, 596 aa] {ON} simila...    37   0.15 
KAFR0J01620 Chr10 complement(300964..302676) [1713 bp, 570 aa] {...    37   0.15 
ZYRO0G21890g Chr7 complement(1801391..1803121) [1731 bp, 576 aa]...    37   0.15 
CAGL0B02079g Chr2 complement(191736..193610) [1875 bp, 624 aa] {...    37   0.15 
SAKL0D04510g Chr4 complement(360010..361605) [1596 bp, 531 aa] {...    37   0.16 
CAGL0J01375g Chr10 (127843..129537) [1695 bp, 564 aa] {ON} simil...    37   0.16 
KLLA0D11330g Chr4 (970243..971808) [1566 bp, 521 aa] {ON} simila...    36   0.18 
SAKL0E08778g Chr5 complement(716961..718763) [1803 bp, 600 aa] {...    37   0.18 
KLLA0E03829g Chr5 (349784..351613) [1830 bp, 609 aa] {ON} highly...    36   0.24 
ZYRO0E10230g Chr5 complement(850980..852656) [1677 bp, 558 aa] {...    36   0.25 
CAGL0M06281g Chr13 (651932..653560) [1629 bp, 542 aa] {ON} simil...    36   0.27 
Kwal_34.15746 s34 (37757..39313) [1557 bp, 518 aa] {ON} YGR224W ...    36   0.29 
YIL120W Chr9 (134417..136108) [1692 bp, 563 aa] {ON}  QDR1Multid...    36   0.30 
KNAG0E02560 Chr5 (506517..508253) [1737 bp, 578 aa] {ON} Anc_2.4...    35   0.32 
NCAS0C03460 Chr3 complement(690089..691981) [1893 bp, 630 aa] {O...    35   0.33 
Suva_9.71 Chr9 (129275..130960) [1686 bp, 561 aa] {ON} YIL121W (...    35   0.40 
KAFR0J00930 Chr10 (168674..170374) [1701 bp, 566 aa] {ON} Anc_2....    35   0.41 
Skud_9.48 Chr9 (109346..111145) [1800 bp, 599 aa] {ON} YIL120W (...    35   0.43 
Ecym_7399 Chr7 complement(820280..821971) [1692 bp, 563 aa] {ON}...    35   0.45 
NDAI0I02770 Chr9 (652149..654029) [1881 bp, 626 aa] {ON} Anc_3.503     35   0.45 
SAKL0E08756g Chr5 complement(714902..716599) [1698 bp, 565 aa] {...    35   0.47 
Kwal_14.782 s14 (42720..44195) [1476 bp, 491 aa] {ON} YGR260W (T...    35   0.52 
ZYRO0G03234g Chr7 (247798..249486) [1689 bp, 562 aa] {ON} simila...    35   0.53 
Kpol_1048.45 s1048 (117855..119801) [1947 bp, 648 aa] {ON} (1178...    35   0.55 
KLTH0B10384g Chr2 complement(877070..878725) [1656 bp, 551 aa] {...    35   0.59 
Skud_7.560 Chr7 (917668..919596) [1929 bp, 642 aa] {ON} YGR224W ...    35   0.70 
Kpol_416.5 s416 (23208..25031) [1824 bp, 607 aa] {ON} (23208..25...    35   0.71 
KLTH0C08074g Chr3 (688367..690295) [1929 bp, 642 aa] {ON} simila...    35   0.73 
ZYRO0F02178g Chr6 (176789..178576) [1788 bp, 595 aa] {ON} simila...    34   0.73 
Smik_1.1 Chr1 complement(4254..6038) [1785 bp, 594 aa] {ON} YAL0...    34   0.75 
KLTH0G19668g Chr7 (1702771..1704297) [1527 bp, 508 aa] {ON} weak...    34   0.77 
TBLA0D02900 Chr4 (714553..716628) [2076 bp, 691 aa] {ON} Anc_3.5...    34   0.80 
KLLA0F13684g Chr6 complement(1267367..1269082) [1716 bp, 571 aa]...    34   0.81 
KLTH0H16214g Chr8 complement(1398230..1399885) [1656 bp, 551 aa]...    34   0.82 
Ecym_7063 Chr7 complement(130980..132842) [1863 bp, 620 aa] {ON}...    34   0.86 
AGR195W Chr7 (1120597..1122456) [1860 bp, 619 aa] {ON} Syntenic ...    34   0.90 
CAGL0G08624g Chr7 complement(811931..813682) [1752 bp, 583 aa] {...    34   0.94 
Skud_2.306 Chr2 (557166..558884) [1719 bp, 572 aa] {ON} YBR180W ...    34   0.94 
Suva_9.70 Chr9 (127105..128802) [1698 bp, 565 aa] {ON} YIL120W (...    34   0.96 
NCAS0G02990 Chr7 complement(549460..551205) [1746 bp, 581 aa] {O...    34   1.1  
TPHA0A01750 Chr1 complement(354061..355971) [1911 bp, 636 aa] {O...    34   1.1  
YAL067C Chr1 complement(7235..9016) [1782 bp, 593 aa] {ON}  SEO1...    34   1.1  
ABL040W Chr2 (321534..323237) [1704 bp, 567 aa] {ON} Syntenic ho...    33   1.3  
ZYRO0G15422g Chr7 (1253872..1255500) [1629 bp, 542 aa] {ON} simi...    33   1.3  
ZYRO0A03564g Chr1 (283783..285837) [2055 bp, 684 aa] {ON} simila...    33   1.3  
Skud_16.450 Chr16 complement(791420..793288) [1869 bp, 622 aa] {...    33   1.4  
Suva_10.9 Chr10 complement(12679..14592) [1914 bp, 637 aa] {ON} ...    33   1.5  
Smik_6.22 Chr6 complement(31536..33446) [1911 bp, 636 aa] {ON} Y...    33   1.5  
Skud_7.448 Chr7 complement(742873..744708) [1836 bp, 611 aa] {ON...    33   1.5  
KLLA0E09879g Chr5 complement(874102..875994) [1893 bp, 630 aa] {...    33   1.6  
Skud_6.14 Chr6 complement(19547..21457) [1911 bp, 636 aa] {ON} Y...    33   1.7  
NDAI0B03770 Chr2 complement(947945..949660) [1716 bp, 571 aa] {O...    33   1.7  
YBR180W Chr2 (589741..591459) [1719 bp, 572 aa] {ON}  DTR1Putati...    33   1.7  
KLTH0B10054g Chr2 complement(839166..840677) [1512 bp, 503 aa] {...    33   1.7  
KLTH0E00462g Chr5 (45358..46869) [1512 bp, 503 aa] {ON} weakly s...    33   1.7  
TDEL0D03800 Chr4 (695403..697325) [1923 bp, 640 aa] {ON} Anc_3.2...    33   1.9  
KNAG0E01160 Chr5 (228323..230041) [1719 bp, 572 aa] {ON}               33   1.9  
KLLA0B06798g Chr2 (596500..598491) [1992 bp, 663 aa] {ON} simila...    33   2.0  
TPHA0B01270 Chr2 complement(283532..285754) [2223 bp, 740 aa] {O...    33   2.2  
SAKL0C05588g Chr3 (527748..529781) [2034 bp, 677 aa] {ON} simila...    33   2.2  
Kpol_416.6 s416 (26742..28535) [1794 bp, 597 aa] {ON} (26742..28...    33   2.3  
Kwal_27.12832 s27 (1393503..1395029) [1527 bp, 508 aa] {ON} YGR2...    33   2.4  
TBLA0G02550 Chr7 complement(668523..670364) [1842 bp, 613 aa] {O...    33   2.4  
Suva_12.245 Chr12 (391999..393774) [1776 bp, 591 aa] {ON} YAL067...    33   2.4  
KLLA0F17776g Chr6 complement(1627198..1628859) [1662 bp, 553 aa]...    32   3.1  
YPR198W Chr16 (934034..935665) [1632 bp, 543 aa] {ON}  SGE1Plasm...    32   3.5  
ZYRO0A00330g Chr1 (19597..21327) [1731 bp, 576 aa] {ON} similar ...    32   3.7  
Kwal_26.7984 s26 complement(598830..600668) [1839 bp, 612 aa] {O...    32   3.8  
SAKL0D11000g Chr4 (910457..912430) [1974 bp, 657 aa] {ON} simila...    32   3.9  
Smik_16.408 Chr16 complement(709761..711629) [1869 bp, 622 aa] {...    32   4.6  
YGR138C Chr7 complement(763762..765606) [1845 bp, 614 aa] {ON}  ...    32   4.6  
Skud_3.172 Chr3 complement(280981..282546) [1566 bp, 521 aa] {ON...    32   4.8  
YPR156C Chr16 complement(837909..839777) [1869 bp, 622 aa] {ON} ...    32   5.1  
KLTH0C10142g Chr3 (842371..844092) [1722 bp, 573 aa] {ON} simila...    32   5.1  
KLTH0G09372g Chr7 (780184..781839) [1656 bp, 551 aa] {ON} simila...    32   5.3  
KNAG0K01020 Chr11 complement(198213..200012) [1800 bp, 599 aa] {...    32   5.6  
NCAS0D04970 Chr4 (952902..954650) [1749 bp, 582 aa] {ON}               32   5.7  
KLLA0F03311g Chr6 (311639..313267) [1629 bp, 542 aa] {ON} simila...    32   5.9  
YGR224W Chr7 (942806..944647) [1842 bp, 613 aa] {ON}  AZR1Plasma...    31   6.7  
TDEL0D05710 Chr4 complement(1025468..1027318) [1851 bp, 616 aa] ...    31   7.5  
TDEL0C02370 Chr3 (416622..418817) [2196 bp, 731 aa] {ON} Anc_7.3...    31   7.7  
KNAG0B02810 Chr2 (541349..543745) [2397 bp, 798 aa] {ON} Anc_7.3...    31   8.2  
Kwal_23.4824 s23 (883258..884919) [1662 bp, 553 aa] {ON} YNL065W...    31   8.6  
SAKL0D04070g Chr4 (331254..333257) [2004 bp, 667 aa] {ON} simila...    31   8.9  
Kwal_26.9616 s26 (1294683..1296371) [1689 bp, 562 aa] {ON} YPR19...    31   9.6  
ZYRO0C09614g Chr3 complement(732463..733257) [795 bp, 264 aa] {O...    30   9.8  

>Kwal_27.10245 s27 (259090..260637) [1548 bp, 515 aa] {ON} YML116W
           (ATR1) - predicted protein is very hydrophobic, has many
           membrane-spanning regions, several potential
           glycosylation sites, potential ATP-binding site [contig
           38] FULL
          Length = 515

 Score = 1019 bits (2634), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 501/515 (97%), Positives = 501/515 (97%)

Query: 1   MNMKENDDEENWEKLQSSSAAGEERDGQTEAIGPKSRLQNPDYFDKPWKEYIFVLSSMLS 60
           MNMKENDDEENWEKLQSSSAAGEERDGQTEAIGPKSRLQNPDYFDKPWKEYIFVLSSMLS
Sbjct: 1   MNMKENDDEENWEKLQSSSAAGEERDGQTEAIGPKSRLQNPDYFDKPWKEYIFVLSSMLS 60

Query: 61  QLLNQAATTQTNPLFDVLSKDLNAKVSQQPWLMASFPLVSGSFILVSGKVGDIYGLKKTL 120
           QLLNQAATTQTNPLFDVLSKDLNAKVSQQPWLMASFPLVSGSFILVSGKVGDIYGLKKTL
Sbjct: 61  QLLNQAATTQTNPLFDVLSKDLNAKVSQQPWLMASFPLVSGSFILVSGKVGDIYGLKKTL 120

Query: 121 LGGYVVVVIWSLICGLSSYAHNVDFFVVARSFQGLGIAFVLPNVMGIVGNIYKPNTEAKN 180
           LGGYVVVVIWSLICGLSSYAHNVDFFVVARSFQGLGIAFVLPNVMGIVGNIYKPNTEAKN
Sbjct: 121 LGGYVVVVIWSLICGLSSYAHNVDFFVVARSFQGLGIAFVLPNVMGIVGNIYKPNTEAKN 180

Query: 181 LVFSLIGACAPIGATLGCVFSGLIGARTDLWGWTFYAYAITAALNGLVALWIIPNNIPTN 240
           LVFSLIGACAPIGATLGCVFSGLIGARTDLWGWTFYAYAITAALNGLVALWIIPNNIPTN
Sbjct: 181 LVFSLIGACAPIGATLGCVFSGLIGARTDLWGWTFYAYAITAALNGLVALWIIPNNIPTN 240

Query: 241 VNEYKMDWIGSAIGVFGLILFNFVWNQAPIAGWGSAYXXXXXXXXXXXXXXFITYEIRFA 300
           VNEYKMDWIGSAIGVFGLILFNFVWNQAPIAGWGSAY              FITYEIRFA
Sbjct: 241 VNEYKMDWIGSAIGVFGLILFNFVWNQAPIAGWGSAYIIVLLIVAVVALIAFITYEIRFA 300

Query: 301 KQPLLPHSVLFNRKLMMILSSLFFGWGSFGIWTFYYMSFMLNLRHYSPLWAGGTYFMFAI 360
           KQPLLPHSVLFNRKLMMILSSLFFGWGSFGIWTFYYMSFMLNLRHYSPLWAGGTYFMFAI
Sbjct: 301 KQPLLPHSVLFNRKLMMILSSLFFGWGSFGIWTFYYMSFMLNLRHYSPLWAGGTYFMFAI 360

Query: 361 WGIVASLLVGYTIHKTGPAVILFLSMVAFDCGCIMLAVTPVHQTYFRMTLGIMIILSFGM 420
           WGIVASLLVGYTIHKTGPAVILFLSMVAFDCGCIMLAVTPVHQTYFRMTLGIMIILSFGM
Sbjct: 361 WGIVASLLVGYTIHKTGPAVILFLSMVAFDCGCIMLAVTPVHQTYFRMTLGIMIILSFGM 420

Query: 421 DLSFPAASIILSDQLPSQYQGMAGSLVSTMISYSMSLCLGISGTAEHQVNKNGIDLLKGY 480
           DLSFPAASIILSDQLPSQYQGMAGSLVSTMISYSMSLCLGISGTAEHQVNKNGIDLLKGY
Sbjct: 421 DLSFPAASIILSDQLPSQYQGMAGSLVSTMISYSMSLCLGISGTAEHQVNKNGIDLLKGY 480

Query: 481 QAALYVGIGLASLGVVISGAFMIEDWWTSRRKRTT 515
           QAALYVGIGLASLGVVISGAFMIEDWWTSRRKRTT
Sbjct: 481 QAALYVGIGLASLGVVISGAFMIEDWWTSRRKRTT 515

>KLTH0C03806g Chr3 (332195..333772) [1578 bp, 525 aa] {ON} similar
           to uniprot|P13090 Saccharomyces cerevisiae YML116W ATR1
           Multidrug efflux pump of the major facilitator
           superfamily required for resistance to aminotriazole and
           4-nitroquinoline-N-oxide
          Length = 525

 Score =  796 bits (2056), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 376/492 (76%), Positives = 432/492 (87%)

Query: 23  EERDGQTEAIGPKSRLQNPDYFDKPWKEYIFVLSSMLSQLLNQAATTQTNPLFDVLSKDL 82
           +  +     +  +SRLQNPDYFDK WKEY+FV+SSMLSQLLNQAA  Q NPLFD+LS+DL
Sbjct: 23  DNHEDSDMLLASRSRLQNPDYFDKQWKEYLFVISSMLSQLLNQAAALQANPLFDLLSEDL 82

Query: 83  NAKVSQQPWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYVVVVIWSLICGLSSYAHN 142
            AK SQQ WLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGY VVVIWSLICGLSSYAHN
Sbjct: 83  KAKASQQAWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYAVVVIWSLICGLSSYAHN 142

Query: 143 VDFFVVARSFQGLGIAFVLPNVMGIVGNIYKPNTEAKNLVFSLIGACAPIGATLGCVFSG 202
           VDFF+VARSFQGLGIAFVLPNV GIVGNIYKPNT+AKN+VFS+IGACAPIGATLGC+FSG
Sbjct: 143 VDFFIVARSFQGLGIAFVLPNVTGIVGNIYKPNTKAKNMVFSMIGACAPIGATLGCLFSG 202

Query: 203 LIGARTDLWGWTFYAYAITAALNGLVALWIIPNNIPTNVNEYKMDWIGSAIGVFGLILFN 262
           LIG  ++ W WTFYAY I AALNGL+A ++IP+NIPTNV+++KMDW+GS +GV GLI+FN
Sbjct: 203 LIGTESEAWAWTFYAYTIVAALNGLIAWYVIPDNIPTNVHKFKMDWLGSFLGVCGLIMFN 262

Query: 263 FVWNQAPIAGWGSAYXXXXXXXXXXXXXXFITYEIRFAKQPLLPHSVLFNRKLMMILSSL 322
           FVWNQAP  GW SAY              FI +E RFAK+PLLP +VLFNRKLMMIL+SL
Sbjct: 263 FVWNQAPTDGWDSAYIIVLLVISVILLLIFIIFEARFAKEPLLPRAVLFNRKLMMILASL 322

Query: 323 FFGWGSFGIWTFYYMSFMLNLRHYSPLWAGGTYFMFAIWGIVASLLVGYTIHKTGPAVIL 382
           F GWGSFGIWT+YYM+F+LNLRHY+PLWAGG+YFMFAI+G +A+ LVG+TIHKTGPA+IL
Sbjct: 323 FLGWGSFGIWTYYYMAFVLNLRHYTPLWAGGSYFMFAIFGTIAAFLVGHTIHKTGPAIIL 382

Query: 383 FLSMVAFDCGCIMLAVTPVHQTYFRMTLGIMIILSFGMDLSFPAASIILSDQLPSQYQGM 442
             S++AFD GCIML+VTPV QTYFRM+LG M+ILSFGMDLSFPA+SIILSDQLPSQYQGM
Sbjct: 383 LASVIAFDVGCIMLSVTPVDQTYFRMSLGTMVILSFGMDLSFPASSIILSDQLPSQYQGM 442

Query: 443 AGSLVSTMISYSMSLCLGISGTAEHQVNKNGIDLLKGYQAALYVGIGLASLGVVISGAFM 502
           AGSLV+TMI+YSMSLCLG+SGTAE QVNK+G DLLKGY+AALYVGIGLAS+G+ +SGA+ 
Sbjct: 443 AGSLVNTMINYSMSLCLGVSGTAERQVNKDGTDLLKGYRAALYVGIGLASVGIFVSGAYA 502

Query: 503 IEDWWTSRRKRT 514
           IEDWWT RR+R+
Sbjct: 503 IEDWWTRRRERS 514

>SAKL0D01386g Chr4 (109619..111184) [1566 bp, 521 aa] {ON}
           uniprot|Q875S7 Saccharomyces kluyveri ATR1
          Length = 521

 Score =  689 bits (1778), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/498 (65%), Positives = 399/498 (80%), Gaps = 1/498 (0%)

Query: 16  QSSSAAGEERDGQTEAIGPKSRLQNPDYFDKPWKEYIFVLSSMLSQLLNQAATTQTNPLF 75
           QS++A  E  D Q +     S +Q+P YF  PWKEY+F+ +SM+SQLLNQA TTQT  L 
Sbjct: 20  QSATAFTEHSDVQVDDKKWPS-IQDPTYFSAPWKEYLFIFASMMSQLLNQAGTTQTLSLI 78

Query: 76  DVLSKDLNAKVSQQPWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYVVVVIWSLICG 135
           ++LSK+ ++  SQQ WLMASFPLVSGSFILVSGK+GDIYGLKKTLL GYVV +IWSLICG
Sbjct: 79  NILSKNFDSSTSQQTWLMASFPLVSGSFILVSGKIGDIYGLKKTLLVGYVVTIIWSLICG 138

Query: 136 LSSYAHNVDFFVVARSFQGLGIAFVLPNVMGIVGNIYKPNTEAKNLVFSLIGACAPIGAT 195
           L+SY  +V+FF+++R+FQGLGIAF+LPN+MGIVGNIY   T  KN+V SLIGACAPIGAT
Sbjct: 139 LTSYTSSVEFFIISRAFQGLGIAFILPNIMGIVGNIYVAGTTRKNMVISLIGACAPIGAT 198

Query: 196 LGCVFSGLIGARTDLWGWTFYAYAITAALNGLVALWIIPNNIPTNVNEYKMDWIGSAIGV 255
           +G +FSGLIG  ++ W WTFYAY ITAA+N  +++W+IPN IPTNV    MDWIGS IG+
Sbjct: 199 MGVLFSGLIGTLSERWAWTFYAYTITAAINMGLSIWVIPNTIPTNVRGSSMDWIGSGIGL 258

Query: 256 FGLILFNFVWNQAPIAGWGSAYXXXXXXXXXXXXXXFITYEIRFAKQPLLPHSVLFNRKL 315
            G+ILFNFVWNQ PI GW +AY              F  YE ++A  PL+P   + N +L
Sbjct: 259 LGMILFNFVWNQGPIVGWDTAYIIVLLIVSVAAIVAFFLYETKYANDPLIPRPAMHNHRL 318

Query: 316 MMILSSLFFGWGSFGIWTFYYMSFMLNLRHYSPLWAGGTYFMFAIWGIVASLLVGYTIHK 375
           +M L ++FFGWGSFGIWTFYY  F+LNLR Y+PLWAGG+YFMF IWGI+A++ VGYTI +
Sbjct: 319 LMTLLAVFFGWGSFGIWTFYYFCFVLNLREYTPLWAGGSYFMFLIWGIIAAISVGYTIKR 378

Query: 376 TGPAVILFLSMVAFDCGCIMLAVTPVHQTYFRMTLGIMIILSFGMDLSFPAASIILSDQL 435
             P++ILFLSM+AFDCGCIML+VTPV QTYFRM LG+MIILSFGMDLSFPA+SIILSD+L
Sbjct: 379 IPPSLILFLSMLAFDCGCIMLSVTPVDQTYFRMILGMMIILSFGMDLSFPASSIILSDEL 438

Query: 436 PSQYQGMAGSLVSTMISYSMSLCLGISGTAEHQVNKNGIDLLKGYQAALYVGIGLASLGV 495
           P + QGMAGSLVSTMI+YSMS+CLGI+GT EHQ+NKNG DLLKGY+AALY+GIGLASLGV
Sbjct: 439 PMENQGMAGSLVSTMINYSMSMCLGIAGTVEHQINKNGDDLLKGYRAALYLGIGLASLGV 498

Query: 496 VISGAFMIEDWWTSRRKR 513
            IS  FM+E++   RR+ 
Sbjct: 499 FISALFMLENYLRMRRRN 516

>NDAI0E00280 Chr5 (37676..39325) [1650 bp, 549 aa] {ON} Anc_8.843
          Length = 549

 Score =  628 bits (1620), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/511 (59%), Positives = 389/511 (76%), Gaps = 8/511 (1%)

Query: 4   KENDDEENWEKLQSSSAAGEERDGQTEAIGPKSRLQNPDYFDKPWKEYIFVLSSMLSQLL 63
           KE ++E + ++L SS    E+ D     IG  S+ QNPDYF   W+EY+F+ S M+SQLL
Sbjct: 36  KEENNEVSEDELPSS----EQED---NTIGDHSKWQNPDYFQNKWQEYLFIFSCMMSQLL 88

Query: 64  NQAATTQTNPLFDVLSKDLNAKVSQQPWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGG 123
           NQAAT QT  + ++++    ++  ++ WL+ASFPLVSGSFIL+SG++GDIYGLKKTL+GG
Sbjct: 89  NQAATPQTLSIMNIITDSFKSEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLIGG 148

Query: 124 YVVVVIWSLICGLSSYAHNVDFFVVARSFQGLGIAFVLPNVMGIVGNIYKPNTEAKNLVF 183
           Y+  +IWSLI G + Y+HN  FF+++R+FQGLGIAF+LPNVMGIVGNIYKP+T+ KN+V 
Sbjct: 149 YLFFIIWSLISGFTDYSHNDIFFIISRAFQGLGIAFILPNVMGIVGNIYKPDTQRKNIVI 208

Query: 184 SLIGACAPIGATLGCVFSGLIGART-DLWGWTFYAYAITAALNGLVALWIIPNNIPTNVN 242
           S+IGA APIGA +G +F+GLIG      W W FYA+AI +A+N  ++++ IPNNIPTN++
Sbjct: 209 SMIGASAPIGAFMGSLFAGLIGTENPKQWPWAFYAFAIASAINLAISIYSIPNNIPTNIH 268

Query: 243 EYKMDWIGSAIGVFGLILFNFVWNQAPIAGWGSAYXXXXXXXXXXXXXXFITYEIRFAKQ 302
            + MDWIGS + V GLIL NFVWNQ PI GW  AY              F TYEI++AK 
Sbjct: 269 GFAMDWIGSIMAVIGLILLNFVWNQGPIVGWQKAYIIVLLIISIIALVLFFTYEIKYAKS 328

Query: 303 PLLPHSVLFNRKLMMILSSLFFGWGSFGIWTFYYMSFMLNLRHYSPLWAGGTYFMFAIWG 362
           P+LP  V  NR ++MIL++LF GWGSFGI++FYY SF+LNLRHYS LWAG TYFMFAIWG
Sbjct: 329 PILPVEVTKNRHIIMILAALFLGWGSFGIFSFYYFSFLLNLRHYSALWAGTTYFMFAIWG 388

Query: 363 IVASLLVGYTIHKTGPAVILFLSMVAFDCGCIMLAVTPVHQTYFRMTLGIMIILSFGMDL 422
            VA+++VG  I +   +VILF SM+AF+ G IML+VTPV QTYFRM LG MIILSFGMD+
Sbjct: 389 TVAAVIVGAFIKRISASVILFFSMIAFNIGLIMLSVTPVDQTYFRMNLGTMIILSFGMDM 448

Query: 423 SFPAASIILSDQLPSQYQGMAGSLVSTMISYSMSLCLGISGTAEHQVNKNGIDLLKGYQA 482
           SFPAA+IILSD L  QYQGMAGSL +TM++YSMSLCLG+  T E Q+NK+G ++LKGY+A
Sbjct: 449 SFPAAAIILSDGLTMQYQGMAGSLANTMVNYSMSLCLGMGTTVERQINKSGKEILKGYRA 508

Query: 483 ALYVGIGLASLGVVISGAFMIEDWWTSRRKR 513
           A Y+G+GLA LG+VISG +M E  W  R++R
Sbjct: 509 AEYLGVGLAGLGIVISGIYMAEVLWAKRKER 539

>CAGL0B02343g Chr2 complement(222130..223743) [1614 bp, 537 aa] {ON}
           similar to uniprot|P13090 Saccharomyces cerevisiae
           YML116w ATR1 Aminotriazole resistance protein or
           uniprot|Q03263 Saccharomyces cerevisiae YMR279c
          Length = 537

 Score =  625 bits (1612), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/500 (59%), Positives = 387/500 (77%), Gaps = 2/500 (0%)

Query: 16  QSSSAAGEERDGQTEAIGPKSRLQNPDYFDKPWKEYIFVLSSMLSQLLNQAATTQTNPLF 75
           Q ++   +E+   T+AI    + QNP+YFD   KEY+F+ S  +SQLLNQA   QT P+ 
Sbjct: 28  QDNNDIVDEKQCDTQAIDGNQKWQNPEYFDSTLKEYLFLCSCFVSQLLNQAGAIQTQPIM 87

Query: 76  DVLSKDLNAKVSQQPWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYVVVVIWSLICG 135
           ++++  L+++  +Q WLMA+FPL+SGSFIL+SG++GDIYGLKKTLL GY+ +++WSLICG
Sbjct: 88  NIVADSLDSQNGKQAWLMAAFPLISGSFILISGRIGDIYGLKKTLLVGYLFLIVWSLICG 147

Query: 136 LSSYAHNVDFFVVARSFQGLGIAFVLPNVMGIVGNIYKPNTEAKNLVFSLIGACAPIGAT 195
           L+ YAH+  FF+V+R+FQGLGI+ +LPN++GIVG+IY   ++ KN+V SLIG  APIGAT
Sbjct: 148 LTKYAHSDSFFIVSRAFQGLGISLILPNILGIVGSIYIAGSKRKNMVISLIGCMAPIGAT 207

Query: 196 LGCVFSGLIGAR-TDLWGWTFYAYAITAALNGLVALWIIPNNIPTNVNEYKMDWIGSAIG 254
           LG VFSGLIG    + W W FY+YAITAA+N ++++W+IPN IPTNV+ +KMDWIGS +G
Sbjct: 208 LGAVFSGLIGTEDANQWPWAFYSYAITAAINFVLSIWLIPNTIPTNVHGHKMDWIGSGLG 267

Query: 255 VFGLILFNFVWNQAPIAGWGSAYXXXXXXXXXXXXXXFITYEIRFAK-QPLLPHSVLFNR 313
           V GLI+ NFVWNQAPI GW SAY              F  YE+ F    PLLP  VL + 
Sbjct: 268 VVGLIMLNFVWNQAPIDGWDSAYLIVLLIISVLLLIAFFIYELHFVNGNPLLPKEVLKSP 327

Query: 314 KLMMILSSLFFGWGSFGIWTFYYMSFMLNLRHYSPLWAGGTYFMFAIWGIVASLLVGYTI 373
           K +++L +LFFGWGSFGI++FYY +F LNLRHY+PLWAGGTYFMF IWGIVA+L+VG+TI
Sbjct: 328 KTIIVLFALFFGWGSFGIFSFYYFTFQLNLRHYTPLWAGGTYFMFLIWGIVAALVVGFTI 387

Query: 374 HKTGPAVILFLSMVAFDCGCIMLAVTPVHQTYFRMTLGIMIILSFGMDLSFPAASIILSD 433
            K  P++ILFLSMVAF+CG I+++VTP+HQTYFR  LG+MIILSFGMDLSFPA+SI+LSD
Sbjct: 388 KKVYPSIILFLSMVAFNCGSIIMSVTPIHQTYFRNHLGMMIILSFGMDLSFPASSILLSD 447

Query: 434 QLPSQYQGMAGSLVSTMISYSMSLCLGISGTAEHQVNKNGIDLLKGYQAALYVGIGLASL 493
           +LP QYQGMAGSLV+TM++YSMS CLG++G  E  VN +G D+LKGY+ A Y+GIGLAS+
Sbjct: 448 KLPLQYQGMAGSLVNTMVNYSMSFCLGVAGVVEQHVNNHGKDVLKGYRGAFYLGIGLASM 507

Query: 494 GVVISGAFMIEDWWTSRRKR 513
             +ISGA M+ +    R+  
Sbjct: 508 ACIISGALMLSEIIQGRKNE 527

>KNAG0G03430 Chr7 complement(734828..736456) [1629 bp, 542 aa] {ON}
           Anc_8.843 YMR279C
          Length = 542

 Score =  616 bits (1589), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/510 (59%), Positives = 375/510 (73%), Gaps = 8/510 (1%)

Query: 5   ENDDEENWEKLQSSSAAGEERDGQTEAIGPKSRLQNPDYFDKPWKEYIFVLSSMLSQLLN 64
           EN D +   KL S    G E         P  + Q+  YF   W+EYIFV + M+SQLLN
Sbjct: 30  ENTDSD---KLGS----GNETSTHVATTDPNCKWQDTTYFQNRWQEYIFVGTCMMSQLLN 82

Query: 65  QAATTQTNPLFDVLSKDLNAKVSQQPWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGY 124
           QA   QT  L ++L+K  ++    Q WLMASFPLVSGSFIL+SG+VGDIYGLK +L+GG 
Sbjct: 83  QACIPQTLSLMNILTKSFHSNAKNQTWLMASFPLVSGSFILISGRVGDIYGLKWSLVGGN 142

Query: 125 VVVVIWSLICGLSSYAHNVDFFVVARSFQGLGIAFVLPNVMGIVGNIYKPNTEAKNLVFS 184
           +  +IW+LI G ++Y H+  FF+V+RSFQGLG+AF+LPNVMG VGNIYKPNT  KN+V S
Sbjct: 143 IFFIIWALISGFTNYTHSDTFFIVSRSFQGLGVAFILPNVMGCVGNIYKPNTFRKNIVIS 202

Query: 185 LIGACAPIGATLGCVFSGLIGART-DLWGWTFYAYAITAALNGLVALWIIPNNIPTNVNE 243
           LIGACAP+GA +G  F+GLIG +  D W W+FYA AI + L  L AL+ IPN+IPTNV+ 
Sbjct: 203 LIGACAPVGAFMGAFFAGLIGTKNPDDWPWSFYAMAIASTLTLLGALYSIPNHIPTNVHG 262

Query: 244 YKMDWIGSAIGVFGLILFNFVWNQAPIAGWGSAYXXXXXXXXXXXXXXFITYEIRFAKQP 303
           + MDWIGS + V GLIL NFVWNQ PI GWG AY              F  YE+ +A  P
Sbjct: 263 FSMDWIGSGLAVVGLILLNFVWNQGPIDGWGKAYIIVLLIVSVFVLTLFFIYEVHYAASP 322

Query: 304 LLPHSVLFNRKLMMILSSLFFGWGSFGIWTFYYMSFMLNLRHYSPLWAGGTYFMFAIWGI 363
           LLP  +  NR ++MIL +LF GWGSFGI++FYY +F+LNLRHYS +WAGGTYFMFAIWG+
Sbjct: 323 LLPRVITQNRHMVMILMALFLGWGSFGIFSFYYFAFLLNLRHYSTVWAGGTYFMFAIWGV 382

Query: 364 VASLLVGYTIHKTGPAVILFLSMVAFDCGCIMLAVTPVHQTYFRMTLGIMIILSFGMDLS 423
           VAS++VG +I K   ++ILF SM+AFD G IML+VTPV QTYFRM LG MIILSFGMD+S
Sbjct: 383 VASVVVGLSIRKISASIILFFSMIAFDVGIIMLSVTPVKQTYFRMNLGTMIILSFGMDMS 442

Query: 424 FPAASIILSDQLPSQYQGMAGSLVSTMISYSMSLCLGISGTAEHQVNKNGIDLLKGYQAA 483
           FPAA+IILSD LP+QYQGMAGSL +TM++YSMSLCLG+  T E Q+N+NG DLLKGY+AA
Sbjct: 443 FPAAAIILSDSLPNQYQGMAGSLANTMVNYSMSLCLGMGSTVESQINQNGKDLLKGYRAA 502

Query: 484 LYVGIGLASLGVVISGAFMIEDWWTSRRKR 513
            Y+GIG+ASL V++S  +M E  W  R++R
Sbjct: 503 EYLGIGIASLAVILSLIYMCERLWIDRKER 532

>YML116W Chr13 (38196..39824) [1629 bp, 542 aa] {ON}  ATR1Multidrug
           efflux pump of the major facilitator superfamily,
           required for resistance to aminotriazole and
           4-nitroquinoline-N-oxide
          Length = 542

 Score =  615 bits (1586), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/516 (57%), Positives = 380/516 (73%), Gaps = 7/516 (1%)

Query: 5   ENDDEENWEKLQSSSAAGEE------RDGQTEAIGPKSRLQNPDYFDKPWKEYIFVLSSM 58
           EN+ E   +K    +  GE          + E +    + QNP+YF   W+EY+F+ + M
Sbjct: 17  ENETELPVKKSSRDNNIGESLTATAFTQSEDEMVDSNQKWQNPNYFKYAWQEYLFIFTCM 76

Query: 59  LSQLLNQAATTQTNPLFDVLSKDLNAKVSQQPWLMASFPLVSGSFILVSGKVGDIYGLKK 118
           +SQLLNQA TTQT  + ++LS    ++ + + WLMASFPLVSGSFIL+SG++GDIYGLKK
Sbjct: 77  ISQLLNQAGTTQTLSIMNILSDSFGSEGNSKSWLMASFPLVSGSFILISGRLGDIYGLKK 136

Query: 119 TLLGGYVVVVIWSLICGLSSYAHNVDFFVVARSFQGLGIAFVLPNVMGIVGNIYKPNTEA 178
            LL GYV+V+IWSLICG++ Y+ +  FF+++R+FQGLGIAFVLPNV+GI+GNIY   T  
Sbjct: 137 MLLVGYVLVIIWSLICGITKYSGSDTFFIISRAFQGLGIAFVLPNVLGIIGNIYVGGTFR 196

Query: 179 KNLVFSLIGACAPIGATLGCVFSGLIGART-DLWGWTFYAYAITAALNGLVALWIIPNNI 237
           KN+V S +GA APIGATLGC+F+GLIG      W W FYAY+I A +N +++++ IP+ I
Sbjct: 197 KNIVISFVGAMAPIGATLGCLFAGLIGTEDPKQWPWAFYAYSIAAFINFVLSIYAIPSTI 256

Query: 238 PTNVNEYKMDWIGSAIGVFGLILFNFVWNQAPIAGWGSAYXXXXXXXXXXXXXXFITYEI 297
           PTN++ + MDWIGS +GV GLIL NFVWNQAPI+GW  AY              FI YEI
Sbjct: 257 PTNIHHFSMDWIGSVLGVIGLILLNFVWNQAPISGWNQAYIIVILIISVIFLVVFIIYEI 316

Query: 298 RFAKQPLLPHSVLFNRKLMMILSSLFFGWGSFGIWTFYYMSFMLNLRHYSPLWAGGTYFM 357
           RFAK PLLP +V+ +R ++ I+ +LFFGWGSFGI+TFYY  F LN+R Y+ LWAGGTYFM
Sbjct: 317 RFAKTPLLPRAVIKDRHMIQIMLALFFGWGSFGIFTFYYFQFQLNIRQYTALWAGGTYFM 376

Query: 358 FAIWGIVASLLVGYTIHKTGPAVILFLSMVAFDCGCIMLAVTPVHQTYFRMTLGIMIILS 417
           F IWGI+A+LLVG+TI    P+V LF SMVAF+ G IM +VTPVH+TYFR  LG MIILS
Sbjct: 377 FLIWGIIAALLVGFTIKNVSPSVFLFFSMVAFNVGSIMASVTPVHETYFRTQLGTMIILS 436

Query: 418 FGMDLSFPAASIILSDQLPSQYQGMAGSLVSTMISYSMSLCLGISGTAEHQVNKNGIDLL 477
           FGMDLSFPA+SII SD LP +YQGMAGSLV+T+++YSMSLCLG+  T E QVN +G  LL
Sbjct: 437 FGMDLSFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLCLGMGATVETQVNSDGKHLL 496

Query: 478 KGYQAALYVGIGLASLGVVISGAFMIEDWWTSRRKR 513
           KGY+ A Y+GIGLASL  +ISG +M+E +   RR R
Sbjct: 497 KGYRGAQYLGIGLASLACMISGLYMVESFIKGRRAR 532

>Suva_13.27 Chr13 (37895..39556) [1662 bp, 553 aa] {ON} YML116W
           (REAL)
          Length = 553

 Score =  612 bits (1578), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/518 (56%), Positives = 382/518 (73%), Gaps = 9/518 (1%)

Query: 5   ENDDEENWEKLQSSSAAGEE--------RDGQTEAIGPKSRLQNPDYFDKPWKEYIFVLS 56
           E ++E   E   SS    +E         + + E +  K + QNP+YF  PW+EY+F+ +
Sbjct: 26  EIENEVALEAEDSSPRNNKEGALTTIVLTNSEDEVMKTKQKWQNPNYFKYPWQEYLFIFT 85

Query: 57  SMLSQLLNQAATTQTNPLFDVLSKDLNAKVSQQPWLMASFPLVSGSFILVSGKVGDIYGL 116
            M+SQLLNQ+ TTQT  + ++L+    +  + + WLMASFPLVSGSFIL+SG++GDI+GL
Sbjct: 86  CMISQLLNQSGTTQTLSIMNILADSFGSDANSRSWLMASFPLVSGSFILISGRMGDIFGL 145

Query: 117 KKTLLGGYVVVVIWSLICGLSSYAHNVDFFVVARSFQGLGIAFVLPNVMGIVGNIYKPNT 176
           K  LL GYV+++IWSLICGL+ Y+ +  FF+V+R+FQGLGIAFVLPNV+GI+GN+Y   T
Sbjct: 146 KNMLLIGYVMIIIWSLICGLTKYSGSDTFFIVSRAFQGLGIAFVLPNVLGIIGNVYVGGT 205

Query: 177 EAKNLVFSLIGACAPIGATLGCVFSGLIGA-RTDLWGWTFYAYAITAALNGLVALWIIPN 235
             KN+V S IGA APIGATLGC F+GLIG    + W W FYAY ITA +N +++++ IPN
Sbjct: 206 FRKNIVISFIGAMAPIGATLGCFFAGLIGTMNPNQWPWAFYAYTITAVINLILSIYAIPN 265

Query: 236 NIPTNVNEYKMDWIGSAIGVFGLILFNFVWNQAPIAGWGSAYXXXXXXXXXXXXXXFITY 295
           NIPTNV+ + MDWIGS +GV GL+L N VWNQAPI+GW  AY              F  Y
Sbjct: 266 NIPTNVHRFSMDWIGSGLGVIGLVLLNLVWNQAPISGWNQAYIIVLLIISVLFLVLFGVY 325

Query: 296 EIRFAKQPLLPHSVLFNRKLMMILSSLFFGWGSFGIWTFYYMSFMLNLRHYSPLWAGGTY 355
           EI FAK PLLP +V+ +R ++ I+ SLFFGWGSFGI+TFYY  F LN+RHY+PLWAGG+Y
Sbjct: 326 EIHFAKSPLLPQAVMKDRHMIQIMLSLFFGWGSFGIFTFYYFQFQLNIRHYTPLWAGGSY 385

Query: 356 FMFAIWGIVASLLVGYTIHKTGPAVILFLSMVAFDCGCIMLAVTPVHQTYFRMTLGIMII 415
           FMF IWGI+A+LLVG++I +  P+V LF +MVAF+ G IM +VTPVH+TYFRM +G MII
Sbjct: 386 FMFLIWGIIAALLVGFSIKRVSPSVFLFFAMVAFNVGSIMASVTPVHETYFRMQMGTMII 445

Query: 416 LSFGMDLSFPAASIILSDQLPSQYQGMAGSLVSTMISYSMSLCLGISGTAEHQVNKNGID 475
           LSFGMDLSFPA+SII SD LP +YQGMAGSLV+T+++YSMSLCLG+  T E Q++ +G  
Sbjct: 446 LSFGMDLSFPASSIIFSDYLPMEYQGMAGSLVNTVVNYSMSLCLGMGATVEMQLDPDGKH 505

Query: 476 LLKGYQAALYVGIGLASLGVVISGAFMIEDWWTSRRKR 513
           +LKGY+ A Y+GIGLASL  +ISG +M+E +    R +
Sbjct: 506 ILKGYRGAQYLGIGLASLACIISGLYMVECYIKDHRAK 543

>KNAG0J00260 Chr10 (37950..39602) [1653 bp, 550 aa] {ON} Anc_8.843
           YMR279C
          Length = 550

 Score =  611 bits (1575), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/504 (58%), Positives = 368/504 (73%), Gaps = 1/504 (0%)

Query: 5   ENDDEENWEKLQSSSAAGEERDGQTEAIGPKSRLQNPDYFDKPWKEYIFVLSSMLSQLLN 64
           +ND     EK   S+ +  E   ++E     +  QNP YF   W+EY F+ + ML+QLLN
Sbjct: 29  KNDQTNVEEKKNCSTESEAEWCSESEFTDNDTPWQNPTYFANRWQEYAFISTCMLAQLLN 88

Query: 65  QAATTQTNPLFDVLSKDLNAKVSQQPWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGY 124
           QA   Q     ++L+   N+   +Q WLMASFPLVSGSFILVSG++GDIYGLKKTL+GGY
Sbjct: 89  QAGQAQATAPMNILADAFNSSAKKQTWLMASFPLVSGSFILVSGRIGDIYGLKKTLIGGY 148

Query: 125 VVVVIWSLICGLSSYAHNVDFFVVARSFQGLGIAFVLPNVMGIVGNIYKPNTEAKNLVFS 184
           +VV+IWSLICG ++Y HN  FF++ R+FQGLGIAF+LPNVMG++GNIYK NT  KN V S
Sbjct: 149 LVVLIWSLICGFANYTHNDAFFILCRAFQGLGIAFILPNVMGLIGNIYKANTLRKNFVIS 208

Query: 185 LIGACAPIGATLGCVFSGLIGART-DLWGWTFYAYAITAALNGLVALWIIPNNIPTNVNE 243
            +G CAPIGA LG V+SGLI       W W FYAYAI  A+N ++A++ IP+ +PTN++ 
Sbjct: 209 FVGMCAPIGAALGGVWSGLIAHENPKQWPWIFYAYAIVVAINMVMAIYSIPSTVPTNIHG 268

Query: 244 YKMDWIGSAIGVFGLILFNFVWNQAPIAGWGSAYXXXXXXXXXXXXXXFITYEIRFAKQP 303
           + MDW GSAIGV G+ILFNFVWNQ PI GW   Y              F  YEI+FAK P
Sbjct: 269 FGMDWTGSAIGVVGMILFNFVWNQGPIDGWNKGYIIALLIVSVFLLIAFFIYEIKFAKSP 328

Query: 304 LLPHSVLFNRKLMMILSSLFFGWGSFGIWTFYYMSFMLNLRHYSPLWAGGTYFMFAIWGI 363
           LLP  V+ NR + MIL ++F GWGSFGIWTFYY +F LNLRHYS +WAGGT+FMF IWG 
Sbjct: 329 LLPPEVIKNRHIGMILLAVFMGWGSFGIWTFYYYAFQLNLRHYSAVWAGGTFFMFVIWGT 388

Query: 364 VASLLVGYTIHKTGPAVILFLSMVAFDCGCIMLAVTPVHQTYFRMTLGIMIILSFGMDLS 423
           +A+ LV  TI + GP+V+L  SM  F  GCIML+VTPVHQ+Y++M LG+ IILSFGMDLS
Sbjct: 389 IAAFLVALTIKRVGPSVLLCFSMTGFTVGCIMLSVTPVHQSYWKMNLGMQIILSFGMDLS 448

Query: 424 FPAASIILSDQLPSQYQGMAGSLVSTMISYSMSLCLGISGTAEHQVNKNGIDLLKGYQAA 483
           FPA+SIILSD LPSQYQGMAGSLV+TM++YS SLCLG+  TAE QVNKNG D LKGY+AA
Sbjct: 449 FPASSIILSDFLPSQYQGMAGSLVNTMVNYSTSLCLGVGSTAEAQVNKNGTDKLKGYRAA 508

Query: 484 LYVGIGLASLGVVISGAFMIEDWW 507
           LYVGIGL + G++++  ++ E  W
Sbjct: 509 LYVGIGLGACGMLVAFCYLFEVLW 532

>Skud_13.25 Chr13 (37872..39485) [1614 bp, 537 aa] {ON} YML116W
           (REAL)
          Length = 537

 Score =  609 bits (1571), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/502 (58%), Positives = 373/502 (74%), Gaps = 7/502 (1%)

Query: 4   KENDDEENWEKLQSSSAAGEERDGQTEAIGPKSRLQNPDYFDKPWKEYIFVLSSMLSQLL 63
           K +  + N E +  S+  GEE          K R QNP+YF   W EY+F+ + M+SQLL
Sbjct: 29  KSSRHDGNEETVTISTDHGEEMTVD------KQRWQNPNYFKNSWHEYLFIFTCMISQLL 82

Query: 64  NQAATTQTNPLFDVLSKDLNAKVSQQPWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGG 123
           NQA TTQT  + ++++    +  + + WLMASFPLVSGSFIL+SG++GDIYGLKK L  G
Sbjct: 83  NQAGTTQTLSIMNIIANSFGSNENSRTWLMASFPLVSGSFILISGRLGDIYGLKKMLTIG 142

Query: 124 YVVVVIWSLICGLSSYAHNVDFFVVARSFQGLGIAFVLPNVMGIVGNIYKPNTEAKNLVF 183
           YVV++IWSLICGL+ Y+ +  FF+++R+FQGLGIAFVLPNV+GI+GNIY   T  KN+V 
Sbjct: 143 YVVIIIWSLICGLTKYSGSDTFFIISRAFQGLGIAFVLPNVLGIIGNIYVSGTFRKNIVI 202

Query: 184 SLIGACAPIGATLGCVFSGLIGART-DLWGWTFYAYAITAALNGLVALWIIPNNIPTNVN 242
           SL+GA AP+GATLGC+F+GLIG +    W W FYAY IT+ +N  ++++ IPNNIPTN+ 
Sbjct: 203 SLVGAMAPVGATLGCLFAGLIGTKNPKQWPWAFYAYTITSIINLALSVYSIPNNIPTNIQ 262

Query: 243 EYKMDWIGSAIGVFGLILFNFVWNQAPIAGWGSAYXXXXXXXXXXXXXXFITYEIRFAKQ 302
            + MDWIGSA+GV GL+L NFVWNQAPI+GW  AY              FI YE RFAK 
Sbjct: 263 HFSMDWIGSALGVIGLVLMNFVWNQAPISGWDQAYIIVLLVISVVFLVVFIIYENRFAKS 322

Query: 303 PLLPHSVLFNRKLMMILSSLFFGWGSFGIWTFYYMSFMLNLRHYSPLWAGGTYFMFAIWG 362
           PLLP +VL +R ++ I+ +LFFGWGSFGI+TFYY  F LN+RHYS +WAGGTYFMF IWG
Sbjct: 323 PLLPRAVLKDRHMIQIMLALFFGWGSFGIFTFYYFQFQLNIRHYSAVWAGGTYFMFLIWG 382

Query: 363 IVASLLVGYTIHKTGPAVILFLSMVAFDCGCIMLAVTPVHQTYFRMTLGIMIILSFGMDL 422
           I+A+LLVG  I K  P+V LFLSM+AF+ G IM +VTPVH+TYFR  LG MIILSFGMD 
Sbjct: 383 IIAALLVGIYIKKVSPSVFLFLSMMAFNIGSIMASVTPVHETYFRTQLGTMIILSFGMDF 442

Query: 423 SFPAASIILSDQLPSQYQGMAGSLVSTMISYSMSLCLGISGTAEHQVNKNGIDLLKGYQA 482
           SFPA+SII SD LP +YQGMAGSLV+T+++YSMSLCLG+  T E  V+ +G  +LKGY+ 
Sbjct: 443 SFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLCLGMGATVETHVDPDGKHVLKGYRG 502

Query: 483 ALYVGIGLASLGVVISGAFMIE 504
           A Y+GIGLASL  +ISG +M+E
Sbjct: 503 AQYLGIGLASLACIISGLYMVE 524

>Smik_13.18 Chr13 (34422..36059) [1638 bp, 545 aa] {ON} YML116W
           (REAL)
          Length = 545

 Score =  601 bits (1549), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/518 (56%), Positives = 381/518 (73%), Gaps = 9/518 (1%)

Query: 5   ENDDEENWEKLQSSSAAGEER--------DGQTEAIGPKSRLQNPDYFDKPWKEYIFVLS 56
           E ++E  +   +SS   G E         + + E +    + QNP YF   W+EY+F+ +
Sbjct: 18  EVENEAVFPPKKSSRDNGSEETLRGTAFTNLEDEMVECNQKWQNPKYFKYAWQEYLFIFT 77

Query: 57  SMLSQLLNQAATTQTNPLFDVLSKDLNAKVSQQPWLMASFPLVSGSFILVSGKVGDIYGL 116
            M+SQLLNQA TTQT  + ++LS    ++ + + WLMASFPLVSGSFIL+SG++GDIYGL
Sbjct: 78  CMISQLLNQAGTTQTLSIMNILSDSFGSEGNSKSWLMASFPLVSGSFILISGRLGDIYGL 137

Query: 117 KKTLLGGYVVVVIWSLICGLSSYAHNVDFFVVARSFQGLGIAFVLPNVMGIVGNIYKPNT 176
           KK LL GYV+V+IWSLICG+++Y+ +  FF++ R+FQGLGIAFVLPNV+GI+GNIY   T
Sbjct: 138 KKMLLVGYVLVIIWSLICGITNYSGSDTFFIICRAFQGLGIAFVLPNVLGIIGNIYVGGT 197

Query: 177 EAKNLVFSLIGACAPIGATLGCVFSGLIGART-DLWGWTFYAYAITAALNGLVALWIIPN 235
             KN+V S +GA APIGATLGC+F+GLIG    + W W FYA++I + +N  ++++ IPN
Sbjct: 198 FRKNIVISFVGAMAPIGATLGCLFAGLIGTENPNQWPWAFYAFSIASLINFGLSIYAIPN 257

Query: 236 NIPTNVNEYKMDWIGSAIGVFGLILFNFVWNQAPIAGWGSAYXXXXXXXXXXXXXXFITY 295
           NIPTN++ + MDWIGS +GV GLIL NFVWNQAPI+GW  AY              FI Y
Sbjct: 258 NIPTNIHHFSMDWIGSVLGVIGLILLNFVWNQAPISGWSQAYIIVILIISVIFLAVFIIY 317

Query: 296 EIRFAKQPLLPHSVLFNRKLMMILSSLFFGWGSFGIWTFYYMSFMLNLRHYSPLWAGGTY 355
           E+ FAK PLLPH+V+ +  ++ I+ +LFFGWGSFGI+TFYY  F LN+RHY+ LWAGGTY
Sbjct: 318 EMWFAKSPLLPHAVIKDYHMIQIMLALFFGWGSFGIFTFYYFQFQLNIRHYTALWAGGTY 377

Query: 356 FMFAIWGIVASLLVGYTIHKTGPAVILFLSMVAFDCGCIMLAVTPVHQTYFRMTLGIMII 415
           FMF IWGI+A+LLVG+TI    P+V LF SMVAF+ G IM +VTPVH+TYFR  LG MII
Sbjct: 378 FMFLIWGIIAALLVGFTIKNVSPSVYLFFSMVAFNVGSIMASVTPVHETYFRTQLGTMII 437

Query: 416 LSFGMDLSFPAASIILSDQLPSQYQGMAGSLVSTMISYSMSLCLGISGTAEHQVNKNGID 475
           LSFGMDLSFPA+SII SD LP +YQGMAGSLV+T+++YSMSLCLG+  T E Q++ +G  
Sbjct: 438 LSFGMDLSFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLCLGMGATVETQLDPDGKH 497

Query: 476 LLKGYQAALYVGIGLASLGVVISGAFMIEDWWTSRRKR 513
           LLKGY+ A Y+GIGLASL  +ISG +M+E +    + +
Sbjct: 498 LLKGYRGAQYLGIGLASLACMISGLYMVESFINDHKAK 535

>TDEL0B00550 Chr2 (105483..107096) [1614 bp, 537 aa] {ON} Anc_8.843
           YMR279C
          Length = 537

 Score =  598 bits (1542), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/510 (56%), Positives = 376/510 (73%), Gaps = 3/510 (0%)

Query: 5   ENDDEENWEKLQSSSAAGEERDGQTEAIGPKSRLQNPDYFDKPWKEYIFVLSSMLSQLLN 64
           EN+ E N  +         E++       P+S  Q+P+YF   W E +FVLS M+ QLLN
Sbjct: 20  ENEIERNLSR--EDKMLTTEKEAPVFVEEPESPWQDPNYFKGKWDEVLFVLSCMMGQLLN 77

Query: 65  QAATTQTNPLFDVLSKDLNAKVSQQPWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGY 124
           QA +T T     VL ++L++  ++  WLMASFPLVSGSFIL+SG++GDIYGLKK LL GY
Sbjct: 78  QAGSTMTLSTMKVLERELDSSSAKSSWLMASFPLVSGSFILISGRLGDIYGLKKMLLLGY 137

Query: 125 VVVVIWSLICGLSSYAHNVDFFVVARSFQGLGIAFVLPNVMGIVGNIYKPNTEAKNLVFS 184
           + + IWSLICGLSS++HN  FF+ +R+FQGLGI+FVLPN++GIVGNIYKP T  KN+V S
Sbjct: 138 IWLTIWSLICGLSSFSHNDTFFITSRAFQGLGISFVLPNLLGIVGNIYKPGTRRKNIVIS 197

Query: 185 LIGACAPIGATLGCVFSGLIGARTDL-WGWTFYAYAITAALNGLVALWIIPNNIPTNVNE 243
           LIG CAPIGAT G +F+G++  R D  W W FYAY I A L  +++ ++IPN+IP NVN+
Sbjct: 198 LIGMCAPIGATFGGLFAGVVVIRKDSDWPWAFYAYTIAAFLTTIISYFVIPNSIPVNVNK 257

Query: 244 YKMDWIGSAIGVFGLILFNFVWNQAPIAGWGSAYXXXXXXXXXXXXXXFITYEIRFAKQP 303
           + MDWIGSA+GV GL+LFNFVWNQ+ + GW + Y              F  +EI++AK P
Sbjct: 258 FAMDWIGSALGVSGLVLFNFVWNQSTVVGWATGYIIALLIVSIFLIALFFIFEIKYAKVP 317

Query: 304 LLPHSVLFNRKLMMILSSLFFGWGSFGIWTFYYMSFMLNLRHYSPLWAGGTYFMFAIWGI 363
           LLP  V  +R ++MIL+SL  GWGSFGIW FYY  F+L LR+YSP+WAGGT+FM +I G 
Sbjct: 318 LLPKEVTESRSIIMILASLMAGWGSFGIWIFYYFQFVLTLRNYSPVWAGGTFFMVSIVGC 377

Query: 364 VASLLVGYTIHKTGPAVILFLSMVAFDCGCIMLAVTPVHQTYFRMTLGIMIILSFGMDLS 423
           +A+L VG++I + GPAV+LF SM+AF CG I+L+VTPVH+TYFR  LG M+ILSFGMDLS
Sbjct: 378 IAALTVGFSIKRVGPAVLLFFSMIAFTCGSIILSVTPVHETYFRSCLGAMVILSFGMDLS 437

Query: 424 FPAASIILSDQLPSQYQGMAGSLVSTMISYSMSLCLGISGTAEHQVNKNGIDLLKGYQAA 483
           FPAASIILSD+L  QYQGMAGSLV+T+++YSMSL LGI GT E Q+NK+G  LL+G++AA
Sbjct: 438 FPAASIILSDELSMQYQGMAGSLVNTVVNYSMSLFLGIGGTIERQINKSGDRLLEGFRAA 497

Query: 484 LYVGIGLASLGVVISGAFMIEDWWTSRRKR 513
           LY  IG+ SLG++ISG F+++      + R
Sbjct: 498 LYFAIGVGSLGILISGVFVLQKELMRSKSR 527

>NCAS0B00290 Chr2 (33760..35388) [1629 bp, 542 aa] {ON} Anc_8.843
          Length = 542

 Score =  598 bits (1542), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/527 (56%), Positives = 385/527 (73%), Gaps = 15/527 (2%)

Query: 2   NMKENDDEENWEKLQSSSAAGE-----------ERDGQTEAIGPK---SRLQNPDYFDKP 47
           N K +  EE  E   SS                E+D  ++   P+   S+ QNPDYF   
Sbjct: 6   NRKSHRSEEIMESAASSITEETSIIKHGDIEEIEKDVISQTETPQLEHSKWQNPDYFQNQ 65

Query: 48  WKEYIFVLSSMLSQLLNQAATTQTNPLFDVLSKDLNAKVSQQPWLMASFPLVSGSFILVS 107
           W+EY+F+ S M+SQLLNQAAT QT  + ++++   N++  ++ WL+ASFPLVSGSFIL+S
Sbjct: 66  WQEYLFIFSCMMSQLLNQAATPQTLSIMNIITDSFNSEGGKETWLIASFPLVSGSFILIS 125

Query: 108 GKVGDIYGLKKTLLGGYVVVVIWSLICGLSSYAHNVDFFVVARSFQGLGIAFVLPNVMGI 167
           G++GDIYGLKKTL+GGY+  +IWS+I GL+ Y+H+  FF+V+R+FQGL IAF+LPNVMGI
Sbjct: 126 GRIGDIYGLKKTLVGGYIFFIIWSIISGLTKYSHSDTFFIVSRAFQGLSIAFILPNVMGI 185

Query: 168 VGNIYKPNTEAKNLVFSLIGACAPIGATLGCVFSGLIGART-DLWGWTFYAYAITAALNG 226
           VGNIYKP++  KN+V S+IGA APIGA  G +F+GLIG    D W W FYA+AI +A N 
Sbjct: 186 VGNIYKPDSNRKNIVISMIGASAPIGAFFGSLFAGLIGTEDPDQWPWAFYAFAIASAFNL 245

Query: 227 LVALWIIPNNIPTNVNEYKMDWIGSAIGVFGLILFNFVWNQAPIAGWGSAYXXXXXXXXX 286
            ++++ IPN++PTNV+ + MDWIGS + V GLIL NFVWNQ PI GW +AY         
Sbjct: 246 AISIYSIPNSVPTNVHGFAMDWIGSVLAVIGLILLNFVWNQGPIVGWQTAYIIALLVVSV 305

Query: 287 XXXXXFITYEIRFAKQPLLPHSVLFNRKLMMILSSLFFGWGSFGIWTFYYMSFMLNLRHY 346
                F TYE+++A+ PLLP  V  NR ++MIL++LF GWGSFGI++FYY SF+LNLRHY
Sbjct: 306 FFLALFFTYEVKYAESPLLPVEVTKNRHIIMILAALFLGWGSFGIFSFYYFSFLLNLRHY 365

Query: 347 SPLWAGGTYFMFAIWGIVASLLVGYTIHKTGPAVILFLSMVAFDCGCIMLAVTPVHQTYF 406
           S LWAG TYFMFAIWG VA+++VG  I K   A ILF+SMVAF+ G IML+VTPV QTYF
Sbjct: 366 SALWAGTTYFMFAIWGTVAAVIVGAFIKKISAAFILFMSMVAFNIGIIMLSVTPVDQTYF 425

Query: 407 RMTLGIMIILSFGMDLSFPAASIILSDQLPSQYQGMAGSLVSTMISYSMSLCLGISGTAE 466
           RM LG MIILSFGMD+SFPAA+IILSD L  QYQGMAGSL +TM++YSMSLCLG+  T E
Sbjct: 426 RMNLGTMIILSFGMDMSFPAAAIILSDGLTMQYQGMAGSLANTMVNYSMSLCLGMGTTVE 485

Query: 467 HQVNKNGIDLLKGYQAALYVGIGLASLGVVISGAFMIEDWWTSRRKR 513
            Q+NK+G DLLKGY+ A Y+GIGLA LG++I+  ++ E  W  R++ 
Sbjct: 486 RQINKSGNDLLKGYRGAEYLGIGLAGLGIIITAIYLGEILWGKRKQH 532

>Kpol_541.16 s541 complement(43396..44982) [1587 bp, 528 aa] {ON}
           complement(43396..44982) [1587 nt, 529 aa]
          Length = 528

 Score =  586 bits (1510), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/502 (57%), Positives = 370/502 (73%), Gaps = 3/502 (0%)

Query: 13  EKLQSSSAAGEERDGQTEAIGPKSRLQNPDYFDKPWKEYIFVLSSMLSQLLNQAATTQTN 72
           E ++S  +   +     E     S L+NPDYF+   +EY F+ S MLSQLLN A TTQT 
Sbjct: 19  ETIRSDCSDANDESPSMEL--KNSSLRNPDYFNSTTQEYAFIFSCMLSQLLNLAGTTQTL 76

Query: 73  PLFDVLSKDLNAKVSQQPWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYVVVVIWSL 132
            + +VL++ L++  S + WL+ASFPLVSGSFILVSG++GDIYGLKK L+ GYV++VIWSL
Sbjct: 77  SIMNVLTRQLHSSDSLKVWLVASFPLVSGSFILVSGRLGDIYGLKKMLILGYVILVIWSL 136

Query: 133 ICGLSSYAHNVDFFVVARSFQGLGIAFVLPNVMGIVGNIYKPNTEAKNLVFSLIGACAPI 192
           I GLS Y+H+  FF++AR+FQGLGI+ VLPNV+G++G IYKP T  KN+V S++GA +PI
Sbjct: 137 ITGLSGYSHSGIFFIIARAFQGLGISLVLPNVLGLIGMIYKPGTLKKNMVISIVGAMSPI 196

Query: 193 GATLGCVFSGLIGARTD-LWGWTFYAYAITAALNGLVALWIIPNNIPTNVNEYKMDWIGS 251
           GATLG +FSGL+   ++  W W FYAY + A +N  ++ + IPNNIPTNVN   MDWIGS
Sbjct: 197 GATLGGLFSGLVATESEGSWPWAFYAYTLAAFINTFISYYSIPNNIPTNVNRLSMDWIGS 256

Query: 252 AIGVFGLILFNFVWNQAPIAGWGSAYXXXXXXXXXXXXXXFITYEIRFAKQPLLPHSVLF 311
             GV GLILFNFVWNQAP  GW SAY              F  YE+R+A+ PLLP  ++ 
Sbjct: 257 FTGVLGLILFNFVWNQAPADGWNSAYLIVLLVISVIALIAFGIYELRYAENPLLPSEIIR 316

Query: 312 NRKLMMILSSLFFGWGSFGIWTFYYMSFMLNLRHYSPLWAGGTYFMFAIWGIVASLLVGY 371
           NR+L+MIL+++ FGWGSFGIWTFYY SF+LNLR+YSPLWAGG+YF+F I G + ++  G+
Sbjct: 317 NRQLIMILTAMTFGWGSFGIWTFYYFSFVLNLRNYSPLWAGGSYFIFVISGTITAISCGF 376

Query: 372 TIHKTGPAVILFLSMVAFDCGCIMLAVTPVHQTYFRMTLGIMIILSFGMDLSFPAASIIL 431
            + K  PAV+L  SMV F+ GCI+ +VTPVHQTYFR  LG MIIL  GMDLSFPA+SIIL
Sbjct: 377 LMKKIRPAVLLTFSMVGFNLGCIIFSVTPVHQTYFRNILGTMIILPLGMDLSFPASSIIL 436

Query: 432 SDQLPSQYQGMAGSLVSTMISYSMSLCLGISGTAEHQVNKNGIDLLKGYQAALYVGIGLA 491
           SD LP+Q+QGMAGSLV+T+I+YS SL LGI+GT E   NKNG DLL+GY+ ALY GI  +
Sbjct: 437 SDNLPNQHQGMAGSLVNTVINYSNSLFLGIAGTVEQHCNKNGTDLLRGYRGALYFGIACS 496

Query: 492 SLGVVISGAFMIEDWWTSRRKR 513
            + V+I+G +M+E  + S + R
Sbjct: 497 GVAVLIAGLYMVETIFDSYKDR 518

>Suva_13.467 Chr13 complement(807375..809006) [1632 bp, 543 aa] {ON}
           YMR279C (REAL)
          Length = 543

 Score =  578 bits (1491), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/525 (53%), Positives = 374/525 (71%), Gaps = 12/525 (2%)

Query: 1   MNMKEND----DEENWEKLQSSSAAGEERDGQTEAIGPKSRL-------QNPDYFDKPWK 49
           +N++  D    D+ + +       + E+ D  T A   KS         Q+P YF    +
Sbjct: 9   VNVQSKDSPVIDKISMKAEDKVVVSSEDEDVTTVASSNKSTQVSNDSPWQDPTYFSSFGR 68

Query: 50  EYIFVLSSMLSQLLNQAATTQTNPLFDVLSKDLNAKVSQQPWLMASFPLVSGSFILVSGK 109
           E +F+++ ML+QLLNQA  T    + +VLSK  N++  +Q WLMASFPLV+GSFIL+SG+
Sbjct: 69  ELMFIVTCMLAQLLNQAGQTHALTIMNVLSKSFNSESDKQAWLMASFPLVAGSFILISGR 128

Query: 110 VGDIYGLKKTLLGGYVVVVIWSLICGLSSYAHNVDFFVVARSFQGLGIAFVLPNVMGIVG 169
           +GDIYGLKK L+ GYV +++WSLICGLS Y++N  FF+  R+FQGLGIAF+LPNVMG+VG
Sbjct: 129 LGDIYGLKKMLMIGYVTIIVWSLICGLSKYSNNDAFFITCRAFQGLGIAFILPNVMGLVG 188

Query: 170 NIYKPNTEAKNLVFSLIGACAP-IGATLGCVFSGLIGARTDLWGWTFYAYAITAALNGLV 228
           ++YK  +  KNLV S IGACAP  G   G     ++   ++ W W FYA+AI   LN ++
Sbjct: 189 HVYKVGSTRKNLVISFIGACAPAGGMFGGLFGGLIVNEDSEQWPWVFYAFAIAFFLNMIL 248

Query: 229 ALWIIPNNIPTNVNEYKMDWIGSAIGVFGLILFNFVWNQAPIAGWGSAYXXXXXXXXXXX 288
           A + IPNNIPTNV+ + MDW GS + V GLILFNFVWNQAP AGWG+AY           
Sbjct: 249 AWYSIPNNIPTNVHGFSMDWTGSVLAVIGLILFNFVWNQAPTAGWGTAYIIALLIISVFF 308

Query: 289 XXXFITYEIRFAKQPLLPHSVLFNRKLMMILSSLFFGWGSFGIWTFYYMSFMLNLRHYSP 348
              F  YE+++AK PLLPH+V  NR ++MIL ++F GWGSFGIWTFYYMSF LNLRHYSP
Sbjct: 309 LVAFFVYEVKYAKVPLLPHAVTKNRHMIMILLAVFLGWGSFGIWTFYYMSFQLNLRHYSP 368

Query: 349 LWAGGTYFMFAIWGIVASLLVGYTIHKTGPAVILFLSMVAFDCGCIMLAVTPVHQTYFRM 408
           +W GGTYF+F I+G +A+ +V  +I + GPA +L  ++VAFD G IM +V PV Q+++++
Sbjct: 369 VWTGGTYFVFVIFGTIAAFMVALSIKRVGPAFLLCFALVAFDVGSIMFSVLPVKQSFWKL 428

Query: 409 TLGIMIILSFGMDLSFPAASIILSDQLPSQYQGMAGSLVSTMISYSMSLCLGISGTAEHQ 468
             G+  IL FGMDLSFPA+SIILSD LP +YQGMAGSLV+T+I+YS SLCLG+  T EHQ
Sbjct: 429 NFGMQAILCFGMDLSFPASSIILSDGLPMEYQGMAGSLVNTVINYSASLCLGMGATVEHQ 488

Query: 469 VNKNGIDLLKGYQAALYVGIGLASLGVVISGAFMIEDWWTSRRKR 513
           +NKNG DLLKGY+ A+Y+G+GLASLGV+IS  +M+E +W +RR R
Sbjct: 489 INKNGKDLLKGYRGAIYLGVGLASLGVLISFTYMLETFWNNRRDR 533

>NCAS0A02540 Chr1 complement(481807..483426) [1620 bp, 539 aa] {ON} 
          Length = 539

 Score =  571 bits (1472), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 274/504 (54%), Positives = 357/504 (70%), Gaps = 1/504 (0%)

Query: 11  NWEKLQSSSAAGEERDGQTEAIGPKSRLQNPDYFDKPWKEYIFVLSSMLSQLLNQAATTQ 70
           N +K  S +      +     +   S  QNP+YF   +KEY F+ + M++ LLNQA  TQ
Sbjct: 23  NEDKNISHNEKEVYSNSTDSVLDDDSPWQNPNYFSSKYKEYFFIFTCMVANLLNQAGQTQ 82

Query: 71  TNPLFDVLSKDLNAKVSQQPWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYVVVVIW 130
                +V+S+  ++   +Q WLMASFPLVSGSFIL+SG++GDIYGLKKT++GGY+ ++IW
Sbjct: 83  VLSTMNVISESFHSDSGKQTWLMASFPLVSGSFILISGRIGDIYGLKKTMIGGYIFMIIW 142

Query: 131 SLICGLSSYAHNVDFFVVARSFQGLGIAFVLPNVMGIVGNIYKPNTEAKNLVFSLIGACA 190
           SL+CG + + HN  FF+V R+FQGLGI+F+LPNVMG++GNIYK  T  KN+V S+IG  A
Sbjct: 143 SLLCGFADFTHNDTFFIVCRAFQGLGISFILPNVMGLIGNIYKVGTLRKNIVISMIGLTA 202

Query: 191 PIGATLGCVFSGLI-GARTDLWGWTFYAYAITAALNGLVALWIIPNNIPTNVNEYKMDWI 249
           P GA +G ++ GLI       W W FYAYA+T  +N ++AL+ +PN IPTNV+ + MDWI
Sbjct: 203 PTGACMGALWGGLIVTENAKQWPWIFYAYALTGLVNLIMALYSVPNCIPTNVHNFAMDWI 262

Query: 250 GSAIGVFGLILFNFVWNQAPIAGWGSAYXXXXXXXXXXXXXXFITYEIRFAKQPLLPHSV 309
           GS IGV GLILFNFVWNQ P+AGW  AY              F+ YE+++   PLLP  V
Sbjct: 263 GSIIGVVGLILFNFVWNQGPVAGWDKAYIIVLLIISVLFLVAFVVYELKYPISPLLPVEV 322

Query: 310 LFNRKLMMILSSLFFGWGSFGIWTFYYMSFMLNLRHYSPLWAGGTYFMFAIWGIVASLLV 369
             N +++ ILS LF GWG+FGIWTFYY +F LNLR YSP+W GGTYFMF IWG +A+L+V
Sbjct: 323 TKNGQILTILSILFLGWGAFGIWTFYYFAFQLNLRDYSPVWVGGTYFMFIIWGTIAALIV 382

Query: 370 GYTIHKTGPAVILFLSMVAFDCGCIMLAVTPVHQTYFRMTLGIMIILSFGMDLSFPAASI 429
            +TI K GPA++LF S + F  G +ML+VTP+HQ Y+RM LG+ IIL FGMDLSFPA+SI
Sbjct: 383 AFTIKKVGPAILLFFSALGFTMGSLMLSVTPIHQMYWRMNLGMQIILCFGMDLSFPASSI 442

Query: 430 ILSDQLPSQYQGMAGSLVSTMISYSMSLCLGISGTAEHQVNKNGIDLLKGYQAALYVGIG 489
           ILSD LP QYQGMAGSLV+T+I+Y+ SLCLG+  T E Q+NK+G DLLKGY++ALY+ +G
Sbjct: 443 ILSDHLPMQYQGMAGSLVNTVINYATSLCLGMGTTVERQINKSGEDLLKGYRSALYLAVG 502

Query: 490 LASLGVVISGAFMIEDWWTSRRKR 513
           L  LG  I+   +    W  RR R
Sbjct: 503 LGGLGSCIAFINLCYTLWMKRRDR 526

>KAFR0B03930 Chr2 complement(816351..818018) [1668 bp, 555 aa] {ON} 
          Length = 555

 Score =  572 bits (1473), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/476 (59%), Positives = 357/476 (75%), Gaps = 4/476 (0%)

Query: 39  QNPDYFDKPWKEYIFVLSSMLSQLLNQAATTQTNPLFDVLSKDLNAKVSQQPWLMASFPL 98
           QNP YF   WKEY+F+L+ MLS LLNQA  TQ     +V+    NA  S + WLMASFPL
Sbjct: 70  QNPSYFSSRWKEYLFILTCMLSNLLNQAGQTQATSTMNVIGSAFNADSSSKTWLMASFPL 129

Query: 99  VSGSFILVSGKVGDIYGLKKTLLGGYVVVVIWSLICGLSSYAHNVDFFVVARSFQGLGIA 158
           VSGSFILVSG++GDIYGLK+T++GG +V++IWSLICG ++Y+ +V FF++ R+FQGLGIA
Sbjct: 130 VSGSFILVSGRIGDIYGLKRTMIGGLIVMIIWSLICGFANYSSSVTFFIICRAFQGLGIA 189

Query: 159 FVLPNVMGIVGNIYKPNTEAKNLVFSLIGACAPIGATLGCVFSGLIGARTD-LWGWTFYA 217
           FVLPNVMG+VGNIYK  +  KN+V S IG CAP GA  G  ++GLI  + +  W W FYA
Sbjct: 190 FVLPNVMGLVGNIYKVGSLRKNIVISCIGMCAPTGAAFGAFWAGLIATKAEKQWPWIFYA 249

Query: 218 YAITAALNGLVALWIIPNNIPTNVNEYKMDWIGSAIGVFGLILFNFVWNQAPIAGWGSAY 277
           YA    LN ++A++ IP+ +P NV+ + MDW GS +GV GLILFNFVWN+API GW  AY
Sbjct: 250 YAFAGILNLVLAIYSIPDTVPVNVHGFSMDWTGSVVGVIGLILFNFVWNEAPIVGWEKAY 309

Query: 278 XXXXXXXXXXXXXXFITYEIRFAKQPLLPHSVLFNRKLMMILSSLFFGWGSFGIWTFYYM 337
                         F  YEI+FAK PLLP +V  N  ++MILS++F GWGSFGIWTFYY 
Sbjct: 310 IIVLLIFSLLIIVVFFIYEIKFAKSPLLPQAVTHNHNIIMILSAMFMGWGSFGIWTFYYY 369

Query: 338 SFMLNLRHYSPLWAGGTYFMFAIWGIVASLLVGYTIHKTGPAVILFLSMVAFDCGCIMLA 397
           +F+LNLR Y+PL AG ++ MF +WG +A+  V +TI + GP+V+LF SMVAF  G IML+
Sbjct: 370 AFLLNLRGYTPLEAGASHCMFILWGTIAAFTVAFTIKRVGPSVLLFCSMVAFTVGSIMLS 429

Query: 398 VTPVHQTYFRMTLGIMIILSFGMDLSFPAASIILSDQLPSQYQGMAGSLVSTMISYSMSL 457
           +TPVHQTY++MT G+ IIL+FGMDLSFPA+SIILSD LP +YQGMAGSLV+T+++YS SL
Sbjct: 430 ITPVHQTYWKMTFGMQIILAFGMDLSFPASSIILSDALPMEYQGMAGSLVNTIVNYSTSL 489

Query: 458 CLGISGTAEHQVNKNGIDLLKGYQAALYVGIGLASLGVVISGAFMIEDWWTSRRKR 513
           CLG+  TAE QVNKNG DLLKGY+AALYVGIGL  +GV+I+  F+ E     R+KR
Sbjct: 490 CLGMGTTAEIQVNKNGTDLLKGYRAALYVGIGLGVVGVIIAALFLFESL---RQKR 542

>CAGL0M03003g Chr13 complement(337942..339618) [1677 bp, 558 aa]
           {ON} similar to uniprot|Q03263 Saccharomyces cerevisiae
           YMR279c or uniprot|P13090 Saccharomyces cerevisiae
           YML116w ATR1
          Length = 558

 Score =  566 bits (1459), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/481 (60%), Positives = 364/481 (75%), Gaps = 2/481 (0%)

Query: 35  KSRLQNPDYFDKPWKEYIFVLSSMLSQLLNQAATTQTNPLFDVLSKDLNAKVSQQPWLMA 94
            S  QNP+YF+  +KE +F++S M++QLLNQA  TQ+    +VL+    +  S+QPWLMA
Sbjct: 70  DSPFQNPEYFETGFKEVMFIISCMVAQLLNQAGQTQSLSTMNVLADYFKSNSSKQPWLMA 129

Query: 95  SFPLVSGSFILVSGKVGDIYGLKKTLLGGYVVVVIWSLICGLSSYAHNVDFFVVARSFQG 154
           SFPLVSGSFIL+SG++GDIYGLKK L  GY+++ +WS+ICGL+ Y ++  FF+V RSFQG
Sbjct: 130 SFPLVSGSFILISGRLGDIYGLKKALSVGYIIMTLWSIICGLAKYTNSDAFFIVCRSFQG 189

Query: 155 LGIAFVLPNVMGIVGNIYKPNTEAKNLVFSLIGACAPIGATLGCVFSGLIGAR-TDLWGW 213
           LGIAF+LPN+MG+VGNIYK  T  KN+V S IG  AP GA LG +F GLI     + W W
Sbjct: 190 LGIAFILPNIMGLVGNIYKVGTLRKNIVISCIGCMAPAGAALGALFGGLIVTEDAEQWPW 249

Query: 214 TFYAYAITAALNGLVALWIIPNNIPTNVNEYKMDWIGSAIGVFGLILFNFVWNQAPIAGW 273
            FYA+ I + +N L+AL+ IPNN+PTN+N   MDWIGS +GV GL+L N VWNQAPI GW
Sbjct: 250 VFYAFGIASFVNMLLALYSIPNNVPTNLNNLNMDWIGSLLGVSGLLLLNIVWNQAPIVGW 309

Query: 274 GSAYXXXXXXXXXXXXXXFITYEIRFAKQPLLPHSVLFNRKLMMILSSLFFGWGSFGIWT 333
           G AY              F+ YEI++A  PLLP SVL N+K++MIL++LFFGWGSFGIWT
Sbjct: 310 GEAYIIVLLIISIILLLIFVVYEIKYATSPLLPPSVLENKKILMILAALFFGWGSFGIWT 369

Query: 334 FYYMSFMLNLRHYSPLWAGGTYFMFAIWGIVASLLVGYTIHKTGPAVILFLSMVAFDCGC 393
           +YY +F LNLR Y+PLWAGGT+FMF IWG VA+ +V  TI K GPAV+L  SMVAFDCG 
Sbjct: 370 YYYYAFQLNLRKYTPLWAGGTHFMFVIWGTVAAFVVALTIKKVGPAVLLCFSMVAFDCGS 429

Query: 394 IMLAVTPVHQTYFRMTLGIMIILSFGMDLSFPAASIILSDQLPSQYQGMAGSLVSTMISY 453
           IML+VTPVHQTY+RM +G+ IILSFGMDLSFPA+SIILSD LP QYQGMAGSLV+T+++Y
Sbjct: 430 IMLSVTPVHQTYWRMNVGMQIILSFGMDLSFPASSIILSDFLPMQYQGMAGSLVNTVVNY 489

Query: 454 SMSLCLGISGTAEHQVNKNGIDLLKGYQAALYVGIGLASLGVVISGAFMIEDWWTSR-RK 512
           S SLCLG+  T E Q N +G DLLKGY++ALY+ IGLAS GV +S  F++ D    R RK
Sbjct: 490 STSLCLGMGNTVEQQYNAHGADLLKGYRSALYLAIGLASAGVCVSLVFLVTDIIAKRHRK 549

Query: 513 R 513
           R
Sbjct: 550 R 550

>NCAS0C00400 Chr3 (61257..62810) [1554 bp, 517 aa] {ON} Anc_8.843
          Length = 517

 Score =  563 bits (1451), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 272/506 (53%), Positives = 361/506 (71%), Gaps = 5/506 (0%)

Query: 10  ENWEKLQSSSAAGEERDGQTEAIGPKSR-LQNPDYFDKPWKEYIFVLSSMLSQLLNQAAT 68
           EN E + SSS   +++    +++   S   QN  YF    KEY F+ + M + LLNQA  
Sbjct: 2   ENKEPIVSSS---QKKTLSCDSLLENSTPWQNEQYFQSHLKEYFFIFTCMFANLLNQAGQ 58

Query: 69  TQTNPLFDVLSKDLNAKVSQQPWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYVVVV 128
           TQ     +V+S+  ++ V  Q WLMASFPLVSGSFIL+SG++GDIYGLKKT++GGY+ ++
Sbjct: 59  TQVLSTMNVISESFHSDVGTQTWLMASFPLVSGSFILISGRIGDIYGLKKTMIGGYIFMI 118

Query: 129 IWSLICGLSSYAHNVDFFVVARSFQGLGIAFVLPNVMGIVGNIYKPNTEAKNLVFSLIGA 188
           IW+L+CG + Y H+  FF+V R+FQGLGI+F+LPN+MG+VGNIYK  T  KN+V SLIG 
Sbjct: 119 IWTLLCGFADYTHSDTFFIVCRAFQGLGISFILPNIMGLVGNIYKVGTLRKNIVISLIGI 178

Query: 189 CAPIGATLGCVFSGLIGARTDL-WGWTFYAYAITAALNGLVALWIIPNNIPTNVNEYKMD 247
            AP GA +G ++ GLI   +   W W FYAYA+ A +N ++A++ +P N+PTNV+ + MD
Sbjct: 179 TAPTGACMGALWGGLIATESSRQWPWIFYAYALAAFVNLIMAIYSVPENVPTNVHNFAMD 238

Query: 248 WIGSAIGVFGLILFNFVWNQAPIAGWGSAYXXXXXXXXXXXXXXFITYEIRFAKQPLLPH 307
           W+G+ IGV GLILFNFVWNQ P+ GW   Y              FI YE++F   PLLP 
Sbjct: 239 WMGAIIGVVGLILFNFVWNQGPVNGWAKPYIIVLLIISIIFLVAFIIYELKFPISPLLPR 298

Query: 308 SVLFNRKLMMILSSLFFGWGSFGIWTFYYMSFMLNLRHYSPLWAGGTYFMFAIWGIVASL 367
            V  N +++ IL  LF GWGSFGIWTFYY +F LNLR+YSPLWAG T+FMF IWG +A+ 
Sbjct: 299 EVTKNGQILTILGILFLGWGSFGIWTFYYYAFQLNLRNYSPLWAGATHFMFIIWGSIAAF 358

Query: 368 LVGYTIHKTGPAVILFLSMVAFDCGCIMLAVTPVHQTYFRMTLGIMIILSFGMDLSFPAA 427
           +VG+TI++ GPAV+LF S + F  G +ML+VTP+HQTY+RM +G+ IILSFGMDLSFPA+
Sbjct: 359 IVGFTINRVGPAVLLFFSALGFTMGSLMLSVTPIHQTYWRMNVGMQIILSFGMDLSFPAS 418

Query: 428 SIILSDQLPSQYQGMAGSLVSTMISYSMSLCLGISGTAEHQVNKNGIDLLKGYQAALYVG 487
           SIILSD LP QYQGMAGSLV+T+I+YS SLCLG+  T E Q+NK G +LL+GY++ALY+ 
Sbjct: 419 SIILSDHLPMQYQGMAGSLVNTIINYSTSLCLGMGTTVERQINKTGEELLRGYRSALYLA 478

Query: 488 IGLASLGVVISGAFMIEDWWTSRRKR 513
           +GL  LG  ++   +  D W  R+ R
Sbjct: 479 VGLGGLGACVAFLNLCYDLWRKRKSR 504

>TBLA0D03270 Chr4 complement(813041..814693) [1653 bp, 550 aa] {ON}
           Anc_8.843 YMR279C
          Length = 550

 Score =  557 bits (1436), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 273/520 (52%), Positives = 367/520 (70%), Gaps = 10/520 (1%)

Query: 1   MNMKENDDEENWEK--LQSSSAAGEERDGQTEAIG-------PKSRLQNPDYFDKPWKEY 51
           +N   N+D +N E+  L++  +        T+ +          S  QNPDYF   ++E+
Sbjct: 16  INYTNNEDCKNPEQQSLKNIDSRSSLNSSLTQVLSTDTADNDESSSYQNPDYFKNKYQEF 75

Query: 52  IFVLSSMLSQLLNQAATTQTNPLFDVLSKDLNAKVSQQPWLMASFPLVSGSFILVSGKVG 111
            F+ S M+ QLL+QA  TQT  + +VL+K+L++  S+Q WLM+SFPL  GSFILVSG++G
Sbjct: 76  GFIFSGMIGQLLSQAGLTQTLSIMNVLAKELDSTSSRQAWLMSSFPLALGSFILVSGRLG 135

Query: 112 DIYGLKKTLLGGYVVVVIWSLICGLSSYAHNVDFFVVARSFQGLGIAFVLPNVMGIVGNI 171
           DIYGLKK LLGGY++  +WS+ICGLSSYAHN  FF+ AR+FQGLG+AF LPN++G++G I
Sbjct: 136 DIYGLKKILLGGYIITTVWSIICGLSSYAHNDAFFITARAFQGLGLAFALPNMIGLIGTI 195

Query: 172 YKPNTEAKNLVFSLIGACAPIGATLGCVFSGL-IGARTDLWGWTFYAYAITAALNGLVAL 230
           Y+P    KN++ S+IGA +P GATLG +F+GL +      W W+FYA+ + + +N +++ 
Sbjct: 196 YRPGCFRKNMIISIIGAMSPTGATLGGLFAGLTVKYDKSNWPWSFYAFGLISFVNLIISW 255

Query: 231 WIIPNNIPTNVNEYKMDWIGSAIGVFGLILFNFVWNQAPIAGWGSAYXXXXXXXXXXXXX 290
           + IPN+IPTN++  KMDW+GS +GVFGLI+ NFV+NQAPI GW SAY             
Sbjct: 256 YCIPNSIPTNIHGLKMDWLGSVLGVFGLIILNFVFNQAPIVGWQSAYIIVLLVLSFCALV 315

Query: 291 XFITYEIRFAKQPLLPHSVLFNRKLMMILSSLFFGWGSFGIWTFYYMSFMLNLRHYSPLW 350
            F+ YE+++AK PL+P ++  NR ++MIL SLF GWGSFGIWTFYY SF LNLRHYSPLW
Sbjct: 316 IFVVYEVKYAKTPLIPKAISSNRGMLMILFSLFCGWGSFGIWTFYYFSFELNLRHYSPLW 375

Query: 351 AGGTYFMFAIWGIVASLLVGYTIHKTGPAVILFLSMVAFDCGCIMLAVTPVHQTYFRMTL 410
           AG +YF+F I G   +++ G TI K  P+V+   SM+ F  G I+ A TPV+QT+FR  L
Sbjct: 376 AGSSYFIFVISGSTVAIVCGLTIKKIKPSVLFCCSMMGFLGGNIIFAATPVNQTFFRNML 435

Query: 411 GIMIILSFGMDLSFPAASIILSDQLPSQYQGMAGSLVSTMISYSMSLCLGISGTAEHQVN 470
           G M +L  GMD SFPA+SIILSD LP QYQGMAGSLV+T+I+YS S+CLG++GT E + N
Sbjct: 436 GCMFLLPLGMDFSFPASSIILSDSLPMQYQGMAGSLVNTVINYSTSICLGMAGTVEMKHN 495

Query: 471 KNGIDLLKGYQAALYVGIGLASLGVVISGAFMIEDWWTSR 510
            +G DLL GY+AA+Y  IGLA L V +SG +MIE  W  R
Sbjct: 496 SHGKDLLNGYRAAIYFAIGLAGLAVCVSGGYMIECLWKDR 535

>Skud_13.451 Chr13 complement(798006..799625) [1620 bp, 539 aa] {ON}
           YMR279C (REAL)
          Length = 539

 Score =  550 bits (1416), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 274/513 (53%), Positives = 368/513 (71%), Gaps = 4/513 (0%)

Query: 1   MNMKENDDEENWEKLQSSSAAGEERDGQTEAIGPKSRLQNPDYFDKPWKEYIFVLSSMLS 60
           ++MKE D        + ++ A   +  Q   I   S  Q+P YF    KE +F+ + ML+
Sbjct: 22  ISMKEEDKVIVSTDEEVTTVASSSKSNQ---ISNDSPWQDPTYFSSFGKELMFIGTCMLA 78

Query: 61  QLLNQAATTQTNPLFDVLSKDLNAKVSQQPWLMASFPLVSGSFILVSGKVGDIYGLKKTL 120
           QLLNQA  T    + +VLSK   ++ + Q WLMASFPL +GSFIL+SG++GDIYGLKK L
Sbjct: 79  QLLNQAGQTHALCIMNVLSKSFGSESNNQAWLMASFPLAAGSFILISGRLGDIYGLKKML 138

Query: 121 LGGYVVVVIWSLICGLSSYAHNVDFFVVARSFQGLGIAFVLPNVMGIVGNIYKPNTEAKN 180
           + GYV++++WS+I GLS Y++N  FF+  R+FQG+GIAF+LPN+MG+VG++YK  +  KN
Sbjct: 139 MIGYVIIIVWSIISGLSKYSNNDSFFITCRAFQGVGIAFILPNIMGLVGHVYKVGSLRKN 198

Query: 181 LVFSLIGACAPIGATLGCVFSGLIGART-DLWGWTFYAYAITAALNGLVALWIIPNNIPT 239
           LV S+IGAC P GA  G VF GLI     + W W FYA+ I   ++ L+A + IPNN+PT
Sbjct: 199 LVISVIGACGPTGALFGGVFGGLIVTEDPNQWPWVFYAFGIATFISMLMAWYSIPNNVPT 258

Query: 240 NVNEYKMDWIGSAIGVFGLILFNFVWNQAPIAGWGSAYXXXXXXXXXXXXXXFITYEIRF 299
           NV+   MDW GS + V GLILFNFVWN+APIAGW  AY              F  YEI++
Sbjct: 259 NVHGLSMDWTGSVLAVIGLILFNFVWNEAPIAGWDKAYIIVLLVVSVFFLVAFFVYEIKY 318

Query: 300 AKQPLLPHSVLFNRKLMMILSSLFFGWGSFGIWTFYYMSFMLNLRHYSPLWAGGTYFMFA 359
           A+ PLLPH+V  NR ++MIL ++F GWGSFGIWTFYY+SF LNLRHYSP+W GGTYF+FA
Sbjct: 319 AEVPLLPHAVTKNRHMIMILLAVFVGWGSFGIWTFYYVSFQLNLRHYSPVWTGGTYFVFA 378

Query: 360 IWGIVASLLVGYTIHKTGPAVILFLSMVAFDCGCIMLAVTPVHQTYFRMTLGIMIILSFG 419
           I+G +A+  V ++I + GPA++L  +++AFD G IM +V PV Q+Y+++   +  +L FG
Sbjct: 379 IFGTIAAFFVAFSIKRLGPALLLCFALMAFDAGSIMFSVLPVEQSYWKLNFAMQAVLCFG 438

Query: 420 MDLSFPAASIILSDQLPSQYQGMAGSLVSTMISYSMSLCLGISGTAEHQVNKNGIDLLKG 479
           MDLSFPA+SIILSD LP QYQGMAGSLV+T+I+YS SLCLG+  T EHQ+NK+G ++L+G
Sbjct: 439 MDLSFPASSIILSDGLPMQYQGMAGSLVNTVINYSASLCLGMGATVEHQINKSGKNVLEG 498

Query: 480 YQAALYVGIGLASLGVVISGAFMIEDWWTSRRK 512
           Y+AA+Y+GIGLASLGV+IS  +M+E  W  R+K
Sbjct: 499 YRAAVYLGIGLASLGVLISVTYMLETVWNERKK 531

>NDAI0K00400 Chr11 (90040..91701) [1662 bp, 553 aa] {ON} 
          Length = 553

 Score =  548 bits (1413), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/512 (54%), Positives = 363/512 (70%), Gaps = 10/512 (1%)

Query: 3   MKENDDEENWEKLQSSSAAGEERDGQTEAIGPKSRLQNPDYFDKPWKEYIFVLSSMLSQL 62
           +KE DDE   +   +SS++ +E +         S  QNPDYF   +KEYIFV + M++ L
Sbjct: 37  IKEQDDEIGSDSTTTSSSSLQENN---------SSWQNPDYFSSSFKEYIFVATCMIANL 87

Query: 63  LNQAATTQTNPLFDVLSKDLNAKVSQQPWLMASFPLVSGSFILVSGKVGDIYGLKKTLLG 122
           LNQA  +Q     +V+S   ++    Q WLMASFPLVSGSFIL+SG++GDIYGLK+ ++G
Sbjct: 88  LNQAGQSQVLSAMNVISDSFHSSTGGQTWLMASFPLVSGSFILISGRLGDIYGLKRMMIG 147

Query: 123 GYVVVVIWSLICGLSSYAHNVDFFVVARSFQGLGIAFVLPNVMGIVGNIYKPNTEAKNLV 182
           G++ ++IWSLICG ++YAH+  FF+VAR+FQGLGI+F+LPNVMG+VGNIYK  T  KN+V
Sbjct: 148 GFIFMIIWSLICGFTNYAHSDTFFIVARAFQGLGISFILPNVMGLVGNIYKVGTLRKNVV 207

Query: 183 FSLIGACAPIGATLGCVFSGLIGART-DLWGWTFYAYAITAALNGLVALWIIPNNIPTNV 241
            SLIG  AP G+  G ++ GLI       W W FYAYA+ AA+  ++  + +P+NIPTNV
Sbjct: 208 ISLIGIMAPTGSCFGALWGGLIVTENPKQWPWIFYAYAVAAAVCLVMGYYTVPDNIPTNV 267

Query: 242 NEYKMDWIGSAIGVFGLILFNFVWNQAPIAGWGSAYXXXXXXXXXXXXXXFITYEIRFAK 301
           N + MDWIGS +GV GLILFNFVWNQ PI GW  AY              F  YEI++AK
Sbjct: 268 NGFTMDWIGSVLGVIGLILFNFVWNQGPIVGWEKAYIIVLLIVSVIFLIAFFVYEIKYAK 327

Query: 302 QPLLPHSVLFNRKLMMILSSLFFGWGSFGIWTFYYMSFMLNLRHYSPLWAGGTYFMFAIW 361
            PLLP +V  N  ++ IL+ LF GWGSFGIWTFYY +F LNLR YSP+W+GGT+F+F I+
Sbjct: 328 VPLLPKAVTQNGHILTILTVLFLGWGSFGIWTFYYFAFQLNLREYSPVWSGGTFFVFIIF 387

Query: 362 GIVASLLVGYTIHKTGPAVILFLSMVAFDCGCIMLAVTPVHQTYFRMTLGIMIILSFGMD 421
           G VA+  V  TI K GPA++LF S + F CG I+++VTPVHQTY+R T G+ IIL FGMD
Sbjct: 388 GTVAATTVALTIKKVGPAILLFFSAIGFTCGSIIMSVTPVHQTYWRNTFGMQIILVFGMD 447

Query: 422 LSFPAASIILSDQLPSQYQGMAGSLVSTMISYSMSLCLGISGTAEHQVNKNGIDLLKGYQ 481
           L FPA+SIILSD LP QYQGMA SLV+T+++YS SLCLG+  T E Q+NK+G DLLKGY+
Sbjct: 448 LPFPASSIILSDYLPMQYQGMAVSLVNTIVNYSTSLCLGMGTTVERQINKSGDDLLKGYR 507

Query: 482 AALYVGIGLASLGVVISGAFMIEDWWTSRRKR 513
           AALY G+G+A LG  I+   +  D W+ R  +
Sbjct: 508 AALYFGVGIAGLGACIAFLNVCHDIWSKRNAK 539

>TPHA0C04790 Chr3 complement(1033653..1035323) [1671 bp, 556 aa]
           {ON} Anc_8.843 YMR279C
          Length = 556

 Score =  548 bits (1411), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 252/477 (52%), Positives = 346/477 (72%), Gaps = 1/477 (0%)

Query: 39  QNPDYFDKPWKEYIFVLSSMLSQLLNQAATTQTNPLFDVLSKDLNAKVSQQPWLMASFPL 98
           Q P YF     E+ F+ + ++ QLLNQA TTQ+  + +++++D  ++ S+Q WL ASFPL
Sbjct: 66  QKPQYFSSKLHEWAFIFTCLMGQLLNQAGTTQSMSIMNIIAEDFGSETSKQAWLFASFPL 125

Query: 99  VSGSFILVSGKVGDIYGLKKTLLGGYVVVVIWSLICGLSSYAHNVDFFVVARSFQGLGIA 158
           VSGSFILV G+ GDIYGLKK LL GY ++ IWS+ICGL+ Y H+ DFF+VA++FQGLG++
Sbjct: 126 VSGSFILVGGRFGDIYGLKKMLLLGYAILTIWSIICGLTHYTHSDDFFIVAKAFQGLGVS 185

Query: 159 FVLPNVMGIVGNIYKPNTEAKNLVFSLIGACAPIGATLGCVFSGLIGARTDL-WGWTFYA 217
           F+LPN++G+VG IY+P +  KN+  S IGA AP+GAT G +FSG++  + D  W WTFYA
Sbjct: 186 FILPNIIGLVGTIYEPGSMKKNITISFIGAMAPLGATFGGLFSGIVVVKDDKNWPWTFYA 245

Query: 218 YAITAALNGLVALWIIPNNIPTNVNEYKMDWIGSAIGVFGLILFNFVWNQAPIAGWGSAY 277
           +AI + L G+   + +P+N+PTN N  KMDWIGSA+GV GL+LF+FVWNQAP+ GW  AY
Sbjct: 246 FAIVSFLVGVTCYFFVPDNVPTNTNNLKMDWIGSAVGVVGLLLFSFVWNQAPMDGWDKAY 305

Query: 278 XXXXXXXXXXXXXXFITYEIRFAKQPLLPHSVLFNRKLMMILSSLFFGWGSFGIWTFYYM 337
                         F  YEI +A+ PLLP ++  NR ++MIL ++F GWG+FGIW+FYY 
Sbjct: 306 IIVLLVISVILIIAFFIYEINYAEVPLLPKAITGNRHIIMILLAIFMGWGTFGIWSFYYF 365

Query: 338 SFMLNLRHYSPLWAGGTYFMFAIWGIVASLLVGYTIHKTGPAVILFLSMVAFDCGCIMLA 397
           SF LNLRH+SP+W GG YF F + G   +  VG+ I    P++IL +S+  F  G ++ A
Sbjct: 366 SFSLNLRHFSPVWTGGAYFAFILSGFTIASCVGFLIKIIRPSIILVISITGFTMGNLIFA 425

Query: 398 VTPVHQTYFRMTLGIMIILSFGMDLSFPAASIILSDQLPSQYQGMAGSLVSTMISYSMSL 457
           VTP  QTY+R T G+M++L  GMDLSFPA+SIILSDQLP +YQGMAGSLV+TM++YS S 
Sbjct: 426 VTPADQTYWRNTFGMMLLLPLGMDLSFPASSIILSDQLPPEYQGMAGSLVNTMVNYSQSF 485

Query: 458 CLGISGTAEHQVNKNGIDLLKGYQAALYVGIGLASLGVVISGAFMIEDWWTSRRKRT 514
           CLG++ T E Q+N +G DLLKGY+AA Y G+G+ +LG+ I+  +M E +WT  +++T
Sbjct: 486 CLGVATTVEKQINSSGDDLLKGYRAAFYTGVGIGTLGISIASLYMFETFWTDYKEKT 542

>YMR279C Chr13 complement(824729..826351) [1623 bp, 540 aa] {ON}
           Putative boron transporter involved in boron efflux and
           resistance; overexpression mutant but not null mutant
           displays boron tolerance phenotype; identified as a
           heat-induced gene in a high-throughout screen; YMR279C
           is not an essential gene; paralog of the efflux pump
           ATR1
          Length = 540

 Score =  546 bits (1406), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 270/509 (53%), Positives = 362/509 (71%), Gaps = 10/509 (1%)

Query: 5   ENDDEENWEKLQSSSAAGEERDGQTEAIGPKSRLQNPDYFDKPWKEYIFVLSSMLSQLLN 64
             +DEE    + S+ +     D         S  Q+P YF    KE +F+ + ML+QLLN
Sbjct: 33  STEDEEVTTIVSSTKSTQVTND---------SPWQDPTYFSSFGKELMFIATCMLAQLLN 83

Query: 65  QAATTQTNPLFDVLSKDLNAKVSQQPWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGY 124
           QA  T    + +VLSK  N++ + Q WLMASFPL +GSFIL+SG++GDIYGLKK L+ GY
Sbjct: 84  QAGQTHALCIMNVLSKSFNSEANNQAWLMASFPLAAGSFILISGRLGDIYGLKKMLIVGY 143

Query: 125 VVVVIWSLICGLSSYAHNVDFFVVARSFQGLGIAFVLPNVMGIVGNIYKPNTEAKNLVFS 184
           V+V++WS+I GLS Y+++  FF+ +R+FQG+GIAF+LPN+MG+VG++YK  +  KN+V S
Sbjct: 144 VIVIVWSIISGLSKYSNSDAFFITSRAFQGVGIAFILPNIMGLVGHVYKVGSFRKNIVIS 203

Query: 185 LIGACAPIGATLGCVFSG-LIGARTDLWGWTFYAYAITAALNGLVALWIIPNNIPTNVNE 243
            IGACAP G   G +F G ++    + W W FYA+ I   L+ L+A + IPNN+PTN++ 
Sbjct: 204 FIGACAPTGGMFGGLFGGLIVTEDPNQWPWVFYAFGIATFLSLLMAWYSIPNNVPTNIHG 263

Query: 244 YKMDWIGSAIGVFGLILFNFVWNQAPIAGWGSAYXXXXXXXXXXXXXXFITYEIRFAKQP 303
             MDW GSA+ + GLILFNFVWNQAPI GW   Y              F  YE ++A+ P
Sbjct: 264 LSMDWTGSALAIIGLILFNFVWNQAPIVGWDKPYIIVLLIISVIFLVAFFVYESKYAEVP 323

Query: 304 LLPHSVLFNRKLMMILSSLFFGWGSFGIWTFYYMSFMLNLRHYSPLWAGGTYFMFAIWGI 363
           LLP ++  NR ++MIL ++F GWGSFGIWTFYY+SF LNLRHYSP+W GGTYF+F I+G 
Sbjct: 324 LLPRAMTKNRHMIMILLAVFLGWGSFGIWTFYYVSFQLNLRHYSPVWTGGTYFVFVIFGS 383

Query: 364 VASLLVGYTIHKTGPAVILFLSMVAFDCGCIMLAVTPVHQTYFRMTLGIMIILSFGMDLS 423
           +A+  V ++I + GPA++L  S++AFD G IM +V PV Q+Y+++   +  IL FGMDLS
Sbjct: 384 MAAFFVAFSIKRLGPALLLCFSLMAFDAGSIMFSVLPVEQSYWKLNFAMQAILCFGMDLS 443

Query: 424 FPAASIILSDQLPSQYQGMAGSLVSTMISYSMSLCLGISGTAEHQVNKNGIDLLKGYQAA 483
           FPA+SIILSD LP QYQGMAGSLV+T+I+YS SLCLG+ GT EHQ+NK+G DLLKGY+AA
Sbjct: 444 FPASSIILSDGLPMQYQGMAGSLVNTVINYSASLCLGMGGTVEHQINKSGNDLLKGYRAA 503

Query: 484 LYVGIGLASLGVVISGAFMIEDWWTSRRK 512
           +Y+G+GLASLGVVIS  +M+E+ W   RK
Sbjct: 504 VYLGVGLASLGVVISVTYMLENLWNRHRK 532

>KAFR0B03940 Chr2 complement(820954..822597) [1644 bp, 547 aa] {ON}
           Anc_8.843 YMR279C
          Length = 547

 Score =  541 bits (1394), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 268/530 (50%), Positives = 357/530 (67%), Gaps = 18/530 (3%)

Query: 2   NMKENDDEEN-WEKLQSSSAAGEER----------------DGQTEAIGPKSRLQNPDYF 44
            +K+ ++E+N  E  Q+++   +                  D    +I   S+ Q+P YF
Sbjct: 8   KLKQQEEEKNPIEDFQTTTVTAQTSLDVLSDSVKKDQISITDDDVSSISNNSKWQDPTYF 67

Query: 45  DKPWKEYIFVLSSMLSQLLNQAATTQTNPLFDVLSKDLNAKVSQQPWLMASFPLVSGSFI 104
              W+EY F+ + ML+ LLNQA  TQT    +VL+  LN+  + + WLMASF L SGSFI
Sbjct: 68  KSSWQEYTFIGTCMLANLLNQAGQTQTLSTMNVLADSLNSDGAAKTWLMASFTLASGSFI 127

Query: 105 LVSGKVGDIYGLKKTLLGGYVVVVIWSLICGLSSYAHNVDFFVVARSFQGLGIAFVLPNV 164
           LVSG++GDIYGLK T +GG ++  IWS++CG+S Y  NV FF++ R+FQGLG+AFVLPNV
Sbjct: 128 LVSGRIGDIYGLKATFIGGNIIFCIWSILCGVSKYTENVTFFIICRAFQGLGVAFVLPNV 187

Query: 165 MGIVGNIYKPNTEAKNLVFSLIGACAPIGATLGCVFSGLI-GARTDLWGWTFYAYAITAA 223
           MG+VGNIY   +  KN+V S IG  AP+G T G ++ GLI  +  D W W F+A AI   
Sbjct: 188 MGLVGNIYNVGSMRKNIVISFIGCMAPVGQTFGGMWGGLIVDSNKDQWPWIFFATAIAVF 247

Query: 224 LNGLVALWIIPNNIPTNVNEYKMDWIGSAIGVFGLILFNFVWNQAPIAGWGSAYXXXXXX 283
           +N ++ ++ IPN++PTN+   KMDWIGS +GV GLIL NFVWNQAPI+GW  AY      
Sbjct: 248 INLIMGIYSIPNHVPTNIYNLKMDWIGSLLGVIGLILMNFVWNQAPISGWSKAYIIVILI 307

Query: 284 XXXXXXXXFITYEIRFAKQPLLPHSVLFNRKLMMILSSLFFGWGSFGIWTFYYMSFMLNL 343
                   F  YE++ A+ PLLP  V  NR ++ I+ SLF GWG+FGIWTFYY +F LNL
Sbjct: 308 VAVFFLVAFFIYELKKAESPLLPPEVTKNRHIVTIIISLFLGWGAFGIWTFYYYAFNLNL 367

Query: 344 RHYSPLWAGGTYFMFAIWGIVASLLVGYTIHKTGPAVILFLSMVAFDCGCIMLAVTPVHQ 403
           RH+SPLWAG T+F+F I+G + ++ V +TI+K GP+V+  LS + F CG I+ +VT   Q
Sbjct: 368 RHFSPLWAGSTHFVFIIFGSLTAITVAFTINKVGPSVLFCLSSIGFTCGNIIFSVTSPDQ 427

Query: 404 TYFRMTLGIMIILSFGMDLSFPAASIILSDQLPSQYQGMAGSLVSTMISYSMSLCLGISG 463
           TY+R +LG+ IIL+ GMDLSFP +SIILSD LP QYQGM+GSLV+T+ +Y+ SLCLG+  
Sbjct: 428 TYWRNSLGMQIILALGMDLSFPGSSIILSDLLPMQYQGMSGSLVNTITNYATSLCLGMGT 487

Query: 464 TAEHQVNKNGIDLLKGYQAALYVGIGLASLGVVISGAFMIEDWWTSRRKR 513
           TAE Q N  G D+LKGY+AALYV IGL +LG   S ++M ED W   RKR
Sbjct: 488 TAEVQYNNGGKDVLKGYRAALYVAIGLGALGFAFSFSYMAEDLWIRYRKR 537

>Smik_13.492 Chr13 complement(807726..809357) [1632 bp, 543 aa] {ON}
           YMR279C (REAL)
          Length = 543

 Score =  536 bits (1380), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 270/488 (55%), Positives = 360/488 (73%), Gaps = 1/488 (0%)

Query: 26  DGQTEAIGPKSRLQNPDYFDKPWKEYIFVLSSMLSQLLNQAATTQTNPLFDVLSKDLNAK 85
             ++  +   S  Q+P YF    KE +F+ + ML+QLLNQA  T    + +VLSK  N++
Sbjct: 45  SNESNQVTNDSPWQDPIYFSSFGKELMFIATCMLAQLLNQAGQTHALCIMNVLSKSFNSE 104

Query: 86  VSQQPWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYVVVVIWSLICGLSSYAHNVDF 145
            + Q WLMASFPL +GSFIL+SG++GDIYGLKK LL GYV+++IWS+I GLS Y+++  F
Sbjct: 105 SNNQAWLMASFPLAAGSFILISGRLGDIYGLKKMLLIGYVIIIIWSIISGLSKYSNSDAF 164

Query: 146 FVVARSFQGLGIAFVLPNVMGIVGNIYKPNTEAKNLVFSLIGACAPIGATLGCVFSGLIG 205
           F+  R+FQGLGIAF+LPN+MG+VG++YK  +  KNLV S+IGACAP G   G VF GLI 
Sbjct: 165 FITCRAFQGLGIAFILPNIMGLVGHVYKVGSLRKNLVISVIGACAPAGGMFGGVFGGLIV 224

Query: 206 ART-DLWGWTFYAYAITAALNGLVALWIIPNNIPTNVNEYKMDWIGSAIGVFGLILFNFV 264
               + W W FYA++I   ++ L+A + IPNN+PTNV+   MDW GS + V GLILFNFV
Sbjct: 225 TEDPEQWPWVFYAFSIATFISLLMAWYSIPNNVPTNVHGLSMDWTGSTLAVLGLILFNFV 284

Query: 265 WNQAPIAGWGSAYXXXXXXXXXXXXXXFITYEIRFAKQPLLPHSVLFNRKLMMILSSLFF 324
           WNQAPIAGWG AY              F  YEI++A+ PLLPH+V  NR ++MIL ++F 
Sbjct: 285 WNQAPIAGWGEAYIIVLLILSVFFLIAFFVYEIKYAEVPLLPHAVTKNRHMIMILLAVFL 344

Query: 325 GWGSFGIWTFYYMSFMLNLRHYSPLWAGGTYFMFAIWGIVASLLVGYTIHKTGPAVILFL 384
           GWGSFGIWTFYY+SF LNLRHYSP+W GGTYF+F I+G +A+  V ++I + GPA++L  
Sbjct: 345 GWGSFGIWTFYYVSFQLNLRHYSPVWTGGTYFVFVIFGSIAAFFVAFSIKRLGPAILLCF 404

Query: 385 SMVAFDCGCIMLAVTPVHQTYFRMTLGIMIILSFGMDLSFPAASIILSDQLPSQYQGMAG 444
           +++AFD G IM +V PV Q+Y+++   +  IL FGMDLSFPA+SIILSD LP QYQGMAG
Sbjct: 405 ALMAFDAGSIMFSVLPVEQSYWKLNFAMQAILCFGMDLSFPASSIILSDGLPMQYQGMAG 464

Query: 445 SLVSTMISYSMSLCLGISGTAEHQVNKNGIDLLKGYQAALYVGIGLASLGVVISGAFMIE 504
           SLV+T+I+YS SLCLG+  T E Q+NK+G +LLKGY+AA+Y+GIGLASLG++IS  +M+E
Sbjct: 465 SLVNTVINYSASLCLGMGVTVERQINKSGQNLLKGYRAAIYLGIGLASLGLLISVTYMLE 524

Query: 505 DWWTSRRK 512
           ++W   ++
Sbjct: 525 NFWNKHKE 532

>TBLA0D03280 Chr4 complement(815937..817679) [1743 bp, 580 aa] {ON} 
          Length = 580

 Score =  536 bits (1382), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 256/520 (49%), Positives = 367/520 (70%), Gaps = 7/520 (1%)

Query: 3   MKEN---DDEENW---EKLQSSSAAGEERDGQTEAIGPKSRLQNPDYFDKPWKEYIFVLS 56
           +K+N   D + N    E + S S+   + D  +E +  ++++ +P YF     EY+F++S
Sbjct: 45  LKKNYSQDSQTNTSMNEVIGSISSVSNDSDINSENLQSENKVLSPKYFKNRTHEYLFIIS 104

Query: 57  SMLSQLLNQAATTQTNPLFDVLSKDLNAKVSQQPWLMASFPLVSGSFILVSGKVGDIYGL 116
            M+SQ ++QA  TQ   + ++L+++LNA+ S+Q WLMASF L  GSFILVSG++GDIYGL
Sbjct: 105 CMVSQFMSQAGLTQALSIMNILAEELNAEKSRQAWLMASFTLSMGSFILVSGRLGDIYGL 164

Query: 117 KKTLLGGYVVVVIWSLICGLSSYAHNVDFFVVARSFQGLGIAFVLPNVMGIVGNIYKPNT 176
           KK LLGGY ++ IWSLICG SSY+HN  FF+ +R+FQGLG+AFVLPN +G++G IY+P +
Sbjct: 165 KKVLLGGYAILTIWSLICGFSSYSHNDAFFITSRAFQGLGLAFVLPNSLGLIGVIYEPGS 224

Query: 177 EAKNLVFSLIGACAPIGATLGCVFSGLIGART-DLWGWTFYAYAITAALNGLVALWIIPN 235
             KN++   +GA +PIGATLG +F+G+IG +    W W+FY++ I +  N +++ + IPN
Sbjct: 225 MKKNMIIGTLGAMSPIGATLGGLFAGIIGTKDPKQWPWSFYSFGIVSFCNMILSWYSIPN 284

Query: 236 NIPTNVNEYKMDWIGSAIGVFGLILFNFVWNQAPIAGWGSAYXXXXXXXXXXXXXXFITY 295
           NIPTN+    MDWIG+ +G+FGL++ NFV+NQAPI GW SAY              F+ Y
Sbjct: 285 NIPTNIYNLSMDWIGAILGIFGLLILNFVFNQAPIVGWQSAYIIVLLVLSFCALVIFVVY 344

Query: 296 EIRFAKQPLLPHSVLFNRKLMMILSSLFFGWGSFGIWTFYYMSFMLNLRHYSPLWAGGTY 355
           E+++AK PL+P ++  NR ++MIL +LF GWG+FG WTFYY SF+LN+R Y+  WAGG+Y
Sbjct: 345 EVKYAKTPLIPKAISSNRGMLMILFALFCGWGAFGTWTFYYFSFVLNVRGYTAAWAGGSY 404

Query: 356 FMFAIWGIVASLLVGYTIHKTGPAVILFLSMVAFDCGCIMLAVTPVHQTYFRMTLGIMII 415
           F+F + G   + L G+ + K  P+VIL++SM+ F  GC+ML VTP+HQ+YF+  LGIM +
Sbjct: 405 FIFIVSGCAIATLCGFMMKKVPPSVILYISMIGFMGGCVMLTVTPIHQSYFQNILGIMFV 464

Query: 416 LSFGMDLSFPAASIILSDQLPSQYQGMAGSLVSTMISYSMSLCLGISGTAEHQVNKNGID 475
           L  G+DLSFPAASIILSD LP QYQGMAGSLV T+ +YS S+CLG++G+ E   N NG +
Sbjct: 465 LPIGIDLSFPAASIILSDALPIQYQGMAGSLVYTITNYSTSICLGMAGSVEAYHNDNGQN 524

Query: 476 LLKGYQAALYVGIGLASLGVVISGAFMIEDWWTSRRKRTT 515
           +LKGY+ A+     LA LG+++SG +M+ +  T R    +
Sbjct: 525 ILKGYRNAMIFADALAGLGIIVSGIYMVINLITIRENSKS 564

>KAFR0A02840 Chr1 complement(588197..589759) [1563 bp, 520 aa] {ON}
           Anc_8.843 YMR279C
          Length = 520

 Score =  518 bits (1333), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 261/485 (53%), Positives = 344/485 (70%), Gaps = 2/485 (0%)

Query: 3   MKENDDEENWEKLQSSSAAGEERDGQTEAI-GPKSRLQNPDYFDKPWKEYIFVLSSMLSQ 61
           M E+      E +QS  +  +  + + E I   KS+ Q+P YF   ++EY+FV S M +Q
Sbjct: 1   MAESRTSSIKEHIQSDISIDKSSNEKCEVIVREKSKWQDPGYFKNSFQEYLFVGSCMTTQ 60

Query: 62  LLNQAATTQTNPLFDVLSKDLNAKVSQQPWLMASFPLVSGSFILVSGKVGDIYGLKKTLL 121
           LLNQA T QT  + +VLS   N+  S Q WL+ASFPLV+GSFIL+SG++GDIYGLKKTL+
Sbjct: 61  LLNQATTPQTLSIMNVLSDSFNSSRSNQTWLVASFPLVAGSFILISGRIGDIYGLKKTLI 120

Query: 122 GGYVVVVIWSLICGLSSYAHNVDFFVVARSFQGLGIAFVLPNVMGIVGNIYKPNTEAKNL 181
           GGY+ ++IWSLICG + Y+ +  F ++AR+FQGLGIAF LPNV+G +GNIY   +  KN+
Sbjct: 121 GGYIFLIIWSLICGFTYYSKSDTFLIIARAFQGLGIAFTLPNVVGTIGNIYHVGSLRKNM 180

Query: 182 VFSLIGACAPIGATLGCVFSGLIGART-DLWGWTFYAYAITAALNGLVALWIIPNNIPTN 240
           V SLI A AP+GA +G  F+GLI   +   W W+FYA+AI  + N L++++ IP+NIPTN
Sbjct: 181 VISLIAASAPVGAAIGGAFAGLIVTESPSQWPWSFYAFAIACSFNLLISIYSIPSNIPTN 240

Query: 241 VNEYKMDWIGSAIGVFGLILFNFVWNQAPIAGWGSAYXXXXXXXXXXXXXXFITYEIRFA 300
           VN +KMDWIGSA+ V GLILFNF WNQ PI GW  AY              F+TYEI FA
Sbjct: 241 VNGFKMDWIGSALIVTGLILFNFAWNQGPIVGWDIAYIIVLLIISVIFILAFLTYEINFA 300

Query: 301 KQPLLPHSVLFNRKLMMILSSLFFGWGSFGIWTFYYMSFMLNLRHYSPLWAGGTYFMFAI 360
             PL+   +  +R +++ + +LF GWGS+GIW+FYY SF+LNLRHYSP+WAGG+YF+F I
Sbjct: 301 PSPLIAREITHSRNMIITIFTLFLGWGSYGIWSFYYFSFVLNLRHYSPVWAGGSYFIFGI 360

Query: 361 WGIVASLLVGYTIHKTGPAVILFLSMVAFDCGCIMLAVTPVHQTYFRMTLGIMIILSFGM 420
           +G++AS  VG +I K    VIL  SMV F  G  +L+V PV Q+YF++TL  M IL  G+
Sbjct: 361 FGVLASAFVGISIKKITAPVILLFSMVLFCVGTTLLSVAPVDQSYFKLTLAGMAILGVGL 420

Query: 421 DLSFPAASIILSDQLPSQYQGMAGSLVSTMISYSMSLCLGISGTAEHQVNKNGIDLLKGY 480
           D SFPAA+IILSD LP +YQGMAGSL  TM++YSMSLCLG+  T E Q+NK+G D+LKGY
Sbjct: 421 DTSFPAATIILSDGLPMEYQGMAGSLALTMVNYSMSLCLGMGNTVERQINKDGQDVLKGY 480

Query: 481 QAALY 485
           ++A Y
Sbjct: 481 RSAEY 485

>TBLA0C01160 Chr3 complement(246034..247836) [1803 bp, 600 aa] {ON} 
          Length = 600

 Score =  471 bits (1213), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 226/483 (46%), Positives = 324/483 (67%), Gaps = 1/483 (0%)

Query: 32  IGPKSRLQNPDYFDKPWKEYIFVLSSMLSQLLNQAATTQTNPLFDVLSKDLNAKVSQQPW 91
           I     L+ PD F   ++E+ FVL  ++ Q L+Q   TQ     ++L+++L+    +QPW
Sbjct: 104 ITESQNLRRPDIFKNRFQEFGFVLVGVIGQFLSQVGLTQVLSTMNILAEELHTTKMRQPW 163

Query: 92  LMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYVVVVIWSLICGLSSYAHNVDFFVVARS 151
           LMA+FPL  G  IL+SG++GDI+GLKK LL GY++  IW+LICG SSYAH+ D F+V+R+
Sbjct: 164 LMAAFPLGLGCTILISGRLGDIFGLKKVLLLGYIITTIWTLICGFSSYAHSDDLFIVSRT 223

Query: 152 FQGLGIAFVLPNVMGIVGNIYKPNTEAKNLVFSLIGACAPIGATLGCVFSGL-IGARTDL 210
           FQGLG+A  LPN+  ++G IYKP+   KN++F +IGA +PIGATLG +F+GL +      
Sbjct: 224 FQGLGLACALPNMFELIGIIYKPHCFKKNMIFCIIGAMSPIGATLGGIFAGLSVKYNIKN 283

Query: 211 WGWTFYAYAITAALNGLVALWIIPNNIPTNVNEYKMDWIGSAIGVFGLILFNFVWNQAPI 270
           W W+FY++AI A LNG++A + IPN+I  N    KMDWIGSA+G+FGL++ NFV+NQ PI
Sbjct: 284 WPWSFYSFAIVAFLNGIIAWFCIPNDIEKNPQGLKMDWIGSALGLFGLVVLNFVFNQTPI 343

Query: 271 AGWGSAYXXXXXXXXXXXXXXFITYEIRFAKQPLLPHSVLFNRKLMMILSSLFFGWGSFG 330
            GW SAY              F+ YE+  A  PL+P  +  N +L++IL +LF GWG F 
Sbjct: 344 DGWSSAYLIVLLVVSVVALILFVIYELTMANFPLIPKGIHSNYRLILILLTLFCGWGGFA 403

Query: 331 IWTFYYMSFMLNLRHYSPLWAGGTYFMFAIWGIVASLLVGYTIHKTGPAVILFLSMVAFD 390
           IWTFYY +F LNLRHYSPLWA  + F+  I G + +++    + +  P ++LF SM+ F 
Sbjct: 404 IWTFYYFAFQLNLRHYSPLWASSSNFVLIISGTIYTIICCLAVQRMKPPILLFFSMLGFL 463

Query: 391 CGCIMLAVTPVHQTYFRMTLGIMIILSFGMDLSFPAASIILSDQLPSQYQGMAGSLVSTM 450
            G I+ AVTP+HQT+FR   G M +   GM  SFP+AS++ ++ LP+ Y+ MAGSLV+  
Sbjct: 464 GGNILFAVTPIHQTFFRNMFGSMFLFPLGMVFSFPSASMMTAETLPTHYKSMAGSLVNVA 523

Query: 451 ISYSMSLCLGISGTAEHQVNKNGIDLLKGYQAALYVGIGLASLGVVISGAFMIEDWWTSR 510
           I+Y+ S+C+G++G+A    N +G DLL G++AA Y+ IGL+   V +SG +MI   WT R
Sbjct: 524 INYATSICVGMAGSANVNHNNHGQDLLHGFRAASYLAIGLSGFSVFLSGLYMIGSIWTDR 583

Query: 511 RKR 513
            ++
Sbjct: 584 NQK 586

>Smik_15.560 Chr15 (995453..997003) [1551 bp, 516 aa] {ON} YOR378W
           (REAL)
          Length = 516

 Score =  332 bits (852), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 197/519 (37%), Positives = 298/519 (57%), Gaps = 27/519 (5%)

Query: 3   MKENDDEENWEKLQSSSAA-GEERDGQTEAIGPKSRLQNPDYFDKPWKE-YIFVLSSMLS 60
           + E + + N E L+       +E D Q E   P+S L         W+  ++ VL S  +
Sbjct: 7   VTEENLDMNVETLKKDDEVLSDEFDVQEEK--PESLL---------WESAFVGVLCS--A 53

Query: 61  QLLNQAATTQT-NPLFDVLSKDLNAKVSQQPWLMASFPLVSGSFILVSGKVGDIYGLKKT 119
           QL+ QA   Q+  PL  +      A   Q  W  +++ L  G+FIL++G++GDI+G KK 
Sbjct: 54  QLMTQAGLGQSLAPLHIIGDSFGTANPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKF 113

Query: 120 LLGGYVVVVIWSLICGLSSYAHNVDFFVVARSFQGLGIAFVLPNVMGIVGNIYKPNTEAK 179
            + G+    +WSL+ G S Y++ + FF   R+FQG+G AF+LPN + I+G  YKP    K
Sbjct: 114 FVLGFFWYALWSLLAGFSVYSNQI-FFDCCRAFQGMGPAFLLPNAIAILGRTYKPGRR-K 171

Query: 180 NLVFSLIGACAPIGATLGCVFSGLIGARTDLWGWTFYAYAITAALNGLVALWIIPNNIPT 239
           N+VFSL GA AP G  LG VFS ++G +   W W ++   I   L  +   ++IP+    
Sbjct: 172 NMVFSLFGASAPGGFVLGAVFSSMLG-QLAWWPWAYWLMGIACFLLAVAGYYLIPHTPMP 230

Query: 240 N--VNEYKM----DWIGSAIGVFGLILFNFVWNQAPIAGWGSAYXXXXXXXXXXXXXXFI 293
           N  V  +K+    D+ GS  GV GLILFNF WNQ P+ GW + Y              F 
Sbjct: 231 NRDVASFKLLERIDFAGSVTGVVGLILFNFAWNQGPVVGWQTPYTYALLIVGTVFLIIFA 290

Query: 294 TYEIRFAKQPLLPHSVLFNRKLMMILSSLFFGWGSFGIWTFYYMSFMLNLRHYSPLWAGG 353
             E R A  PLLP + L +     +LS +  GW SFGIW FY   FM + R  +PL +  
Sbjct: 291 FIESR-AAFPLLPFAAL-SSDTAFVLSCIAAGWASFGIWIFYTWQFMEDSRGQTPLLSSA 348

Query: 354 TYFMFAIWGIVASLLVGYTIHKTGPAVILFLSMVAFDCGCIMLAVTPVHQTYFRMTLGIM 413
            +   AI G  A+L+ G+ +  T P+ ++F +M AF  G I++A  PVHQTY+  T   +
Sbjct: 349 QFSPVAISGFCAALMTGFLLSHTPPSTVMFFAMTAFTVGTILIATAPVHQTYWAQTFVSI 408

Query: 414 IILSFGMDLSFPAASIILSDQLPSQYQGMAGSLVSTMISYSMSLCLGISGTAEHQVNKNG 473
           I++ +GMD+SFPAA+I+LSD +P ++QG+A SLV+T+++YS+S+ LGI+GT E  VN  G
Sbjct: 409 IVMPWGMDMSFPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESNVNDGG 468

Query: 474 IDLLKGYQAALYVGIGLASLGVVISGAFMIEDWWTSRRK 512
            ++LKGY+ + Y+GIGL+  G+ ++  + +  +  S+++
Sbjct: 469 ANVLKGYRCSWYLGIGLSGFGIFVAATYAVSTFMKSKKR 507

>Skud_15.545 Chr15 (988549..990099) [1551 bp, 516 aa] {ON} YOR378W
           (REAL)
          Length = 516

 Score =  326 bits (835), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 197/522 (37%), Positives = 296/522 (56%), Gaps = 29/522 (5%)

Query: 3   MKENDDEENWEKLQSSSAAGEERDGQTEAIGPKSRLQNPDYFDKPWKEYIFVLSSMLSQL 62
           M+++ D       +      +E D Q E   P S L            ++ VL S  +QL
Sbjct: 8   MQKDFDTNTGTLKKDDEVVLDEFDIQDET--PGSLLWE--------TAFVGVLCS--AQL 55

Query: 63  LNQAATTQTNPLFDVLSKDL-NAKVSQQPWLMASFPLVSGSFILVSGKVGDIYGLKKTLL 121
           + QA   Q+     ++ K        Q  W  +++ L  G+FIL++G++GDI+G KK  +
Sbjct: 56  MTQAGLGQSLAPLHIIGKSFGTTNPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFV 115

Query: 122 GGYVVVVIWSLICGLSSYAHNVDFFVVARSFQGLGIAFVLPNVMGIVGNIYKPNTEAKNL 181
            G+    +WSL+ G S Y++ + FF   R+FQG+G AF+LPN + I+G  YK + + KN+
Sbjct: 116 LGFFWYALWSLLAGFSVYSNKI-FFDCCRAFQGMGPAFLLPNAIAILGRTYK-SGKRKNM 173

Query: 182 VFSLIGACAPIGATLGCVFSGLIGARTDLWGWTFYAYAITAALNGLVALWIIPNN-IPT- 239
           VFSL GACAP G  LG VFS L+G +   W W ++   I      +   +IIP+  +P+ 
Sbjct: 174 VFSLFGACAPGGFVLGAVFSSLLG-QLAWWPWAYWIMGIACFFLAIAGYFIIPHTAMPSR 232

Query: 240 NVNEYKM----DWIGSAIGVFGLILFNFVWNQAPIAGWGSAYXXXXXXXXXXXXXXFITY 295
           + + +K+    D+ GS  GV GLILFNF WNQ P+ GW + Y              F   
Sbjct: 233 HASSFKLLERVDFAGSVTGVIGLILFNFAWNQGPVVGWQTPYTYILLIVGTVFLAIFAFI 292

Query: 296 EIRFAKQPLLPHSVLFNRKLMMILSSLFFGWGSFGIWTFYYMSFMLNLRHYSPLWAGGTY 355
           E R A  PLLP + L +     +LS +  GW SFGIW FY   FM + R  +PL +   +
Sbjct: 293 ESR-AAFPLLPFAAL-SSDTAFVLSCIAAGWASFGIWIFYTWQFMEDSRGQTPLLSSAQF 350

Query: 356 FMFAIWGIVASLLVGYTIHKTGPAVILFLSMVAFDCGCIMLAVTPVHQTYFRMTLGIMII 415
              A+ G  A+L  GY + +T P+ ++  +M AF  G I++A  PVHQTY+  T   +I+
Sbjct: 351 SPVAVSGFCAALTTGYLLSRTPPSTVMLFAMTAFTAGTILIATAPVHQTYWAQTFVSIIV 410

Query: 416 LSFGMDLSFPAASIILSDQLPSQYQGMAGSLVSTMISYSMSLCLGISGTAEHQVNKNGID 475
           + +GMD+SFPAA+I+LSD +P ++QG+A SLV+T+++YS+S+ LGI+GT E  VN  G  
Sbjct: 411 MPWGMDMSFPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESNVNDGGAK 470

Query: 476 LLKGYQAALYVGIGLASLGVVISGAFMIEDWWTSR--RKRTT 515
            LKGY+ + Y+GIGL+ LG+ ++    I  W T +  +KRT+
Sbjct: 471 PLKGYRCSWYMGIGLSGLGIFVAA---IYAWSTFKKSKKRTS 509

>YOR378W Chr15 (1049511..1051058) [1548 bp, 515 aa] {ON} Putative
           paralog of ATR1, but not required for boron tolerance;
           member of the DHA2 family of drug:H+ antiporters;
           YOR378W is not an essential gene
          Length = 515

 Score =  325 bits (834), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 193/519 (37%), Positives = 298/519 (57%), Gaps = 26/519 (5%)

Query: 2   NMKENDDEENWEKLQSSSAAGEERDGQTEAIGPKSRLQNPDYFDKPWKE-YIFVLSSMLS 60
           ++ + + + N E L+       E D Q E   PKS L         W+  ++ VL S  +
Sbjct: 6   SVTQKNLDTNAEALKKEDKVLSEFDIQDER--PKSLL---------WESAFVGVLCS--A 52

Query: 61  QLLNQAATTQT-NPLFDVLSKDLNAKVSQQPWLMASFPLVSGSFILVSGKVGDIYGLKKT 119
           QL+ QA   Q+  PL  + +        Q  W  +++ L  G+FIL++G++GDI+G KK 
Sbjct: 53  QLMTQAGLGQSLAPLHIIGNSFGTTNAGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKF 112

Query: 120 LLGGYVVVVIWSLICGLSSYAHNVDFFVVARSFQGLGIAFVLPNVMGIVGNIYKPNTEAK 179
            + G+    +WSL+ G S Y++ + FF   R+FQG+G AF+LPN + I+G  YKP    K
Sbjct: 113 FVLGFFWYALWSLLAGFSVYSNQI-FFDCCRAFQGMGPAFLLPNAIAILGRTYKPGRR-K 170

Query: 180 NLVFSLIGACAPIGATLGCVFSGLIGARTDLWGWTFYAYAITAALNGLVALWIIPNN-IP 238
           N+VFSL GA AP G  LG VFS ++G +   W W ++   I   +  +   ++IP+  +P
Sbjct: 171 NMVFSLFGASAPGGFFLGAVFSSMLG-QLAWWPWAYWIMGIACFVLAVAGYFVIPHTPMP 229

Query: 239 T-NVNEYKM----DWIGSAIGVFGLILFNFVWNQAPIAGWGSAYXXXXXXXXXXXXXXFI 293
           + + + +K+    D+ GS  GV GLILFNF WNQ P+ GW + Y              F 
Sbjct: 230 SRDASSFKLLERIDFAGSVTGVVGLILFNFAWNQGPVVGWQTPYTYALLIVGTFFLVIFA 289

Query: 294 TYEIRFAKQPLLPHSVLFNRKLMMILSSLFFGWGSFGIWTFYYMSFMLNLRHYSPLWAGG 353
             E R A  PLLP + L +     +LS +  GW SFGIW FY   FM + R  +PL +  
Sbjct: 290 YIESR-AAFPLLPFAAL-SSDTAFVLSCIAAGWASFGIWIFYTWQFMEDSRGQTPLLSSA 347

Query: 354 TYFMFAIWGIVASLLVGYTIHKTGPAVILFLSMVAFDCGCIMLAVTPVHQTYFRMTLGIM 413
            +   AI G  A++  G+ +  T P+ ++  +M AF  G I++A  PVHQTY+  T   +
Sbjct: 348 QFSPVAISGFCAAVTTGFLLSHTPPSTVMLFAMTAFTVGTILIATAPVHQTYWAQTFVSI 407

Query: 414 IILSFGMDLSFPAASIILSDQLPSQYQGMAGSLVSTMISYSMSLCLGISGTAEHQVNKNG 473
           I++ +GMD+SFPAA+I+LSD +P ++QG+A SLV+T+++YS+S+ LGI+GT E +VN  G
Sbjct: 408 IVMPWGMDMSFPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESRVNDGG 467

Query: 474 IDLLKGYQAALYVGIGLASLGVVISGAFMIEDWWTSRRK 512
              LKGY+ + Y+GIGL+ LG+ ++  +    +  S+++
Sbjct: 468 AKPLKGYRCSWYMGIGLSGLGIFVAATYAWSTFMKSKKR 506

>Suva_8.435 Chr8 (786917..788464) [1548 bp, 515 aa] {ON} YOR378W
           (REAL)
          Length = 515

 Score =  321 bits (822), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 189/522 (36%), Positives = 292/522 (55%), Gaps = 21/522 (4%)

Query: 1   MNMKENDDEENWEKLQSSSAAGEERDGQTEAIGPKSRLQNPDYFDKPWKE-YIFVLSSML 59
           M  + +  ++N E       + E      E +  +  LQ+       W+  ++ VL S  
Sbjct: 1   MPRRPSVTQKNLET------SAETTKTDDEVLLNQFELQDETPGSLVWEAAFVGVLCS-- 52

Query: 60  SQLLNQAATTQT-NPLFDVLSKDLNAKVSQQPWLMASFPLVSGSFILVSGKVGDIYGLKK 118
           +QL+ QA   Q+  PL  +          Q  W  +S+ L  G+FIL++G++GDI+G +K
Sbjct: 53  AQLMTQAGLGQSIAPLHIIGDSFGTTNPGQLSWFASSYSLTVGTFILIAGRLGDIFGHRK 112

Query: 119 TLLGGYVVVVIWSLICGLSSYAHNVDFFVVARSFQGLGIAFVLPNVMGIVGNIYKPNTEA 178
             + G+    +WSL+ G S Y++ + FF   R+FQG+G AF+LPN + I+G  YKP    
Sbjct: 113 FFILGFFWYALWSLLAGFSVYSNKI-FFDCCRAFQGMGPAFLLPNAIAILGRTYKPGKR- 170

Query: 179 KNLVFSLIGACAPIGATLGCVFSGLIGARTDLWGWTFYAYAITAALNGLVALWIIPN--- 235
           KN+VFSL GA AP G  LG VFS ++G +   W W ++   I   L  +   ++IP+   
Sbjct: 171 KNMVFSLFGASAPGGFVLGAVFSSMLG-QLAWWPWAYWIMGIACFLLAVAGYFVIPHVQM 229

Query: 236 ---NIPTNVNEYKMDWIGSAIGVFGLILFNFVWNQAPIAGWGSAYXXXXXXXXXXXXXXF 292
              + P+     ++D+ GS  GV GLILFNF WNQ P+ GW + Y              F
Sbjct: 230 PSRDSPSFNMLERVDFAGSVTGVIGLILFNFAWNQGPVVGWETPYTYVLLIVGTVFLGVF 289

Query: 293 ITYEIRFAKQPLLPHSVLFNRKLMMILSSLFFGWGSFGIWTFYYMSFMLNLRHYSPLWAG 352
           +  E R A  PLLP + L +     +L  +  GW SFGIW FY   FM   R  SPL + 
Sbjct: 290 VFIESR-AAYPLLPFAAL-SSDAAFVLGCIAAGWSSFGIWIFYTWQFMEESRKQSPLLSS 347

Query: 353 GTYFMFAIWGIVASLLVGYTIHKTGPAVILFLSMVAFDCGCIMLAVTPVHQTYFRMTLGI 412
             +   AI G  A++  G+ +  T  + ++  +M AF  G I++A  PVHQTY+  T   
Sbjct: 348 AQFAPVAISGFCAAVTTGFLLSHTPASTVMLFAMTAFTVGIILIATAPVHQTYWAQTFVS 407

Query: 413 MIILSFGMDLSFPAASIILSDQLPSQYQGMAGSLVSTMISYSMSLCLGISGTAEHQVNKN 472
           +I++ +GMD+SFPAA+I+LS+ +P ++QG+A SLV+T+++YS+S+ LGI+GT E QVN  
Sbjct: 408 IIVMPWGMDMSFPAATIMLSNSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESQVNDG 467

Query: 473 GIDLLKGYQAALYVGIGLASLGVVISGAFMIEDWWTSRRKRT 514
           G + LKGY+ + Y+GIGL+ LG+ ++  +    +  S++K +
Sbjct: 468 GANALKGYRCSWYMGIGLSGLGIFVAAVYASSTFLKSKKKAS 509

>KLTH0C10560g Chr3 (875216..876763) [1548 bp, 515 aa] {ON} similar
           to uniprot|Q08902 Saccharomyces cerevisiae YOR378W
           Hypothetical ORF
          Length = 515

 Score =  316 bits (810), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 187/517 (36%), Positives = 283/517 (54%), Gaps = 16/517 (3%)

Query: 3   MKENDDEENWEKLQSSSAAGEERDGQTEAIGPKSRLQNPDYFDKPWKEYIFVLSSMLSQL 62
           M   D EEN +K    +       GQ  +    + +Q P+       E  FV     +QL
Sbjct: 1   MSFTDKEENQKKDDGLTRESTHDQGQELSQPHHNGIQKPESL---LGEAAFVGVICGAQL 57

Query: 63  LNQAATTQTNPLFDVLSKDLNAK-VSQQPWLMASFPLVSGSFILVSGKVGDIYGLKKTLL 121
           + QA   Q+     ++      +   Q  W  A++ L  G+FIL++G++GD+YG KK  +
Sbjct: 58  MTQAGLGQSIAPLHIIGDSFGTRNPGQLSWFAAAYSLTVGTFILIAGRLGDVYGHKKFFI 117

Query: 122 GGYVVVVIWSLICGLSSYAHNVDFFVVARSFQGLGIAFVLPNVMGIVGNIYKPNTEAKNL 181
            G+    +WSL+ G S Y++ + FF   R+FQG+G A +LPN + I+G  Y P    K +
Sbjct: 118 IGFFWYALWSLLAGFSVYSNQI-FFDCCRAFQGIGPALLLPNAIAILGRTYVPGRR-KAM 175

Query: 182 VFSLIGACAPIGATLGCVFSGLIGARTDLWGWTFYAYAITAALNGLVALWIIPN----NI 237
           + SL GA AP G  LG VFS + G  T  W W ++A  I      +  + +IP      +
Sbjct: 176 ILSLFGATAPAGFVLGAVFSSIFGQLT-WWPWAYWAMGIVCFFLAVAGILVIPRMPLPEL 234

Query: 238 PTNVNEY-KMDWIGSAIGVFGLILFNFVWNQAPIAGWGSAYXXXXXXXXXXXXXXFITYE 296
            T+V+ Y ++D  GS  GV GL+L NF WNQ P+ GW + Y              F   E
Sbjct: 235 DTSVSTYQRLDIPGSVTGVIGLVLLNFAWNQGPVVGWQTPYTYSLLIVSAVFLCVFAFIE 294

Query: 297 IRFAKQPLLPHSVLFNRKLMMILSSLFFGWGSFGIWTFYYMSFMLNLRHYSPLWAGGTYF 356
            R A  PLLP S L +     +L  +  GW SFGIW +Y+  F+  LR +SPL     + 
Sbjct: 295 SR-APHPLLPLSAL-SSDAAFVLGCVGAGWSSFGIWIYYFWLFLEELRGHSPLLTSAQFA 352

Query: 357 MFAIWGIVASLLVGYTIHKTGPAVILFLSMVAFDCGCIMLAVTPVHQTYFRMTLGIMIIL 416
             AI G+ A+L  G+ I +   ++++  +M AF  G I++A  PV Q Y+      +I++
Sbjct: 353 PVAISGLCAALTTGFVITRVRASLVMLFAMTAFTVGGILIATAPVKQVYWAQAFVSIIVM 412

Query: 417 SFGMDLSFPAASIILSDQLPSQYQGMAGSLVSTMISYSMSLCLGISGTAEHQVNKNGIDL 476
            +GMD+SFPAA+I+LSD +P ++QG+A SLV+ +++YS+S+ LG++GT E +VN  G +L
Sbjct: 413 PWGMDMSFPAATIMLSDSMPHEHQGLAASLVNVVVNYSISIGLGLAGTVEGRVNNGGANL 472

Query: 477 LKGYQAALYVGIGLASLGVVISGAFMIEDWWTSRRKR 513
           LKGY+ A Y+GIGL+  G++I  AFM E     + K+
Sbjct: 473 LKGYRGAWYMGIGLSGFGILI--AFMYEYHTFKKSKK 507

>KLLA0B00352g Chr2 (22476..23972) [1497 bp, 498 aa] {ON} highly
           similar to uniprot|Q08902 Saccharomyces cerevisiae
           YOR378W
          Length = 498

 Score =  310 bits (795), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 183/483 (37%), Positives = 283/483 (58%), Gaps = 13/483 (2%)

Query: 38  LQNPDYFDKPWKEYIFVLSSMLSQLLNQAATTQTNPLFDVLSKDLNAK-VSQQPWLMASF 96
           LQN   +    KE   ++    +QL+ QA   Q+     ++      K   Q  W  ++F
Sbjct: 17  LQNSREWTSLLKEGFAIMVLCSAQLMTQAGLAQSIVPLQIIGDSFGIKNPGQLSWFASAF 76

Query: 97  PLVSGSFILVSGKVGDIYGLKKTLLGGYVVVVIWSLICGLSSYAHNVDFFVVARSFQGLG 156
            L  G+FIL++G++GD +G KK  + G++   +WS++ G S Y++ + FF   R+FQG+G
Sbjct: 77  SLTVGTFILIAGRLGDTFGHKKFFVMGFLWYALWSILAGFSVYSNQI-FFDCCRAFQGIG 135

Query: 157 IAFVLPNVMGIVGNIYKPNTEAKNLVFSLIGACAPIGATLGCVFSGLIGARTDLWGWTFY 216
            AF LPN + I+   Y+P  + +N++FSL GACAP G  +G VFS L+ +    W W ++
Sbjct: 136 PAFTLPNAIAIIARTYRPGRK-QNMIFSLFGACAPSGFVVGAVFSSLL-SEFAWWPWAYW 193

Query: 217 AYAITAALNGLVALWIIPNNIPTNVNEY-----KMDWIGSAIGVFGLILFNFVWNQAPIA 271
              IT  L G+    +IP++ P + +E      ++D  GS  GV GLILFNF WNQ P+ 
Sbjct: 194 IMGITCFLLGVAGYLVIPHHPPIHPDEKCSLVERIDVAGSVTGVVGLILFNFAWNQGPVV 253

Query: 272 GWGSAYXXXXXXXXXXXXXXFITYEIRFAKQPLLPHSVLFNRKLMMILSSLFFGWGSFGI 331
           GW ++Y              F   E R AK PLLP   L +   + ++  +  GW SFGI
Sbjct: 254 GWETSYTYALLIVGSAFLAAFGFIESR-AKHPLLPVRKL-SSDTIFVMGCIAAGWSSFGI 311

Query: 332 WTFYYMSFMLNLRHYSPLWAGGTYFMFAIWGIVASLLVGYTIHKTGPAVILFLSMVAFDC 391
           W +Y    M NLR   PL +   +   AI G+ A++   + + +T P+ ++ ++M+AF  
Sbjct: 312 WVYYTWQLMANLRDQPPLLSSAQFVPVAISGLCAAMSTEFLLTRTSPSTVMIIAMIAFTV 371

Query: 392 GCIMLAVTPVHQTYFRMTLGIMIILSFGMDLSFPAASIILSDQLPSQYQGMAGSLVSTMI 451
           G I++A  PV QTY+  T   +I++ +GMD+SFPAA+IILS  +P+ +QG+A SLV+T+I
Sbjct: 372 GSILVATVPVSQTYWAQTFVSIIVMPWGMDMSFPAATIILSTAMPASHQGLAASLVNTII 431

Query: 452 SYSMSLCLGISGTAEHQVNKNGIDLLKGYQAALYVGIGLASLGVVISGAFMIEDWWTSRR 511
           +YS+S+ LG +GT E Q++    DLLKGY+ A Y+GIGLA LG+ ++ ++ I  +  SR 
Sbjct: 432 NYSISIGLGFAGTIESQISDGEDDLLKGYRGAYYMGIGLAGLGLGVAISYAIFHY--SRL 489

Query: 512 KRT 514
           KR+
Sbjct: 490 KRS 492

>Kwal_23.6547 s23 (1635677..1637212) [1536 bp, 511 aa] {ON} YOR378W
           - Hypothetical ORF [contig 358] FULL
          Length = 511

 Score =  303 bits (777), Expect = 8e-97,   Method: Compositional matrix adjust.
 Identities = 173/511 (33%), Positives = 288/511 (56%), Gaps = 18/511 (3%)

Query: 9   EENWEKLQSSSAAGEERDGQTEAIGPKSRLQNPDYFDKPWKEYIFVLSSMLSQLLNQAAT 68
           +   E L++     +  +G++  +  +S ++ P    +   E +FV     +QL+ QA  
Sbjct: 2   DAELESLEAQFVELKNEEGESLQL-VQSHVEKPQSLMR---EALFVGILSCAQLMTQAGL 57

Query: 69  TQTNPLFDVLSKDLN-AKVSQQPWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYVVV 127
            Q+     ++      +   Q  W  A++ L  G+FIL++G++GD++G KK  + G++  
Sbjct: 58  AQSIAPVRIIGNSFGISNPGQLSWFSAAYSLTVGTFILIAGRLGDLFGHKKLFVVGFLWY 117

Query: 128 VIWSLICGLSSYAHNVDFFVVARSFQGLGIAFVLPNVMGIVGNIYKPNTEAKNLVFSLIG 187
            +WSL+ G S Y++ + FF   R+ QG+G AF+LPN + I+G  Y P    K +VFS+ G
Sbjct: 118 SLWSLLAGFSVYSNQI-FFDCCRALQGIGPAFLLPNSIAILGRTYTPGKR-KQMVFSIFG 175

Query: 188 ACAPIGATLGCVFSGLIGARTDLWGWTFYAYAITAALNGLVALWIIPNNIPTNVN----- 242
           A AP G  LG VFS +  ++   W W ++A      + G+  + +IP   P  ++     
Sbjct: 176 ATAPGGFVLGSVFSSIF-SQLAWWPWAYWAMGTACLVLGVAGIIVIPQAPPPKIDISAGI 234

Query: 243 EYKMDWIGSAIGVFGLILFNFVWNQAPIAGWGSAYXXXXXXXXXXXXXXFITYEIRFAKQ 302
             ++D  G+  G+ GL L NF WNQ P+ GW + Y              F   E R A+ 
Sbjct: 235 LERIDAAGATTGILGLALVNFAWNQGPVVGWQTPYTYALLIVGFVFLLVFSLIESR-ARF 293

Query: 303 PLLPHSVLFNRKLMMILSSLFFGWGSFGIWTFYYMSFMLNLRHYSPLWAGGTYFMFAIWG 362
           PLLP + L +  L  +L  +  GW SFGIW FY+  F+ + R  SPL     +   AI G
Sbjct: 294 PLLPFAAL-STDLAYVLGCIAAGWSSFGIWIFYFWQFLEDSRSQSPLLTSAQFVPVAISG 352

Query: 363 IVASLLVGYTIHKTGPAVILFLSMVAFDCGCIMLAVTPVHQTYFRMTLGIMIILSFGMDL 422
           + A+L  GY +       ++ ++M+AF  G +++A  P++QTY+  T   +II+ +GMD+
Sbjct: 353 LCAALTTGYILSHVPACAVMLIAMIAFTVGGVLVATAPINQTYWAQTFVSLIIMPWGMDM 412

Query: 423 SFPAASIILSDQLPSQYQGMAGSLVSTMISYSMSLCLGISGTAEHQVNKNGIDLLKGYQA 482
           SFPAA+I++S+ +P ++QG+A SLV+T+++YS+SL LG +GT E +VN  G + L+GY+ 
Sbjct: 413 SFPAATIMISNAMPHEHQGLAASLVNTVVNYSISLALGFAGTIETRVNNKGANRLEGYRG 472

Query: 483 ALYVGIGLASLGVVISGAFMIEDWWTSRRKR 513
           A Y+GIGL+ LGV+++   ++  W T ++ +
Sbjct: 473 AWYMGIGLSGLGVLVA---IVYAWSTLKKFK 500

>TDEL0G04950 Chr7 complement(922428..923966) [1539 bp, 512 aa] {ON} 
          Length = 512

 Score =  299 bits (765), Expect = 7e-95,   Method: Compositional matrix adjust.
 Identities = 179/504 (35%), Positives = 299/504 (59%), Gaps = 19/504 (3%)

Query: 4   KENDDEENW----EKLQSSSAAGEERDGQTEAIGPKSRLQNPDYFDKPWKEYIFVLSSML 59
           K++D E+ +    E  + S +  +E     EA    S L++ + F    KEY FV + ++
Sbjct: 3   KKHDKEDQYVFFSECTERSISCNQESS--KEAYDRCSWLKSSN-FHFLCKEYAFVFTGVM 59

Query: 60  SQLLNQAATTQTNPLFDVLSKDLNAKVSQQPWLMASFPLVSGSFILVSGKVGDIYGLKKT 119
           +Q  NQA  T   PL +VLS   + K     +L+ S+P+V GSF+L+ G++G+++G K+T
Sbjct: 60  AQAFNQAGGTMILPLVNVLSDSFHGK-----FLLNSYPMVCGSFMLIGGRLGEVHGYKET 114

Query: 120 LLGGYVVVVIWSLICGLSSYAHNVDFFVVARSFQGLGIAFVLPNVMGIVGNIYKPNTEA- 178
           LLGGY+++++ SL+ GLS Y+ +  F+V+ R+FQG+G+A +LPN        Y+   +A 
Sbjct: 115 LLGGYIILILSSLLGGLSRYSKSSIFYVICRAFQGVGMALILPNFSAAYDYRYQSQAKAH 174

Query: 179 -KNLVFSLIGACAPIGATLGCVFSGLIGARTDL-WGWTFYAYAITAALNGLVALWIIPNN 236
            K ++ ++IG  A  GA LG   SG+   R++  W W +Y Y I A L   ++ + +P+N
Sbjct: 175 RKTILSTIIGCGASTGAFLGTFLSGICVTRSESNWSWAYYTYTIAATLTLALSYYSVPDN 234

Query: 237 IPTNVNEYKMDWIG-SAIGVFGLILFNFVWNQAPIAGWGSAYXXXXXXXXXXXXXXFITY 295
           I T  N+  ++ +G  +    GL++ N   N A +A    ++              F+ +
Sbjct: 235 I-TKKNKPCLNGLGWFSNRSCGLLMLNVACNLAAVASSNWSHIIVLLVVFVCLLLLFLVF 293

Query: 296 EIRFAKQPLLPHSVLFNRKLMMILSSLFFGWGSFGIWTFYYMSFMLNLRHYSPLWAGGTY 355
           E++F++ P+    +  N  + ++L+S+FFGWG++GIW+ Y+  F+LNLR+YSPL AG TY
Sbjct: 294 ELKFSEDPVFSKELFTNASVSLVLASIFFGWGTYGIWSGYFFRFLLNLRNYSPLAAGSTY 353

Query: 356 FMFAIWGIVASLLVGYTIHKTGPAVILFLSMVAFDCGCIMLAVTPVHQTYFRMTLGIMII 415
               I G VA + +   + +TGP + L  S + F C  I+L+VTP+HQ+YFR TLG MI 
Sbjct: 354 LTLVIGGYVAEIGISMLVKRTGPKLFLLFSSLGFTCSIIILSVTPIHQSYFRSTLGSMIF 413

Query: 416 LSFGMDLSFPAASIILSDQLPSQYQGMAGSLVSTMISYSMSLCLGISGTAEHQVNKNGID 475
           L+ G+D SFP+++IIL ++LPS+Y  M   L + + +Y++S   GI  +A   ++   I+
Sbjct: 414 LALGLDFSFPSSAIILQNELPSKYHEMTAVLTNGIFNYAISFWPGICNSALRSLSS--IE 471

Query: 476 LLKGYQAALYVGIGLASLGVVISG 499
           L+K Y+   Y  IGL+++G+  +G
Sbjct: 472 LIKYYRYVYYFAIGLSAIGLFAAG 495

>KNAG0D00130 Chr4 complement(6264..7961) [1698 bp, 565 aa] {ON}
           YOR378W
          Length = 565

 Score =  214 bits (545), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 148/504 (29%), Positives = 245/504 (48%), Gaps = 21/504 (4%)

Query: 5   ENDDEENWEKLQSSSAAGEERDGQTEAIGPKSRLQNPDYFDKPWKEYIFVLSSMLSQLLN 64
             D ++N   +  S+ A EE D       P    +          E IFVL    SQ+L 
Sbjct: 40  RRDSDDNVSDINKSAPAPEEHD-------PPCTGEEATLNMSLLHEIIFVLLVSSSQVLG 92

Query: 65  QAATTQTNPLFDVLSKDLN-AKVSQQPWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGG 123
            A   Q  P  DV+ +       S   W    +    GSF+L++GK+GD+ G K   L G
Sbjct: 93  LAGAVQGIPQMDVIVEWFKLTHPSDSGWCNGGYATTYGSFVLIAGKMGDMNGHKSMFLIG 152

Query: 124 YVVVVIWSLICGLSSYAHNVDFFVVARSFQGLGIAFVLPNVMGIVGNIYKPNTEAKNLVF 183
           Y  + +WSL+ G S Y  +  FF   R+ QG+G AF   + + I+G  Y P  + KN +F
Sbjct: 153 YAWLALWSLLTGFSRYCPSSHFFFFCRAAQGIGAAFTFTSALSILGKSYPP-CKRKNFIF 211

Query: 184 SLIGACAPIGATLGCVFSGLIGARTDLWGWTFYAYAITAALNGLVALWIIPNNI---PTN 240
           S  GAC   G  LG VFS L   +   W W +++ AI   +  +++++ IP ++      
Sbjct: 212 SFFGACGSFGVVLGMVFSALF-TQLAHWSWAYWSMAIACVVIIILSIFFIPGDVVEKHET 270

Query: 241 VNEYKMDWIGSAIGVFGLILFNFVWNQAPIAGWGSAYXXXXXXXXXXXXXXFITYEIRFA 300
            N +  D++G+ + V GL+LF+  WNQAP  G+G  Y               +  E +  
Sbjct: 271 SNVFYFDYLGAFLFVTGLVLFSVAWNQAPTYGFGRTYVYVLLIVSVVILALAMYVETK-V 329

Query: 301 KQPLLPHSVLFNRKLMMILSSLFFGWGSFGIWTFYYMSFMLNLRHYSPLWAGGTYFMFAI 360
             PLLP + +    L ++L ++FF + SF +W  Y   F L  +  + L A       A+
Sbjct: 330 DDPLLPWTHISANTLKVLL-AIFFAYASFTMWAAYTFRFNLMAKGDTLLLAAAKMTPMAV 388

Query: 361 WGIVASLLVGYTIH-KTGPAVILFLSMVAFDCGCIMLAVTPVHQTYFRMTLGIMIILSFG 419
            G+ A+L     ++      + + +S++AF    I++A     QTY+       I++SFG
Sbjct: 389 SGVFAALFSALLLNIHVQVQIRMLISLLAFLVPPILMATMGAGQTYWGEVFVTTIVISFG 448

Query: 420 MDLSFPAASIILSDQLPSQYQGMAGSLVSTMISYSMSLCLGISGTA-EHQ----VNKNGI 474
           +D+SFP+A+++LS+++P +++G+  SLV  +++Y+ +L    + +   +Q    +   G 
Sbjct: 449 LDISFPSATLLLSNRIPDKFKGLGASLVGAVLNYATALGPPTAASVLRYQCPDCMAHKGN 508

Query: 475 DLLKGYQAALYVGIGLASLGVVIS 498
              K      YVGIG A LG +++
Sbjct: 509 AFTKTINIIGYVGIGTAGLGTLVA 532

>KAFR0C04860 Chr3 (964552..966156) [1605 bp, 534 aa] {ON}  YOR378W
          Length = 534

 Score =  189 bits (480), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 146/518 (28%), Positives = 252/518 (48%), Gaps = 20/518 (3%)

Query: 9   EENWEKLQSSSAAGEERDGQTEAIGPKSRL---QNPDYFDKPWKEYIFVLSSMLSQLLNQ 65
            E+ E L SS     E     + +   + +    +    +  +KE I VL     Q ++ 
Sbjct: 4   HESEETLTSSKLQPHEPTSPVKVVPSHNEILSKTDEHPLNMQFKEIIIVLLISSGQFISL 63

Query: 66  AATTQTNPLFDVLSKDLNAKVSQQ---PWLMASFPLVSGSFILVSGKVGDIYGLKKTLLG 122
               Q  P    ++   + +  Q     W  A++   + +F++++GK+GDI G K   + 
Sbjct: 64  LGAVQGIPQMASIASTFSLRPDQNLELGWCNAAYATTATTFVIIAGKLGDINGHKNMFIF 123

Query: 123 GYVVVVIWSLICGLSSYAH-NVDFFVVARSFQGLGIAFVLPNVMGIVGNIYKPNTEAKNL 181
           GY  + +WSL+ G S YA  N  FF   R  QG+G AF+ P  + ++G  Y P  + KN 
Sbjct: 124 GYAWLTLWSLLTGFSKYAKANAVFFYFCRGAQGIGSAFLTPTGLALLGKHYPP-CKRKNY 182

Query: 182 VFSLIGACAPIGATLGCVFSGLIGARTDLWGWTFYAYAITAALNGLVALWIIP-NNIPTN 240
           VFS  GAC P G   G VFS L    T  W WT+++ A+T  +  +++   IP +N P  
Sbjct: 183 VFSFYGACGPFGIVAGSVFSALFTQLTT-WAWTYWSMAVTCLIITILSYIFIPKDNTPKR 241

Query: 241 VNE--YKMDWIGSAIGVFGLILFNFVWNQAPIAGWGSAYXXXXXXXXXXXXXXFITYEIR 298
                Y  D++G   G+ G+ILF+ VWNQAP++ + + Y               +  + R
Sbjct: 242 ERSAFYSFDYVGGFCGITGMILFSVVWNQAPLSHFKAPYVYSLLIVSVVFMTMALIIDSR 301

Query: 299 FAKQPLLPHSVLFNRKLMMILSSLFFGWGSFGIWTFYYMSFMLNLRHYSPLWAGGTYFMF 358
             K PL+P   + +  ++  L  +FFG+  F IW FY   F L  ++ S L A   +   
Sbjct: 302 -VKDPLIPWKSMCS-NVIKALIVVFFGFLGFTIWLFYSWRFYLVAKNDSLLLAAAKFIPL 359

Query: 359 AIWGIVASLLVGYTIHKTGPAVILFLSMV-AFDCGCIMLAVTPVHQTYFRMTLGIMIILS 417
            I GI A+      ++K  P  +  L+ V AF    I+++   + +TY+       +I++
Sbjct: 360 GISGIFAACFSVLLLNKKVPVQLRLLTAVCAFLICAILISTMTLQETYWGNAFVATVIIA 419

Query: 418 FGMDLSFPAASIILSDQLPSQYQGMAGSLVSTMISYSMSLCLG-----ISGTAEHQVNKN 472
            G+D++FP+A+++LS+ + ++ QG+A +L +T ++Y  +L  G     I+   +  + ++
Sbjct: 420 IGLDVAFPSATLLLSNGVLNEQQGLAAALAATALNYGTALGPGVATLIITYQCDDCLARS 479

Query: 473 GIDLLKGYQAALYVGIGLASLGVVISGAFMIEDWWTSR 510
               +     A YV IG A + VV++    I +++  R
Sbjct: 480 DGRFVHAVHIAGYVAIGTAGIAVVVAIFGSITEYYKER 517

>SAKL0C06116g Chr3 complement(571813..572370) [558 bp, 185 aa] {ON}
           some similarities with uniprot|P13090 Saccharomyces
           cerevisiae YML116W ATR1 Multidrug efflux pump of the
           major facilitator superfamily required for resistance to
           aminotriazole and 4-nitroquinoline-N-oxide
          Length = 185

 Score =  177 bits (449), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 95/189 (50%), Positives = 117/189 (61%), Gaps = 33/189 (17%)

Query: 58  MLSQLLNQAATTQTNPLFDVLSKDLNAKVSQQPWLMASFPLVSGSFILVSGKVGDIYGLK 117
           M+SQLLNQ  TTQT PL +VLS+   +  ++Q  L+AS PLVSGSFILVSGKVGDIYGLK
Sbjct: 1   MMSQLLNQVGTTQTLPLINVLSRGFESSTAEQTRLVASIPLVSGSFILVSGKVGDIYGLK 60

Query: 118 KTLLGGYVVVVIWSLICGLSSYAHNVDFFVVARSFQGLGIAFVLPNVMGIVGNIYKPNTE 177
            TLL GY  V++WS ICGL+ YA +V FFV+AR+FQGLG+AFVLPNVMG V N+Y   + 
Sbjct: 61  NTLLFGYATVIVWSFICGLTRYAGSVQFFVIARAFQGLGLAFVLPNVMGTVSNVYIAGSI 120

Query: 178 AKNLVFSLIGACAPIGATLGCVFSGLIGARTDLWGWTFYAYAITAALNGLVALWIIPNNI 237
            KN+V                                 YAY +  +LN  + +W +P NI
Sbjct: 121 RKNMV---------------------------------YAYTVAVSLNMALCVWALPWNI 147

Query: 238 PTNVNEYKM 246
           PTNV    M
Sbjct: 148 PTNVRGQAM 156

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 20/44 (45%), Positives = 28/44 (63%), Gaps = 6/44 (13%)

Query: 434 QLPSQYQGMAGSLVSTMISYSMSLCLGISGTAEHQVNKNGIDLL 477
            +P+  +G A      M+ YSM +CLGI+GT EH+V+K G D L
Sbjct: 146 NIPTNVRGQA------MLGYSMPMCLGIAGTVEHRVHKGGADRL 183

>CAGL0L02519g Chr12 complement(297555..299144) [1590 bp, 529 aa]
           {ON} similar to uniprot|Q08902 Saccharomyces cerevisiae
           YOR378w
          Length = 529

 Score =  168 bits (426), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 142/483 (29%), Positives = 231/483 (47%), Gaps = 23/483 (4%)

Query: 46  KPWKEYIFVLSSMLS-QLLNQAATTQTNPLFDVLSKDLN---AKVSQQPWLMASFPLVSG 101
           K W   IF++  ++S QL+      Q  P+   L +      AK     W  AS+ L S 
Sbjct: 33  KTWIREIFLVIILISSQLVTLIGAVQGVPIAAYLRERYRIEPAKGGLVGWANASYMLGSA 92

Query: 102 SFILVSGKVGDIYGLKKTLLGGYVVVVIWSLICGLSSYAH-NVDFFVVARSFQGLGIAFV 160
             +L++GK+GD+ G K+ ++ G++ + IWSLI G S Y   N  F+  AR+ QG+G  F+
Sbjct: 93  VMVLIAGKLGDLNGHKRMVVFGWIWLTIWSLITGFSYYDRGNQAFYYTARALQGIGSGFI 152

Query: 161 LPNVMGIVGNIYKPNTEAKNLVFSLIGACAPIGATLGCVFSGLIGARTDLWGWTFYAYAI 220
           +PN + I+G  Y      K ++FS+ G     G  +G  FS L    T  W W ++A A 
Sbjct: 153 VPNSLAIMGRTYFEPGLKKTIIFSIFGMMTSTGFVIGTTFSSLFAQLTK-WAWNYWALAC 211

Query: 221 TAALNGLVA-LWIIPNNI---PTNVNEYK-MDWIGSAIGVFGLILFNFVWNQAPIAGWGS 275
              L  + A L+I P+NI   P +   YK  D++G+  GV GL+LF+  + QA   GW  
Sbjct: 212 VCVLYTVGAILFIPPDNIVHKPNSKPLYKRFDYLGAITGVSGLVLFDVAFTQASALGWSP 271

Query: 276 --AYXXXXXXXXXXXXXXFITYEIRFAKQPLLPHSVLFNRKLMMILSSLFFGWGSFGIWT 333
              Y              F+ + +     PL+P   L    +++IL  ++FG+ SF IW 
Sbjct: 272 PHTYITLIIGVILILIAMFVDWRV---DDPLVPLQHL-RADVVVILICVYFGFLSFVIWA 327

Query: 334 FYYMSFMLNLRHYSPLWAGGTYFMFAIWGIVASLLVGYTIHKTGPA-VILFLSMVAFDCG 392
            ++  F   + + SPL         AI  I A++     +     A  ++ +SMV F   
Sbjct: 328 NWFWQFYELVHNDSPLRIAAKLVPLAIGSIPAAIFTVTCLQLNIKAPTMMVISMVCFLVP 387

Query: 393 CIMLAVTPVHQTYFRMTLGIMIILSFGMDLSFPAASIILSDQLPSQYQGMAGSLVSTMIS 452
            I++A    + TY+       II  F +D++ P A+++ SD +  + QG+A SL+ T+IS
Sbjct: 388 NILMATVTPNTTYWAQPFVSSIIAPFAVDITVPTATLLFSDSVRKESQGIAASLIITVIS 447

Query: 453 YSMSLCLGISGTAEHQVNKNGIDLLKG-----YQAALYVGIGLASLGVVISGAFMIEDWW 507
           Y++S+    +      V   G D   G       +    GI L+ +G+V +    + D+ 
Sbjct: 448 YAISIGPSYTAMVMWYVAPLGNDSTPGGFTHSLHSNFICGIVLSGIGLVTAVIAGLIDYK 507

Query: 508 TSR 510
            +R
Sbjct: 508 ITR 510

>NCAS0A05720 Chr1 (1117491..1119182) [1692 bp, 563 aa] {ON} 
          Length = 563

 Score =  162 bits (411), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 142/521 (27%), Positives = 244/521 (46%), Gaps = 39/521 (7%)

Query: 2   NMKENDDEENWEKLQSSSAAGEERDGQTEAIGPK---SRLQNPDYFDKPWKEYIFVLSSM 58
           N   +       K Q S+    +   Q E++ P    SRL          +E +F++   
Sbjct: 30  NSTASSLHSQRTKEQCSNLQPAQAQDQLESMNPPPGPSRL----------RECMFIVIIA 79

Query: 59  LSQLLNQAATTQTNPLFDVLSK--DLNAKVSQQP-WLMASFPLVSGSFILVSGKVGDIYG 115
            SQ ++ AA +Q     D ++    L A  S +  W  A+F +  G+FI+ +GK+ D+ G
Sbjct: 80  SSQFISLAAASQAILQMDAITAWFQLPADRSLEAGWANAAFAITCGTFIIPAGKLCDLIG 139

Query: 116 LKKTLLGGYVVVVIWSLICGLSSYAH--NVDFFVVARSFQGLGIAFVLPNVMGIVGNIYK 173
            K   + GY    +WSL+ G+S YA      FF   R  QG+G A + P+ + ++G  Y 
Sbjct: 140 SKTVFIFGYAWYTLWSLLVGISRYAPKGQATFFFFGRGCQGIGAAALFPSSLALLGKYYP 199

Query: 174 PNTEAKNLVFSLIGACAPIGATLGCVFSGLIGARTDLWGWTFYAYAITAALNGLVALWII 233
           P+ + KN+VFSL G C P+G  +G VFS  I  +   W W +++ AI +A   L++ + I
Sbjct: 200 PSCK-KNIVFSLYGFCVPLGVVVGGVFSA-IFTQLAHWSWNYWSMAIVSAFFTLISCFYI 257

Query: 234 PNNIPTNVNEY----------KMDWIGSAIGVFGLILFNFVWNQAPIAGWGSAYXXXXXX 283
           P +      E           K D++G+ + V  L+LF   WNQA    + S        
Sbjct: 258 PPDEIIKSEEQKKKRAWFHLPKFDYLGTFLYVASLLLFAVCWNQATGFKFKSVQVYVTLI 317

Query: 284 XXXXXXXXFITYEIRFAKQPLLPHSVLFNRKLMMILSSLFFGWGSFGIWTFYYMSFMLNL 343
                    +  E  +   P++P   +  + +  +L  +FF + SF IW FY   +   +
Sbjct: 318 VSLVCFVAMVIVEF-YVDDPIIPARKIHPQTIKALL-VVFFSYLSFTIWLFYLWKYFTVV 375

Query: 344 RHYSPLWAGGTYFMFAIWGIVASLLVGYTIHKTGPAVILFLS-MVAFDCGCIMLAVTPVH 402
           R+ + L     +   +I G +A+L     I    P  I  L+   +F    I+       
Sbjct: 376 RNDTVLLGAAKFVPLSIAGFIAALFSILLISTAVPVQIRLLAGACSFLLAHILFITLSRT 435

Query: 403 QTYFRMTLGIMIILSFGMDLSFPAASIILSDQLPSQYQGMAGSLVSTMISYSMSLCLGIS 462
           ++Y+      +II+S G+D+SFP+A+++LS+ +P + +G++ +LV T ++Y   +   I+
Sbjct: 436 ESYWARPFLTIIIISIGLDISFPSATLLLSNGVPQELRGISAALVGTALNYGTGIGPPIA 495

Query: 463 GT-AEHQVNK-----NGIDLLKGYQAALYVGIGLASLGVVI 497
            T   +Q +K     +    +K    A  VGIG + + VV+
Sbjct: 496 QTIIGYQCDKCMASGDMDQFVKAIHIAAAVGIGASGIAVVV 536

>NDAI0K02730 Chr11 complement(612590..614404) [1815 bp, 604 aa] {ON}
           
          Length = 604

 Score =  147 bits (371), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 134/545 (24%), Positives = 243/545 (44%), Gaps = 77/545 (14%)

Query: 25  RDGQTEAIGPKS-----RLQNPDYFDKPWKEYIFVLSSMLSQLLNQAATTQTNPLFDVLS 79
           +D Q+  +   S     +LQ+P   +    + IF+     SQ +  A+ +Q     D LS
Sbjct: 43  QDQQSHKVTHSSLIRLQKLQSPT--NSYLNDIIFIFLICSSQFITLASASQAILQMDSLS 100

Query: 80  ---KDLNAKVSQQPWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYVVVVIWSLICGL 136
              K       Q  W+ ASF +  G+FI+++GK+ DI   +   + GYV   +W+LI G 
Sbjct: 101 VWFKIPPTSTLQLGWVNASFAMTCGAFIILAGKLCDILNPRIIFISGYVWFSLWTLITGF 160

Query: 137 SSYA-HNVDFFVVARSFQGLGIAFVLPNVMGIVGNIY--------------------KPN 175
           +SY   N+ F  + R  QG+G A + P+ + ++   Y                     P+
Sbjct: 161 ASYVPKNMIFLYICRGCQGIGGALLFPSALILLNQYYTVPEPSPSQSQSKSPTTSAPSPS 220

Query: 176 TE--------------------------AKNLVFSLIGACAPIGATLGCVFSGLIGARTD 209
            +                          +K++ FSL GACAP+G  +G +FS  I  +  
Sbjct: 221 HDIEKNLSSDDDNDGDSSIADDSDIICTSKSIAFSLYGACAPLGIVIGGIFSA-IFTQLA 279

Query: 210 LWGWTFYAYAITAALNGLVALWIIPNNIP-----TNVNEYK----MDWIGSAIGVFGLIL 260
            W W +++ +I   L  +++ + +   IP     +N N  K     D++G  +G+  LIL
Sbjct: 280 TWPWNYWSMSIVTTLLSILSYFYVVVPIPVEKLDSNPNSLKNWKNFDFLGVILGISALIL 339

Query: 261 FNFVWNQAPIAGWGSAYXXXXXXXXXXXXXXFITYEIRFAKQPLLPHSVLFNRKLMMILS 320
           F   W+QA +  + + +               I +E  F   P++P   +    +  +L 
Sbjct: 340 FGVSWDQATMYKFKTIHVYLTLLFSLVSFIAMIIWEYYF-NNPIIPIRQIHPGTIKALLV 398

Query: 321 SLFFGWGSFGIWTFYYMSFMLNLRHYSPLWAGGTYFMFAIWGIVASLLVGYTIHKTGPAV 380
            +FF + SF  W FY       ++  SP+     +   ++ GI+++      I K  P  
Sbjct: 399 -VFFSYISFTQWLFYTWKLFTEVKDNSPILGSVKFIPLSVAGIISATFSILLIVKRVPVQ 457

Query: 381 ILFLS-MVAFDCGCIMLAVTPVHQTYFRMTLGIMIILSFGMDLSFPAASIILSDQLPSQY 439
           I  L+   +F    I+L    +  +Y+      +I +S G+D+SFP+A+++L++ +P + 
Sbjct: 458 IRLLAGASSFLLSHILLLTCKLDSSYWTYQFFSIISISIGLDISFPSATLLLTNGIPPEI 517

Query: 440 QGMAGSLVSTMISYSMSLCLGISGT-AEHQVNKNGID------LLKGYQAALYVGIGLAS 492
           QG+  +LV ++++Y  ++   I+ T  ++Q      D       LKG   A  VG+G + 
Sbjct: 518 QGICAALVGSVLNYGTAIGPPIAQTIIQYQCESCMSDPHDKKAFLKGIHIAGAVGVGCSG 577

Query: 493 LGVVI 497
           + V+I
Sbjct: 578 IAVLI 582

>Smik_6.24 Chr6 (39520..41154) [1635 bp, 544 aa] {ON} YMR279C (REAL)
          Length = 544

 Score = 57.8 bits (138), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 107/488 (21%), Positives = 183/488 (37%), Gaps = 54/488 (11%)

Query: 61  QLLNQAATTQTNPLFDVLSKDLNAKVSQQPWLMASFPLVSGSFILVSGKVGDIYGLKKTL 120
            LLN A+      L D L+K  N   +   W + S+ +    FI   G++GDI G     
Sbjct: 41  DLLNVASMIS---LIDDLAKKYNISYTTASWSLTSYAVTFAGFIACMGRLGDIVGNSVLF 97

Query: 121 LGGYVVVVIWSLICGLSSYAHNVDFFVVARSFQGLGIAFVLPNVMGIVGNIYKPNTEAKN 180
                   I SL+C +     N   F V R+ QG+  A ++P    ++  I  P  + + 
Sbjct: 98  TISCSCFAILSLLCAV---MPNFPAFAVFRAIQGICAAGLVPCAYALI-PILAPKEKVQK 153

Query: 181 LVFSLI--GACAPIGATLGCVFSGLIGARTDLWGWTFYAYAITAALNGLVALWII----- 233
             FS++  G  + IG  LG +  G   A    +   FY      +L  ++A +       
Sbjct: 154 Y-FSIVSCGFSSTIG--LGLIIGGAFAATKIGYRGIFYLTFAVMSLISVIAFFFTYNVEN 210

Query: 234 ----PNNIPTNVNEYKMDWIGSAIGVFGLILFNFVWNQAPIAGWGSAYXXXXXXXXXXXX 289
               P  I    +   +D+IGS I V G IL      +     W                
Sbjct: 211 FDKKPQKIQAQTSVKSLDFIGSLIFVAGSILIVVGLTEGG-ESWNRPVTYVTLIIGILLF 269

Query: 290 XXFITYEIRFAK-------------------QPLLPHSVLFNRKLMMILSSLFFGWGSFG 330
             F  +   +AK                   Q L+P  VLF +  + I+  L F   +  
Sbjct: 270 FGFFVWNCTYAKIVRGIRFVGIDTSKYFEKVQLLIPVDVLFMKNFIPIV--LAFALNNAC 327

Query: 331 IWTFYYM--SFMLNLRHYSPLWAGGTYFMFAIWGIVASLLVGYTIHKTGPAVILFLSM-V 387
           +++  Y+   +       SPL AG       I  +V + L  +   K  P V + L   +
Sbjct: 328 LFSCLYIIDQYSQYAEKDSPLLAGVKLVPLIICMVVGNALCAFESTKLKPRVGVALGFSL 387

Query: 388 AFDCGCIMLAVTPVHQTYF-RMTLGIMIILSFGMDLSFPAASIILSDQLPSQYQGMAGSL 446
           A     I++ +  +    F ++      ++ FG+ + +P A  I     P Q +G+A  +
Sbjct: 388 ALAGSIILIQLHLIKDNVFWKIFFSSQALVGFGVAIFYPYALQIAVGGAPDQSKGIASGV 447

Query: 447 VSTMISYSMSLCLGISGTAEHQVN--KNGIDLLK----GYQAALYVGIGLASLGVVISGA 500
             T     + +   +  +    +N  K   D ++    G+Q   Y  + + +LG +++ A
Sbjct: 448 AQTFGQLGIEITFSVMASVLGDINEMKGKEDAIQNFRTGFQNCSYFTVAVGALGFLVT-A 506

Query: 501 FMIEDWWT 508
             I D  T
Sbjct: 507 ICIRDIHT 514

>ZYRO0C01430g Chr3 complement(101140..102912) [1773 bp, 590 aa] {ON}
           weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 590

 Score = 54.7 bits (130), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 93/354 (26%), Positives = 139/354 (39%), Gaps = 57/354 (16%)

Query: 23  EERDGQTEAIGPKSRLQNPDYFDKPWKEYIFVLSSMLSQLLNQAATTQTNPLFDVLSKDL 82
           + RDG   +  P            P K  +  LS  L   L  A  T  + +   ++ + 
Sbjct: 63  DSRDGVASSPVP------------PDKLLVITLSMYLGIFLAAADGTLVSTIMAHIASEF 110

Query: 83  NAKVSQQPWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYVVVVIWSLICGLSSYAHN 142
           N ++ +  W+  ++ L S +F  + GK+ DI+G K  L+   +V ++  L+CGL+     
Sbjct: 111 N-ELPRISWIATAYLLSSATFQPLYGKLSDIFGRKPLLMLNNIVFLVGCLMCGLTPSFWG 169

Query: 143 VDFFVVARSFQGLGIAFVLPNVMGIVGNIYKPNTEA-----KNLVFSLIGACAPIGATLG 197
           +   V AR   G+G   V       + +I      A      N  F L  AC   G  +G
Sbjct: 170 L---VGARFISGIGGGGVTSMCSITISDIVPLRDRALYQGMCNFFFGLGTAC---GGVVG 223

Query: 198 CVFSGLIGARTDLWGWTFYAYAITAALNGLVALWI-----IPN-----NIPTNVNE--YK 245
             FS   G      GW   A+ I   L+ L +L I     +P      N P ++      
Sbjct: 224 GWFSDHGG------GWRM-AFLIQVPLSALSSLLIAVFMKLPPRSKRVNSPASIKNKLLS 276

Query: 246 MDWIG-SAIGVF-GLILFNFVWNQAPIAGWGSAYXXXXXXXXXXXXXXFITYEIRFAKQP 303
           +DWIG SA+ VF  L L         IA + S                FI  E+  AK P
Sbjct: 277 VDWIGASALVVFLSLFLVTASLGGKEIA-FNSKTFVALCIGSSLACAFFIGVELYGAKDP 335

Query: 304 LLPHSVLFNRKLMMILSSLFFGWGSFGIWTFYYMSFMLNLRHYSPLWAGGTYFM 357
           +LP S L NR    +L S F  W        + M  M+   +Y P++  G   M
Sbjct: 336 ILPLSFLRNRS---VLGSSFSNW--------FCMMAMMTTSYYLPIYYSGVLNM 378

>Skud_6.16 Chr6 (26284..27933) [1650 bp, 549 aa] {ON} YOR378W (REAL)
          Length = 549

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 114/538 (21%), Positives = 201/538 (37%), Gaps = 73/538 (13%)

Query: 12  WEKLQSSSAAGEERDGQTEAIGPKSRLQ-NPDYFDKPWKEYIFVLSSMLSQLLNQAATTQ 70
           W+K+   S A EE   + +    KSR Q N +         IF+  +    LLN A+   
Sbjct: 3   WDKIAKLSNALEEIRNKCQ----KSRYQLNVNV------GLIFLGCTF--DLLNVASMIS 50

Query: 71  TNPLFDVLSKDLNAKVSQQPWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYVVVVIW 130
              L D L+K  N   +   W + S+ +    FI   G++GDI G             + 
Sbjct: 51  ---LIDDLAKTYNISYTTASWSLTSYAVTFAGFIACMGRLGDIIGNSVLFTISCSCFAVL 107

Query: 131 SLICGLSSYAHNVDFFVVARSFQGLGIAFVLPNVMGIVGNIYKPNTEAKNLVFSLI--GA 188
           SL+C +     N   F V R+ QG+  A ++P    ++  I  P  + +   FS++  G 
Sbjct: 108 SLLCAV---MPNFPAFAVFRAIQGICAAGLVPCAYALI-PILAPKEKVQKY-FSIVSCGF 162

Query: 189 CAPIGATLGCVFSGLIGARTDLWGWTFYAYAITAALNGLVALWII---------PNNIPT 239
            + IG  LG +  G        +   FY       L  ++A +           P     
Sbjct: 163 SSTIG--LGLIIGGAFATTKIGYRGIFYLTFAVMTLISIIAFFFTYGVEKLNKKPQKDQA 220

Query: 240 NVNEYKMDWIGSAIGVFGLILFNFVWNQAPIAGWGSAYXXXXXXXXXXXXXXFITYEIRF 299
           + +   +D+IGS I V G IL      +     W                  F  +   +
Sbjct: 221 STSVKSLDFIGSLIFVAGSILIVVGLTEGG-ESWNRPVTYVTLVIGIILFFGFFVWNCTY 279

Query: 300 AK-------------------QPLLPHSVLFNRKLMMILSSLFFGWGSFGIWTFYYM--S 338
            K                   Q L+P  VLF +  + I+  L F   +  +++  Y+   
Sbjct: 280 TKIVRGFKYCGIDTSKYFEKVQLLIPIDVLFMKNFIPIV--LAFALNNACLFSCLYIIDQ 337

Query: 339 FMLNLRHYSPLWAGGTYFMFAIWGIVASLLVGYTIHKTGP----AVILFLSMVAFDCGCI 394
           +       SPL AG       I  ++ + L  +   K  P    A+  FL++       I
Sbjct: 338 YSQYAERNSPLLAGVKLVPLIICMVIGNALCAFESTKLRPRVGVAIGFFLALAG---SII 394

Query: 395 MLAVTPVHQTYF-RMTLGIMIILSFGMDLSFPAASIILSDQLPSQYQGMAGSLVSTMISY 453
           ++ +  V +  F ++      ++ FG+ + +P A  I     P + +G+A  +  T    
Sbjct: 395 LIQLHLVKEDLFWKIFFSAQALVGFGVAIFYPYALQIAVGGAPDESRGIASGVAQTFGQL 454

Query: 454 SMSLCLGISGTAEHQVNK-----NGIDLLK-GYQAALYVGIGLASLGVVISGAFMIED 505
            + +   +  +    +N+     N I   + G+Q   Y  + + +LG +++ A  I D
Sbjct: 455 GIEITFSVMASVLGNINEMKGKSNAIQKFRTGFQNCSYFTVAVGALGFLVT-AICIRD 511

>Suva_10.11 Chr10 (18934..20556) [1623 bp, 540 aa] {ON} YOR378W
           (REAL)
          Length = 540

 Score = 50.4 bits (119), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 105/482 (21%), Positives = 181/482 (37%), Gaps = 61/482 (12%)

Query: 61  QLLNQAATTQTNPLFDVLSKDLNAKVSQQPWLMASFPLVSGSFILVSGKVGDIYGLKKTL 120
            LLN A+      L D L++  +   +   W + S+ +    FI   G++GDI G     
Sbjct: 41  DLLNVASMIS---LIDDLAQKYDISYTTASWSLTSYAVTFAGFIAFMGRLGDIVGNSILF 97

Query: 121 LGGYVVVVIWSLICGLSSYAHNVDFFVVARSFQGLGIAFVLPNVMGIVGNIYKPNTEAKN 180
                   I SL+C +     N   F V R+ QG+  A ++P    ++  +  P  E + 
Sbjct: 98  TVSCFFFAILSLLCAV---MPNFPAFAVFRAIQGISAAGLVPCAYALI-PMLAPEEEVQK 153

Query: 181 LVFSLI--GACAPIGATLGCVFSGLIGARTDLWGWTFYAYAITAALNGLVALWII----- 233
             FS++  G  + IG  LG +  G   A    +   FY       L  +VA +       
Sbjct: 154 Y-FSIVSCGFSSTIG--LGLIIGGAFAATKIGYKGIFYLTFAVMFLISIVAFFFTYGVEN 210

Query: 234 ---PNNIPTNVNEYK-MDWIGSAIGVFGLILF-------NFVWNQAPI------------ 270
              P       N  + +D+IGS I V G IL           WN+               
Sbjct: 211 LSEPPRKDQATNRVRSLDFIGSLIFVTGSILIVVGLTEGGESWNRPATYVTLVIGIILFF 270

Query: 271 --AGWGSAYXXXXXXXXXXXXXXFITYEIRFAKQPLLPHSVLFNRKLMMILSSLFFGWGS 328
               W  +Y                 +E     Q L+P  VLF +  + I+  L F   +
Sbjct: 271 GFFFWNCSYARIVRGIRCCGIDTSRYFE---KVQLLIPVDVLFMKNFIPIV--LAFALNN 325

Query: 329 FGIWTFYYM--SFMLNLRHYSPLWAGGTYFMFAIWGIVASLLVGYTIHKTGPAVILFLSM 386
             +++  Y+   +       SPL+AG       I  ++ + L  +   K  P V + L  
Sbjct: 326 ACLFSCIYIIDQYSQYEEKNSPLYAGVKLVPLIICMVIGNGLCAFESTKLKPKVGVVLGF 385

Query: 387 VAFDCGCIMLAVTPVH----QTYFRMTLGIMIILSFGMDLSFPAASIILSDQLPSQYQGM 442
                G I+L  T +H      ++++      ++ FG+ + +P A  I     P + +G+
Sbjct: 386 SLALAGSIIL--TQLHLIKEDMFWKIFFSSQALVGFGVAIFYPYALQIAVGGAPDRSKGI 443

Query: 443 AGSLVSTM----ISYSMSLCLGISGTAEHQVNKNGI--DLLKGYQAALYVGIGLASLGVV 496
           A  +  T     I  + S+   + G  +    K+G       G+Q   Y  + + +LG +
Sbjct: 444 ASGVAQTFGQLGIEITFSVMASVLGNIDGIRGKSGASQKFRTGFQNCTYFTVAVGALGFL 503

Query: 497 IS 498
           ++
Sbjct: 504 VT 505

>KLLA0C18931g Chr3 (1680133..1681794) [1662 bp, 553 aa] {ON}
           uniprot|Q874B4 Kluyveromyces lactis KLLA0C18931g Drug
           efflux permease KNQ1
          Length = 553

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 52/190 (27%), Positives = 86/190 (45%), Gaps = 10/190 (5%)

Query: 78  LSKDLNAKVSQQPWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYVVVVIWSLICGLS 137
           +    N   +Q  W + S+ +    FI   G+VGDI G    +    V+  I+SL+C + 
Sbjct: 49  IETRFNVSHTQSGWALTSYVITFAGFIAFFGRVGDIVGNGIMMCVFSVIFGIFSLLCAV- 107

Query: 138 SYAHNVDFFVVARSFQGLGIAFVLPNVMGIVGNIYK-PNTEAK-NLVFSLIGACAPIGAT 195
               N   F V R+FQG+  A ++P    +V  +++ PN +   +++ S+I A A +G  
Sbjct: 108 --VPNFIAFTVFRAFQGMAGAGIVPCAYALVNKMFQGPNLQRYFSILSSVISAMAGVGFI 165

Query: 196 LGCVFSGLIGARTDLWGWTFYAYAITAA----LNGLVALWIIPNNIPTNVNE-YKMDWIG 250
           +G  F          + + F A   TAA    L G   L +  ++        YK+D IG
Sbjct: 166 IGGAFGETALGYKSFFYFLFAASLATAAVICVLIGYPELLLNRHSYKEKFQRVYKLDVIG 225

Query: 251 SAIGVFGLIL 260
             + + G IL
Sbjct: 226 CLLFISGSIL 235

>SAKL0E04246g Chr5 (336416..338113) [1698 bp, 565 aa] {ON} weakly
           similar to uniprot|Q04301 Saccharomyces cerevisiae
           YMR088C VBA1 Permease of basic amino acids in the
           vacuolar membrane
          Length = 565

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 56/211 (26%), Positives = 91/211 (43%), Gaps = 17/211 (8%)

Query: 49  KEYIFVLSSMLSQLLNQAATTQTNPLFDVLSKDLNAKVSQQPWLMASFPLVSGSFILVSG 108
           K  I V++  L   L+   TT  + L   ++ DL+A  SQ  W+  S+ L   +F  + G
Sbjct: 39  KTRIIVIALFLGSFLSALDTTIVSTLLPTIASDLDAS-SQMSWIATSYLLSCSAFQPLYG 97

Query: 109 KVGDIYGLKKTLLGGYVVVVIWSLICGLSSYAHNVDFFVVARSFQGLGIAFVLPNVMGIV 168
           K+ DI+G K  L+   +V  I   +CG S +  N+      R   G+G   +        
Sbjct: 98  KLSDIFGRKILLVWSNLVFAIGCALCG-SPWTTNIWILSAGRFIAGIGGGGLTTLSTITT 156

Query: 169 GNIYKPNTEA-----KNLVFSLIGACAPIGATLGCVFSGLIGARTDLWGWTFYAYAITAA 223
            +I             N+ FSL   CA  G+ LG V    IG     W W F      A 
Sbjct: 157 SDIIPLRKRGVYQGLGNICFSL--GCAS-GSVLGAVLQQGIG-----WRWAFLIQVPIAL 208

Query: 224 LNGLVALWIIPNNIPTNVNEYKMDWIGSAIG 254
           ++GL+ ++++   +P++     + W+  A G
Sbjct: 209 ISGLLIVFVL--ELPSDSPGRGLIWLEHARG 237

>NCAS0A07810 Chr1 complement(1554541..1556247) [1707 bp, 568 aa]
           {ON} Anc_2.473
          Length = 568

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 53/210 (25%), Positives = 91/210 (43%), Gaps = 21/210 (10%)

Query: 3   MKENDDEENWEKLQSSSAAGEERDGQTEAIGPKSRLQNPDYFDKPWKEYIFVLSSMLSQL 62
           M   D+  +   ++SS   GEE +G  E        Q  +Y +    ++  +LS  L   
Sbjct: 1   MDPLDETSSLLPIRSSIEDGEEDNGLEE--------QYHEY-NLSLPKFPILLSLWLGSF 51

Query: 63  LNQAATTQTNPLFDVLSKDLNAKVSQQPWLMASFPLVSGSFILVSGKVGDIYGLKKTLLG 122
           L+   +T    + + ++++      +Q W+  SF L + +F  + GK+ DI G K  +L 
Sbjct: 52  LSSLDSTIVANIMNKVAEEFEESDKKQ-WIATSFLLTNTAFQPLYGKLSDITGRKFAVLT 110

Query: 123 GYVVVVIWSLICGLSSYAHNVDFFVVARSFQGLGIAFVLPNVMGIVGNIYKPNTEA---- 178
            +     + L C L+ +A N+  F +AR+  G+G   V       V +I           
Sbjct: 111 SH---FFFGLGCFLTCFAQNITQFSIARAICGIGAGGVNAMSSITVSDICSTRERGIYQG 167

Query: 179 -KNLVFSLIGACAPIGATLGCVFSGLIGAR 207
             N+VF   G    +GA LG +F   +G R
Sbjct: 168 YANIVF---GLGQLLGAPLGGLFIDSVGWR 194

>KLTH0G13464g Chr7 complement(1154304..1156085) [1782 bp, 593 aa]
           {ON} weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 593

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 72/334 (21%), Positives = 126/334 (37%), Gaps = 34/334 (10%)

Query: 2   NMKEND---DEENWEKLQSSSAAGEERDGQTEAIGPKSR--LQNPDYFDKPWKEYIFVLS 56
            +++ D   D E      S++ +    + + E  G  +     + +++    +  I + S
Sbjct: 32  QIEQQDHLLDIEQGRAYGSTTKSSISSENEREDAGGATVAGCGSAEFYLPSSRILIIMFS 91

Query: 57  SMLSQLLNQAATTQTNPLFDVLSKDLNAKVSQQPWLMASFPLVSGSFILVSGKVGDIYGL 116
             L   L     T  + L   +  + N+ + +  W+  S+ L S +   + GK+ D  G 
Sbjct: 92  MFLGIFLAALDGTIVSTLLTHIGSEFNS-LDKASWIATSYLLSSSTCQPLYGKLSDRLGR 150

Query: 117 KKTLLGGYVVVVIWSLICGLSSYAHNVDFFVVARSFQGLGIAFVLPNVMGIVGNIYKPNT 176
           K  L+    V  I  LICGLS+    V   V  R   G+G   +      I+ ++     
Sbjct: 151 KPLLVFSNAVFAIGCLICGLSNSIWAV---VAGRFISGIGGCGLTSLATMIMSDLVPLRD 207

Query: 177 EA-----KNLVFSLIGACAPIGATLGCVFSGLIGARTDLWGWTFYAYAITAALNGL---V 228
            A      N VF            LG    GL+GA    W   F      + L+G+   V
Sbjct: 208 RAVYQGLCNFVFG-----------LGTASGGLVGAYFRDWRLAFILQCPISVLSGILIVV 256

Query: 229 ALWIIPNNIPTNVNEY-----KMDWIGSAIGVFGLILFNFVWNQ-APIAGWGSAYXXXXX 282
            L + P    +N + +     ++DW G+   +  L LF    +       +GS       
Sbjct: 257 YLELPPRASASNKDCWSARLRRLDWAGATSLIAFLFLFMLTSSMGGSSVAYGSRLFAAMC 316

Query: 283 XXXXXXXXXFITYEIRFAKQPLLPHSVLFNRKLM 316
                    F+  E+R A  P+LP + L +R ++
Sbjct: 317 AATLVFGAVFVYVELRVAADPVLPVTFLRDRSVL 350

>AGR076C Chr7 complement(871564..873624) [2061 bp, 686 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR119W
          Length = 686

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 71/319 (22%), Positives = 124/319 (38%), Gaps = 41/319 (12%)

Query: 49  KEYIFVLSSMLSQLLNQAATTQTNPLFDVLSKDLNAKVSQQPWLMASFPLVSGSFILVSG 108
           +  + + S  L   L     T    L D ++ + N ++ +  W+  ++ L S +F  + G
Sbjct: 138 RRRVVMASMCLGVFLAALDGTIVTTLLDHIASEFN-ELPRISWIATAYLLSSATFQPLYG 196

Query: 109 KVGDIYGLKKTLLGGYVVVVIWSLICGLSSYAHNVDFFVVARSFQGLGIAFVLPNVMGIV 168
           K+ DI+G +  L+   +V  + +LICG+S    N+   V+ R   G+G   +        
Sbjct: 197 KLSDIFGRRPLLVFSNLVFCLGALICGMSK---NLWVLVLGRFVAGIGGGGLTSMCSITT 253

Query: 169 GNIYKPNTEA-----KNLVFSLIGACAPIGATLGCVFSGLIGARTDLWGWTFYAYA-ITA 222
            +I    + A      N+ F L  AC       G +  GL   R   W   F     +T 
Sbjct: 254 TDIVPLRSRALYQGICNVFFGLGTAC-------GGLVGGLFADRAVGWRMAFLVQVPLTL 306

Query: 223 ALNGLVALWIIPNNIPTNVNEYK---------------MDWIGSAIGVFGLILFNFVWNQ 267
                + L++    +P  V+ +K               +DW G+   V  L  F  V + 
Sbjct: 307 LSTTAIQLFL---TLPKPVDAHKGAGQRSIPWTTKLRMVDWTGTVTLVVFLFCFTLVCS- 362

Query: 268 APIAGWGSAYXXXXXXXXXXXXXXFITYEIRFAKQPLLPHSVLFNRKLMMILSSLFF--- 324
             + G    +              FI +E+  A  P+LP   L NR ++    S +F   
Sbjct: 363 --LYGEDLPHLYLIFVVILLSGSYFIYHELYVATDPILPIRFLENRSVLAASLSNWFCMM 420

Query: 325 GWGSFGIWTFYYMSFMLNL 343
           G  + G +   Y + +LN+
Sbjct: 421 GMMTTGFYIPVYYASVLNM 439

>NDAI0D01020 Chr4 complement(229357..231135) [1779 bp, 592 aa] {ON} 
          Length = 592

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 47/172 (27%), Positives = 78/172 (45%), Gaps = 12/172 (6%)

Query: 73  PLFDVLSKDLNAKVSQQPWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYVVVVIWSL 132
           P    L K+ N   ++    +  + L  G    VSG + D++G +  +LGG V+ V+ S+
Sbjct: 123 PALRQLEKEFNMDENKVNVTVVVYLLFQGIAPTVSGGLADVFGRRPIILGGMVIYVVASI 182

Query: 133 ICGLSSYAHNVDFFVVARSFQGLGIAFVLPNVMGIVGNIYKPNTEAKNLVFSLIGACAPI 192
             GL+  A +       R  Q +GI+  +    G+VG+    +        + +GA + +
Sbjct: 183 --GLAC-APSYGVICFLRCIQSIGISPTIAISSGVVGDFTLKHERG-----TFVGATSGL 234

Query: 193 GATLGCVFSGLIGA-RTDLWGWT--FYAYAITAALNGLVALWIIPNNIPTNV 241
              LG  F  LIGA  T  W W   F+  AI + +  +VA + +P    T V
Sbjct: 235 -VLLGQCFGSLIGAVLTARWDWRAIFWFLAIGSGVALIVAAFTLPETKRTIV 285

>SAKL0C02178g Chr3 complement(191542..193239) [1698 bp, 565 aa] {ON}
           weakly similar to uniprot|Q04301 Saccharomyces
           cerevisiae YMR088C VBA1 Permease of basic amino acids in
           the vacuolar membrane
          Length = 565

 Score = 44.7 bits (104), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 33/110 (30%), Positives = 53/110 (48%), Gaps = 2/110 (1%)

Query: 47  PWKEYIFVLSSMLSQLLNQAATTQTNPLFDVLSKDLNAKVSQQPWLMASFPLVSGSFILV 106
           P K  I VL+ ++   L+   TT    L   ++ DL+A  SQ  W+  ++ L   +F  +
Sbjct: 37  PTKVRITVLALLMGSFLSALDTTIVATLLPTIASDLDAS-SQMSWIATAYLLSCSAFQPL 95

Query: 107 SGKVGDIYGLKKTLLGGYVVVVIWSLICGLSSYAHNVDFFVVARSFQGLG 156
            GK+ DI+G K  L+   +   +   ICG S + +NV      R   G+G
Sbjct: 96  YGKLSDIFGRKILLILSNLTFALGCAICG-SPWTNNVWVLSTGRFVAGIG 144

>NDAI0H02200 Chr8 complement(536385..538100) [1716 bp, 571 aa] {ON} 
           YGR224W
          Length = 571

 Score = 44.7 bits (104), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 54/209 (25%), Positives = 92/209 (44%), Gaps = 24/209 (11%)

Query: 9   EENWEKLQSSSAAGEERDGQTE-AIGPKSRLQNPDYFDKPWKEYIFVLSSM-LSQLLNQA 66
           +E    L + S   E  +G+ E ++  K    N      P      +LSS+ L    +  
Sbjct: 5   DETSSLLPARSTIEEVPEGEYEISLEKKYHEHNLSLPKVP------ILSSLWLGSFFSSL 58

Query: 67  ATTQTNPLFDVLSKDLNAKVSQQPWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYVV 126
            +T    + + ++++  A+  ++ W+  SF L + +F  + GK+ DI G K  +L  +  
Sbjct: 59  DSTIVANIMNRVAEEF-AESDKKQWIATSFLLTNTAFQPLYGKLSDITGRKFAVLTAH-- 115

Query: 127 VVIWSLICGLSSYAHNVDFFVVARSFQGLGIAFVLPNVMGIVGNIYKPNTEAK------- 179
              + L C L+ +A NV  F +AR+  G+G   +  N M  +       T  +       
Sbjct: 116 -FFFGLGCLLTCFAQNVTQFSIARAICGMGAGGI--NAMSSITTSDICTTRERGIFQGYA 172

Query: 180 NLVFSLIGACAPIGATLGCVFSGLIGART 208
           N+VF   G    +GA LG +F   IG RT
Sbjct: 173 NIVF---GMGQVLGAPLGGLFLDHIGWRT 198

>KLLA0E24113g Chr5 complement(2148115..2149842) [1728 bp, 575 aa]
           {ON} similar to uniprot|P38125 Saccharomyces cerevisiae
           YBR180W DTR1 Multidrug resistance dityrosine transporter
           of the major facilitator superfamily essential for spore
           wall synthesis facilitates the translocation of
           bisformyl dityrosine through the prospore membrane
          Length = 575

 Score = 44.7 bits (104), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 54/253 (21%), Positives = 104/253 (41%), Gaps = 14/253 (5%)

Query: 2   NMKENDDEENWEKLQSSSAAGEERDGQT--EAIGPKSRLQNPDYFDKPWKEYIFVLSSML 59
            +K+ D + +  K + SS    E+  +T   A+ P+     P      ++    +L  + 
Sbjct: 60  EIKDTDFDSDKSKEEQSSIVRNEKHPETAFTALEPEIAYNPPYSAFSNYQVVSILLIIIY 119

Query: 60  SQLLNQAATTQTNPLFDVLSKDLNAKVSQQPWLMASF--PLVSGSFILVSGKVGDIYGLK 117
              L         P   +L  + N   +     +A+F      G F+     V   +G +
Sbjct: 120 IGFLGPVTGNIYIPALPILQSEFNTSTTAINGTVAAFMGVFAVGPFLWA---VHADFGGR 176

Query: 118 KTLLGGYVVVVIWSLICG--LSSYAHNVDFFVVARSFQGLGIAFVLPNVMGIVGNIYKPN 175
           K L   Y+  ++ +LI    L++   ++    + R FQ +G + V+P  +G V ++  P 
Sbjct: 177 KFL---YIFSLMIALIANVLLAAVPKHLAALYILRVFQAIGTSAVIPLGVGTVSDLISPM 233

Query: 176 TEAKNLVFSLIGACAPIGATLGCVFSGLIGARTDLWGWTFYAYAITAALNGLVALWIIPN 235
             AK + + ++G    +G  LG +F GLI    + W W F   +IT  +  ++ +  +P 
Sbjct: 234 NRAKGVSYFMLG--PNMGPILGPIFGGLILMNGNQWRWLFGFTSITTGVGLILIVTFLPE 291

Query: 236 NIPTNVNEYKMDW 248
            +   V      W
Sbjct: 292 TLRCIVGNGDPRW 304

>SAKL0A00726g Chr1 (82164..83960) [1797 bp, 598 aa] {ON} similar to
           uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 598

 Score = 44.3 bits (103), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 48/243 (19%), Positives = 103/243 (42%), Gaps = 19/243 (7%)

Query: 3   MKENDDEENWEKLQSSSAAGEERDGQTEAIGPKSRLQNPDYFDKPWKEYIFVLSSMLSQL 62
           +++N  +E   + +SS+         +E +    ++ + D   K +  Y  + S  L+  
Sbjct: 4   LEDNSSKELCTQAESST---------SEVVEQNKKVVSQDQVVKGFALYACLGSLTLALF 54

Query: 63  LNQAATTQTNPLFDVLSKDLNAKVSQQPWLMASFPLVSGSFILVSGKVGDIYGLKKTLLG 122
           L+       + + + +S+D N + S+  WL+  + L +    LV G+   I G K ++L 
Sbjct: 55  LSALDILIVSTIIETVSRDFN-EYSKSGWLVTGYSLPTALLSLVWGRAASIIGFKSSMLL 113

Query: 123 GYVVVVIWSLICGLSSYAHNVDFFVVARSFQGLGIAFVLPNVMGIVGNIYKPNTEAKNLV 182
             ++  + SL+   S+ A++++  +  R   G+G + +      I+  +   N  ++ + 
Sbjct: 114 SIIIFEVGSLV---SALANSMNMLIGGRVISGVGGSGLQTLCFLIISTLV--NERSRGMA 168

Query: 183 FSLIGACAPIGATLGCVFSGLIGARTDLWGWTFYAYAITAALNGLVALWIIPNNIPTNVN 242
            S++     + + +G    G        W W FY   I   + GL  L  + +  P   N
Sbjct: 169 ISVLSCSFAVASIVGPFLGGAFTTHVT-WRWCFY---INLPIGGLAFLVFVLSYNPNGGN 224

Query: 243 EYK 245
             K
Sbjct: 225 SIK 227

>TDEL0D00240 Chr4 complement(38642..40132) [1491 bp, 496 aa] {ON} 
          Length = 496

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 56/235 (23%), Positives = 92/235 (39%), Gaps = 21/235 (8%)

Query: 5   ENDDEENWEKLQSSSAAGEERDGQTEAIGPKSR---LQNPDYFDKPWKEYIFVLSSMLSQ 61
            NDDE       S +   E   G    I PK     ++  D+   P   +++ LSS+   
Sbjct: 14  RNDDEFLNGSAVSFTHESEIETGDELYIDPKEEAALVRKLDFRLLPMLAFMYFLSSLDRS 73

Query: 62  LLNQAATTQTNPLFDVLSKDLNAKVS--QQPWLMASFPLVSGSFILVSGKVGDIYGLKKT 119
            +  A T+       + S+  +  VS     +L A  P V     LV  +V   Y +   
Sbjct: 74  NIGNAYTSGMKEDLKLTSRQYSNAVSVFYSTYLAAELPAV-----LVLKRVNVRYYMS-- 126

Query: 120 LLGGYVVVVIWSLICGLSSYAHNVDFFVVARSFQGLGIAFVLPNVMGIVGNIYKPNTEAK 179
                 +V  WS+I   + +  N    +  R   G       P +  I+  +YK   +AK
Sbjct: 127 -----FLVFSWSIITLCNGFVQNHKSLIALRVLLGCFEGGFFPAMTLIISMVYKQQEQAK 181

Query: 180 NLVFSLIGACAPIGATLGCVFSGLIGARTD--LWGWTFYAYAITAALNGLVALWI 232
            + F   G+ +  GA  G +  GL   +T   L GW  Y Y I   ++ + ++W+
Sbjct: 182 RIAF-FFGSASLSGAFGGLIAGGLSSVKTTGGLEGWR-YLYIIEGLVSVVASVWL 234

>Smik_13.272 Chr13 complement(427283..428968) [1686 bp, 561 aa] {ON}
           YMR088C (REAL)
          Length = 561

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 41/131 (31%), Positives = 63/131 (48%), Gaps = 15/131 (11%)

Query: 84  AKVSQQPWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYVVVVIWSLICGLSSYAHNV 143
           ++ S++ W+  SF L + +F  + GK+ DI G K  LL  +     + + C L+ +A NV
Sbjct: 68  SESSRKQWIATSFLLTNTAFQPLYGKLSDITGRKSALLTAH---FFFGIGCLLTCFARNV 124

Query: 144 DFFVVARSFQGLGIAFVLPNVMG--IVGNIYKPNTEA-----KNLVFSLIGACAPIGATL 196
             F +AR+  G+G   +  N +G   V +I             N+VF   G    +GA L
Sbjct: 125 TEFSIARAICGIGAGGL--NAIGSIAVSDICTARERGVYQGYANIVF---GLGQLLGAPL 179

Query: 197 GCVFSGLIGAR 207
           G VF   IG R
Sbjct: 180 GGVFIETIGWR 190

>Skud_13.244 Chr13 complement(417271..418959) [1689 bp, 562 aa] {ON}
           YMR088C (REAL)
          Length = 562

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 29/98 (29%), Positives = 52/98 (53%), Gaps = 4/98 (4%)

Query: 59  LSQLLNQAATTQTNPLFDVLSKDLNAKVSQQPWLMASFPLVSGSFILVSGKVGDIYGLKK 118
           L   L+   +T    + + +++D  ++ S++ W+  SF L + +F  + GK+ DI G K 
Sbjct: 44  LGSFLSSLDSTIVANIMNRVAEDF-SESSRKQWIATSFLLTNTAFQPLYGKLSDITGRKS 102

Query: 119 TLLGGYVVVVIWSLICGLSSYAHNVDFFVVARSFQGLG 156
            LL   +    + L C L+ +A NV  F +AR+  G+G
Sbjct: 103 ALL---IAQFFFGLGCLLTCFARNVTEFSIARAICGIG 137

>Kpol_543.44 s543 (96992..98923) [1932 bp, 643 aa] {ON}
           (96992..98923) [1932 nt, 644 aa]
          Length = 643

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 105/451 (23%), Positives = 171/451 (37%), Gaps = 72/451 (15%)

Query: 52  IFVLSSMLSQLLNQAATTQTNPLFDVLSKDLNAKVSQQPWLMASFPLVSGSFILVSGKVG 111
           I +LS  L   L     T  + L   ++ + N ++ +  W+  ++ L S +F  + GK+ 
Sbjct: 122 IIMLSMYLGIFLAALDNTIVSTLLAHIASEFN-ELPRISWVATAYLLSSATFQPIYGKIS 180

Query: 112 DIYGLKKTLLGGYVVVVIWSLICGLSSYAHNVDFFVVARSFQGLGIAFVLPNVMGIVGNI 171
           DI+G K  L+   +   + SLICGLS        ++VA  F        + ++  I  + 
Sbjct: 181 DIFGRKVVLIFCNITFFVGSLICGLSPSFE----WLVAGRFIAGIGGGGITSMSSITTSD 236

Query: 172 YKPNTEAKNLVFSLIGACAPIGATLGCVFSGLIGARTDLWGWTFYAYAITAALNGLV--- 228
             P    + L   +      +G  LG V  G    R+  W  +F      A  + ++   
Sbjct: 237 IVP-LRNRALYQGICNFYFGLGTALGGVVGGWFSDRSVGWRMSFLIQLPIAFFSTILIIL 295

Query: 229 -----------ALWIIPNNIPT-NVNEYKMDWIGSAIGVFGLILFNFVWNQAPIAGWGSA 276
                       L +  N   T  V    +DWIG+   V  L LF+F+   A + G    
Sbjct: 296 FLRLPKESKGRGLQVDGNYFSTIKVRLSAVDWIGATTLV--LFLFSFMIT-ASLGGKEIP 352

Query: 277 YXXXX----XXXXXXXXXXFITYEIRFAKQPLLPHSVLFNRKLMMILSSLFFGWGSFGIW 332
           Y                  F   E++ AK P+LP   L +R    +L S    W      
Sbjct: 353 YTSHKFIGLCVVTVIGALIFGYTELKIAKDPILPLRFLKDRS---VLGSSLSNW------ 403

Query: 333 TFYYMSFMLNLRHYSPLWAGGTY--------------FMFAIWGIVASLLVGYTIHKTGP 378
             + M  ++ + +Y P++  G                F    +G   SL  GY + KTG 
Sbjct: 404 --FCMMALMTVSYYLPIYFAGVLNMKPTDIGKRIIPNFFSTAFG---SLGAGYYMKKTGK 458

Query: 379 A---VILFLSMVAFDCGCIMLA-VTPVHQTYFRMTLGIMIILSFGMDLSFPAASIILSDQ 434
               VI F  + +   GC+ +  + P    + + TL  M I   G  +    A + +   
Sbjct: 459 YYWFVISFCVLASI--GCLQIVWIQPDISVFKQYTL--MFIPGLGASVLITVALLAMIAA 514

Query: 435 LPSQYQGMAGSLVSTMISY---SMSLCLGIS 462
           +P  +Q      V+T ISY   S    LG+S
Sbjct: 515 VPHNHQA-----VTTSISYAFRSTGCTLGVS 540

>KNAG0I01910 Chr9 complement(373073..374869) [1797 bp, 598 aa] {ON} 
          Length = 598

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 47/175 (26%), Positives = 76/175 (43%), Gaps = 6/175 (3%)

Query: 73  PLFDVLSKDLNAKVSQQPWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYVVVVIWSL 132
           P    L K+ +   SQ    +  + L  G     SG + D YG +  +LGG +V V+ S+
Sbjct: 135 PALRQLEKEFHLNESQVNVTVVVYLLFQGIAPTFSGGLADRYGRRPIILGGMLVYVVASI 194

Query: 133 ICGLSSYAHNVDFFVVARSFQGLGIAFVLPNVMGIVGNIYKPNTEAKNLVFSLIGACAPI 192
             GL+  A +    V  R  Q +GI+  +    G+V + Y    E    V +  G    I
Sbjct: 195 --GLAR-APSYGVIVFLRIVQSIGISPTIAISSGVVSD-YTLKRERGTFVGATSGFVL-I 249

Query: 193 GATLGCVFSGLIGARTDLWGWTFYAYAITAALNGLVALWIIPNNIPTNVNEYKMD 247
           G  +G +   +I AR D W   F+   I    + L+A +++P    T V    ++
Sbjct: 250 GQGIGPLLGAVIAARWD-WRAIFWFLVIGCGTSMLIAFFLLPETKRTIVGNLSIE 303

>KLTH0D16962g Chr4 (1399514..1401229) [1716 bp, 571 aa] {ON} similar
           to uniprot|P33335 Saccharomyces cerevisiae YPR198W SGE1
           Member of drug-resistance protein family multicopy
           suppressor of gal11 null mutation
          Length = 571

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 36/143 (25%), Positives = 67/143 (46%), Gaps = 7/143 (4%)

Query: 74  LFDVLSKDLNAKVSQQPWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYVVVVIWSLI 133
           L+D + ++ N   +   WLMA + L +  F+L+ G++  + GLK +L+   V+    SL+
Sbjct: 30  LYDTIGQEFN-DYANVGWLMAGYNLPNALFMLLWGRIASLVGLKCSLMASIVIFEAGSLM 88

Query: 134 CGLSSYAHNVDFFVVARSFQGLGIAFVLPNVMGIVGNIYKPNTEAKNLVFSLIGACAPIG 193
            G    A+++   + AR   G G + +   V G+  +I +    A+  V +++G    + 
Sbjct: 89  AG---AANSMGMLIGARVISGFGGSGIESLVYGVGTSIVEEKHRAR--VITVLGIAYMLA 143

Query: 194 ATLGCVFSGLIGARTDLWGWTFY 216
              G    G +      W W FY
Sbjct: 144 EGAGPFVGGGLAEHVS-WRWCFY 165

>YMR088C Chr13 complement(443414..445102) [1689 bp, 562 aa] {ON}
           VBA1Permease of basic amino acids in the vacuolar
           membrane
          Length = 562

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 40/73 (54%), Gaps = 3/73 (4%)

Query: 84  AKVSQQPWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYVVVVIWSLICGLSSYAHNV 143
           ++ S++ W+  SF L + +F  + GK+ DI G K  LL        + L C L+ +A NV
Sbjct: 68  SESSKKQWIATSFLLTNTAFQPLYGKLSDITGRKSALLTAQ---FFFGLGCLLTCFARNV 124

Query: 144 DFFVVARSFQGLG 156
             F +AR+  G+G
Sbjct: 125 TEFSIARAICGIG 137

>TDEL0A05130 Chr1 complement(910315..912114) [1800 bp, 599 aa] {ON}
           Anc_8.570 YBR180W
          Length = 599

 Score = 40.8 bits (94), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 38/146 (26%), Positives = 58/146 (39%), Gaps = 17/146 (11%)

Query: 142 NVDFFVVARSFQGLGIAFVLPNVMGIVGNIYKPNTEAKNLVFSLIGACAPIGATLGCVFS 201
           N+    V R FQ  G + V+    G V +I  P    K + + ++G    +G  L  + S
Sbjct: 223 NIVALFVLRVFQAFGSSSVIALGTGTVSDISPPKDRGKAIAYFMMGPN--MGPILAPIIS 280

Query: 202 GLIGARTDLWGWTFYAYAITAALNGLVALWIIPNNIPTNVNEYKMDW------------- 248
           GLI  R D W W F   +I + +  L+ L ++P  +   V      W             
Sbjct: 281 GLILIRGDYWRWLFGFTSIMSGIALLLVLALLPETLRCIVGNGDQRWRSAERGSKNSASD 340

Query: 249 --IGSAIGVFGLILFNFVWNQAPIAG 272
             IG  I    + LF  +  Q P+ G
Sbjct: 341 REIGETIQTPKINLFQDIGMQKPVNG 366

>TPHA0I01760 Chr9 (388160..390121) [1962 bp, 653 aa] {ON} Anc_8.570
           YBR180W
          Length = 653

 Score = 40.4 bits (93), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 38/144 (26%), Positives = 61/144 (42%), Gaps = 4/144 (2%)

Query: 108 GKVGDIYGLKKTLLGGYVVVVIWSLICGLSSYAHNVDFFVVARSFQGLGIAFVLPNVMGI 167
           G   D+ G K   L   ++V + +L+  L+    N+    V R FQ  G + V+    G 
Sbjct: 167 GVYADVCGRKWLYLCSLILVTVINLL--LAVLPANLASLFVLRVFQAFGSSSVITLGSGT 224

Query: 168 VGNIYKPNTEAKNLVFSLIGACAPIGATLGCVFSGLIGARTDLWGWTFYAYAITAALNGL 227
           V +I       K + + ++G    +G  LG + +GLI    D W W F    I +A+  L
Sbjct: 225 VTDITPMKHRGKAIAYFMLGP--NMGPILGPIIAGLILINGDYWRWLFGFTCIMSAIGFL 282

Query: 228 VALWIIPNNIPTNVNEYKMDWIGS 251
           + L  +P  +   V      W  S
Sbjct: 283 LVLIFLPETLRCIVGNGDPRWRNS 306

>Kwal_27.12173 s27 complement(1120952..1122655) [1704 bp, 567 aa]
           {ON} YBR180W (DTR1) - dityrosine transporter MFS-MDR
           [contig 22] FULL
          Length = 567

 Score = 40.4 bits (93), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 44/184 (23%), Positives = 74/184 (40%), Gaps = 11/184 (5%)

Query: 74  LFDVLSKDLNAKVSQQPWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYVVVVIWSLI 133
           +F V S  +NA VS    + A  PL+  SF        D  G K   +   ++ VI +++
Sbjct: 140 IFGVSSTTINATVSVFMAVFAVGPLIWASF-------ADFGGRKILYMISLLLTVIVNVL 192

Query: 134 CGLSSYAHNVDFFVVARSFQGLGIAFVLPNVMGIVGNIYKPNTEAKNLVFSLIGACAPIG 193
             L++   N       R  Q    + V+    G V +I  P    K + + ++G    +G
Sbjct: 193 --LAAVPVNTGALFFLRVMQAFASSSVMALGAGTVSDIRPPQVRGKAIAYFMLGPN--MG 248

Query: 194 ATLGCVFSGLIGARTDLWGWTFYAYAITAALNGLVALWIIPNNIPTNVNEYKMDWIGSAI 253
             L  + +GLI  R   W W F   +I + +  +  +  +P  +   V      WI +  
Sbjct: 249 PILAPIIAGLILMRGSYWRWLFGFTSILSGIGLIAVIVFLPETLRCIVGNGDPKWIDTED 308

Query: 254 GVFG 257
            V G
Sbjct: 309 EVVG 312

>TDEL0F03990 Chr6 (740471..742366) [1896 bp, 631 aa] {ON} Anc_8.272
           YDR119W
          Length = 631

 Score = 40.4 bits (93), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 78/295 (26%), Positives = 118/295 (40%), Gaps = 50/295 (16%)

Query: 85  KVSQQPWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYVVVVIWSLICGLSSYAHNVD 144
           ++S+  W+  S+ L S +F  + GKV DI+G K  L+   V  +I  L+CGLS    +  
Sbjct: 144 QLSKVSWIATSYLLSSATFQPLYGKVSDIFGRKCLLVFTNVAFLIGCLMCGLS---KSFW 200

Query: 145 FFVVARSFQGLGIAFVLPNVMGIVGNIYKPNTEAK------NLVFSLIGACAPIGATLGC 198
           + V+AR   G+G    L ++  I      P  E        N+ + L  AC   G  +G 
Sbjct: 201 WLVIARFVAGVG-GGGLTSMSSITITDLVPLRERAMYQGICNVFYGLGTAC---GGIVGG 256

Query: 199 VFSGLIGARTDLWGWTFYAYAITAALNGLVALWII-----PNNIPTNVNE-------YKM 246
            FS   G      GW   A+ I   L+ +  L II     P+   T   +         +
Sbjct: 257 WFSDNKG------GWRM-AFLIQVPLSAISLLVIILHLKLPSKRATRNQDNSIKRKLLAI 309

Query: 247 DWIGSAIGVFGLILFNFVWNQAPIAG----WGSAYXXXXXXXXXXXXXXFITYEIRFAKQ 302
           DW+G++  V  L+LF      A + G    +GS                FI  E+R A  
Sbjct: 310 DWLGASTLVIFLVLFLLT---ASLGGKEIAYGSRTFALMLISSLLSCLVFIYVELRVAAD 366

Query: 303 PLLPHSVLFNRKLMMILSSLFFGWGSFGIWTFYYMSFMLNLRHYSPLWAGGTYFM 357
           P+LP   L  R    +L S    W        + M   +   +Y P++  G   M
Sbjct: 367 PILPLRFLAIRS---VLGSSLSNW--------FCMMATMTTSYYLPIYFSGVLNM 410

>Suva_4.431 Chr4 (759282..761000) [1719 bp, 572 aa] {ON} YBR180W
           (REAL)
          Length = 572

 Score = 40.4 bits (93), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 43/186 (23%), Positives = 79/186 (42%), Gaps = 11/186 (5%)

Query: 75  FDVLSKDLNAKVSQQPWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYVVVVIWSLIC 134
           FDV +  +N+ VS     MA F +      L  G + D  G K   +    +++  ++I 
Sbjct: 141 FDVSATTINSTVSA---FMAVFSVGP----LFWGALADFGGRKFLYMVSLSLMLAVNII- 192

Query: 135 GLSSYAHNVDFFVVARSFQGLGIAFVLPNVMGIVGNIYKPNTEAKNLVFSLIGACAPIGA 194
            L++   N+    V R FQ    + V+    G V ++  P    K + + ++G    +G 
Sbjct: 193 -LAAVPANIAALFVLRVFQAFASSSVISLGAGTVTDVVPPKHRGKAIAYFMMGPN--MGP 249

Query: 195 TLGCVFSGLIGARTDLWGWTFYAYAITAALNGLVALWIIPNNIPTNVNEYKMDWIGSAIG 254
            +  + +GLI  + + W W F   +I A +  ++   ++P  +   V      W     G
Sbjct: 250 IIAPIVAGLILMKGNYWRWLFGFTSIMAGIALILVTALLPETLRCIVGNGDPKWCERKKG 309

Query: 255 VFGLIL 260
           V G +L
Sbjct: 310 VEGKVL 315

>NCAS0B02010 Chr2 (328296..329888) [1593 bp, 530 aa] {ON} Anc_8.570
          Length = 530

 Score = 40.0 bits (92), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 43/174 (24%), Positives = 74/174 (42%), Gaps = 11/174 (6%)

Query: 75  FDVLSKDLNAKVSQQPWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYVVVVIWSLIC 134
           F+V S  +NA VS    + A  PL  G F        D+ G K   +   +++VI +++ 
Sbjct: 99  FNVSSTVINATVSVFMAVFAVGPLFWGLF-------ADVGGRKVLYICSILLMVIVNIL- 150

Query: 135 GLSSYAHNVDFFVVARSFQGLGIAFVLPNVMGIVGNIYKPNTEAKNLVFSLIGACAPIGA 194
            L+S   ++    V R  Q  G + V+    G V +I  P    + + + +IG    +G 
Sbjct: 151 -LASIPAHISSLFVLRIVQAFGSSSVITLGAGTVTDITPPKQRGRAIGYFMIGP--NMGP 207

Query: 195 TLGCVFSGLIGARTDLWGWTFYAYAITAALNGLVALWIIPNNIPTNVNEYKMDW 248
            L  + +GLI  + + W W F    I   +  L+ +  +P  +   V      W
Sbjct: 208 VLAPIIAGLILMKGNYWRWLFGLTGIMGGVGLLLIVAFLPETLRCIVGNADPGW 261

>TDEL0G03260 Chr7 (605429..607267) [1839 bp, 612 aa] {ON} 
          Length = 612

 Score = 40.0 bits (92), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 44/218 (20%), Positives = 93/218 (42%), Gaps = 10/218 (4%)

Query: 1   MNMKENDDEENWEKLQSSSAAGEERDGQTEAIGPKSRLQNPDYFDKP--WKEYIFVLSSM 58
           + +++N  E+    LQSS   G       E    + + Q      +P  +  Y  V+S +
Sbjct: 4   LEVQKNTVEDEAAYLQSSDEQGSSSHSVIEKP-QQQQPQEQLEQTRPTGFTLYACVISLI 62

Query: 59  LSQLLNQAATTQTNPLFDVLSKDLNAKVSQQPWLMASFPLVSGSFILVSGKVGDIYGLKK 118
           LS  L        + + + ++++     S+  W+ A + L S    L+ G++  + G K 
Sbjct: 63  LSIFLAALDIMIVSTIIENVAREF-GDYSKTGWIYAGYSLPSALLTLIWGRIAAVCGFKS 121

Query: 119 TLLGGYVVVVIWSLICGLSSYAHNVDFFVVARSFQGLGIAFVLPNVMGIVGNIYKPNTEA 178
           ++L   ++  + SL+  L   A+++D  +  R   GLG + +      I+  + + +   
Sbjct: 122 SMLTAIIIFEVGSLVAAL---ANSMDMLIGGRVIAGLGGSGIQTLCFVIISTLVEES--K 176

Query: 179 KNLVFSLIGACAPIGATLGCVFSGLIGARTDLWGWTFY 216
           + L+ + +G+   I + +G    G        W W F+
Sbjct: 177 RGLLIACMGSAFGIASVVGPFLGGAFTTHVT-WRWCFW 213

>TBLA0B04480 Chr2 (1029953..1031779) [1827 bp, 608 aa] {ON}
           Anc_8.570 YBR180W
          Length = 608

 Score = 40.0 bits (92), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 42/181 (23%), Positives = 73/181 (40%), Gaps = 11/181 (6%)

Query: 75  FDVLSKDLNAKVSQQPWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYVVVVIWSLIC 134
           F V +  +N  VS    L A  PLV G F        D  G K   +    +  + +++ 
Sbjct: 165 FQVTTTTINGTVSIFMGLFAFMPLVWGMF-------ADFGGRKFLYIISLFIFTVANIL- 216

Query: 135 GLSSYAHNVDFFVVARSFQGLGIAFVLPNVMGIVGNIYKPNTEAKNLVFSLIGACAPIGA 194
            L+S   N+    + R  Q +G +  +    G V +I  P    K++   ++G    +G 
Sbjct: 217 -LASLPANIIALYLVRVLQVVGASAAISLGTGTVADISPPKHRGKSVALFMLGPN--MGP 273

Query: 195 TLGCVFSGLIGARTDLWGWTFYAYAITAALNGLVALWIIPNNIPTNVNEYKMDWIGSAIG 254
            +  + +GLI   ++ W W F   AI   +  ++ + I+P  +   V      W  S  G
Sbjct: 274 IIAPIIAGLILMNSNQWRWLFGFSAICTGVALMIVIVILPETLRCIVGNNDPKWSRSQRG 333

Query: 255 V 255
            
Sbjct: 334 T 334

>YIL121W Chr9 (132244..133872) [1629 bp, 542 aa] {ON}  QDR2Multidrug
           transporter of the major facilitator superfamily,
           required for resistance to quinidine, barban, cisplatin,
           and bleomycin; may have a role in potassium uptake
          Length = 542

 Score = 40.0 bits (92), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 55/242 (22%), Positives = 102/242 (42%), Gaps = 18/242 (7%)

Query: 3   MKEND-DEENWEKLQSSSAAGEERDG--QTEAIGPKSRLQNPDY--FDKPWKEYIFVLSS 57
           ++END ++E  E +QS +    ++    +TE++ P+  +  P +  F + +K  + +   
Sbjct: 9   IRENDFEDELAESMQSYNRETADKLALTRTESVKPEPEITAPPHSRFSRSFKT-VLIAQC 67

Query: 58  MLSQLLNQAATTQTNPLFDVLSKDLNAKVSQQPWLMASFPLVSGSFILVSGKVGDIYGLK 117
             +   +  A     P+  V+ +  +         +  + +  G      G   D  G +
Sbjct: 68  AFTGFFSTIAGAIYYPVLSVIERKFDIDEELVNVTVVVYFVFQGLAPTFMGGFADSLGRR 127

Query: 118 KTLLGGYVVVVIWSLICGLSSYAHNVDFFVVARSFQGLGIAFVLPNVMGIVGNIYKPNTE 177
             +L   V +VI+   C   + A      +V R  Q  GI+ V+    GI+G++    T 
Sbjct: 128 PVVL---VAIVIYFGACIGLACAQTYAQIIVLRCLQAAGISPVIAINSGIMGDV---TTR 181

Query: 178 AKNLVFSLIGACAPIGATLGCVFSGLIGA-RTDLWGWT--FYAYAITAALNGLVALWIIP 234
           A+   +  +G  A     LG  F  LIGA  +  WGW   F+  AI + +  L +  I+P
Sbjct: 182 AERGGY--VGYVAGF-QVLGSAFGALIGAGLSSRWGWRAIFWFLAIGSGICFLASFLILP 238

Query: 235 NN 236
             
Sbjct: 239 ET 240

>Suva_13.265 Chr13 complement(424929..426614) [1686 bp, 561 aa] {ON}
           YMR088C (REAL)
          Length = 561

 Score = 40.0 bits (92), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 30/102 (29%), Positives = 49/102 (48%), Gaps = 8/102 (7%)

Query: 55  LSSMLSQLLNQAATTQTNPLFDVLSKDLNAKVSQQPWLMASFPLVSGSFILVSGKVGDIY 114
           L S LS L +       N + +  S+      S++ W+  SF L + +F  + GK+ DI 
Sbjct: 44  LGSFLSSLDSTIVANIMNRVAEEFSES-----SKKQWIATSFLLTNTAFQPLYGKLSDII 98

Query: 115 GLKKTLLGGYVVVVIWSLICGLSSYAHNVDFFVVARSFQGLG 156
           G +  LL        + L C ++ +A NV  F +AR+  G+G
Sbjct: 99  GRRPALLTAQ---FFFGLGCLMTCFARNVTEFSIARAVCGIG 137

>Ecym_4298 Chr4 complement(636605..638641) [2037 bp, 678 aa] {ON}
           similar to Ashbya gossypii AGR076C
          Length = 678

 Score = 40.0 bits (92), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 69/318 (21%), Positives = 123/318 (38%), Gaps = 25/318 (7%)

Query: 74  LFDVLSKDLNAKVSQQPWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYVVVVIWSLI 133
           L D ++ +  A +    W+ AS+ L +  F  + GK+ DI+G K  LL   ++  +  L+
Sbjct: 175 LLDYIASEFEA-LPYISWIAASYLLSACIFQPLYGKLSDIFGRKAILLFSNLMFGLGCLV 233

Query: 134 CGLSSYAHNVDFFVVARSFQGLGIAFVLPNVMGIVGNIYKPNTEAKNLVFSLIGACAPIG 193
           CG    A  V + +  R   G+G   +      I+ +I    + A      L   C  +G
Sbjct: 234 CGT---APTVWWLLAGRFVAGIGGGGLTSMPSIIISDIVPLRSRASYQ--DLFNICYVLG 288

Query: 194 ATLGCVFSGLIGARTDLWGWTFYAYAITAALNG--LVALWIIP-----------NNIPTN 240
            TLG    G + A    W   F    + A ++G  + A  I+P           N     
Sbjct: 289 ITLGGSMGGWL-AEYGGWRLVFLLQVVAALISGCFIQAFLILPKVHHGNGIALANKESLK 347

Query: 241 VNEYKMDWIGSAIGVFGLILF-NFVWNQAPIAGWGSAYXXXXXXXXXXXXXXFITYEIRF 299
              Y MDW+G+    F L++F   +     +      +              F+ +E+  
Sbjct: 348 TKLYMMDWLGT----FCLVIFLASLTLTCSLVDLNFNFLLLLILLMFVSGYYFVYHELNI 403

Query: 300 AKQPLLPHSVLFNRKLMMILSSLFFGWGSFGIWTFYYMSFMLNLRHYSPLWAGGTYFMFA 359
           A  P+L   +L +R ++    + FF   +  +  FY   +  ++ +  P   G    +  
Sbjct: 404 AADPILSVHLLTDRNVLASSLANFFCMLNDVLTIFYVPMYFASVLYMGPKEIGKRTIISF 463

Query: 360 IWGIVASLLVGYTIHKTG 377
           +   + S   GY I + G
Sbjct: 464 LGTSIGSFGTGYYIKRRG 481

>TBLA0F03040 Chr6 complement(735352..738072) [2721 bp, 906 aa] {ON}
           Anc_8.272 YDR119W
          Length = 906

 Score = 40.0 bits (92), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 70/308 (22%), Positives = 118/308 (38%), Gaps = 27/308 (8%)

Query: 85  KVSQQPWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYVVVVIWSLICGLSSYAHNVD 144
           ++ + PW+  S+ L S  F  + GK+ DI+G K  L+   ++     +ICG+S   ++++
Sbjct: 430 QIPKVPWVATSYLLSSAVFQPLYGKLSDIFGRKALLIFSNLIFFFGCIICGMS---NSLN 486

Query: 145 FFVVARSFQGLGIAFVLPNVMGIVGNIYKPNTEAKNLVFSLIGACAPIGATLGCVFSGLI 204
             V  R   G+G   +       V +I    + A   V+   G C      LG  F G+I
Sbjct: 487 MLVWGRFVAGIGGGGITSMTTITVSDIVPLRSRA---VYQ--GICNFFFG-LGTAFGGVI 540

Query: 205 GA--RTDLWGWTFYAYAITAALNGLVALWIIPNNIPTNVNEY---------KMDWIGSAI 253
           G       +GW    ++    ++GL  L I    +   +  Y         ++DW+GS  
Sbjct: 541 GGIFVDHQYGWRMVFWS-QVPVSGLSTLLICSFLVVPRIKNYEVSLGRKLMRVDWLGSIS 599

Query: 254 GVFGLILFNFVWNQAPIAGWG----SAYXXXXXXXXXXXXXXFITYEIRFAKQPLLPHSV 309
            +  L  F  +     + G      S                F+  E+  A  P+LP   
Sbjct: 600 MILWLTSFLLITTM--MGGISLDIDSDQFHYLIMFSSVSAIIFVLTELFVASDPVLPLRF 657

Query: 310 LFNRKLMMILSSLFFGWGSFGIWTFYYMSFMLNLRHYSPLWAGGTYFMFAIWGIVASLLV 369
           L NR ++      FF    F    FY   +  ++   SP   G       +   + SL  
Sbjct: 658 LSNRSVLGASLGNFFCVMGFMTICFYLPIYFASVLDISPTGIGKRMAPNFLCTALGSLGA 717

Query: 370 GYTIHKTG 377
           G  + +TG
Sbjct: 718 GVYMKQTG 725

>ZYRO0F14652g Chr6 complement(1207106..1208806) [1701 bp, 566 aa]
           {ON} similar to uniprot|P38125 Saccharomyces cerevisiae
           YBR180W DTR1 Multidrug resistance dityrosine transporter
           of the major facilitator superfamily essential for spore
           wall synthesis facilitates the translocation of
           bisformyl dityrosine through the prospore membrane
          Length = 566

 Score = 39.7 bits (91), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 29/116 (25%), Positives = 49/116 (42%), Gaps = 2/116 (1%)

Query: 137 SSYAHNVDFFVVARSFQGLGIAFVLPNVMGIVGNIYKPNTEAKNLVFSLIGACAPIGATL 196
           +S   N+    V R FQ  G +  +    G V +I  P    K + + ++G    +G  L
Sbjct: 183 ASVPANIGALYVLRVFQAFGSSSAISLGTGTVTDITPPKHRGKAIGYFMMGPN--MGPIL 240

Query: 197 GCVFSGLIGARTDLWGWTFYAYAITAALNGLVALWIIPNNIPTNVNEYKMDWIGSA 252
             + SGLI   +D W W F   +I + +  +  + I+P  +   V      W  S+
Sbjct: 241 APIISGLILMESDAWRWLFGFTSIMSGIAFIAVVLILPETLRCIVGNGDQRWKKSS 296

>TDEL0D06610 Chr4 complement(1195341..1196834) [1494 bp, 497 aa]
           {ON}  possible pseudogene; N added at two sites to avoid
           frameshifts
          Length = 497

 Score = 39.7 bits (91), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 38/85 (44%), Gaps = 3/85 (3%)

Query: 74  LFDVLSKDLNAKVSQQPWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYVVVVIWSLI 133
           L D LS   +   +   W + S+ +    FI   G++GDI G  +          I SL+
Sbjct: 51  LIDELSTKYSISYTTASWSLTSYAVTFAGFIAFMGRLGDIVGNSRLFTVSCGCFAILSLL 110

Query: 134 CGLSSYAHNVDFFVVARSFQGLGIA 158
           CGL     N + F V R+ QG+  A
Sbjct: 111 CGL---MPNFEAFAVMRALQGIAAA 132

>CAGL0J09020g Chr10 (889269..891839) [2571 bp, 856 aa] {ON} highly
           similar to uniprot|P10870 Saccharomyces cerevisiae
           YDL194w SNF3 or uniprot|Q12300 Saccharomyces cerevisiae
           YDL138w RGT2
          Length = 856

 Score = 39.7 bits (91), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 26/77 (33%), Positives = 41/77 (53%), Gaps = 5/77 (6%)

Query: 86  VSQQPWLMASFPLVSGSFI--LVSGKVGDIYGLKKTLLGGYVVVVIWSLICGLSSYAHNV 143
            +QQ  ++ SF L  G+F+  L +  + D YG KKT++  +   V++SL   L   AHN+
Sbjct: 161 TAQQLAILVSF-LSLGTFVGALSAPVISDKYGRKKTIM--FSTAVVFSLGNSLQVGAHNI 217

Query: 144 DFFVVARSFQGLGIAFV 160
              +  R   GLG+  V
Sbjct: 218 QLLIAGRVISGLGVGLV 234

>KNAG0A03540 Chr1 (450487..452103) [1617 bp, 538 aa] {ON} Anc_8.570
           YBR180W
          Length = 538

 Score = 38.9 bits (89), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 45/180 (25%), Positives = 82/180 (45%), Gaps = 13/180 (7%)

Query: 74  LFDVLSKDLNAKVSQQPWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYVVVVIWSLI 133
           +F   +  +NA VS    + A  PL+ G++  V G+   +Y L   L+  ++V V+    
Sbjct: 106 IFHTSTSTINATVSVFMAVFAVGPLLWGAYADVGGR-KILYLLSLALM--FIVNVL---- 158

Query: 134 CGLSSYAHNVDFFVVARSFQGLGIAFVLPNVMGIVGNIYKPNTEAKNLVFSLIGACAPIG 193
             L+S + N+    + R  Q    + V+    G V ++  P+   K + + ++G    +G
Sbjct: 159 --LASLSPNIVALFILRIAQAFASSSVIALGAGTVTDLIVPSARGKAIGYFMMGP--NMG 214

Query: 194 ATLGCVFSGLIGARTDLWGWTFYAYAITAALNGLVALWI-IPNNIPTNVNEYKMDWIGSA 252
             +  + +GLI   TD W W F   AI + +  L+ +WI +P  +   V      W G +
Sbjct: 215 PVIAPIVAGLILINTDRWRWLFGFCAIMSGV-ALLCVWIFLPETLRCIVGNGDPSWKGES 273

>TDEL0A02490 Chr1 (446429..448093) [1665 bp, 554 aa] {ON} Anc_2.473
           YMR088C
          Length = 554

 Score = 38.9 bits (89), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 84  AKVSQQPWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYVVVVIWSLICGLSSYAHNV 143
           ++  ++ W+  SF L + +F  + GK+ D+ G K  LL  Y  +VI    C L+  A NV
Sbjct: 67  SESDKKQWIATSFLLTNTAFQPLYGKLSDVTGRKFALLMAYFFLVIG---CLLTCLARNV 123

Query: 144 DFFVVARS 151
             F VAR+
Sbjct: 124 TEFAVARA 131

>ZYRO0G21868g Chr7 complement(1799212..1801074) [1863 bp, 620 aa]
           {ON} weakly similar to uniprot|Q04301 Saccharomyces
           cerevisiae YMR088C VBA1 Permease of basic amino acids in
           the vacuolar membrane
          Length = 620

 Score = 39.3 bits (90), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 44/160 (27%), Positives = 75/160 (46%), Gaps = 21/160 (13%)

Query: 8   DEENWE-KLQSSSA-----AGEERDGQTEAIGPKSRLQNPDYFDKPWKEYIFVLSSM--- 58
           D++N +  +QSSS      +G E  G  E  G K   ++ +   +  K + +VL+S+   
Sbjct: 54  DKQNVQLTVQSSSENDSYKSGREHSGALE--GNKEDEEDLEIDLRDPKTFKWVLTSLWTN 111

Query: 59  --LSQLLNQAATTQTNPLFDVLSKDLNAKVSQQPWLMASFPLVSGSFILVSGKVGDIYGL 116
             LS L     +T  N   DV S+   A  S   W+  ++ L + +   + GK+ DI G 
Sbjct: 112 SALSALDGTIVSTTVN---DVASRFQQA--SMVTWVATAYLLTTTAAQPLYGKISDIIGR 166

Query: 117 KKTLLGGYVVVVIWSLICGLSSYAHNVDFFVVARSFQGLG 156
           +K LL G +V  +     GL  ++ ++    +AR   G+G
Sbjct: 167 RKCLLFGEIVFAVG---VGLCIFSKSIPQLAIARGICGIG 203

>KLLA0A04631g Chr1 complement(415070..416809) [1740 bp, 579 aa] {ON}
           weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 579

 Score = 38.9 bits (89), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 33/138 (23%), Positives = 60/138 (43%), Gaps = 16/138 (11%)

Query: 19  SAAGEERDGQTEAIGPKSRLQNPDYFDKPWKEYIFVLSSMLSQLLNQAATTQTNPLFDVL 78
            +  E R+G   +   ++RL            +I + S  L   L     T    L   +
Sbjct: 41  ESEDEAREGLQVSEMSRARL------------HIIISSMCLGSFLAALDNTIVTTLLSHI 88

Query: 79  SKDLNAKVSQQPWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYVVVVIWSLICGLSS 138
           + + N ++S   W+  ++ L S +F  + GK+ DI+G +  ++   +  ++  LICGLS 
Sbjct: 89  ASEFN-ELSHISWIATAYLLSSATFQPLYGKISDIFGRRPLIIISNLFFILGCLICGLS- 146

Query: 139 YAHNVDFFVVARSFQGLG 156
              N+   V  R   G+G
Sbjct: 147 --KNLWTLVAGRFIAGIG 162

>KLTH0H05456g Chr8 (484160..485866) [1707 bp, 568 aa] {ON} similar
           to uniprot|Q04301 Saccharomyces cerevisiae YMR088C VBA1
           Permease of basic amino acids in the vacuolar membrane
          Length = 568

 Score = 38.9 bits (89), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 33/156 (21%), Positives = 68/156 (43%), Gaps = 17/156 (10%)

Query: 1   MNMKENDDEENWEKLQSSSAAGEERDGQTEAIGPKSRLQNPDYFDKPWKEYIFVLSSMLS 60
           + + E    +    + S    GEE D + +        ++P+ F  P+      L++ + 
Sbjct: 11  IELDEIHSSKGESTVPSFPDTGEEEDLEKD-------FRDPNTF--PYILLSLWLNTSIC 61

Query: 61  QLLNQAATTQTNPLFDVLSKDLNAKVSQQPWLMASFPLVSGSFILVSGKVGDIYGLKKTL 120
            +     +T  N +  +  +      S+  W+  ++ L + +   + GK  D+ G KK L
Sbjct: 62  AVDGTIISTTMNEIASIFQE-----ASKVTWVATAYMLTTCAVQPLYGKTSDLLGRKKCL 116

Query: 121 LGGYVVVVIWSLICGLSSYAHNVDFFVVARSFQGLG 156
           L   VV ++  ++CG    A  ++  +VAR+  G+G
Sbjct: 117 LFAEVVFIVGLVMCG---AARTIEELIVARAICGVG 149

>SAKL0A08228g Chr1 complement(732518..734227) [1710 bp, 569 aa] {ON}
           similar to uniprot|P33335 Saccharomyces cerevisiae
           YPR198W SGE1 Member of drug-resistance protein family
           multicopy suppressor of gal11 null mutation
          Length = 569

 Score = 38.5 bits (88), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 33/143 (23%), Positives = 65/143 (45%), Gaps = 7/143 (4%)

Query: 74  LFDVLSKDLNAKVSQQPWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYVVVVIWSLI 133
           + + ++   NA  S+  WL+  + L +  F L+ G+   I+G K TL+   ++  I SL+
Sbjct: 43  ILNTIADKFNA-YSKIGWLITGYSLSNALFTLLWGRFAVIFGSKTTLMVSIIIFEIGSLV 101

Query: 134 CGLSSYAHNVDFFVVARSFQGLGIAFVLPNVMGIVGNIYKPNTEAKNLVFSLIGACAPIG 193
             +S   +++D  +  R   G G + +   V  I  ++   +T  +  + +L+     + 
Sbjct: 102 IAVS---NSMDMIIGGRVIAGCGASGIQTLVFAIATSLVDEHT--RGTIVTLLSLSYAVA 156

Query: 194 ATLGCVFSGLIGARTDLWGWTFY 216
           + LG    G +      W W FY
Sbjct: 157 SALGPYIGGALTEYVT-WRWCFY 178

>NDAI0C05670 Chr3 complement(1310115..1311617) [1503 bp, 500 aa]
           {ON} Anc_8.570
          Length = 500

 Score = 38.1 bits (87), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 26/113 (23%), Positives = 46/113 (40%), Gaps = 2/113 (1%)

Query: 136 LSSYAHNVDFFVVARSFQGLGIAFVLPNVMGIVGNIYKPNTEAKNLVFSLIGACAPIGAT 195
           L++   ++      R  Q  G + V+    G V +I  P    K + + ++G    IG  
Sbjct: 115 LAAVPSHIGALFAMRVVQAFGSSSVITLGAGTVTDITPPKHRGKAIAYFMMGP--NIGPV 172

Query: 196 LGCVFSGLIGARTDLWGWTFYAYAITAALNGLVALWIIPNNIPTNVNEYKMDW 248
           +  + +GLI  + D W W F   AI + +     +  +P  +   V  Y   W
Sbjct: 173 IAPIIAGLILMKGDYWRWLFGFTAIMSGIGLFAIIIFLPETLRCIVGNYDPRW 225

>Smik_16.81 Chr16 complement(152022..153515,153516..153899) [1878
           bp, 625 aa] {ON} YGR224W (REAL)
          Length = 625

 Score = 38.1 bits (87), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 40/213 (18%), Positives = 94/213 (44%), Gaps = 10/213 (4%)

Query: 4   KENDDEENWEKLQSSSAAGEERDGQTEAIGPKSRLQNPDYFDKPWKEYIFVLSSMLSQLL 63
           ++++ +  +   Q  +    E D   E   P+  ++      K    Y+ +++  LS  L
Sbjct: 17  QQHEQKRQFAVDQKFAHTSSEHD---ETSIPEDNVKKNVELSKGSILYVSLVAVALSLFL 73

Query: 64  NQAATTQTNPLFDVLSKDLNAKVSQQPWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGG 123
                   + + + ++K L +  S+  WL   + L +   +L+ G++    G K T+L  
Sbjct: 74  AALDVMIVSTIIEEVAKQLGS-YSEIGWLFTGYSLPNALLVLIWGRIATPIGFKATMLFA 132

Query: 124 YVVVVIWSLICGLSSYAHNVDFFVVARSFQGLGIAFVLPNVMGIVGNIYKPNTEAKNLVF 183
            V+  I SLI  L+S   +++  +  R   G+G    + ++  ++G+     ++ + ++ 
Sbjct: 133 IVIFEIGSLISALAS---SMNMLIGGRVIAGIG-GCGIQSLSFVIGSTLVEESK-RGMLI 187

Query: 184 SLIGACAPIGATLGCVFSGLIGARTDLWGWTFY 216
           +++ +   I + +G    G+  +    W W FY
Sbjct: 188 AILSSSFAIASVVGPFLGGVFTSSVT-WRWCFY 219

>ACL172C Chr3 complement(58313..60208) [1896 bp, 631 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR043C
          Length = 631

 Score = 38.1 bits (87), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 33/137 (24%), Positives = 66/137 (48%), Gaps = 12/137 (8%)

Query: 110 VGDIYGLKKTLLGGYVVVVIWSLICGLSSYAHNVDFFVVARSFQGLGIAFVLPNVMGIVG 169
           + D  G +   +  + ++V++S+    ++++ N++ F++ R   G   A V     G + 
Sbjct: 154 LADKNGRRTVYVLSFALLVVFSVG---TAFSRNIETFIILRILCGAASASVQSVGAGTIA 210

Query: 170 NIYKPNTEAKNLVFSLIGAC-APIGATLGCVFSGLIGARTDLWGW--TFYAYAITAALNG 226
           ++Y P    +NL +  +G   AP+   L  + S L+  R   W W  T +   I AAL  
Sbjct: 211 DLYVPEERGRNLGYYYLGPLMAPL---LSPIVSSLLVNR---WSWRSTQWFMVILAALTF 264

Query: 227 LVALWIIPNNIPTNVNE 243
           L+ ++ +P  + T  N+
Sbjct: 265 LLLVFALPETLRTQDNK 281

>Kpol_467.24 s467 (55523..56632) [1110 bp, 370 aa] {ON}
           (55523..56632) [1110 nt, 370 aa]
          Length = 370

 Score = 37.7 bits (86), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 47/185 (25%), Positives = 79/185 (42%), Gaps = 19/185 (10%)

Query: 39  QNPDYFDKPWKEYIFVLSSM-------LSQLLNQAATTQTNPLFDVLSKDLNAKVSQQPW 91
           Q+ D  D+ + +Y   L          L   L+   +T    + + ++++      +Q W
Sbjct: 15  QHCDALDEEYTKYNLSLPKFPILVSLWLGSFLSSIDSTIVANIMNKVAEEFQESQEKQ-W 73

Query: 92  LMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYVVVVIWSLICGLSSYAHNVDFFVVARS 151
           +  SF L + +F  + GK+ DI G K  LL     +  + L C L+S + N+  F +AR+
Sbjct: 74  IATSFLLTNTAFQPLYGKLSDITGRKFALLTA---LSFFGLGCFLTSLSTNIKQFAIARA 130

Query: 152 FQGLGIAFVLPNVMGIVGNIYKPNTEA-----KNLVFSLIGACAPIGATLGCVFSGLIGA 206
             G+G   +       VG+I             N+VF   G    +GA +G +F   IG 
Sbjct: 131 ICGIGGGGINAISSITVGDICTAKDRGIYQGYANIVF---GMGQLLGAPVGGLFIATIGW 187

Query: 207 RTDLW 211
           R   W
Sbjct: 188 RALFW 192

>Kwal_56.23754 s56 complement(690851..692620) [1770 bp, 589 aa] {ON}
           YBR293W - Hypothetical ORF [contig 173] FULL
          Length = 589

 Score = 37.7 bits (86), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 98/445 (22%), Positives = 171/445 (38%), Gaps = 64/445 (14%)

Query: 39  QNPDYFDKPWKEYIFVLSSMLSQLLNQAATTQTNPLFDVLSKDLNAKVSQQPWLMASFPL 98
           + P++     +  I ++S  L   L     T  + L   +  + N+ + +  W+  S+ L
Sbjct: 70  ETPEFALSSSRIRIIMISMFLGIFLAALDGTIVSTLLTRIGSEFNS-LDKVSWIATSYLL 128

Query: 99  VSGSFILVSGKVGDIYGLKKTLLGGYVVVVIWSLICGLSSYAHNVDFFVVARSFQGLGIA 158
            S +   + GK+ D  G K  L+   VV  I  LICG+S+   ++ + VV R   G+G  
Sbjct: 129 SSSTCQPLYGKLSDQLGRKPLLVFSNVVFSIGCLICGMST---SIWWVVVGRFVSGIGGC 185

Query: 159 FVLPNVMGIVGNIYKPNTEAKNLVFSLIGACAPIGATLGCVFSGLIGARTDLWGWTFYAY 218
            +      ++ ++      A   V+   G C  I   LG    GL+GA    W   F   
Sbjct: 186 GLTCLASMVISDLVPLRERA---VYQ--GLCNFIFG-LGTASGGLVGAAFQDWRMAFTIQ 239

Query: 219 A-ITAALNGLVALWI-IPNNIPTNVNEY------KMDWIGSAIGVFGLILFNFVWN-QAP 269
             I+ A   L+  ++ +P     + + +       +DW G    V  L LF  V +    
Sbjct: 240 CPISLASCALIVSYLELPPRHEDDKDRHWTSKLRDLDWAGVVTLVCFLFLFMLVSSLGGK 299

Query: 270 IAGWGSAYXXXXXXXXXXXXXXFITYEIRFAKQPLLPHSVLFNRKLMMILSSLFFGWGSF 329
              + S                F   E+  A  P+LP + L  R    +L S    W   
Sbjct: 300 EIAYDSVLFALLCVTTLVLGSIFAYVELYVAVDPVLPIAFLKYRS---VLGSSLANW--- 353

Query: 330 GIWTFYYMSFMLNLRHYSPL-WAG---------GTYFMFAIWGIV-ASLLVGYTIHKTGP 378
                + M  ML   +Y P+ WA          G   + + + +   SL  G  + +TG 
Sbjct: 354 -----FAMMSMLTTNYYLPVYWASVLNMKPTDIGKRSIPSFFSVAFGSLGAGIYMKRTGK 408

Query: 379 AVILFLSMVAFDCGC---------IMLAVTPVHQTYFRMTLGIMIILSFGMDLSFPAASI 429
               +  ++AF CG          ++   TPV Q Y      ++++ SFG+ +      +
Sbjct: 409 ---YYWFLLAF-CGIGILGQLKINLLTPATPVWQQYL-----LLVVPSFGLSVLITVTLL 459

Query: 430 ILSDQLPSQYQGMAGSLVSTMISYS 454
            +   +P ++        +T ISY+
Sbjct: 460 AMISAVPHEHHA-----ATTSISYA 479

>KLTH0E13222g Chr5 complement(1175450..1177150) [1701 bp, 566 aa]
           {ON} similar to uniprot|P38125 Saccharomyces cerevisiae
           YBR180W DTR1 Multidrug resistance dityrosine transporter
           of the major facilitator superfamily essential for spore
           wall synthesis facilitates the translocation of
           bisformyl dityrosine through the prospore membrane
          Length = 566

 Score = 37.7 bits (86), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 65/275 (23%), Positives = 106/275 (38%), Gaps = 30/275 (10%)

Query: 6   NDDEENWEKLQSSSAAGEERDGQTEAIGPKSRLQNPDY--FDKPWKEYIFVLS------S 57
           N D E+ EK   S    EE     +A    S   +P Y  F +     IF++        
Sbjct: 63  NVDIES-EKEHPSGKLKEEELKTEDADQNLSEQPDPPYTAFSQRQVLVIFIIVIFVGFLG 121

Query: 58  MLSQLLNQAATTQTNPLFDVLSKDLNAKVSQQPWLMASFPLVSGSFILVSGKVGDIYGLK 117
            LS  +   A      +F + +  +NA VS    + A  PL+  SF        D  G K
Sbjct: 122 PLSGNIYIPALPILQNVFGLSATAINATVSVFMAVFAVGPLIWASF-------ADFGGRK 174

Query: 118 KTLLGGYVVVVIWSLICGLSSYAHNVDFFVVARSFQGLGIAFVLPNVMGIVGNIYKPNTE 177
              +   ++ V+ +++  L+S   NV      R  Q    + V+    G V +I  P   
Sbjct: 175 ILYMISLLMTVVVNVL--LASVPVNVGALFTLRVVQAFASSSVMALGAGTVSDIRPPKVR 232

Query: 178 AKNLVFSLIGACAPIGATLGCVFSGLIGARTDLWGWTFYAYAITAALNGLVALWIIPNNI 237
            K + + ++G    +G  L  + +GLI      W W F    I +    L+ + ++P  +
Sbjct: 233 GKAIAYFMLGP--NMGPILAPIIAGLILMHGSYWRWLFGFTCILSGFGLLMVVVLLPETL 290

Query: 238 PTNVNEYKMDW--------IG--SAIGVFGLILFN 262
              V    + W        IG    I V GL++F+
Sbjct: 291 RCIVGNGDIKWRDCEEKDNIGPTRTISVAGLLIFS 325

>SAKL0E02992g Chr5 complement(243652..245364) [1713 bp, 570 aa] {ON}
           similar to uniprot|Q04301 Saccharomyces cerevisiae
           YMR088C VBA1 Permease of basic amino acids in the
           vacuolar membrane
          Length = 570

 Score = 37.4 bits (85), Expect = 0.080,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 35/64 (54%), Gaps = 3/64 (4%)

Query: 88  QQPWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYVVVVIWSLICGLSSYAHNVDFFV 147
           ++ W+  SF L + +F  + GK+ DI G K  LL   V    + L C L+ +A NV  F 
Sbjct: 87  KKQWIATSFLLTNTAFQPLYGKLSDITGRKFALL---VAHTFFCLGCLLTCFARNVTEFS 143

Query: 148 VARS 151
           +AR+
Sbjct: 144 IARA 147

>SAKL0F00440g Chr6 complement(36452..38086) [1635 bp, 544 aa] {ON}
           conserved hypothetical protein
          Length = 544

 Score = 37.4 bits (85), Expect = 0.085,   Method: Compositional matrix adjust.
 Identities = 29/129 (22%), Positives = 53/129 (41%), Gaps = 8/129 (6%)

Query: 35  KSRLQNPDYFDKPWKEYIFVLSSMLSQLLNQAATTQTNPLFDVLSKDLNAKVSQQPWLMA 94
           +S  QN  +    +   + ++ S    L+N  A          +      + +   W + 
Sbjct: 13  RSNFQNISF--HRYINLVLIMVSCAFDLINVTAVLSAT---RDIENTYQIEFTTASWALT 67

Query: 95  SFPLVSGSFILVSGKVGDIYGLKKTLLGGYVVVVIWSLICGLSSYAHNVDFFVVARSFQG 154
           ++ +    FI   G+VGDI G     +    +  I SLIC +    +N   F V R+ QG
Sbjct: 68  AYAITFAGFIAFLGRVGDIIGNSVLFVSSCFLFSILSLICAV---VNNFGTFAVFRALQG 124

Query: 155 LGIAFVLPN 163
           +  A ++P+
Sbjct: 125 IAAAGIVPS 133

>Smik_2.320 Chr2 (575945..577663) [1719 bp, 572 aa] {ON} YBR180W
           (REAL)
          Length = 572

 Score = 37.4 bits (85), Expect = 0.086,   Method: Compositional matrix adjust.
 Identities = 31/141 (21%), Positives = 61/141 (43%), Gaps = 4/141 (2%)

Query: 108 GKVGDIYGLKKTLLGGYVVVVIWSLICGLSSYAHNVDFFVVARSFQGLGIAFVLPNVMGI 167
           G + D  G K   +    +++I +++  L++   N+    V R FQ    + V+    G 
Sbjct: 167 GALADFGGRKFLYMASLSLMLIVNIL--LAAVPVNIAALFVLRVFQAFASSSVISLGAGT 224

Query: 168 VGNIYKPNTEAKNLVFSLIGACAPIGATLGCVFSGLIGARTDLWGWTFYAYAITAALNGL 227
           V ++  P    K + + ++G    +G  +  + +GLI  + D W W F   AI A +  +
Sbjct: 225 VTDVVPPKHRGKAIAYFMMGPN--MGPIIAPIVAGLILMKGDYWRWLFGFTAIIAGIALI 282

Query: 228 VALWIIPNNIPTNVNEYKMDW 248
           +   ++P  +   V      W
Sbjct: 283 LVSALLPETLRCIVGNGDPRW 303

>ZYRO0G00352g Chr7 (27042..28526) [1485 bp, 494 aa] {ON} weakly
           similar to uniprot|P53322 Saccharomyces cerevisiae
           YGR260W
          Length = 494

 Score = 37.4 bits (85), Expect = 0.095,   Method: Compositional matrix adjust.
 Identities = 52/224 (23%), Positives = 90/224 (40%), Gaps = 26/224 (11%)

Query: 1   MNMKENDDEENWEKLQSSSAAGE-----ERDGQTEAIGPKSRLQNPDYFDKPWKEYIFVL 55
           + +++N++ +     +S  +  E     E D   +    +  L+  D    P   +++ L
Sbjct: 6   LTLRKNNESQKANGEESIVSLTENSEFIEEDLYIDKYEERKLLKKLDIRLLPMLAFMYFL 65

Query: 56  SSMLSQLLNQAATTQTNPLFDVLSKDLNAKVS--QQPWLMASFPLVSGSFILVSGKVGDI 113
           SS+    +  A T+       + SK  +  VS     +L A  P V     LV       
Sbjct: 66  SSLDRSNIANAYTSGMKEDLGLTSKQYSNCVSVFYSTYLAAELPAV-----LV------- 113

Query: 114 YGLKKTLLGGYV--VVVIWSLICGLSSYAHNVDFFVVARSFQGLGIAFVLPNVMGIVGNI 171
             LK+T +  Y+  +V  WS+I   S +  +    +  R   G       P +  I+  +
Sbjct: 114 --LKRTNVKYYMSFLVFSWSIITLCSGFVKSHKSLLALRVLLGTFEGGFFPAMTLIISIV 171

Query: 172 YKPNTEAKNLVFSLIGACAPIGATLGCVFSGLIGART--DLWGW 213
           YKP  +AK + F   G+ A  GA  G + +GL   +    L GW
Sbjct: 172 YKPQEQAKRIAF-FFGSSALSGAFGGLIATGLASVKDAGGLEGW 214

>KAFR0I00710 Chr9 (139612..141339) [1728 bp, 575 aa] {ON} Anc_8.570
           YBR180W
          Length = 575

 Score = 37.4 bits (85), Expect = 0.098,   Method: Compositional matrix adjust.
 Identities = 44/174 (25%), Positives = 71/174 (40%), Gaps = 11/174 (6%)

Query: 75  FDVLSKDLNAKVSQQPWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYVVVVIWSLIC 134
           ++V S  +NA VS    + A  PL  G F  V G+   I  L   LL   + V+      
Sbjct: 128 YNVSSTTINATVSVFMAVFAVGPLFWGMFADVGGR--KILYLISLLLMTLINVL------ 179

Query: 135 GLSSYAHNVDFFVVARSFQGLGIAFVLPNVMGIVGNIYKPNTEAKNLVFSLIGACAPIGA 194
            LS    N+    V R  Q    + V+    G + +I  P    K + + +IG    +G 
Sbjct: 180 -LSVLPTNIAALFVLRILQAFSSSSVITLGAGTITDITPPKHRGKAIGYFMIGPN--MGP 236

Query: 195 TLGCVFSGLIGARTDLWGWTFYAYAITAALNGLVALWIIPNNIPTNVNEYKMDW 248
            +  + +GLI  + + W W F   +I + +  +V L  +P  +   V      W
Sbjct: 237 IVAPIIAGLILMKGNYWRWLFGFTSIMSGVAFIVVLIFLPETLRCKVGNGDPGW 290

>SAKL0H16808g Chr8 complement(1477137..1479110) [1974 bp, 657 aa]
           {ON} weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 657

 Score = 37.0 bits (84), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 37/69 (53%), Gaps = 3/69 (4%)

Query: 72  NPLFDVLSKDLNAKVSQQP---WLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYVVVV 128
           N +   L   + ++ ++ P   W+  ++ L S +F  + GK+ DI+G K  L+   V+  
Sbjct: 146 NTIVSTLLAHIASEFNEMPHISWIATAYLLSSATFQPLYGKISDIFGRKPLLIFSNVMFA 205

Query: 129 IWSLICGLS 137
           +  LICGLS
Sbjct: 206 LGCLICGLS 214

>Kwal_56.22949 s56 complement(342503..344431) [1929 bp, 642 aa] {ON}
           YBR043C (AQR2) - YBR043C [contig 184] FULL
          Length = 642

 Score = 37.0 bits (84), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 27/93 (29%), Positives = 44/93 (47%), Gaps = 10/93 (10%)

Query: 125 VVVVIWSLICGL---SSYAHNVDFFVVARSFQGLGIAFVLPNVMGIVGNIYKPNTEAKNL 181
           V V+ ++L+C     S+ A N++ F+V R   G   A V     G V ++YKP    K L
Sbjct: 160 VYVLSFTLLCAFCIGSALAPNIEAFIVFRMLCGASSASVQSVGAGTVADLYKPEDRGKRL 219

Query: 182 VFSLIGACAPIGATLGCVFSGLIGA-RTDLWGW 213
            +  +GA       +  + S +IG+   + W W
Sbjct: 220 GYYYLGAL------MAPLLSPIIGSLLVNRWSW 246

>Kwal_14.1585 s14 (377103..378815) [1713 bp, 570 aa] {ON} YMR088C -
           Hypothetical ORF [contig 239] FULL
          Length = 570

 Score = 37.0 bits (84), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 37/72 (51%), Gaps = 3/72 (4%)

Query: 85  KVSQQPWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYVVVVIWSLICGLSSYAHNVD 144
           + S   W+  ++ L + S   + GK  D+ G KK LL   VV +I  ++CG+   A  V 
Sbjct: 84  EASLVTWVATAYMLTTCSVQPLYGKTSDLLGRKKCLLFAEVVFIIGLVLCGM---ARTVK 140

Query: 145 FFVVARSFQGLG 156
              +AR+  G+G
Sbjct: 141 ELAIARAICGIG 152

>TBLA0C01100 Chr3 (227542..229491) [1950 bp, 649 aa] {ON} Anc_1.432
          Length = 649

 Score = 37.0 bits (84), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 30/95 (31%), Positives = 41/95 (43%), Gaps = 15/95 (15%)

Query: 105 LVSGKVGDIYGLKKTLLGGYVVVVIWSLICGLSSYAHNVDFFVVARSFQGLGIAF----- 159
           L+S  V D  G K +L   +V  ++W + CG+ S +  V   VV R   G+GI F     
Sbjct: 83  LLSPSVSDALGRKCSL---HVSCILWCIGCGIQSGSTGVAMLVVGRVIAGVGIGFGVAAA 139

Query: 160 -------VLPNVMGIVGNIYKPNTEAKNLVFSLIG 187
                    P V G V  I++    A  LV   IG
Sbjct: 140 PMYCVELAPPRVRGTVVGIFQLAVTAGILVLFFIG 174

>SAKL0H09328g Chr8 (791744..793534) [1791 bp, 596 aa] {ON} similar
           to uniprot|P38125 Saccharomyces cerevisiae YBR180W DTR1
           Multidrug resistance dityrosine transporter of the major
           facilitator superfamily essential for spore wall
           synthesis facilitates the translocation of bisformyl
           dityrosine through the prospore membrane
          Length = 596

 Score = 36.6 bits (83), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 35/159 (22%), Positives = 70/159 (44%), Gaps = 13/159 (8%)

Query: 124 YVVVVIWSLICG--LSSYAHNVDFFVVARSFQGLGIAFVLPNVMGIVGNIYKPNTEAKNL 181
           Y+V ++ ++I    LS+   N+      R  Q  G + V+   +G V +I  P +  + +
Sbjct: 208 YIVSLLLTIIVNILLSAVPTNIGALFFLRIAQAFGSSSVMSLGIGTVSDITPPKSRGRAV 267

Query: 182 VFSLIGACAPIGATLGCVFSGLIGARTDLWGWTFYAYAITAALNGLVALWIIP------- 234
            + ++G    +G  L  + +GLI   ++ W W F    I + +   + + ++P       
Sbjct: 268 SYFMLGPN--MGPILAPIIAGLILMSSNNWRWLFGFICIISGIALFLVVLLLPETLRCIV 325

Query: 235 -NNIPTNVNEYKMDWIGSAIGVFG-LILFNFVWNQAPIA 271
            N  P    +Y++D    A+     L L  F+  Q P++
Sbjct: 326 GNGDPHWREDYQLDAESQALKAGNRLQLCKFIGIQVPVS 364

>KAFR0J01620 Chr10 complement(300964..302676) [1713 bp, 570 aa] {ON}
           Anc_2.241 YIL121W
          Length = 570

 Score = 36.6 bits (83), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 43/168 (25%), Positives = 76/168 (45%), Gaps = 29/168 (17%)

Query: 115 GLKKTLLGGYV------VVVIWSLI-----CGLSSYAHNVDFFVVARSFQGLGIAFVLPN 163
           GL  +L+GG         VV+WS++     C   + + N    ++ R  Q  GI+ V+  
Sbjct: 125 GLSPSLMGGLADSLGRRPVVLWSVVIYFGACIGLALSQNYTQIIILRCLQAAGISPVIAI 184

Query: 164 VMGIVGNIYKPNTEAKNLVF-SLIGACAPIGATLGCVFSGLIGARTDLWGWTFYAYAITA 222
             GI+G++    T+A+   +   +     +G+ LG +    + +R D W   F+  AI +
Sbjct: 185 NSGIMGDV---TTKAERGGYVGYVAGFQILGSALGALIGAALSSRWD-WRAIFWFLAIGS 240

Query: 223 ALNGLVALWIIPNNIPTNVNEYKMDWIGSAIGVFGLILFNFVWNQAPI 270
               LV+ +++P        E K   +G+     G I    V+N+API
Sbjct: 241 GACALVSFFVLP--------ETKRTVVGN-----GSIRPKPVFNRAPI 275

>ZYRO0G21890g Chr7 complement(1801391..1803121) [1731 bp, 576 aa]
           {ON} weakly similar to uniprot|Q04301 Saccharomyces
           cerevisiae YMR088C VBA1 Permease of basic amino acids in
           the vacuolar membrane
          Length = 576

 Score = 36.6 bits (83), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 39/72 (54%), Gaps = 3/72 (4%)

Query: 85  KVSQQPWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYVVVVIWSLICGLSSYAHNVD 144
           + S   W+  ++ L + +   + GK+ DI G +K LL G V+  +  L+C   ++A+ + 
Sbjct: 93  QASMVTWVATAYLLTTTAVQPLYGKISDIIGRRKCLLFGEVIFALGVLLC---NFANTIP 149

Query: 145 FFVVARSFQGLG 156
              +AR+  G+G
Sbjct: 150 QLAIARAICGIG 161

>CAGL0B02079g Chr2 complement(191736..193610) [1875 bp, 624 aa] {ON}
           similar to uniprot|P50080 Saccharomyces cerevisiae
           YGR224w AZR1 or uniprot|P36172 Saccharomyces cerevisiae
           YKR105c
          Length = 624

 Score = 36.6 bits (83), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 29/130 (22%), Positives = 57/130 (43%), Gaps = 6/130 (4%)

Query: 87  SQQPWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYVVVVIWSLICGLSSYAHNVDFF 146
           S+  WL   + L +   +L+ G++  + G K + L   V+  + SL+  L   A+++D  
Sbjct: 78  SKVGWLFTGYSLPNALLVLIWGRIATLVGFKTSTLAAIVIFEVGSLVSAL---ANSMDML 134

Query: 147 VVARSFQGLGIAFVLPNVMGIVGNIYKPNTEAKNLVFSLIGACAPIGATLGCVFSGLIGA 206
           +  R   G+G + V   V  I   + +     + L+ +++ +   I + +G    G    
Sbjct: 135 IGGRVIAGIGGSGVQSLVFVISSTLVEERN--RGLIIAVMSSSFGIASVVGPFLGGAFTT 192

Query: 207 RTDLWGWTFY 216
               W W FY
Sbjct: 193 HVT-WRWCFY 201

>SAKL0D04510g Chr4 complement(360010..361605) [1596 bp, 531 aa] {ON}
           similar to uniprot|P36035 Saccharomyces cerevisiae
           YKL217W JEN1 Lactate transporter, required for uptake of
           lactate and pyruvate; expression is derepressed by
           transcriptional activator Cat8p under nonfermentative
           growth conditions, and repressed in the presence of
           glucose, fructose, and mannose
          Length = 531

 Score = 36.6 bits (83), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 38/176 (21%), Positives = 73/176 (41%), Gaps = 6/176 (3%)

Query: 48  WKEYIFVLSSMLSQLLNQAATTQTNPLFDVLSKDLNAKVSQQPWLMASFPLVSGSFILVS 107
           +K+++F+LS+  S                 +S D +    Q  W +    ++     ++ 
Sbjct: 71  YKQWLFILSAFASFTWEAFDFFTVTLNVKKISHDFDVTTKQVTWGITLVLMLRVVGAVLF 130

Query: 108 GKVGDIYGLKKTLLGGYVVVVIWSLICGLSSYAHNVDFFVVARSFQGLGIAFVLPNVMGI 167
           G +GD YG K + +     +++  +I G     HN  +F++AR+F G+ +  +  N    
Sbjct: 131 GYIGDRYGRKVSFIINLFFMMVLEIITGF--IKHNFKYFLIARAFFGVVLGGIFGNSAAQ 188

Query: 168 VGNIYKPNTEAKNLVFSLIGACAPIGATLGCVFSGLIGART-DLWGWTF-YAYAIT 221
             +   P  EA + +         +G  L  +F+  +   T D W   F +A  IT
Sbjct: 189 CFDDCPP--EAHSFISGFFQQGYTLGYLLAVIFTRALADTTKDRWRSCFWFAAGIT 242

>CAGL0J01375g Chr10 (127843..129537) [1695 bp, 564 aa] {ON} similar
           to uniprot|Q04301 Saccharomyces cerevisiae YMR088c
          Length = 564

 Score = 36.6 bits (83), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 32/141 (22%), Positives = 62/141 (43%), Gaps = 11/141 (7%)

Query: 23  EERDGQTEAIGPKSRLQNPDYFDKPWKEYIF-------VLSSMLSQLLNQAATTQTNPLF 75
           E  D  T  +         D  ++ + E+         VLS  L   L+    T    + 
Sbjct: 2   ENLDETTGLLEQTPDTTEQDALEQEYHEHNLSLPKLPIVLSLWLGSFLSSLDGTIVANIM 61

Query: 76  DVLSKDLNAKVSQQPWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYVVVVIWSLICG 135
           + ++++      +Q W+  S+ L + +F  + GK+ D+ G K  +L  +     + L C 
Sbjct: 62  NRVAEEFQESDKKQ-WIATSYLLTNTAFQPLYGKLSDLTGRKFAVLTAH---FFFGLGCL 117

Query: 136 LSSYAHNVDFFVVARSFQGLG 156
           L+ +A++V  F +AR+  G+G
Sbjct: 118 LTCFANSVTQFAIARAICGVG 138

>KLLA0D11330g Chr4 (970243..971808) [1566 bp, 521 aa] {ON} similar
           to uniprot|P15365 Saccharomyces cerevisiae YJR152W DAL5
           Allantoin permease ureidosuccinate permease expression
           is constitutive but sensitive to nitrogen catabolite
           repression
          Length = 521

 Score = 36.2 bits (82), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 36/120 (30%), Positives = 55/120 (45%), Gaps = 13/120 (10%)

Query: 125 VVVVIWSLICGLSSYAHNVDFFVVARSFQGLGIAFVLPNVMGIVGNIYKPNTEAKNLVFS 184
           + +VIW +I  L   A +   F + R+  G+  AFV P +  I+ N Y   +E    +  
Sbjct: 145 ICIVIWGVIQCLHVTAKSYATFTLLRTLLGVLEAFVSP-IFVIMMNQYYKKSEHFGYIGV 203

Query: 185 LIGACAPIGAT-LGCVFSGLIGARTDLWGWTFYAYAI-------TAALNGLVALWIIPNN 236
           L G C  +G   L C+  GL     +L  +T  AY +           NGL+ L+I+PN 
Sbjct: 204 LYG-CNGLGTVILACISYGLYH---NLGSYTMEAYKVLFIIVGCLTIFNGLLILFIMPNT 259

>SAKL0E08778g Chr5 complement(716961..718763) [1803 bp, 600 aa] {ON}
           similar to uniprot|P40474 Saccharomyces cerevisiae
           YIL121W QDR2 Multidrug transporter required for
           resistance to quinidine barban cisplatin and bleomycin
           member of the major facilitator superfamily of
           transporters conferring multiple drug resistance
           (MFS-MDR)
          Length = 600

 Score = 36.6 bits (83), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 56/242 (23%), Positives = 104/242 (42%), Gaps = 26/242 (10%)

Query: 6   NDDEENWEKLQSSSAAGEERDGQTEAIGPKSRLQNPDY--FDKPWKEYIFVLSSMLSQLL 63
           +D+++  E++   S+A    +            Q P Y  F K  K  + VL +  + L 
Sbjct: 42  DDNQKVIEQISKPSSANPNNE---------KTCQEPPYSRFGKSEKSILAVLCAS-AGLF 91

Query: 64  NQAATTQTNPLFDVLSKDLNAKVSQQPWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGG 123
           +  +     P   ++ +D N         +  + ++ G   ++ G + D  G +  +L  
Sbjct: 92  STISAPIYYPALTIIEEDFNISQEMVNITVVVYFILQGLAPMLMGGLADKVGRRPIVLCS 151

Query: 124 YVVVVIWSLIC-GLSSYAHNVDFFVVARSFQGLGIAFVLPNVMGIVGNIYKPNTEAKNLV 182
              + ++++ C GL+S A N    +  R  Q  GI+ V+    GI+G+I    T+A+   
Sbjct: 152 ---IALYAVACIGLAS-AQNYGEVLFLRCLQSAGISPVVAVNNGIIGDI---TTKAERGG 204

Query: 183 F-SLIGACAPIGATLGCVFSGLIGARTDLWGWT--FYAYAITAALNGLVALWIIPNNIPT 239
           +  L+     IG+  G +    I AR   WGW   F+  AI +  +  VA +++P    T
Sbjct: 205 YLGLMAGTQVIGSAFGALIGAGITAR---WGWRAIFWFLAIGSGFSLAVASFLLPETKRT 261

Query: 240 NV 241
            V
Sbjct: 262 VV 263

>KLLA0E03829g Chr5 (349784..351613) [1830 bp, 609 aa] {ON} highly
           similar to uniprot|Q06451 Saccharomyces cerevisiae
           YPR156C TPO3 Polyamine transport protein
          Length = 609

 Score = 36.2 bits (82), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 59/240 (24%), Positives = 102/240 (42%), Gaps = 26/240 (10%)

Query: 4   KENDDEENWEKLQSSSAAGEERDGQTEAIG-PKSRLQNPDYFDKPWKEYIF-VLSSMLSQ 61
           +E +DEE  E+L S        D + E +    +  +NP  +   W  + + +L S+L  
Sbjct: 126 EEKNDEEPDEELPS------HIDKEVEFVTFVTNDPENPHNWPL-WIRWSYTILMSVLVI 178

Query: 62  LLNQAATTQTNPLFDVLSKDLNAKVSQQPWLMASFPLVSGSFI--LVSGKVGDIYGLKKT 119
            +   +   T  LF V  K     VSQ+  +++   +V G  +  L+   V D+YG +  
Sbjct: 179 AVAYGSACITGGLFTVEEK---FHVSQEVAILSCSLMVIGFSLGPLIWSPVSDLYGRRVA 235

Query: 120 LLGGYVVVVIWSLICGLSSYAHNVDFFVVARSFQGLGIAFVLPNVMGIVGNIYKPNTEAK 179
                 + VI+++ C L   A N+   +V R   G+  +  L  V G + +++   T  +
Sbjct: 236 YFISLGLYVIFNIPCAL---AKNIGTLLVCRFLCGVWSSSGLCLVGGSIADMFPAETRGR 292

Query: 180 NLV-FSLIGACAPIGATLGCVFSGLIGARTDLWGWTFYAYAITAALNGLVALWIIPNNIP 238
            +  F+    C P+   L   F  +   R DL  W   A+A          +WII + IP
Sbjct: 293 AIAFFAYAPYCGPVFGPLVNGFIAISTNRMDLIFWVNMAFA--------GVMWIIVSCIP 344

>ZYRO0E10230g Chr5 complement(850980..852656) [1677 bp, 558 aa] {ON}
           weakly similar to uniprot|Q07824 Saccharomyces
           cerevisiae YLL028W TPO1 Proton- motive-force-dependent
           multidrug transporter of the major facilitator
           superfamily able to transport eight different compounds
           including polyamines quinidine cycloheximide and
           nystatin involved in excess spermidine detoxification
          Length = 558

 Score = 35.8 bits (81), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 45/227 (19%), Positives = 89/227 (39%), Gaps = 15/227 (6%)

Query: 17  SSSAAGEERDGQTEAIGPKSRLQNPDYFDK------PWKEYIFVLSSMLSQL-LNQAATT 69
           S +    +       +  K  LQ  + +DK       WK++  V    + QL +N   + 
Sbjct: 40  SPAEKFRQESSSIHTVNGKRVLQEYEVYDKLGYEFPQWKKWSIVTVIFVCQLSMNFNGSV 99

Query: 70  QTNPLFDVLSKDLNAKVSQQPWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYVVVVI 129
             + L  ++SK+ +            F +  G    +     + YG +  +        I
Sbjct: 100 YPHAL-SLISKEFHVSSQAANTSQMIFKVAYGFGCELWAPWSEEYGRRNIMQLSLFFTNI 158

Query: 130 WSLICGLSSYAHNVDFFVVARSFQGLGIAFVLPNVMGIVGNIYKPNTEAKNLVFSLIGAC 189
           W ++ G    A N    +VAR   G+  A      +G+V ++++P      + + ++ + 
Sbjct: 159 WQILGG---KAPNFGTIIVARFLGGISQAGG-SVTLGVVADMWQPQDHGYAVAYVVLASV 214

Query: 190 APIGATLGCVFSGLIGARTDLWGWTFYAYAITAALNGLVALWIIPNN 236
             +GA +G VF GL+      W W F+   I   +  L+  +++P  
Sbjct: 215 --LGAVIGPVFGGLMEEHLS-WHWNFWIQLIFGGVTQLLHFFLVPET 258

>CAGL0M06281g Chr13 (651932..653560) [1629 bp, 542 aa] {ON} similar
           to uniprot|P38125 Saccharomyces cerevisiae YBR180w DTR1
          Length = 542

 Score = 35.8 bits (81), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 39/174 (22%), Positives = 72/174 (41%), Gaps = 11/174 (6%)

Query: 75  FDVLSKDLNAKVSQQPWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYVVVVIWSLIC 134
           F+V    +NA VS     MA+F +      L  G + D  G K   +    ++VI +++ 
Sbjct: 110 FNVSETTINATVSV---FMATFSISP----LFWGALADKGGRKILYIISISLMVIINIL- 161

Query: 135 GLSSYAHNVDFFVVARSFQGLGIAFVLPNVMGIVGNIYKPNTEAKNLVFSLIGACAPIGA 194
            L+S    +   +  R  Q    + V+    G V ++  P    K + + ++G    +G 
Sbjct: 162 -LASVPKKIGSLIFLRIIQAFASSSVISLGAGTVADLTPPKDRGKAMAYFMLGP--NLGP 218

Query: 195 TLGCVFSGLIGARTDLWGWTFYAYAITAALNGLVALWIIPNNIPTNVNEYKMDW 248
            L  + +GLI    + W W F    I + L  ++ + ++P  +   V      W
Sbjct: 219 ILAPIIAGLILLDNNNWRWLFGFLCIVSGLGLIMVILLLPETLRCIVGNGDRQW 272

>Kwal_34.15746 s34 (37757..39313) [1557 bp, 518 aa] {ON} YGR224W
           (AZR1) - MFS-MDR [contig 274] FULL
          Length = 518

 Score = 35.8 bits (81), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 42/184 (22%), Positives = 72/184 (39%), Gaps = 20/184 (10%)

Query: 91  WLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYVVVVIWSLICGLSSYAHNVDFFVVAR 150
           W + S+ +    FI   G++GDI G          +  ++SL+C +     +   F V R
Sbjct: 67  WALTSYAITFAGFIAFMGRLGDIVGNSVLFTISCFLFTLFSLLCAV---VRDFPTFAVFR 123

Query: 151 SFQGLGIAFVLPNVMGIVGNIYKPNTEAKNLVFSLIGACAPIGATL-------------- 196
           + QG+  A ++P    ++  + +P    K       G  + IG  L              
Sbjct: 124 ALQGISAAGIVPCGYALIPLLAEPQDIQKFFSIVSCGFSSTIGIGLIVGGAFALTKVGYA 183

Query: 197 GCVFSGLIGARTDLWGWTFYAYAITAALNGLVALWIIPNNIPTNVNEYKMDWIGSAIGVF 256
           G  +    G        +FY Y I       V +  IP++ P   +   +D++GS I V 
Sbjct: 184 GIFYLSFAGMLVVSIAASFYTYRIEERKFLEVKVEDIPHDHPKVAS---LDFVGSLIFVS 240

Query: 257 GLIL 260
           G +L
Sbjct: 241 GSVL 244

>YIL120W Chr9 (134417..136108) [1692 bp, 563 aa] {ON}  QDR1Multidrug
           transporter of the major facilitator superfamily,
           required for resistance to quinidine, ketoconazole,
           fluconazole, and barban
          Length = 563

 Score = 35.8 bits (81), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 47/218 (21%), Positives = 85/218 (38%), Gaps = 21/218 (9%)

Query: 4   KENDDEENWEKLQSSSAAGEERDGQTEAIGPKSRLQNPDYFDK-PWKEY------IFVLS 56
           +E  D  N ++  SSS A  + D   E     S + N   FD  P+  +      + V+ 
Sbjct: 19  REGSDNNNVDR--SSSDAISDNDA--ERSNSHSEIDNESNFDMVPYSRFSHKQKMLLVVQ 74

Query: 57  SMLSQLLNQAATTQTNPLFDVLSKDLNAKVSQQPWLMASFPLVSGSFILVSGKVGDIYGL 116
              +   +  A +   P+  ++ +  N         +  + +  G    + G + D +G 
Sbjct: 75  CAFTGFFSTVAGSIYYPVLTIIERKFNITEELANVTIVVYFIFQGVAPSIMGGLADTFGR 134

Query: 117 KKTLLGGYVVVVIWSLICGLSSYAHNVDFFVVARSFQGLGIAFVLPNVMGIVGNIYKPNT 176
           +  +L  + ++  +    GL+  AHN    +  R  Q  GI+ V+    GI+G++     
Sbjct: 135 RPIVL--WAILAYFCACIGLAC-AHNYAQILALRCLQAAGISPVIAINSGIMGDVTTKVE 191

Query: 177 EAKNLVFSLIGACAPIGATLGCVFSGLIGA-RTDLWGW 213
                    +G  A     +G  F  LIGA  +  WGW
Sbjct: 192 RG-----GYVGLVAGF-QVVGTAFGALIGAGLSSKWGW 223

>KNAG0E02560 Chr5 (506517..508253) [1737 bp, 578 aa] {ON} Anc_2.473
           YMR088C
          Length = 578

 Score = 35.4 bits (80), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 38/68 (55%), Gaps = 3/68 (4%)

Query: 84  AKVSQQPWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYVVVVIWSLICGLSSYAHNV 143
           A+  ++ W+  S+ L + +F  + GK+ DI G K  ++  +     ++L C L+ +A NV
Sbjct: 74  AESDKKQWIATSYLLTNTAFQPLYGKLSDITGRKVAVITAH---FFFALGCLLTCFAQNV 130

Query: 144 DFFVVARS 151
             F +AR+
Sbjct: 131 TQFSIARA 138

>NCAS0C03460 Chr3 complement(690089..691981) [1893 bp, 630 aa] {ON} 
          Length = 630

 Score = 35.4 bits (80), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 28/130 (21%), Positives = 57/130 (43%), Gaps = 6/130 (4%)

Query: 87  SQQPWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYVVVVIWSLICGLSSYAHNVDFF 146
           S+  W+ A + L +    L+ G++  I G K  +L   ++  I SLI G+   A++++  
Sbjct: 113 SKTGWIFAGYSLPNALLALLWGRIASIIGFKSCMLAAIIIFEIGSLISGV---ANSMNML 169

Query: 147 VVARSFQGLGIAFVLPNVMGIVGNIYKPNTEAKNLVFSLIGACAPIGATLGCVFSGLIGA 206
           +  R   G+G + +      I  N+   +   + L+ + + +   + + +G    G    
Sbjct: 170 IGGRVIAGVGGSGIQSLAFVIGSNLV--DERRRGLIIACMSSAFAVASVIGPFLGGAFTT 227

Query: 207 RTDLWGWTFY 216
               W W FY
Sbjct: 228 HAT-WRWCFY 236

>Suva_9.71 Chr9 (129275..130960) [1686 bp, 561 aa] {ON} YIL121W
           (REAL)
          Length = 561

 Score = 35.4 bits (80), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 53/229 (23%), Positives = 92/229 (40%), Gaps = 22/229 (9%)

Query: 16  QSSSAAGEERDGQTEAIGPKSRLQNPDYFDKPWKEYIFVLSSMLSQLLNQAATTQTNPLF 75
            S S  G E D + E   P SR  +        ++ + V+    +   +  A +   P+ 
Sbjct: 40  NSQSEVGNESDFELE---PYSRFSHT-------QKMLLVVQCAFTGFFSTVAGSIYYPVL 89

Query: 76  DVLSKDLNAKVSQQPWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYVVVVIWSLICG 135
            V+ K  N         +  + +  G    + G + D +G +  +L  + V+       G
Sbjct: 90  TVIEKKFNITEELANVTIVVYFVFQGLAPSIMGGLADTFGRRPVVL--WAVLTYCCACIG 147

Query: 136 LSSYAHNVDFFVVARSFQGLGIAFVLPNVMGIVGNIYKPNTEAKNLVFSLIGACAPIGAT 195
           L+S +HN    +  R  Q  GI+ V+    GI+G++     E    V  + G        
Sbjct: 148 LAS-SHNYAQILALRCLQAAGISPVIAINSGIMGDV-TTKVERGGYVGLVSGF-----QV 200

Query: 196 LGCVFSGLIGA-RTDLWGWT--FYAYAITAALNGLVALWIIPNNIPTNV 241
           +G  F  LIGA  +  WGW   F+  AI + +  +V+  ++P    T V
Sbjct: 201 VGTAFGALIGAGLSSRWGWRAIFWFLAIGSGICLVVSALLLPETKRTLV 249

>KAFR0J00930 Chr10 (168674..170374) [1701 bp, 566 aa] {ON} Anc_2.242
           YNL065W
          Length = 566

 Score = 35.0 bits (79), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 69/310 (22%), Positives = 113/310 (36%), Gaps = 40/310 (12%)

Query: 73  PLFDVLSKDLNAKVSQQPWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYVVVVIWSL 132
           P    L +  N   ++    +  + L  G    +SG + D+YG +  +LGG ++ V+ S+
Sbjct: 112 PALKELEQKFNIDENKVNVTVVVYLLFQGVAPAISGGLADVYGRRPVILGGMLIFVVASI 171

Query: 133 -ICGLSSYAHNVDFFVVARSFQGLGIAFVLPNVMGIVGNIYKPNTEAKNLVFSLIGACAP 191
            I    SY       V  R  Q +GI+  +    G+V +        K    + +GA + 
Sbjct: 172 GIAKAPSYG----VIVFLRCIQSIGISPTIAISSGVVSDF-----TVKRERGTFVGATSG 222

Query: 192 ---IGATLGCVFSGLIGARTDLWGWTFYAYAITAALNGLVALWIIPNNIPTNVNEYKMDW 248
              IG  +G +   +I A    W   F+   I      ++  +++P    T         
Sbjct: 223 LVLIGQGIGPLLGAVITAALH-WRAVFWFLTIGCGSCMIIGFFLLPETKRT--------- 272

Query: 249 IGSAIGVFGLILFNFVWNQAPIAGWGSAYXXXXXXXXXXXXXXFITYEIRFAKQPLLPHS 308
               +G   +   N + N+API      Y              + + ++    +P L  S
Sbjct: 273 ---IVGNLSIKPKNII-NRAPI-----TYLPVVQKRFHYDNPDYDSLDL---NKPTLDLS 320

Query: 309 VLFN-RKLMMILSSLFFGWGSFGIWTFYYMSFMLNLR----HYSPLWAGGTYFMFAIWGI 363
             F    L  I  SL  G   F +WT    S    L     +YS    G  Y    I G+
Sbjct: 321 TAFRITALPEIFLSLLPGGLQFAMWTLMLSSISSELSVAPYNYSLTIIGVCYLPAGIGGL 380

Query: 364 VASLLVGYTI 373
             S+L G  I
Sbjct: 381 AGSMLTGRVI 390

>Skud_9.48 Chr9 (109346..111145) [1800 bp, 599 aa] {ON} YIL120W
           (REAL)
          Length = 599

 Score = 35.0 bits (79), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 60/273 (21%), Positives = 113/273 (41%), Gaps = 31/273 (11%)

Query: 6   ND-DEENWEKLQSSSAAGEERDG--QTEAIGPKSRLQNPDY--FDKPWKEYIFVLSSMLS 60
           ND ++E  E ++S +    ++    +TE++ P+  +  P +  F + +K  + +     +
Sbjct: 34  NDFEDELAESIRSYNKETADKLSLHRTESVKPEPEITAPPHSRFSRSFKT-VLIAQCAFT 92

Query: 61  QLLNQAATTQTNPLFDVLSKDLNAKVSQQPWLMASFPLVSGSFILVSGKVGDIYGLKKTL 120
              +  A     P+  V+ +  N         +  + +  G    + G   D  G +  +
Sbjct: 93  GFFSTIAGAIYYPVLSVIERKFNIDEQLVNVTVVVYFVFQGLAPTLMGGFADSLGRRPVV 152

Query: 121 LGGYVVVVIWSLICGLSSYAHNVDFFVVARSFQGLGIAFVLPNVMGIVGNIYKPNTEAKN 180
           L   + ++I+   C   +        +V R  Q  GI+ V+    GI+G+I    T A+ 
Sbjct: 153 L---IAIIIYFGACVGLACTQTYAQIIVLRCLQAAGISPVIAINSGIMGDI---TTRAER 206

Query: 181 LVFSLIGACAPIGATLGCVFSGLIGA-RTDLWGWT--FYAYAITAALNGLVALWIIPNNI 237
             +  +G  A     LG  F  LIGA  +  WGW   F+   I + +  L +L I+P   
Sbjct: 207 GGY--VGYAAGF-QVLGSAFGALIGAGLSSRWGWRAIFWFLTIGSGICFLASLLILP--- 260

Query: 238 PTNVNEYKMDWIGSAIGVFGLILFNFVWNQAPI 270
                E K +  G+     G ++   + N+API
Sbjct: 261 -----ETKRNISGN-----GSVMPKSLLNRAPI 283

>Ecym_7399 Chr7 complement(820280..821971) [1692 bp, 563 aa] {ON}
           similar to Ashbya gossypii ABL040W
          Length = 563

 Score = 35.0 bits (79), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 34/130 (26%), Positives = 60/130 (46%), Gaps = 12/130 (9%)

Query: 91  WLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYVVVVIWSLI---CGLSSYAHNVDFFV 147
           W+  SF L S  F  + GK+ D+ G +      +V+V+ +SL    C +++YA N+  F 
Sbjct: 86  WVATSFLLTSTVFQPIYGKLSDVTGRR------FVLVLAYSLFLLGCLVTAYARNIWEFA 139

Query: 148 VARSFQGLGIAFVLPNVMGIVGNIYKPNTEAKNLVFSLIGACAPIGATLGCVFSGLIGAR 207
             R+  G+G   +    +  +G+++  + + +++  S       IG  LG    G I   
Sbjct: 140 FGRAICGIGAGGIPTMCVITMGDMF--SVKEQSIYQSYAHIIYTIGEVLGAPIGG-IALE 196

Query: 208 TDLWGWTFYA 217
           T  W   F A
Sbjct: 197 TVGWRAIFLA 206

>NDAI0I02770 Chr9 (652149..654029) [1881 bp, 626 aa] {ON} Anc_3.503
          Length = 626

 Score = 35.0 bits (79), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 37/137 (27%), Positives = 57/137 (41%), Gaps = 16/137 (11%)

Query: 105 LVSGKVGDIYGLKKTLLGGYVVVVIWSLICGLSSYAHNVDFFVVARSFQGLGIAFVLPNV 164
           L+   V D+YG +        + VI+++ C L   A N+   +  R   G+  +  L  V
Sbjct: 236 LIWSPVSDLYGRQVAYFFSMGLYVIFNIPCAL---APNLGCLLACRFLCGVWSSSGLCLV 292

Query: 165 MGIVGNIYKPNTEAKNLVFSLIGACAPIGATLGCVFSGLIG---ARTDLWGWTFYAYAIT 221
            G + +++   T  K + F     C   G  LG V +G I     R DL  W   A+A  
Sbjct: 293 GGSIADMFPSETRGKAIAF--FAFCPYTGPVLGPVVNGFISVSTGRMDLIFWVNMAFA-- 348

Query: 222 AALNGLVALWIIPNNIP 238
                   +WII + IP
Sbjct: 349 ------GVMWIISSAIP 359

>SAKL0E08756g Chr5 complement(714902..716599) [1698 bp, 565 aa] {ON}
           similar to uniprot|P53943 Saccharomyces cerevisiae
           YNL065W AQR1 Plasma membrane transporter of the major
           facilitator superfamily that confers resistance to
           short- chain monocarboxylic acids and quinidine
          Length = 565

 Score = 35.0 bits (79), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 29/101 (28%), Positives = 51/101 (50%), Gaps = 9/101 (8%)

Query: 106 VSGKVGDIYGLKKTLLGGYVVVVIWSLICGLSSYAHNVDFFVVARSFQGLGIAFVLPNVM 165
           +SG + D+YG +  +L G ++ V+ S+  GL+  +++    V  R  Q  GI+ ++    
Sbjct: 152 ISGGLADVYGRRPIILAGMLIYVVASI--GLAC-SNSYGVIVFLRCVQSAGISPLIAISS 208

Query: 166 GIVGNIYKPNTEAKNLVFSLIGACAPIGATLGCVFSGLIGA 206
           G+VG+    +        S +GA +   A +G  F  LIGA
Sbjct: 209 GVVGDFTTKSERG-----SFVGAVSGF-ALMGQAFGSLIGA 243

>Kwal_14.782 s14 (42720..44195) [1476 bp, 491 aa] {ON} YGR260W
           (TNA1) - Tna1p is a high affinity nicotinic acid plasma
           membrane permease [contig 245] FULL
          Length = 491

 Score = 35.0 bits (79), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 31/123 (25%), Positives = 55/123 (44%), Gaps = 5/123 (4%)

Query: 125 VVVVIWSLICGLSSYAHNVDFFVVARSFQGLGIAFVLPNVMGIVGNIYKPNTEAKNLVFS 184
            +V  WS+I   S +  +    +  R   G       P +  ++  +YKP  +AK + F 
Sbjct: 122 TLVFCWSVITLSSGFVQSYGSLLATRILLGTFEGGFFPAMTLLITMMYKPKEQAKRIAF- 180

Query: 185 LIGACAPIGATLGCVFSGL--IGARTDLWGWTFYAYAITAALNGLVALWIIPNNIPTNVN 242
             G+ A  GA  G + +GL  + + + L GW  + Y I   ++     W+    +P N++
Sbjct: 181 FFGSSALSGAFGGLIATGLASVKSTSGLEGWR-WLYIIEGLISVCATAWLF-FGLPDNLD 238

Query: 243 EYK 245
           E K
Sbjct: 239 EMK 241

>ZYRO0G03234g Chr7 (247798..249486) [1689 bp, 562 aa] {ON} similar
           to uniprot|Q04301 Saccharomyces cerevisiae YMR088C VBA1
           Permease of basic amino acids in the vacuolar membrane
          Length = 562

 Score = 35.0 bits (79), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 31/133 (23%), Positives = 62/133 (46%), Gaps = 13/133 (9%)

Query: 26  DGQTEAIGPKSRLQNPDYFDKPWKEY------IFVLSSM-LSQLLNQAATTQTNPLFDVL 78
           D     I P+SR  + +  +  +  Y      + +L+S+ L   +     T    + + +
Sbjct: 3   DDTAPLIPPESR--DEESLEAEYHRYNLSLPKLPILTSLWLGSFIGSLDGTIVANIMNRV 60

Query: 79  SKDLNAKVSQQPWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYVVVVIWSLICGLSS 138
           +++      +Q W+  SF L + +F  + GK+ DI G +  LL  +     + L C L+ 
Sbjct: 61  AEEFEESDKKQ-WIATSFLLTNTAFQPLYGKLSDITGRRFALLTAH---FFFGLGCLLTC 116

Query: 139 YAHNVDFFVVARS 151
           +A +V+ F +AR+
Sbjct: 117 FAQSVEQFALARA 129

>Kpol_1048.45 s1048 (117855..119801) [1947 bp, 648 aa] {ON}
           (117855..119801) [1947 nt, 649 aa]
          Length = 648

 Score = 35.0 bits (79), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 41/175 (23%), Positives = 73/175 (41%), Gaps = 12/175 (6%)

Query: 75  FDVLSKDLNAKVSQQPWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYVVVVIWSLIC 134
           F+V +  +N+ VS    + A  PL+ G F        DI G K   L   +++ I +++ 
Sbjct: 202 FNVSTTTINSTVSVFMAVFAIGPLIWGHF-------ADICGRKWLYLCSLLLMTIVNIL- 253

Query: 135 GLSSYAHNVDFFVVARSFQGLGIAFVLPNVMGIVGNIYKPNTEAKNLVFSLIGACAPIGA 194
            L+S    +      R FQ    + V+    G V +I  P    K + + ++G    +G 
Sbjct: 254 -LASLPAKIGLLYFLRIFQAFSSSSVMSMGAGTVTDITAPKHRGKAIAYFMMGPN--MGP 310

Query: 195 TLGCVFSGLIGARTDLWGWTFYAYAITAALNGLVALWIIPNNIPTNVNEYKMDWI 249
            +  + +G+I    D W W F   +I + +   + L  +P  +   V      WI
Sbjct: 311 IVAPIIAGVI-LINDNWRWLFGFTSIMSGVAFFLVLVFLPETLRCMVGNGDKRWI 364

>KLTH0B10384g Chr2 complement(877070..878725) [1656 bp, 551 aa] {ON}
           similar to uniprot|P15365 Saccharomyces cerevisiae
           YJR152W DAL5 Allantoin permease ureidosuccinate permease
           expression is constitutive but sensitive to nitrogen
           catabolite repression
          Length = 551

 Score = 34.7 bits (78), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 26/117 (22%), Positives = 52/117 (44%), Gaps = 9/117 (7%)

Query: 127 VVIWSLICGLSSYAHNVDFFVVARSFQGLGIAFVLPNVMGIVGNIYKPNTEAKNLVFSLI 186
           ++ W L+  L+S   +   F++ R+  G+  + + P ++  +   YK + +      S++
Sbjct: 178 IIAWGLLLCLTSLVKSYPTFILTRTLLGVLESSITPAMVLFMSQWYKKDEQF--FRTSIL 235

Query: 187 GACAPIGATLGCVFSGLIGART-------DLWGWTFYAYAITAALNGLVALWIIPNN 236
            AC  +G  +G   S  +  R        D W   F    +   + GL+ L+IIP+ 
Sbjct: 236 IACNAVGGLVGASVSYRLYERQLAGTLSMDAWRILFIIVGLITIVTGLMVLFIIPDT 292

>Skud_7.560 Chr7 (917668..919596) [1929 bp, 642 aa] {ON} YGR224W
           (REAL)
          Length = 642

 Score = 34.7 bits (78), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 29/130 (22%), Positives = 60/130 (46%), Gaps = 6/130 (4%)

Query: 87  SQQPWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYVVVVIWSLICGLSSYAHNVDFF 146
           S+  WL   + L +    L+ G++    G K+T+L   V+  + SLI   S+ A++++  
Sbjct: 111 SEIGWLFTGYSLPNALLALIWGRIATPIGFKRTMLFAIVIFEVGSLI---SALANSMNVL 167

Query: 147 VVARSFQGLGIAFVLPNVMGIVGNIYKPNTEAKNLVFSLIGACAPIGATLGCVFSGLIGA 206
           +  R   G+G   +      I  N+ + +   + ++ +++     I + +G    G+  +
Sbjct: 168 IGGRVIAGVGGCGIQSLSFVIGSNLVEESN--RGVLIAILSCSFAIASVVGPFLGGVFTS 225

Query: 207 RTDLWGWTFY 216
           R   W W FY
Sbjct: 226 RVT-WRWCFY 234

>Kpol_416.5 s416 (23208..25031) [1824 bp, 607 aa] {ON}
           (23208..25031) [1824 nt, 608 aa]
          Length = 607

 Score = 34.7 bits (78), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 33/135 (24%), Positives = 55/135 (40%), Gaps = 25/135 (18%)

Query: 254 GVFGLILFNF--------VWNQAPIA-----GWGSAYXXXXXXXXXXXXXXFITYEIRFA 300
            +FG+IL  F        VW+ A I      GW  A               F+ +EI+FA
Sbjct: 282 AIFGMILIPFTLAGGEEKVWSTARIIVPEVLGWAFA------------LPLFLVWEIKFA 329

Query: 301 KQPLLPHSVLFNRKLMMILSSLFFGWGSFGIWTFYYMSFMLNLRHYSPLWAGGTYFMFAI 360
           + PL P   L NR ++  L  + F   ++ + + Y  + +L     S   A     +F+ 
Sbjct: 330 RYPLTPKDALKNRGIVSALVLVLFLQFAYQMQSTYLYTVLLVAVDESKKSATRINKLFSF 389

Query: 361 WGIVASLLVGYTIHK 375
             ++   L G+ + K
Sbjct: 390 VSVITGFLSGFVVAK 404

>KLTH0C08074g Chr3 (688367..690295) [1929 bp, 642 aa] {ON} similar
           to uniprot|P38227 Saccharomyces cerevisiae YBR043C QDR3
           Multidrug transporter required for resistance to
           quinidine barban cisplatin and bleomycin member of the
           major facilitator superfamily of transporters conferring
           multiple drug resistance (MFS- MDR)
          Length = 642

 Score = 34.7 bits (78), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 29/93 (31%), Positives = 44/93 (47%), Gaps = 10/93 (10%)

Query: 125 VVVVIWSLICGL---SSYAHNVDFFVVARSFQGLGIAFVLPNVMGIVGNIYKPNTEAKNL 181
           V V+ +SL+C     S+ A N+  F+V R   G   A V     G V +++KP    K L
Sbjct: 160 VYVLSFSLLCAFCVGSALAPNIQAFIVFRMLCGACSASVQSVGAGTVADLFKPEDRGKML 219

Query: 182 VFSLIGAC-APIGATLGCVFSGLIGARTDLWGW 213
            +  +GA  AP+   L  +   L+ +R   W W
Sbjct: 220 GYYYLGALMAPL---LAPIIGSLLVSR---WSW 246

>ZYRO0F02178g Chr6 (176789..178576) [1788 bp, 595 aa] {ON} similar
           to gnl|GLV|DEHA0A14894g Debaryomyces hansenii
           DEHA0A14894g and weakly similar to YLL028W
           uniprot|Q07824 Saccharomyces cerevisiae YLL028W TPO1
           Proton- motive-force-dependent multidrug transporter of
           the major facilitator superfamily able to transport
           eight different compounds including polyamines quinidine
           cycloheximide and nystatin involved in excess spermidine
           detoxification
          Length = 595

 Score = 34.3 bits (77), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 31/132 (23%), Positives = 58/132 (43%), Gaps = 10/132 (7%)

Query: 129 IWSLICGLSSYAHNVDFFVVARSFQGLGIAFVLPNVMGIVGNIYKPNTEAKNLVFSLIGA 188
           +W ++ GL   A N    +VAR   G+ +A      +G+  +++ P      + F ++  
Sbjct: 194 VWQILGGL---APNFGSIIVARFLGGISLAGG-SVTLGVAADMWDPADHGYAVAFVVL-- 247

Query: 189 CAPIGATLGCVFSGLIGARTDLWGWTFYAYAITAALNGLVALWIIPNNIPT---NVNEYK 245
           C+  G  +G +F GL+      W W F+   I   +  ++  +I+P    T   + +  K
Sbjct: 248 CSVGGTVIGPIFGGLMEEHLS-WHWNFWIQLIFNGVTQVLHFFIVPETRSTVIMDRSAKK 306

Query: 246 MDWIGSAIGVFG 257
           M   G    V+G
Sbjct: 307 MRKSGRDPHVYG 318

>Smik_1.1 Chr1 complement(4254..6038) [1785 bp, 594 aa] {ON} YAL067C
           (REAL)
          Length = 594

 Score = 34.3 bits (77), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 32/120 (26%), Positives = 53/120 (44%), Gaps = 11/120 (9%)

Query: 128 VIWSLICGLSSYAHNVDFFVVARSFQGLGIAFVLPNVMG---IVGNIYKPNTEAKNLVFS 184
           + WSL+   ++Y ++V      R F G   AF  P+ +    + G+ YK +   +   F 
Sbjct: 213 LCWSLLTVGAAYVNSVPHLKAIRFFIG---AFEAPSYLAYQYLFGSFYKHDEMVRRSAFY 269

Query: 185 LIGACAPI---GATLGCVFSGLIGAR-TDLWGWTFYAYAITAALNGLVALWIIPNNIPTN 240
            +G    I   G     V+S L G    + W W F   AI + + GL+  + +P + P N
Sbjct: 270 YLGQYIGILSAGGIQSAVYSSLNGVNGLEGWRWNFIIDAIVSVVVGLIGFYALPGD-PYN 328

>KLTH0G19668g Chr7 (1702771..1704297) [1527 bp, 508 aa] {ON} weakly
           similar to uniprot|P53322 Saccharomyces cerevisiae
           YGR260W TNA1 High affinity nicotinic acid plasma
           membrane permease
          Length = 508

 Score = 34.3 bits (77), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 55/120 (45%), Gaps = 7/120 (5%)

Query: 126 VVVIWSLICGLSSYAHNVDFFVVARSFQGLGIAFVLPNVMGIVGNIYKPNTEAKNLVFSL 185
           +V  WS+I   S +  +    +  R   G       P ++ +V  IYKP  +AK + F  
Sbjct: 140 MVFCWSIITLCSGFVKSYHSLIALRVLLGAFEGGYFPAMVLLVSMIYKPEEQAKRIAFFF 199

Query: 186 IGACAPI-GATLGCVFSGL--IGARTDLWGWTFYAYAITAALNGLVALWIIPNNIPTNVN 242
             +CA + GA  G + +GL  +     L GW  + Y I   ++   A+WI    +PT+V 
Sbjct: 200 --SCAALAGAFGGLIATGLATVHGAGGLNGWR-WLYIIEGLVSTTAAVWIY-FGLPTDVE 255

>TBLA0D02900 Chr4 (714553..716628) [2076 bp, 691 aa] {ON} Anc_3.503
           YPR156C
          Length = 691

 Score = 34.3 bits (77), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 34/135 (25%), Positives = 59/135 (43%), Gaps = 12/135 (8%)

Query: 105 LVSGKVGDIYGLKKTLLGGYVVVVIWSLICGLSSYAHNVDFFVVARSFQGLGIAFVLPNV 164
           L+   + DIYG + T      + VI+++ C +    +N+   ++ R F G+  +  L  V
Sbjct: 296 LIWSPMSDIYGRRLTYFVSMGLYVIFNIPCAI---PNNIATLMICRFFCGVWSSSGLCLV 352

Query: 165 MGIVGNIYKPNTEAKNLV-FSLIGACAPIGATLGCVFSGLIGARTDLWGWTFYAYAITAA 223
            G + +++   T  + +  F+    C P+   L   F  +   R DL  W   A+A    
Sbjct: 353 GGSLADMFPSETRGRAIAFFAYAPYCGPVFGPLVNGFISISTRRMDLIFWVNMAFA---- 408

Query: 224 LNGLVALWIIPNNIP 238
                A+WII   IP
Sbjct: 409 ----GAMWIIVALIP 419

>KLLA0F13684g Chr6 complement(1267367..1269082) [1716 bp, 571 aa]
           {ON} similar to uniprot|Q04301 Saccharomyces cerevisiae
           YMR088C VBA1 Permease of basic amino acids in the
           vacuolar membrane
          Length = 571

 Score = 34.3 bits (77), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 37/69 (53%), Gaps = 3/69 (4%)

Query: 88  QQPWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYVVVVIWSLICGLSSYAHNVDFFV 147
           ++ W++ SF L + +F  + GK+ D+ G K  L+  +   ++  L   LS    N+  F 
Sbjct: 76  KKQWIVTSFLLTNTAFQPLYGKLSDLAGRKTALMVAHSFFLVGCLFTALS---RNLVEFS 132

Query: 148 VARSFQGLG 156
           +AR+  G+G
Sbjct: 133 IARAVCGMG 141

>KLTH0H16214g Chr8 complement(1398230..1399885) [1656 bp, 551 aa]
           {ON} conserved hypothetical protein
          Length = 551

 Score = 34.3 bits (77), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 37/156 (23%), Positives = 64/156 (41%), Gaps = 18/156 (11%)

Query: 35  KSRLQNPDYFDKPWKEYIFVLSSMLSQLLNQAATTQTNPLFDVLSKDLNAKVSQQPWLMA 94
           + R QN  Y        IF+  +    LLN A       + + L +    + +   W + 
Sbjct: 20  RRRCQNSKYQLIINMALIFLGCTF--DLLNVAGVIS---VIEDLGETYGLEYTTASWALT 74

Query: 95  SFPLVSGSFILVSGKVGDIYGLKKTLLGGYVVVVI----WSLICGLSSYAHNVDFFVVAR 150
           S+ +     I   G++GDI       +G  V+  I    +SL C L +   N   F V R
Sbjct: 75  SYAITFAGLIAFMGRLGDI-------IGNSVLFTISGFFFSLFCLLCAVVTNFPAFAVLR 127

Query: 151 SFQGLGIAFVLPNVMGIVGNIYKPNTEAKNLVFSLI 186
           + QG+  A ++P    ++  +  P  E   L F+++
Sbjct: 128 ALQGIAAAGLVPCGYALIPTLADP--EDVQLFFAVV 161

 Score = 33.5 bits (75), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 41/209 (19%), Positives = 84/209 (40%), Gaps = 8/209 (3%)

Query: 302 QPLLPHSVLFNRKLMMILSSLFFGWGSFGIWTFYYMSFMLNLRHYSPLWAGGTYFMFAIW 361
           Q L+P  VLF    + I        G      +    +   +   SPL AG       I 
Sbjct: 308 QVLIPRDVLFMTNFIPITLGFLCNGGCLYSNIYIIDQYSQYVDKNSPLLAGVKLVPLIIT 367

Query: 362 GIVASLLVGYTIHKTGPAVILFLSMVAFDCGCIMLAVTPV--HQTYFRMTLGIMIILSFG 419
            ++ + +      K  P + + L  ++  CG I+L    +     Y+++     I++ FG
Sbjct: 368 MVIGNTICASKSVKLRPRIGVALGFLSMVCGSIILIQLHLVEENLYWKIMFCSQILVGFG 427

Query: 420 MDLSFPAASIILSDQLPSQYQGMAGSLVSTM----ISYSMSLCLGISGT-AEHQVNKNGI 474
             + +P A  ++    PS  +G+A  +  T     I  + S+ + + G   + +   +  
Sbjct: 428 AAIFYPYALKLVVGDAPSGAKGIASGVTQTFAQLGIEMTFSVMVSVLGNITQVKSRPDSF 487

Query: 475 DLLK-GYQAALYVGIGLASLGVVISGAFM 502
           +  + G+Q   Y  +   + G+V++  F+
Sbjct: 488 ERFRDGFQKCTYFTLASGAFGLVLTTFFV 516

>Ecym_7063 Chr7 complement(130980..132842) [1863 bp, 620 aa] {ON}
           similar to Ashbya gossypii AGR195W
          Length = 620

 Score = 34.3 bits (77), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 33/137 (24%), Positives = 57/137 (41%), Gaps = 7/137 (5%)

Query: 114 YGLKKTLLGGYVVVVIWSLICG--LSSYAHNVDFFVVARSFQGLGIAFVLPNVMGIVGNI 171
           YG +K L   YV+ +  ++I    L+S   N+      R  Q    + V+    G V +I
Sbjct: 224 YGGRKLL---YVISMGLNVIVNILLASIPTNIGALYFLRIAQAFASSSVISLGAGTVSDI 280

Query: 172 YKPNTEAKNLVFSLIGACAPIGATLGCVFSGLIGARTDLWGWTFYAYAITAALNGLVALW 231
             P    K + + ++G  A  G  L  + +G+I    D W W F   +I A +  ++   
Sbjct: 281 TSPKDRGKAVAYFMLGPNA--GPVLAPIIAGIILMNGDNWRWLFGFTSIMAGVGFMLVCL 338

Query: 232 IIPNNIPTNVNEYKMDW 248
            +P  +   V    + W
Sbjct: 339 FLPETLRCIVGNGDLRW 355

>AGR195W Chr7 (1120597..1122456) [1860 bp, 619 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBR180W (DTR1)
          Length = 619

 Score = 34.3 bits (77), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 26/101 (25%), Positives = 40/101 (39%), Gaps = 2/101 (1%)

Query: 148 VARSFQGLGIAFVLPNVMGIVGNIYKPNTEAKNLVFSLIGACAPIGATLGCVFSGLIGAR 207
           V R  Q    +  L    G V +I  P    K + + ++G  A  G  L  + +GLI   
Sbjct: 254 VLRVVQAFASSSALSLGAGTVSDITPPKNRGKAIAYFMLGPNA--GPILAPIIAGLILFD 311

Query: 208 TDLWGWTFYAYAITAALNGLVALWIIPNNIPTNVNEYKMDW 248
            D W W F   +I A +  L+    +P  +   V    + W
Sbjct: 312 NDRWRWLFGFTSIMAGIGFLLVCVFLPETLRCIVGNGDVRW 352

>CAGL0G08624g Chr7 complement(811931..813682) [1752 bp, 583 aa] {ON}
           similar to uniprot|P40474 Saccharomyces cerevisiae
           YIL121w
          Length = 583

 Score = 34.3 bits (77), Expect = 0.94,   Method: Compositional matrix adjust.
 Identities = 60/253 (23%), Positives = 99/253 (39%), Gaps = 29/253 (11%)

Query: 2   NMKENDDEENWEKLQSSSAAG------EERDGQTEA----IGPKSRLQNPDYFDKPWKEY 51
           ++ E D E+N + ++++            R  QTE       P SR      FD  +K  
Sbjct: 29  DLSEVDSEDNDKMIKTNEDEAVKEPIYRTRSNQTEPDIANAPPYSR------FDAKYK-M 81

Query: 52  IFVLSSMLSQLLNQAATTQTNPLFDVLSKDLNAKVSQQPWLMASFPLVSGSFILVSGKVG 111
             VL    + L +  A     P+  V+ K  +         +  + +  G    + G + 
Sbjct: 82  ALVLQCAYTGLFSTMAGAIYYPVLSVIEKQFHITEELVNITVVVYFIFQGIAPTLMGGLA 141

Query: 112 DIYGLKKTLLGGYVVVVIWSLICGLSSYAHNVDFFVVARSFQGLGIAFVLPNVMGIVGNI 171
           D  G +  +L  + V V +    GL+  A      VV R  Q  GI+ V+    GI+G++
Sbjct: 142 DSLGRRPVVL--FAVTVYFGACIGLAC-AQTYAQIVVLRCLQAAGISPVIAINSGIIGDV 198

Query: 172 YKPNTEAKNLVFSLIGACAPIGATLGCVFSGLIGA-RTDLWGWT--FYAYAITAALNGLV 228
                E    V  + G        LG  F  LIGA  +  WGW   F+  AI + +  + 
Sbjct: 199 -TTRAERGGYVGYISGF-----QVLGSAFGALIGAGLSSRWGWRSIFWFLAIGSGVCLVF 252

Query: 229 ALWIIPNNIPTNV 241
           ++ ++P    T V
Sbjct: 253 SIIMLPETKRTIV 265

>Skud_2.306 Chr2 (557166..558884) [1719 bp, 572 aa] {ON} YBR180W
           (REAL)
          Length = 572

 Score = 34.3 bits (77), Expect = 0.94,   Method: Compositional matrix adjust.
 Identities = 40/168 (23%), Positives = 74/168 (44%), Gaps = 15/168 (8%)

Query: 75  FDVLSKDLNAKVSQQPWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYVVVVIWSLIC 134
           FDV S  +NA VS     MA F +      L  G + D  G K   +    +++  +++ 
Sbjct: 141 FDVSSTTINATVSA---FMAVFSVGP----LFWGALADFGGRKFLYMVSLSLMLTVNIL- 192

Query: 135 GLSSYAHNVDFFVVARSFQGLGIAFVLPNVMGIVGNIYKPNTEAKNLVFSLIGACAPIGA 194
            L++   N+    V R FQ    + V+    G V ++  P    K + + ++G    +G 
Sbjct: 193 -LAAVPANIAALFVLRVFQAFSSSSVISLGAGTVTDVVPPKHRGKAIAYFMMGPN--MGP 249

Query: 195 TLGCVFSGLIGARTDLWGWTFYAYAITAALNGLVALWIIPNNIPTNVN 242
            +  + +GLI  + + W W F     T+ + G +AL ++   +P  + 
Sbjct: 250 IIAPIVAGLILMKGNYWRWLF---GFTSIMTG-IALILVSAFLPETLR 293

>Suva_9.70 Chr9 (127105..128802) [1698 bp, 565 aa] {ON} YIL120W
           (REAL)
          Length = 565

 Score = 33.9 bits (76), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 49/174 (28%), Positives = 74/174 (42%), Gaps = 33/174 (18%)

Query: 115 GLKKTLLGGY-----------VVVVIWSLICGLSSYAHNVDFFVVARSFQGLGIAFVLPN 163
           GL  T +GG+           V ++I+   C   + A      +V R  Q  GI+ V+  
Sbjct: 111 GLAPTFMGGFADSLGRRPVVLVAILIYLGACVGLACAQTYAQIIVLRCLQAAGISPVIAI 170

Query: 164 VMGIVGNIYKPNTEAKNLVFSLIGACAPIGATLGCVFSGLIGA-RTDLWGWT--FYAYAI 220
             GI+G+I    T A+   +  +G  A     LG  F  LIGA  +  WGW   F+  AI
Sbjct: 171 NSGIMGDI---TTRAERGGY--VGYVAGF-QVLGSAFGALIGAGLSSRWGWRAIFWFLAI 224

Query: 221 TAALNGLVALWIIPNNIPTNVNEYKMDWIGSAIGVFGLILFNFVWNQAPIAGWG 274
            + +  L +L ++P        E K +  G+     G I     +N+API   G
Sbjct: 225 GSGVCFLGSLLVLP--------ETKRNIAGN-----GSITPKLYFNRAPILALG 265

>NCAS0G02990 Chr7 complement(549460..551205) [1746 bp, 581 aa] {ON} 
          Length = 581

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 36/139 (25%), Positives = 64/139 (46%), Gaps = 12/139 (8%)

Query: 106 VSGKVGDIYGLKKTLLGGYVVVVIWSLICGLSSYAHNVDFFVVARSFQGLGIAFVLPNVM 165
           +SG + D++G +  +L G ++ V+ S+  GL+  A +    V  R  Q +GI+  +    
Sbjct: 145 ISGGLADVFGRRPVILIGMLIYVVASI--GLAC-APSYGVIVFLRIIQSIGISPTIAISS 201

Query: 166 GIVGNIYKPNTEAKNLVFSLIGACAPIGATLGCVFSGLIGA-RTDLWGWT--FYAYAITA 222
           G+VG+    +        + +GA + +   LG  F  LIGA     W W   F+   I  
Sbjct: 202 GVVGDFTLKHERG-----TFVGATSGL-VLLGQCFGSLIGAVLAAAWNWRAIFWFLTIGC 255

Query: 223 ALNGLVALWIIPNNIPTNV 241
             + ++A  ++P    T V
Sbjct: 256 GTSFIIAFLLLPETKRTLV 274

>TPHA0A01750 Chr1 complement(354061..355971) [1911 bp, 636 aa] {ON}
           Anc_8.272 YDR119W
          Length = 636

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 34/147 (23%), Positives = 60/147 (40%), Gaps = 4/147 (2%)

Query: 10  ENWEKLQSSSAAGEERDGQTEAIGPKSRLQNPDYFDKPWKEYIFVLSSMLSQLLNQAATT 69
           E  E+L   ++    +     ++     L N      P +  + + S  L   L+    T
Sbjct: 54  EEREELYREASIASNQHHDYGSVANSIILDNDKNNLSPTRLRLAMSSMYLGIFLSALDNT 113

Query: 70  QTNPLFDVLSKDLNAKVSQQPWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYVVVVI 129
             + L   +  + N ++ +  W+  ++ L S +F  + GK+ DI+G K  L    V   I
Sbjct: 114 IVSTLLARIGSEFN-ELPRISWIATAYLLSSATFQPLYGKISDIFGRKIVLTFCNVNFFI 172

Query: 130 WSLICGLSSYAHNVDFFVVARSFQGLG 156
             LICG    A +    V+ R   G+G
Sbjct: 173 GCLICGT---AKSFWVLVIGRFISGVG 196

>YAL067C Chr1 complement(7235..9016) [1782 bp, 593 aa] {ON}
           SEO1Putative permease, member of the allantoate
           transporter subfamily of the major facilitator
           superfamily; mutation confers resistance to ethionine
           sulfoxide
          Length = 593

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 32/120 (26%), Positives = 53/120 (44%), Gaps = 11/120 (9%)

Query: 128 VIWSLICGLSSYAHNVDFFVVARSFQGLGIAFVLPNVMG---IVGNIYKPNTEAKNLVFS 184
           + WSL+   ++Y ++V      R F G   AF  P+ +    + G+ YK +   +   F 
Sbjct: 212 LCWSLLTVGAAYVNSVPHLKAIRFFIG---AFEAPSYLAYQYLFGSFYKHDEMVRRSAFY 268

Query: 185 LIGACAPI---GATLGCVFSGLIGAR-TDLWGWTFYAYAITAALNGLVALWIIPNNIPTN 240
            +G    I   G     V+S L G    + W W F   AI + + GL+  + +P + P N
Sbjct: 269 YLGQYIGILSAGGIQSAVYSSLNGVNGLEGWRWNFIIDAIVSVVVGLIGFYSLPGD-PYN 327

>ABL040W Chr2 (321534..323237) [1704 bp, 567 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR088C
          Length = 567

 Score = 33.5 bits (75), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 34/64 (53%), Gaps = 3/64 (4%)

Query: 88  QQPWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYVVVVIWSLICGLSSYAHNVDFFV 147
           ++ W+  SF L + +F  + G+  DI G K  LL      ++ +L   L+ +A NV  F 
Sbjct: 80  KKQWMATSFLLTNAAFQPLYGRCSDIVGRKCALLIAQSFFLLGTL---LTCFARNVTEFA 136

Query: 148 VARS 151
           +AR+
Sbjct: 137 IARA 140

>ZYRO0G15422g Chr7 (1253872..1255500) [1629 bp, 542 aa] {ON} similar
           to uniprot|Q2UJ53 Aspergillus oryzae AO090003001353
           Synaptic vesicle transporter SVOP and related
           transporters and weakly similar to YBR008C
           uniprot|P38124 Saccharomyces cerevisiae YBR008C FLR1
           Plasma membrane multidrug transporter member of the
           major facilitator superfamily involved in efflux of
           fluconazole diazaborine benomyl methotrexate and other
           drugs
          Length = 542

 Score = 33.5 bits (75), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 27/111 (24%), Positives = 51/111 (45%), Gaps = 7/111 (6%)

Query: 129 IWSLICGLSSYAHNVDFFVVARSFQGLGIAFVLPNVMGIVGNIYKPNTEAKNLVFSLIGA 188
           IW ++ G    A N    +VAR   GL  A      +G+V +++ P+     + + ++ +
Sbjct: 136 IWQILGG---KAPNFGAIIVARGLCGLSQAGG-SVTLGVVADLWDPSEHGYAVAYIVLAS 191

Query: 189 CAPIGATLGCVFSGLIGARTDLWGWTFYAYAITAALNGLVALWIIPNNIPT 239
               G+ LG VF GL+      W W F+   I   ++ ++  +++P    T
Sbjct: 192 VG--GSVLGPVFGGLMQEHLS-WHWNFWIQLIFNGVSQILHFFLVPETRAT 239

>ZYRO0A03564g Chr1 (283783..285837) [2055 bp, 684 aa] {ON} similar
           to YBR043C, uniprot|P38227 Saccharomyces cerevisiae
           YBR043C (QDR3)
          Length = 684

 Score = 33.5 bits (75), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 46/210 (21%), Positives = 91/210 (43%), Gaps = 19/210 (9%)

Query: 5   ENDDEEN-----WEKLQSSS--AAGEERDGQTEAIGPKSRLQNPDYFDKPWKEYI-FVLS 56
           E++ +EN     W+KL+  S     +ER G    +      ++   +    K++I FV++
Sbjct: 71  ESEQDENKKVGVWKKLKDRSYWTPRKERRGILPHLSLIPEFKDARDYPPHIKKFIVFVIA 130

Query: 57  SMLSQLLNQAATTQTNPLFDVLSKDLNAKVSQQPWLMASFPLVSGSFILVSGKVGDIYGL 116
              S ++   AT+   P  D + +D           +  + +  G F L    + ++ G 
Sbjct: 131 --FSSMMGPMATSIVYPAIDPIKEDYKTTSIMVNVSVGVYQISLGVFPLWWSSISEMNGR 188

Query: 117 KKTLLGGYVVVVIWSLICGLSSYAHNVDFFVVARSFQGLGIAFVLPNVMGIVGNIYKPNT 176
           +   +  +++++ +++  GLS    N++ F++ R   G   A V     G V ++Y P  
Sbjct: 189 RTVYVLSFLLLLAFNVGTGLSP---NINDFIILRVLSGGAAASVQSVGAGTVADLYVPEE 245

Query: 177 EAKNLVFSLIGACAPIGATLGCVFSGLIGA 206
              N+    +G   P+ A L    S +IGA
Sbjct: 246 RGTNIGIYYMG---PLMAPL---VSPIIGA 269

>Skud_16.450 Chr16 complement(791420..793288) [1869 bp, 622 aa] {ON}
           YPR156C (REAL)
          Length = 622

 Score = 33.5 bits (75), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 38/138 (27%), Positives = 61/138 (44%), Gaps = 18/138 (13%)

Query: 105 LVSGKVGDIYGLKKTLLGGYVVVVIWSLICGLSSYAHNVDFFVVARSFQGLGIAFVLPNV 164
           L+   V D+YG +        + VI+++ C L   A N+   +V R   G+  +  L  V
Sbjct: 233 LIWSPVSDLYGRRVAYFVSMGLYVIFNIPCAL---APNLGCLLVCRFLCGVWSSSGLCLV 289

Query: 165 MGIVGNIYKPNTEAKNLVFSLIGACAP-IGATLGCVFSGLIG---ARTDLWGWTFYAYAI 220
            G + +++   T  K + F    A AP +G  +G + +G I     R DL  W   A+A 
Sbjct: 290 GGSIADMFPSETRGKAIAFF---AFAPYVGPVVGPLVNGFISVSTGRMDLIFWVNMAFA- 345

Query: 221 TAALNGLVALWIIPNNIP 238
                    +WII + IP
Sbjct: 346 -------GVMWIIASAIP 356

>Suva_10.9 Chr10 complement(12679..14592) [1914 bp, 637 aa] {ON}
           YEL065W (REAL)
          Length = 637

 Score = 33.5 bits (75), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 54/247 (21%), Positives = 100/247 (40%), Gaps = 32/247 (12%)

Query: 253 IGVFGLILFNFVWNQAPI---------AGWGSAYXXXXXXXXXXXXXXFITYEIRFAKQP 303
           I  FGLIL  F ++   +          GW +                ++ +E+ FA  P
Sbjct: 302 IDAFGLILLGFAFSLILLPCSLYSYAEGGWKNPSMIAMEVIGGIFLISYVIFEVFFAPFP 361

Query: 304 LLPHSVLFNRKLM--MILSSLFFGWGSFGIWTFYYMSF-MLNLRHYSPLWAGGTY----- 355
           LLP  VL NR  +  +++  ++   G F +  F   +F +LNL + + ++   T      
Sbjct: 362 LLPKRVLVNRTFICCVVIDFIYQMGGYFSLLFFTSYTFVVLNLSYKNWVYLSNTTTMGLC 421

Query: 356 FMFAIWGIVASLLVGYTIHKTGPAVILFLSMVAFDCGCIMLAVTPVHQTYFRMTLGIMII 415
           F   +WG++      Y I +     I  + M      C     +P          GI +I
Sbjct: 422 FFGVVWGVLFRYFHRYKIFQVVGIAIKLIGM-GLYVACSKKDGSP----------GIGLI 470

Query: 416 LSFGMDLSFPAASIILSDQLPSQ----YQGMAGSLVSTMISYSMSLCLGISGTAEHQVNK 471
           ++  +  +F  A+ ++  Q+ +Q    +Q MA ++    +  S+   +G + T+    N+
Sbjct: 471 VAALIVTNFGDAANVMGTQVAAQAAVPHQDMAATISVLSLYSSIGAAVGTAITSAVWTNE 530

Query: 472 NGIDLLK 478
               LLK
Sbjct: 531 LPGALLK 537

>Smik_6.22 Chr6 complement(31536..33446) [1911 bp, 636 aa] {ON}
           YEL065W (REAL)
          Length = 636

 Score = 33.5 bits (75), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 35/137 (25%), Positives = 59/137 (43%), Gaps = 14/137 (10%)

Query: 253 IGVFGLILFNFVWNQAPI---------AGWGSAYXXXXXXXXXXXXXXFITYEIRFAKQP 303
           I  FGLIL  F ++   +          GW +                ++ +E+ FA  P
Sbjct: 301 IDAFGLILLGFAFSLILLPCSLYSYAEGGWNNPSMIAMEVVGGILLISYVVFEVFFAPFP 360

Query: 304 LLPHSVLFNRKLM--MILSSLFFGWGSFGIWTFYYMSF-MLNLRHYSPLWAGGTYFM-FA 359
           LLP  VL NR  +  +I+  ++   G F +  F   +F +LNL +   ++   T  M   
Sbjct: 361 LLPKRVLMNRTFICCVIIDFIYQMAGYFSLLFFTSYTFVVLNLSYRDWVYLSNTTTMGLC 420

Query: 360 IWGIV-ASLLVGYTIHK 375
            +G+V  +L  G+  +K
Sbjct: 421 FFGVVWGALFRGFHRYK 437

>Skud_7.448 Chr7 complement(742873..744708) [1836 bp, 611 aa] {ON}
           YGR138C (REAL)
          Length = 611

 Score = 33.5 bits (75), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 38/138 (27%), Positives = 61/138 (44%), Gaps = 18/138 (13%)

Query: 105 LVSGKVGDIYGLKKTLLGGYVVVVIWSLICGLSSYAHNVDFFVVARSFQGLGIAFVLPNV 164
           L+   V D+YG +        + VI+++ C L   A N+   +V R   G+  +  L  V
Sbjct: 221 LIWSPVSDLYGRRVAYFVSMGLYVIFNIPCAL---APNLGCLLVCRFLCGVWSSSGLCLV 277

Query: 165 MGIVGNIYKPNTEAKNLVFSLIGACAP-IGATLGCVFSGLIG---ARTDLWGWTFYAYAI 220
            G + +++   T  K + F    A AP +G  +G + +G I     R DL  W   A+A 
Sbjct: 278 GGSIADMFPSETRGKAIAFF---AFAPYVGPVVGPLVNGFISVSTGRMDLIFWVNMAFA- 333

Query: 221 TAALNGLVALWIIPNNIP 238
                    +WII + IP
Sbjct: 334 -------GVMWIIASAIP 344

>KLLA0E09879g Chr5 complement(874102..875994) [1893 bp, 630 aa] {ON}
           similar to uniprot|P36172 Saccharomyces cerevisiae
           YKR105C Hypothetical ORF
          Length = 630

 Score = 33.5 bits (75), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 25/108 (23%), Positives = 55/108 (50%), Gaps = 4/108 (3%)

Query: 49  KEYIFVLSSMLSQLLNQAATTQTNPLFDVLSKDLNAKVSQQPWLMASFPLVSGSFILVSG 108
           + Y+ + + +L+QL+        N + DV+SK+L    ++  WL+  + L +    L+ G
Sbjct: 73  RLYVCLFALVLAQLIVALDVFIVNTVIDVVSKNLGG-YAKSGWLITGYSLPNSLLSLIWG 131

Query: 109 KVGDIYGLKKTLLGGYVVVVIWSLICGLSSYAHNVDFFVVARSFQGLG 156
           +   + G + ++L    +  + S++   S+ A +++  VV R   G+G
Sbjct: 132 RATSLLGFQSSMLISIFIFEVGSIV---SATATSMNNLVVGRVVAGIG 176

>Skud_6.14 Chr6 complement(19547..21457) [1911 bp, 636 aa] {ON}
           YEL065W (REAL)
          Length = 636

 Score = 33.5 bits (75), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 35/137 (25%), Positives = 60/137 (43%), Gaps = 14/137 (10%)

Query: 253 IGVFGLILFNFVWNQAPI---------AGWGSAYXXXXXXXXXXXXXXFITYEIRFAKQP 303
           I  FGLIL  F ++   +          GW +                ++ +E+ FA  P
Sbjct: 301 IDAFGLILLGFAFSLILLPCSLYSYAEGGWNNPSMIAMEVVGGIFLISYVVFEVFFAPFP 360

Query: 304 LLPHSVLFNRKLM--MILSSLFFGWGSFGIWTFYYMSF-MLNLRHYSPLWAGGTYFM-FA 359
           LLP  VL NR  +  +I+  ++   G F +  F   +F +LNL + + ++   T  M   
Sbjct: 361 LLPKRVLMNRTFICCVIIDFIYQMAGYFSLLFFTSYTFVVLNLSYRNWVYLSNTTTMGLC 420

Query: 360 IWGIV-ASLLVGYTIHK 375
            +G+V  +L  G+  +K
Sbjct: 421 FFGVVWGALFRGFHRYK 437

>NDAI0B03770 Chr2 complement(947945..949660) [1716 bp, 571 aa] {ON} 
          Length = 571

 Score = 33.1 bits (74), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 51/245 (20%), Positives = 94/245 (38%), Gaps = 23/245 (9%)

Query: 6   NDDEENWEKLQSSSAAGEERDGQTEAIGPKSRLQNPDYFDKPWKEY------IFVLSSML 59
           ++D+++   +  S    + +  QT     KS    PD    P+  +      I V+    
Sbjct: 32  HNDDDDESVINISDINPKNQLCQT-----KSNQNEPDIASPPYSRFGTTEKMILVIQCAF 86

Query: 60  SQLLNQAATTQTNPLFDVLSKDLNAKVSQQPWLMASFPLVSGSFILVSGKVGDIYGLKKT 119
           +   +  A     P+  V+  + N         +  + +  G    + G + D  G +  
Sbjct: 87  TGFFSSIAGAIYYPVLSVIENEFNITEEMVNITVVVYFIFQGIAPSIMGGLADSMGRRPV 146

Query: 120 LLGGYVVVVIWSLICGLSSYAHNVDFFVVARSFQGLGIAFVLPNVMGIVGNIYKPNTEAK 179
           +L     V+++   C   + +H     +V R  Q  GI+ V+    GI+G+I     E  
Sbjct: 147 VLSS---VLVYCCACIGLACSHTYAQIIVLRCLQAAGISPVIAINSGIMGDI-TTRAERG 202

Query: 180 NLVFSLIGACAPIGATLGCVFSGLIGA-RTDLWGWT--FYAYAITAALNGLVALWIIPNN 236
             V  + G        +G  F  LIGA  +  W W   F+  AI + +  + ++ I+P  
Sbjct: 203 GYVGYVSGF-----QVIGSAFGALIGAGLSATWSWRSIFWFLAIGSGVCLVASIIILPET 257

Query: 237 IPTNV 241
             T V
Sbjct: 258 KRTVV 262

>YBR180W Chr2 (589741..591459) [1719 bp, 572 aa] {ON}  DTR1Putative
           dityrosine transporter, required for spore wall
           synthesis; expressed during sporulation; member of the
           major facilitator superfamily (DHA1 family) of multidrug
           resistance transporters
          Length = 572

 Score = 33.1 bits (74), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 52/257 (20%), Positives = 103/257 (40%), Gaps = 25/257 (9%)

Query: 6   NDDEENWEKLQSSSAAGEERDGQTEAIGPKSRLQNPD--------YFDKPWKEYIFVLSS 57
           ++  ++   L +  A  +E +   ++   +SR  +PD        YF K  +  IF +  
Sbjct: 58  HEHPDSSPSLSAQKAKTKEEEVAVKSSNSQSRDPSPDTQAHIPYTYFSKDQRLIIFGIII 117

Query: 58  MLSQLLNQAATTQTNPL------FDVLSKDLNAKVSQQPWLMASFPLVSGSFILVSGKVG 111
            +  L   +       L      +DV +  +NA VS     MA F +      L  G + 
Sbjct: 118 FIGFLGPMSGNIYIPALPLLQREYDVSATTINATVSV---FMAVFSVGP----LFWGALA 170

Query: 112 DIYGLKKTLLGGYVVVVIWSLICGLSSYAHNVDFFVVARSFQGLGIAFVLPNVMGIVGNI 171
           D  G K   +    +++I +++  L++   N+    V R FQ    + V+    G V ++
Sbjct: 171 DFGGRKFLYMVSLSLMLIVNIL--LAAVPVNIAALFVLRIFQAFASSSVISLGAGTVTDV 228

Query: 172 YKPNTEAKNLVFSLIGACAPIGATLGCVFSGLIGARTDLWGWTFYAYAITAALNGLVALW 231
             P    K + + ++G    +G  +  + +GLI  + + W W F   +I   +  ++   
Sbjct: 229 VPPKHRGKAIAYFMMGPN--MGPIIAPIVAGLILMKGNYWRWLFGFTSIMTGIALILVTA 286

Query: 232 IIPNNIPTNVNEYKMDW 248
           ++P  +   V      W
Sbjct: 287 LLPETLRCIVGNGDPKW 303

>KLTH0B10054g Chr2 complement(839166..840677) [1512 bp, 503 aa] {ON}
           weakly similar to uniprot|P53322 Saccharomyces
           cerevisiae YGR260W TNA1 High affinity nicotinic acid
           plasma membrane permease
          Length = 503

 Score = 33.1 bits (74), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 30/123 (24%), Positives = 54/123 (43%), Gaps = 5/123 (4%)

Query: 125 VVVVIWSLICGLSSYAHNVDFFVVARSFQGLGIAFVLPNVMGIVGNIYKPNTEAKNLVFS 184
           ++V  WS+I   S +  +    +  R   G       P +  ++  +YKP  +AK + F 
Sbjct: 134 ILVFCWSVITLSSGFVKSYHSLLATRILLGTFEGGFFPAMTLLITMMYKPKEQAKRIAF- 192

Query: 185 LIGACAPIGATLGCVFSGLIGART--DLWGWTFYAYAITAALNGLVALWIIPNNIPTNVN 242
             G+ A  GA  G + +GL        L GW  + Y I   ++   + W+    +P N++
Sbjct: 193 FFGSSALSGAFGGLIATGLASVNNAGGLEGWR-WLYIIEGLISVCASFWLF-FGLPDNLD 250

Query: 243 EYK 245
           + K
Sbjct: 251 KMK 253

>KLTH0E00462g Chr5 (45358..46869) [1512 bp, 503 aa] {ON} weakly
           similar to uniprot|P53322 Saccharomyces cerevisiae
           YGR260W TNA1 High affinity nicotinic acid plasma
           membrane permease
          Length = 503

 Score = 33.1 bits (74), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 30/123 (24%), Positives = 54/123 (43%), Gaps = 5/123 (4%)

Query: 125 VVVVIWSLICGLSSYAHNVDFFVVARSFQGLGIAFVLPNVMGIVGNIYKPNTEAKNLVFS 184
           ++V  WS+I   S +  +    +  R   G       P +  ++  +YKP  +AK + F 
Sbjct: 134 ILVFCWSVITLSSGFVKSYHSLLATRILLGTFEGGFFPAMTLLITMMYKPKEQAKRIAF- 192

Query: 185 LIGACAPIGATLGCVFSGLIGART--DLWGWTFYAYAITAALNGLVALWIIPNNIPTNVN 242
             G+ A  GA  G + +GL        L GW  + Y I   ++   + W+    +P N++
Sbjct: 193 FFGSSALSGAFGGLIATGLASVNNAGGLEGWR-WLYIIEGLISVCASFWLF-FGLPDNLD 250

Query: 243 EYK 245
           + K
Sbjct: 251 KMK 253

>TDEL0D03800 Chr4 (695403..697325) [1923 bp, 640 aa] {ON} Anc_3.245
           YBR043C
          Length = 640

 Score = 33.1 bits (74), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 47/218 (21%), Positives = 91/218 (41%), Gaps = 13/218 (5%)

Query: 23  EERDGQTEAIGPKSRLQNPDYFDKPWKEYIFVLSSMLSQLLNQAATTQTNPLFDVLSKDL 82
           +ER G    +      ++P  +    K+ I VL    S L+   AT+   P  + +++ L
Sbjct: 62  KERRGLLAHLSIIPEFKDPRDYPASIKKLI-VLIIAFSSLMGPMATSIVFPAINPITESL 120

Query: 83  NAKVSQQPWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYVVVVIWSLICGLSSYAHN 142
           +         +  + L  G F L      +++G +   +  ++++  + +   LS    N
Sbjct: 121 DTTTFMVNISVGVYSLSLGIFPLWWSSFSEMHGRRSVYVVSFIMLFGFCIGAALSP---N 177

Query: 143 VDFFVVARSFQGLGIAFVLPNVMGIVGNIYKPNTEAKNLVFSLIGAC-APIGATLGCVFS 201
           +  F++ R   G   A V     G V ++Y P    +NL    +G   AP+ A +  + S
Sbjct: 178 ISSFIILRVLCGAASASVQSVGAGTVSDLYIPEDRGRNLGIYYMGPLMAPLIAPI--IAS 235

Query: 202 GLIGARTDLWGW--TFYAYAITAALNGLVALWIIPNNI 237
           GL+      W W  T +   I A  + L+ ++ +P  +
Sbjct: 236 GLVTR----WSWRSTQWFMVILAGFDVLLLVFFLPETL 269

>KNAG0E01160 Chr5 (228323..230041) [1719 bp, 572 aa] {ON} 
          Length = 572

 Score = 33.1 bits (74), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 41/170 (24%), Positives = 73/170 (42%), Gaps = 33/170 (19%)

Query: 115 GLKKTLLGGY-----------VVVVIWSLICGLSSYAHNVDFFVVARSFQGLGIAFVLPN 163
           GL  TL+GG              V+I+   C   + ++N    +  R  Q  GI+ V+  
Sbjct: 130 GLSPTLMGGLADSLGRRPVILCSVIIYFCACIGLACSNNYAQVIALRCLQAAGISPVIAI 189

Query: 164 VMGIVGNIYKPNTEAKNLVF-SLIGACAPIGATLGCVFSGLIGARTDLWGWT--FYAYAI 220
             G++G++    T+A+   +   +     +G   G VF  L+ +R   WGW   F+  AI
Sbjct: 190 NSGMMGDV---TTKAERGGYVGYVSGFQVVGTATGAVFGALLSSR---WGWRSIFWFLAI 243

Query: 221 TAALNGLVALWIIPNNIPTNVNEYKMDWIGSAIGVFGLILFNFVWNQAPI 270
            +    +V+L ++P        E K   +G+     G +    ++N +PI
Sbjct: 244 GSGACSIVSLLLLP--------ETKRTIVGN-----GSVTPKSIYNYSPI 280

>KLLA0B06798g Chr2 (596500..598491) [1992 bp, 663 aa] {ON} similar
           to uniprot|P38227 Saccharomyces cerevisiae YBR043C QDR3
           Multidrug transporter required for resistance to
           quinidine barban cisplatin and bleomycin member of the
           major facilitator superfamily of transporters conferring
           multiple drug resistance (MFS-MDR)
          Length = 663

 Score = 33.1 bits (74), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 36/145 (24%), Positives = 62/145 (42%), Gaps = 19/145 (13%)

Query: 96  FPLVSGSFILVSGKVGDIYGLKKTLLGGYVVVVIWSLICGLSSYAHNVDFFVVARSFQGL 155
           FP+   S   + G+   +Y L  TLL  + +          S+ + N+  F+V R  QG 
Sbjct: 162 FPIWWSSLSEIEGR-RTVYVLSFTLLTAFTIG---------SALSPNISAFIVFRMLQGA 211

Query: 156 GIAFVLPNVMGIVGNIYKPNTEAKNLVFSLIGACAPIGATLGCVFSGLIGA-RTDLWGW- 213
             A V     G + +++ P    KNL +  +G        +  + S +IGA   + W W 
Sbjct: 212 SSASVQSVGAGTISDLFIPEERGKNLGYYYLGTL------MAPLLSPIIGALLVNRWSWR 265

Query: 214 -TFYAYAITAALNGLVALWIIPNNI 237
            T +   I A +N L+   ++P  +
Sbjct: 266 STQWFMVILAVVNVLLFTLLLPETL 290

>TPHA0B01270 Chr2 complement(283532..285754) [2223 bp, 740 aa] {ON}
           Anc_1.261 YKR024C
          Length = 740

 Score = 33.1 bits (74), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 44/184 (23%), Positives = 77/184 (41%), Gaps = 28/184 (15%)

Query: 6   NDDEENWEKLQSSSAAGEERDGQTEAIGPKSRLQNPDYFDKPWKEYIFVLSSMLSQLLNQ 65
           ND +  WE     S A + + G+ +  GP +                 + + + SQ++  
Sbjct: 76  NDAKATWESFSGESGASDNQKGKQKKDGPSN----------------VIPAHISSQVVTS 119

Query: 66  AATTQTNPLFDVLSKDLNAKVSQQPWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYV 125
             T  +N   D L K++N K   +    ++ PL++  F   S  V DI  L K L     
Sbjct: 120 LFT--SNRKIDTL-KNINQKNEDEETNPSNAPLIADDF--ESSGVSDI--LVKHLHEKLK 172

Query: 126 V---VVIWSLICGLSSYAHNVDFFVVARSFQGLGIAFVLPNVMGIVGNIYKPNTEAKNLV 182
           +     I  L+       +N D F+ A++  G  +AF+LP +  I+    K   + K+  
Sbjct: 173 IDKPTSIQKLVLPQLLSNNNEDLFIHAQTGSGKTLAFLLPILSRILN--MKTRVDRKSGC 230

Query: 183 FSLI 186
           F++I
Sbjct: 231 FAII 234

>SAKL0C05588g Chr3 (527748..529781) [2034 bp, 677 aa] {ON} similar
           to uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 677

 Score = 32.7 bits (73), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 26/130 (20%), Positives = 60/130 (46%), Gaps = 6/130 (4%)

Query: 87  SQQPWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYVVVVIWSLICGLSSYAHNVDFF 146
           S+  W+++ + L      L+ G+   I G K +LL   ++    SLI  +S   ++++  
Sbjct: 153 SKSGWIVSGYSLTEALLTLLWGRFATIIGFKSSLLVSILIFEAGSLISAIS---NSMNML 209

Query: 147 VVARSFQGLGIAFVLPNVMGIVGNIYKPNTEAKNLVFSLIGACAPIGATLGCVFSGLIGA 206
           +  R   G+G + +  ++  ++ +   P+  ++ ++ S++     + A +G    G +  
Sbjct: 210 IGGRVVAGIGGSGI-QSLCFVIASTLTPD-RSRVIIISVLSCSYAVAAVVGPFLGGALTT 267

Query: 207 RTDLWGWTFY 216
               W W FY
Sbjct: 268 HVT-WRWCFY 276

>Kpol_416.6 s416 (26742..28535) [1794 bp, 597 aa] {ON}
           (26742..28535) [1794 nt, 598 aa]
          Length = 597

 Score = 32.7 bits (73), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 29/106 (27%), Positives = 46/106 (43%), Gaps = 3/106 (2%)

Query: 239 TNVNEYKMDWIGS--AIGVFGLILFNFVWNQAPIAGWGSAYXXXXXXXX-XXXXXXFITY 295
           T +  +K+D+IG   A+  FGL+L  F         W +A                F+T+
Sbjct: 269 TEIFLWKLDFIGLLLAVAFFGLVLVPFTLAGGLNKKWKTARIIVPEVLGWVVAFPAFLTW 328

Query: 296 EIRFAKQPLLPHSVLFNRKLMMILSSLFFGWGSFGIWTFYYMSFML 341
           EI+FAK PL P   + +R +   L    F   +F +   Y  + +L
Sbjct: 329 EIKFAKYPLTPWKTVKDRGVFSALIIAIFLQTAFYMQKTYMYTILL 374

>Kwal_27.12832 s27 (1393503..1395029) [1527 bp, 508 aa] {ON} YGR260W
           (TNA1) - 1:1 [contig 261] FULL
          Length = 508

 Score = 32.7 bits (73), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 33/125 (26%), Positives = 56/125 (44%), Gaps = 9/125 (7%)

Query: 126 VVVIWSLICGLSSYAHNVDFFVVARSFQGLGIAFVLPNVMGIVGNIYKPNTEAKNLVFSL 185
           +V  WS+I   + +  +    +  R   G       P ++ +V  IYKP  +AK +    
Sbjct: 140 MVFCWSVITLGNGFIQSYHSLIALRVLLGAFEGGYFPAMILLVSMIYKPEEQAKRIAL-F 198

Query: 186 IGACAPIGATLGCVFSGL--IGARTDLWGWTFYAYAITAALNGLVALWI---IPNNI--P 238
            G  A  GA  G + +GL  +   + L GW  + Y I   ++   ++WI   +P +I  P
Sbjct: 199 FGCAALAGAFGGLIATGLATVNGASGLNGWR-WLYIIEGLISITASIWIYFGLPTDIEKP 257

Query: 239 TNVNE 243
             +NE
Sbjct: 258 AFLNE 262

>TBLA0G02550 Chr7 complement(668523..670364) [1842 bp, 613 aa] {ON}
           Anc_2.242 YNL065W
          Length = 613

 Score = 32.7 bits (73), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 50/102 (49%), Gaps = 11/102 (10%)

Query: 106 VSGKVGDIYGLKKTLLGGYVVVVIWSL-ICGLSSYAHNVDFFVVARSFQGLGIAFVLPNV 164
           VSG + DIYG +  +L G +V V+ S+ I   +SY       +  R  Q  GI+ ++   
Sbjct: 153 VSGGLADIYGRRPVILFGMLVYVVASIGIAACNSYG----VIIFLRCLQSTGISPLIAIS 208

Query: 165 MGIVGNIYKPNTEAKNLVFSLIGACAPIGATLGCVFSGLIGA 206
            G VG+      +A+   F  +GA + +   +G  F  LIGA
Sbjct: 209 SGAVGDF---TVKAERGTF--VGAVSGL-VLMGQAFGSLIGA 244

>Suva_12.245 Chr12 (391999..393774) [1776 bp, 591 aa] {ON} YAL067C
           (REAL)
          Length = 591

 Score = 32.7 bits (73), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 30/112 (26%), Positives = 48/112 (42%), Gaps = 10/112 (8%)

Query: 130 WSLICGLSSYAHNVDFFVVARSFQGLGIAFVLPNVMG---IVGNIYKPNTEAKNLVFSLI 186
           WSL+   ++Y ++V      R F G   AF  P+ +    + G+ YK +   +   F  +
Sbjct: 212 WSLLTVGAAYVNSVPHLKAIRFFIG---AFEAPSYLAYQYLFGSFYKHDEMVRRSAFYYL 268

Query: 187 GACAPI---GATLGCVFSGLIGAR-TDLWGWTFYAYAITAALNGLVALWIIP 234
           G    I   G     VFS L G      W W F   AI +   G++  +++P
Sbjct: 269 GQYLGILSAGGIQSAVFSSLNGVNGLAGWRWNFIIDAIVSVAVGIIGFYVLP 320

>KLLA0F17776g Chr6 complement(1627198..1628859) [1662 bp, 553 aa]
           {ON} weakly similar to uniprot|Q04301 Saccharomyces
           cerevisiae YMR088C VBA1 Permease of basic amino acids in
           the vacuolar membrane
          Length = 553

 Score = 32.3 bits (72), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 26/112 (23%), Positives = 51/112 (45%), Gaps = 6/112 (5%)

Query: 45  DKPWKEYIFVLSSMLSQLLNQAATTQTNPLFDVLSKDLNAKVSQQPWLMASFPLVSGSFI 104
           D  W  +   + S L+ L     TT    L   ++ +L+A  +Q  W+  S+ L   +F 
Sbjct: 30  DVNWIVFALFVGSYLAAL----DTTIVTTLLPTIASELDAS-NQMSWIATSYLLSCSAFQ 84

Query: 105 LVSGKVGDIYGLKKTLLGGYVVVVIWSLICGLSSYAHNVDFFVVARSFQGLG 156
            + GK+ D++G K  L+   +      ++CG + +  ++    + R   G+G
Sbjct: 85  PLYGKLSDVFGRKPLLIWSNLCFGFGCILCG-APFTKSLWMLCIGRFIAGVG 135

>YPR198W Chr16 (934034..935665) [1632 bp, 543 aa] {ON}  SGE1Plasma
           membrane multidrug transporter of the major facilitator
           superfamily, acts as an extrusion permease; partial
           multicopy suppressor of gal11 mutations
          Length = 543

 Score = 32.3 bits (72), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 25/74 (33%), Positives = 39/74 (52%), Gaps = 3/74 (4%)

Query: 91  WLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYVVVVIWSLICGLSSYAHNVDFFVVAR 150
           WL+  + L +  F+L+ G++ +I G K+ L+   +V  I SLI  LS+    +    V  
Sbjct: 47  WLVTGYALSNAVFMLLWGRLAEILGTKECLMISVIVFEIGSLISALSNSMATLISGRVVA 106

Query: 151 SFQGLGI---AFVL 161
            F G GI   AFV+
Sbjct: 107 GFGGSGIESLAFVV 120

>ZYRO0A00330g Chr1 (19597..21327) [1731 bp, 576 aa] {ON} similar to
           uniprot|P38358 Saccharomyces cerevisiae YBR293W VBA2
           Permease of basic amino acids in the vacuolar membrane
          Length = 576

 Score = 32.3 bits (72), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 58/229 (25%), Positives = 92/229 (40%), Gaps = 37/229 (16%)

Query: 2   NMKENDDEENWEKLQ-SSSAAGEER-----DGQ---TEAIGPKSRLQNPDYFDKPWKEYI 52
           N + N D+ N   L  S S  GE R     D Q    +   P SR+ +    +      +
Sbjct: 18  NKQTNADKINQHYLSISHSDVGEYREEPNDDEQGDLDDETTPLSRIPHLWLIEAALYTNV 77

Query: 53  FVLSSMLSQLLNQAATTQTNPLFDVLSKDLNAKVSQQPWLMASFPLVSGSFILVSGKVGD 112
           F         L+   +T T   +  +  + N  +    W+ AS+ + S SF  + G   D
Sbjct: 78  F---------LSGFDSTVTASTYQTIGNEFN-HMDLSSWITASYLITSTSFQPLYGSFSD 127

Query: 113 IYGLKKTLLGGYVVVVIWSLICGLSSYAHNVDFFVVARSFQGLGIAFVLPNVMGIVGNIY 172
           + G +K L    ++  I  L CG+S    N+ +    R+F G+G    L  +  IV +  
Sbjct: 128 VLGRRKCLFFASMIFSIGCLGCGISI---NILWLSFMRAFTGIGGG-GLITLSTIVNSDM 183

Query: 173 KPNTEA------KNLVFSLIGACAPIGATLGCVFSGLIGARTDLWGWTF 215
            P ++       +NL+  L   C   GA+ G V +  IG     W W F
Sbjct: 184 IPTSKRGIFQAFQNLLLGLGAIC---GASFGGVITSSIG-----WRWCF 224

>Kwal_26.7984 s26 complement(598830..600668) [1839 bp, 612 aa] {ON}
           YNR055C (HOL1) - Putative ion transporter similar to the
           major facilitator superfamily of transporters [contig
           55] FULL
          Length = 612

 Score = 32.0 bits (71), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 35/160 (21%), Positives = 70/160 (43%), Gaps = 8/160 (5%)

Query: 78  LSKDLNAKVSQQPWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYVVVVIWSLICGLS 137
           L+++ N  +S   +L+    L      +++     ++G +   L G +V    S+ C +S
Sbjct: 105 LAEEFNRSLSDISYLVGGMMLALAFGSIIASPSAVLFGKRILYLIGIIVFFFGSIGCSVS 164

Query: 138 SYAHNVDFFVVARSFQGLGIAFVLPNVMGIVGNIYKPNTEAKNL-VFSLIGACAPIGATL 196
              H+ +  + +R   GLG+A +       V  IY  +  A  L V++L+      G  L
Sbjct: 165 ---HSYESLLASRIVSGLGVATIESLPSATVAEIYFAHERAYRLGVYTLLLLG---GKNL 218

Query: 197 GCVFSGLIGARTDLWGWTFYAYAITAALNGLVALWIIPNN 236
             + + L+    D + W F+   I   +N ++ L+ +P  
Sbjct: 219 VPLLASLVFQSLDRY-WLFWIVTIIVGINFVLHLFFVPET 257

>SAKL0D11000g Chr4 (910457..912430) [1974 bp, 657 aa] {ON} similar
           to uniprot|P25351 Saccharomyces cerevisiae YCR023C
           Hypothetical ORF
          Length = 657

 Score = 32.0 bits (71), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 45/156 (28%), Positives = 61/156 (39%), Gaps = 22/156 (14%)

Query: 91  WLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYVVVVIWSLICGLSSYAHNVDFFVVAR 150
           +L ++F L      L  GK  D YG K  L  G       SLI G S   +   F   AR
Sbjct: 106 YLSSTFALCQVLSSLQWGKFSDKYGRKPALFIGLCGTCASSLILGFSQNFYQALF---AR 162

Query: 151 SFQGL--GIAFVLPNVMGIVGNIYKPNTEAKNLVFSLIGACAPIGATLGCVFSGLIGART 208
           S  GL  G   VL  V+G V +        + L FS +    P+    G V   +IG   
Sbjct: 163 SLMGLLNGNVAVLRTVIGEVAS----ERRHQALAFSTM----PLLFQFGSVIGPMIGG-- 212

Query: 209 DLWGWTFYAYAITAALNGLVALWIIPNNIPTNVNEY 244
                 F+++   +  N  V  W +P  I   V +Y
Sbjct: 213 ------FFSFPKGSDNNKEVPKW-LPKPIAKMVEKY 241

>Smik_16.408 Chr16 complement(709761..711629) [1869 bp, 622 aa] {ON}
           YPR156C (REAL)
          Length = 622

 Score = 32.0 bits (71), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 37/138 (26%), Positives = 60/138 (43%), Gaps = 18/138 (13%)

Query: 105 LVSGKVGDIYGLKKTLLGGYVVVVIWSLICGLSSYAHNVDFFVVARSFQGLGIAFVLPNV 164
           L+   V D+YG +        + VI+++ C L   A N+   +  R   G+  +  L  V
Sbjct: 233 LIWSPVSDLYGRRVAYFVSMGLYVIFNIPCAL---APNLGCLLACRFLCGVWSSSGLCLV 289

Query: 165 MGIVGNIYKPNTEAKNLVFSLIGACAP-IGATLGCVFSGLIG---ARTDLWGWTFYAYAI 220
            G + +++   T  K + F    A AP +G  +G + +G I     R DL  W   A+A 
Sbjct: 290 GGSIADMFPSETRGKAIAFF---AFAPYVGPVVGPLVNGFISVSTGRMDLIFWVNMAFA- 345

Query: 221 TAALNGLVALWIIPNNIP 238
                    +WII + IP
Sbjct: 346 -------GVMWIIASAIP 356

>YGR138C Chr7 complement(763762..765606) [1845 bp, 614 aa] {ON}
           TPO2Polyamine transport protein specific for spermine;
           localizes to the plasma membrane; transcription of TPO2
           is regulated by Haa1p; member of the major facilitator
           superfamily
          Length = 614

 Score = 32.0 bits (71), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 37/138 (26%), Positives = 60/138 (43%), Gaps = 18/138 (13%)

Query: 105 LVSGKVGDIYGLKKTLLGGYVVVVIWSLICGLSSYAHNVDFFVVARSFQGLGIAFVLPNV 164
           L+   V D+YG +        + VI+++ C L   A N+   +  R   G+  +  L  V
Sbjct: 224 LIWSPVSDLYGRRVAYFVSMGLYVIFNIPCAL---APNLGCLLACRFLCGVWSSSGLCLV 280

Query: 165 MGIVGNIYKPNTEAKNLVFSLIGACAP-IGATLGCVFSGLIG---ARTDLWGWTFYAYAI 220
            G + +++   T  K + F    A AP +G  +G + +G I     R DL  W   A+A 
Sbjct: 281 GGSIADMFPSETRGKAIAFF---AFAPYVGPVVGPLVNGFISVSTGRMDLIFWVNMAFA- 336

Query: 221 TAALNGLVALWIIPNNIP 238
                    +WII + IP
Sbjct: 337 -------GVMWIISSAIP 347

>Skud_3.172 Chr3 complement(280981..282546) [1566 bp, 521 aa] {ON}
           YCR098C (REAL)
          Length = 521

 Score = 32.0 bits (71), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 37/170 (21%), Positives = 70/170 (41%), Gaps = 13/170 (7%)

Query: 1   MNMKENDDEENWEKLQSSSAAGEERDGQTEAIGPKSRLQNPDYFDKPWKEYIFVLSS--- 57
           M   E  D    ++++ +      R  + +A G  +R Q+       WK  I +++S   
Sbjct: 1   MMKTEEKDSSTIDEIEFNEK-NNSRIIKYDAEGRATRTQSSK--KDKWKNIITIIASGFA 57

Query: 58  MLSQLLNQAATTQTNPLF--DVLSKDLNAKVSQQPWLMASFPLVSGSFILVSGKVGDIYG 115
           ++S      + +  N LF  +  +K+ ++KVS +    +   ++ G F +  G   D Y 
Sbjct: 58  LISDGYVNGSMSMLNKLFVMEYGAKNYSSKVSTRVSNASLVGIIFGQFFM--GIAADYYS 115

Query: 116 LKKTLLGGYVVVVIWSLICGLSSYAHNVDFF---VVARSFQGLGIAFVLP 162
            K  +L    ++V+ S +C  S        F    V R   G+G+    P
Sbjct: 116 RKSCILVATTILVVGSALCAASHGTTVPGMFWMLTVMRGLVGIGVGAEYP 165

>YPR156C Chr16 complement(837909..839777) [1869 bp, 622 aa] {ON}
           TPO3Polyamine transport protein specific for spermine;
           localizes to the plasma membrane; member of the major
           facilitator superfamily
          Length = 622

 Score = 31.6 bits (70), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 37/138 (26%), Positives = 60/138 (43%), Gaps = 18/138 (13%)

Query: 105 LVSGKVGDIYGLKKTLLGGYVVVVIWSLICGLSSYAHNVDFFVVARSFQGLGIAFVLPNV 164
           L+   V D+YG +        + VI+++ C L   A N+   +  R   G+  +  L  V
Sbjct: 233 LIWSPVSDLYGRRVAYFVSMGLYVIFNIPCAL---APNLGSLLACRFLCGVWSSSGLCLV 289

Query: 165 MGIVGNIYKPNTEAKNLVFSLIGACAP-IGATLGCVFSGLIG---ARTDLWGWTFYAYAI 220
            G + +++   T  K + F    A AP +G  +G + +G I     R DL  W   A+A 
Sbjct: 290 GGSIADMFPSETRGKAIAFF---AFAPYVGPVVGPLVNGFISVSTGRMDLIFWVNMAFA- 345

Query: 221 TAALNGLVALWIIPNNIP 238
                    +WII + IP
Sbjct: 346 -------GVMWIISSAIP 356

>KLTH0C10142g Chr3 (842371..844092) [1722 bp, 573 aa] {ON} similar
           to uniprot|P33335 Saccharomyces cerevisiae YPR198W SGE1
           Member of drug-resistance protein family multicopy
           suppressor of gal11 null mutation
          Length = 573

 Score = 31.6 bits (70), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 30/126 (23%), Positives = 56/126 (44%), Gaps = 6/126 (4%)

Query: 91  WLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYVVVVIWSLICGLSSYAHNVDFFVVAR 150
           WL+  + L +  F L+ G++  I GLK +L    V+  I SLI  +S   +++   +  R
Sbjct: 46  WLVTGYALPNALFTLLWGRLASILGLKTSLTFSIVIFEIGSLIVAVS---NSMGMIIGGR 102

Query: 151 SFQGLGIAFVLPNVMGIVGNIYKPNTEAKNLVFSLIGACAPIGATLGCVFSGLIGARTDL 210
              G G + +   V  +  ++ +     + +V +++G    +   +G V  G        
Sbjct: 103 VVAGCGGSGIQSLVFVVGTSLVEERN--RGMVITVLGLAFAVAFAVGPVIGGAFTENVS- 159

Query: 211 WGWTFY 216
           W W FY
Sbjct: 160 WRWCFY 165

>KLTH0G09372g Chr7 (780184..781839) [1656 bp, 551 aa] {ON} similar
           to uniprot|P53943 Saccharomyces cerevisiae YNL065W AQR1
           Plasma membrane transporter of the major facilitator
           superfamily that confers resistance to short- chain
           monocarboxylic acids and quinidine
          Length = 551

 Score = 31.6 bits (70), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 35/135 (25%), Positives = 58/135 (42%), Gaps = 11/135 (8%)

Query: 73  PLFDVLSKDLNAKVSQQPWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYVVVVIWSL 132
           P    L K  N         +  + +  G    +SG + D+YG +  +L G ++ V  S+
Sbjct: 108 PALKQLEKKFNVSEEMVNITVVVYLIFQGIAPTISGGLADVYGRRPVILMGMLIYVCASI 167

Query: 133 ICGLSSYAHNVDFFVVARSFQGLGIAFVLPNVMGIVGNIYKPNTEAKNLVFSLIGACAPI 192
             GL+  + +    V  R  Q  GI+ ++    G+VG+    +        + +GA +  
Sbjct: 168 --GLAC-SQSYGVIVFLRCLQSAGISPIIAINSGVVGDFTLKHERG-----TFVGAVS-- 217

Query: 193 GATL-GCVFSGLIGA 206
           G TL G  F  LIGA
Sbjct: 218 GFTLMGQAFGSLIGA 232

>KNAG0K01020 Chr11 complement(198213..200012) [1800 bp, 599 aa] {ON}
           
          Length = 599

 Score = 31.6 bits (70), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 31/147 (21%), Positives = 62/147 (42%), Gaps = 7/147 (4%)

Query: 87  SQQPWLMASFPLVSGSFILVSGKVG-DIYGLKKTLLGGYVVVVIWSLICGLSSYAHNVDF 145
           ++  W++A + L +    L+ G++     G K  +L   V+  I SLIC L   A+++D 
Sbjct: 93  AKTGWIIAGYSLPNALMSLLWGRIAFSFLGFKTAMLSAIVIFEIGSLICAL---ANSMDM 149

Query: 146 FVVARSFQGLGIAFVLPNVMGIVGNIYKPNTEAKNLVFSLIGACAPIGATLGCVFSGLIG 205
            +  R   G+G + +      I   +  P    +  + + + A   I + +G    G   
Sbjct: 150 LIGGRVIAGIGGSGIQSLSFVIGSTLVSP--RGRGFIIAFMSASFGIASVIGPFIGGAFT 207

Query: 206 ARTDLWGWTFYAYAITAALNGLVALWI 232
           +    W W F+      A+  ++  W+
Sbjct: 208 SHVT-WRWCFWINLPVGAVALVIFTWV 233

>NCAS0D04970 Chr4 (952902..954650) [1749 bp, 582 aa] {ON} 
          Length = 582

 Score = 31.6 bits (70), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 32/120 (26%), Positives = 52/120 (43%), Gaps = 13/120 (10%)

Query: 130 WSLICGLSSYAHNVDFFVVARSFQGLGIAFVLPNVMG---IVGNIYKPNTEAKNLVFSLI 186
           WSL+   ++Y ++V      R F G    F  P+ +    + G  YK +   +   F  +
Sbjct: 210 WSLLTIGAAYVNSVPHLKAIRFFIG---GFEAPSYLAYQYLFGCFYKHDEMVRRSAFYYL 266

Query: 187 GACAPI---GATLGCVFSGLIGARTDL--WGWTFYAYAITAALNGLVALWIIPNNIPTNV 241
           G    I   G     V+S L G R  L  W W+F   AI +   G++  +++P + P N 
Sbjct: 267 GQYVGILSSGGIQSAVYSNLDG-RNGLSGWRWSFIIDAIISVFVGILGFYVLPGD-PDNC 324

>KLLA0F03311g Chr6 (311639..313267) [1629 bp, 542 aa] {ON} similar
           to uniprot|P53943 Saccharomyces cerevisiae YNL065W AQR1
           Plasma membrane transporter of the major facilitator
           superfamily that confers resistance to short- chain
           monocarboxylic acids and quinidine
          Length = 542

 Score = 31.6 bits (70), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 51/220 (23%), Positives = 87/220 (39%), Gaps = 27/220 (12%)

Query: 4   KENDDEENWEKLQSSSAAGEERDGQTEAIGPK----------SRLQNPDYFDKPWKEYIF 53
           K+N D    E     +   E RD   + +  +          S+ +     D P+    +
Sbjct: 19  KKNCDNTGSESSVFRTVTRELRDDTDDVVTHEIYDEESFPDGSKQEQLSEEDVPYTLLTY 78

Query: 54  VLSSMLSQLLNQAA--TTQTNPLFDVLSKDLNAKVSQQPWLM----ASFPLVSGSFILVS 107
                +  LL  A   ++  +P++    K+L A+      L+      + L  G    +S
Sbjct: 79  RQKWFMVALLTSAGFWSSLGSPIYYPALKELEAEFDVNEELINITVVVYLLFQGIAPTIS 138

Query: 108 GKVGDIYGLKKTLLGGYVVVVIWSLICGLSSYAHNVDFFVVARSFQGLGIAFVLPNVMGI 167
           G + D+YG +  +L G ++ VI S+    S     V F    R  Q  GI+ ++    G+
Sbjct: 139 GGLADVYGRRPIILLGMLIYVIASIGLACSKSYGAVVFL---RCLQSAGISPIIAINSGV 195

Query: 168 VGNIYKPNTEAKNLVFSLIGACAPIGATL-GCVFSGLIGA 206
            G+        K+   + +GA +  G TL G  F  LIGA
Sbjct: 196 AGDF-----TVKSERGTFVGAVS--GFTLMGQAFGSLIGA 228

>YGR224W Chr7 (942806..944647) [1842 bp, 613 aa] {ON}  AZR1Plasma
           membrane transporter of the major facilitator
           superfamily, involved in resistance to azole drugs such
           as ketoconazole and fluconazole
          Length = 613

 Score = 31.2 bits (69), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 28/130 (21%), Positives = 61/130 (46%), Gaps = 6/130 (4%)

Query: 87  SQQPWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYVVVVIWSLICGLSSYAHNVDFF 146
           S+  WL   + L +    L+ G++    G K+T+L   V+  I SLI   S+ A+++   
Sbjct: 102 SEIGWLFTGYSLPNALLALIWGRIATPIGFKETMLFAIVIFEIGSLI---SALANSMSML 158

Query: 147 VVARSFQGLGIAFVLPNVMGIVGNIYKPNTEAKNLVFSLIGACAPIGATLGCVFSGLIGA 206
           +  R   G+G    + ++  ++G+     ++ + ++ +++     I + +G    G+  +
Sbjct: 159 IGGRVIAGVG-GCGIQSLSFVIGSTLVEESQ-RGILIAVLSCSFAIASVVGPFLGGVFTS 216

Query: 207 RTDLWGWTFY 216
               W W FY
Sbjct: 217 SVT-WRWCFY 225

>TDEL0D05710 Chr4 complement(1025468..1027318) [1851 bp, 616 aa]
           {ON} Anc_3.503 YPR156C
          Length = 616

 Score = 31.2 bits (69), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 31/114 (27%), Positives = 51/114 (44%), Gaps = 10/114 (8%)

Query: 110 VGDIYGLKKTLLGGYVVVVIWSLICGLSSYAHNVDFFVVARSFQGLGIAFVLPNVMGIVG 169
           V D+YG +        + VI+++ C +S    N+   +V R   G+  +  L  V G + 
Sbjct: 232 VSDLYGRRVAYFVSMGLYVIFNIPCAISP---NISGLMVCRFLCGVWASSGLCLVGGSIA 288

Query: 170 NIYKPNTEAKNLVFSLIGACAP-IGATLGCVFSGLIGA---RTDLWGWTFYAYA 219
           +++   T  K + F    A AP +G   G + +G I     R DL  W   A+A
Sbjct: 289 DMFPSETRGKAIAFF---AFAPYVGPVFGPLVNGFISVSTRRMDLIFWVNMAFA 339

>TDEL0C02370 Chr3 (416622..418817) [2196 bp, 731 aa] {ON} Anc_7.309
           YDL194W
          Length = 731

 Score = 31.2 bits (69), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 29/100 (29%), Positives = 48/100 (48%), Gaps = 8/100 (8%)

Query: 78  LSKDLNAKVSQQPWLMASFPLVSGSFI--LVSGKVGDIYGLKKTLLGGYVVVVIWSLICG 135
           L+ D     +++  ++ SF L  G+FI  L +  + D YG K T++  +  VV++ +   
Sbjct: 132 LAPDHEGFSAREMAIIVSF-LSLGTFIGALSAPLLSDSYGRKATII--FSTVVVFLIGNS 188

Query: 136 LSSYAHNVDFFVVARSFQGLGIAF---VLPNVMGIVGNIY 172
           L   AH+V   +  R   GLGI     V+P   G   N +
Sbjct: 189 LQVAAHSVKLLIAGRVISGLGIGLISAVVPLYQGEAANKF 228

>KNAG0B02810 Chr2 (541349..543745) [2397 bp, 798 aa] {ON} Anc_7.309
           YDL194W
          Length = 798

 Score = 31.2 bits (69), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 36/127 (28%), Positives = 64/127 (50%), Gaps = 12/127 (9%)

Query: 62  LLNQAATTQTNPLFDVLSKDLNAKVSQQPWLMASFPLVSGSFI--LVSGKVGDIYGLKKT 119
           L+N  A  + N + + L+ + NA  +++  ++ SF L  G+F+  L++  + D +G KKT
Sbjct: 139 LINSIA--EMNYVKEHLTPNRNAFTTKEMAIVVSF-LSMGTFVGALMAPFLSDSWGRKKT 195

Query: 120 LLGGYVVVVIWSLICGLSSYAHNVDFFVVARSFQGLGIAFVLPNVMGIVGNIYKPNTEAK 179
           ++     VVI+S+   L   A ++   VV R   GL I      V+  V  +Y+     K
Sbjct: 196 IIAS--TVVIFSVGNSLQVGAASMTLLVVGRVVSGLAIG-----VISAVVPLYQAEAAKK 248

Query: 180 NLVFSLI 186
            L  ++I
Sbjct: 249 ELRGAII 255

>Kwal_23.4824 s23 (883258..884919) [1662 bp, 553 aa] {ON} YNL065W
           (AQR1) - multidrug resistance transporter [contig 5]
           FULL
          Length = 553

 Score = 30.8 bits (68), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 31/102 (30%), Positives = 51/102 (50%), Gaps = 11/102 (10%)

Query: 106 VSGKVGDIYGLKKTLLGGYVVVVIWSLICGLSSYAHNVDFFVVARSFQGLGIAFVLPNVM 165
           +SG + D+YG +  +L G ++ V  S+  GL+  +++    V  R  Q  GI+ ++    
Sbjct: 141 ISGGLADVYGRRPVILIGMLIYVCASI--GLAC-SNSYGVIVFLRCLQSAGISPIIAINS 197

Query: 166 GIVGNIYKPNTEAKNLVFSLIGACAPIGATL-GCVFSGLIGA 206
           G+VG+        K    + +GA +  G TL G  F  LIGA
Sbjct: 198 GVVGDF-----TVKQERGTFVGAVS--GFTLMGQAFGSLIGA 232

>SAKL0D04070g Chr4 (331254..333257) [2004 bp, 667 aa] {ON} similar
           to uniprot|P38227 Saccharomyces cerevisiae YBR043C QDR3
           Multidrug transporter required for resistance to
           quinidine barban cisplatin and bleomycin member of the
           major facilitator superfamily of transporters conferring
           multiple drug resistance (MFS-MDR)
          Length = 667

 Score = 30.8 bits (68), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 28/114 (24%), Positives = 50/114 (43%), Gaps = 11/114 (9%)

Query: 134 CGLSSYAHNVDFFVVARSFQGLGIAFVLPNVMGIVGNIYKPNTEAKNLVFSLIGA-CAPI 192
           C  ++ + N+  F++ R   G   A V     G + ++Y P    KNL +  +GA  AP+
Sbjct: 179 CIGTAVSPNIQAFIILRVLCGASSASVQSVGAGTIADLYAPEERGKNLGYFYLGALTAPL 238

Query: 193 GATLGCVFSGLIGA-RTDLWGW--TFYAYAITAALNGLVALWIIPNNIPTNVNE 243
                   S +IG+   + W W  T +   I A  N ++ +  +P  +    N+
Sbjct: 239 -------LSPIIGSLLVNHWSWRSTQWFMVILAGANVILIVLFLPETLRLQENK 285

>Kwal_26.9616 s26 (1294683..1296371) [1689 bp, 562 aa] {ON} YPR198W
           (SGE1) - Member of drug-resistance protein family
           [contig 363] FULL
          Length = 562

 Score = 30.8 bits (68), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 31/143 (21%), Positives = 58/143 (40%), Gaps = 7/143 (4%)

Query: 74  LFDVLSKDLNAKVSQQPWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYVVVVIWSLI 133
           L+D + K  N   +   WLM  + L +   +L+ G++  + GLK +L+   V+    SL+
Sbjct: 30  LYDTIGKVFN-DYANVGWLMTGYNLPNALCMLLWGRIASLVGLKNSLVASIVIFEAGSLL 88

Query: 134 CGLSSYAHNVDFFVVARSFQGLGIAFVLPNVMGIVGNIYKPNTEAKNLVFSLIGACAPIG 193
             L   A ++   +  R   G G + +   V  +   +      A+  V +++G    + 
Sbjct: 89  AAL---ATSMGMLIGGRVIAGFGGSGIETLVFAVGTRMVDEKHRAR--VVTILGIAYMLA 143

Query: 194 ATLGCVFSGLIGARTDLWGWTFY 216
              G    G        W W F+
Sbjct: 144 EGAGPFIGGAFAEHVS-WRWCFF 165

>ZYRO0C09614g Chr3 complement(732463..733257) [795 bp, 264 aa] {ON}
           similar to uniprot|Q02774 Saccharomyces cerevisiae
           YDL212W SHR3 Endoplasmic reticulum packaging chaperone
           required for incorporation of amino acid permeases into
           COPII coated vesicles for transport to the cell surface
          Length = 264

 Score = 30.4 bits (67), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 34/66 (51%), Gaps = 14/66 (21%)

Query: 155 LGIAFVLPNVMGIVGN---IYKPNTEAKN-----LVFSLIGACAPIGATLGCVFSGLIGA 206
           +G+A V   V+G+VG+   IYKPN + +N     LV    G C      L  V +G+I +
Sbjct: 66  IGLAAVA--VIGLVGHLIRIYKPNPDLRNFEYGSLVLYFFGVC----VCLSNVKTGIISS 119

Query: 207 RTDLWG 212
            T  WG
Sbjct: 120 VTGEWG 125

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.325    0.139    0.439 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 50,364,307
Number of extensions: 2024682
Number of successful extensions: 7798
Number of sequences better than 10.0: 259
Number of HSP's gapped: 7913
Number of HSP's successfully gapped: 274
Length of query: 515
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 401
Effective length of database: 40,409,475
Effective search space: 16204199475
Effective search space used: 16204199475
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 68 (30.8 bits)