Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_27.102398.844ON91491443560.0
KLTH0C03784g8.844ON99792225650.0
SAKL0D01364g8.844ON108293615830.0
TDEL0B005408.844ON111589612831e-159
NCAS0B002808.844ON1081101912671e-157
Ecym_46158.844ON1067100912661e-157
ZYRO0G14256g8.844ON125972812441e-152
KNAG0G034408.844ON1053101112211e-151
ABL122C8.844ON1043100912171e-151
KAFR0A028508.844ON104265011851e-146
TPHA0I002708.844ON103985311541e-141
CAGL0B02365g8.844ON105071711041e-134
KLLA0D01485g8.844ON11516609921e-117
Kpol_1068.58.844ON10324979711e-115
YML117W (NAB6)8.844ON11346149181e-107
NDAI0E002708.844ON11984979051e-104
Suva_13.268.844ON11223798671e-99
Smik_13.178.844ON11313918493e-97
TBLA0B032808.844ON13622038391e-94
Skud_13.248.844ON11283938213e-93
SAKL0A05280g6.183ON5821994422e-45
NCAS0H010406.183ON6291984319e-44
TBLA0B052106.183ON7101984276e-43
Kwal_27.111586.183ON5671984226e-43
AFL061C6.183ON5231984119e-42
NDAI0F022606.183ON6801984179e-42
Ecym_22336.183ON5761984121e-41
KLLA0E19031g6.183ON6521984151e-41
KLTH0H04906g6.183ON5691994112e-41
Kpol_1002.696.183ON5901984102e-41
TDEL0G016206.183ON5841984093e-41
CAGL0C01419g6.183ON6391984114e-41
ZYRO0G08140g6.183ON6321984043e-40
YPL184C (MRN1)6.183ON6121984033e-40
KNAG0M004306.183ON4431983943e-40
Smik_6.3906.183ON6251984033e-40
TPHA0J022106.183ON5931984023e-40
Skud_16.946.183ON6141984024e-40
Suva_16.1236.183ON5961984006e-40
KAFR0B066906.183ON5331983862e-38
KNAG0A024008.466ON301107890.040
ZYRO0F07238g8.670ON389209880.066
KAFR0A038308.670ON37467880.071
ACR135C8.670ON37669850.14
KLTH0F02838g1.102ON330113810.44
KAFR0D026003.379ON28853742.6
TPHA0L012008.466ON32268733.7
NDAI0C038205.254ON47066734.6
TDEL0C059901.102ON33774717.6
NCAS0B009508.797ON219187698.7
KLLA0F11275g8.670ON38569709.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_27.10239
         (914 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_27.10239 s27 (255440..258184) [2745 bp, 914 aa] {ON} YML117...  1682   0.0  
KLTH0C03784g Chr3 (328834..331827) [2994 bp, 997 aa] {ON} simila...   992   0.0  
SAKL0D01364g Chr4 (105477..108725) [3249 bp, 1082 aa] {ON} simil...   614   0.0  
TDEL0B00540 Chr2 (100637..103984) [3348 bp, 1115 aa] {ON} Anc_8....   498   e-159
NCAS0B00280 Chr2 (30005..33250) [3246 bp, 1081 aa] {ON} Anc_8.844     492   e-157
Ecym_4615 Chr4 complement(1199802..1203005) [3204 bp, 1067 aa] {...   492   e-157
ZYRO0G14256g Chr7 complement(1136628..1140407) [3780 bp, 1259 aa...   483   e-152
KNAG0G03440 Chr7 complement(736829..739990) [3162 bp, 1053 aa] {...   474   e-151
ABL122C Chr2 complement(167005..170136) [3132 bp, 1043 aa] {ON} ...   473   e-151
KAFR0A02850 Chr1 complement(590196..593324) [3129 bp, 1042 aa] {...   461   e-146
TPHA0I00270 Chr9 complement(50298..53417) [3120 bp, 1039 aa] {ON...   449   e-141
CAGL0B02365g Chr2 complement(224663..227815) [3153 bp, 1050 aa] ...   429   e-134
KLLA0D01485g Chr4 (129351..132806) [3456 bp, 1151 aa] {ON} simil...   386   e-117
Kpol_1068.5 s1068 (7832..9475,9855..9863,10320..11765) [3099 bp,...   378   e-115
YML117W Chr13 (34243..37647) [3405 bp, 1134 aa] {ON}  NAB6Putati...   358   e-107
NDAI0E00270 Chr5 (33295..36891) [3597 bp, 1198 aa] {ON} Anc_8.844     353   e-104
Suva_13.26 Chr13 (34036..37404) [3369 bp, 1122 aa] {ON} YML117W ...   338   1e-99
Smik_13.17 Chr13 (30501..33896) [3396 bp, 1131 aa] {ON} YML117W ...   331   3e-97
TBLA0B03280 Chr2 complement(764832..768920) [4089 bp, 1362 aa] {...   327   1e-94
Skud_13.24 Chr13 (33966..37352) [3387 bp, 1128 aa] {ON} YML117W ...   320   3e-93
SAKL0A05280g Chr1 complement(475021..476769) [1749 bp, 582 aa] {...   174   2e-45
NCAS0H01040 Chr8 complement(194824..196713) [1890 bp, 629 aa] {O...   170   9e-44
TBLA0B05210 Chr2 complement(1225521..1227653) [2133 bp, 710 aa] ...   169   6e-43
Kwal_27.11158 s27 (665984..667687) [1704 bp, 567 aa] {ON} YPL184...   167   6e-43
AFL061C Chr6 complement(317447..319018) [1572 bp, 523 aa] {ON} S...   162   9e-42
NDAI0F02260 Chr6 (546978..549020) [2043 bp, 680 aa] {ON} Anc_6.183    165   9e-42
Ecym_2233 Chr2 complement(453154..454884) [1731 bp, 576 aa] {ON}...   163   1e-41
KLLA0E19031g Chr5 (1694566..1696524) [1959 bp, 652 aa] {ON} simi...   164   1e-41
KLTH0H04906g Chr8 complement(436720..438429) [1710 bp, 569 aa] {...   162   2e-41
Kpol_1002.69 s1002 complement(185133..186905) [1773 bp, 590 aa] ...   162   2e-41
TDEL0G01620 Chr7 complement(316768..318522) [1755 bp, 584 aa] {O...   162   3e-41
CAGL0C01419g Chr3 complement(153063..154982) [1920 bp, 639 aa] {...   162   4e-41
ZYRO0G08140g Chr7 (663951..665849) [1899 bp, 632 aa] {ON} simila...   160   3e-40
YPL184C Chr16 complement(195950..197788) [1839 bp, 612 aa] {ON} ...   159   3e-40
KNAG0M00430 Chr13 complement(63427..64758) [1332 bp, 443 aa] {ON...   156   3e-40
Smik_6.390 Chr6 (626853..628730) [1878 bp, 625 aa] {ON} YPL184C ...   159   3e-40
TPHA0J02210 Chr10 (494346..496127) [1782 bp, 593 aa] {ON} Anc_6....   159   3e-40
Skud_16.94 Chr16 complement(169165..171009) [1845 bp, 614 aa] {O...   159   4e-40
Suva_16.123 Chr16 complement(205700..207490) [1791 bp, 596 aa] {...   158   6e-40
KAFR0B06690 Chr2 (1394829..1396430) [1602 bp, 533 aa] {ON} Anc_6...   153   2e-38
KNAG0A02400 Chr1 complement(236366..237271) [906 bp, 301 aa] {ON...    39   0.040
ZYRO0F07238g Chr6 complement(586327..587496) [1170 bp, 389 aa] {...    39   0.066
KAFR0A03830 Chr1 complement(779143..780267) [1125 bp, 374 aa] {O...    39   0.071
ACR135C Chr3 complement(585997..587127) [1131 bp, 376 aa] {ON} S...    37   0.14 
KLTH0F02838g Chr6 complement(245748..246740) [993 bp, 330 aa] {O...    36   0.44 
KAFR0D02600 Chr4 complement(514523..515369,515443..515462) [867 ...    33   2.6  
TPHA0L01200 Chr12 (250506..251474) [969 bp, 322 aa] {ON} Anc_8.4...    33   3.7  
NDAI0C03820 Chr3 (871538..872950) [1413 bp, 470 aa] {ON} Anc_5.2...    33   4.6  
TDEL0C05990 Chr3 (1079338..1080351) [1014 bp, 337 aa] {ON} Anc_1...    32   7.6  
NCAS0B00950 Chr2 (150330..150989) [660 bp, 219 aa] {ON} Anc_8.797      31   8.7  
KLLA0F11275g Chr6 (1038770..1039927) [1158 bp, 385 aa] {ON} weak...    32   9.5  

>Kwal_27.10239 s27 (255440..258184) [2745 bp, 914 aa] {ON} YML117W -
           Hypothetical ORF [contig 38] PARTIAL
          Length = 914

 Score = 1682 bits (4356), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 833/914 (91%), Positives = 833/914 (91%)

Query: 1   MSSPFLATPGVGHSSPHRHVTNKSSQAYKSTQLRMPPSDAIRGSRRHNKEKHLYDEGTRQ 60
           MSSPFLATPGVGHSSPHRHVTNKSSQAYKSTQLRMPPSDAIRGSRRHNKEKHLYDEGTRQ
Sbjct: 1   MSSPFLATPGVGHSSPHRHVTNKSSQAYKSTQLRMPPSDAIRGSRRHNKEKHLYDEGTRQ 60

Query: 61  IPYKLTFNILPRNGNGDGDKFRTRSLYFSNLNPDVRLHEFLATFHKFDRIESVYVVDREQ 120
           IPYKLTFNILPRNGNGDGDKFRTRSLYFSNLNPDVRLHEFLATFHKFDRIESVYVVDREQ
Sbjct: 61  IPYKLTFNILPRNGNGDGDKFRTRSLYFSNLNPDVRLHEFLATFHKFDRIESVYVVDREQ 120

Query: 121 QSVLVSFLTKETCLDFYNGILQKLSEFKKELRSKELSLSFASPQKVESGPTLQEIKFEVL 180
           QSVLVSFLTKETCLDFYNGILQKLSEFKKELRSKELSLSFASPQKVESGPTLQEIKFEVL
Sbjct: 121 QSVLVSFLTKETCLDFYNGILQKLSEFKKELRSKELSLSFASPQKVESGPTLQEIKFEVL 180

Query: 181 RAGATRSLGLEFKDEIDFASLLKKFDFFDNSGPRYVIESIETVNTDKPSKYFGSNYAIVH 240
           RAGATRSLGLEFKDEIDFASLLKKFDFFDNSGPRYVIESIETVNTDKPSKYFGSNYAIVH
Sbjct: 181 RAGATRSLGLEFKDEIDFASLLKKFDFFDNSGPRYVIESIETVNTDKPSKYFGSNYAIVH 240

Query: 241 FISIAMAVETMEYLKVQTPESFGLTKVSYVNSTFTSGKSEFQTFSNSELSDQNDVEVQDS 300
           FISIAMAVETMEYLKVQTPESFGLTKVSYVNSTFTSGKSEFQTFSNSELSDQNDVEVQDS
Sbjct: 241 FISIAMAVETMEYLKVQTPESFGLTKVSYVNSTFTSGKSEFQTFSNSELSDQNDVEVQDS 300

Query: 301 ISSFEDITLSEGSMSVENEKAFTVLPSQYGPPVVEEHNQHCSHITISKALXXXXXXXXXX 360
           ISSFEDITLSEGSMSVENEKAFTVLPSQYGPPVVEEHNQHCSHITISKAL          
Sbjct: 301 ISSFEDITLSEGSMSVENEKAFTVLPSQYGPPVVEEHNQHCSHITISKALSSKVSRNGSS 360

Query: 361 XXIASPQPQEVLVSNSEAPSSRNSIVSLLSARSQGPTYPVPGYHYYMDMSKPLGXXXXXX 420
             IASPQPQEVLVSNSEAPSSRNSIVSLLSARSQGPTYPVPGYHYYMDMSKPLG      
Sbjct: 361 SSIASPQPQEVLVSNSEAPSSRNSIVSLLSARSQGPTYPVPGYHYYMDMSKPLGQTLQQQ 420

Query: 421 XXXXXXXXXXMGGGAGNRTVYIGNISPRSKTEDICNVVRGGILQSVKYIEAKHICFVTFI 480
                     MGGGAGNRTVYIGNISPRSKTEDICNVVRGGILQSVKYIEAKHICFVTFI
Sbjct: 421 YTATAQVATAMGGGAGNRTVYIGNISPRSKTEDICNVVRGGILQSVKYIEAKHICFVTFI 480

Query: 481 EAASAVQFFANSSIEPIVLHGSLLKVGWGHHSGNLPQSISLAVTIGASRNVYVSLPEYAF 540
           EAASAVQFFANSSIEPIVLHGSLLKVGWGHHSGNLPQSISLAVTIGASRNVYVSLPEYAF
Sbjct: 481 EAASAVQFFANSSIEPIVLHGSLLKVGWGHHSGNLPQSISLAVTIGASRNVYVSLPEYAF 540

Query: 541 KDKFIKDPEYQAFREKFKLPSKQQLYDDFSTFGDIELINFLEDGHCCWINFMNISNAIKL 600
           KDKFIKDPEYQAFREKFKLPSKQQLYDDFSTFGDIELINFLEDGHCCWINFMNISNAIKL
Sbjct: 541 KDKFIKDPEYQAFREKFKLPSKQQLYDDFSTFGDIELINFLEDGHCCWINFMNISNAIKL 600

Query: 601 VEDANNSNNESFHEKFENRYRGLFIGYGKDRCGXXXXXXXXXXXXXXXXXXXXXXXXIRL 660
           VEDANNSNNESFHEKFENRYRGLFIGYGKDRCG                        IRL
Sbjct: 601 VEDANNSNNESFHEKFENRYRGLFIGYGKDRCGNVNKNLVSNKNSKYFKKVKKASYNIRL 660

Query: 661 RRQQKSDIEAQAKSGKGDENSEKKLQVDAFGISVGSQPDARYSDEEQKIEENELLLLSKP 720
           RRQQKSDIEAQAKSGKGDENSEKKLQVDAFGISVGSQPDARYSDEEQKIEENELLLLSKP
Sbjct: 661 RRQQKSDIEAQAKSGKGDENSEKKLQVDAFGISVGSQPDARYSDEEQKIEENELLLLSKP 720

Query: 721 NSAEGGLGISVSQDVTVTENNTACGGKNKTGSVSSGSSEVDILVSAPGSANTSQLEGGGP 780
           NSAEGGLGISVSQDVTVTENNTACGGKNKTGSVSSGSSEVDILVSAPGSANTSQLEGGGP
Sbjct: 721 NSAEGGLGISVSQDVTVTENNTACGGKNKTGSVSSGSSEVDILVSAPGSANTSQLEGGGP 780

Query: 781 TQRTTAASNGKKERSSGVSKLHCFSEIAPRVSKXXXXXXXXXXXXXXNCHYNSAPRRSAR 840
           TQRTTAASNGKKERSSGVSKLHCFSEIAPRVSK              NCHYNSAPRRSAR
Sbjct: 781 TQRTTAASNGKKERSSGVSKLHCFSEIAPRVSKASLDAVPPLAPAALNCHYNSAPRRSAR 840

Query: 841 KNGHDHDSNPVSGSKSDIXXXXXXXXXXXXXXXNAQAIPGSNVMAQYLAQLQHSTFMYAA 900
           KNGHDHDSNPVSGSKSDI               NAQAIPGSNVMAQYLAQLQHSTFMYAA
Sbjct: 841 KNGHDHDSNPVSGSKSDIGSKSTQGKSSKSRQRNAQAIPGSNVMAQYLAQLQHSTFMYAA 900

Query: 901 DILGVDDPNLHSTL 914
           DILGVDDPNLHSTL
Sbjct: 901 DILGVDDPNLHSTL 914

>KLTH0C03784g Chr3 (328834..331827) [2994 bp, 997 aa] {ON} similar
           to uniprot|Q03735 Saccharomyces cerevisiae YML117W NAB6
           Putative RNA-binding protein based on computational
           analysis of large-scale protein-protein interaction data
          Length = 997

 Score =  992 bits (2565), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 537/922 (58%), Positives = 641/922 (69%), Gaps = 24/922 (2%)

Query: 1   MSSPFLATPGVGHSSPHRHVTNKSSQA--------YKSTQLRMPPSDAIRGSRRHNKEKH 52
           MSSPFLATPG+G +SPHR   ++SS A        + STQLRMPP    R  +  +  +H
Sbjct: 68  MSSPFLATPGMGSASPHRAGGSRSSHAQSSYHTPNFGSTQLRMPPPTEKRNFKHGSSYRH 127

Query: 53  LYDEGTRQIPYKLTFNILPRNGNGDGDKFRTRSLYFSNLNPDVRLHEFLATFHKFDRIES 112
             +   +Q  Y++ F+ILPR+ +G GD++ TRSL FSNLNPD  LH+FL  F KFDR+ES
Sbjct: 128 --NSSVQQRAYEVVFHILPRSADGGGDEYMTRSLLFSNLNPDTHLHDFLTKFEKFDRVES 185

Query: 113 VYVVDREQQSVLVSFLTKETCLDFYNGILQKLSEFKKELRSKELSLSFASPQKVESGPTL 172
           VY+VD +QQSVLVSFLTKETCLDFYNG+LQKLSEFKKEL+SKEL+L+FAS + V++GPTL
Sbjct: 186 VYLVDSQQQSVLVSFLTKETCLDFYNGVLQKLSEFKKELKSKELTLNFASLRDVKTGPTL 245

Query: 173 QEIKFEVLRAGATRSLGLEFKDEIDFASLLKKFDFFDNSGPRYVIESIETVNTDKPSKYF 232
           QEIK EVLRAGATRSL LEF+D++D A L K   F  N GPRYV+E+IE VN  + SK+F
Sbjct: 246 QEIKIEVLRAGATRSLILEFQDKVDLALLSKSLGFIVNEGPRYVVEAIEIVNAGRSSKHF 305

Query: 233 GSNYAIVHFISIAMAVETMEYLKVQTPESFGLTKVSYVNSTFTSGKSEFQTFSNSELSDQ 292
           G +YAI+HFISIAMA+ET+EYLK Q+ +  GL K  YVN+T  SGKSEFQT S+S+L+++
Sbjct: 306 GPHYAIIHFISIAMALETVEYLKSQSNKLAGLIKFRYVNTTSASGKSEFQTLSSSQLNER 365

Query: 293 NDVEVQDSISSFEDITLSEGS---MSVENEKAFTVLPSQYGPPVVEEHNQHCSHITISKA 349
                 DS  S  +   S GS    +   E+   V P+QYG P+VEE ++H  H+TISKA
Sbjct: 366 ALSNTSDSDISGGESVASLGSKLQQTSLGEQTLVVDPTQYGRPLVEERSEHLPHVTISKA 425

Query: 350 LXXXXXXXXXXXXIASPQPQEVLVSNSEAPSSRNSIVSLLSARSQGPTYP-VPGYHYYMD 408
           L              SPQPQEVLV++ E  SSR S+VSL  A S GP YP +PGY +YM+
Sbjct: 426 LNSKSSLNDLTSNTTSPQPQEVLVNDHEDSSSRGSMVSLKQANSHGPAYPPIPGYPFYMN 485

Query: 409 MSKPLGXXXXXXXXXXXXXXXXMGGGAGNRTVYIGNISPRSKTEDICNVVRGGILQSVKY 468
           MSKPLG                MGGG GNRTVYIGNISPRSKTEDICNVVRGGILQSVKY
Sbjct: 486 MSKPLGQTLQQQYTTTAQVATAMGGGLGNRTVYIGNISPRSKTEDICNVVRGGILQSVKY 545

Query: 469 IEAKHICFVTFIEAASAVQFFANSSIEPIVLHGSLLKVGWGHHSGNLPQSISLAVTIGAS 528
           IEAKHICFVTFIEAASAVQFFANS+IEPIVLHG++LKVGWGHHSGNLPQSISLAVTIGAS
Sbjct: 546 IEAKHICFVTFIEAASAVQFFANSTIEPIVLHGNVLKVGWGHHSGNLPQSISLAVTIGAS 605

Query: 529 RNVYVSLPEYAFKDKFIKDPEYQAFREKFKLPSKQQLYDDFSTFGDIELINFLEDGHCCW 588
           RNVYVSLPE+AFKDKFIKDPEYQ F+EKF+LPSK+QLY+DFS FGDIEL+NFLEDGHCCW
Sbjct: 606 RNVYVSLPEHAFKDKFIKDPEYQEFKEKFQLPSKEQLYEDFSVFGDIELVNFLEDGHCCW 665

Query: 589 INFMNISNAIKLVEDANNSNNESFHEKFENRYRGLFIGYGKDRCGXXXXXXXXXXXXXXX 648
           INFMNISNAIKLVEDANN NN+SFHEKF NRY+GLFIGYGKDRCG               
Sbjct: 666 INFMNISNAIKLVEDANNPNNDSFHEKFGNRYKGLFIGYGKDRCGNVNKNLVANKNSKYF 725

Query: 649 XXXXXXXXXIRLRRQQKSDIEAQAKSGKGDENSEKKLQVDAFGISVG-SQPDARYSDEEQ 707
                    IRLR+QQK   +A  +     +  +K ++ DAFGISVG +Q   R SDEEQ
Sbjct: 726 KKVKKASYNIRLRKQQKGASDAPTEVKDEAKELDKPIKADAFGISVGDTQNLVRDSDEEQ 785

Query: 708 KIEENELLLLSKPNSAEGGLGISVSQDVTVTENNTACGGKNKTGSVSSGSSEVDILVSAP 767
           K+EE+ELL LS  N+  GGLGIS++       N       +K  SVSS SS+VDILVSAP
Sbjct: 786 KLEEDELLRLSDLNNTGGGLGISLASSTGEETNTPVSDESSKEESVSSESSDVDILVSAP 845

Query: 768 GSANTSQLEGGGPTQRTTAASNGKKER--SSGVSKLHCFSEIAPRVSKXXXXXXXXXXXX 825
           GSA+TSQLE        TA  + K+ R  ++   K   FS I PRVS             
Sbjct: 846 GSADTSQLES------KTAPRSPKQPRVLANVPEKPSAFSAIIPRVSSASLDAVPPLAPS 899

Query: 826 XXNCHYNSAPRRSARKNGHDHDSNPVSGSKSDIXXXXXXXXXXXXXXXNAQAIPGSNVMA 885
             +  Y +  + ++R+      +   S   +DI                ++AIPGS+VMA
Sbjct: 900 TLSRQYTATSKHNSRRGSRFGTTEKSSPRYNDI-RSQDSKKPLHPRRRKSKAIPGSDVMA 958

Query: 886 QYLAQLQHSTFMYAADILGVDD 907
           QYLAQLQHSTFMYAA+ILGVDD
Sbjct: 959 QYLAQLQHSTFMYAANILGVDD 980

>SAKL0D01364g Chr4 (105477..108725) [3249 bp, 1082 aa] {ON} similar to
            uniprot|Q03735 Saccharomyces cerevisiae YML117W NAB6
            Putative RNA-binding protein based on computational
            analysis of large-scale protein-protein interaction data
          Length = 1082

 Score =  614 bits (1583), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 384/936 (41%), Positives = 520/936 (55%), Gaps = 111/936 (11%)

Query: 47   HNKEKHLYDEGTRQI---PYKLTFNILPRNGNGDGDKFRTRSLYFSNLNPDVRLHEFLAT 103
            H ++ HL  E   Q    PY + F ILP+   GD D++ TRSL  SN+N  ++LH+F+  
Sbjct: 164  HKRKTHLRHETNSQPSSEPYVINFKILPK---GD-DEYMTRSLLLSNVNASIKLHDFITK 219

Query: 104  FHKFDRIESVYVV-------------------------DREQQSVLVSFLTKETCLDFYN 138
            F KF  IESVYVV                         + ++QS+L+SFLTK TCLDFYN
Sbjct: 220  FVKFGPIESVYVVPEEEEEEEEEEEEEEEEEEEEEEKGEEKKQSILLSFLTKNTCLDFYN 279

Query: 139  GILQKLSEFKKELRSKELSLSFASPQKVESGPTLQEIKFEVLRAGATRSLGLEFKDEIDF 198
             +LQKLS+FK +L SK L+L+F S        T ++I+ +VLR GATRS+ LEFK+    
Sbjct: 280  NVLQKLSDFKIDLNSKSLTLNFVSL-------TSEDIRDDVLRKGATRSIALEFKNSFTT 332

Query: 199  ASLLKKFDFFDNSGPRYVIESIETVNTDKPSKYFGSNYAIVHFISIAMAVETMEYLKVQT 258
              L       + S  R+V+E I+ VNT+ P+K F ++YAI+HFISI+MAVE   YL +  
Sbjct: 333  KQLESIEILSNASNSRFVVEKIDIVNTESPNKNFNTHYAIIHFISISMAVEASSYL-LNW 391

Query: 259  PESFGLTKVSYVNSTFTSGKSEFQTFSNSELSDQNDVEVQDSISSFEDITLSEGSMSVEN 318
             E  G++++ +V  +  +    F++   S+ + ++ V +  ++    +    +    V  
Sbjct: 392  DEKLGISRLFFVTDSIINKSDYFRSAPASQDASRSSVSIDQTL----EFATKKLQGLVLK 447

Query: 319  EKAFTVLPSQYGPPVVEEHNQHCSHITISK------ALXXXXXXXXXXXXIASPQPQEVL 372
            E+  ++ P  Y    +EEH  H + I+ISK                     +SP  QE+ 
Sbjct: 448  ERTLSIKPKTYPQAEIEEHQHHLTSISISKPLLSSNNNSSSVSLQGNQNLTSSPVTQEMY 507

Query: 373  VSNSEAPSSRNSIVSLLSARSQGPTYPVPGYHYYMDMSKPLGXXXXXXXXXXXXXXXXMG 432
            + ++ + S+R  ++   S  S    +  P  HYYMD++KP+                 MG
Sbjct: 508  LHDT-SNSTREDVMIQSSMASGTSNFVPPPPHYYMDVTKPIRQTLQQQLTTTAQVASNMG 566

Query: 433  GGAGNRTVYIGNISPRSKTEDICNVVRGGILQSVKYIEAKHICFVTFIEAASAVQFFANS 492
            GG GNRTVY+GNI+PRSK EDICNVVRGGILQ +K+ E KH+CFVTFIEAA+AVQFFAN+
Sbjct: 567  GGLGNRTVYLGNINPRSKPEDICNVVRGGILQHIKFFEHKHVCFVTFIEAAAAVQFFANA 626

Query: 493  SIEPIVLHGSLLKVGWGHHSGNLPQSISLAVTIGASRNVYVSLPEYAFKDKFIKDPEYQA 552
            SIEPIVLHG++LKVGWGHH G+L QSI+LAVTIGASRNVYVSLPEYAFKDKFIKDPE+Q 
Sbjct: 627  SIEPIVLHGNVLKVGWGHHPGDLAQSIALAVTIGASRNVYVSLPEYAFKDKFIKDPEFQE 686

Query: 553  FREKFKLPSKQQLYDDFSTFGDIELINFLEDGHCCWINFMNISNAIKLVEDANNSNNESF 612
            FREK++LPSK+QL  DFS FG+IE IN+L+DGHCCW+NFMNI++AIKLVEDAN ++N+ F
Sbjct: 687  FREKYELPSKEQLRQDFSNFGEIEQINYLDDGHCCWVNFMNITSAIKLVEDANGADNKKF 746

Query: 613  HEKFENRYRGLFIGYGKDRCGXXXXXXXXXXXXXXXXXXXXXXXXIRLRRQQKSDIEAQA 672
            H  +++RY+GL IGYGKDRCG                        IR+ +Q K+      
Sbjct: 747  HGSYQDRYKGLIIGYGKDRCGNVNKNLVANKKSRFFKKVKKASYKIRMHKQNKA------ 800

Query: 673  KSGKGDENSEKKLQVDAFGISVGSQ----------PDARYSDEEQKIEENE-LLLLSKPN 721
              G   +      Q +AFGI +  +          PD   + EE+K  +N  LL L+  N
Sbjct: 801  -GGSNGQEPISSFQDNAFGICISPRGIESEEVEALPDVPQNIEEEKNPQNNGLLKLANGN 859

Query: 722  SAEGGLGISVSQDVT-----------VTENNTACGGKNKTGSVSSGSSEVDILVSAPGSA 770
                GLGI  S  +              +      GK++  S SS SS++DI+VSAP   
Sbjct: 860  GIGEGLGIEFSPGLNKEGHEGDDKFDCIQQENGFDGKDEDESYSSDSSDIDIIVSAP--- 916

Query: 771  NTSQLEGGGPTQRTTAASNG------KKERS---------SGVSKLHCFSEIAPRVSKXX 815
              S  E     +  T+ +NG      KKE+S         SG++ L+  +     VS   
Sbjct: 917  EQSSAEEDDDKRSVTSYTNGHPTNKFKKEKSRTKLKRRPTSGLTDLYSLNGFPSMVSSTS 976

Query: 816  XXXXXXXXXXXXNCHYNSA---PRRSARKNG-HDHDSNPVSGSKSDIXXXXXXXXXXXXX 871
                        + HY+ A      S   NG HD       G K +              
Sbjct: 977  LDAVPPLAPSTVSRHYSVASSHSNNSYHNNGRHDASKKRHGGGKGNTHHGRHRK------ 1030

Query: 872  XXNAQAIPGSNVMAQYLAQLQHSTFMYAADILGVDD 907
               ++AIPGS VMAQYLAQLQHSTFMYAA+ILGV +
Sbjct: 1031 ---SKAIPGSQVMAQYLAQLQHSTFMYAANILGVTN 1063

>TDEL0B00540 Chr2 (100637..103984) [3348 bp, 1115 aa] {ON} Anc_8.844
           YML117W
          Length = 1115

 Score =  498 bits (1283), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 328/896 (36%), Positives = 471/896 (52%), Gaps = 147/896 (16%)

Query: 1   MSSPFLATPGV-----------GHSSPHRHVTNKSSQAYK----STQLRMPPS------- 38
           M SPF+++P +                + H  +KSS        +T   +PPS       
Sbjct: 76  MGSPFVSSPNLFQQPHHHQHAHQRLQQYSHNQSKSSSGRSFGKLATAYPVPPSLNSPPAS 135

Query: 39  -DAI--RGSRR--HNKEKHLYDEGTR-QIPYKLTFNILPRNGNGDGDKFRTRSLYFSNLN 92
            +A+  RG RR  H K     D   R + P+ LT+ +LP+ GN   D+FRTRSL F N++
Sbjct: 136 RNALHNRGPRRGSHYKSIQSSDASKRFKDPFILTYRVLPK-GN---DEFRTRSLLFENVD 191

Query: 93  PDVRLHEFLATFHKFDRIESVYVVDRE--QQSVLVSFLTKETCLDFYNGILQKLSEFKKE 150
             + LH F+  F  +  +ESVY+   E    S+L+SF +K  CLDFYN +LQ+LSE+K +
Sbjct: 192 GSIDLHSFVTNFTNYGPVESVYLFKSEGDHVSILLSFFSKAICLDFYNSVLQRLSEYKSD 251

Query: 151 LRSKELSLSFASPQKVESGPTLQEI-------------------KFEVLRAGATRSLGLE 191
           L SK L+LSF S +   S  + ++I                   +++V+  GATRS+ + 
Sbjct: 252 LDSKALTLSFVSLEYKVSDTSEEDIDKEDDSKPDAFNITAAGSLRYDVINRGATRSIMIT 311

Query: 192 FKDEIDFASLL-KKFDFFDN-SGPRYVIESIETVNTDKPSKYFGSNYAIVHFISIAMAVE 249
           FK       L+ KK +F    +  RYV+ESI+ V  D+PSK+F  NYA++ F++I MAVE
Sbjct: 312 FKTPCSKDELIDKKLEFLKKENNTRYVLESIDLVTADEPSKHFPQNYAVLTFLNIFMAVE 371

Query: 250 TMEYLKVQTPESFGLTKVSYVN-------------STFTSGKSEFQTFSN--SELSDQND 294
            ++Y+++ + +   ++K  +++             S+ ++G+S      N  S+ +    
Sbjct: 372 ILDYIRLHS-QKLDISKCFFISIQPQIPDGKRLSVSSASNGRSMESISGNYRSKNASVTS 430

Query: 295 VEVQDSISSFEDITLSEGSMSVEN----EKAFTVLPSQYGPPVVEEHNQHCSHITISKAL 350
           +E   SI S  D  + E +  +++    +    V  + Y  P  E H  H +++T+S+A 
Sbjct: 431 LESSGSIISL-DQEIDEMTYKLQSVNSKKNILEVTTNNYKDPSFEGHTDHLTNVTVSEA- 488

Query: 351 XXXXXXXXXXXXIASPQPQEVLVS-------NSEAPSSRNSIVSLLSARSQGP------T 397
                       +  P PQEV V+       +   P+  N   S+    +  P      T
Sbjct: 489 ------ASLDSQLTMPSPQEVTVNEYVLPNQDMPLPNDMNYAPSVQDVDAVPPSMVPMST 542

Query: 398 YPVPGYHYYM---------DMSKPLGXXXXXXXXXXXXXXXXMGGGAGNRTVYIGNISPR 448
            P   Y  YM         +M+KP+                 MGGG GNRTVYIGNI PR
Sbjct: 543 MPNTPYGCYMPPPNVRQNGNMTKPITQSLQRQYATSAEVASSMGGGIGNRTVYIGNIHPR 602

Query: 449 SKTEDICNVVRGGILQSVKYIEAKHICFVTFIEAASAVQFFANSSIEPIVLHGSLLKVGW 508
           S+TEDICNVVRGGILQ+VK++  K ICFVTF+EA++AVQF+ N+ I+PIVLHG++LKVGW
Sbjct: 603 SRTEDICNVVRGGILQNVKFLAEKRICFVTFVEASAAVQFYTNAFIDPIVLHGNMLKVGW 662

Query: 509 GHHSGNLPQSISLAVTIGASRNVYVSLPEYAFKDKFIKDPEYQAFREKFKLPSKQQLYDD 568
           GHHSG LP+SI+LAVT+GASRNVYVSLPE+AFKDK+I DP+Y+ + +KF+LP ++QL DD
Sbjct: 663 GHHSGPLPKSIALAVTVGASRNVYVSLPEFAFKDKYIYDPQYEEYNKKFRLPDEEQLRDD 722

Query: 569 FSTFGDIELINFLEDGHCCWINFMNISNAIKLVEDANNSNNESFHEKFENRYRGLFIGYG 628
           FS +GDIE IN+L DGHCCW+NF NIS AIKLVE+       +F++    RY GL IGYG
Sbjct: 723 FSHYGDIEQINYLNDGHCCWVNFTNISAAIKLVEEVKYEGGGNFYKMLGGRYDGLVIGYG 782

Query: 629 KDRCGXXXXXXXXXXXXXXXXXXXXXXXXIRL------RRQQKSDIEAQAKSGKGDENSE 682
           KDRCG                        IRL      RRQ +  +  Q ++     NSE
Sbjct: 783 KDRCGNVNKNFIAGKNSRFYKKVKKPSFNIRLSKMEEERRQHEETLRRQQEN-----NSE 837

Query: 683 KKLQVDAFGISVGSQ--------PDARYSDE------------------EQKIEENELLL 716
           K LQ  + GI++ S          D  + DE                  E   EE ELL 
Sbjct: 838 KFLQFGSLGITIDSNGKEDPEKVDDVDFEDEVKFDSNSPKKTVEQASGKESDQEEQELLK 897

Query: 717 LSKPNSAEGGLGISVSQDVTVTENNTACGGKN-----KTGSVSSGSSEVDILVSAP 767
           LS  +    GL I  SQ  +  E       +N     +T + S  SS+V++++++P
Sbjct: 898 LSNKSQGAQGLNIVESQGQSTREKEATKLTRNHSENDETSAKSDASSDVELIINSP 953

 Score = 56.6 bits (135), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 24/31 (77%), Positives = 29/31 (93%)

Query: 875  AQAIPGSNVMAQYLAQLQHSTFMYAADILGV 905
             ++IPGS+VMAQYLAQLQHSTF+YAA+ILG 
Sbjct: 1070 GKSIPGSDVMAQYLAQLQHSTFIYAANILGA 1100

>NCAS0B00280 Chr2 (30005..33250) [3246 bp, 1081 aa] {ON} Anc_8.844
          Length = 1081

 Score =  492 bits (1267), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 344/1019 (33%), Positives = 503/1019 (49%), Gaps = 162/1019 (15%)

Query: 1    MSSPFLATPGVGHSS------PHRHVTNKSSQAYKSTQLRM--PPSDAIRGSRRH-NKEK 51
            M SPF+ATP  GHS       P+    N++S +   + L +  PPS   +G++   N+ +
Sbjct: 98   MGSPFVATPTTGHSQSAIFQQPYMMTPNRASFSQIPSMLNVGNPPSARRQGNQNDPNRRR 157

Query: 52   HLYDEGTRQI--------PYKLTFNILPRNGNGDGDKFRTRSLYFSNLNPDVRLHEFLAT 103
              Y     +         P+++++ ILP   +GD D +RTRSL F N+   + LH F+  
Sbjct: 158  SSYRSKVPETDPKTLFLQPFRMSYKILP---SGD-DAYRTRSLLFENVVNSIELHTFMTE 213

Query: 104  FHKFDRIESVYVV----------DREQQSVLVSFLTKETCLDFYNGILQKLSEFKKELRS 153
            F +F  IESVY++          D E +S+L+SFLT+E CL FYN +LQ+L EFK +L+S
Sbjct: 214  FVRFSPIESVYLINHHDSDKPDDDTECRSILLSFLTREVCLTFYNNVLQRLKEFKAKLKS 273

Query: 154  KELSLSFASPQKVESGP-------------TLQEIKFEVLRAGATRSLGLEFKDEIDFAS 200
            + L LSF S +  +                T + + FE+    ATRS+ ++FK+      
Sbjct: 274  ENLRLSFVSIKYQDENEEEETNIVDEPSFYTKESVYFELSNPQATRSILIQFKNPCSEQE 333

Query: 201  LL-KKFDFFDN-SGPRYVIESIETVNTDKPSKYFGSNYAIVHFISIAMAVETMEYLKVQT 258
            L  KK  F +  +  RY++ESI+ VN  +    F  +YAI+ FI+I MA+E  +YLK+  
Sbjct: 334  LFDKKLKFLNQENNSRYILESIDLVNVTQTENEFPKHYAILTFINILMAMEICDYLKIHG 393

Query: 259  PESFGLTKVSYV-------------------------NSTFTSGKSEFQTFSNSELSDQN 293
            P  +G+    +V                         + T +S + +     NS +    
Sbjct: 394  PR-YGIQDCMFVQVIPKAVSCVSSKRASIISKDNDNNDETLSSQQKKNDILKNSSIISLP 452

Query: 294  DVEVQDSISSFEDI-TLSEGSMSVENEKAFTVLPSQYGP-PVVEEHNQHCSHITISKALX 351
              E  D +S  E +  LSE   S   E+   ++ +   P P    H++H  + T+S +  
Sbjct: 453  SAE-NDQVSDEEKLDKLSEKLKSTNIEELILIVDTATYPRPSFLSHDEHLPNATLSLS-- 509

Query: 352  XXXXXXXXXXXIASPQPQEVLVSNSEAPSSRNSIVS-LLSARSQGPTYP----------- 399
                        ++P  Q++  S  E    R ++ S  L A  Q P  P           
Sbjct: 510  ----------SSSNPFEQQLPYSYEEDDDQRTNVRSGSLPANPQFPNMPNLPKGYISPNP 559

Query: 400  ---------VPGYHYYMD--------------MSKPLGXXXXXXXXXXXXXXXXMGGGAG 436
                      P  ++  D                 P+                 +G  AG
Sbjct: 560  NMNYNTPLMYPNGYFVNDPAFSMNNNYNNNTNYRNPISKTLEQHATTTSQVVNSLGADAG 619

Query: 437  NRTVYIGNISPRSKTEDICNVVRGGILQSVKYIEAKHICFVTFIEAASAVQFFANSSIEP 496
            NRT+YIGNI+ RSK EDICNVVRGGILQ+VKYIE KHICF+TFIEA++A+ F+ANS I+P
Sbjct: 620  NRTIYIGNINSRSKVEDICNVVRGGILQNVKYIEHKHICFITFIEASAAIHFYANSFIDP 679

Query: 497  IVLHGSLLKVGWGHHSGNLPQSISLAVTIGASRNVYVSLPEYAFKDKFIKDPEYQAFREK 556
            IVLH   LK+GWG++   LP++++LAVT+GASRNVYVSLPE+AFKDKFI DPEYQ + +K
Sbjct: 680  IVLHNHTLKIGWGNYVEPLPKAVALAVTVGASRNVYVSLPEFAFKDKFINDPEYQEYHQK 739

Query: 557  FKLPSKQQLYDDFSTFGDIELINFLEDGHCCWINFMNISNAIKLVEDANNSNNESFHEKF 616
            +KLP   QL  DFS +G IE IN+L+D HCCW+NF+NIS AI+LVEDA+N     F EKF
Sbjct: 740  YKLPQADQLRIDFSKYGGIEQINYLKDSHCCWVNFLNISAAIRLVEDAHNPVESKFSEKF 799

Query: 617  ENRYRGLFIGYGKDRCGXXXXXXXXXXXXXXXXXXXXXXXXIRLR---RQQKSDIEAQAK 673
             NRY GL I YGKDRCG                        ++L+    ++K+D E    
Sbjct: 800  NNRYDGLIINYGKDRCGNVNKSLMSNKNSRFYKKVKSISNNVKLKELEEKRKADTERLNS 859

Query: 674  SGKGDENSEKKLQVDAFGISVGSQPDARYSDEEQKIEE-NELLLLSKPNSAEGGLGISV- 731
              K   +  +  ++DAFGI + +      ++E+  IE+ N L  +    +    LG  + 
Sbjct: 860  LRKTSSSDGQLSKLDAFGIGIDT---VSNNEEDGNIEKGNTLSKIDTDVNGFNALGFKIE 916

Query: 732  -SQDVT--VTENNTACGGKNKTGSVSSG-SSEVDILVSAPGSANTSQLEGGGPTQRTTAA 787
               D+     +NNT   G N   ++SS  SS +++++S+P     S  +G   T +   +
Sbjct: 917  PKHDMMNETMDNNTE--GNNTLENISSDESSNIELMISSPKE---SVQKGDVITNQKPHS 971

Query: 788  SNGKKERSSGVSKLHCFSEIAPRVSKXXXXXXXXXXXXXXNCHYNSAPRRSA-RKNGHDH 846
            +N    + +  S    + E   + +                  +  +P     +KN   H
Sbjct: 972  NNHHNFKRNSSSNRQRYKETDTQNTHRNNNNSNATFAPNKEFGFGISPNVDEHQKNNKKH 1031

Query: 847  DSNPVSGSKSDIXXXXXXXXXXXXXXXNAQAIPGSNVMAQYLAQLQHSTFMYAADILGV 905
            ++N                         A+ IPGS+VMAQYLAQLQHSTFMYAA+ILG 
Sbjct: 1032 NTN----------------------DKEARVIPGSDVMAQYLAQLQHSTFMYAANILGA 1068

>Ecym_4615 Chr4 complement(1199802..1203005) [3204 bp, 1067 aa] {ON}
            similar to Ashbya gossypii ABL122C
          Length = 1067

 Score =  492 bits (1266), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 354/1009 (35%), Positives = 504/1009 (49%), Gaps = 155/1009 (15%)

Query: 1    MSSPFLATPGVGHSSPHRHVTNKSSQAYKSTQLRMPPSDAIRGSRRHNKEKHLYDEGTRQ 60
            M SPF++TP       H   ++ S+ +        PP       RR       + E    
Sbjct: 102  MGSPFVSTPMRPQGHFHPSASSHSNHSRSFLYYPQPPILKPIPPRRRKSFSLNHSE---- 157

Query: 61   IPYKLTFNILPRNGNGDGDKFRTRSLYFSNL--NPDVRLHEFLATFHKFDRIESVYVVDR 118
             PY++ F ILP+      D++ TRSL FSNL    +  +H FL  F KF  IES+Y++D 
Sbjct: 158  -PYQVNFKILPKGK----DEYMTRSLLFSNLERQENFDIHNFLTNFIKFGPIESIYLLD- 211

Query: 119  EQQSVLVSFLTKETCLDFYNGILQKLSEFKKELRSKELSLSFASPQKVESGPTLQEIKFE 178
            +  S+L+SFLTK TCLDFYN +LQ+ SEFK +L S +LS+SF    +      LQ     
Sbjct: 212  DSHSILLSFLTKATCLDFYNNLLQRFSEFKSKLHSTKLSVSFVCQDETNWFRLLQ---MN 268

Query: 179  VLRAGATRSLGLEFKDE-IDFASLLKK----FDFFDNSGPRYVIESIETVNTDKP-SKYF 232
            V+  G TRSL +EF+D+ ++  S L      + FF +   R+VIE I+ VN   P ++ F
Sbjct: 269  VVTRGVTRSLCIEFEDQSMELTSDLIHEKIPWLFFSH---RFVIERIDLVNAAAPKNQNF 325

Query: 233  GSNYAIVHFISIAMAVETMEYLK-VQTPESFGLTKVSYVNSTFTSGKSEFQTFSNSELSD 291
             + Y ++HFI I+MA+E  EYL+     +  G++K+ +VN    +G S       S+LSD
Sbjct: 326  NNRYLLIHFICISMALEVEEYLQQASQKKQLGISKIQFVN---VNGHS-------SDLSD 375

Query: 292  QNDVEV-----------------------QDSISSFEDITLSEGSMSVENEKAFTVLPSQ 328
            ++ V                          D +  F  + L+ G +S++      V+PS+
Sbjct: 376  EDAVAAANGLQRESRTSSVSSISLPISNSSDLVELFHSLDLALGIISLQ------VIPSE 429

Query: 329  YGPPVVEEHNQHCSHITISK---------ALXXXXXXXXXXXXIASPQPQEVLVSNSEAP 379
            Y  P++E H+ H   +TIS+         +L              S   Q VL+ +   P
Sbjct: 430  YPVPLIESHDDHLHSVTISRPSKTLTSSTSLVEMDGGPNGGTPNGSNAMQGVLLLSD--P 487

Query: 380  SSRNSIVSLLSARSQGPTYPVPG--------------YH-----------YYMDMSKPL- 413
            SS  +  S+L       T  +PG               H           Y+MD   P+ 
Sbjct: 488  SSDGNTPSMLPNELNINTSLMPGPMGGQVLGTSQSLSLHNPNDNGGAGPSYFMD---PMS 544

Query: 414  GXXXXXXXXXXXXXXXXMGGGAGNRTVYIGNISPRSKTEDICNVVRGGILQSVKYIEAKH 473
            G                  GG+ NRTVYIGNI PRSK EDICNVVRGGILQ++K+I +K 
Sbjct: 545  GAPINQALQRQYLTGTGQVGGSNNRTVYIGNIHPRSKPEDICNVVRGGILQNIKWIHSKR 604

Query: 474  ICFVTFIEAASAVQFFANSSIEPIVLHGSLLKVGWGHHSGNLPQSISLAVTIGASRNVYV 533
            ICFVTFIEAA+A+QF+AN+S+EPIVLHG++L+VGWG  SG LP++I+LAVTIGASRNVYV
Sbjct: 605  ICFVTFIEAAAAIQFYANASLEPIVLHGNILRVGWGQPSGELPKNIALAVTIGASRNVYV 664

Query: 534  SLPEYAFKDKFIKDPEYQAFREKFKLPSKQQLYDDFSTFGDIELINFLEDGHCCWINFMN 593
            SLPEY+FK+K+I +PE++ +  K+KLPS++QL  DF+ +G +E IN+L+DGHCCW+NFMN
Sbjct: 665  SLPEYSFKEKYINNPEFKEYHGKYKLPSEEQLRQDFTKYGQVEQINYLDDGHCCWVNFMN 724

Query: 594  ISNAIKLVEDANN---SNNESFHEKFENRYRGLFIGYGKDRCGXXXXXXXXXXXXXXXXX 650
            I++AI+LVED N+    N E FH +F+ RY+ L IGYGKDRCG                 
Sbjct: 725  IAHAIRLVEDCNSLSQRNLEKFHAQFDGRYKNLIIGYGKDRCGNVNKNLTANKNSRFFKK 784

Query: 651  XXXXXXXIRLRRQQKSDIEAQAKSGKGDENSEKKLQVDAFGISVGSQPDARYSDEEQKIE 710
                    +L    K +   Q+K G    +S+   + DA      S      S +E   +
Sbjct: 785  IK------KLNCTTKPNKRQQSKRGTSSASSDDARKDDA------STEKVPVSSKEPVCD 832

Query: 711  ENELLLLSKPNSAEGGLGISVSQDVTVTENNTACGGKNK------------TGSVSSGSS 758
              E+L L+  N+   GLGIS+S        +      NK            TG  +SGSS
Sbjct: 833  --EILGLNDDNALAEGLGISLSSAYVNEYGDDISKRTNKKNRSKTETVEEDTGYTTSGSS 890

Query: 759  EVDILVSAPGSANTSQLEGGGPTQRTTAASNGKKERSSGV-----------SKLHCFSEI 807
            ++DI+V+ P   N  + EG     ++   S G K   +G            S+ +     
Sbjct: 891  DIDIIVAPPLEHNKGK-EGNSNHGKSKRKSQGGKRLQNGAQDGVGGGYGGHSQHYLAGSF 949

Query: 808  APRVSKXXXXXXXXXXXXXXNCHYNSAPRRSARKNGHDHDSNPVSGSKSDIXXXXXXXXX 867
                S               N H++   +   R + H +D+N   G  ++          
Sbjct: 950  ELVNSNTYLDSIPPLVPSPINQHFHD--KSLCRGSAHVNDNNNALGGFNNYSYNCGGSNN 1007

Query: 868  XXXXXXNAQA-----IPGSNVMAQYLAQLQHSTFMYAADILG---VDDP 908
                    QA     I G +VM+QYL QL HSTF+Y+ +ILG   V DP
Sbjct: 1008 GNRTRRRRQAKFSKPIAGQDVMSQYLEQLHHSTFLYSTNILGATTVHDP 1056

>ZYRO0G14256g Chr7 complement(1136628..1140407) [3780 bp, 1259 aa]
           {ON} similar to uniprot|Q03735 Saccharomyces cerevisiae
           YML117W NAB6 Putative RNA-binding protein based on
           computational analysis of large-scale protein-protein
           interaction data
          Length = 1259

 Score =  483 bits (1244), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 286/728 (39%), Positives = 404/728 (55%), Gaps = 114/728 (15%)

Query: 62  PYKLTFNILPRNGNGDGDKFRTRSLYFSNLNPDVRLHEFLATFHKFDRIESVYVV----D 117
           P+ +T+ +LP+   GD D++RTRSL F N+N  V L+ F++ + ++  +ES+Y+     D
Sbjct: 214 PFVVTYRMLPK---GD-DEYRTRSLLFENVNGSVDLYSFVSKYSRYGPVESIYMFKDRND 269

Query: 118 REQQSVLVSFLTKETCLDFYNGILQKLSEFKKELRSKELSLSFAS------------PQK 165
           + + SVL+SFL+++ CLD YN +LQ+L+EFK  L+SK L++SF S             Q 
Sbjct: 270 KTKHSVLLSFLSRKICLDSYNSVLQRLAEFKTGLKSKSLTVSFVSLKYRKHVDENEVDQN 329

Query: 166 VESGPT-----------------------------LQEIKFEVLRAGATRSLGLEFKDEI 196
             S  T                             +  ++++++  GATRS+ LE   E 
Sbjct: 330 DNSSSTPMNETDDTDASKTPVATSNVQDDAYNVTVVASLQYDIVNRGATRSVALELDGEY 389

Query: 197 DFASLL-KKFDFFDNSG-PRYVIESIETVNTDKPSKYFGSNYAIVHFISIAMAVETMEYL 254
           D   LL ++ DF   +   RYV+ESI  +N  +P K+F  NYAI+ F++I+MAVE ++Y+
Sbjct: 390 DKTKLLDQELDFLSPANNQRYVLESIYLINAKEPFKHFPKNYAILTFLNISMAVEVLDYV 449

Query: 255 K--------------------VQTPESFGLTKVSYVNSTFTSGKSEF---------QTFS 285
           +                     QT    G+   S   +   SG S            T  
Sbjct: 450 RNNETARSKFQKCFFVSVSSCPQTSSDGGIVTTSNSITPVASGGSAGIATNGDLGGYTSK 509

Query: 286 NSELSDQNDVEVQDSISSFEDITLSEGSMSVENEKAFTVLPSQYGPPVVEEHNQHCSHIT 345
           N+ LS  N V    S+    D      S S++     TV   +Y  P   E + H S+ +
Sbjct: 510 NASLSSLNSVGSYISLDQEIDFL----SSSLKGSHTITVAVDEYPKPFFAEFSDHLSNAS 565

Query: 346 ISKALXXXXXXXXXXXXIASPQPQEVLVSNSEAP---------SSRNSIVSLLSARSQGP 396
           + +A             I+SP PQEV+V + ++P         +   +    LS++   P
Sbjct: 566 VLEA-------SALDTQISSPHPQEVIVPSQDSPLVGGAPPLDAVHPAATPALSSQVL-P 617

Query: 397 TYPVPGYH--YYMD--------MSKPLGXXXXXXXXXXXXXXXXMGGGAGNRTVYIGNIS 446
             P    +   YM+        M KP+                 MGGG GNRTVYIGNI 
Sbjct: 618 LQPHMAMNSGIYMEPFGRRNKTMIKPITQSLQKQFATSAEVANSMGGGIGNRTVYIGNIH 677

Query: 447 PRSKTEDICNVVRGGILQSVKYIEAKHICFVTFIEAASAVQFFANSSIEPIVLHGSLLKV 506
           PRSK EDICNVVRGGILQS+++++ KHICFVTFIEA++AVQF+ N+ I+PIVLHG++LKV
Sbjct: 678 PRSKPEDICNVVRGGILQSIRFLQDKHICFVTFIEASTAVQFYTNAFIDPIVLHGNMLKV 737

Query: 507 GWGHHSGNLPQSISLAVTIGASRNVYVSLPEYAFKDKFIKDPEYQAFREKFKLPSKQQLY 566
           GWGHHSG LP+S+SLAVT+GASRNVYVSLP++AFKDK+I DP+YQ + +++KLP+++QL 
Sbjct: 738 GWGHHSGPLPKSVSLAVTVGASRNVYVSLPDFAFKDKYINDPQYQRYSDEYKLPAEEQLR 797

Query: 567 DDFSTFGDIELINFLEDGHCCWINFMNISNAIKLVEDANNSNNESFHEKFENRYRGLFIG 626
           +DF+ FGDIE INFL DGHCCW+NFMNIS+AIKLVE+   ++ E+FH+ F+NRYRGL IG
Sbjct: 798 NDFNQFGDIEQINFLSDGHCCWVNFMNISSAIKLVEEIKYNDGEAFHKSFDNRYRGLIIG 857

Query: 627 YGKDRCGXXXXXXXXXXXXXXXXXXXXXXXXIRLRR--QQKSDIEAQAKSGKGDENSEKK 684
           YGKDRCG                        IRL R  +++   E   +S +   N EK 
Sbjct: 858 YGKDRCGNVNKNLISGKNSRFYKKVKKPSYNIRLSRMEEERKKHEETLRS-QNQNNDEKM 916

Query: 685 LQVDAFGI 692
           LQ  + GI
Sbjct: 917 LQFGSLGI 924

 Score = 63.5 bits (153), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 28/32 (87%), Positives = 31/32 (96%)

Query: 874  NAQAIPGSNVMAQYLAQLQHSTFMYAADILGV 905
            NA+AIPGS+VMAQYLAQLQHSTFMYAA+ILG 
Sbjct: 1213 NAKAIPGSDVMAQYLAQLQHSTFMYAANILGA 1244

>KNAG0G03440 Chr7 complement(736829..739990) [3162 bp, 1053 aa] {ON}
            Anc_8.844 YML117W
          Length = 1053

 Score =  474 bits (1221), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 345/1011 (34%), Positives = 495/1011 (48%), Gaps = 179/1011 (17%)

Query: 1    MSSPFLATPGVGHSSPHRHVTNKSSQAYKSTQLRMPPSDAIRGSRRHNKEKHLYDEGTRQ 60
            M SPF++TP +         TN ++Q  K +   M       GS  + +       G  Q
Sbjct: 109  MGSPFVSTPNLPQ-------TNYTAQR-KGSHTGMANG---TGSMNYYRTDPQIINGLFQ 157

Query: 61   IPYKLTFNILPRNGNGDGDKFRTRSLYFSNLNPDVRLHEFLATFHKFDRIESVYVVDREQ 120
            IP+++++ ILP+   GD D +RTRSL   N++  V LH F++ F + + +ESVY+    Q
Sbjct: 158  IPFEISYKILPK---GD-DLYRTRSLLLGNIDDMVDLHTFVSKFVQNNSVESVYITKEGQ 213

Query: 121  Q----SVLVSFLTKETCLDFYNGILQKLSEFKKELRSKELSLSFAS----PQKVE----- 167
            Q      L+SFL+ + CL+FYN +LQ+L EFK++L++  L LSF S    P KVE     
Sbjct: 214  QPEKYGFLLSFLSVQICLNFYNNVLQRLKEFKEQLKASSLELSFVSMRQRPTKVEGKIYR 273

Query: 168  -----SGPTLQEIKFEVL-RAGATRSLGLEFKDEIDFAS----LLKKFDFFDNSGPRYVI 217
                  G  +  + F++  + GATRS+ +EF D+    +    L KK  F      RY++
Sbjct: 274  RFAADDGDGMANLHFDMAAQTGATRSIAIEFVDKDVILTRDELLNKKLKFLSEGNNRYIL 333

Query: 218  ESIETVNTDKPSKYFGSNYAIVHFISIAMAVETMEYLKVQTPESFGLTKVSYVNSTFTSG 277
            E I    T   +K FG NYAI+ F+SI MA+E M+YLK+   +   LTK  YV  T    
Sbjct: 334  EHIAVFKTQHGTKVFGKNYAIITFLSIPMAMEIMDYLKLNI-KQLHLTKFFYVQVTHPPQ 392

Query: 278  KSEF---------QTFSNSELSDQNDVEVQD-------------------------SISS 303
            +S            T SN + S  N  + Q+                          ++ 
Sbjct: 393  QSPAASQKKPHANDTESNRDTSPPNSKKDQEFFPNNSMLSLVSSESSTSLADDVDGLVNK 452

Query: 304  FEDITLSEGSMSVENEKAFTVLPSQYGPPVVEEHNQHCSHITISKALXXXXXXXXXXXXI 363
             + I L E ++ +  E         Y  P+ E+ ++H + I  S  +            I
Sbjct: 453  LKSIELQESTLKLRVE--------DYPEPLFEQFSEHSNGIVQSLPVPQTRPIGGPQSSI 504

Query: 364  ASPQPQEVLVSNSEAPSSR---------NSIVSL----LSARSQGPTYPVPGY------- 403
            ++P+      ++  +P +          NS+ +L    + A   GP  P           
Sbjct: 505  STPRAFGAFPNDIGSPPASFLPLDLNHSNSVPNLPPGFIPATPSGPMSPQQQQLFLNSQR 564

Query: 404  ----HYYMDMSKPLGXXXXXXXXXXXXXXXXMGGGAGNRTVYIGNISPRSKTEDICNVVR 459
                H     + P+                 MG    NRT+YIGNI+PRS+ EDICNVVR
Sbjct: 565  QQRDHAGGKFAHPITDSLESQMKTSTQVATAMGSDFNNRTIYIGNINPRSRAEDICNVVR 624

Query: 460  GGILQSVKYIEAKHICFVTFIEAASAVQFFANSSIEPIVLHGSLLKVGWGHHSGNLPQSI 519
            GGILQ++K+IEAKHICF+TFIEA++AVQF+AN+ I+PIVLHG+ LK+GWG ++G LP+ I
Sbjct: 625  GGILQNIKFIEAKHICFITFIEASAAVQFYANAFIDPIVLHGNTLKLGWGTYTGPLPKPI 684

Query: 520  SLAVTIGASRNVYVSLPEYAFKDKFIKDPEYQAFREKFKLPSKQQLYDDFSTFGDIELIN 579
            +LAVTIGASRNVY+SLPE AFKDK+IKDP+++ + E FKLP+K+ L  DF  +G IE IN
Sbjct: 685  ALAVTIGASRNVYISLPEIAFKDKYIKDPKFKIYHESFKLPAKEVLRKDFLHYGSIEQIN 744

Query: 580  FLEDGHCCWINFMNISNAIKLVEDANNSNNESFHEKFENRYRGLFIGYGKDRCGXXXXXX 639
             L D HCCW+NFMNIS+AI+LVEDA ++  + F++ F++RY GL I YGKDRCG      
Sbjct: 745  MLNDSHCCWVNFMNISSAIRLVEDA-STKQDHFNQLFDHRYEGLVINYGKDRCGNINRNL 803

Query: 640  XXXXXXXXXXXXXXXXXXIRL------RRQQKSDIEAQAKSGKGDENSEKKLQVDAFGIS 693
                              +RL      RR Q ++          +EN       DAF I+
Sbjct: 804  VAGKTSKYHKKVKKHTRDVRLSQLEEKRRNQDAERREMVNGTIPEENP-----FDAFAIN 858

Query: 694  VGSQPDARYSDEEQKIEENELLLLSKPNSAEGGLGISVSQDVTVTENNTACGG--KNKTG 751
             GS         E+K   +EL L S        LGIS+ +  + +  +   G    +  G
Sbjct: 859  TGS--------AEKK---DELSLDS--------LGISIMEVESASPISPVMGDLEDHTNG 899

Query: 752  SV-------------SSGSSEVDILVSAPGSANTS--QLEGGGPTQRTTAASNGKKERSS 796
            S              S  SS+++++++ P   N S   LEG   T   +  S+ +K    
Sbjct: 900  SYTDAGIAPLNYTNNSGSSSDIELIINPPNDPNRSVGVLEGDPST--LSPPSDKRK---- 953

Query: 797  GVSKLHCFSEIAPRVSKXXXXXXXXXXXXXXNCHYNSAPRRSARKNGHDHDSNPVSGSKS 856
             +  LH  S   P ++                  Y  A   +    G+DH   P +G   
Sbjct: 954  -LVALHEVSSPPPPLAPDTISR-----------QYAEASYHNELVTGNDH---PDTG--- 995

Query: 857  DIXXXXXXXXXXXXXXXNAQAIPGSNVMAQYLAQLQHSTFMYAADILGVDD 907
                             NA+ IPGS+VMAQYLAQLQHSTFMYAA++LG  +
Sbjct: 996  --YGKAENGRHRQQLPRNARTIPGSDVMAQYLAQLQHSTFMYAANVLGASN 1044

>ABL122C Chr2 complement(167005..170136) [3132 bp, 1043 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YML117W
          Length = 1043

 Score =  473 bits (1217), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 340/1009 (33%), Positives = 508/1009 (50%), Gaps = 167/1009 (16%)

Query: 1    MSSPFLATP----------GVGHSSPHRHVTNKSSQAYKSTQLRMPPSDAIRGSRRHNKE 50
            M SPFL+TP            GHSS   H     +Q+ +S+ L  P    ++      K+
Sbjct: 79   MGSPFLSTPLRPQAHFHPSTPGHSSHSLH----HAQSARSSFLYYPQPPMLKPIPPRRKK 134

Query: 51   KHLYDEGTRQIPYKLTFNILPRNGNGDGDKFRTRSLYFSNLN--PDVRLHEFLATFHKFD 108
                +      PY + F ILP+      D++ TRSL  +NL    D+ +H FL +F KF 
Sbjct: 135  SVTLNHSE---PYHINFKILPKGK----DEYMTRSLLLTNLEMLRDLDIHNFLNSFVKFG 187

Query: 109  RIESVYVVDREQQSVLVSFLTKETCLDFYNGILQKLSEFKKELRSKELSLSFASPQKVES 168
             +ES+Y++D +  S+L+SFLTK TCLDFYN +LQ+ SEFK +L S +LS+SF      + 
Sbjct: 188  PVESIYLMD-DNHSILLSFLTKATCLDFYNNLLQRFSEFKTKLHSPKLSVSFVC---QDE 243

Query: 169  GPTLQEIKFEVLRAGATRSLGLEFKDEI-----DFASLLKKFDFFDNSGPRYVIESIETV 223
                + ++  V+  GATRSL +EF+D +     DF  L  KF +   S  R+V+E I+ +
Sbjct: 244  SSWFKYLQMNVVTRGATRSLTVEFEDSVKELNEDFVRL--KFPWLFCSQ-RFVLERIDLI 300

Query: 224  NTDKPSKYFGSNYAIVHFISIAMAVETMEYLKVQTPE-SFGLTKVSYVNSTFTSGKSEFQ 282
            N    +++FG+ Y I+HFISI+MA+E  ++L+  + +    ++++ +VN      K    
Sbjct: 301  NATTVNQHFGTRYMILHFISISMALEVDDFLQQPSQKRQLNISRIQFVNVNGHHSK---- 356

Query: 283  TFSNSELSDQNDVEVQDSISSFEDITLSEGSMSVENEKAF------------TVLPSQYG 330
              S+ E +   +   QDS +S         S + +    F             V+PS+Y 
Sbjct: 357  -LSDEEAAAAANGLQQDSRTSSVSSISLSISNTADLAALFHSLDLSLDTLSLQVVPSEYP 415

Query: 331  PPVVEEHNQHCSHITISKA------------LXXXXXXXXXXXXIASPQPQEVLVSNSEA 378
             P++E+H++H + ITIS+             +            ++S     + +++  +
Sbjct: 416  TPLIEQHSEHLTSITISRPSKTLGPSASLIEMDSNATNAGNHHGVSSSLSGVLFMNDPSS 475

Query: 379  --------PSSRNSIVSLLSARSQGPTYPVP----GYH-----------YYMD--MSKPL 413
                    PS  N    ++    QG   P P      H           Y+MD  +  P+
Sbjct: 476  SGSTPMIVPSELNLNTPVMGGPMQGQLMPGPPQPMSLHNPSDGNGGSPSYFMDPMVGAPI 535

Query: 414  GXXXXXXXXXXXXXXXXMGGGAGNRTVYIGNISPRSKTEDICNVVRGGILQSVKYIEAKH 473
            G                   G  NRTVYIGNI PRSK EDICNVVRGGILQ++K+I +K 
Sbjct: 536  GQTLQRQYLAGAS----QANGINNRTVYIGNIHPRSKPEDICNVVRGGILQTIKWISSKR 591

Query: 474  ICFVTFIEAASAVQFFANSSIEPIVLHGSLLKVGWGHHSGNLPQSISLAVTIGASRNVYV 533
            ICFVTFIE A+AVQF+AN+S+EPIVLHG++L+VGWG  SG LP++I+LAVTIGASRNVYV
Sbjct: 592  ICFVTFIETAAAVQFYANASLEPIVLHGNILRVGWGQPSGELPKNIALAVTIGASRNVYV 651

Query: 534  SLPEYAFKDKFIKDPEYQAFREKFKLPSKQQLYDDFSTFGDIELINFLEDGHCCWINFMN 593
            SLPEY+FK+K+I +PE++ +  K+KLP+++QL  DF+ +G +E IN+LEDGHCCW+NFMN
Sbjct: 652  SLPEYSFKEKYINNPEFKLYHGKYKLPTEEQLRQDFTKYGQVEQINYLEDGHCCWVNFMN 711

Query: 594  ISNAIKLVEDANN---SNNESFHEKFENRYRGLFIGYGKDRCGXXXXXXXXXXXXXXXXX 650
            I++AI+LVED+N+    N E FH +F+ RY+ L IGYGKDRCG                 
Sbjct: 712  IAHAIRLVEDSNSPIEKNLEKFHAQFDGRYKNLIIGYGKDRCGNVNKNLAANKNSRFYK- 770

Query: 651  XXXXXXXIRLRRQQKSDIEA-QAKSGKGDENSEKKLQVDAF--GISVGSQPDARYSDEEQ 707
                    ++++Q  S  +  Q +   G  NS+   + +    G+ + S  +    + + 
Sbjct: 771  --------KIKKQSYSMKQGKQPRKEDGIVNSDDLTKNNEVLPGVQMNSSKNGGVGESQS 822

Query: 708  KIEENELLLLSKPNSAEGGLGIS-----VSQDVTVTEN------NTACGGKNKTGSVSSG 756
             + + EL        AE GLGIS     +S D   T +             +  G  +SG
Sbjct: 823  LVGDQEL--------AE-GLGISLTSAQISPDTGHTHHYSDGVEEGDECDDDDAGYSTSG 873

Query: 757  SSEVDILVSAP--------GSANTSQLEGGGPTQR---TTAASN---------GKKERSS 796
            SS++DI+V+ P        G+++    +    T+R   + AAS+         G  + +S
Sbjct: 874  SSDIDIIVAPPDEFKRRESGTSSGKHKKKSKSTRRNQHSNAASSASYNQQYSLGSLDHTS 933

Query: 797  GVSKLHCFSEIAPRVSKXXXXXXXXXXXXXXNCHYNSAPRRSARKNGHDHDSNPVSGSKS 856
                L     +AP                  +   + A RR     G   DS+  S   S
Sbjct: 934  SAGSLDAPPPLAP-----------------SSMQQHLADRRPRHTPGRSTDSS-ASQYNS 975

Query: 857  DIXXXXXXXXXXXXXXXNAQAIPGSNVMAQYLAQLQHSTFMYAADILGV 905
                              ++ I G +VM+QYL QL HSTF+YA +ILG 
Sbjct: 976  QTPTNANYKSRRRRQAKFSKPIAGQDVMSQYLEQLHHSTFLYATNILGA 1024

>KAFR0A02850 Chr1 complement(590196..593324) [3129 bp, 1042 aa] {ON}
           Anc_8.844 YML117W
          Length = 1042

 Score =  461 bits (1185), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 272/650 (41%), Positives = 375/650 (57%), Gaps = 104/650 (16%)

Query: 62  PYKLTFNILPRNGNGDGDKFRTRSLYFSNLNPDVRLHEFLATFHKFDRIESVYVVDREQQ 121
           P  +++ ILP+   GD D +RTRSL F N++  + LH F+  F K + IES+Y+V  +  
Sbjct: 180 PINISYVILPK---GD-DAYRTRSLLFENVDNAINLHSFITNFVKNNSIESIYLVPNKND 235

Query: 122 S----VLVSFLTKETCLDFYNGILQKLSEFKKELRSKELSLSFASPQ-----KVESGPTL 172
           S    +++SFL++  CLDFYN +LQ+L EFKK L S+ L+L+F S +     +   GP+L
Sbjct: 236 SNTCDIILSFLSRHICLDFYNNVLQRLKEFKKHLNSESLNLNFVSLKYNKTTRDNQGPSL 295

Query: 173 QEIKFEVLRAGATRSLGLEFKDEIDFASLLKKFDFFD---------NSGPRYVIESIETV 223
           +   F ++   ATRSL +E     + + +L+K   F+         +   RYV+ESI+ V
Sbjct: 296 E---FNIVTRDATRSLAIELCSNENDSLILEKEQLFEKILNEILRTDENKRYVLESIDLV 352

Query: 224 NTDKPSKYFGSNYAIVHFISIAMAVETMEYLKVQTPESFGLTKVSYV------------N 271
           +TDK +K FG NYAI+ F++I MA+E M+Y++V + +   + K S+V            N
Sbjct: 353 STDKSNKEFGKNYAILSFLNITMAIEIMDYIQVISSK-LNIGKCSFVTIQPLIENNVMNN 411

Query: 272 STFTSGKSEFQTFSNSE-------------------------LSDQNDVEVQDSISSFED 306
           S+  S  +  Q+  +SE                          S   D EV       + 
Sbjct: 412 SSALSSATNIQSSVSSEGNNNQNNNGSTFFHKNSINSLLSSESSVSIDEEVISIADKLKG 471

Query: 307 ITLSEGSMSVENEKAFTVLPSQYGPPVVEEHNQHCSHITISKALXXXXXXXXXXXXIASP 366
           I L + S+ +        LP  Y  P       H  ++TIS                 +P
Sbjct: 472 IKLKDISLDI--------LPRDYPEPEFNFSTDHLPNVTISVPTQLDQIP-------GTP 516

Query: 367 QPQEVLVSNSEAPS-----SRNSIVSLLSAR----SQGPTYPVPGYHYYMDMSK------ 411
           + QE+ + N  +PS       NS  ++LS      S  P   +P   +YMD +       
Sbjct: 517 RTQEIYI-NDMSPSFEGIDMMNSSSTMLSGNGTFISNTPML-IPSQSFYMDQNTQIQEAP 574

Query: 412 --------PLGXXXXXXXXXXXXXXXXMGGGAGNRTVYIGNISPRSKTEDICNVVRGGIL 463
                   P+                 MG  AGNRT+YIGNI+PRSK EDICNVVRGGIL
Sbjct: 575 FRSNSFIHPITDSLENQLSTSAKVASAMGSDAGNRTIYIGNINPRSKAEDICNVVRGGIL 634

Query: 464 QSVKYIEAKHICFVTFIEAASAVQFFANSSIEPIVLHGSLLKVGWGHHSGNLPQSISLAV 523
           QS+K+IE+KHICFVTFIEAA+AVQF+AN+ I+PIVLHG+ LK+GWG++SG LP+SI+LAV
Sbjct: 635 QSIKFIESKHICFVTFIEAAAAVQFYANAFIDPIVLHGNTLKLGWGNYSGPLPKSIALAV 694

Query: 524 TIGASRNVYVSLPEYAFKDKFIKDPEYQAFREKFKLPSKQQLYDDFSTFGDIELINFLED 583
           TIGASRNVYVSLPE+AFKDK+I DPE++ + EKFKLP  +QL  DFS++G  E IN+L D
Sbjct: 695 TIGASRNVYVSLPEFAFKDKYINDPEFKEYHEKFKLPDPEQLRIDFSSYGPTEQINYLSD 754

Query: 584 GHCCWINFMNISNAIKLVEDANNSNNESFHEKFENRYRGLFIGYGKDRCG 633
            HCCW+NFMNIS+AIKLVE+A N + + F+EKF+ RY GL I YGKDRCG
Sbjct: 755 SHCCWVNFMNISSAIKLVEEATN-DFDRFNEKFDERYNGLVINYGKDRCG 803

 Score = 57.8 bits (138), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 25/29 (86%), Positives = 27/29 (93%)

Query: 877  AIPGSNVMAQYLAQLQHSTFMYAADILGV 905
             IPGS+VMAQYLAQLQHSTFMYAA+ILG 
Sbjct: 996  TIPGSDVMAQYLAQLQHSTFMYAANILGA 1024

>TPHA0I00270 Chr9 complement(50298..53417) [3120 bp, 1039 aa] {ON}
           Anc_8.844 YML117W
          Length = 1039

 Score =  449 bits (1154), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 300/853 (35%), Positives = 443/853 (51%), Gaps = 135/853 (15%)

Query: 1   MSSPFLATPGVGH----SSPHRHVT----NKSSQAYKSTQLRMPP---SDAIRGSRRHNK 49
           M+SPF++TP   +    +SP R ++    N +   + +  +   P    D    ++  N 
Sbjct: 127 MNSPFVSTPNKSYLSFQASPSRGISYNRRNSNQMVFPNPPIITSPHLVGDKSERAKSDNY 186

Query: 50  EK--HLYDEGTRQ--------IPYKLTFNILPRNGNGDGDKFRTRSLYFSNLNPDVRLHE 99
           EK   L DE   +        I YK+++ ILP+   GD D + TRSL F N+N  + LH 
Sbjct: 187 EKVDTLDDEKRNREVFEEESAIAYKISYQILPK---GD-DTYHTRSLLFENINESIDLHT 242

Query: 100 FLATFHKFDRIESVYVVDREQ------QSVLVSFLTKETCLDFYNGILQKLSEFKKELRS 153
           F+  F  +  IESVYVV   +      +S+L+SF ++  CLDFYN +LQKLSE+K +L S
Sbjct: 243 FIEKFVNYGLIESVYVVPSYETHQNSVKSILLSFTSRSICLDFYNSVLQKLSEYKTQLNS 302

Query: 154 KELSLSFAS------------------PQKVESGPTLQE-IKFEVLRAGATRSLGLEFKD 194
           + L LSF S                   QK E+   L   I+++V   GATRSL +EF  
Sbjct: 303 ENLKLSFVSLCYLQNNINKGNGKISVESQKNETDFELTSLIQYQVANFGATRSLCIEFDK 362

Query: 195 EIDFASLLKKFDFFD--------NSGPRYVIESIETVNTDKPSKYFGSNYAIVHFISIAM 246
            +D     K  DF +        N+  RY+IES+  VN +     F ++Y I+ F++I+M
Sbjct: 363 RVD-----KIDDFIETYLPFLSSNANKRYIIESLYIVNNNGKDNEFPAHYVILSFLNISM 417

Query: 247 AVETMEYLKVQTPE---------SFGLTKVSYVNSTFTS----GKSE-FQTFS------- 285
            +E + Y++ +            SF  TK +  NS   S    G S+   T++       
Sbjct: 418 VIEVLHYIRSKNLSKTIKNCLYVSFDRTKHAVSNSNRQSLSKKGTSDTLNTYTLESPINH 477

Query: 286 NSELS--------DQNDVEVQDSISSFEDITLSEGSMSVENEKAFTVLPSQYGPPVVEEH 337
           N+E+         D+N++E+ + +S  E  T             F +  S Y  P +E  
Sbjct: 478 NTEVDMNDIPSIYDENEIEIANKLSELEIQT-----------HTFNLDISNYSNPHIEIR 526

Query: 338 NQHCSHITISKALXXXXXXXXXXXXIASPQPQEVLVSNSEAPSSRNSIVSLLSARSQGPT 397
            +H  +++IS+                SP    +    +  P   + IV    A  +   
Sbjct: 527 AEHLPNVSISR-----DPMIYANPIYQSPPSGYMENMWTTTPFLSSHIVHEEYANDRV-D 580

Query: 398 YPVPGYHYYMDMSKPLGXXXXXXXXXXXXXXXXMGGGAGNRTVYIGNISPRSKTEDICNV 457
           Y +  Y+  +  + PL                 MGGG GNRT++IGNI+PRSKTEDICNV
Sbjct: 581 YNMKHYNNQL-YNVPLPQTLQSQFATSAEMASKMGGGVGNRTIFIGNINPRSKTEDICNV 639

Query: 458 VRGGILQSVKYIEAKHICFVTFIEAASAVQFFANSSIEPIVLHGSLLKVGWGHHSGNLPQ 517
            RGGI+Q VKYI  K+ICFV FI+  +A QF+ANS I+PI+LH + LK+GWG H G LP+
Sbjct: 640 TRGGIIQQVKYIREKNICFVIFIDPQAAAQFYANSFIDPIILHNNTLKIGWGDHPGPLPK 699

Query: 518 SISLAVTIGASRNVYVSLPEYAFKDKFIKDPEYQAFREKFKLPSKQQLYDDFSTFGDIEL 577
           +I LAVT GASRNVYVSLPE+AFKDK+I DP Y+ +  K+ LPS+QQL +DFS FG++E 
Sbjct: 700 AIELAVTAGASRNVYVSLPEFAFKDKYINDPNYKEYHNKYILPSEQQLREDFSKFGEMEQ 759

Query: 578 INFLEDGHCCWINFMNISNAIKLVEDANNSNNESFHEKFENRYRGLFIGYGKDRCGXXXX 637
           INFL+D HCCWINF NI +AIKLVE   N +N +FHE+++NRY+GL IGYGKDRCG    
Sbjct: 760 INFLKDKHCCWINFTNIRSAIKLVELVKNEDNNNFHERYKNRYKGLIIGYGKDRCGNVNK 819

Query: 638 XXXXXXXXXXXXXXXXXXXXIRLRRQQKSDIEAQAKSGKGDENSEKKLQVDAFGISVGSQ 697
                               IRL++ +    E + ++ +  +   K++ +D+ GI+    
Sbjct: 820 SLVSNKNSRYFRKVKKPSYNIRLQQLE----EERKRNDEIKQIDNKRINLDSLGITTSPN 875

Query: 698 PDARYSDEEQKIEENELLLLSKPNSAEGGLGISVSQDVTVTENNTACGGKNKTGSVSSGS 757
                    Q I+E+E L L+K       L ++       +EN +         S S+ S
Sbjct: 876 ---------QNIQEDETLSLAK-------LKLTSDTGFKNSENESDID-----DSASNSS 914

Query: 758 SEVDILVSAPGSA 770
           ++V++++++PG+ 
Sbjct: 915 TDVELIINSPGNG 927

 Score = 52.4 bits (124), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 22/38 (57%), Positives = 32/38 (84%), Gaps = 2/38 (5%)

Query: 876  QAIPGSNVMAQYLAQLQHSTFMYAADILG--VDDPNLH 911
            + IPGS+VM+QYLAQ+QHSTFMYAA++L   +++P  +
Sbjct: 992  KIIPGSDVMSQYLAQVQHSTFMYAANVLNASIEEPEFY 1029

>CAGL0B02365g Chr2 complement(224663..227815) [3153 bp, 1050 aa]
           {ON} some similarities with uniprot|Q03735 Saccharomyces
           cerevisiae YML117w
          Length = 1050

 Score =  429 bits (1104), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 263/717 (36%), Positives = 389/717 (54%), Gaps = 90/717 (12%)

Query: 62  PYKLTFNILPRNGNGDGDKFRTRSLYFSNLNP-DVRLHEFLATFHKFDRIESVYVV---- 116
           P  + + +LP   +GD D ++TRSL F N+   D  L  F+     + ++ESVYV     
Sbjct: 169 PISINYRVLP---SGD-DTYKTRSLLFENVQKNDEMLSVFMRLIINYSQVESVYVFQQTD 224

Query: 117 --------DREQQSVLVSFLTKETCLDFYNGILQKLSEFKKELRSKELSLSFAS------ 162
                   D++   + +SFL+++  LDFYN  LQ+L +FKK+L S +LS+SF S      
Sbjct: 225 TPSKDKESDKDTCCLQLSFLSRQAALDFYNNFLQRLPDFKKKLSSPKLSVSFVSFSYVTD 284

Query: 163 ----------------------PQKVESGPTLQEIKFEVLRAGATRSLGLEFKDEIDFAS 200
                                  Q++   P L E   E+    ATRS+ +EF  +++  +
Sbjct: 285 EDKDKDKDKDKDINTEKRNIKRSQELLKEPALGE---EIFSHDATRSIAIEFYSQVEQDA 341

Query: 201 LLKKFDFFDN-SGPRYVIESIETVNTDKPSKYFGSNYAIVHFISIAMAVETMEYLKVQTP 259
           L +K  F D+    RY++E+++ ++ +  +  F +NY I+ FI+I MA+E ++YLK    
Sbjct: 342 LFEKLPFLDDKDNKRYILEAVDIISAEDAADDFPANYVILTFINIKMAIEVLDYLKANL- 400

Query: 260 ESFGLTKVSYVN---------STFTSGKSEFQTFSNSELSDQNDVEVQDSI---SSFEDI 307
            ++ + +  +V+         S+ T       T  +  +S+ N     +++      E +
Sbjct: 401 MTYSVNECFFVSLPGCKSQRESSTTPVLGHISTEGSKSVSEVNLANGGNTVMIDRELESL 460

Query: 308 TLSEGSMSVENEKAFTVLPSQYGPPVVEEHNQHCSHITI--------------SKALXXX 353
           +    S+ +E EK   ++ S Y  P +  H+ H    T               +  +   
Sbjct: 461 SDELASLKLE-EKCLKIIRSDYPKPEIRSHDDHIPGSTNFSMYIFDDGMNPEGNSGMYLH 519

Query: 354 XXXXXXXXXIASPQPQEVLVSNSEAPSSRNSI-VSLLSARSQGPTYPVPGYHYYMDMSKP 412
                    I SP    +  S S      N + V    A  + P  P+ G  +    +K 
Sbjct: 520 DNLTDHSSIIGSPFSNYIDPSISHVMLPNNGLPVGGFDAPGKFPIEPISGPPF-NHTNKV 578

Query: 413 LGXXXXXXXXXXXXXXXXMGGGAGNRTVYIGNISPRSKTEDICNVVRGGILQSVKYIEAK 472
           +                 MGG A NRTVYIGNI+PRSK EDICNVVRGGILQ+VK+IE K
Sbjct: 579 ITQSIEDRLNTSARIAAAMGGDADNRTVYIGNINPRSKVEDICNVVRGGILQNVKFIEDK 638

Query: 473 HICFVTFIEAASAVQFFANSSIEPIVLHGSLLKVGWGHHSGNLPQSISLAVTIGASRNVY 532
            ICFVTFIEA++A QF ANS I+PIVLHG+ L+VGWG+ SG LP+SI+LAVT+GA+RNVY
Sbjct: 639 RICFVTFIEASAAAQFCANSFIDPIVLHGNTLRVGWGNQSGPLPKSIALAVTVGANRNVY 698

Query: 533 VSLPEYAFKDKFIKDPEYQAFREKFKLPSKQQLYDDFSTFGDIELINFLEDGHCCWINFM 592
           VSLPEYAFKDKFI DP+Y+ + E++KLPS++QL  DF+T+G+IE IN+L+D HCCW+NF+
Sbjct: 699 VSLPEYAFKDKFINDPKYKEYHERYKLPSQEQLRKDFTTYGEIEQINYLKDSHCCWVNFI 758

Query: 593 NISNAIKLVEDANNSNNESFHEKFENRYRGLFIGYGKDRCGXXXXXXXXXXXXXXXXXXX 652
           NI++AI+LVED N++N E FH+KF NRY GL I YGKDRCG                   
Sbjct: 759 NIASAIRLVEDINHNNGEEFHKKFNNRYEGLIINYGKDRCGNINKNLIAGKGSKFYKKVK 818

Query: 653 XXXXXIRLRRQQKSDIEAQAKSGKGDENSEKK--LQVDAFGISVGSQPDARYSDEEQ 707
                IR+++     +E + K  + +  S+KK  +Q+D+ GISV    D  +S+E +
Sbjct: 819 KPSYDIRIKK-----MEEKRKMQEDNLLSQKKNSIQLDSLGISV----DRTFSNESK 866

 Score = 57.8 bits (138), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 25/31 (80%), Positives = 28/31 (90%)

Query: 875  AQAIPGSNVMAQYLAQLQHSTFMYAADILGV 905
             + IPGS+VMAQYLAQLQHSTFMYAA+ILG 
Sbjct: 1009 TRPIPGSDVMAQYLAQLQHSTFMYAANILGA 1039

>KLLA0D01485g Chr4 (129351..132806) [3456 bp, 1151 aa] {ON} similar
           to uniprot|Q03735 Saccharomyces cerevisiae YML117W NAB6
           Putative RNA-binding protein based on computational
           analysis of large-scale protein-protein interaction data
          Length = 1151

 Score =  386 bits (992), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 243/660 (36%), Positives = 358/660 (54%), Gaps = 116/660 (17%)

Query: 60  QIPYKLTFNILPRNGNGDGDKFRTRSLYFSNLNPDVRLHEFLATFHKFDRIESVYVV--- 116
           ++  +  ++ILP+ GN   D +R+RSL F+N+N ++ + EFL    K   IES+Y++   
Sbjct: 212 ELKIQFQYSILPK-GN---DTYRSRSLLFTNVNSELDIVEFLQKVAKNYPIESIYLIKDE 267

Query: 117 ------------------------------------DRE-----------------QQSV 123
                                               D+E                 QQS 
Sbjct: 268 DTGDDIENLNTSNNDDDPNQNYNADNNNNSKREDDKDKESAPALTKQIAISPSSCSQQSY 327

Query: 124 LVSFLTKETCLDFYNGILQKLSEFKKELRSKELSLSFASPQKVESGPTLQEIKFEVLRAG 183
           L+SF TKE+CLDFYN +LQ+ +E K  ++S +L+++F   Q  E    +  +K  V+  G
Sbjct: 328 LLSFFTKESCLDFYNNLLQRYAEIKNAVKSDQLAMNFVKIQDDEEW--MANLKMNVISLG 385

Query: 184 ATRSLGLEFKDE-IDFASLLKKFDFFDNSGPRYVIESIETVNTDKPSKYFGSNYAIVHFI 242
           ATRSL +EF D+ +   ++     F  NSG +YV+  ++ V TD+  K FG +Y ++HF+
Sbjct: 386 ATRSLYVEFADDSVTSDTIWDTLPFLKNSG-KYVVIDVDVVTTDERRKNFGLHYCLLHFL 444

Query: 243 SIAMAVETMEYLKVQTPESFGLTKVSYVNSTFTSGKSEFQTFSNSELSDQNDVEVQD--- 299
           S+ MA+E  E L+        +++VS+V    ++ K E +   +S +S + +   Q    
Sbjct: 445 SVTMALEVKELLETGDE---AVSRVSFVTPANSADK-EMRRRRSSAISLKQEASPQMFST 500

Query: 300 -----------SISSFEDITLSEGSMSVENEKAF---------TVLPSQYGPPVVEEHNQ 339
                      S+   E ++ +   +S    + F          V  S+Y  P+V E + 
Sbjct: 501 DSRSRSRSSNVSLPLSEQVSTASTDISTPIYEEFDGNLTWSTLIVDVSEYKEPIVNEFDH 560

Query: 340 HCSHITISKALXXXXXXXXXXXXIASPQPQEVLVSNSEAPSSRNSIVSLLSARSQGPTYP 399
           H +  +ISK                     E   +N  + S+ +  +  LS  S  P   
Sbjct: 561 HLNSWSISKPTTLYM--------------HESGTTNFSS-SNLSDDIDPLSISSHDP--- 602

Query: 400 VPG------YHYYMDMSKPLGXXXXXXXXXXXXXXXXMGGGAGNRTVYIGNISPRSKTED 453
           VP       Y Y M+   P                  +  G  +RTVYIGNI+PRSK ED
Sbjct: 603 VPQQMLLNEYPYIMEPLMP-PQITQTIQNQYSKSIQAVNAGMEHRTVYIGNINPRSKAED 661

Query: 454 ICNVVRGGILQSVKYIEAKHICFVTFIEAASAVQFFANSSIEPIVLHGSLLKVGWGHHSG 513
           ICNVVRGGILQ +K++  K ICFVTFIE A+AVQF+AN+++EPI+LHG++LKVGWG + G
Sbjct: 662 ICNVVRGGILQHIKWVSHKRICFVTFIETAAAVQFYANTTLEPIILHGNVLKVGWGQNPG 721

Query: 514 NLPQSISLAVTIGASRNVYVSLPEYAFKDKFIKDPEYQAFREKFKLPSKQQLYDDFSTFG 573
            LP++I+LAVT+GASRNVYVSLP+ AFKDKFI DP+++ ++ ++K+P+  QL  DF  +G
Sbjct: 722 PLPKNIALAVTVGASRNVYVSLPDKAFKDKFINDPQFKEYQNRYKIPNIAQLKSDFGAYG 781

Query: 574 DIELINFLEDGHCCWINFMNISNAIKLVEDANNSNNESFHEKFENRYRGLFIGYGKDRCG 633
            +E +NF  DGHCCWINFMNIS+AIKLVE+ +++ +  FH+K E RY GL IGYGKDRCG
Sbjct: 782 TMEQVNFHSDGHCCWINFMNISSAIKLVEEYSDTKDNLFHKKTEGRYVGLIIGYGKDRCG 841

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/34 (58%), Positives = 26/34 (76%), Gaps = 1/34 (2%)

Query: 876  QAIPGSNVMAQYLAQLQHSTFMYAADILG-VDDP 908
            + I GS+VM +YL QL H+TF+YAA+ILG   DP
Sbjct: 1110 KPIAGSDVMTRYLEQLHHNTFVYAANILGATQDP 1143

>Kpol_1068.5 s1068 (7832..9475,9855..9863,10320..11765) [3099 bp, 1032
            aa] {ON} (7832..9475,9855..9863,10320..11765) [3099 nt,
            1033 aa]
          Length = 1032

 Score =  378 bits (971), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 218/497 (43%), Positives = 282/497 (56%), Gaps = 64/497 (12%)

Query: 431  MGGGAGNRTVYIGNISPRSKTEDICNVVRGGILQSVKYIEAKHICFVTFIEAASAVQFFA 490
            MGGGAGNRTVYIGNI+PRSK EDICNVVRGG LQ +K+ + K ICFVTFIEAASA QF+A
Sbjct: 574  MGGGAGNRTVYIGNINPRSKAEDICNVVRGGTLQQIKFFKEKGICFVTFIEAASAAQFYA 633

Query: 491  NSSIEPIVLHGSLLKVGWGHHSGNLPQSISLAVTIGASRNVYVSLPEYAFKDKFIKDPEY 550
            NS I+PI+LH + L+VGWG HSG LP+SISLAVT+GASRNVYVSLPEYAFKDKFI DPEY
Sbjct: 634  NSFIDPIILHNNTLRVGWGDHSGPLPKSISLAVTVGASRNVYVSLPEYAFKDKFINDPEY 693

Query: 551  QAFREKFKLPSKQQLYDDFSTFGDIELINFLEDGHCCWINFMNISNAIKLVEDANNSNN- 609
            + +  K+ LP++++L  DFS FG++E +NFL DGHCCWINFMNI +AIKLVE  N+SN  
Sbjct: 694  KEYHNKYVLPTEEELRKDFSYFGEMEQVNFLNDGHCCWINFMNIRSAIKLVESVNSSNGG 753

Query: 610  ESFHEKFENRYRGLFIGYGKDRCGXXXXXXXXXXXXXXXXXXXXXXXXIRLRRQQKSDIE 669
            ++FHE++ NRY+GL IGYGKDRCG                        IRL++     +E
Sbjct: 754  KTFHERYANRYKGLIIGYGKDRCGNVNKSLISGKNSKFYRKVKKPSYNIRLQQ-----LE 808

Query: 670  AQAKSGKGDENSEKKLQVDAFGISVGSQPDARYSDEEQKIEENEL-LLLSKPNSAEGGL- 727
             + K  + ++ S K + +++FGI V +        EE KI  + L + LSKPNS    L 
Sbjct: 809  EERKQEEKNKISNKSINLNSFGIQVETPSQNESEQEEPKISLDGLGMSLSKPNSENHDLK 868

Query: 728  -----------GISVSQDVTVTENNTACGGKNKTGSVSSGSSEVDILVSAPGSANTSQLE 776
                        I +  D  V EN    G KNK  +        ++    P   + + LE
Sbjct: 869  ETDDSDSDISTDIELIIDPPVRENTK--GNKNKKQNHRKNDMNNNLNFGNPPPVSKTLLE 926

Query: 777  GGGPTQRTTAASNGKKERSSGVSKLHCFSEIAPRVSKXXXXXXXXXXXXXXNCHYNSAPR 836
               P    T + + +K      S L   S +                        N++ +
Sbjct: 927  SSPPLAPATLSRDFQKSSKQLSSDLTNLSTM---------DQNDMSENDSNTSSKNASHK 977

Query: 837  RSARKNGHDHDSNPVSGSKSDIXXXXXXXXXXXXXXXNAQAIPGSNVMAQYLAQLQHSTF 896
            RS++KN                                 + +PGS+VM+QYLAQLQHSTF
Sbjct: 978  RSSKKN--------------------------------KKLLPGSDVMSQYLAQLQHSTF 1005

Query: 897  MYAADILGV--DDPNLH 911
            MYAA+ILG   D+P  +
Sbjct: 1006 MYAANILGASSDEPEFY 1022

 Score =  122 bits (305), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 79/252 (31%), Positives = 132/252 (52%), Gaps = 49/252 (19%)

Query: 63  YKLTFNILPRNGNGDGDKFRTRSLYFSNLNPDVRLHEFLATFHKFDRIESVYVVDRE--- 119
           + +++ +LP+ GN   D+++TRSL F N++  V LH F+  F  F  IESVY+++     
Sbjct: 251 FTISYKVLPK-GN---DEYQTRSLLFENVDKSVDLHCFIKKFVNFGPIESVYLINSNGIY 306

Query: 120 ---------------------------QQSVLVSFLTKETCLDFYNGILQKLSEFKKELR 152
                                       QS+L+SFL++  CLDFYN +LQ+LSEFK +L 
Sbjct: 307 DNNKNNDDYDDDNDNNNDNDDNANNHDTQSILLSFLSRPICLDFYNSVLQRLSEFKTQLN 366

Query: 153 SKELSLSFA--------SPQKVES--GPTLQ-EIKFEVLRAGATRSLGLEFKDEIDFAS- 200
           S +L+LSF          P   ES   P L   +++++++ GATRS+ +EF   I     
Sbjct: 367 SNDLTLSFVLLKYKNQDRPDDEESDFSPALPLSLEYDIIKRGATRSIAVEFNQPITSKEG 426

Query: 201 -LLKKFDF-FDNSGPRYVIESIETVNTDKPSKYFGSNYAIVHFISIAMAVETMEYLKVQT 258
            +  K  F       RY+IES++ +N  +       N  I+ F++I+M V+ M+ ++++ 
Sbjct: 427 FMNSKLSFLLSPENKRYIIESVDIINAAERDANLPKNTVILTFLNISMTVDVMDRIRLER 486

Query: 259 PESFGLTKVSYV 270
            +S G++K  +V
Sbjct: 487 KDS-GISKCVFV 497

>YML117W Chr13 (34243..37647) [3405 bp, 1134 aa] {ON}  NAB6Putative
            RNA-binding protein that associates with mRNAs encoding
            cell wall proteins in high-throughput studies; deletion
            mutants display increased sensitivity to some cell wall
            disrupting agents; expression negatively regulated by
            cAMP
          Length = 1134

 Score =  358 bits (918), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 238/614 (38%), Positives = 318/614 (51%), Gaps = 74/614 (12%)

Query: 329  YGPPVVEEHNQHCSHITISKALXXXXXXXXXXXXIASPQPQEVLVSNSEAPSSRNSIVSL 388
            Y  P +EEH+ H S++ ISK              I SP P    +  +++  S  +I+  
Sbjct: 548  YQTPTIEEHSTHLSNVKISKT---TENSRQFSQDIPSPLPLNEHMFMNDSNQSNGAIIPQ 604

Query: 389  LSARSQGPTYPVPGYHYYMDMSKPLGXXXXXXXXXXXXXXXXMGGGAGNRTVYIGNISPR 448
                +  P  P    +  + +  P+                 MG   GNRT+YIGNI+PR
Sbjct: 605  QLIATPSPVSPNLQMNQRV-LPNPITQSLEQNFNVSAKVASSMGSDIGNRTIYIGNINPR 663

Query: 449  SKTEDICNVVRGGILQSVKYIEAKHICFVTFIEAASAVQFFANSSIEPIVLHGSLLKVGW 508
            SK EDICNVVRGGILQS+KYI  K ICFVTFIEA SAVQF+ANS I+PIVLHG++L+VGW
Sbjct: 664  SKAEDICNVVRGGILQSIKYIPEKKICFVTFIEAPSAVQFYANSFIDPIVLHGNMLRVGW 723

Query: 509  GHHSGNLPQSISLAVTIGASRNVYVSLPEYAFKDKFIKDPEYQAFREKFKLPSKQQLYDD 568
            GH+SG LP+ ISLAVTIGASRNVYVSLPE+AFK+KFI DP+Y+   E   LP  +QL +D
Sbjct: 724  GHYSGPLPKLISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKKLHETLSLPDAEQLRED 783

Query: 569  FSTFGDIELINFLEDGHCCWINFMNISNAIKLVEDANNSN---NES--------FHEKFE 617
            FST+GDIE IN+L D HCCWINFMNIS+AI LVE+ N  +   NES          EKF 
Sbjct: 784  FSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNKESTVQNESGEVTLKRATEEKFG 843

Query: 618  NRYRGLFIGYGKDRCGXXXXXXXXXXXXXXXXXXXXXXXXIRLRRQQKSDIEAQAKSGKG 677
             RY+GL I YGKDRCG                        IRL     S +E + +  + 
Sbjct: 844  GRYKGLLINYGKDRCGNINKNLIAGKNSRFYKKVKRPSYNIRL-----SKLEEKRRQNEI 898

Query: 678  DENS---EKKLQVDAFGISV-----------GSQPDARYSDEEQKIEENELLLLSKPNSA 723
            DE     +K L +++ GIS+           G+  +  + +E +   ENE         +
Sbjct: 899  DEKEKAFDKPLNLESLGISLDAHKDNGGGETGTANNTGHENESELEAENE---NGNETGS 955

Query: 724  EGGLGISV-SQDVT-VTENNTACGGK-NKTGSVSSGSSEVDILVSAPGSANTSQLEGGGP 780
             GGLG++V S DV   T + T      NK+   S  SS+V++++ +P     + L+    
Sbjct: 956  FGGLGLAVASSDVKRATSDETDYEDIFNKSSGSSDSSSDVEVIMHSPSDPEYA-LKSQTL 1014

Query: 781  TQRTTAASNGKK-------ERSSGVSKLHCFSEIAPRVSKXXXXXXXXXXXXXXNCHYNS 833
               +    N K+       E + G+S+L+  S +                          
Sbjct: 1015 RSSSQTVINSKRPVKIEDEEEAVGMSQLNYRSSL------------------------RQ 1050

Query: 834  APRRSARKNGHDHDSNPVSGSKSDIXXXXXXXXXXXXXXXNA--QAIPGSNVMAQYLAQL 891
            AP R+     ++H  N  +  +                   A  + IPGS+VMAQYLAQ+
Sbjct: 1051 APPRAPSTLSYNHSKNNETPMQDIFTNGETANNRKKKRGSFARHRTIPGSDVMAQYLAQV 1110

Query: 892  QHSTFMYAADILGV 905
            QHSTFMYAA+ILG 
Sbjct: 1111 QHSTFMYAANILGA 1124

 Score =  144 bits (363), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 95/266 (35%), Positives = 143/266 (53%), Gaps = 42/266 (15%)

Query: 42  RGSRRHNKEKHLYDEGTRQIPYKLTFNILPRNGNGDGDKFRTRSLYFSNLNPDVRLHEFL 101
           R   R+N    +  E   Q P+ + + +LP    GD D +RTRSL   N++  + LH  +
Sbjct: 176 RTFARNNIFDDILPEMLLQRPFCINYKVLP---TGD-DAYRTRSLLIENVDHSIDLHSIV 231

Query: 102 ATFHKFDRIESVYV-----------VDREQQSVLVSFLTKETCLDFYNGILQKLSEFKKE 150
             F K + +ES Y+           V+ +  S+L+SFLTK  CL+FYN ILQ+LSEFK  
Sbjct: 232 KNFVKSNTLESAYLIEGGKSDDSKDVETKNLSILISFLTKGDCLNFYNNILQRLSEFKTF 291

Query: 151 LRSKELSLSFAS--------PQKVES--------------GPTL--QEIKFEVLRAGATR 186
           L+S+ L+L F          P  +ES              G T+    +   +    ATR
Sbjct: 292 LKSEALNLKFVCLNYDPKCLPTFIESEALTENAEEADITNGSTMISASLHHNIANKDATR 351

Query: 187 SLGLEFKDEIDFASLLKK-FDFFDNS-GPRYVIESIETVNTDKPSKYFGSNYAIVHFISI 244
           S+ +EFK  ++ + L KK   F D S   RY++ESI+ VNTD PS  F  NYA++ F++I
Sbjct: 352 SIIIEFKSPVEKSDLFKKKLQFLDRSKNKRYILESIDLVNTDVPSNQFPENYAVLTFLNI 411

Query: 245 AMAVETMEYLKVQTPESFGLTKVSYV 270
           +MA+E ++YLK +  ++ G++K  YV
Sbjct: 412 SMAIEVLDYLK-KYSKNLGISKCFYV 436

>NDAI0E00270 Chr5 (33295..36891) [3597 bp, 1198 aa] {ON} Anc_8.844
          Length = 1198

 Score =  353 bits (905), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 215/497 (43%), Positives = 281/497 (56%), Gaps = 55/497 (11%)

Query: 431  MGGGAGNRTVYIGNISPRSKTEDICNVVRGGILQSVKYIEAKHICFVTFIEAASAVQFFA 490
            MG   GNRT+YIGN++PRSK ED+CNVVRGGILQS+K I +K ICFVTFIEA++AVQF+A
Sbjct: 721  MGVEMGNRTIYIGNLNPRSKAEDVCNVVRGGILQSIKLIASKRICFVTFIEASAAVQFYA 780

Query: 491  NSSIEPIVLHGSLLKVGWGHHSGNLPQSISLAVTIGASRNVYVSLPEYAFKDKFIKDPEY 550
            NS I+P++LHG+ LK+GWG++   L +SI+LAVTIGASRNVYVSLPE+AFKDKF+ DPEY
Sbjct: 781  NSFIDPLILHGNTLKIGWGNYYEPLSKSIALAVTIGASRNVYVSLPEFAFKDKFLNDPEY 840

Query: 551  QAFREKFKLPSKQQLYDDFSTFGDIELINFLEDGHCCWINFMNISNAIKLVEDANNS-NN 609
            + F EK+KLPS+QQL  DF+ +G IE IN+L D HCCW+NFMNI++AIKLVED NN+  +
Sbjct: 841  KEFHEKYKLPSEQQLRFDFNKYGPIEQINYLSDSHCCWVNFMNITSAIKLVEDVNNNPKD 900

Query: 610  ESFHEKFENRYRGLFIGYGKDRCGXXXXXXXXXXXXXXXXXXXXXXXXIRLRR-QQKSDI 668
             +F +KF +RY GL I YGKDRCG                         +LR+ Q+K  +
Sbjct: 901  NTFSKKFNHRYDGLIINYGKDRCGNVNRNLISNKNSRHYRKVKKFSDNYKLRQLQEKRRV 960

Query: 669  EAQ-AKSGKGDENSEKKLQVDAFGISVGSQPDARYSDEEQKI-EENE-------LLLLSK 719
            E +  K   G  N  K   +DA GI  G Q  A    EEQK+ E NE        +  S 
Sbjct: 961  EQEKGKELNGGVNDNKLPSLDALGI--GLQRTA--PPEEQKVPESNEDDANYDSAVTESD 1016

Query: 720  PNSAEG-GLGISVSQDVTVTENNTACGGKNKTGSV--------SSGSSEVDILVSAP-GS 769
             N+    G  I  + D    E N   G + +   V        S  SS+V+I++  P   
Sbjct: 1017 TNTFNALGFRIQSNTDSHDDEQNDEKGEEQEEVDVIAHADDISSVNSSDVEIIIDCPHNE 1076

Query: 770  ANTSQLEGGGPTQRTTAASNGKKERSSGVSKLHCFSEIAPRVSKXXXXXXXXXXXXXXNC 829
            ++TS ++     ++ T   N +K      ++   F E    +                N 
Sbjct: 1077 SDTSMIQ----EKKKTIRKNQQKIDRLAKARNAMFPEHRETIPDINNKLFHDRKNKDKN- 1131

Query: 830  HYNSAPRRSARKNG-HDHDSNPVSGSKSDIXXXXXXXXXXXXXXXNAQAIPGSNVMAQYL 888
                  RR   + G  D D +  S  K                    + IPG++VMAQYL
Sbjct: 1132 ------RRKQVQGGIQDQDPHLSSTGKQ------------------QRVIPGADVMAQYL 1167

Query: 889  AQLQHSTFMYAADILGV 905
             QLQHSTFMYAA+ILGV
Sbjct: 1168 TQLQHSTFMYAANILGV 1184

 Score =  120 bits (302), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 109/413 (26%), Positives = 179/413 (43%), Gaps = 130/413 (31%)

Query: 60  QIPYKLTFNILPRNGNGDGDKFRTRSLYFSNLNPDVRLHEFLATFHKFDRIESVYVV--- 116
           Q P+ +++ +LP    GD D +RTRSL FSN+   + LH F+  F ++  IES+Y++   
Sbjct: 182 QKPFVISYKLLP---TGD-DAYRTRSLLFSNVASSIDLHSFIYDFVQYSSIESIYLISNT 237

Query: 117 ----------DREQQSVLVSFLTKETCLDFYNGILQKLSEFKKELRSKELSLSFA---SP 163
                     D+ ++S+L+SFL++E CL FYN +LQ+L+EFK  L+SK L+L+F      
Sbjct: 238 DDEKDQDNENDKNKRSILLSFLSREICLSFYNNVLQRLNEFKTNLQSKSLTLNFVILNYL 297

Query: 164 QKVESGPT----------LQE---------------------IKFEVLRAGATRSLGLEF 192
           +K + G T          +QE                     +KF+++   ATR + +E 
Sbjct: 298 EKTDDGSTANISNNQLNQIQENENDVNTNEFDYRNSMNTVNALKFDLINPDATRFIMIEL 357

Query: 193 KDEIDFASLLKK---FDFFDNSGPRYVIESIETVNT------------------------ 225
           K + D  +LL K   F   +    RY++ESI+  N                         
Sbjct: 358 KTKCDKETLLNKHLSFLIDNKKNIRYILESIDLFNIIENENSSENKSIIEAKNENENSPQ 417

Query: 226 -------------DKPSKYFGSNYAIVHFISIAMAVETMEYLKVQTPESFGLTKVSYVN- 271
                        ++  + F ++YA++ FI+I MA+E  +YLK+   +  G+T  SYV  
Sbjct: 418 GKEKDTMVQKRKRNRSKRTFPNHYAVLSFINIYMAMELRDYLKLNGLK-HGITNASYVQI 476

Query: 272 ------------------STFTSGKSEFQTFSNSELSDQNDVEVQDSISSFEDITLSEGS 313
                             +T    KSE  T  + E  D+   E +   +    IT+S   
Sbjct: 477 KHVKKSLNSSSKRSSVTSTTDNKDKSEVDTNESVEGKDKKSEEAKSFNNKLSSITMSSPD 536

Query: 314 MSVENE------------------KAFTVLP-SQYGPPVVEEHNQHCSHITIS 347
            + E E                  +   VL  + Y  P+ + H+ H ++IT+S
Sbjct: 537 TTYEGEDDIDIDIIISKLQKLKLKETIQVLDIATYNTPLFQSHDSHMANITLS 589

>Suva_13.26 Chr13 (34036..37404) [3369 bp, 1122 aa] {ON} YML117W
           (REAL)
          Length = 1122

 Score =  338 bits (867), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 179/379 (47%), Positives = 228/379 (60%), Gaps = 22/379 (5%)

Query: 329 YGPPVVEEHNQHCSHITISKALXXXXXXXXXXXXIASPQPQEVLVSNSEAPSSRNSIVSL 388
           Y  PV+ EH+ H S+I ISK +            I SP P    +  +++  S  +IVS 
Sbjct: 539 YPTPVINEHSAHLSNIKISKTVDNSRQFTQD---IPSPLPLNEHMFMTDSNQSNGTIVSQ 595

Query: 389 LSARSQGPTYPVPGYHYYMDMSKPLGXXXXXXXXXXXXXXXXMGGGAGNRTVYIGNISPR 448
               +  P  P P  +  + +  P+                 MG   GNRT+YIGNI+PR
Sbjct: 596 QLITAPSPQSPNPQMNQRV-LPNPITQSLEQNFNVSAKVASSMGSDIGNRTIYIGNINPR 654

Query: 449 SKTEDICNVVRGGILQSVKYIEAKHICFVTFIEAASAVQFFANSSIEPIVLHGSLLKVGW 508
           S+ EDICNVVRGGILQ++KYI  K ICFVTFIEAASAVQF+ANS I+PIVLHG++L+VGW
Sbjct: 655 SRAEDICNVVRGGILQNIKYIAEKRICFVTFIEAASAVQFYANSFIDPIVLHGNMLRVGW 714

Query: 509 GHHSGNLPQSISLAVTIGASRNVYVSLPEYAFKDKFIKDPEYQAFREKFKLPSKQQLYDD 568
           GH+SG LP+SISLAVTIGASRNVYVSLPE+AFK+KFI DP+Y+   E   LP  +QL +D
Sbjct: 715 GHYSGPLPKSISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKQLHETLALPDAEQLRED 774

Query: 569 FSTFGDIELINFLEDGHCCWINFMNISNAIKLVEDANNSNN-----------ESFHEKFE 617
           FST+GDIE IN+L D HCCWINFMNIS+AI LVE+ N                +  EKF+
Sbjct: 775 FSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNEEPTGHDDSGELIPKTATEEKFD 834

Query: 618 NRYRGLFIGYGKDRCGXXXXXXXXXXXXXXXXXXXXXXXXIRLRRQQKSDIEAQAKSGKG 677
            RY+GL I YGKDRCG                        IRL     S +E + +  + 
Sbjct: 835 GRYKGLLINYGKDRCGNINKNLVAGKNSRFYKKVKRPSYNIRL-----SKLEERRRQNEN 889

Query: 678 D--ENSEKKLQVDAFGISV 694
           D  E+ +K L +++ GIS+
Sbjct: 890 DKKESFDKVLNLESLGISL 908

 Score = 56.6 bits (135), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 24/30 (80%), Positives = 28/30 (93%)

Query: 876  QAIPGSNVMAQYLAQLQHSTFMYAADILGV 905
            + IPGS+VMAQYLAQ+QHSTFMYAA+ILG 
Sbjct: 1083 RTIPGSDVMAQYLAQVQHSTFMYAANILGA 1112

>Smik_13.17 Chr13 (30501..33896) [3396 bp, 1131 aa] {ON} YML117W
           (REAL)
          Length = 1131

 Score =  331 bits (849), Expect = 3e-97,   Method: Compositional matrix adjust.
 Identities = 179/391 (45%), Positives = 228/391 (58%), Gaps = 17/391 (4%)

Query: 329 YGPPVVEEHNQHCSHITISKALXXXXXXXXXXXXIASPQPQEVLVSNSEAPSSRNSIVSL 388
           Y  P V EH+ H S++ ISK +            I SP P    +  +++  S  SIV  
Sbjct: 546 YQTPTVHEHSTHLSNVKISKTVENSRQFPHD---IPSPLPLNERMFMNDSNHSNGSIVPQ 602

Query: 389 LSARSQGPTYPVPGYHYYMDMSKPLGXXXXXXXXXXXXXXXXMGGGAGNRTVYIGNISPR 448
               +  P       +  + +  P+                 MG   GNRT+YIGNI+PR
Sbjct: 603 QLMATPSPVSSTIQMNQRV-LPNPITQSLEQNFNVSAKVASSMGSDVGNRTIYIGNINPR 661

Query: 449 SKTEDICNVVRGGILQSVKYIEAKHICFVTFIEAASAVQFFANSSIEPIVLHGSLLKVGW 508
           S+ EDICNVVRGGILQS+KY+  K ICFVTFIEA SAVQF+ANS I+PIVLHG++L+VGW
Sbjct: 662 SRAEDICNVVRGGILQSIKYMPEKRICFVTFIEAPSAVQFYANSFIDPIVLHGNMLRVGW 721

Query: 509 GHHSGNLPQSISLAVTIGASRNVYVSLPEYAFKDKFIKDPEYQAFREKFKLPSKQQLYDD 568
           GH+SG LP+SISLAVTIGASRNVYVSLPE+AFK+KFI DP+Y+   E   LP  +QL +D
Sbjct: 722 GHYSGPLPKSISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKKLHETLSLPDAEQLRED 781

Query: 569 FSTFGDIELINFLEDGHCCWINFMNISNAIKLVEDAN------NSNNESFH-----EKFE 617
           FST+GDIE IN+L D HCCWINFMNIS+AI LVE+ N      N + E  H     +KF 
Sbjct: 782 FSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNKESTAHNEDGEMTHKTATEKKFG 841

Query: 618 NRYRGLFIGYGKDRCGXXXXXXXXXXXXXXXXXXXXXXXXIRLRRQQKSDIEAQAKSGKG 677
            RY GL I YGKDRCG                        IRL + ++     Q ++ K 
Sbjct: 842 GRYEGLLINYGKDRCGNINKNLVAGKNSRFYKKVKRPSYNIRLSKLEER--RRQNENDKK 899

Query: 678 DENSEKKLQVDAFGISVGSQPDARYSDEEQK 708
           +   +K L +++ GIS+ S  D    + E K
Sbjct: 900 ERAFDKALNLESLGISLDSHKDIGIGEIENK 930

 Score =  142 bits (359), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 95/266 (35%), Positives = 139/266 (52%), Gaps = 42/266 (15%)

Query: 42  RGSRRHNKEKHLYDEGTRQIPYKLTFNILPRNGNGDGDKFRTRSLYFSNLNPDVRLHEFL 101
           R S R+N    +  E   Q P+++ + ILP    GD D +RTRSL   N++    LH  +
Sbjct: 175 RTSTRNNIFDDISSELLLQRPFRINYKILP---TGD-DAYRTRSLLIENVDRSTDLHSIV 230

Query: 102 ATFHKFDRIESVYVVDREQQ-----------SVLVSFLTKETCLDFYNGILQKLSEFKKE 150
             F K + +ES Y++  E+            S+L+SFLT+  CL+FYN ILQ+LSEFK  
Sbjct: 231 KNFVKSNTLESTYIIGNEKSDDLKDEQTSNLSILISFLTRSDCLNFYNNILQRLSEFKTF 290

Query: 151 LRSKELSLSF-----------------ASPQKVE-------SGPTLQEIKFEVLRAGATR 186
           L+S+ L+L F                 A  + VE       S      +  ++    ATR
Sbjct: 291 LKSESLNLKFVCLNYDFKCLSTFIEDDALTENVEQIDITNDSSMISASLHHDLENKDATR 350

Query: 187 SLGLEFKDEIDFASLL-KKFDFFDNSG-PRYVIESIETVNTDKPSKYFGSNYAIVHFISI 244
           S+ +EFK  +    L  KK  F D S   RY++ESI+ VNTD PS  F  NYA++ F++I
Sbjct: 351 SIIVEFKSPLKSTELFNKKLQFLDRSNNKRYILESIDIVNTDVPSNQFPENYAVLTFLNI 410

Query: 245 AMAVETMEYLKVQTPESFGLTKVSYV 270
            MA+E ++YLK +  +  G++K  YV
Sbjct: 411 FMAIEVLDYLK-KYSKKLGISKCFYV 435

 Score = 57.0 bits (136), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 24/30 (80%), Positives = 28/30 (93%)

Query: 876  QAIPGSNVMAQYLAQLQHSTFMYAADILGV 905
            + IPGS+VMAQYLAQ+QHSTFMYAA+ILG 
Sbjct: 1092 RTIPGSDVMAQYLAQVQHSTFMYAANILGA 1121

>TBLA0B03280 Chr2 complement(764832..768920) [4089 bp, 1362 aa] {ON}
            Anc_8.844 YML117W
          Length = 1362

 Score =  327 bits (839), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 142/203 (69%), Positives = 172/203 (84%)

Query: 431  MGGGAGNRTVYIGNISPRSKTEDICNVVRGGILQSVKYIEAKHICFVTFIEAASAVQFFA 490
            +GGG GNRTVYIGNI+PRSK ED+CNVVRGGILQ + ++  KHICFVTFIEA +A QFFA
Sbjct: 819  LGGGPGNRTVYIGNINPRSKPEDLCNVVRGGILQKIVFLRDKHICFVTFIEATNAAQFFA 878

Query: 491  NSSIEPIVLHGSLLKVGWGHHSGNLPQSISLAVTIGASRNVYVSLPEYAFKDKFIKDPEY 550
            N+ I+PIVLHG++LKVGWG+HSG LP+SISLAVTIGA+RNVYVSLPE+AFKDKFI +P+Y
Sbjct: 879  NAYIDPIVLHGNILKVGWGNHSGPLPKSISLAVTIGANRNVYVSLPEFAFKDKFINNPDY 938

Query: 551  QAFREKFKLPSKQQLYDDFSTFGDIELINFLEDGHCCWINFMNISNAIKLVEDANNSNNE 610
            + + E +KLP++ QL  DFS +G+IE IN+L DGHCCWINFMNI++AI LVE+ N  +  
Sbjct: 939  EKYHEIYKLPNELQLRKDFSQYGEIEQINYLNDGHCCWINFMNINSAITLVEEVNEDDGI 998

Query: 611  SFHEKFENRYRGLFIGYGKDRCG 633
             FH KF+ RY GL IGYGKDRCG
Sbjct: 999  RFHNKFDGRYNGLIIGYGKDRCG 1021

 Score =  100 bits (248), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 85/301 (28%), Positives = 128/301 (42%), Gaps = 95/301 (31%)

Query: 60  QIPYKLTFNILPRNGNGDGDKFRTRSLYFSNLNPDVRLHEFLATFHKFDRIESVYVVD-- 117
           +IP  +++ ILP+      D+FRTRSL   N+N  +     +  F  F  IESVY++   
Sbjct: 258 EIPLVVSYKILPKGT----DEFRTRSLLLENINQSIDTRTLVKNFINFGPIESVYLIKLN 313

Query: 118 --REQQSVLVSFLTKETCLDFYNGILQKLSEFKKELRSKELSLSF--------------- 160
              +  S+L+SF+++E CLDFYN +LQ+L EFK EL SK L+LSF               
Sbjct: 314 PGSKYNSILLSFVSREICLDFYNNVLQRLMEFKTELSSKSLTLSFVILKYEFTDYNHPIN 373

Query: 161 --ASPQKVESGPTLQEIKFEVLRA------------------------------------ 182
             AS    ES  + + +K + ++                                     
Sbjct: 374 EHASDNGDESSSSNKNLKIDTIKEEEEDEEETDGEEIVIEDIRNDLNKENFPLTFASALQ 433

Query: 183 ------GATRSLGLEFKDEIDFASLLKK---FDFFDNSGPRYVIESIETVNT-------- 225
                 GATRSL L+F   +    L+ +       +N   RY++ESI  VN         
Sbjct: 434 SDLVKRGATRSLLLKFNGVVSKDQLINEKLNLFINNNLNNRYILESISLVNIENNTKNNK 493

Query: 226 ------------DKPSKYFGSNYAIVHFISIAMAVETMEYLKVQTPE-----SFGLTKVS 268
                       D P   FG+NY ++ F +I MA+E  +Y K +  E      F ++K +
Sbjct: 494 NTIGDDNEDQIEDTPISKFGNNYCLLTFSNILMAIEAFDYFKAKLNELNIFDCFFVSKTN 553

Query: 269 Y 269
           Y
Sbjct: 554 Y 554

 Score = 57.4 bits (137), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 24/30 (80%), Positives = 28/30 (93%)

Query: 876  QAIPGSNVMAQYLAQLQHSTFMYAADILGV 905
            + IPGS+VM+QYL QLQHSTFMYAA+ILGV
Sbjct: 1316 KTIPGSDVMSQYLTQLQHSTFMYAANILGV 1345

>Skud_13.24 Chr13 (33966..37352) [3387 bp, 1128 aa] {ON} YML117W
           (REAL)
          Length = 1128

 Score =  320 bits (821), Expect = 3e-93,   Method: Compositional matrix adjust.
 Identities = 177/393 (45%), Positives = 226/393 (57%), Gaps = 38/393 (9%)

Query: 329 YGPPVVEEHNQHCSHITISKALXXXXXXXXXXXXIASPQPQEVLVSNSEAPSSRNSIV-- 386
           Y  P + EH+ H S+I ISK +            I SP P    +  +++  S  +++  
Sbjct: 545 YSTPTINEHSTHLSNIKISKTVENSRHFPQD---IPSPLPLNEQMFMNDSNQSNGAVIPQ 601

Query: 387 ------SLLSARSQGPTYPVPGYHYYMDMSKPLGXXXXXXXXXXXXXXXXMGGGAGNRTV 440
                 S LS+  Q     +P           +                 MG   GNRT+
Sbjct: 602 QLIAAPSPLSSNLQINQRVLPN---------AITQSLEQNFNVSAKVASSMGSDVGNRTI 652

Query: 441 YIGNISPRSKTEDICNVVRGGILQSVKYIEAKHICFVTFIEAASAVQFFANSSIEPIVLH 500
           YIGNI+PRS+ EDICNVVRGGILQS+KYI  K I FVTFIEA SAVQF+ANS I+PIVLH
Sbjct: 653 YIGNINPRSRAEDICNVVRGGILQSIKYIPEKRISFVTFIEAPSAVQFYANSFIDPIVLH 712

Query: 501 GSLLKVGWGHHSGNLPQSISLAVTIGASRNVYVSLPEYAFKDKFIKDPEYQAFREKFKLP 560
           G++L+VGWGH+SG LP+SISLAVTIGASRNVYVSLPE+AFK+KFI DP+Y+   E   LP
Sbjct: 713 GNMLRVGWGHYSGPLPKSISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKQLHETLALP 772

Query: 561 SKQQLYDDFSTFGDIELINFLEDGHCCWINFMNISNAIKLVEDANNSN-----------N 609
             +QL +DFST+GDIE IN+L D HCCWINFMNIS+AI LVE+ N  +            
Sbjct: 773 DAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAIGLVEEMNKESMAHHDGGEVIVK 832

Query: 610 ESFHEKFENRYRGLFIGYGKDRCGXXXXXXXXXXXXXXXXXXXXXXXXIRLRRQQKSDIE 669
            +  EKF+ RY+GL I YGKDRCG                        IRL     S +E
Sbjct: 833 TAGEEKFDGRYKGLLINYGKDRCGNINKNLVAGKNSRFYKKVKRPSYNIRL-----SKLE 887

Query: 670 AQAKSGKGD--ENSEKKLQVDAFGISVGSQPDA 700
            + +  + D  E+ +K L +++ GIS+    DA
Sbjct: 888 ERRRQNENDKKESFDKVLNLESLGISLDPHKDA 920

 Score =  147 bits (371), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 96/251 (38%), Positives = 136/251 (54%), Gaps = 42/251 (16%)

Query: 60  QIPYKLTFNILPRNGNGDGDKFRTRSLYFSNLNPDVRLHEFLATFHKFDRIESVYVVDR- 118
           Q P+++ + ILP    GD D +RTRSL   N++    LH  +  F KF+ +ES Y VD  
Sbjct: 193 QRPFRINYKILP---TGD-DAYRTRSLLIENVDRSTDLHSLVKNFVKFNTLESAYFVDND 248

Query: 119 ----------EQQSVLVSFLTKETCLDFYNGILQKLSEFKKELRSKELSLSFA------- 161
                     E  SVL+SFLT+  CL+FYN ILQ+LSEFK  L+SK L+L F        
Sbjct: 249 KNDDLEDGETENLSVLISFLTRSDCLNFYNNILQRLSEFKIFLKSKSLNLKFVCLNYESE 308

Query: 162 ---------SPQKV--------ESGPTLQEIKFEVLRAGATRSLGLEFKDEIDFASLL-K 203
                     P++V        +S      +  +V    ATRS+ +EFK  ++   L  K
Sbjct: 309 CLSTFVEGEKPKEVDEQVHAANDSMMISASLHHDVENKDATRSIIIEFKSALEKTELFRK 368

Query: 204 KFDFFDNS-GPRYVIESIETVNTDKPSKYFGSNYAIVHFISIAMAVETMEYLKVQTPESF 262
           +  F D S   RY++ESI+ VNTD PS  F  NYA++ F++I MAVE ++YLK +  +S 
Sbjct: 369 RLQFLDESKNKRYILESIDLVNTDVPSNQFPENYAVLTFLNIFMAVEVLDYLK-KFSKSL 427

Query: 263 GLTKVSYVNST 273
            ++K  YV+ T
Sbjct: 428 EISKCFYVSLT 438

 Score = 56.6 bits (135), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 24/29 (82%), Positives = 28/29 (96%)

Query: 876  QAIPGSNVMAQYLAQLQHSTFMYAADILG 904
            + IPGS+VMAQYLAQ+QHSTFMYAA+ILG
Sbjct: 1089 RTIPGSDVMAQYLAQVQHSTFMYAANILG 1117

>SAKL0A05280g Chr1 complement(475021..476769) [1749 bp, 582 aa] {ON}
           similar to uniprot|Q08925 Saccharomyces cerevisiae
           YPL184C Hypothetical ORF
          Length = 582

 Score =  174 bits (442), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 86/199 (43%), Positives = 125/199 (62%), Gaps = 23/199 (11%)

Query: 436 GNRTVYIGNISPRSKTEDICNVVRGGILQSVKYIEAKHICFVTFIEAASAVQFFANSSIE 495
           GNRTVY+GN+    K E+ICN VRGG+LQSVK +  +H+CFVTFI+  +A QF+A SS+ 
Sbjct: 399 GNRTVYLGNLPKDVKIEEICNAVRGGLLQSVKLLSDRHVCFVTFIDPTAAAQFYAMSSLH 458

Query: 496 PIVLHGSLLKVGWGHHSGNLPQSISLAVTIGASRNVYVSLPEYAFKDKFIKDPEYQAFRE 555
            + +H    K+GWG HSG+LP +++LAV+ GASRN+YV             + ++ A  E
Sbjct: 459 GLTIHNKRCKIGWGKHSGSLPNALALAVSHGASRNIYVG------------NIDFNAIDE 506

Query: 556 KFK-LPSKQQLYDDFSTFGDIELINFLEDGHCCWINFMNISNAIKLVEDANNSNNESFHE 614
             + + ++Q L + F  FG++E INFL + +CC+INF NISNAI  ++            
Sbjct: 507 TGETIFTEQNLRETFQEFGEVEQINFLHEKNCCFINFTNISNAILAIDKI---------- 556

Query: 615 KFENRYRGLFIGYGKDRCG 633
           K    ++ L + +GKDRCG
Sbjct: 557 KCNPYFKNLKVNFGKDRCG 575

 Score = 94.4 bits (233), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 62/203 (30%), Positives = 112/203 (55%), Gaps = 22/203 (10%)

Query: 435 AGNRTVYIGNISPRSKTEDICNVVRGGILQSVKYIEAKHICFVTFIEAASAVQFFANSSI 494
           A +RTVY+GNI P    + + + VR G+++ +K +  +   F++F++ +SA+ F +++ +
Sbjct: 158 APSRTVYLGNIPPFLPAKQLLDHVRSGVIEELKILPDRMCAFISFVDESSALLFHSDAIL 217

Query: 495 EPIVLHGSLLKVGWGHHSGNLPQSISLAVTIGASRNVYV----SLPEYAFKDKFIKDPEY 550
           + + + G  +KVGWG  +   P   +   + GA+RNVY+    + P+ A   +F  DP  
Sbjct: 218 KRLNIEGRDIKVGWGKPTPIDPIVAAGIASDGATRNVYIGRLNTDPQLA--PQFGTDPNE 275

Query: 551 QAFREKFKLPSKQQLYDDFSTFGDIELINFLEDGHCCWINFMNISNAIKLVEDANNSNNE 610
           +       + S+++L  D + FG+IE I  + D    +++F +I +AIK+V     SN  
Sbjct: 276 E-------IVSEEKLRKDLNDFGEIESIKIVRDKGIAFVHFSSIFSAIKVV-----SNLA 323

Query: 611 SFHEKFENRYRGLFIGYGKDRCG 633
           S +  + N+     I YGKDRC 
Sbjct: 324 SVNPYYTNKK----IFYGKDRCA 342

>NCAS0H01040 Chr8 complement(194824..196713) [1890 bp, 629 aa] {ON}
           Anc_6.183
          Length = 629

 Score =  170 bits (431), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 91/198 (45%), Positives = 125/198 (63%), Gaps = 21/198 (10%)

Query: 436 GNRTVYIGNISPRSKTEDICNVVRGGILQSVKYIEAKHICFVTFIEAASAVQFFANSSIE 495
           GNRTVY+GN+    K E+ICNVVRGG+LQSVK +  +++CFVTFI+  +A QF+A SS+ 
Sbjct: 446 GNRTVYLGNLPKDIKIEEICNVVRGGLLQSVKLLSDRYVCFVTFIDPTAAAQFYAMSSLH 505

Query: 496 PIVLHGSLLKVGWGHHSGNLPQSISLAVTIGASRNVYVSLPEYAFKDKFIKDPEYQAFRE 555
            + +     KVGWG HSG LP +++LAV+ GASRNVY+      F+   ++DP       
Sbjct: 506 GLTIQKKRCKVGWGKHSGPLPNALALAVSNGASRNVYIG--NINFEKDAMRDP------- 556

Query: 556 KFKLPSKQQLYDDFSTFGDIELINFLEDGHCCWINFMNISNAIKLVEDANNSNNESFHEK 615
             ++ ++  L   F  +G++E INFL + +CC+INF NISNAI L  D   SN       
Sbjct: 557 --RIFTEDSLRKLFRQYGEVEQINFLPEKNCCFINFTNISNAI-LALDKIKSN-----PH 608

Query: 616 FENRYRGLFIGYGKDRCG 633
           FE+    L I +GKDRCG
Sbjct: 609 FED----LKINFGKDRCG 622

 Score = 95.1 bits (235), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 57/199 (28%), Positives = 104/199 (52%), Gaps = 20/199 (10%)

Query: 435 AGNRTVYIGNISPRSKTEDICNVVRGGILQSVKYIEAKHICFVTFIEAASAVQFFANSSI 494
           A +RTVY+GNI      +++ + VR G+++ VK I  K   F++F++ +SA+ F +++ +
Sbjct: 211 APSRTVYLGNIPSNLTVKELLDHVRSGVVEDVKIIPEKLCAFISFVDESSALLFHSDAIL 270

Query: 495 EPIVLHGSLLKVGWGHHSGNLPQSISLAVTIGASRNVYVSLPEYAFKDKFIKDPEYQAFR 554
           + + + G  +K+GWG  +   P   +  +   A+RNV++        D   K+P  +A  
Sbjct: 271 KRLNIGGKDIKIGWGKPTTVDPMISARIINDDATRNVFIGHLNKTDNDSCTKEPITEA-- 328

Query: 555 EKFKLPSKQQLYDDFSTFGDIELINFLEDGHCCWINFMNISNAIKLVEDANNSNNESFHE 614
                    +L +D   FG+IE +  + +    +++F +I++AIK V      N  S + 
Sbjct: 329 ---------KLREDLEDFGEIETVKIIPEKGIAFVHFSSITSAIKCVH-----NLRSMNP 374

Query: 615 KFENRYRGLFIGYGKDRCG 633
            +EN+     I YGKDRC 
Sbjct: 375 YYENKK----IAYGKDRCA 389

>TBLA0B05210 Chr2 complement(1225521..1227653) [2133 bp, 710 aa]
           {ON} Anc_6.183 YPL184C
          Length = 710

 Score =  169 bits (427), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 85/198 (42%), Positives = 120/198 (60%), Gaps = 20/198 (10%)

Query: 436 GNRTVYIGNISPRSKTEDICNVVRGGILQSVKYIEAKHICFVTFIEAASAVQFFANSSIE 495
           GNRTVY+GN+    K ++ICN VRGG+LQ +K +  +H+CFVTFI+  +A QF+A SS+ 
Sbjct: 526 GNRTVYLGNLPVDVKIDEICNAVRGGLLQHIKLLTDRHVCFVTFIDPTAAAQFYAMSSLH 585

Query: 496 PIVLHGSLLKVGWGHHSGNLPQSISLAVTIGASRNVYVSLPEYAFKDKFIKDPEYQAFRE 555
            + +     KVGWG HSG LP  I+LAV+ GASRNVY+   ++    K    P +     
Sbjct: 586 GLSIQKKRCKVGWGKHSGPLPNLIALAVSNGASRNVYLGNIDFENDIKLHNPPIF----- 640

Query: 556 KFKLPSKQQLYDDFSTFGDIELINFLEDGHCCWINFMNISNAIKLVEDANNSNNESFHEK 615
                ++  L + F  +GD+E INFL + +CC+INF NISNAI  +E   N+ +      
Sbjct: 641 -----TELSLRNIFQQYGDVEQINFLPEKNCCFINFTNISNAILAIEKIKNNPD------ 689

Query: 616 FENRYRGLFIGYGKDRCG 633
               ++ L I +GKDRCG
Sbjct: 690 ----FKDLKINFGKDRCG 703

 Score = 84.3 bits (207), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 56/217 (25%), Positives = 110/217 (50%), Gaps = 26/217 (11%)

Query: 433 GGAGNRTVYIGNISPRSKTEDICNVVRGGILQSVKYIEAKHICFVTFIEAASAVQFFANS 492
           G   +RTVY+GNI      +D+ + VR G+++++K +  K   F++F++ +SA+ F +++
Sbjct: 263 GNTPSRTVYLGNIPSDLSVKDLLDHVRSGVVENIKILPDKMCAFISFVDESSALLFHSDA 322

Query: 493 SIEPIVLHGSLLKVGWGHHSGNLPQSISLAVTIGASRNVYV----------------SLP 536
            ++ + + G  +K+GWG  +   P   +  VT GA+RNVY+                S  
Sbjct: 323 ILKRLNIGGRDIKIGWGKPTPIDPIVATSIVTDGATRNVYIGQLSNSSNNNTSSSSSSTS 382

Query: 537 EYAFKDKFIKDPEYQAFREKFKLPSKQQLYDDFSTFGDIELINFLEDGHCCWINFMNISN 596
             +  +    D E +   +   L ++++L +D   +G+I+ +  ++D    +++  +I +
Sbjct: 383 PSSPSNNTSDDLEKKKNIDDSPL-TEEKLREDLKDYGEIDCVKIVQDKGFAFVHMSSILS 441

Query: 597 AIKLVEDANNSNNESFHEKFENRYRGLFIGYGKDRCG 633
           AIK+V +   +N           Y+   I YGKDRC 
Sbjct: 442 AIKVVNNLAQTN---------PYYQNKRIFYGKDRCA 469

>Kwal_27.11158 s27 (665984..667687) [1704 bp, 567 aa] {ON} YPL184C -
           Hypothetical ORF [contig 30] FULL
          Length = 567

 Score =  167 bits (422), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 85/198 (42%), Positives = 122/198 (61%), Gaps = 21/198 (10%)

Query: 436 GNRTVYIGNISPRSKTEDICNVVRGGILQSVKYIEAKHICFVTFIEAASAVQFFANSSIE 495
           GNRT+Y+GN+    K E+ICNVVRGG+LQS+K +  +H+CFVTFI+  +A Q +A +S+ 
Sbjct: 384 GNRTIYLGNLPKDVKIEEICNVVRGGLLQSIKLLTDRHVCFVTFIDPTAAAQLYAMASLH 443

Query: 496 PIVLHGSLLKVGWGHHSGNLPQSISLAVTIGASRNVYVSLPEYAFKDKFIKDPEYQAFRE 555
            + +H    K+GWG HSG L  +++LAV+ GASRN+Y+   ++    K   + E+  F E
Sbjct: 444 GLTIHNKRCKIGWGKHSGALSNALALAVSHGASRNIYLGNIDF----KADSETEHPIFTE 499

Query: 556 KFKLPSKQQLYDDFSTFGDIELINFLEDGHCCWINFMNISNAIKLVEDANNSNNESFHEK 615
                  Q L   F  FG++E INFL + +CC++NF NISNAI  ++     NN  F + 
Sbjct: 500 -------QNLRSIFEEFGEVEQINFLIERNCCFVNFTNISNAILAIDKI--KNNPQFSD- 549

Query: 616 FENRYRGLFIGYGKDRCG 633
                  L I +GKDRCG
Sbjct: 550 -------LKINFGKDRCG 560

 Score = 96.7 bits (239), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 58/201 (28%), Positives = 105/201 (52%), Gaps = 18/201 (8%)

Query: 435 AGNRTVYIGNISPRSKTEDICNVVRGGILQSVKYIEAKHICFVTFIEAASAVQFFANSSI 494
           A +RTVY+GNI P  +   + + VR G+++ ++ +  K   F++F++ +SA+ F +++ +
Sbjct: 143 APSRTVYLGNIPPNLEARQLLDHVRSGVVEDIRILREKMCAFISFLDESSALLFHSDAIL 202

Query: 495 EPIVLHGSLLKVGWGHHSGNLPQSISLAVTIGASRNVYVSL--PEYAFKDKFIKDPEYQA 552
           + + + G  +K+GWG  +   P   S     GA+RNVY+     + +F  +   DP  + 
Sbjct: 203 KRLNIDGRDIKIGWGKPTPIDPVVTSAVANDGATRNVYIGRLNTDSSFAPQIGADPRDEV 262

Query: 553 FREKFKLPSKQQLYDDFSTFGDIELINFLEDGHCCWINFMNISNAIKLVEDANNSNNESF 612
             E       Q+L DD S +G+IE +  + +    +++F +I +AIK+V      N    
Sbjct: 263 VTE-------QKLRDDLSFYGEIESVKIITEKGIAFVHFCSIFSAIKVVSSLAAVNPYYA 315

Query: 613 HEKFENRYRGLFIGYGKDRCG 633
           ++K         I YGKDRC 
Sbjct: 316 NKK---------IFYGKDRCA 327

>AFL061C Chr6 complement(317447..319018) [1572 bp, 523 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL184C
          Length = 523

 Score =  162 bits (411), Expect = 9e-42,   Method: Compositional matrix adjust.
 Identities = 83/198 (41%), Positives = 121/198 (61%), Gaps = 21/198 (10%)

Query: 436 GNRTVYIGNISPRSKTEDICNVVRGGILQSVKYIEAKHICFVTFIEAASAVQFFANSSIE 495
           GNRT+Y+GN+    K E+ICN VRGG+LQ +K +  +H+CFVTFI+  +A QF+A SS+ 
Sbjct: 340 GNRTIYLGNLPKDVKLEEICNSVRGGLLQHIKLLSDRHVCFVTFIDPTAAAQFYAMSSLH 399

Query: 496 PIVLHGSLLKVGWGHHSGNLPQSISLAVTIGASRNVYVSLPEYAFKDKFIKDPEYQAFRE 555
            + +H    K+GWG HSG LP  ++LAV+ GASRN+Y+   ++A  DK  + P +     
Sbjct: 400 GLTIHNKRCKIGWGKHSGPLPNPLALAVSRGASRNIYLGNIDFA-ADKKSQHPIF----- 453

Query: 556 KFKLPSKQQLYDDFSTFGDIELINFLEDGHCCWINFMNISNAIKLVEDANNSNNESFHEK 615
                ++  L   F  FG++E INFL + +CC+INF NIS+AI  ++            K
Sbjct: 454 -----TEAALRAVFQEFGEVEQINFLYERNCCFINFANISSAILAIDKI----------K 498

Query: 616 FENRYRGLFIGYGKDRCG 633
               ++ L I +GKDRCG
Sbjct: 499 SIPTFKDLKINFGKDRCG 516

 Score = 88.2 bits (217), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 59/202 (29%), Positives = 105/202 (51%), Gaps = 20/202 (9%)

Query: 435 AGNRTVYIGNISPRSKTEDICNVVRGGILQSVKYIEAKHICFVTFIEAASAVQFFANSSI 494
           A +RTVY+GN+ P   T+++ + VR G+++ VK +  K   F++F+E  SA+ F +++ +
Sbjct: 100 APSRTVYLGNVPPYITTKELLDHVRSGVVEEVKILPEKMCAFISFVEENSALLFHSDAIL 159

Query: 495 EPIVLHGSLLKVGWGHHSGNLPQSISLAVTIGASRNVYVSLPEYAFKD---KFIKDPEYQ 551
           + + +    +K+GWG  +   P   +     GA+RNVY+       KD   ++  DP  +
Sbjct: 160 KRLNIDDRDIKIGWGKPTQIDPIVAAGITNDGATRNVYIGKLNTN-KDICAQWGVDPNEE 218

Query: 552 AFREKFKLPSKQQLYDDFSTFGDIELINFLEDGHCCWINFMNISNAIKLVEDANNSNNES 611
              E       ++L +D S FG++E +  + +    +++F +I  AIK+V +  N N   
Sbjct: 219 VITE-------EKLRNDLSDFGEVENVKIVPEKGIAFVHFSSIFAAIKVVANLANINPYY 271

Query: 612 FHEKFENRYRGLFIGYGKDRCG 633
             +K         I YGKDRC 
Sbjct: 272 AQKK---------IFYGKDRCA 284

>NDAI0F02260 Chr6 (546978..549020) [2043 bp, 680 aa] {ON} Anc_6.183
          Length = 680

 Score =  165 bits (417), Expect = 9e-42,   Method: Compositional matrix adjust.
 Identities = 88/198 (44%), Positives = 124/198 (62%), Gaps = 21/198 (10%)

Query: 436 GNRTVYIGNISPRSKTEDICNVVRGGILQSVKYIEAKHICFVTFIEAASAVQFFANSSIE 495
           GNRT+Y+GN+    + E+ICNVVRGG+LQSVK +  +++CFVTFI+  +A QFFA SS+ 
Sbjct: 497 GNRTIYLGNLPKDIRVEEICNVVRGGLLQSVKLLGDRYVCFVTFIDPTAAAQFFAMSSLH 556

Query: 496 PIVLHGSLLKVGWGHHSGNLPQSISLAVTIGASRNVYVSLPEYAFKDKFIKDPEYQAFRE 555
            + +     KVGWG HSG L  +++LAV+ GASRN+Y+   ++A  DK   +P +     
Sbjct: 557 GLTIQKKRCKVGWGKHSGPLSNALALAVSHGASRNIYIGNIDFA-TDKKRDNPIF----- 610

Query: 556 KFKLPSKQQLYDDFSTFGDIELINFLEDGHCCWINFMNISNAIKLVEDANNSNNESFHEK 615
                ++  L   FS +G++E INFL + +CC+INF NISNAI L  D   SN       
Sbjct: 611 -----TEDSLRKMFSMYGEMEQINFLPEKNCCFINFTNISNAI-LALDKIKSNPV----- 659

Query: 616 FENRYRGLFIGYGKDRCG 633
               ++ L I +GKDRCG
Sbjct: 660 ----FKDLKINFGKDRCG 673

 Score = 89.7 bits (221), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 64/231 (27%), Positives = 110/231 (47%), Gaps = 41/231 (17%)

Query: 435 AGNRTVYIGNISPRSKTEDICNVVRGGILQSVKYIEAKHICFVTFIEAASAVQFFANSSI 494
           A +RTVY+GNI      +++ + VR G+++ VK I  K   F++F++  SA+ F +++ +
Sbjct: 219 APSRTVYLGNIPSDLTVKELLDHVRSGVIEDVKIIPEKLCAFISFLDENSALLFHSDAIL 278

Query: 495 EPIVLHGSLLKVGWGHHSGNLPQSISLAVTIGASRNVYVS-LPEYAF---KDKFIKDPEY 550
           + + ++G  +K+GWG  +   P   +  +  GA+RNV++  L   +F   K K  K P  
Sbjct: 279 KRLNINGKDIKIGWGKSTAVDPMIATRIINDGATRNVFIGQLKTKSFDPNKAKVTKMPPS 338

Query: 551 QAFREKFKLP----------------------------SKQQLYDDFSTFGDIELINFLE 582
           +       +                             S  +L  D + FGDI+ I  +E
Sbjct: 339 RNHDINATISNENDEKENGVDTAHVEGEVEVGEEEEPISDAKLRKDLADFGDIDCIKIVE 398

Query: 583 DGHCCWINFMNISNAIKLVEDANNSNNESFHEKFENRYRGLFIGYGKDRCG 633
           D    +I+F +I++AIK V + N+ N+    +K         I YGKDRC 
Sbjct: 399 DKGIAFIHFASITSAIKCVHNLNSMNDYYSTKK---------IFYGKDRCA 440

>Ecym_2233 Chr2 complement(453154..454884) [1731 bp, 576 aa] {ON}
           similar to Ashbya gossypii AFL061C
          Length = 576

 Score =  163 bits (412), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 81/198 (40%), Positives = 121/198 (61%), Gaps = 21/198 (10%)

Query: 436 GNRTVYIGNISPRSKTEDICNVVRGGILQSVKYIEAKHICFVTFIEAASAVQFFANSSIE 495
           GNRT+Y+GN+    K E+ICN VRGG+LQ +K +  +H+CFVTFI+  +A QF+A SS+ 
Sbjct: 393 GNRTIYLGNLPKDVKLEEICNSVRGGLLQHIKLLNDRHVCFVTFIDPTAAAQFYAMSSLH 452

Query: 496 PIVLHGSLLKVGWGHHSGNLPQSISLAVTIGASRNVYVSLPEYAFKDKFIKDPEYQAFRE 555
            + +H    K+GWG HSG LP  ++LAV+ GASRN+Y+   ++   D+ ++ P +     
Sbjct: 453 GLTIHNKRCKIGWGKHSGPLPNPLALAVSRGASRNIYLGNIDFE-DDRKLEQPIF----- 506

Query: 556 KFKLPSKQQLYDDFSTFGDIELINFLEDGHCCWINFMNISNAIKLVEDANNSNNESFHEK 615
                ++  L   F  FG++E INFL + +CC+INF NIS+AI  ++            K
Sbjct: 507 -----TETSLRSVFQEFGEVEQINFLYERNCCFINFANISSAILAIDKI----------K 551

Query: 616 FENRYRGLFIGYGKDRCG 633
               ++ L I +GKDRCG
Sbjct: 552 SIPTFKDLKINFGKDRCG 569

 Score = 87.0 bits (214), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 56/203 (27%), Positives = 106/203 (52%), Gaps = 22/203 (10%)

Query: 435 AGNRTVYIGNISPRSKTEDICNVVRGGILQSVKYIEAKHICFVTFIEAASAVQFFANSSI 494
           A +RTVY+GN+ P   T ++ + VR G+++ VK +  K   F++F++  SA+ F +++ +
Sbjct: 153 APSRTVYLGNVPPYITTRELLDHVRSGVVEDVKILPEKMCAFISFVDENSALLFHSDAIL 212

Query: 495 EPIVLHGSLLKVGWGHHSGNLPQSISLAVTIGASRNVYV----SLPEYAFKDKFIKDPEY 550
           + + +    +K+GWG  +   P   +     GA+RNVY+    + P+     ++  DP  
Sbjct: 213 KRLNIDDRDIKIGWGKPTQIDPIVAAGINNDGATRNVYLGKLNTNPKMC--AQWGADPNE 270

Query: 551 QAFREKFKLPSKQQLYDDFSTFGDIELINFLEDGHCCWINFMNISNAIKLVEDANNSNNE 610
           +   E       ++L +D + FG++E +  + +    +++F +I +AIK+V +  N N  
Sbjct: 271 ETITE-------EKLRNDLADFGEVESVKIVTEKGIAFVHFSSIFSAIKVVANLANVNPY 323

Query: 611 SFHEKFENRYRGLFIGYGKDRCG 633
              +K         I YGKDRC 
Sbjct: 324 YAQKK---------IFYGKDRCA 337

>KLLA0E19031g Chr5 (1694566..1696524) [1959 bp, 652 aa] {ON} similar
           to uniprot|Q08925 Saccharomyces cerevisiae YPL184C
           Hypothetical ORF
          Length = 652

 Score =  164 bits (415), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 83/198 (41%), Positives = 119/198 (60%), Gaps = 21/198 (10%)

Query: 436 GNRTVYIGNISPRSKTEDICNVVRGGILQSVKYIEAKHICFVTFIEAASAVQFFANSSIE 495
           GNRTVY+GN+    K E+ICN +RGG+LQ++K +  +H+CFVTFI+  +A QF+A SS+ 
Sbjct: 470 GNRTVYLGNLPKNVKLEEICNAIRGGLLQNIKLLNDRHVCFVTFIDPTAAAQFYAMSSLH 529

Query: 496 PIVLHGSLLKVGWGHHSGNLPQSISLAVTIGASRNVYVSLPEYAFKDKFIKDPEYQAFRE 555
            + +H    K+GWG HSG LP  I+LAV+ GASRN+Y+          F +D      ++
Sbjct: 530 GLTIHNKRCKIGWGKHSGPLPNPIALAVSRGASRNIYLG------NINFEEDA-----KQ 578

Query: 556 KFKLPSKQQLYDDFSTFGDIELINFLEDGHCCWINFMNISNAIKLVEDANNSNNESFHEK 615
           +  + ++  L   F  FG +E INFL + +CC+INF NISNAI  ++            K
Sbjct: 579 EESVFAEDTLRAIFEEFGTVEQINFLYEKNCCFINFANISNAILAIDKI----------K 628

Query: 616 FENRYRGLFIGYGKDRCG 633
               +  L I +GKDRCG
Sbjct: 629 SNPHFNNLKINFGKDRCG 646

 Score = 94.7 bits (234), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 69/207 (33%), Positives = 107/207 (51%), Gaps = 30/207 (14%)

Query: 435 AGNRTVYIGNISPRSKTEDICNVVRGGILQSVKYIEAKHICFVTFIEAASAVQFFANSSI 494
           A +RTVY+GNI      + + + VR G+++ VK +  K   FV+F++   A+ F +++ +
Sbjct: 230 APSRTVYLGNIPATITYKALLDYVRTGVVEEVKILSEKMCAFVSFVDENDALLFHSDAIL 289

Query: 495 EPIVLHGSLLKVGWGHHSGNLPQSISLAVTI-----GASRNVYVSLPEYAFKD---KFIK 546
           + + + G  +K+GWG      PQ I   V       GA+RNVY+       KD   K+  
Sbjct: 290 KRLNIDGRDIKIGWGK-----PQPIDPIVRAGIANDGATRNVYIGKLN-TNKDSCEKWGA 343

Query: 547 DPEYQAFREKFKLPSKQQLYDDFSTFGDIELINFLEDGHCCWINFMNISNAIKLVEDANN 606
           DP       K  L +K++LYDD S FG+IE I  +ED    +++F +I  AIK V     
Sbjct: 344 DP-------KEILVTKEKLYDDLSQFGEIESIKLVEDRGIAFVHFTSIFAAIKAV----- 391

Query: 607 SNNESFHEKFENRYRGLFIGYGKDRCG 633
           +N  S    + N+     + YGKDRC 
Sbjct: 392 ANIGSIDPYYSNKK----VFYGKDRCA 414

>KLTH0H04906g Chr8 complement(436720..438429) [1710 bp, 569 aa] {ON}
           similar to uniprot|Q08925 Saccharomyces cerevisiae
           YPL184C Hypothetical ORF
          Length = 569

 Score =  162 bits (411), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 82/199 (41%), Positives = 123/199 (61%), Gaps = 23/199 (11%)

Query: 436 GNRTVYIGNISPRSKTEDICNVVRGGILQSVKYIEAKHICFVTFIEAASAVQFFANSSIE 495
           GNRT+Y+GN+    K E+ICN VRGG+LQS+K +  +H+CFVTFI+  +A Q +A +S+ 
Sbjct: 386 GNRTIYLGNLPKDVKIEEICNAVRGGLLQSIKLLTDRHVCFVTFIDPTAAAQLYAMTSLH 445

Query: 496 PIVLHGSLLKVGWGHHSGNLPQSISLAVTIGASRNVYVSLPEYAFKDKFIKDPEYQAFRE 555
            + +H    K+GWG HSG L  +++LAV+ GASRN+Y+             + +++A  E
Sbjct: 446 GLTIHNKRCKIGWGKHSGALSNALALAVSHGASRNIYLG------------NIDFKADSE 493

Query: 556 K-FKLPSKQQLYDDFSTFGDIELINFLEDGHCCWINFMNISNAIKLVEDANNSNNESFHE 614
           +   + ++Q L   F  +G++E INFL +  CC++NF NISNAI L  D   SN +    
Sbjct: 494 RDVPVFTEQNLRKLFEEYGEVEQINFLPERSCCFVNFTNISNAI-LAIDKIKSNEQ---- 548

Query: 615 KFENRYRGLFIGYGKDRCG 633
                ++ L I +GKDRCG
Sbjct: 549 -----FKDLKINFGKDRCG 562

 Score = 88.6 bits (218), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 55/201 (27%), Positives = 105/201 (52%), Gaps = 18/201 (8%)

Query: 435 AGNRTVYIGNISPRSKTEDICNVVRGGILQSVKYIEAKHICFVTFIEAASAVQFFANSSI 494
           A +RTVY+GNI P  +  ++ + VR G+++ V+ +  K   F++F++ +SA+ F +++ +
Sbjct: 145 APSRTVYLGNIPPNLEVRELLDHVRSGVVEDVRILREKMCAFISFLDESSALLFHSDAIL 204

Query: 495 EPIVLHGSLLKVGWGHHSGNLPQSISLAVTIGASRNVYVSL--PEYAFKDKFIKDPEYQA 552
           + + + G  +KVGWG  +   P   +     GA+RNVY+     +     +F  DP    
Sbjct: 205 KRLNIGGRDIKVGWGKPTPIDPVVTAAVSNDGATRNVYIGRLNTDRDLAPQFGADP---- 260

Query: 553 FREKFKLPSKQQLYDDFSTFGDIELINFLEDGHCCWINFMNISNAIKLVEDANNSNNESF 612
              +  + ++++L  D   +G+IE +  + +    +++F +I +AIK+V      N    
Sbjct: 261 ---RDLIATEEKLRADLDFYGEIESVKIIVEKGIAFVHFSSIFSAIKVVSSLATVNPYYS 317

Query: 613 HEKFENRYRGLFIGYGKDRCG 633
           ++K         I YGKDRC 
Sbjct: 318 NKK---------IFYGKDRCA 329

>Kpol_1002.69 s1002 complement(185133..186905) [1773 bp, 590 aa]
           {ON} complement(185133..186905) [1773 nt, 591 aa]
          Length = 590

 Score =  162 bits (410), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 84/198 (42%), Positives = 117/198 (59%), Gaps = 21/198 (10%)

Query: 436 GNRTVYIGNISPRSKTEDICNVVRGGILQSVKYIEAKHICFVTFIEAASAVQFFANSSIE 495
           GNRTVY+GN+    K E+ICN VR G+LQSVK +  +H+CFVTFI+  +A QF+A SS+ 
Sbjct: 407 GNRTVYLGNLPKGIKIEEICNTVRSGLLQSVKLLSDRHVCFVTFIDPTAAAQFYAMSSLH 466

Query: 496 PIVLHGSLLKVGWGHHSGNLPQSISLAVTIGASRNVYVSLPEYAFKDKFIKDPEYQAFRE 555
            ++L     KVGWG HSG LP  I+LAV+ GASRNVY+   ++    K            
Sbjct: 467 GLILQRKRCKVGWGKHSGPLPNLIALAVSNGASRNVYIGNIDFEEDSK-----------R 515

Query: 556 KFKLPSKQQLYDDFSTFGDIELINFLEDGHCCWINFMNISNAIKLVEDANNSNNESFHEK 615
             ++ ++  L   F  +G++E INFL   +CC+IN+ NISNAI  ++            K
Sbjct: 516 NERVFTEDNLRKLFQEYGEVEQINFLPSKNCCFINYTNISNAISAIDKI----------K 565

Query: 616 FENRYRGLFIGYGKDRCG 633
               ++ L I +GKDRCG
Sbjct: 566 SNPYFKDLKINFGKDRCG 583

 Score = 92.4 bits (228), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 59/205 (28%), Positives = 108/205 (52%), Gaps = 26/205 (12%)

Query: 435 AGNRTVYIGNISPRSKTEDICNVVRGGILQSVKYIEAKHICFVTFIEAASAVQFFANSSI 494
           A +RTVY+GNI      +++ + VR G+++ VK +  K   F++F++ +SA+ F +++ +
Sbjct: 166 APSRTVYLGNIPTTLTVKELLDHVRSGVVEDVKILPEKMCAFISFVDDSSALLFHSDAIL 225

Query: 495 EPIVLHGSLLKVGWGHHSGNLPQSISLAVTIGASRNVYVSLPEYAFKDKFIKDPEYQAFR 554
           + + + G  +K+GWG  +   P   +   T GA+RNVY+         +   D E     
Sbjct: 226 KRLNIEGRDIKIGWGKPTKIDPIVANGITTDGATRNVYIG--------QLYTDAE---VA 274

Query: 555 EKFKLP------SKQQLYDDFSTFGDIELINFLEDGHCCWINFMNISNAIKLVEDANNSN 608
           E   +P      ++++L  D   +GDI+ +  +++    +I+F +I +AIK+V +   SN
Sbjct: 275 ESLNIPKESEIVTEERLIADLEIYGDIDSVKIVKEKGIAFIHFASILSAIKVVNNLAASN 334

Query: 609 NESFHEKFENRYRGLFIGYGKDRCG 633
                  ++NR     I YGKDRC 
Sbjct: 335 -----RYYQNRK----IFYGKDRCA 350

>TDEL0G01620 Chr7 complement(316768..318522) [1755 bp, 584 aa] {ON}
           Anc_6.183 YPL184C
          Length = 584

 Score =  162 bits (409), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 82/198 (41%), Positives = 121/198 (61%), Gaps = 21/198 (10%)

Query: 436 GNRTVYIGNISPRSKTEDICNVVRGGILQSVKYIEAKHICFVTFIEAASAVQFFANSSIE 495
           GNRTVY+GN+    K E+ICNVVRGGILQ++K +  +H+CFVTFI+  +A QF+A SS+ 
Sbjct: 401 GNRTVYLGNLPKDVKIEEICNVVRGGILQAIKVLSDRHVCFVTFIDPIAAAQFYAMSSLH 460

Query: 496 PIVLHGSLLKVGWGHHSGNLPQSISLAVTIGASRNVYVSLPEYAFKDKFIKDPEYQAFRE 555
            I +     +VGWG H G LP +I+LAV+ GASRNVY+   ++ ++D   ++P + A   
Sbjct: 461 GITIQKRRCRVGWGKHPGPLPNAIALAVSNGASRNVYIGNIDF-YEDSKRQEPIFTA--- 516

Query: 556 KFKLPSKQQLYDDFSTFGDIELINFLEDGHCCWINFMNISNAIKLVEDANNSNNESFHEK 615
                    L   F  +G++E +NFL + +C ++N+ NISNAI  ++            K
Sbjct: 517 -------DYLRKIFQEYGEVEQLNFLPEKNCAFVNYTNISNAISAIDKI----------K 559

Query: 616 FENRYRGLFIGYGKDRCG 633
               ++ L I +GKDRCG
Sbjct: 560 SNPLFKNLKINFGKDRCG 577

 Score = 94.4 bits (233), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 57/201 (28%), Positives = 106/201 (52%), Gaps = 18/201 (8%)

Query: 435 AGNRTVYIGNISPRSKTEDICNVVRGGILQSVKYIEAKHICFVTFIEAASAVQFFANSSI 494
           A  +TVY+GNI P     ++ + VR G+++ VK +  K   F+TF++ ++A+ F +++ +
Sbjct: 160 APRKTVYLGNIPPSLTVRELLDHVRSGVVEEVKILPEKTCAFLTFVDESAALLFHSDAIL 219

Query: 495 EPIVLHGSLLKVGWGHHSGNLPQSISLAVTIGASRNVYVSL--PEYAFKDKFIKDPEYQA 552
           + + + G  +K+GWG  +   P   +   + GA+RNVY+ L   +     +   DP  + 
Sbjct: 220 KRLHIDGRDIKIGWGKATPVDPLVTTAIASDGATRNVYIGLLNTDSDIALQVGADPNDEK 279

Query: 553 FREKFKLPSKQQLYDDFSTFGDIELINFLEDGHCCWINFMNISNAIKLVEDANNSNNESF 612
             E       ++L  D   FG+I+ +  +E+    +I+F +I +A+K+V     +N    
Sbjct: 280 ITE-------EKLRSDLGEFGEIDCVKIVEEKGIAFIHFASILSAVKVV-----ANLAGI 327

Query: 613 HEKFENRYRGLFIGYGKDRCG 633
           +  +EN+     I YGKDRC 
Sbjct: 328 NPYYENKK----IYYGKDRCA 344

>CAGL0C01419g Chr3 complement(153063..154982) [1920 bp, 639 aa] {ON}
           similar to uniprot|Q08925 Saccharomyces cerevisiae
           YPL184c
          Length = 639

 Score =  162 bits (411), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 85/198 (42%), Positives = 117/198 (59%), Gaps = 21/198 (10%)

Query: 436 GNRTVYIGNISPRSKTEDICNVVRGGILQSVKYIEAKHICFVTFIEAASAVQFFANSSIE 495
           GNRTVY+GN+    K E+ICN VRGG+LQS+K ++ +H+CFVTFI+  +A QF+A SS+ 
Sbjct: 456 GNRTVYLGNLPKGVKIEEICNAVRGGLLQSIKLLDDRHVCFVTFIDPTAAAQFYAMSSLY 515

Query: 496 PIVLHGSLLKVGWGHHSGNLPQSISLAVTIGASRNVYVSLPEYAFKDKFIKDPEYQAFRE 555
              +     KVGWG HSG LP +++LAV+ GASRNVY+   ++    K     E   F E
Sbjct: 516 GFTIQRQRCKVGWGKHSGPLPNALALAVSNGASRNVYLGNIDFEADSK----KEQPIFNE 571

Query: 556 KFKLPSKQQLYDDFSTFGDIELINFLEDGHCCWINFMNISNAIKLVEDANNSNNESFHEK 615
                    L   F  +G++E INFL +  CC+INF NI+NAI  ++            K
Sbjct: 572 T-------ALRAIFQEYGEVEQINFLVEKKCCFINFTNINNAIFAMDKI----------K 614

Query: 616 FENRYRGLFIGYGKDRCG 633
               ++ L I +GKDRCG
Sbjct: 615 SNPHFKSLKINFGKDRCG 632

 Score = 90.1 bits (222), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 56/199 (28%), Positives = 104/199 (52%), Gaps = 20/199 (10%)

Query: 435 AGNRTVYIGNISPRSKTEDICNVVRGGILQSVKYIEAKHICFVTFIEAASAVQFFANSSI 494
           A +RTVY+GNI P    +++ + VR G+++  K +  K   F++F+E +SA+ F +++ +
Sbjct: 221 APSRTVYLGNIPPSLTIKELLDHVRSGVVEEAKILPEKMCAFISFVEESSALLFHSDAIL 280

Query: 495 EPIVLHGSLLKVGWGHHSGNLPQSISLAVTIGASRNVYVSLPEYAFKDKFIKDPEYQAFR 554
           + + +    +KVGWG  +   P   S  +  GA+RNVY+         K  K+P      
Sbjct: 281 KRLNIDNRDIKVGWGKPTVLDPSIASRIINDGATRNVYIGQGNNDRSSKENKEPL----- 335

Query: 555 EKFKLPSKQQLYDDFSTFGDIELINFLEDGHCCWINFMNISNAIKLVEDANNSNNESFHE 614
                 ++++L +D   +G+I+ I  + +    +++F +I+ AIK+V      N   F++
Sbjct: 336 ------TEEKLREDLKEYGEIDSIKIIPEKDIAFVHFSSIATAIKVVSTLAQKN--PFYQ 387

Query: 615 KFENRYRGLFIGYGKDRCG 633
           + +       I YGKDRC 
Sbjct: 388 EKK-------IFYGKDRCA 399

 Score = 33.1 bits (74), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 41/192 (21%), Positives = 85/192 (44%), Gaps = 45/192 (23%)

Query: 83  TRSLYFSNLNPDVRLHEFLATFHKFDRIESVYV----VDREQQSVLVSFLTKETCLDFY- 137
           +R++Y  N+ P + + E L      D + S  V    +  E+    +SF+ + + L F+ 
Sbjct: 223 SRTVYLGNIPPSLTIKELL------DHVRSGVVEEAKILPEKMCAFISFVEESSALLFHS 276

Query: 138 NGILQKLSEFKKELRSKELSLSFASPQKVESGPTLQEIKFEVLRAGATRSLGL------- 190
           + IL++L+     + ++++ + +  P  ++       I   ++  GATR++ +       
Sbjct: 277 DAILKRLN-----IDNRDIKVGWGKPTVLDPS-----IASRIINDGATRNVYIGQGNNDR 326

Query: 191 ---EFKDEIDFASLLKKFDFFDNSGPRYVIESIETVNTDKPSKYFGSNYAIVHFISIAMA 247
              E K+ +    L +    +        I+SI+ +    P K    + A VHF SIA A
Sbjct: 327 SSKENKEPLTEEKLREDLKEYGE------IDSIKII----PEK----DIAFVHFSSIATA 372

Query: 248 VETMEYLKVQTP 259
           ++ +  L  + P
Sbjct: 373 IKVVSTLAQKNP 384

>ZYRO0G08140g Chr7 (663951..665849) [1899 bp, 632 aa] {ON} similar
           to uniprot|Q08925 Saccharomyces cerevisiae YPL184C
           Hypothetical ORF
          Length = 632

 Score =  160 bits (404), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 83/198 (41%), Positives = 122/198 (61%), Gaps = 21/198 (10%)

Query: 436 GNRTVYIGNISPRSKTEDICNVVRGGILQSVKYIEAKHICFVTFIEAASAVQFFANSSIE 495
           GNRTVY+GN+    K E+ICNVVRGG+LQ+VK +  +H+CFVTFI+  +A QF+A SS+ 
Sbjct: 449 GNRTVYLGNLPKDVKVEEICNVVRGGLLQNVKVLSDRHVCFVTFIDPTAAAQFYAMSSLH 508

Query: 496 PIVLHGSLLKVGWGHHSGNLPQSISLAVTIGASRNVYVSLPEYAFKDKFIKDPEYQAFRE 555
            I +     +VGWG H G+L  +++LAV+ GASRNVYV    +  +D   +DP +     
Sbjct: 509 GITIQKRRCRVGWGKHPGSLENALALAVSNGASRNVYVGNINFD-EDSKREDPIF----- 562

Query: 556 KFKLPSKQQLYDDFSTFGDIELINFLEDGHCCWINFMNISNAIKLVEDANNSNNESFHEK 615
                ++  L   F  +G++E IN+L + +CC++N+ NISNAI  ++          H  
Sbjct: 563 -----TESSLRSIFQQWGEVEQINYLPERNCCFVNYTNISNAILAIDKIKG------HPV 611

Query: 616 FENRYRGLFIGYGKDRCG 633
           F++    L I +GKDRCG
Sbjct: 612 FKD----LKINFGKDRCG 625

 Score = 85.1 bits (209), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 55/203 (27%), Positives = 102/203 (50%), Gaps = 21/203 (10%)

Query: 435 AGNRTVYIGNISPRSKTEDICNVVRGGILQSVKYIEAKHICFVTFIEAASAVQFFANSSI 494
           A ++TVY+GN       +++ + VR G+++ V+ +  K   FV+F++ ++A+ F +++ +
Sbjct: 207 APSKTVYLGNTPITLTVKELLDHVRSGVVEDVRILPDKMCAFVSFVDESAALLFHSDAIL 266

Query: 495 EPIVLHGSLLKVGWGHHSGNLPQSISLAVTIGASRNVYV----SLPEYAFKDKFIKDPEY 550
           + + + G  +K+GWG  +   P   +      A+RNVY+    + P+ + +   +   E 
Sbjct: 267 KRLHIDGRDIKIGWGKPTPIDPVVATAVANDNATRNVYIGQLNTGPKLSSQVSPVDVTEP 326

Query: 551 QAFREKFKLPSKQQLYDDFSTFGDIELINFLEDGHCCWINFMNISNAIKLVEDANNSNNE 610
               +K +L        D   FG+I+ I  +E+    +++F +I NAIK V +  N N  
Sbjct: 327 VITEDKLRL--------DLQEFGEIDCIKIVEEKGIAFVHFASILNAIKAVANLANIN-- 376

Query: 611 SFHEKFENRYRGLFIGYGKDRCG 633
                    YR   I YGKDRC 
Sbjct: 377 -------PYYRNKKIFYGKDRCA 392

>YPL184C Chr16 complement(195950..197788) [1839 bp, 612 aa] {ON}
           MRN1RNA-binding protein proposed to be involved in
           translational regulation; binds specific categories of
           mRNAs, including those that contain upstream open
           reading frames (uORFs) and internal ribosome entry sites
           (IRES)
          Length = 612

 Score =  159 bits (403), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 86/198 (43%), Positives = 123/198 (62%), Gaps = 21/198 (10%)

Query: 436 GNRTVYIGNISPRSKTEDICNVVRGGILQSVKYIEAKHICFVTFIEAASAVQFFANSSIE 495
           GNRTVY+G++    K E+ICN VRGG+LQS+K +  +++CFVTFI+  +A QF+A SS+ 
Sbjct: 429 GNRTVYLGSLPKDVKIEEICNAVRGGLLQSIKLLNDRYVCFVTFIDPTAAAQFYAMSSLY 488

Query: 496 PIVLHGSLLKVGWGHHSGNLPQSISLAVTIGASRNVYVSLPEYAFKDKFIKDPEYQAFRE 555
              +     KVGWG HSG LP +++LAV+ GASRNVYV          F+ D    + R+
Sbjct: 489 GFTVQKKRCKVGWGKHSGPLPNALALAVSNGASRNVYVG------NIDFVGD----SLRD 538

Query: 556 KFKLPSKQQLYDDFSTFGDIELINFLEDGHCCWINFMNISNAIKLVEDANNSNNESFHEK 615
           + ++ ++  L   F  +G++E INFL + +CC+IN+ NISNAI L  D   SN       
Sbjct: 539 E-RVFTESNLRHIFQQYGEVEQINFLPEKNCCFINYTNISNAI-LALDKIKSN------- 589

Query: 616 FENRYRGLFIGYGKDRCG 633
               ++ L I +GKDRCG
Sbjct: 590 --PYFKDLKINFGKDRCG 605

 Score = 89.7 bits (221), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 57/199 (28%), Positives = 102/199 (51%), Gaps = 24/199 (12%)

Query: 435 AGNRTVYIGNISPRSKTEDICNVVRGGILQSVKYIEAKHICFVTFIEAASAVQFFANSSI 494
           A +RTVY+GN+ P    +++ + VR G+++ VK I  K   FV+FI+ ++A+ F +++ +
Sbjct: 198 APSRTVYLGNVPPNLSVKELLDHVRSGVVEDVKIIPEKMCAFVSFIDESAALLFHSDAIL 257

Query: 495 EPIVLHGSLLKVGWGHHSGNLPQSISLAVTIGASRNVYVSLPEYAFKDKFIKDPEYQAFR 554
           + + +    +K+GWG  +   P   +   T GA+RNVY+       ++  +         
Sbjct: 258 KRLNIGDRDIKIGWGKPTRIDPIVAARISTDGATRNVYIGRMTIEGEESHL--------- 308

Query: 555 EKFKLPSKQQLYDDFSTFGDIELINFLEDGHCCWINFMNISNAIKLVEDANNSNNESFHE 614
                 S++QL  D   +G+I+ I  +++    +I+F +I NAIK+V +    N      
Sbjct: 309 ------SEEQLRVDLEEYGEIDCIKIIKEKGIAFIHFASILNAIKVVTNLPIRN------ 356

Query: 615 KFENRYRGLFIGYGKDRCG 633
                Y+   I YGKDRC 
Sbjct: 357 ---PYYQNKRIFYGKDRCA 372

>KNAG0M00430 Chr13 complement(63427..64758) [1332 bp, 443 aa] {ON}
           Anc_6.183 YPL184C
          Length = 443

 Score =  156 bits (394), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 78/198 (39%), Positives = 118/198 (59%), Gaps = 23/198 (11%)

Query: 436 GNRTVYIGNISPRSKTEDICNVVRGGILQSVKYIEAKHICFVTFIEAASAVQFFANSSIE 495
           GNRT+Y+GN+S R + E++CNVVRGG+LQSVK++  +H+CFVTF +  +A QF+A +S+ 
Sbjct: 263 GNRTIYVGNLSARCRIEEVCNVVRGGLLQSVKFLPDRHVCFVTFADPTAAAQFYAMASLH 322

Query: 496 PIVLHGSLLKVGWGHHSGNLPQSISLAVTIGASRNVYVSLPEYAFKDKFIKDPEYQAFRE 555
            + +     K+GWG HSG LP  ++ A++ GASRNVY       F +   +DP    F E
Sbjct: 323 GLTIQRRRCKIGWGKHSGPLPAHLADAISHGASRNVY-------FGNVNWQDPAVAEFFE 375

Query: 556 KFKLPSKQQLYDDFSTFGDIELINFLEDGHCCWINFMNISNAIKLVEDANNSNNESFHEK 615
                 ++ L    S FG++E +N + +  C ++NF N+ +AI  VE            K
Sbjct: 376 ------ERHLRQAMSHFGEMEQVNAVPERRCVFVNFTNLESAIAAVEQV----------K 419

Query: 616 FENRYRGLFIGYGKDRCG 633
              +++ L + YGKDRCG
Sbjct: 420 KWPQFQQLKVNYGKDRCG 437

 Score = 73.6 bits (179), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 49/200 (24%), Positives = 92/200 (46%), Gaps = 31/200 (15%)

Query: 435 AGNRTVYIGNISPRSKTEDICNVVRGGILQSVKYIEAKHICFVTFIEAASAVQFFANSSI 494
           A +RTVY+GNI+P     ++ + V+ G+++  +   AK   FV+F++  SA+ F +++ +
Sbjct: 36  APSRTVYLGNIAPEVTLRELLDHVQSGVVEDARLFPAKSCAFVSFVDENSALLFHSDAIL 95

Query: 495 EPIVLHGSLLKVGWGHHSGNLPQSISLAVTIGASRNVYV-SLPEYAFKDKFIKDPEYQAF 553
             + +    +K+GW   +   P   +   + GA+RNVY+ +LP+                
Sbjct: 96  NRLRIGDRDVKIGWATATLMDPLVATRIQSEGATRNVYLGNLPDGV-------------- 141

Query: 554 REKFKLPSKQQLYDDFSTFGDIELINFLEDGHCCWINFMNISNAIKLVEDANNSNNESFH 613
                  S+ +L  D S +G+I+ +  L      +++  +I  AI  V +    N     
Sbjct: 142 -------SRYELTKDLSVYGEIDSVKLLSSKGVAFVHMASIGQAIHAVANLQRDNKI--- 191

Query: 614 EKFENRYRGLFIGYGKDRCG 633
                 Y    + +GKDRC 
Sbjct: 192 ------YSDRRVSFGKDRCA 205

>Smik_6.390 Chr6 (626853..628730) [1878 bp, 625 aa] {ON} YPL184C
           (REAL)
          Length = 625

 Score =  159 bits (403), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 85/198 (42%), Positives = 123/198 (62%), Gaps = 21/198 (10%)

Query: 436 GNRTVYIGNISPRSKTEDICNVVRGGILQSVKYIEAKHICFVTFIEAASAVQFFANSSIE 495
           GNRTVY+G++    K E+ICN VRGG+LQS+K +  +++CFVTFI+  +A QF+A SS+ 
Sbjct: 442 GNRTVYLGSLPKDVKIEEICNAVRGGLLQSIKLLNDRYVCFVTFIDPTAAAQFYAMSSLY 501

Query: 496 PIVLHGSLLKVGWGHHSGNLPQSISLAVTIGASRNVYVSLPEYAFKDKFIKDPEYQAFRE 555
              +     KVGWG HSG LP +++LAV+ GASRNVYV          F+ D    + R+
Sbjct: 502 GFTVQKKRCKVGWGKHSGPLPNALALAVSNGASRNVYVG------NIDFVSD----SLRD 551

Query: 556 KFKLPSKQQLYDDFSTFGDIELINFLEDGHCCWINFMNISNAIKLVEDANNSNNESFHEK 615
           + ++ ++  L   F  +G++E INFL + +CC++N+ NISNAI L  D   SN       
Sbjct: 552 E-RIFTESNLRHVFQQYGEVEQINFLPEKNCCFVNYTNISNAI-LALDKIKSN------- 602

Query: 616 FENRYRGLFIGYGKDRCG 633
               ++ L I +GKDRCG
Sbjct: 603 --PYFKDLKINFGKDRCG 618

 Score = 89.4 bits (220), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 57/199 (28%), Positives = 102/199 (51%), Gaps = 24/199 (12%)

Query: 435 AGNRTVYIGNISPRSKTEDICNVVRGGILQSVKYIEAKHICFVTFIEAASAVQFFANSSI 494
           A +RTVY+GN+ P    +++ + VR G+++ VK I  K   F++F++ ++A+ F +++ +
Sbjct: 211 APSRTVYLGNVPPNLSVKELLDHVRSGVVEDVKIISEKMCAFISFVDESAALLFHSDAIL 270

Query: 495 EPIVLHGSLLKVGWGHHSGNLPQSISLAVTIGASRNVYVSLPEYAFKDKFIKDPEYQAFR 554
           + + +    +K+GWG  +   P   +   T GA+RNVY+         +   D E     
Sbjct: 271 KRLNIGDRDIKIGWGKPTRIDPIVAARISTDGATRNVYIG--------RMTIDGEESHL- 321

Query: 555 EKFKLPSKQQLYDDFSTFGDIELINFLEDGHCCWINFMNISNAIKLVEDANNSNNESFHE 614
                 S++QL  D   +G+I+ I  +++    +I+F +I NAIK+V +    N      
Sbjct: 322 ------SEEQLRIDLKEYGEIDCIKVIKEKGIAFIHFASILNAIKVVTNLPIRN------ 369

Query: 615 KFENRYRGLFIGYGKDRCG 633
                Y+   I YGKDRC 
Sbjct: 370 ---PYYQNKRIFYGKDRCA 385

>TPHA0J02210 Chr10 (494346..496127) [1782 bp, 593 aa] {ON} Anc_6.183
           YPL184C
          Length = 593

 Score =  159 bits (402), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 85/198 (42%), Positives = 118/198 (59%), Gaps = 21/198 (10%)

Query: 436 GNRTVYIGNISPRSKTEDICNVVRGGILQSVKYIEAKHICFVTFIEAASAVQFFANSSIE 495
           GNRTVY+GN+    + EDICN +R G+LQ++K +  +H+CFVTFI+  SA QF+A SSI 
Sbjct: 413 GNRTVYLGNLPNDIRIEDICNTIRCGLLQNIKLLSDRHVCFVTFIDPVSAAQFYAMSSIY 472

Query: 496 PIVLHGSLLKVGWGHHSGNLPQSISLAVTIGASRNVYVSLPEYAFKDKFIKDPEYQAFRE 555
             VL     KVGWG HSG L   ++LAV+ GASRNVY+   ++               RE
Sbjct: 473 GFVLQKKRCKVGWGKHSGPLSNPLTLAVSNGASRNVYIGNIDFTAD---------GTKRE 523

Query: 556 KFKLPSKQQLYDDFSTFGDIELINFLEDGHCCWINFMNISNAIKLVEDANNSNNESFHEK 615
           ++   S   L   FS +G++E INFL   +CC++N+ NI+NAI  ++     NN +F   
Sbjct: 524 RYFTDS--NLRRIFSEYGEVEQINFLYSKNCCFVNYTNINNAISAIDKI--KNNPTF--- 576

Query: 616 FENRYRGLFIGYGKDRCG 633
                + L I +GKDRCG
Sbjct: 577 -----KNLKINFGKDRCG 589

 Score = 93.6 bits (231), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 59/202 (29%), Positives = 110/202 (54%), Gaps = 13/202 (6%)

Query: 435 AGNRTVYIGNISPRSKTEDICNVVRGGILQSVKYIEAKHICFVTFIEAASAVQFFANSSI 494
           A +RTVY+GNI P     D+ + VR G+++ VK +  K   F++F++  S++ F +++ +
Sbjct: 165 APSRTVYLGNIPPTLTASDLLDHVRSGVIEEVKILPEKMCAFISFLDENSSLLFHSDAIL 224

Query: 495 EPIVLHGSLLKVGWGHHSGNLPQSISLAVTIGASRNVYVSLPEYAFKDKFIKDPE---YQ 551
           + + + G  +K+GWG  S   P   +   T GA+RN+++        +K  KD +   Y 
Sbjct: 225 KRLNIDGKDIKIGWGKPSPLSPIIATSVATDGATRNIFIGQLNTTDHNK-QKDNDATIYH 283

Query: 552 AFREKFKLPSKQQLYDDFSTFGDIELINFLEDGHCCWINFMNISNAIKLVEDANNSNNES 611
              +   + ++++L  D   +GDI+ I   ++    +++F +I +AIK+V + +NSN   
Sbjct: 284 GSDDFEDIMTEEKLRKDLEEYGDIDCIKIFKEKGFAFVHFTSILSAIKVVNNLSNSN--P 341

Query: 612 FHEKFENRYRGLFIGYGKDRCG 633
           ++ K +       I YGKDRC 
Sbjct: 342 YYSKKK-------IYYGKDRCA 356

>Skud_16.94 Chr16 complement(169165..171009) [1845 bp, 614 aa] {ON}
           YPL184C (REAL)
          Length = 614

 Score =  159 bits (402), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 86/198 (43%), Positives = 125/198 (63%), Gaps = 21/198 (10%)

Query: 436 GNRTVYIGNISPRSKTEDICNVVRGGILQSVKYIEAKHICFVTFIEAASAVQFFANSSIE 495
           GNRTVY+G++    K E+ICN VRGG+LQS+K +  +++CFVTFI+  +A QF+A SS+ 
Sbjct: 431 GNRTVYLGSLPKDVKIEEICNAVRGGLLQSIKLLNDRYVCFVTFIDPTAAAQFYAMSSLY 490

Query: 496 PIVLHGSLLKVGWGHHSGNLPQSISLAVTIGASRNVYVSLPEYAFKDKFIKDPEYQAFRE 555
              +     KVGWG HSG LP +++LAV+ GASRNVYV   +Y      + D    + R+
Sbjct: 491 GFTVQKKRCKVGWGKHSGPLPNALALAVSNGASRNVYVGNIDY------VSD----SVRD 540

Query: 556 KFKLPSKQQLYDDFSTFGDIELINFLEDGHCCWINFMNISNAIKLVEDANNSNNESFHEK 615
           + ++ ++ +L   F  +G++E INFL + +CC+IN+ NISNAI L  D   SN       
Sbjct: 541 E-RIFTEGKLRGIFQQYGEVEQINFLPEKNCCFINYTNISNAI-LALDKIKSN------- 591

Query: 616 FENRYRGLFIGYGKDRCG 633
               ++ L I +GKDRCG
Sbjct: 592 --PYFKDLKINFGKDRCG 607

 Score = 87.4 bits (215), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 55/199 (27%), Positives = 101/199 (50%), Gaps = 24/199 (12%)

Query: 435 AGNRTVYIGNISPRSKTEDICNVVRGGILQSVKYIEAKHICFVTFIEAASAVQFFANSSI 494
           A +RTVY+GN+ P    +++ + VR G+++ VK I  K   F++F++ ++A+ F +++ +
Sbjct: 200 AQSRTVYLGNVPPNLSVKELLDHVRSGVVEDVKIIPEKMCAFISFVDESAALLFHSDAIL 259

Query: 495 EPIVLHGSLLKVGWGHHSGNLPQSISLAVTIGASRNVYVSLPEYAFKDKFIKDPEYQAFR 554
           + + +    +K+GWG  +   P   +   T GA+RNVY+       ++  +         
Sbjct: 260 KRLNIGDRDIKIGWGKPTRIDPIVAARISTDGATRNVYIGRMTIEGEESHL--------- 310

Query: 555 EKFKLPSKQQLYDDFSTFGDIELINFLEDGHCCWINFMNISNAIKLVEDANNSNNESFHE 614
                 S +QL  D   +G+I+ I  +++    +I+F +I NAIK+V +    N      
Sbjct: 311 ------SGEQLRADLEEYGEIDCIKIIKEKGVAFIHFASILNAIKVVTNLPIRN------ 358

Query: 615 KFENRYRGLFIGYGKDRCG 633
                Y+   I YGKDRC 
Sbjct: 359 ---LYYQNKRIFYGKDRCA 374

>Suva_16.123 Chr16 complement(205700..207490) [1791 bp, 596 aa] {ON}
           YPL184C (REAL)
          Length = 596

 Score =  158 bits (400), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 85/198 (42%), Positives = 121/198 (61%), Gaps = 21/198 (10%)

Query: 436 GNRTVYIGNISPRSKTEDICNVVRGGILQSVKYIEAKHICFVTFIEAASAVQFFANSSIE 495
           GNRTVY+G++    K E+ICN VRGG+LQS+K +  +++CFVTFI+  +A QF+A SS+ 
Sbjct: 413 GNRTVYLGSLPKDVKIEEICNAVRGGLLQSIKLLNDRYVCFVTFIDPTAAAQFYAMSSLY 472

Query: 496 PIVLHGSLLKVGWGHHSGNLPQSISLAVTIGASRNVYVSLPEYAFKDKFIKDPEYQAFRE 555
              +     KVGWG HSG LP +++LAV+ GASRNVYV   ++A  D    +        
Sbjct: 473 GFTVQKKRCKVGWGKHSGPLPNALALAVSNGASRNVYVGNIDFA-SDSLNDE-------- 523

Query: 556 KFKLPSKQQLYDDFSTFGDIELINFLEDGHCCWINFMNISNAIKLVEDANNSNNESFHEK 615
             ++ ++  L   F  +G++E INFL + +CC+IN+ NISNAI L  D   SN       
Sbjct: 524 --RIFTENNLRSIFQQYGEVEQINFLPEKNCCFINYTNISNAI-LALDKIKSN------- 573

Query: 616 FENRYRGLFIGYGKDRCG 633
               ++ L I +GKDRCG
Sbjct: 574 --PYFKDLKINFGKDRCG 589

 Score = 89.4 bits (220), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 55/199 (27%), Positives = 101/199 (50%), Gaps = 24/199 (12%)

Query: 435 AGNRTVYIGNISPRSKTEDICNVVRGGILQSVKYIEAKHICFVTFIEAASAVQFFANSSI 494
           A  RTVY+GN+ P    +++ + VR G+++ VK I  K   F++F++ ++A+ F +++ +
Sbjct: 182 APTRTVYLGNVPPHLTVKELLDHVRSGVVEDVKIIPEKMCAFISFVDESAALLFHSDAIL 241

Query: 495 EPIVLHGSLLKVGWGHHSGNLPQSISLAVTIGASRNVYVSLPEYAFKDKFIKDPEYQAFR 554
           + + +    +K+GWG  +   P   +   T GA+RNVY+       ++  +         
Sbjct: 242 KRLNIGDRDIKIGWGKPTRIDPIVAARITTDGATRNVYIGRMTVEGEESHL--------- 292

Query: 555 EKFKLPSKQQLYDDFSTFGDIELINFLEDGHCCWINFMNISNAIKLVEDANNSNNESFHE 614
                 S++QL  D   +G+I+ I  +++    +I+F +I NAIK+V +    N      
Sbjct: 293 ------SEEQLRADLQEYGEIDCIKIIKEKGIAFIHFASILNAIKVVTNLPIRN------ 340

Query: 615 KFENRYRGLFIGYGKDRCG 633
                Y+   I YGKDRC 
Sbjct: 341 ---PYYQNKRIFYGKDRCA 356

>KAFR0B06690 Chr2 (1394829..1396430) [1602 bp, 533 aa] {ON}
           Anc_6.183 YPL184C
          Length = 533

 Score =  153 bits (386), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 76/198 (38%), Positives = 121/198 (61%), Gaps = 25/198 (12%)

Query: 436 GNRTVYIGNISPRSKTEDICNVVRGGILQSVKYIEAKHICFVTFIEAASAVQFFANSSIE 495
           GNRT+Y+GN+    K E+ICNVVRGG+LQ++K +  +  CF+TFI+  +A QF+A SS+ 
Sbjct: 354 GNRTIYLGNLPKGVKIEEICNVVRGGLLQNIKLLSDRFACFITFIDPTAAAQFYAMSSLH 413

Query: 496 PIVLHGSLLKVGWGHHSGNLPQSISLAVTIGASRNVYVSLPEYAFKDKFIKDPEYQAFRE 555
            + +  +  KVGWG HSG L  +++LA++ GASRN+Y+   ++  K+++           
Sbjct: 414 GLTIQKNRCKVGWGKHSGPLSNALALAISNGASRNIYIGNVDFEKKNEYF---------- 463

Query: 556 KFKLPSKQQLYDDFSTFGDIELINFLEDGHCCWINFMNISNAIKLVEDANNSNNESFHEK 615
                +++ L + F  FG++E INFL +  CC++NF NI++AI  ++       +S  E 
Sbjct: 464 -----NEEHLREIFEEFGEVEQINFLREKGCCFVNFTNINHAILALDKI-----KSLPE- 512

Query: 616 FENRYRGLFIGYGKDRCG 633
               +  L I +GKDRCG
Sbjct: 513 ----FEDLKINFGKDRCG 526

 Score = 93.6 bits (231), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 61/200 (30%), Positives = 110/200 (55%), Gaps = 28/200 (14%)

Query: 435 AGNRTVYIGNISPRSKTEDICNVVRGGILQSVKYIEAKHICFVTFIEAASAVQFFANSSI 494
           A +RTVY+GNI      +++ + VR G+++SVK +  K   F++FI+   A+ F +++ +
Sbjct: 125 APSRTVYLGNIPQGLTIKELLDHVRSGVVESVKILPTKLCAFISFIDERGALLFHSDAIL 184

Query: 495 EPIVLHGSLLKVGWGHHSGNLPQSISLAVT-IGASRNVYVSLPEYAFKDKFIKDPEYQAF 553
           + + + G  +K+GWG  S ++   ++  +T  GA+RNVY+         +   DP     
Sbjct: 185 KRLNIRGKDIKIGWG-KSNHIDSIVAARITNDGATRNVYIG--------QLNDDP----- 230

Query: 554 REKFKLPSKQQLYDDFSTFGDIELINFLEDGHCCWINFMNISNAIKLVEDANNSNNESFH 613
                + ++Q+L  D   FG+I+ I FL +    +++F +IS AI +V++ +  N     
Sbjct: 231 ----TITTEQELEKDMQKFGEIDCIKFLSNKGIAFVHFASISVAIYVVQNLSKLN----- 281

Query: 614 EKFENRYRGLFIGYGKDRCG 633
           EK++N+     I YGKDRC 
Sbjct: 282 EKYKNKR----IFYGKDRCA 297

>KNAG0A02400 Chr1 complement(236366..237271) [906 bp, 301 aa] {ON}
           Anc_8.466 YDL209C
          Length = 301

 Score = 38.9 bits (89), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 34/107 (31%), Positives = 46/107 (42%), Gaps = 33/107 (30%)

Query: 433 GGAG-----NRTVYIGNISP------------RSKTEDICNVVRGGILQSVKYIEAKHIC 475
           GG G     NRT+YIG I+              S+   + N +  G L  ++Y+EAK+  
Sbjct: 126 GGVGSFNNANRTLYIGGIAGALNDKPLKPLQIESRLRYLFNKL--GALDRIRYVEAKNCA 183

Query: 476 FVTFIEAASAVQFFANSSIE------------PIVLHGSLLKVGWGH 510
           FVTF   A+A   FA  ++             P  L GS L V W H
Sbjct: 184 FVTFKSTANAE--FAKEAMTNQTLLVPTDKEYPQRLEGSGLLVKWSH 228

>ZYRO0F07238g Chr6 complement(586327..587496) [1170 bp, 389 aa] {ON}
           similar to uniprot|Q96US5 Saccharomyces cerevisiae
           YOR242C SSP2 Sporulation SPecific involved in
           sporulation
          Length = 389

 Score = 38.5 bits (88), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 48/209 (22%), Positives = 86/209 (41%), Gaps = 27/209 (12%)

Query: 438 RTVYIGNISPRSKTEDICNVVRGGIL----------QSVKYIEAKHICFVTFIEAASAVQ 487
           + + +GNI  R+    I   +  G L          Q++K IE      + F+   +A  
Sbjct: 183 KAIVLGNIPKRTGIASILAQIHAGPLENIIVHTDDEQALKKIE------LDFLTHEAAYS 236

Query: 488 FFANSSIEPIVLHGSLLKVGWGHHSGNLPQSISLAVTIGASRNVYVSLPEYAFKDKFIKD 547
           F          ++G  L   WG  S +  +  +      +S +          K K+I  
Sbjct: 237 FMKYGRTNMFKINGQHLTPEWGKSSEHKTKKGNEWDDQQSSSDDQDFCRSLIMK-KYINC 295

Query: 548 PEYQAFREKFKLPSKQ-----QLYDDFSTFGDI-ELINFLEDGHCCWINFMNISNAIKLV 601
            +   + E +K    +     ++  DF TFG+I E+   +    C  INF N+ +A+K +
Sbjct: 296 TKRTKYSEAYKESPLEPLNLSEIKQDFGTFGEILEITPVVSRKLCISINFFNMESAMKAM 355

Query: 602 EDANNSNNESFHEKFENRYRGLFIGYGKD 630
           ++  N N++  H+ + N +    I YGKD
Sbjct: 356 KEYENPNSD-LHKAYFNNWA---IWYGKD 380

>KAFR0A03830 Chr1 complement(779143..780267) [1125 bp, 374 aa] {ON}
           Anc_8.670 YOR242C
          Length = 374

 Score = 38.5 bits (88), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 36/67 (53%), Gaps = 5/67 (7%)

Query: 565 LYDDFSTFGDI-ELINFLEDGHCCWINFMNISNAIKLVEDANNSNNESFHEKFENRYRGL 623
           + +DF  FG I E+   +    C  +N+ NI +A+K +E   + N+E  H K+   Y+  
Sbjct: 303 IVEDFGQFGRIQEVTPIISRKLCVAVNYYNILSALKAIESYEDPNSE-LHRKY---YKSW 358

Query: 624 FIGYGKD 630
            I +GKD
Sbjct: 359 AIWFGKD 365

>ACR135C Chr3 complement(585997..587127) [1131 bp, 376 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR242C
           (SSP2)
          Length = 376

 Score = 37.4 bits (85), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 24/69 (34%), Positives = 38/69 (55%), Gaps = 5/69 (7%)

Query: 563 QQLYDDFSTFGDIELIN-FLEDGHCCWINFMNISNAIKLVEDANNSNNESFHEKFENRYR 621
           Q+L  DFS FG+I  I+  +    C  INF +I +A+  ++   N+N+   + K+   + 
Sbjct: 303 QELKKDFSQFGNILDISPMISRKLCVQINFYDIKSAMDALQSYKNANS-PLNRKYAESWT 361

Query: 622 GLFIGYGKD 630
              IGYGKD
Sbjct: 362 ---IGYGKD 367

>KLTH0F02838g Chr6 complement(245748..246740) [993 bp, 330 aa] {ON}
           conserved hypothetical protein
          Length = 330

 Score = 35.8 bits (81), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 36/113 (31%), Positives = 53/113 (46%), Gaps = 21/113 (18%)

Query: 33  LRMPPSDAIRGSRRHNKEKHLYDEGT--RQIPYK-LTFNILPRNGNGD----GDKFRTRS 85
           +R+PP      + R N+E  L ++    R++  K LT  IL     GD    G K   R 
Sbjct: 198 VRLPP----HLTNRPNQESGLDEQKKIEREMRSKELTLEIL-----GDIPYVGIKPSERV 248

Query: 86  LYFSNLNPDVRLHEFLATFHKFDRIESVYVV-DREQQSVL----VSFLTKETC 133
           L+   LNP  R  +    FH+F  I+ + +V D+E  S L    + F  KE+C
Sbjct: 249 LFVCRLNPITRAKDLATIFHRFGEIDVIEIVRDKETGSSLGYGFIEFTKKESC 301

>KAFR0D02600 Chr4 complement(514523..515369,515443..515462) [867 bp,
           288 aa] {ON} Anc_3.379 YBR119W
          Length = 288

 Score = 33.1 bits (74), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 14/53 (26%), Positives = 30/53 (56%), Gaps = 2/53 (3%)

Query: 437 NRTVYIGNISPRSKTEDICNVVRGGILQSVKYIEAKHICFVTF--IEAASAVQ 487
           N+ + + N+    K ED+ N+ +   L  V+ +  +H+ FV +  +E +SA++
Sbjct: 216 NKVLLVQNLPANVKQEDVINLFQNAGLVEVRLVSPRHLAFVEYKTVEDSSAIK 268

>TPHA0L01200 Chr12 (250506..251474) [969 bp, 322 aa] {ON} Anc_8.466
           YDL209C
          Length = 322

 Score = 32.7 bits (73), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 34/68 (50%), Gaps = 15/68 (22%)

Query: 433 GGAG-----NRTVYIGNISPRSKTEDI----------CNVVRGGILQSVKYIEAKHICFV 477
           GG G     NRT+YIG ++     E+               R G +++++YIEAK+  FV
Sbjct: 123 GGVGSFRKRNRTLYIGGLTGALNNENFKPSQIEGRLRFAFSRLGEIETIRYIEAKNCAFV 182

Query: 478 TFIEAASA 485
           T+   A+A
Sbjct: 183 TYRFQANA 190

>NDAI0C03820 Chr3 (871538..872950) [1413 bp, 470 aa] {ON} Anc_5.254
           YKL149C
          Length = 470

 Score = 32.7 bits (73), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 18/66 (27%), Positives = 34/66 (51%), Gaps = 4/66 (6%)

Query: 701 RYSDEEQKIEENELLLLSKPNSAEGGLGISVSQDVTVTENNTACGGKNKTGSVSSGSSEV 760
           R + E+  +E+  +L     N+AE  LG+S  +D    EN  + G   + G +   S+E+
Sbjct: 247 RKTQEDTNVEKRTVL----KNNAEIDLGLSSDEDTDAIENKQSTGEMKQKGVIQKNSAEI 302

Query: 761 DILVSA 766
            + +S+
Sbjct: 303 SLDLSS 308

>TDEL0C05990 Chr3 (1079338..1080351) [1014 bp, 337 aa] {ON}
           Anc_1.102
          Length = 337

 Score = 32.0 bits (71), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 34/74 (45%), Gaps = 8/74 (10%)

Query: 76  GDGDKFRTRSLYFSNLNPDVRLHEFLATFHKFDRIESVYVV-DREQQSVL----VSFLTK 130
           G G K   R L+   LNP  +  +    FH+F  + SV +V D+E    L    + F  +
Sbjct: 244 GVGIKPSERVLFICRLNPSTKAKDIATIFHRFGEVHSVEIVRDKESGRSLCYGFIEFNDR 303

Query: 131 ETCLDFY---NGIL 141
           + C   Y   NG+L
Sbjct: 304 KACESAYKNMNGVL 317

>NCAS0B00950 Chr2 (150330..150989) [660 bp, 219 aa] {ON} Anc_8.797
          Length = 219

 Score = 31.2 bits (69), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 45/187 (24%), Positives = 74/187 (39%), Gaps = 41/187 (21%)

Query: 439 TVYIGNISPRSKTEDICNV-VRGGILQSVKYIEAKHICF---VTFIEAASA--VQFFANS 492
           TVY+GNI P+   E +  + ++   +  ++Y + K +       FIE  +A  VQ+    
Sbjct: 11  TVYVGNIDPKVTKEQLYELFIQVSPISKLRYPKDKILQMHQGYAFIEFYTAKDVQYVIQV 70

Query: 493 SIEPIVLHGSLLKV-----------GWGHHSGNLPQSISLAVTIGASRNVYVSLPEYAFK 541
               + L+   LKV           G  + S N  QSI L +     +N+          
Sbjct: 71  MNNTVALYDRFLKVRQSVQNPTSSMGGANTSENSNQSIVLPIAKLFVKNL---------- 120

Query: 542 DKFIKDPEYQAFREKFKLPSKQQLYDDFSTFGDIELINFLEDG--HCCWINFMNISNAIK 599
           D+ I++P+     +KF              F D E+  FL +G   C +I F    N+  
Sbjct: 121 DESIENPQLIKLFQKFG-----------PLFKDPEIF-FLSNGKLRCAYIYFKFYENSDM 168

Query: 600 LVEDANN 606
            +   NN
Sbjct: 169 AIAKLNN 175

>KLLA0F11275g Chr6 (1038770..1039927) [1158 bp, 385 aa] {ON} weakly
           similar to uniprot|Q96US5 Saccharomyces cerevisiae
           YOR242C SSP2 Sporulation SPecific involved in
           sporulation
          Length = 385

 Score = 31.6 bits (70), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 37/69 (53%), Gaps = 5/69 (7%)

Query: 563 QQLYDDFSTFGDI-ELINFLEDGHCCWINFMNISNAIKLVEDANNSNNESFHEKFENRYR 621
           QQ+ DDF+ FG + E+   +    C  I+F +I +AI+ +     SN+   + K+   ++
Sbjct: 312 QQIIDDFNQFGQVLEVSPLISRKICLQISFHDIRSAIEAMRSYETSNS-YINGKY---FK 367

Query: 622 GLFIGYGKD 630
              I YGKD
Sbjct: 368 DWSIWYGKD 376

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.131    0.371 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 91,523,705
Number of extensions: 3925226
Number of successful extensions: 11573
Number of sequences better than 10.0: 87
Number of HSP's gapped: 11787
Number of HSP's successfully gapped: 145
Length of query: 914
Length of database: 53,481,399
Length adjustment: 119
Effective length of query: 795
Effective length of database: 39,836,145
Effective search space: 31669735275
Effective search space used: 31669735275
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 70 (31.6 bits)