Re-run this search with the SEG filter switched off

Re-run this search as BLASTP i.e. protein query (default)

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_27.102328.845ON1209120952750.0
KLTH0C03762g8.845ON1206121037720.0
SAKL0D01342g8.845ON1270129527490.0
ABL121C8.845ON1285132822480.0
TDEL0B005308.845ON1301133222170.0
ZYRO0G14278g8.845ON1250118520730.0
KLLA0D01452g8.845ON1445131720670.0
YMR280C (CAT8)8.845ON1433109715530.0
Skud_13.4528.845ON1432107415420.0
NCAS0C003908.845ON116495215140.0
Smik_13.4938.845ON1433108815280.0
Suva_13.4688.845ON1418107215170.0
KNAG0J002508.845ON123793914251e-175
Ecym_46168.845ON157773714281e-173
KAFR0B039508.845ON124677913631e-166
NDAI0K003908.845ON1495107613581e-163
CAGL0M03025g8.845ON125497613151e-159
Kwal_27.10233singletonOFF1101075648e-67
Kwal_27.10235singletonOFF81811803e-15
Kpol_1016.201.277ON10861402043e-15
Kwal_26.7397singletonOFF201621876e-15
AFR096W1.277ON852481935e-14
ZYRO0G15136g1.277ON10271211936e-14
KLTH0D03564g1.277ON862621927e-14
KAFR0A014801.277ON725581918e-14
Smik_10.1531.277ON829571901e-13
Ecym_63401.277ON952481901e-13
KLLA0F14322g1.277ON717661882e-13
Suva_6.1611.277ON832561882e-13
SAKL0D05654g1.277ON919481882e-13
TPHA0I028201.277ON1044501864e-13
YJL089W (SIP4)1.277ON829571846e-13
TDEL0D014501.277ON945541847e-13
Skud_10.1251.277ON833571811e-12
KNAG0B018401.277ON1072661784e-12
CAGL0L03377g1.277ON1209481758e-12
NDAI0G055301.277ON1186721731e-11
TBLA0D054201.277ON757731722e-11
NCAS0A094101.277ON932451453e-08
KLLA0E13993gsingletonON678721301e-06
SAKL0C02024gsingletonON898721248e-06
KLLA0C10923g5.235ON775581221e-05
NCAS0D025405.235ON890661202e-05
TPHA0F013802.231ON890571159e-05
SAKL0G11902g5.235ON906481159e-05
KNAG0B051205.235ON888601141e-04
KLTH0G07898g5.235ON866781132e-04
TBLA0G026102.231ON1000581132e-04
TBLA0A012101.380ON1422661132e-04
KLLA0A02585gna 1ON370551112e-04
ZYRO0E08272g6.279ON794471122e-04
KLTH0E08778gna 2ON8731981122e-04
KAFR0F034104.113ON995421122e-04
YOR380W (RDR1)na 3ON546581112e-04
Kwal_47.17681na 2ON8541891113e-04
Smik_6.4526.279ON878471113e-04
YPL248C (GAL4)6.279ON881471113e-04
NCAS0D041906.279ON890451113e-04
NDAI0F012206.279ON960511113e-04
KLLA0F04609g2.231ON916411104e-04
KNAG0D006906.279ON875511095e-04
Kpol_1018.306.279ON881511095e-04
Kwal_23.29055.235ON881481086e-04
KNAG0E017602.231ON902581086e-04
KLTH0D07260g2.547ON979581086e-04
Skud_15.546na 3ON542591077e-04
KLTH0G09108g2.231ON782431078e-04
Suva_6.2851.128ON7862071078e-04
Kwal_23.47542.231ON812431078e-04
SAKL0E08998g2.231ON823411078e-04
TDEL0C044802.231ON852411078e-04
NDAI0I023505.235ON889441078e-04
Suva_10.945.235ON906711078e-04
NDAI0B038502.231ON930411078e-04
Skud_9.372.231ON954451078e-04
NDAI0A087907.17ON1059341078e-04
TDEL0E00160singletonON631471060.001
SAKL0A02860g6.279ON745451060.001
KAFR0J017102.231ON848411060.001
ZYRO0A10956g5.235ON855441060.001
KAFR0J006905.235ON864441060.001
Ecym_7440na 4ON898421060.001
KLTH0E14454gna 4ON9021601060.001
SAKL0B04620gna 1ON362411040.001
KAFR0F014901.128ON6581081050.001
TDEL0C056801.128ON691441050.001
YJL206C1.128ON7582111050.001
AER370W2.231ON801471050.001
KLTH0D02222gna 5ON847501050.001
CAGL0G08844g2.231ON847411050.001
TDEL0E039105.235ON862441050.001
Suva_16.596.279ON895431050.001
Skud_12.825.235ON899751050.001
NCAS0B065502.231ON906331050.001
Suva_9.592.231ON926331050.001
YIL130W (ASG1)2.231ON964331050.001
Smik_9.392.231ON1012331050.001
Smik_1.137.17ON1046631050.001
CAGL0A00451g4.113ON1107671050.001
NCAS0G011006.279ON935451040.002
SAKL0D14542gna 6ON946491040.002
YBR297W (MAL33)na 7ON468411030.002
Kpol_495.213.109ON1085511040.002
Smik_2.438na 7ON469411030.002
Skud_11.1902.547ON1171771030.002
KLTH0H16170gna 8ON619371020.003
Klac_YGOB_39601.128aON810441020.003
SAKL0B06732gna 4ON878451020.003
Kpol_1039.112.231ON992531020.003
TPHA0H019806.279ON993471020.003
Skud_1.107.17ON1040751020.003
Smik_12.775.235ON903441010.004
YLR014C (PPR1)5.235ON904441010.004
ZYRO0E06270g2.565ON912461010.004
SAKL0H24860gna 9ON971651010.004
Smik_2.3836.154ON448491000.004
SAKL0C09944g3.109ON1061621010.004
Smik_18.8singletonON775381000.005
SAKL0C03938g1.128ON780421000.005
SAKL0D01100g4.113ON940481000.005
YAL051W (OAF1)7.17ON1047631000.005
Ecym_53972.231ON82641990.007
KLTH0B00352gsingletonON93443990.007
SAKL0C03960g1.128aON103377990.007
NDAI0I007406.279ON103345990.007
YBR240C (THI2)6.154ON45062980.007
TBLA0G018006.279ON115445990.007
TPHA0N002307.17ON123233990.007
NDAI0G052601.380ON158160990.008
ZYRO0C18150g1.128ON57138980.008
Skud_5.331singletonON17038930.009
Smik_10.251.128ON772208980.009
Skud_10.101.128ON833208980.009
KNAG0E002107.17ON94833980.009
KAFR0C049807.17ON95141980.009
TDEL0H043407.17ON98947980.009
TDEL0D051503.109ON99655980.009
Skud_15.5327.17ON100058980.009
Skud_2.3726.154ON45249970.010
Skud_2.427na 7ON46838970.010
Suva_8.436na 3ON54543970.010
Smik_15.561na 3ON54659970.010
SAKL0A08250gsingletonON70141970.011
KAFR0C03730singletonON79150970.012
AER183Cna 4ON87952970.012
Ecym_50177.17ON97833970.012
SAKL0D14520g7.17ON98333970.012
ZYRO0C00726g7.17ON103571970.012
KAFR0I002307.17ON104533970.012
Suva_1.147.17ON104546970.012
CAGL0I07755g3.109ON105354970.012
KNAG0E041507.17ON113659970.013
Ecym_22636.154ON50861960.013
TDEL0D036103.264ON72456960.015
KLTH0H02684g6.279ON74945960.015
Kwal_26.68057.17ON94450960.016
NCAS0I002707.17ON94442960.016
Kwal_26.81092.547ON97058960.016
ADR403C7.17ON97033960.016
SAKL0A09856g2.547ON102050960.016
KLLA0D10153gsingletonON65538950.019
KAFR0F010406.279ON83445950.020
CAGL0M12298g7.17ON99459950.021
SAKL0B01870gsingletonON100957950.021
CAGL0J07150g7.17ON102243950.021
KLLA0A09119g4.113ON108261950.021
Smik_11.2102.547ON116977950.022
YGR288W (MAL13)na 10ON47339940.022
Suva_10.3511.380ON32455930.023
SAKL0H25520gna 11ON75336940.026
Kpol_260.25.59ON75652940.026
KLLA0D12672g6.279ON86577940.027
NDAI0D00900singletonON86533940.027
Suva_16.25singletonON14341880.027
AFR117C1.380ON115243940.028
TBLA0E007007.17ON127448940.029
NDAI0F00110singletonON50833930.030
SAKL0A00704gna 12ON71846930.034
Skud_9.220singletonON79335930.035
SAKL0D00264g8.879ON84828930.035
Suva_13.1862.565ON89457930.035
Smik_13.1832.565ON91166930.036
Skud_13.1732.565ON92060930.036
KAFR0C032308.109ON40644920.036
YOR363C (PIP2)7.17ON99658930.036
YGL013C (PDR1)4.113ON106838930.037
KAFR0B014502.547ON108875930.037
TBLA0G011308.879ON113238930.037
TPHA0A045403.109ON117873930.037
Kwal_0.142singletonOFF62940920.043
AFL160C6.279ON64847920.043
KLLA0A06039g1.199ON65744920.043
KLLA0A03421gna 6ON88034920.046
NDAI0D002207.512ON94471920.047
Kpol_538.427.17ON108842920.048
Suva_11.1872.547ON117183920.049
Kwal_YGOB_0.1391.380ON124040920.049
Suva_4.4996.154ON45055910.050
Skud_7.638singletonON47339910.051
Kwal_34.15751na 8ON62840910.056
KNAG0I005601.128ON66347910.057
TPHA0F025406.60ON79356910.060
ACL058Wna 9ON81777910.060
ADR404Cna 6ON87537910.061
KLLA0A03443g7.17ON97542910.062
KLLA0C14212gna 13ON104036910.063
TBLA0D006307.389ON107758910.063
Skud_7.2744.113ON108038910.063
YKL038W (RGT1)2.547ON117077910.064
TBLA0C040504.113ON120733910.064
KLLA0F22990g1.380ON125330910.064
TPHA0O006001.380ON137258910.065
TBLA0A097606.75ON153043910.066
Kwal_23.6529na 14ON59834900.073
NCAS0A03070singletonON65633900.075
Smik_17.27singletonON68833900.076
NCAS0D04860singletonON70139900.076
KAFR0E023305.59ON70438900.076
TDEL0A02690singletonON72244900.076
KNAG0A02300singletonON72945900.077
KLTH0E05786gna 15ON81756900.079
CAGL0F09229gna 15ON83533900.079
Kwal_26.7095na 5ON83868900.079
TPHA0A06090singletonON84733900.079
SAKL0H00682gna 13ON92246900.081
KLLA0F25630g2.547ON100769900.082
ZYRO0G21626g6.154ON41339890.082
Smik_7.2774.113ON106933900.083
NCAS0A035804.113ON111362900.083
NCAS0A047502.547ON114168900.083
NDAI0H019907.17ON116171900.084
KAFR0I020301.380ON123348900.084
Skud_12.3616.75ON134241900.085
Ecym_42868.283ON627192890.097
KLLA0A10329gna 14ON63939890.097
ZYRO0A13596gsingletonON64837890.098
KAFR0A021302.565ON70743890.100
ZYRO0G22550gsingletonON72437890.10
Kpol_1061.113.264ON73369890.10
KLTH0A03498gna 16ON73957890.10
TBLA0A058601.128aON81071890.10
TPHA0H012405.59ON87739890.10
Ecym_8404na 9ON88572890.10
TBLA0G005106.60ON93546890.11
YKL015W (PUT3)2.654ON979155890.11
Suva_8.4217.17ON100245890.11
SAKL0D07898g1.380ON124440890.11
Smik_16.20na 10ON47332880.12
TBLA0H007208.416ON61854880.13
Kwal_8.580singletonON63842880.13
BLASTX 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Kwal_27.10232
         (3630 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_27.10232 s27 (251015..254644) [3630 bp, 1209 aa] {ON} YMR28...  2036   0.0  
KLTH0C03762g Chr3 (324666..328286) [3621 bp, 1206 aa] {ON} simil...  1457   0.0  
SAKL0D01342g Chr4 (101095..104907) [3813 bp, 1270 aa] {ON} simil...  1063   0.0  
ABL121C Chr2 complement(170782..174639) [3858 bp, 1285 aa] {ON} ...   870   0.0  
TDEL0B00530 Chr2 (95898..99803) [3906 bp, 1301 aa] {ON} Anc_8.84...   858   0.0  
ZYRO0G14278g Chr7 complement(1141297..1145049) [3753 bp, 1250 aa...   803   0.0  
KLLA0D01452g Chr4 (124018..128355) [4338 bp, 1445 aa] {ON} simil...   800   0.0  
YMR280C Chr13 complement(827028..831329) [4302 bp, 1433 aa] {ON}...   602   0.0  
Skud_13.452 Chr13 complement(800289..804587) [4299 bp, 1432 aa] ...   598   0.0  
NCAS0C00390 Chr3 (57333..60827) [3495 bp, 1164 aa] {ON} Anc_8.845     587   0.0  
Smik_13.493 Chr13 complement(810035..814336) [4302 bp, 1433 aa] ...   593   0.0  
Suva_13.468 Chr13 complement(809712..812654,812694..814007) [425...   588   0.0  
KNAG0J00250 Chr10 (33322..37035) [3714 bp, 1237 aa] {ON} Anc_8.8...   553   e-175
Ecym_4616 Chr4 complement(1204091..1208824) [4734 bp, 1577 aa] {...   554   e-173
KAFR0B03950 Chr2 complement(823760..827500) [3741 bp, 1246 aa] {...   529   e-166
NDAI0K00390 Chr11 (84641..89128) [4488 bp, 1495 aa] {ON} Anc_8.845    527   e-163
CAGL0M03025g Chr13 complement(341849..345613) [3765 bp, 1254 aa]...   511   e-159
Kwal_27.10233 s27 complement(251120..251452) [333 bp, 110 aa] {O...   221   8e-67
Kwal_27.10235 s27 complement(253246..253491) [246 bp, 81 aa] {OF...    74   3e-15
Kpol_1016.20 s1016 (51828..55088) [3261 bp, 1086 aa] {ON} (51828...    83   3e-15
Kwal_26.7397 s26 complement(342483..343085) [603 bp, 201 aa] {OF...    77   6e-15
AFR096W Chr6 (606993..609551) [2559 bp, 852 aa] {ON} Syntenic ho...    79   5e-14
ZYRO0G15136g Chr7 complement(1218989..1222072) [3084 bp, 1027 aa...    79   6e-14
KLTH0D03564g Chr4 (343546..346134) [2589 bp, 862 aa] {ON} weakly...    79   7e-14
KAFR0A01480 Chr1 (294040..296217) [2178 bp, 725 aa] {ON} Anc_1.2...    78   8e-14
Smik_10.153 Chr10 (257677..260166) [2490 bp, 829 aa] {ON} YJL089...    78   1e-13
Ecym_6340 Chr6 complement(652943..655801) [2859 bp, 952 aa] {ON}...    78   1e-13
KLLA0F14322g Chr6 (1328925..1331078) [2154 bp, 717 aa] {ON} unip...    77   2e-13
Suva_6.161 Chr6 complement(283370..284500,284547..284764,284948....    77   2e-13
SAKL0D05654g Chr4 (457485..460244) [2760 bp, 919 aa] {ON} weakly...    77   2e-13
TPHA0I02820 Chr9 complement(620925..624059) [3135 bp, 1044 aa] {...    76   4e-13
YJL089W Chr10 (265926..268415) [2490 bp, 829 aa] {ON}  SIP4C6 zi...    75   6e-13
TDEL0D01450 Chr4 (284869..287706) [2838 bp, 945 aa] {ON} Anc_1.2...    75   7e-13
Skud_10.125 Chr10 (233921..236422) [2502 bp, 833 aa] {ON} YJL089...    74   1e-12
KNAG0B01840 Chr2 (345204..348422) [3219 bp, 1072 aa] {ON} Anc_1....    73   4e-12
CAGL0L03377g Chr12 complement(384929..388558) [3630 bp, 1209 aa]...    72   8e-12
NDAI0G05530 Chr7 (1360413..1363973) [3561 bp, 1186 aa] {ON}            71   1e-11
TBLA0D05420 Chr4 complement(1334955..1337228) [2274 bp, 757 aa] ...    71   2e-11
NCAS0A09410 Chr1 complement(1865924..1868722) [2799 bp, 932 aa] ...    60   3e-08
KLLA0E13993g Chr5 complement(1239566..1241602) [2037 bp, 678 aa]...    55   1e-06
SAKL0C02024g Chr3 complement(174858..177554) [2697 bp, 898 aa] {...    52   8e-06
KLLA0C10923g Chr3 complement(939148..941475) [2328 bp, 775 aa] {...    52   1e-05
NCAS0D02540 Chr4 complement(484060..486732) [2673 bp, 890 aa] {O...    51   2e-05
TPHA0F01380 Chr6 complement(318207..320879) [2673 bp, 890 aa] {O...    49   9e-05
SAKL0G11902g Chr7 (1016915..1019635) [2721 bp, 906 aa] {ON} simi...    49   9e-05
KNAG0B05120 Chr2 (982236..984902) [2667 bp, 888 aa] {ON}               49   1e-04
KLTH0G07898g Chr7 (636890..639490) [2601 bp, 866 aa] {ON} simila...    48   2e-04
TBLA0G02610 Chr7 complement(689843..692845) [3003 bp, 1000 aa] {...    48   2e-04
TBLA0A01210 Chr1 (276151..280419) [4269 bp, 1422 aa] {ON} Anc_1....    48   2e-04
KLLA0A02585g Chr1 complement(226562..227674) [1113 bp, 370 aa] {...    47   2e-04
ZYRO0E08272g Chr5 (651705..654089) [2385 bp, 794 aa] {ON} simila...    48   2e-04
KLTH0E08778g Chr5 complement(795841..798462) [2622 bp, 873 aa] {...    48   2e-04
KAFR0F03410 Chr6 complement(677156..680143) [2988 bp, 995 aa] {O...    48   2e-04
YOR380W Chr15 (1051290..1052930) [1641 bp, 546 aa] {ON}  RDR1Tra...    47   2e-04
Kwal_47.17681 s47 complement(513119..515683) [2565 bp, 854 aa] {...    47   3e-04
Smik_6.452 Chr6 (741922..744558) [2637 bp, 878 aa] {ON} YPL248C ...    47   3e-04
YPL248C Chr16 complement(79711..82356) [2646 bp, 881 aa] {ON}  G...    47   3e-04
NCAS0D04190 Chr4 (793242..795914) [2673 bp, 890 aa] {ON} Anc_6.279     47   3e-04
NDAI0F01220 Chr6 complement(295418..298300) [2883 bp, 960 aa] {O...    47   3e-04
KLLA0F04609g Chr6 complement(451579..454329) [2751 bp, 916 aa] {...    47   4e-04
KNAG0D00690 Chr4 (105640..108267) [2628 bp, 875 aa] {ON} Anc_6.2...    47   5e-04
Kpol_1018.30 s1018 complement(81534..83840,83842..84180) [2646 b...    47   5e-04
Kwal_23.2905 s23 (69235..71880) [2646 bp, 881 aa] {ON} YLR014C (...    46   6e-04
KNAG0E01760 Chr5 (350254..352962) [2709 bp, 902 aa] {ON} Anc_2.2...    46   6e-04
KLTH0D07260g Chr4 complement(635598..638537) [2940 bp, 979 aa] {...    46   6e-04
Skud_15.546 Chr15 (990335..991963) [1629 bp, 542 aa] {ON} YOR380...    46   7e-04
KLTH0G09108g Chr7 (744062..746410) [2349 bp, 782 aa] {ON} weakly...    46   8e-04
Suva_6.285 Chr6 (499581..501941) [2361 bp, 786 aa] {ON} YJL206C ...    46   8e-04
Kwal_23.4754 s23 (845550..847988) [2439 bp, 812 aa] {ON} YIL130W...    46   8e-04
SAKL0E08998g Chr5 complement(747085..749556) [2472 bp, 823 aa] {...    46   8e-04
TDEL0C04480 Chr3 (799022..801580) [2559 bp, 852 aa] {ON} Anc_2.2...    46   8e-04
NDAI0I02350 Chr9 (536448..539117) [2670 bp, 889 aa] {ON} Anc_5.235     46   8e-04
Suva_10.94 Chr10 complement(178366..181086) [2721 bp, 906 aa] {O...    46   8e-04
NDAI0B03850 Chr2 complement(970366..973158) [2793 bp, 930 aa] {O...    46   8e-04
Skud_9.37 Chr9 (79947..82811) [2865 bp, 954 aa] {ON} YIL130W (REAL)    46   8e-04
NDAI0A08790 Chr1 complement(2026171..2029350) [3180 bp, 1059 aa]...    46   8e-04
TDEL0E00160 Chr5 (16083..17978) [1896 bp, 631 aa] {ON}                 45   0.001
SAKL0A02860g Chr1 complement(259388..261625) [2238 bp, 745 aa] {...    45   0.001
KAFR0J01710 Chr10 complement(327570..330116) [2547 bp, 848 aa] {...    45   0.001
ZYRO0A10956g Chr1 (881429..883996) [2568 bp, 855 aa] {ON} simila...    45   0.001
KAFR0J00690 Chr10 (124449..127043) [2595 bp, 864 aa] {ON} Anc_5....    45   0.001
Ecym_7440 Chr7 complement(902108..904804) [2697 bp, 898 aa] {ON}...    45   0.001
KLTH0E14454g Chr5 complement(1282704..1285412) [2709 bp, 902 aa]...    45   0.001
SAKL0B04620g Chr2 complement(406622..407710) [1089 bp, 362 aa] {...    45   0.001
KAFR0F01490 Chr6 complement(290988..292964) [1977 bp, 658 aa] {O...    45   0.001
TDEL0C05680 Chr3 complement(1020646..1022721) [2076 bp, 691 aa] ...    45   0.001
YJL206C Chr10 complement(47659..49935) [2277 bp, 758 aa] {ON} Pu...    45   0.001
AER370W Chr5 (1320487..1322892) [2406 bp, 801 aa] {ON} Syntenic ...    45   0.001
KLTH0D02222g Chr4 (220570..223113) [2544 bp, 847 aa] {ON} weakly...    45   0.001
CAGL0G08844g Chr7 complement(846590..849133) [2544 bp, 847 aa] {...    45   0.001
TDEL0E03910 Chr5 (732533..735121) [2589 bp, 862 aa] {ON} Anc_5.2...    45   0.001
Suva_16.59 Chr16 complement(88631..91318) [2688 bp, 895 aa] {ON}...    45   0.001
Skud_12.82 Chr12 complement(164119..166818) [2700 bp, 899 aa] {O...    45   0.001
NCAS0B06550 Chr2 complement(1242371..1245091) [2721 bp, 906 aa] ...    45   0.001
Suva_9.59 Chr9 (97521..100298) [2778 bp, 926 aa] {ON} YIL130W (R...    45   0.001
YIL130W Chr9 (102782..105676) [2895 bp, 964 aa] {ON}  ASG1Zinc c...    45   0.001
Smik_9.39 Chr9 (80510..83548) [3039 bp, 1012 aa] {ON} YIL130W (R...    45   0.001
Smik_1.13 Chr1 (31514..34654) [3141 bp, 1046 aa] {ON} YAL051W (R...    45   0.001
CAGL0A00451g Chr1 (47557..50880) [3324 bp, 1107 aa] {ON} similar...    45   0.001
NCAS0G01100 Chr7 complement(193052..195859) [2808 bp, 935 aa] {O...    45   0.002
SAKL0D14542g Chr4 complement(1195951..1198791) [2841 bp, 946 aa]...    45   0.002
YBR297W Chr2 (800523..801929) [1407 bp, 468 aa] {ON}  MAL33MAL-a...    44   0.002
Kpol_495.21 s495 (71447..74704) [3258 bp, 1085 aa] {ON} (71447.....    45   0.002
Smik_2.438 Chr2 (786437..787846) [1410 bp, 469 aa] {ON} YBR297W ...    44   0.002
Skud_11.190 Chr11 (345221..348736) [3516 bp, 1171 aa] {ON} YKL03...    44   0.002
KLTH0H16170g Chr8 complement(1391996..1393855) [1860 bp, 619 aa]...    44   0.003
Klac_YGOB_3960 Chr3 (291786..293297,293300..294220) [2433 bp, 81...    44   0.003
SAKL0B06732g Chr2 complement(578508..581144) [2637 bp, 878 aa] {...    44   0.003
Kpol_1039.11 s1039 (29727..32705) [2979 bp, 992 aa] {ON} (29727....    44   0.003
TPHA0H01980 Chr8 (467688..470669) [2982 bp, 993 aa] {ON} Anc_6.2...    44   0.003
Skud_1.10 Chr1 (24510..27632) [3123 bp, 1040 aa] {ON} YAL051W (R...    44   0.003
Smik_12.77 Chr12 complement(159125..161836) [2712 bp, 903 aa] {O...    44   0.004
YLR014C Chr12 complement(172268..174982) [2715 bp, 904 aa] {ON} ...    44   0.004
ZYRO0E06270g Chr5 (475960..478698) [2739 bp, 912 aa] {ON} weakly...    44   0.004
SAKL0H24860g Chr8 complement(2162455..2165370) [2916 bp, 971 aa]...    44   0.004
Smik_2.383 Chr2 complement(686676..688022) [1347 bp, 448 aa] {ON...    43   0.004
SAKL0C09944g Chr3 complement(899127..902312) [3186 bp, 1061 aa] ...    44   0.004
Smik_18.8 Chr18 (12069..14396) [2328 bp, 775 aa] {ON} YOR172W (R...    43   0.005
SAKL0C03938g Chr3 complement(377431..379773) [2343 bp, 780 aa] {...    43   0.005
SAKL0D01100g Chr4 complement(81235..84057) [2823 bp, 940 aa] {ON...    43   0.005
YAL051W Chr1 (48564..51707) [3144 bp, 1047 aa] {ON}  OAF1Oleate-...    43   0.005
Ecym_5397 Chr5 (805712..808192) [2481 bp, 826 aa] {ON} similar t...    43   0.007
KLTH0B00352g Chr2 complement(31952..34756) [2805 bp, 934 aa] {ON...    43   0.007
SAKL0C03960g Chr3 (380387..383488) [3102 bp, 1033 aa] {ON} conse...    43   0.007
NDAI0I00740 Chr9 complement(160212..163313) [3102 bp, 1033 aa] {...    43   0.007
YBR240C Chr2 complement(700490..701842) [1353 bp, 450 aa] {ON}  ...    42   0.007
TBLA0G01800 Chr7 complement(469668..473132) [3465 bp, 1154 aa] {...    43   0.007
TPHA0N00230 Chr14 (39855..43553) [3699 bp, 1232 aa] {ON} Anc_7.1...    43   0.007
NDAI0G05260 Chr7 (1277631..1282376) [4746 bp, 1581 aa] {ON} Anc_...    43   0.008
ZYRO0C18150g Chr3 (1418645..1420360) [1716 bp, 571 aa] {ON} some...    42   0.008
Skud_5.331 Chr5 complement(543439..543951) [513 bp, 170 aa] {ON}...    40   0.009
Smik_10.25 Chr10 complement(45977..48295) [2319 bp, 772 aa] {ON}...    42   0.009
Skud_10.10 Chr10 complement(21672..24173) [2502 bp, 833 aa] {ON}...    42   0.009
KNAG0E00210 Chr5 (24545..27391) [2847 bp, 948 aa] {ON} Anc_7.17 ...    42   0.009
KAFR0C04980 Chr3 (987900..990755) [2856 bp, 951 aa] {ON} Anc_7.1...    42   0.009
TDEL0H04340 Chr8 complement(746566..749535) [2970 bp, 989 aa] {O...    42   0.009
TDEL0D05150 Chr4 (932888..935878) [2991 bp, 996 aa] {ON} Anc_3.1...    42   0.009
Skud_15.532 Chr15 complement(959437..962439) [3003 bp, 1000 aa] ...    42   0.009
Skud_2.372 Chr2 complement(669194..670552) [1359 bp, 452 aa] {ON...    42   0.010
Skud_2.427 Chr2 (769889..771295) [1407 bp, 468 aa] {ON} YGR288W ...    42   0.010
Suva_8.436 Chr8 (788699..790336) [1638 bp, 545 aa] {ON} YOR380W ...    42   0.010
Smik_15.561 Chr15 (997239..998879) [1641 bp, 546 aa] {ON} YOR380...    42   0.010
SAKL0A08250g Chr1 (734566..736671) [2106 bp, 701 aa] {ON} weakly...    42   0.011
KAFR0C03730 Chr3 (759382..761757) [2376 bp, 791 aa] {ON}               42   0.012
AER183C Chr5 complement(975879..978518) [2640 bp, 879 aa] {ON} N...    42   0.012
Ecym_5017 Chr5 (36647..39583) [2937 bp, 978 aa] {ON} similar to ...    42   0.012
SAKL0D14520g Chr4 complement(1192788..1195739) [2952 bp, 983 aa]...    42   0.012
ZYRO0C00726g Chr3 (53977..57084) [3108 bp, 1035 aa] {ON} similar...    42   0.012
KAFR0I00230 Chr9 (48095..51232) [3138 bp, 1045 aa] {ON} Anc_7.17...    42   0.012
Suva_1.14 Chr1 (25653..28790) [3138 bp, 1045 aa] {ON} YAL051W (R...    42   0.012
CAGL0I07755g Chr9 complement(745585..748746) [3162 bp, 1053 aa] ...    42   0.012
KNAG0E04150 Chr5 complement(823063..826473) [3411 bp, 1136 aa] {...    42   0.013
Ecym_2263 Chr2 (518089..519615) [1527 bp, 508 aa] {ON} similar t...    42   0.013
TDEL0D03610 Chr4 (664819..666993) [2175 bp, 724 aa] {ON} Anc_3.2...    42   0.015
KLTH0H02684g Chr8 complement(235527..237776) [2250 bp, 749 aa] {...    42   0.015
Kwal_26.6805 s26 (71596..74430) [2835 bp, 944 aa] {ON} YAL051W (...    42   0.016
NCAS0I00270 Chr9 complement(33129..35963) [2835 bp, 944 aa] {ON}...    42   0.016
Kwal_26.8109 s26 complement(650270..653182) [2913 bp, 970 aa] {O...    42   0.016
ADR403C Chr4 complement(1429115..1432027) [2913 bp, 970 aa] {ON}...    42   0.016
SAKL0A09856g Chr1 complement(867959..871021) [3063 bp, 1020 aa] ...    42   0.016
KLLA0D10153g Chr4 (858016..859983) [1968 bp, 655 aa] {ON} some s...    41   0.019
KAFR0F01040 Chr6 complement(195192..197696) [2505 bp, 834 aa] {O...    41   0.020
CAGL0M12298g Chr13 complement(1227303..1230287) [2985 bp, 994 aa...    41   0.021
SAKL0B01870g Chr2 (185897..188926) [3030 bp, 1009 aa] {ON} weakl...    41   0.021
CAGL0J07150g Chr10 complement(688858..691926) [3069 bp, 1022 aa]...    41   0.021
KLLA0A09119g Chr1 complement(797533..800781) [3249 bp, 1082 aa] ...    41   0.021
Smik_11.210 Chr11 (352056..355565) [3510 bp, 1169 aa] {ON} YKL03...    41   0.022
YGR288W Chr7 (1070293..1071714) [1422 bp, 473 aa] {ON}  MAL13MAL...    41   0.022
Suva_10.351 Chr10 (613486..614460) [975 bp, 324 aa] {ON} YLR256W...    40   0.023
SAKL0H25520g Chr8 (2233960..2236221) [2262 bp, 753 aa] {ON} some...    41   0.026
Kpol_260.2 s260 complement(3488..5758) [2271 bp, 756 aa] {ON} co...    41   0.026
KLLA0D12672g Chr4 complement(1076011..1078608) [2598 bp, 865 aa]...    41   0.027
NDAI0D00900 Chr4 (205039..207636) [2598 bp, 865 aa] {ON}               41   0.027
Suva_16.25 Chr16 complement(31437..31868) [432 bp, 143 aa] {ON} ...    39   0.027
AFR117C Chr6 complement(646829..650287) [3459 bp, 1152 aa] {ON} ...    41   0.028
TBLA0E00700 Chr5 complement(138121..141945) [3825 bp, 1274 aa] {...    41   0.029
NDAI0F00110 Chr6 (10745..12271) [1527 bp, 508 aa] {ON}                 40   0.030
SAKL0A00704g Chr1 complement(78811..80967) [2157 bp, 718 aa] {ON...    40   0.034
Skud_9.220 Chr9 complement(396576..398957) [2382 bp, 793 aa] {ON...    40   0.035
SAKL0D00264g Chr4 complement(24754..27300) [2547 bp, 848 aa] {ON...    40   0.035
Suva_13.186 Chr13 (302887..305571) [2685 bp, 894 aa] {ON} YMR019...    40   0.035
Smik_13.183 Chr13 (304049..304060,304064..306787) [2736 bp, 911 ...    40   0.036
Skud_13.173 Chr13 (298693..298722,298729..301461) [2763 bp, 920 ...    40   0.036
KAFR0C03230 Chr3 complement(655300..656520) [1221 bp, 406 aa] {O...    40   0.036
YOR363C Chr15 complement(1020222..1023212) [2991 bp, 996 aa] {ON...    40   0.036
YGL013C Chr7 complement(469092..472298) [3207 bp, 1068 aa] {ON} ...    40   0.037
KAFR0B01450 Chr2 (273614..276880) [3267 bp, 1088 aa] {ON} Anc_2....    40   0.037
TBLA0G01130 Chr7 (287952..291350) [3399 bp, 1132 aa] {ON} Anc_8....    40   0.037
TPHA0A04540 Chr1 (1031790..1035326) [3537 bp, 1178 aa] {ON} Anc_...    40   0.037
Kwal_0.142 s0 complement(63621..65507) [1887 bp, 629 aa] {OFF} Y...    40   0.043
AFL160C Chr6 complement(130842..132788) [1947 bp, 648 aa] {ON} S...    40   0.043
KLLA0A06039g Chr1 (557368..559341) [1974 bp, 657 aa] {ON} weakly...    40   0.043
KLLA0A03421g Chr1 (308414..311056) [2643 bp, 880 aa] {ON} weakly...    40   0.046
NDAI0D00220 Chr4 complement(43353..46187) [2835 bp, 944 aa] {ON}...    40   0.047
Kpol_538.42 s538 complement(89752..93018) [3267 bp, 1088 aa] {ON...    40   0.048
Suva_11.187 Chr11 (348570..352085) [3516 bp, 1171 aa] {ON} YKL03...    40   0.049
Kwal_YGOB_0.139 s0 complement(61752..63560,63594..65507) [3723 b...    40   0.049
Suva_4.499 Chr4 complement(871565..872917) [1353 bp, 450 aa] {ON...    40   0.050
Skud_7.638 Chr7 (1060062..1061483) [1422 bp, 473 aa] {ON} YFL052...    40   0.051
Kwal_34.15751 s34 (40148..42034) [1887 bp, 628 aa] {ON} [contig ...    40   0.056
KNAG0I00560 Chr9 complement(93785..95776) [1992 bp, 663 aa] {ON}...    40   0.057
TPHA0F02540 Chr6 (556797..559178) [2382 bp, 793 aa] {ON} Anc_6.6...    40   0.060
ACL058W Chr3 (261723..264176) [2454 bp, 817 aa] {ON} NOHBY305; N...    40   0.060
ADR404C Chr4 complement(1432320..1434947) [2628 bp, 875 aa] {ON}...    40   0.061
KLLA0A03443g Chr1 (311628..314555) [2928 bp, 975 aa] {ON} simila...    40   0.062
KLLA0C14212g Chr3 complement(1229219..1232341) [3123 bp, 1040 aa...    40   0.063
TBLA0D00630 Chr4 complement(164651..167884) [3234 bp, 1077 aa] {...    40   0.063
Skud_7.274 Chr7 complement(472171..475413) [3243 bp, 1080 aa] {O...    40   0.063
YKL038W Chr11 (365605..369117) [3513 bp, 1170 aa] {ON}  RGT1Gluc...    40   0.064
TBLA0C04050 Chr3 complement(980010..983633) [3624 bp, 1207 aa] {...    40   0.064
KLLA0F22990g Chr6 (2134385..2138146) [3762 bp, 1253 aa] {ON} uni...    40   0.064
TPHA0O00600 Chr15 complement(107944..112062) [4119 bp, 1372 aa] ...    40   0.065
TBLA0A09760 Chr1 complement(2398683..2403275) [4593 bp, 1530 aa]...    40   0.066
Kwal_23.6529 s23 (1627853..1629649) [1797 bp, 598 aa] {ON} YDR03...    39   0.073
NCAS0A03070 Chr1 (603639..605609) [1971 bp, 656 aa] {ON}               39   0.075
Smik_17.27 Chr17 complement(29476..31542) [2067 bp, 688 aa] {ON}...    39   0.076
NCAS0D04860 Chr4 (933920..936025) [2106 bp, 701 aa] {ON}               39   0.076
KAFR0E02330 Chr5 (468300..470414) [2115 bp, 704 aa] {ON} Anc_5.5...    39   0.076
TDEL0A02690 Chr1 (485785..487953) [2169 bp, 722 aa] {ON}               39   0.076
KNAG0A02300 Chr1 (214177..216363) [2187 bp, 729 aa] {ON}  gene e...    39   0.077
KLTH0E05786g Chr5 (517896..520349) [2454 bp, 817 aa] {ON} weakly...    39   0.079
CAGL0F09229g Chr6 complement(908186..910693) [2508 bp, 835 aa] {...    39   0.079
Kwal_26.7095 s26 (211883..214399) [2517 bp, 838 aa] {ON} YOR363C...    39   0.079
TPHA0A06090 Chr1 complement(1372559..1375102) [2544 bp, 847 aa] ...    39   0.079
SAKL0H00682g Chr8 complement(81989..84757) [2769 bp, 922 aa] {ON...    39   0.081
KLLA0F25630g Chr6 (2378464..2381487) [3024 bp, 1007 aa] {ON} som...    39   0.082
ZYRO0G21626g Chr7 complement(1781790..1783031) [1242 bp, 413 aa]...    39   0.082
Smik_7.277 Chr7 complement(461108..464317) [3210 bp, 1069 aa] {O...    39   0.083
NCAS0A03580 Chr1 complement(712039..715380) [3342 bp, 1113 aa] {...    39   0.083
NCAS0A04750 Chr1 (944929..948354) [3426 bp, 1141 aa] {ON} Anc_2....    39   0.083
NDAI0H01990 Chr8 complement(481983..485468) [3486 bp, 1161 aa] {...    39   0.084
KAFR0I02030 Chr9 complement(416471..420172) [3702 bp, 1233 aa] {...    39   0.084
Skud_12.361 Chr12 complement(641047..645075) [4029 bp, 1342 aa] ...    39   0.085
Ecym_4286 Chr4 (613587..615470) [1884 bp, 627 aa] {ON} similar t...    39   0.097
KLLA0A10329g Chr1 (903873..905792) [1920 bp, 639 aa] {ON} conser...    39   0.097
ZYRO0A13596g Chr1 complement(1080653..1082599) [1947 bp, 648 aa]...    39   0.098
KAFR0A02130 Chr1 (447063..449186) [2124 bp, 707 aa] {ON} Anc_2.5...    39   0.100
ZYRO0G22550g Chr7 complement(1856064..1858238) [2175 bp, 724 aa]...    39   0.10 
Kpol_1061.11 s1061 complement(31679..33880) [2202 bp, 733 aa] {O...    39   0.10 
KLTH0A03498g Chr1 complement(301696..303915) [2220 bp, 739 aa] {...    39   0.10 
TBLA0A05860 Chr1 (1449582..1452014) [2433 bp, 810 aa] {ON}             39   0.10 
TPHA0H01240 Chr8 (274496..277129) [2634 bp, 877 aa] {ON} Anc_5.5...    39   0.10 
Ecym_8404 Chr8 complement(834988..837645) [2658 bp, 885 aa] {ON}...    39   0.10 
TBLA0G00510 Chr7 (104797..107604) [2808 bp, 935 aa] {ON} Anc_6.6...    39   0.11 
YKL015W Chr11 (408544..411483) [2940 bp, 979 aa] {ON}  PUT3Trans...    39   0.11 
Suva_8.421 Chr8 complement(757924..760932) [3009 bp, 1002 aa] {O...    39   0.11 
SAKL0D07898g Chr4 complement(653332..657066) [3735 bp, 1244 aa] ...    39   0.11 
Smik_16.20 Chr16 complement(26236..27657) [1422 bp, 473 aa] {ON}...    39   0.12 
TBLA0H00720 Chr8 (157413..159269) [1857 bp, 618 aa] {ON} Anc_8.4...    39   0.13 
Kwal_8.580 s8 (13266..15182) [1917 bp, 638 aa] {ON} [contig 311]...    39   0.13 
ZYRO0G19338g Chr7 complement(1601895..1603856) [1962 bp, 653 aa]...    39   0.13 
KLLA0F09559g Chr6 complement(876719..878695) [1977 bp, 658 aa] {...    39   0.13 
KNAG0E00450 Chr5 complement(74721..76853) [2133 bp, 710 aa] {ON}...    39   0.13 
NCAS0C02730 Chr3 (513280..515607) [2328 bp, 775 aa] {ON} Anc_8.423     39   0.13 
Kwal_23.3122 s23 complement(166388..168754) [2367 bp, 788 aa] {O...    39   0.13 
KLTH0F07854g Chr6 complement(677647..680013) [2367 bp, 788 aa] {...    39   0.13 
Skud_3.181 Chr3 (293773..296268) [2496 bp, 831 aa] {ON} YCR106W ...    39   0.14 
YMR019W Chr13 (312156..315005) [2850 bp, 949 aa] {ON}  STB4Putat...    39   0.14 
Kpol_1002.5 s1002 (11943..14819) [2877 bp, 958 aa] {ON} (11943.....    39   0.14 
KNAG0C05980 Chr3 complement(1164771..1167677) [2907 bp, 968 aa] ...    39   0.14 
Smik_11.240 Chr11 (395459..395932,395981..398437) [2931 bp, 976 ...    39   0.14 
TPHA0N01100 Chr14 (231308..232501) [1194 bp, 397 aa] {ON} Anc_6....    38   0.14 
NCAS0A07610 Chr1 complement(1512914..1515982) [3069 bp, 1022 aa]...    39   0.14 
Suva_15.77 Chr15 complement(123654..126743) [3090 bp, 1029 aa] {...    39   0.14 
Skud_15.64 Chr15 complement(109746..112844) [3099 bp, 1032 aa] {...    39   0.14 
NCAS0A01630 Chr1 complement(317259..320390) [3132 bp, 1043 aa] {...    39   0.14 
Ecym_4686 Chr4 complement(1336279..1339581) [3303 bp, 1100 aa] {...    39   0.14 
KLTH0H11572g Chr8 complement(989095..992808) [3714 bp, 1237 aa] ...    39   0.14 
KNAG0A07100 Chr1 complement(1113008..1116868) [3861 bp, 1286 aa]...    39   0.15 
Smik_12.357 Chr12 complement(638342..642208) [3867 bp, 1288 aa] ...    39   0.15 
Suva_10.376 Chr10 complement(660780..664688) [3909 bp, 1302 aa] ...    39   0.15 
YLR278C Chr12 complement(699999..704024) [4026 bp, 1341 aa] {ON}...    39   0.15 
CAGL0K05841g Chr11 (573144..577262) [4119 bp, 1372 aa] {ON} simi...    39   0.15 
YLR256W Chr12 (646415..650923) [4509 bp, 1502 aa] {ON}  HAP1Zinc...    39   0.15 
Smik_12.327 Chr12 (590984..595495) [4512 bp, 1503 aa] {ON} YLR25...    39   0.15 
Skud_7.627 Chr7 (1048240..1049664) [1425 bp, 474 aa] {ON} YBR297...    38   0.15 
KLLA0F19602g Chr6 complement(1814949..1816760) [1812 bp, 603 aa]...    38   0.16 
SAKL0H25146g Chr8 complement(2185695..2187632) [1938 bp, 645 aa]...    38   0.17 
KLLA0C03201g Chr3 complement(286973..288925) [1953 bp, 650 aa] {...    38   0.17 
KLLA0D05038g Chr4 (433653..435674) [2022 bp, 673 aa] {ON} simila...    38   0.17 
TBLA0D01210 Chr4 complement(305406..306464) [1059 bp, 352 aa] {O...    38   0.17 
SAKL0D03586g Chr4 (290224..292629) [2406 bp, 801 aa] {ON} simila...    38   0.18 
Skud_15.326 Chr15 complement(588275..590731) [2457 bp, 818 aa] {...    38   0.18 
TDEL0B00480 Chr2 (83911..86418) [2508 bp, 835 aa] {ON} Anc_8.879...    38   0.18 
Kpol_538.52 s538 (126243..128966) [2724 bp, 907 aa] {ON} (126243...    38   0.18 
TBLA0A00730 Chr1 (156043..159156) [3114 bp, 1037 aa] {ON} Anc_2....    38   0.19 
NDAI0D03550 Chr4 complement(843265..846621) [3357 bp, 1118 aa] {...    38   0.19 
KLLA0F02750g Chr6 complement(250368..253814) [3447 bp, 1148 aa] ...    38   0.19 
Ecym_2732 Chr2 (1410290..1413886) [3597 bp, 1198 aa] {ON} simila...    38   0.19 
ZYRO0E05412g Chr5 (410945..414679) [3735 bp, 1244 aa] {ON} simil...    38   0.19 
Kpol_467.1 s467 (471..4340) [3870 bp, 1289 aa] {ON} (471..4340) ...    38   0.19 
CAGL0B03421g Chr2 complement(336071..340138) [4068 bp, 1355 aa] ...    38   0.19 
KNAG0I01450 Chr9 (277513..281943) [4431 bp, 1476 aa] {ON}              38   0.19 
Smik_16.15 Chr16 complement(14421..15812) [1392 bp, 463 aa] {ON}...    38   0.20 
TBLA0F03550 Chr6 complement(875734..876630) [897 bp, 298 aa] {ON...    37   0.20 
KLTH0C10516g Chr3 (871091..872776) [1686 bp, 561 aa] {ON} simila...    38   0.21 
SAKL0H01958g Chr8 complement(193079..195055) [1977 bp, 658 aa] {...    38   0.22 
YLR266C Chr12 complement(675619..677724) [2106 bp, 701 aa] {ON} ...    38   0.23 
KLLA0F10373g Chr6 (957948..958994) [1047 bp, 348 aa] {ON} some s...    37   0.23 
YOR162C Chr15 complement(639560..641992) [2433 bp, 810 aa] {ON} ...    38   0.23 
CAGL0L09691g Chr12 complement(1041796..1044270) [2475 bp, 824 aa...    38   0.23 
CAGL0F02519g Chr6 (245120..247618) [2499 bp, 832 aa] {ON} weakly...    38   0.23 
NCAS0C00220 Chr3 (22532..25051) [2520 bp, 839 aa] {ON} Anc_8.879       38   0.23 
ZYRO0A00440g Chr1 complement(27895..30447) [2553 bp, 850 aa] {ON...    38   0.23 
CAGL0D02904g Chr4 complement(302952..305615) [2664 bp, 887 aa] {...    38   0.24 
NCAS0C04780 Chr3 (974254..976998) [2745 bp, 914 aa] {ON}               38   0.24 
TBLA0G00490 Chr7 (99344..102100) [2757 bp, 918 aa] {ON}                38   0.24 
CAGL0L04400g Chr12 complement(513759..516722) [2964 bp, 987 aa] ...    38   0.24 
Suva_7.268 Chr7 complement(460629..463631) [3003 bp, 1000 aa] {O...    38   0.24 
TDEL0B06260 Chr2 (1104557..1108300) [3744 bp, 1247 aa] {ON} Anc_...    38   0.25 
NCAS0A08840 Chr1 (1746841..1751277) [4437 bp, 1478 aa] {ON} Anc_...    38   0.25 
Sklu_YGOB_gneas1 Chr3 complement(352893..354335) [1443 bp, 480 a...    37   0.26 
Kwal_23.6537 s23 complement(1632048..1633706) [1659 bp, 552 aa] ...    37   0.28 
TDEL0G00830 Chr7 complement(170169..172229) [2061 bp, 686 aa] {O...    37   0.29 
Kwal_23.4370 s23 complement(689686..691764) [2079 bp, 692 aa] {O...    37   0.29 
KLLA0C18953g Chr3 (1682246..1684357) [2112 bp, 703 aa] {ON} some...    37   0.30 
KNAG0A02550 Chr1 complement(262867..265059) [2193 bp, 730 aa] {O...    37   0.30 
Kwal_47.18089 s47 complement(680481..682718) [2238 bp, 745 aa] {...    37   0.30 
TBLA0B07920 Chr2 complement(1877300..1879603) [2304 bp, 767 aa] ...    37   0.30 
TBLA0C06230 Chr3 (1509702..1512089) [2388 bp, 795 aa] {ON} Anc_6...    37   0.30 
Smik_3.209 Chr3 (306620..309118) [2499 bp, 832 aa] {ON} YCR106W ...    37   0.31 
Ecym_2522 Chr2 (1017930..1020710) [2781 bp, 926 aa] {ON} similar...    37   0.31 
NDAI0C04840 Chr3 (1117201..1120047) [2847 bp, 948 aa] {ON} Anc_8...    37   0.31 
Smik_15.547 Chr15 complement(966368..969355) [2988 bp, 995 aa] {...    37   0.32 
NDAI0D03540 Chr4 complement(838966..842289) [3324 bp, 1107 aa] {...    37   0.32 
TPHA0F00830 Chr6 complement(188299..191877) [3579 bp, 1192 aa] {...    37   0.32 
Skud_12.335 Chr12 (592952..597391) [4440 bp, 1479 aa] {ON} YLR25...    37   0.33 
TDEL0C01880 Chr3 (332932..334554) [1623 bp, 540 aa] {ON} Anc_7.3...    37   0.36 
ZYRO0B02574g Chr2 complement(204817..206541) [1725 bp, 574 aa] {...    37   0.37 
KNAG0M02120 Chr13 (395195..397021) [1827 bp, 608 aa] {ON} Anc_2....    37   0.37 
Smik_26.8 Chr26 (8892..9242) [351 bp, 117 aa] {ON} YER184C (REAL)      35   0.38 
TBLA0G01100 Chr7 complement(279553..281454) [1902 bp, 633 aa] {O...    37   0.38 
KLTH0B08580g Chr2 (697066..698970) [1905 bp, 634 aa] {ON} simila...    37   0.38 
Suva_10.364 Chr10 complement(637047..639170) [2124 bp, 707 aa] {...    37   0.39 
TPHA0N00440 Chr14 complement(82249..84522) [2274 bp, 757 aa] {ON...    37   0.39 
Suva_8.387 Chr8 (696078..698357) [2280 bp, 759 aa] {ON} YOR337W ...    37   0.40 
Suva_8.216 Chr8 complement(389549..391894) [2346 bp, 781 aa] {ON...    37   0.40 
Kwal_27.9688 s27 complement(21328..23853) [2526 bp, 841 aa] {ON}...    37   0.40 
CAGL0F07865g Chr6 complement(768270..770804) [2535 bp, 844 aa] {...    37   0.40 
Kwal_55.20674 s55 complement(515392..516147) [756 bp, 252 aa] {O...    36   0.41 
KNAG0M00120 Chr13 complement(12320..14965) [2646 bp, 881 aa] {ON}      37   0.41 
NDAI0E03460 Chr5 (742144..744993) [2850 bp, 949 aa] {ON} Anc_8.423     37   0.41 
NDAI0K00150 Chr11 complement(20792..23653) [2862 bp, 953 aa] {ON...    37   0.41 
TDEL0B06360 Chr2 complement(1127150..1130095) [2946 bp, 981 aa] ...    37   0.41 
CAGL0F07909g Chr6 (776659..779808) [3150 bp, 1049 aa] {ON} some ...    37   0.42 
KAFR0G02450 Chr7 (508147..511353) [3207 bp, 1068 aa] {ON} Anc_6....    37   0.42 
KNAG0M00970 Chr13 (169393..172926) [3534 bp, 1177 aa] {ON} Anc_6...    37   0.42 
SAKL0F11616g Chr6 complement(901066..902841) [1776 bp, 591 aa] {...    37   0.49 
KLLA0E19603g Chr5 complement(1739869..1741914) [2046 bp, 681 aa]...    37   0.51 
SAKL0D13464g Chr4 (1116277..1118340) [2064 bp, 687 aa] {ON} weak...    37   0.51 
AGL099C Chr7 complement(516587..518830) [2244 bp, 747 aa] {ON} S...    37   0.52 
KLLA0A04169g Chr1 complement(376273..378600) [2328 bp, 775 aa] {...    37   0.52 
TBLA0B04800 Chr2 complement(1127000..1129333) [2334 bp, 777 aa] ...    37   0.52 
Kpol_1042.6 s1042 (9848..11548,11550..11612,11615..12193) [2343 ...    37   0.52 
ADR405C Chr4 complement(1435702..1438125) [2424 bp, 807 aa] {ON}...    37   0.52 
CAGL0L04576g Chr12 (528957..531554) [2598 bp, 865 aa] {ON} simil...    37   0.53 
KNAG0H00250 Chr8 (37360..40050) [2691 bp, 896 aa] {ON} Anc_2.654...    37   0.53 
NCAS0H00780 Chr8 complement(140472..143201) [2730 bp, 909 aa] {O...    37   0.54 
NDAI0A06990 Chr1 (1593540..1596476) [2937 bp, 978 aa] {ON} Anc_3...    37   0.54 
NDAI0G04140 Chr7 (994071..997076) [3006 bp, 1001 aa] {ON} Anc_3....    37   0.54 
KNAG0D03520 Chr4 complement(642517..645609) [3093 bp, 1030 aa] {...    37   0.55 
TBLA0E03480 Chr5 (865043..868183) [3141 bp, 1046 aa] {ON} Anc_3....    37   0.55 
Kpol_1061.42 s1061 complement(116430..119819) [3390 bp, 1129 aa]...    37   0.55 
TPHA0B03630 Chr2 (844571..848860) [4290 bp, 1429 aa] {ON} Anc_1....    37   0.57 
KNAG0M00620 Chr13 (99320..100699) [1380 bp, 459 aa] {ON} Anc_6.1...    36   0.59 
KLTH0A00484g Chr1 (42443..44149) [1707 bp, 568 aa] {ON} conserve...    36   0.63 
KLTH0E00176g Chr5 (8605..10311) [1707 bp, 568 aa] {ON} conserved...    36   0.63 
TDEL0C05790 Chr3 (1045249..1047057) [1809 bp, 602 aa] {ON}             36   0.64 
KLLA0D11286g Chr4 complement(964642..966678) [2037 bp, 678 aa] {...    36   0.66 
Skud_12.346 Chr12 complement(616734..618818) [2085 bp, 694 aa] {...    36   0.67 
SAKL0B10538g Chr2 (910662..912767) [2106 bp, 701 aa] {ON} simila...    36   0.67 
ZYRO0C18282g Chr3 (1431515..1433665) [2151 bp, 716 aa] {ON} cons...    36   0.67 
Suva_2.187 Chr2 complement(320833..323187) [2355 bp, 784 aa] {ON...    36   0.68 
YER184C Chr5 complement(556296..558680) [2385 bp, 794 aa] {ON} P...    36   0.69 
Suva_10.323 Chr10 complement(566314..568755) [2442 bp, 813 aa] {...    36   0.69 
CAGL0E05434g Chr5 (532814..535264) [2451 bp, 816 aa] {ON} simila...    36   0.69 
Suva_2.374 Chr2 complement(656129..658624) [2496 bp, 831 aa] {ON...    36   0.69 
KLTH0E16500g Chr5 (1460844..1463345) [2502 bp, 833 aa] {ON} simi...    36   0.69 
TPHA0C04980 Chr3 (1072547..1075105) [2559 bp, 852 aa] {ON} Anc_8...    36   0.70 
KAFR0A03060 Chr1 complement(626316..628898) [2583 bp, 860 aa] {O...    36   0.70 
SAKL0C05918g Chr3 complement(558911..561538) [2628 bp, 875 aa] {...    36   0.70 
TPHA0L02050 Chr12 complement(423921..426563) [2643 bp, 880 aa] {...    36   0.70 
KAFR0L02130 Chr12 (403953..406601) [2649 bp, 882 aa] {ON} Anc_8....    36   0.70 
KNAG0A04550 Chr1 (642548..645208) [2661 bp, 886 aa] {ON} Anc_8.4...    36   0.70 
TPHA0C02040 Chr3 (460036..462753) [2718 bp, 905 aa] {ON} Anc_8.4...    36   0.70 
Skud_4.475 Chr4 (844018..846759) [2742 bp, 913 aa] {ON} YDR213W ...    36   0.70 
YDR213W Chr4 (889751..892492) [2742 bp, 913 aa] {ON}  UPC2Sterol...    36   0.70 
Suva_2.381 Chr2 (669136..671892) [2757 bp, 918 aa] {ON} YDR213W ...    36   0.70 
Smik_4.460 Chr4 (833609..836365) [2757 bp, 918 aa] {ON} YDR213W ...    36   0.70 
SAKL0G07634g Chr7 (636596..639364) [2769 bp, 922 aa] {ON} some s...    36   0.70 
TDEL0G03970 Chr7 (720080..723187) [3108 bp, 1035 aa] {ON} Anc_6....    36   0.72 
ZYRO0G10252g Chr7 (819658..822768) [3111 bp, 1036 aa] {ON} simil...    36   0.72 
NDAI0K02840 Chr11 (640461..643634) [3174 bp, 1057 aa] {ON} Anc_6...    36   0.72 
KLLA0A03091g Chr1 (276333..277484) [1152 bp, 383 aa] {ON} some s...    36   0.72 
TDEL0F02330 Chr6 complement(429974..433234) [3261 bp, 1086 aa] {...    36   0.72 
Kpol_1009.5 s1009 complement(10170..13706) [3537 bp, 1178 aa] {O...    36   0.73 
CAGL0L01903g Chr12 (220700..224563) [3864 bp, 1287 aa] {ON} simi...    36   0.74 
Kwal_56.23308 s56 complement(485779..487092) [1314 bp, 438 aa] {...    36   0.76 
Kwal_14.1631 s14 (397794..399125) [1332 bp, 443 aa] {ON} YBR240C...    36   0.77 
NDAI0F02050 Chr6 complement(503400..504740) [1341 bp, 446 aa] {O...    36   0.77 
TDEL0D00260 Chr4 complement(44685..46628) [1944 bp, 647 aa] {ON}       36   0.86 
AER291C Chr5 complement(1172383..1174374) [1992 bp, 663 aa] {ON}...    36   0.87 
KLTH0D07898g Chr4 (672516..674534) [2019 bp, 672 aa] {ON} weakly...    36   0.87 
TPHA0C02220 Chr3 (504550..506658) [2109 bp, 702 aa] {ON} Anc_8.4...    36   0.88 
KLLA0F02387g Chr6 complement(213669..215852) [2184 bp, 727 aa] {...    36   0.88 
Ecym_5015 Chr5 (29616..32099) [2484 bp, 827 aa] {ON} similar to ...    36   0.91 
YDR207C Chr4 complement(865012..867522) [2511 bp, 836 aa] {ON}  ...    36   0.91 
Smik_4.453 Chr4 complement(820614..823172) [2559 bp, 852 aa] {ON...    36   0.91 
KAFR0G02540 Chr7 complement(524919..527486) [2568 bp, 855 aa] {O...    36   0.91 
KNAG0J00210 Chr10 (26132..28717) [2586 bp, 861 aa] {ON} Anc_8.87...    36   0.91 
Suva_15.415 Chr15 (726296..728899) [2604 bp, 867 aa] {ON} YCR106...    36   0.91 
SAKL0H00660g Chr8 complement(78740..81478) [2739 bp, 912 aa] {ON...    36   0.92 
ZYRO0D14080g Chr4 (1191418..1194183) [2766 bp, 921 aa] {ON} weak...    36   0.92 
Kwal_47.17506 s47 (431921..434695) [2775 bp, 924 aa] {ON} YGL013...    36   0.92 
CAGL0L09383g Chr12 (1020856..1021956) [1101 bp, 366 aa] {ON} som...    35   0.93 
NDAI0A03420 Chr1 complement(782010..785336) [3327 bp, 1108 aa] {...    36   0.95 
YBL066C Chr2 complement(96669..100115) [3447 bp, 1148 aa] {ON}  ...    36   0.95 
Smik_2.50 Chr2 complement(90559..94011) [3453 bp, 1150 aa] {ON} ...    36   0.95 
Suva_2.51 Chr2 complement(93709..97176) [3468 bp, 1155 aa] {ON} ...    36   0.95 
Skud_2.39 Chr2 complement(80293..83772) [3480 bp, 1159 aa] {ON} ...    36   0.95 
Kpol_1061.26 s1061 (69833..73657) [3825 bp, 1274 aa] {ON} (69833...    36   0.96 
KLTH0H05720g Chr8 (505672..507006) [1335 bp, 444 aa] {ON} simila...    35   1.0  
YPR196W Chr16 (931376..932788) [1413 bp, 470 aa] {ON} Putative m...    35   1.0  
NCAS0H01240 Chr8 (235885..237312) [1428 bp, 475 aa] {ON} Anc_6.154     35   1.0  
ZYRO0D06688g Chr4 (577455..577507,577577..579311) [1788 bp, 595 ...    35   1.1  
AFR171W Chr6 (752589..754427) [1839 bp, 612 aa] {ON} NOHBY629; N...    35   1.1  
Ecym_2345 Chr2 (676841..678754) [1914 bp, 637 aa] {ON} similar t...    35   1.1  
ADR365W Chr4 (1355407..1357512) [2106 bp, 701 aa] {ON} Syntenic ...    35   1.2  
Smik_12.341 Chr12 complement(613817..615922) [2106 bp, 701 aa] {...    35   1.2  
ZYRO0D14058g Chr4 (1188615..1190891) [2277 bp, 758 aa] {ON} simi...    35   1.2  
NCAS0A12720 Chr1 (2510574..2512853) [2280 bp, 759 aa] {ON} Anc_2...    35   1.2  
KAFR0H01800 Chr8 complement(333664..336048) [2385 bp, 794 aa] {O...    35   1.2  
KNAG0A02290 Chr1 (211626..214028) [2403 bp, 800 aa] {ON}               35   1.2  
Smik_15.342 Chr15 complement(595611..595820,595851..598070) [243...    35   1.2  
Skud_12.296 Chr12 complement(540407..542851) [2445 bp, 814 aa] {...    35   1.2  
YLR228C Chr12 complement(600019..602463) [2445 bp, 814 aa] {ON} ...    35   1.2  
KLLA0D10197g Chr4 complement(861726..864296) [2571 bp, 856 aa] {...    35   1.2  
Skud_4.469 Chr4 complement(831562..834189) [2628 bp, 875 aa] {ON...    35   1.2  
NDAI0B01680 Chr2 (398598..401372) [2775 bp, 924 aa] {ON} Anc_2.547     35   1.2  
Ecym_7235 Chr7 (489574..492405) [2832 bp, 943 aa] {ON} similar t...    35   1.2  
TPHA0L01060 Chr12 (220857..223778) [2922 bp, 973 aa] {ON} Anc_8....    35   1.2  
TPHA0E00880 Chr5 complement(177030..180164) [3135 bp, 1044 aa] {...    35   1.2  
Kpol_1061.19 s1061 (51386..54709) [3324 bp, 1107 aa] {ON} (51386...    35   1.2  
Suva_2.322 Chr2 (565810..569739) [3930 bp, 1309 aa] {ON} YDR159W...    35   1.3  
Kwal_26.6664 s26 complement(11094..12833) [1740 bp, 579 aa] {ON}...    35   1.4  
KLLA0D12650g Chr4 complement(1073580..1075535) [1956 bp, 651 aa]...    35   1.5  
NDAI0K01580 Chr11 (355753..357825) [2073 bp, 690 aa] {ON} Anc_6....    35   1.5  
Skud_16.500 Chr16 (874371..876485) [2115 bp, 704 aa] {ON} YKL222...    35   1.5  
KAFR0E01250 Chr5 complement(249538..251748) [2211 bp, 736 aa] {O...    35   1.5  
TDEL0G04090 Chr7 complement(744499..746730) [2232 bp, 743 aa] {O...    35   1.5  
YOR337W Chr15 (954344..956623) [2280 bp, 759 aa] {ON}  TEA1Ty1 e...    35   1.5  
KLTH0C10098g Chr3 complement(836528..838843) [2316 bp, 771 aa] {...    35   1.5  
YOR172W Chr15 (654210..656570) [2361 bp, 786 aa] {ON}  YRM1Zn2-C...    35   1.5  
NDAI0B01540 Chr2 complement(359639..362050) [2412 bp, 803 aa] {O...    35   1.6  
Ecym_5183 Chr5 complement(385669..388101) [2433 bp, 810 aa] {ON}...    35   1.6  
Smik_12.289 Chr12 complement(540824..543262) [2439 bp, 812 aa] {...    35   1.6  
KLTH0C00814g Chr3 (76637..79141) [2505 bp, 834 aa] {ON} similar ...    35   1.6  
KAFR0G02520 Chr7 complement(522206..524722) [2517 bp, 838 aa] {O...    35   1.6  
KAFR0A03180 Chr1 complement(655176..657716) [2541 bp, 846 aa] {O...    35   1.6  
TBLA0G00520 Chr7 (108060..110696) [2637 bp, 878 aa] {ON} Anc_6.6...    35   1.6  
KLTH0E07854g Chr5 (719642..722458) [2817 bp, 938 aa] {ON} weakly...    35   1.6  
Kpol_1049.19 s1049 (38439..41270) [2832 bp, 943 aa] {ON} (38439....    35   1.6  
NDAI0A03410 Chr1 complement(778569..781511) [2943 bp, 980 aa] {O...    35   1.6  
Suva_11.213 Chr11 (392506..392993,393045..395514) [2958 bp, 985 ...    35   1.6  
KAFR0A06690 Chr1 complement(1354262..1357255) [2994 bp, 997 aa] ...    35   1.6  
YOL089C Chr15 complement(150398..153490) [3093 bp, 1030 aa] {ON}...    35   1.6  
CAGL0A04455g Chr1 (437546..440842) [3297 bp, 1098 aa] {ON} simil...    35   1.6  
NCAS0F00370 Chr6 complement(61819..65148) [3330 bp, 1109 aa] {ON...    35   1.6  
NCAS0E02620 Chr5 complement(523279..526626) [3348 bp, 1115 aa] {...    35   1.6  
KLLA0C04620g Chr3 complement(422705..426514) [3810 bp, 1269 aa] ...    35   1.7  
Ecym_6141 Chr6 complement(258221..258565) [345 bp, 114 aa] {ON} ...    33   1.7  
Skud_7.646 Chr7 (1073386..1074795) [1410 bp, 469 aa] {ON} YPR196...    35   1.8  
TPHA0F03110 Chr6 complement(682012..683664) [1653 bp, 550 aa] {O...    35   1.9  
Kwal_14.819 s14 complement(63184..64890) [1707 bp, 568 aa] {ON} ...    35   1.9  
ZYRO0C11880g Chr3 (929030..930943) [1914 bp, 637 aa] {ON} simila...    35   1.9  
Suva_15.425 Chr15 (750153..752087) [1935 bp, 644 aa] {ON} YLR098...    35   1.9  
KLTH0D01804g Chr4 complement(173650..175608) [1959 bp, 652 aa] {...    35   2.0  
TDEL0G04100 Chr7 complement(746975..749074) [2100 bp, 699 aa] {O...    35   2.0  
CAGL0H01683g Chr8 (162753..164852) [2100 bp, 699 aa] {ON} simila...    35   2.0  
ZYRO0A03058g Chr1 (247954..250164) [2211 bp, 736 aa] {ON} simila...    35   2.0  
SAKL0H13024g Chr8 complement(1119585..1121849) [2265 bp, 754 aa]...    35   2.0  
Smik_4.269 Chr4 complement(491110..493446) [2337 bp, 778 aa] {ON...    35   2.0  
Smik_15.350 Chr15 (610312..612666) [2355 bp, 784 aa] {ON} YOR172...    35   2.0  
Smik_25.2 Chr25 (2105..4462) [2358 bp, 785 aa] {ON} YER184C (REAL)     35   2.0  
YDR034C Chr4 complement(509737..512109) [2373 bp, 790 aa] {ON}  ...    35   2.0  
CAGL0H01507g Chr8 complement(147689..150073) [2385 bp, 794 aa] {...    35   2.0  
Ecym_4153 Chr4 complement(330831..333281) [2451 bp, 816 aa] {ON}...    35   2.0  
YCR106W Chr3 (310958..313456) [2499 bp, 832 aa] {ON}  RDS1Putati...    35   2.0  
Smik_12.6 Chr12 complement(17429..19966) [2538 bp, 845 aa] {ON} ...    35   2.1  
AGL233C Chr7 complement(260414..263032) [2619 bp, 872 aa] {ON} N...    35   2.1  
KLTH0D01694g Chr4 (166143..168788) [2646 bp, 881 aa] {ON} conser...    35   2.1  
CAGL0H00396g Chr8 complement(37005..39827) [2823 bp, 940 aa] {ON...    35   2.1  
TBLA0F01200 Chr6 (295744..299004) [3261 bp, 1086 aa] {ON} Anc_3....    35   2.1  
AGR280C Chr7 complement(1266912..1270232) [3321 bp, 1106 aa] {ON...    35   2.1  
ZYRO0D14432g Chr4 complement(1222977..1226489) [3513 bp, 1170 aa...    35   2.1  
NDAI0K01800 Chr11 (401055..404687) [3633 bp, 1210 aa] {ON} Anc_2...    35   2.2  
Kpol_345.3 s345 complement(7411..11517) [4107 bp, 1368 aa] {ON} ...    35   2.2  
CAGL0G09757g Chr7 (930351..934622) [4272 bp, 1423 aa] {ON} some ...    35   2.2  
TBLA0C01120 Chr3 complement(233451..237911) [4461 bp, 1486 aa] {...    35   2.2  
KLTH0H00968g Chr8 (103482..105353) [1872 bp, 623 aa] {ON} simila...    34   2.5  
TDEL0E00300 Chr5 (64461..66374) [1914 bp, 637 aa] {ON}                 34   2.6  
Kwal_56.24670 s56 complement(1099601..1101532) [1932 bp, 643 aa]...    34   2.6  
Kwal_26.7014 s26 complement(164333..166297) [1965 bp, 654 aa] {O...    34   2.6  
KLTH0E03256g Chr5 complement(294997..297021) [2025 bp, 674 aa] {...    34   2.6  
NCAS0E02310 Chr5 (452368..454524) [2157 bp, 718 aa] {ON} Anc_7.56      34   2.6  
KLTH0A06644g Chr1 complement(553084..555270) [2187 bp, 728 aa] {...    34   2.6  
KLTH0A07260g Chr1 (602127..604328) [2202 bp, 733 aa] {ON} weakly...    34   2.6  
Kwal_23.6425 s23 (1574518..1576725) [2208 bp, 735 aa] {ON} YKL22...    34   2.6  
Skud_15.502 Chr15 (894741..897020) [2280 bp, 759 aa] {ON} YOR337...    34   2.6  
Smik_15.515 Chr15 (903950..906229) [2280 bp, 759 aa] {ON} YOR337...    34   2.6  
Kwal_56.23058 s56 complement(381390..383717) [2328 bp, 775 aa] {...    34   2.7  
KLTH0C07480g Chr3 (645219..647546) [2328 bp, 775 aa] {ON} simila...    34   2.7  
TPHA0C00640 Chr3 complement(120261..122636) [2376 bp, 791 aa] {O...    34   2.7  
ABL099W Chr2 (212830..215232) [2403 bp, 800 aa] {ON} Syntenic ho...    34   2.7  
SAKL0G19470g Chr7 complement(1677759..1680254) [2496 bp, 831 aa]...    34   2.7  
KAFR0G01360 Chr7 complement(305620..308121) [2502 bp, 833 aa] {O...    34   2.7  
Ecym_4144 Chr4 complement(306206..308728) [2523 bp, 840 aa] {ON}...    34   2.7  
TBLA0E01900 Chr5 (462299..464821) [2523 bp, 840 aa] {ON} Anc_7.5...    34   2.7  
TPHA0G00380 Chr7 complement(65673..68294) [2622 bp, 873 aa] {ON}       34   2.7  
KLTH0E06666g Chr5 (611348..614188) [2841 bp, 946 aa] {ON} conser...    34   2.7  
Kwal_47.17233 s47 (309658..312504) [2847 bp, 948 aa] {ON} [conti...    34   2.7  
KLLA0C17050g Chr3 (1490472..1493339) [2868 bp, 955 aa] {ON} cons...    34   2.7  
KLLA0D00484g Chr4 (44879..47893) [3015 bp, 1004 aa] {ON} conserv...    34   2.8  
TPHA0K01100 Chr11 (228134..231619) [3486 bp, 1161 aa] {ON} Anc_6...    34   2.8  
TPHA0F02630 Chr6 complement(583511..587299) [3789 bp, 1262 aa] {...    34   2.8  
SAKL0A06072g Chr1 (551181..552518) [1338 bp, 445 aa] {ON} simila...    34   3.0  
KAFR0C05400 Chr3 complement(1082243..1083688) [1446 bp, 481 aa] ...    34   3.1  
KLTH0F03300g Chr6 complement(283918..285474) [1557 bp, 518 aa] {...    34   3.2  
Kwal_YGOB_gneas1 s33 complement(285483..287042) [1560 bp, 519 aa...    34   3.2  
KLTH0G13200g Chr7 (1133333..1133382,1133450..1135100) [1701 bp, ...    34   3.3  
CAGL0M11440g Chr13 complement(1127298..1129025) [1728 bp, 575 aa...    34   3.3  
Skud_7.108 Chr7 (203544..204437) [894 bp, 297 aa] {ON} YGL162W (...    33   3.3  
SAKL0H13266g Chr8 (1138536..1140362) [1827 bp, 608 aa] {ON} some...    34   3.3  
AGR061C Chr7 complement(831052..832890) [1839 bp, 612 aa] {ON} S...    34   3.3  
YMR172W Chr13 (605981..608140) [2160 bp, 719 aa] {ON}  HOT1Trans...    34   3.4  
NDAI0A05750 Chr1 complement(1302180..1304459) [2280 bp, 759 aa] ...    34   3.5  
TPHA0M00150 Chr13 (29607..31919) [2313 bp, 770 aa] {ON}                34   3.5  
Skud_4.287 Chr4 complement(501344..503698) [2355 bp, 784 aa] {ON...    34   3.5  
Skud_15.334 Chr15 (602966..605338) [2373 bp, 790 aa] {ON} YOR172...    34   3.5  
Suva_2.701 Chr2 complement(1233963..1236344) [2382 bp, 793 aa] {...    34   3.5  
TDEL0F05470 Chr6 (1017743..1020175) [2433 bp, 810 aa] {ON} Anc_8...    34   3.5  
NDAI0J00440 Chr10 complement(78052..80523) [2472 bp, 823 aa] {ON...    34   3.5  
Ecym_3392 Chr3 (741359..743902) [2544 bp, 847 aa] {ON} similar t...    34   3.5  
NCAS0F00310 Chr6 (49514..52084) [2571 bp, 856 aa] {ON}                 34   3.5  
KLLA0E18129g Chr5 (1613115..1615712) [2598 bp, 865 aa] {ON} simi...    34   3.5  
CAGL0C01199g Chr3 complement(121944..124712) [2769 bp, 922 aa] {...    34   3.6  
Smik_4.696 Chr4 (1232828..1235677) [2850 bp, 949 aa] {ON} YDR421...    34   3.6  
Suva_2.121 Chr2 (211466..214381) [2916 bp, 971 aa] {ON} YBL005W ...    34   3.6  
Skud_11.214 Chr11 (389377..389855,389895..392361) [2946 bp, 981 ...    34   3.6  
KNAG0B02380 Chr2 complement(466392..469595) [3204 bp, 1067 aa] {...    34   3.7  
YNL054W Chr14 (526086..529583) [3498 bp, 1165 aa] {ON}  VAC7Inte...    34   3.7  
TDEL0C01580 Chr3 complement(272178..275687) [3510 bp, 1169 aa] {...    34   3.7  
NDAI0I01940 Chr9 (450330..454112) [3783 bp, 1260 aa] {ON} Anc_6.75     34   3.7  
TBLA0I02500 Chr9 complement(575195..579253) [4059 bp, 1352 aa] {...    34   3.7  
NCAS0B06430 Chr2 (1214203..1218609) [4407 bp, 1468 aa] {ON} Anc_...    34   3.8  
Suva_15.3 Chr15 complement(4971..6152) [1182 bp, 393 aa] {ON} YK...    33   3.8  
ACL195C Chr3 complement(19204..19533) [330 bp, 109 aa] {ON} NOHB...    32   3.9  
TDEL0B04000 Chr2 (715716..716981) [1266 bp, 421 aa] {ON} Anc_6.1...    33   3.9  
Skud_20.3 Chr20 (4504..5916) [1413 bp, 470 aa] {ON} YBR297W (REAL)     33   4.1  
KNAG0D02330 Chr4 complement(407687..408490) [804 bp, 267 aa] {ON...    33   4.1  
Skud_6.15 Chr6 complement(24031..25701) [1671 bp, 556 aa] {ON} Y...    33   4.3  
TDEL0D06620 Chr4 (1197405..1199084) [1680 bp, 559 aa] {ON}             33   4.3  
ZYRO0G00374g Chr7 complement(28649..30553) [1905 bp, 634 aa] {ON...    33   4.4  
TDEL0G04920 Chr7 complement(912754..914844) [2091 bp, 696 aa] {O...    33   4.5  
Ecym_2672 Chr2 (1294580..1296799) [2220 bp, 739 aa] {ON} similar...    33   4.5  
NCAS0A10550 Chr1 (2100725..2102950) [2226 bp, 741 aa] {ON} Anc_3...    33   4.5  
SAKL0A01386g Chr1 (132287..134599) [2313 bp, 770 aa] {ON} conser...    33   4.6  
NDAI0D01770 Chr4 (411567..413924) [2358 bp, 785 aa] {ON} Anc_5.322     33   4.6  
ZYRO0A09350g Chr1 (749695..752076) [2382 bp, 793 aa] {ON} simila...    33   4.6  
ACR241C Chr3 complement(784358..786745) [2388 bp, 795 aa] {ON} S...    33   4.6  
TPHA0F02550 Chr6 (559614..562013) [2400 bp, 799 aa] {ON} Anc_6.6...    33   4.6  
NCAS0A15020 Chr1 (2957420..2959849) [2430 bp, 809 aa] {ON} Anc_7...    33   4.6  
Kpol_455.10 s455 (12074..14566) [2493 bp, 830 aa] {ON} (12074..1...    33   4.6  
ZYRO0E00572g Chr5 (35940..38456) [2517 bp, 838 aa] {ON} similar ...    33   4.6  
KAFR0D04590 Chr4 (900318..902840) [2523 bp, 840 aa] {ON} Anc_5.3...    33   4.6  
Suva_10.18 Chr10 complement(36048..38576) [2529 bp, 842 aa] {ON}...    33   4.6  
Skud_12.17 Chr12 complement(23388..25916) [2529 bp, 842 aa] {ON}...    33   4.6  
KAFR0C03660 Chr3 complement(745068..747611) [2544 bp, 847 aa] {O...    33   4.6  
Kwal_56.22605 s56 (200072..202669) [2598 bp, 865 aa] {ON} YOL089...    33   4.7  
TDEL0B07490 Chr2 complement(1314447..1317044) [2598 bp, 865 aa] ...    33   4.7  
AGL091W Chr7 (535317..537917) [2601 bp, 866 aa] {ON} Syntenic ho...    33   4.7  
ZYRO0D12518g Chr4 (1055521..1058166) [2646 bp, 881 aa] {ON} simi...    33   4.7  
Suva_13.49 Chr13 complement(75704..78352) [2649 bp, 882 aa] {ON}...    33   4.7  
AAL175W Chr1 (32874..35525) [2652 bp, 883 aa] {ON} Non-syntenic ...    33   4.7  
TPHA0C02180 Chr3 complement(493972..496632) [2661 bp, 886 aa] {O...    33   4.7  
Kpol_1031.47 s1031 (125242..127926) [2685 bp, 894 aa] {ON} (1252...    33   4.7  
TPHA0A02900 Chr1 complement(628134..630920) [2787 bp, 928 aa] {O...    33   4.7  
CAGL0I02552g Chr9 (227257..230274) [3018 bp, 1005 aa] {ON} weakl...    33   4.8  
Skud_2.106 Chr2 (200722..203754) [3033 bp, 1010 aa] {ON} YBL005W...    33   4.8  
Smik_15.67 Chr15 complement(113506..116598) [3093 bp, 1030 aa] {...    33   4.8  
NDAI0C00260 Chr3 (40019..43144) [3126 bp, 1041 aa] {ON} Anc_2.65...    33   4.8  
Ecym_7239 Chr7 (501580..504774) [3195 bp, 1064 aa] {ON} similar ...    33   4.8  
TBLA0E01110 Chr5 (243534..246755) [3222 bp, 1073 aa] {ON} Anc_6....    33   4.8  
KLTH0G15180g Chr7 (1326581..1329871) [3291 bp, 1096 aa] {ON} sim...    33   4.8  
Ecym_3112 Chr3 (203876..207310) [3435 bp, 1144 aa] {ON} similar ...    33   4.8  
KAFR0A04940 Chr1 (975356..978913) [3558 bp, 1185 aa] {ON} Anc_6....    33   4.8  
NDAI0D02730 Chr4 (629970..633647) [3678 bp, 1225 aa] {ON} Anc_6....    33   4.9  
TBLA0D00490 Chr4 (127599..131339) [3741 bp, 1246 aa] {ON} Anc_7....    33   4.9  
KAFR0F02270 Chr6 complement(443168..446968) [3801 bp, 1266 aa] {...    33   4.9  
YPL016W Chr16 (521014..524958) [3945 bp, 1314 aa] {ON}  SWI1Subu...    33   4.9  
SAKL0C03388g Chr3 complement(318605..320548) [1944 bp, 647 aa] {...    29   4.9  
TDEL0C01380 Chr3 (237170..237949) [780 bp, 259 aa] {ON} Anc_8.10...    33   5.3  
KAFR0F01650 Chr6 complement(329455..330249) [795 bp, 264 aa] {ON...    33   5.3  
ZYRO0G17512g Chr7 complement(1447970..1449541) [1572 bp, 523 aa]...    33   5.5  
Skud_7.2 Chr7 (5094..6749) [1656 bp, 551 aa] {ON} YLR098C (REAL)       33   5.6  
KLLA0C19228g Chr3 (1713787..1715562) [1776 bp, 591 aa] {ON} simi...    33   5.7  
SAKL0B12518g Chr2 (1072142..1073932) [1791 bp, 596 aa] {ON} cons...    33   5.7  
TDEL0H03950 Chr8 (674423..676411) [1989 bp, 662 aa] {ON} Anc_7.5...    33   5.8  
KLLA0A09251g Chr1 (808253..810319) [2067 bp, 688 aa] {ON} simila...    33   5.9  
CAGL0H06875g Chr8 complement(682518..684626) [2109 bp, 702 aa] {...    33   5.9  
TBLA0A07010 Chr1 (1713923..1716046) [2124 bp, 707 aa] {ON}             33   5.9  
NDAI0I02190 Chr9 (501867..504074) [2208 bp, 735 aa] {ON} Anc_6.6...    33   5.9  
Skud_8.242 Chr8 (430739..432958) [2220 bp, 739 aa] {ON} YHR178W ...    33   5.9  
YHR178W Chr8 (459299..461530) [2232 bp, 743 aa] {ON}  STB5Transc...    33   6.0  
KNAG0E00780 Chr5 (140071..142353) [2283 bp, 760 aa] {ON} Anc_5.5...    33   6.0  
TBLA0H03910 Chr8 complement(943931..946234) [2304 bp, 767 aa] {O...    33   6.0  
NDAI0C03450 Chr3 (789514..791844) [2331 bp, 776 aa] {ON} Anc_5.59      33   6.0  
Kpol_1042.7 s1042 (12882..15233) [2352 bp, 783 aa] {ON} (12882.....    33   6.0  
KLLA0F20680g Chr6 (1924148..1926511) [2364 bp, 787 aa] {ON} weak...    33   6.0  
Suva_8.374 Chr8 complement(659267..661693) [2427 bp, 808 aa] {ON...    33   6.0  
KAFR0C03900 Chr3 (787524..789980) [2457 bp, 818 aa] {ON} Anc_2.6...    33   6.1  
TDEL0A03890 Chr1 (695880..698375) [2496 bp, 831 aa] {ON} Anc_5.5...    33   6.1  
ACL096W Chr3 (169508..172015) [2508 bp, 835 aa] {ON} Syntenic ho...    33   6.1  
AGL083W Chr7 (550291..552861) [2571 bp, 856 aa] {ON} Syntenic ho...    33   6.1  
Kpol_529.15 s529 complement(38664..41510) [2847 bp, 948 aa] {ON}...    33   6.2  
KNAG0K00820 Chr11 complement(153470..156622) [3153 bp, 1050 aa] ...    33   6.3  
AGR369W Chr7 (1412833..1415988) [3156 bp, 1051 aa] {ON} Syntenic...    33   6.3  
SAKL0G19404g Chr7 (1667193..1670582) [3390 bp, 1129 aa] {ON} sim...    33   6.3  
SAKL0A08074g Chr1 (711985..715425) [3441 bp, 1146 aa] {ON} simil...    33   6.3  
TBLA0B10050 Chr2 complement(2408235..2415311) [7077 bp, 2358 aa]...    33   6.7  
Kpol_534.28 s534 (64772..66079) [1308 bp, 435 aa] {ON} (64772..6...    33   6.9  
Smik_23.3 Chr23 complement(4675..6111) [1437 bp, 478 aa] {ON} YB...    33   7.1  
KLTH0F03014g Chr6 (260568..262406) [1839 bp, 612 aa] {ON} simila...    33   7.5  
Ecym_3001 Chr3 (1150..3042) [1893 bp, 630 aa] {ON} similar to As...    33   7.6  
Kpol_1061.37 s1061 complement(102667..104616) [1950 bp, 649 aa] ...    33   7.6  
YKL222C Chr11 complement(3503..5620) [2118 bp, 705 aa] {ON} Prot...    33   7.7  
Suva_13.353 Chr13 (586141..588282) [2142 bp, 713 aa] {ON} YMR172...    33   7.8  
KNAG0F02830 Chr6 (536483..538723) [2241 bp, 746 aa] {ON}               33   7.8  
Suva_15.378 Chr15 (665572..667815) [2244 bp, 747 aa] {ON} YHR178...    33   7.8  
SAKL0D02596g Chr4 (204347..206599) [2253 bp, 750 aa] {ON} conser...    33   7.8  
NDAI0E03850 Chr5 (846504..848810) [2307 bp, 768 aa] {ON} Anc_7.56      33   7.9  
Suva_8.225 Chr8 (404288..406693) [2406 bp, 801 aa] {ON} YOR172W ...    33   7.9  
TBLA0E02790 Chr5 complement(693136..695562) [2427 bp, 808 aa] {O...    33   7.9  
NDAI0F04500 Chr6 complement(1093752..1096181) [2430 bp, 809 aa] ...    33   7.9  
KLTH0B09262g Chr2 (758773..761235) [2463 bp, 820 aa] {ON} weakly...    33   7.9  
Kwal_55.20722 s55 (530982..533465) [2484 bp, 827 aa] {ON} YCR106...    33   8.0  
CAGL0K11902g Chr11 complement(1149210..1151705) [2496 bp, 831 aa...    33   8.0  
SAKL0C00242g Chr3 (14453..16954) [2502 bp, 833 aa] {ON} weakly s...    33   8.0  
KLTH0E06116g Chr5 complement(553784..556297) [2514 bp, 837 aa] {...    33   8.0  
Ecym_8159 Chr8 (330207..332933) [2727 bp, 908 aa] {ON} similar t...    33   8.1  
YBL005W Chr2 (217470..220400) [2931 bp, 976 aa] {ON}  PDR3Transc...    33   8.1  
NCAS0A03570 Chr1 complement(708718..711654) [2937 bp, 978 aa] {O...    33   8.1  
AEL298C Chr5 complement(81182..82195) [1014 bp, 337 aa] {ON} Syn...    32   8.1  
KLTH0C06776g Chr3 complement(586976..590140) [3165 bp, 1054 aa] ...    33   8.2  
SAKL0G02992g Chr7 (243859..247044) [3186 bp, 1061 aa] {ON} conse...    33   8.2  
ZYRO0E05676g Chr5 complement(439616..442816) [3201 bp, 1066 aa] ...    33   8.2  
NDAI0E04190 Chr5 complement(944753..948466) [3714 bp, 1237 aa] {...    33   8.4  
Smik_14.85 Chr14 (154519..158457) [3939 bp, 1312 aa] {ON} YNL250...    33   8.4  
KLTH0D02200g Chr4 complement(215729..219868) [4140 bp, 1379 aa] ...    33   8.4  
TPHA0J00190 Chr10 (44450..45142) [693 bp, 230 aa] {ON}                 32   8.4  
TBLA0G02350 Chr7 complement(605666..610141) [4476 bp, 1491 aa] {...    33   8.5  
KAFR0G03520 Chr7 complement(728360..729694) [1335 bp, 444 aa] {O...    32   9.1  
Skud_6.7 Chr6 (12394..13791) [1398 bp, 465 aa] {ON} YPR196W (REAL)     32   9.2  
YFL052W Chr6 (28232..29629) [1398 bp, 465 aa] {ON} Putative zinc...    32   9.2  
Smik_4.68 Chr4 (133172..134758) [1587 bp, 528 aa] {ON} YDL170W (...    32   9.5  
Smik_6.23 Chr6 complement(37285..38955) [1671 bp, 556 aa] {ON} Y...    32   9.7  
Skud_14.399 Chr14 (715444..717267) [1824 bp, 607 aa] {ON} YNR063...    32   9.9  
SAKL0F16588g Chr6 complement(1369763..1371610) [1848 bp, 615 aa]...    32   9.9  
KNAG0G02130 Chr7 complement(482333..484231) [1899 bp, 632 aa] {O...    32   9.9  

>Kwal_27.10232 s27 (251015..254644) [3630 bp, 1209 aa] {ON} YMR280C
            (CAT8) - Zinc-cluster protein involved in activating
            gluconeogenic genes; related to Gal4p [contig 39] FULL
          Length = 1209

 Score = 2036 bits (5275), Expect = 0.0
 Identities = 1046/1209 (86%), Positives = 1046/1209 (86%)
 Frame = +1

Query: 1    MGERENESFGPRFIRTLGSQSLSGTNPLXXXXXXXXXXXXXXRTNNSAAPNAARSISPVT 180
            MGERENESFGPRFIRTLGSQSLSGTNPL              RTNNSAAPNAARSISPVT
Sbjct: 1    MGERENESFGPRFIRTLGSQSLSGTNPLSSQPSSISQSPAQPRTNNSAAPNAARSISPVT 60

Query: 181  SATPTSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGYXXXX 360
            SATPTSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGY    
Sbjct: 61   SATPTSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGYTETL 120

Query: 361  XXXXXXXXXXXXXXXXXCDLKDEQMHLVSKYSSNKRHEPSSTEEGRMLEQLSNSDGGSLR 540
                             CDLKDEQMHLVSKYSSNKRHEPSSTEEGRMLEQLSNSDGGSLR
Sbjct: 121  EERVRELEAENRRLVALCDLKDEQMHLVSKYSSNKRHEPSSTEEGRMLEQLSNSDGGSLR 180

Query: 541  VSSTNLYLLNKTTPAVQDGSELHKCQGLGCNHASHPHLHEKPVSTSLSDPAAISFEQNEA 720
            VSSTNLYLLNKTTPAVQDGSELHKCQGLGCNHASHPHLHEKPVSTSLSDPAAISFEQNEA
Sbjct: 181  VSSTNLYLLNKTTPAVQDGSELHKCQGLGCNHASHPHLHEKPVSTSLSDPAAISFEQNEA 240

Query: 721  PGLPAVKALNTMANHEYSAQLAYLVALSVPRSTDEILFIPQLLARLGQVHGLTSKQCXXX 900
            PGLPAVKALNTMANHEYSAQLAYLVALSVPRSTDEILFIPQLLARLGQVHGLTSKQC   
Sbjct: 241  PGLPAVKALNTMANHEYSAQLAYLVALSVPRSTDEILFIPQLLARLGQVHGLTSKQCLYS 300

Query: 901  XXXXXXXXXXXQTSFQGSPDYKDLKDKSLWEIDDCMTFFKTGCKFNLTSSKDAXXXXXXX 1080
                       QTSFQGSPDYKDLKDKSLWEIDDCMTFFKTGCKFNLTSSKDA       
Sbjct: 301  ASLLAALKESSQTSFQGSPDYKDLKDKSLWEIDDCMTFFKTGCKFNLTSSKDAECLTISE 360

Query: 1081 XXXXXXXYFGECHALIPVLNEAEFYKYYNKFKSNLTTDPEFFKTSTPSFAQRSKSISYKI 1260
                   YFGECHALIPVLNEAEFYKYYNKFKSNLTTDPEFFKTSTPSFAQRSKSISYKI
Sbjct: 361  IEELISIYFGECHALIPVLNEAEFYKYYNKFKSNLTTDPEFFKTSTPSFAQRSKSISYKI 420

Query: 1261 FACILLVICQFGLMAKVKREQLPTKNKFSLLMSYYSNALLALKTNPYFSVKNXXXXXXXX 1440
            FACILLVICQFGLMAKVKREQLPTKNKFSLLMSYYSNALLALKTNPYFSVKN        
Sbjct: 421  FACILLVICQFGLMAKVKREQLPTKNKFSLLMSYYSNALLALKTNPYFSVKNTSIQTLQL 480

Query: 1441 XXXXXXXXXNVGEVSSVYEIRGTVVSMAQQLRLHRCPSAVLGTEGSTMSKSEQGDRRLLF 1620
                     NVGEVSSVYEIRGTVVSMAQQLRLHRCPSAVLGTEGSTMSKSEQGDRRLLF
Sbjct: 481  LSLLLFYYLNVGEVSSVYEIRGTVVSMAQQLRLHRCPSAVLGTEGSTMSKSEQGDRRLLF 540

Query: 1621 WGIYYLDVFGALQLGVPRLLKDHEIECALPISEHAHAGVSLADQVIKLEGQVSELSLSLL 1800
            WGIYYLDVFGALQLGVPRLLKDHEIECALPISEHAHAGVSLADQVIKLEGQVSELSLSLL
Sbjct: 541  WGIYYLDVFGALQLGVPRLLKDHEIECALPISEHAHAGVSLADQVIKLEGQVSELSLSLL 600

Query: 1801 RFSKILGNILDSIFKRGMTSSAAQQVALIHENALDNWRRGLPKNLTFELDVNGTIKIEEL 1980
            RFSKILGNILDSIFKRGMTSSAAQQVALIHENALDNWRRGLPKNLTFELDVNGTIKIEEL
Sbjct: 601  RFSKILGNILDSIFKRGMTSSAAQQVALIHENALDNWRRGLPKNLTFELDVNGTIKIEEL 660

Query: 1981 TGSAQNNQDFTKNASSDKKILMLLYFLVKCLVHLPVLAAKPLLGGSSEPDKDATPXXXXX 2160
            TGSAQNNQDFTKNASSDKKILMLLYFLVKCLVHLPVLAAKPLLGGSSEPDKDATP     
Sbjct: 661  TGSAQNNQDFTKNASSDKKILMLLYFLVKCLVHLPVLAAKPLLGGSSEPDKDATPAFDDA 720

Query: 2161 XXXXXXXXXXYVLLQQATNTFLSVQSCFKTRHLPLAIDLPRIKARFALLSARGILEYTKG 2340
                      YVLLQQATNTFLSVQSCFKTRHLPLAIDLPRIKARFALLSARGILEYTKG
Sbjct: 721  SSGADRSSSSYVLLQQATNTFLSVQSCFKTRHLPLAIDLPRIKARFALLSARGILEYTKG 780

Query: 2341 GALFQDNXXXXXXXXXXXXXXXXXXXPGSLSWHSLILLDMATLLIMQPPQTKTDKLDKLL 2520
            GALFQDN                   PGSLSWHSLILLDMATLLIMQPPQTKTDKLDKLL
Sbjct: 781  GALFQDNKALLLEVVKELEASKKLELPGSLSWHSLILLDMATLLIMQPPQTKTDKLDKLL 840

Query: 2521 ETRLNYYNKLMGRSTLTSNGKRKNEENDATSKVSKLTPLSSEYNTPSDKRIKVESIGSSG 2700
            ETRLNYYNKLMGRSTLTSNGKRKNEENDATSKVSKLTPLSSEYNTPSDKRIKVESIGSSG
Sbjct: 841  ETRLNYYNKLMGRSTLTSNGKRKNEENDATSKVSKLTPLSSEYNTPSDKRIKVESIGSSG 900

Query: 2701 NVPSNSESVHHFDDIQNDKFSTNWPSNNPQPNAIAEAFHLDPVLNGNPFSNGDLTAFFNS 2880
            NVPSNSESVHHFDDIQNDKFSTNWPSNNPQPNAIAEAFHLDPVLNGNPFSNGDLTAFFNS
Sbjct: 901  NVPSNSESVHHFDDIQNDKFSTNWPSNNPQPNAIAEAFHLDPVLNGNPFSNGDLTAFFNS 960

Query: 2881 DNGIPQIGGGSSVLNLAGIXXXXXXXXXXXXXXXXXXXPRKVATTVNDGLFRVPSNGDFL 3060
            DNGIPQIGGGSSVLNLAGI                   PRKVATTVNDGLFRVPSNGDFL
Sbjct: 961  DNGIPQIGGGSSVLNLAGIGAANSNELNNNNNEAAGGGPRKVATTVNDGLFRVPSNGDFL 1020

Query: 3061 KDYYRIPGASSSQLNLMFMGPGNTGXXXXXXXXXXXXFTVPGFGFTVDASLGLAPLLAWS 3240
            KDYYRIPGASSSQLNLMFMGPGNTG            FTVPGFGFTVDASLGLAPLLAWS
Sbjct: 1021 KDYYRIPGASSSQLNLMFMGPGNTGANQNAPNNQKNNFTVPGFGFTVDASLGLAPLLAWS 1080

Query: 3241 PEAPQPSMPEIAQNADRRDSDPLSRTRLPSATIPASDPTHVISQDSNNVHLREQYRSNSF 3420
            PEAPQPSMPEIAQNADRRDSDPLSRTRLPSATIPASDPTHVISQDSNNVHLREQYRSNSF
Sbjct: 1081 PEAPQPSMPEIAQNADRRDSDPLSRTRLPSATIPASDPTHVISQDSNNVHLREQYRSNSF 1140

Query: 3421 NQLYAQDQSLDDTAITIPTRSHRGPRRRWNSSNGTTVITXXXXXXXXXXXXXXXXXXYKD 3600
            NQLYAQDQSLDDTAITIPTRSHRGPRRRWNSSNGTTVIT                  YKD
Sbjct: 1141 NQLYAQDQSLDDTAITIPTRSHRGPRRRWNSSNGTTVITPNSDRPRNPPSSESENENYKD 1200

Query: 3601 LFRWQNSGF 3627
            LFRWQNSGF
Sbjct: 1201 LFRWQNSGF 1209

>KLTH0C03762g Chr3 (324666..328286) [3621 bp, 1206 aa] {ON} similar to
            uniprot|P39113 Saccharomyces cerevisiae YMR280C CAT8 Zinc
            cluster transcriptional activator
          Length = 1206

 Score = 1457 bits (3772), Expect = 0.0
 Identities = 767/1210 (63%), Positives = 865/1210 (71%), Gaps = 1/1210 (0%)
 Frame = +1

Query: 1    MGERENESFGPRFIRTLGSQSLSGTNPLXXXXXXXXXXXXXXRTNNSAAPNAARSISPVT 180
            MGERENESFGPRFIRTLGSQS+S  NPL              + N +    A  SISP  
Sbjct: 1    MGERENESFGPRFIRTLGSQSISVINPLSSQPSSISQSPAQPKANTNTQTTATASISPTA 60

Query: 181  SATPTSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGYXXXX 360
            S TP+SNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGY    
Sbjct: 61   SVTPSSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGYTETL 120

Query: 361  XXXXXXXXXXXXXXXXXCDLKDEQMHLVSKYSSNKRHEPSSTEEGRMLEQLSNSDGGSLR 540
                             CDLKDEQMHLV KYSSNKR EPSSTEE +MLEQLS+S+GGSLR
Sbjct: 121  EERVRELEAENRRLVALCDLKDEQMHLVYKYSSNKRPEPSSTEEEQMLEQLSSSNGGSLR 180

Query: 541  VSSTNLYLLNKTTPAVQDGSELHKCQGLGCNHASHPHLHEKPVSTSLSDPAAISFEQNEA 720
            VSSTNLYLLNKT+PA  +  E HKCQG+ CNH SHPHLHEKPVST+LSDP  ISFEQ+EA
Sbjct: 181  VSSTNLYLLNKTSPAGHEVPENHKCQGIDCNHTSHPHLHEKPVSTTLSDPTTISFEQHEA 240

Query: 721  PGLPAVKALNTMANHEYSAQLAYLVALSVPRSTDEILFIPQLLARLGQVHGLTSKQCXXX 900
            PGLPAVKAL++MANHEYS QLA LVALSVPRST+EILFIPQLLARLGQVHGLTSKQC   
Sbjct: 241  PGLPAVKALSSMANHEYSTQLACLVALSVPRSTEEILFIPQLLARLGQVHGLTSKQCLYT 300

Query: 901  XXXXXXXXXXXQTSFQGSPDYKDLKDKSLWEIDDCMTFFKTGCKFNLTSSKDAXXXXXXX 1080
                       Q     +    +LK  SLWEIDD M FFK  CKFNL S  D        
Sbjct: 301  ASLLASLKEPSQAVVPTTDGLTELKCTSLWEIDDPMRFFKDSCKFNLGSDNDVELLSISE 360

Query: 1081 XXXXXXXYFGECHALIPVLNEAEFYKYYNKFKSNLTTDPEFFKTSTPSFAQRSKSISYKI 1260
                   YF ECHALIPVLNE EFYKYYNKFK +LT DP FF  +  SFA RSKSISYKI
Sbjct: 361  IEDLISIYFEECHALIPVLNENEFYKYYNKFKESLTVDPNFFGKANSSFAHRSKSISYKI 420

Query: 1261 FACILLVICQFGLMAKVKREQLPTKNKFSLLMSYYSNALLALKTNPYFSVKNXXXXXXXX 1440
            FACILLV+CQ G+M+KVKREQLP K+KFS +M+YY+NA+LALK NPYFSVK         
Sbjct: 421  FACILLVVCQLGIMSKVKREQLPAKSKFSRIMAYYNNAILALKLNPYFSVKTTSVKTLQL 480

Query: 1441 XXXXXXXXXNVGEVSSVYEIRGTVVSMAQQLRLHRCPSAVLGTEGSTMSKSEQGDRRLLF 1620
                     NVGEVSSVYE+RGT+VSMAQQLRLHRCPSAVLGTEGSTMSKSEQGDRRLLF
Sbjct: 481  MSLLLFYFLNVGEVSSVYELRGTIVSMAQQLRLHRCPSAVLGTEGSTMSKSEQGDRRLLF 540

Query: 1621 WGIYYLDVFGALQLGVPRLLKDHEIECALPISEHAHAGVSLADQVIKLEGQVSELSLSLL 1800
            WGIYYLDVF ALQLGVPRLLKDHEIECALPISE+ H GVSLADQVI+LEGQVSE SLSLL
Sbjct: 541  WGIYYLDVFSALQLGVPRLLKDHEIECALPISENGHPGVSLADQVIRLEGQVSEFSLSLL 600

Query: 1801 RFSKILGNILDSIFKRGMTSSAAQQVALIHENALDNWRRGLPKNLTFELDVNGTIKIEEL 1980
            RFSKILGNILDSIFKRGMTSS AQQVALIHENALD+WRRGLPKNLTFELDVNGTI +EEL
Sbjct: 601  RFSKILGNILDSIFKRGMTSSIAQQVALIHENALDSWRRGLPKNLTFELDVNGTINMEEL 660

Query: 1981 TGSAQNNQDFTKNASSDKKILMLLYFLVKCLVHLPVLAAKPLLGGSSEPDKDATPXXXXX 2160
               +   +D++   S D + LM+LYFLVKCLVHLPVLAAKPLLGG+SE D DAT      
Sbjct: 661  NSGSHWKKDYSTAPSCDNRTLMVLYFLVKCLVHLPVLAAKPLLGGASEVDTDATLAFDDA 720

Query: 2161 XXXXXXXXXXYVLLQQATNTFLSVQSCFKTRHLPLAIDLPRIKARFALLSARGILEYTKG 2340
                      YVLLQQATNTFLSVQS  K+RHLPLA++LPRIKARFALLSARGILEYTKG
Sbjct: 721  SSGADRSSSSYVLLQQATNTFLSVQSSLKSRHLPLALNLPRIKARFALLSARGILEYTKG 780

Query: 2341 GALFQDNXXXXXXXXXXXXXXXXXXXPGSLSWHSLILLDMATLLIMQPPQTKTDKLDKLL 2520
            GALFQ N                   PGSLSWHSLILLDMA  LIMQPP TK  KLDKLL
Sbjct: 781  GALFQGNKALLLDVVKELETTKRLEIPGSLSWHSLILLDMAVSLIMQPPHTKAGKLDKLL 840

Query: 2521 ETRLNYYNKLMGRSTLTSNGKRKNEE-NDATSKVSKLTPLSSEYNTPSDKRIKVESIGSS 2697
            E +L+YYNKLMGRS   ++ KRK EE N + S  +KLTPLSS+ ++PS+KR+K+E     
Sbjct: 841  EAKLSYYNKLMGRSANVASTKRKKEEDNTSLSNATKLTPLSSDSSSPSEKRVKLEHTDKV 900

Query: 2698 GNVPSNSESVHHFDDIQNDKFSTNWPSNNPQPNAIAEAFHLDPVLNGNPFSNGDLTAFFN 2877
            G  P   E+    +    + ++  W + N   + +AEAFHLDPVLN NPFSNGDLTAFF+
Sbjct: 901  GETPVGVENTGQPNGNTQEHYAATWSNQNQPHSTVAEAFHLDPVLNNNPFSNGDLTAFFS 960

Query: 2878 SDNGIPQIGGGSSVLNLAGIXXXXXXXXXXXXXXXXXXXPRKVATTVNDGLFRVPSNGDF 3057
            +DNG+P + GG+S+LN+ G+                    +  +T  NDGLFRVPSNGDF
Sbjct: 961  TDNGMPNLSGGASMLNMVGVDQAHSTAGNDAQNTVNANSQQ--STLFNDGLFRVPSNGDF 1018

Query: 3058 LKDYYRIPGASSSQLNLMFMGPGNTGXXXXXXXXXXXXFTVPGFGFTVDASLGLAPLLAW 3237
            LKDYYR+PGASSSQLNLM MG G++G             T PGFGFTVDASLGLAPLLAW
Sbjct: 1019 LKDYYRVPGASSSQLNLMLMGSGSSGSNQRQAKQQQTNTTDPGFGFTVDASLGLAPLLAW 1078

Query: 3238 SPEAPQPSMPEIAQNADRRDSDPLSRTRLPSATIPASDPTHVISQDSNNVHLREQYRSNS 3417
            SPEA Q  + E + +  R DS    ++   +A +  +  +  ++  S +   ++Q R  S
Sbjct: 1079 SPEAAQEPIAETSDHDTRNDSGLRRKSGAETAGVLVAGHSQ-LADSSTDPASQQQRRVGS 1137

Query: 3418 FNQLYAQDQSLDDTAITIPTRSHRGPRRRWNSSNGTTVITXXXXXXXXXXXXXXXXXXYK 3597
            ++  YAQDQS++D+AIT+PTR HRGPRRRWNS+ G   IT                   +
Sbjct: 1138 YDHTYAQDQSVEDSAITMPTRPHRGPRRRWNSTTGAAAIT-PNSDRPRNAPASETDENLQ 1196

Query: 3598 DLFRWQNSGF 3627
            DLFRWQNSGF
Sbjct: 1197 DLFRWQNSGF 1206

>SAKL0D01342g Chr4 (101095..104907) [3813 bp, 1270 aa] {ON} similar to
            uniprot|Q75DZ4 Ashbya gossypii ABL121C ABL121Cp and
            similar to YMR280C uniprot|P39113 Saccharomyces
            cerevisiae YMR280C CAT8 Zinc cluster transcriptional
            activator
          Length = 1270

 Score = 1063 bits (2749), Expect = 0.0
 Identities = 628/1295 (48%), Positives = 784/1295 (60%), Gaps = 87/1295 (6%)
 Frame = +1

Query: 1    MGERENESFGPRFIRTLGSQSLSGTNPLXXXXXXXXXXXXXXRTN--NSAAPNAARSISP 174
            M +RE E+F PR IRTLGSQSLSG NP                +   + AA N   S +P
Sbjct: 1    MSKRERETFAPRIIRTLGSQSLSGLNPFSSSNPSSLSQSPATSSTVPHVAANNTTMSPTP 60

Query: 175  -----------VTSATPT----SNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKV 309
                       VTS   T    SNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECK+
Sbjct: 61   LNSNNMGTGTSVTSGADTPASASNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKI 120

Query: 310  SDKLSRRAFPRGYXXXXXXXXXXXXXXXXXXXXXCDLKDEQMHLVSKYSSNKRHEPSSTE 489
            SDKLSRRAFPRGY                     CDLK+EQ+HLVSKYS+ +  E S  E
Sbjct: 121  SDKLSRRAFPRGYTETLEERVRELEAENRRLVALCDLKEEQLHLVSKYSNKRTSEISENE 180

Query: 490  EGRMLEQLSNSDGGSLRVSSTNLYLLNKTTPAVQDGSELHK-------CQGLGCNHASHP 648
            + ++L+QLS ++GGSLRVSSTNLYLLNKTTP  Q   E          C G+GCNH+  P
Sbjct: 181  DEQILQQLSAANGGSLRVSSTNLYLLNKTTPGDQQDEEDQMSSKTTVDCNGVGCNHSHQP 240

Query: 649  HLHEKPVSTSLSDPAAISFEQNEAPGLPAVKALNTMANHEYSAQLAYLVALSVPRSTDEI 828
            ++H+KPVST+L+DP +ISFEQNEAPGLPAVKAL +MANHE+S QLA LVALSVPRST+EI
Sbjct: 241  NIHDKPVSTNLNDPTSISFEQNEAPGLPAVKALTSMANHEHSVQLATLVALSVPRSTEEI 300

Query: 829  LFIPQLLARLGQVHGLTSKQCXXXXXXXXXXXXXXQTSFQGSPDYKDLKDKSLWEIDDCM 1008
            L IPQLLAR+GQVHGLTSKQ                 +   + D   LK  +LWE+DD +
Sbjct: 301  LLIPQLLARIGQVHGLTSKQSLYTASLLASLKESIPLTLPTNVDM--LKSTNLWEVDDVI 358

Query: 1009 TFFKTGCKFNL---TSSKDAXXXXXXXXXXXXXXYFGECHALIPVLNEAEFYKYYNKFKS 1179
             FF+T  KF++   +S+                 +F + +  IP+L++ EFY YYNKFK+
Sbjct: 359  QFFQTVFKFDIQAESSTTSQDHLIATEIDGLVSDFFSQWYNFIPILDKDEFYNYYNKFKT 418

Query: 1180 NLTTDPEFFKTSTPSFAQRSKSISYKIFACILLVICQFGLMAKVKREQLPTKNKFSLLMS 1359
            +L  DP FF      F +R+KSISYKIF CILL+ICQ GL++KVK E LP  NK+S LM+
Sbjct: 419  DLM-DPNFFDDEKNLFNKRNKSISYKIFGCILLIICQMGLISKVKAENLPATNKYSQLMA 477

Query: 1360 YYSNALLALKTNPYFSVKNXXXXXXXXXXXXXXXXXNVGEVSSVYEIRGTVVSMAQQLRL 1539
            YY   +  L  NPYF++K+                 N+GEVSSVY++RG VVSM+QQLRL
Sbjct: 478  YYDIVVRQLMMNPYFNLKSTSIQSLQFTSLQLFYFLNIGEVSSVYDLRGKVVSMSQQLRL 537

Query: 1540 HRCPSAVLGTEGSTMSKSEQGDRRLLFWGIYYLDVFGALQLGVPRLLKDHEIECALPISE 1719
            HRCPSAVLG  GS +SK++QG+RR+LFWGIYYLDVF ALQLGVPRLLKDHEIECALP+++
Sbjct: 538  HRCPSAVLGGNGSAVSKAQQGERRILFWGIYYLDVFSALQLGVPRLLKDHEIECALPVAD 597

Query: 1720 HAHAGVSLADQVIKLEGQVSELSLSLLRFSKILGNILDSIFKRGMTSSAAQQVALIHENA 1899
            +    V+LA Q+I LEG+VS LSLS++RF+K+LGNILDSIFKRGM++S  +Q++L+HENA
Sbjct: 598  NDDQKVNLAGQMIALEGRVSMLSLSVIRFAKVLGNILDSIFKRGMSASLTKQISLVHENA 657

Query: 1900 LDNWRRGLPKNLTFELDVNGTIKIEELTGSAQNNQDFTKNA-SSDKKILMLLYFLVKCLV 2076
            LDNWRRGLP+ L FELDVNGTI ++E     Q   D + N  S + K LM+LYF+ KC++
Sbjct: 658  LDNWRRGLPQQLKFELDVNGTINMDEFNHLKQ--LDTSGNMYSKENKSLMVLYFMAKCMI 715

Query: 2077 HLPVLAAKPLLGGSSEPDKDATPXXXXXXXXXXXXXXXYVLLQQATNTFLSVQSCFKTRH 2256
            HLPV+A +PL+    +  + +TP               YVLLQQATNT L+V +  +  +
Sbjct: 716  HLPVVAKRPLVNDPEQSPESSTP----SNNCGDRSSSSYVLLQQATNTLLNVFTSLRNVY 771

Query: 2257 LPLAIDLPRIKARFALLSARGILEYTKGGALFQDNXXXXXXXXXXXXXXXXXXXPGSLSW 2436
             P+ I++ R K RF+LLSARG LEYTKGGALFQDN                   PG+LSW
Sbjct: 772  PPIPINVSRTKTRFSLLSARGSLEYTKGGALFQDNKALLLDLVKELEVDKKLELPGTLSW 831

Query: 2437 HSLILLDMATLLIMQPPQTKTDKLDKLLETRLNYYNKLMGR----------STLTSNGKR 2586
            HSL LLDM+  LI+QP  TK +KL+K+L+ +LNYYNKL  R          S+   N KR
Sbjct: 832  HSLKLLDMSISLILQPANTKPEKLEKMLQRKLNYYNKLTNRRSNLGGGRSASSPGGNSKR 891

Query: 2587 KNEENDATSKVSKLTPLSSEYNTPSDKRIKVESIGSSGNVPSNSESVHHFDDIQNDKFST 2766
            K +EN  +++  KLTP SS+ +TP DK+IK+E    +G VP  + S H   D  ++KF  
Sbjct: 892  KLDENQGSAEPPKLTPASSKGDTPPDKKIKLE---DTGFVPVRAVSQHSQSD--SEKFEN 946

Query: 2767 NWPSNNPQPNAIAEAFHLDPVLNGNPFSNGDLTAFFNSDNG-IP-QIGGGSSVLNLAGIX 2940
              P   PQ N+IAEAFHLDPVLN NPFSN DL AFFN++NG +P  +  G S+ N+A   
Sbjct: 947  FQPPVAPQ-NSIAEAFHLDPVLNNNPFSNTDLNAFFNTNNGNVPAALRSGGSLFNIAATA 1005

Query: 2941 XXXXXXXXXXXXXXXXXXPRKVATTVNDGLFRVPSNGDFLKDYYRIPGASSSQLNLMFMG 3120
                                  + T+N+GLF+VPSNGDFLKDYY +PGASSSQLNL+F+ 
Sbjct: 1006 AASGNNANSTAP----------SNTLNEGLFKVPSNGDFLKDYYNVPGASSSQLNLLFLN 1055

Query: 3121 PGNTGXXXXXXXXXXXXFTVP------GFGFTVDASLGLAPLLAWSPEAPQPSMPE---- 3270
               +              T        GFGF VDAS GLAPLL WSP A +P  P     
Sbjct: 1056 NNASNGKPQLNGSSAHSGTQAQNNDNNGFGFAVDASWGLAPLLEWSP-AGKPVDPGTCNA 1114

Query: 3271 ------IAQNADRRDSDPLSRTRLPSATIPASD-------PTHVISQDSNNVHLR----- 3396
                  +  +A   +S+  +  RL S T   +D       PT   S+       R     
Sbjct: 1115 NENSIILDTSAANMESEMATGGRLHSNTRSYTDAKNLDIVPTLPSSKQQQQQQHRLQKGA 1174

Query: 3397 -EQYRSNSF---NQLYAQDQ------SLDDTAITIPTRSHRGPRRRWNSSNGTTVIT--- 3537
             +Q RS S     Q   +        S DD  +T+ TR+HRGPRRRWNS+ G    T   
Sbjct: 1175 SQQPRSASIPTRKQSLCESNPTTATGSRDDGVLTMGTRNHRGPRRRWNSTTGQNTRTQLA 1234

Query: 3538 ------XXXXXXXXXXXXXXXXXXYKDLFRWQNSG 3624
                                      DLFRWQNSG
Sbjct: 1235 TMNTPQSERSKSQNIGEPGSTEDSLHDLFRWQNSG 1269

>ABL121C Chr2 complement(170782..174639) [3858 bp, 1285 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YMR280C
            (CAT8)
          Length = 1285

 Score =  870 bits (2248), Expect = 0.0
 Identities = 565/1328 (42%), Positives = 717/1328 (53%), Gaps = 123/1328 (9%)
 Frame = +1

Query: 10   RENESFGPRFIRTLGSQSLSGTNPLXXXXXXXXXXXXXXRTNNSAAPNAARSIS---PVT 180
            +E + +GPR IRTLGSQ+L G                       A+P AA   +   P++
Sbjct: 6    KEKDGYGPRIIRTLGSQALGGAGGSSRASSVSQSPGGPEGATGGASPAAAPQSTTGTPLS 65

Query: 181  SATPTSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGYXXXX 360
            S TPT NYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECK+SDKLSRRAFPRGY    
Sbjct: 66   SLTPT-NYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGYTETL 124

Query: 361  XXXXXXXXXXXXXXXXXCDLKDEQMHLVSKY-----------SSNKRHEPSST--EEGRM 501
                             CDLK+EQ+ LVSKY           S+NK+ +   T  E+ ++
Sbjct: 125  EERVRELEAENRRLVALCDLKEEQLRLVSKYGCASAPATSSSSANKKGDSDHTTLEDEQI 184

Query: 502  LEQLSNSDGGSLRVSSTNLYLLNKTTPA-------------VQDGSELHKCQGLGCNHAS 642
            L+QLSNSDGG+LRVSSTNLYLLNK T A              Q  S  +    L  +H +
Sbjct: 185  LQQLSNSDGGALRVSSTNLYLLNKKTAAFPLVQPVQQNLSPTQLRSNPYTRATLSPSHVA 244

Query: 643  HPH--------LHEKPVS-------------TSLSDPAAISFEQNEAPGLPAVKALNTMA 759
                       L   PV+             T+L+DP +ISFEQ++APGLPAVKAL+++A
Sbjct: 245  EADHVTDLRKGLPANPVAISSSVGQVPPYPFTNLNDPTSISFEQDQAPGLPAVKALSSLA 304

Query: 760  NHEYSAQLAYLVALSVPRSTDEILFIPQLLARLGQVHGLTSKQCXXXXXXXXXXXXXXQT 939
            +HE S+QLA LVA+S+PR+T+EILF+PQLLAR+GQ+HG TSKQC               T
Sbjct: 305  SHEESSQLAALVAVSIPRTTEEILFVPQLLARIGQMHGFTSKQCLYTASVLASLKEI--T 362

Query: 940  SFQGSPDYKDLKDKSLWEIDDCMTFFKTGCK----------FNLTS------------SK 1053
              + S   + LK K+LWEID+  TF   G +          FNL +            +K
Sbjct: 363  PRKTSSILEQLKAKNLWEIDNVDTFLLEGLQIDIRRGSSGDFNLENPNGYKLENEYHQTK 422

Query: 1054 DAXXXXXXXXXXXXXX-------YFGECHALIPVLNEAEFYKYYNKFKSNLTTDPEFFKT 1212
            DA                     +F + ++LIP+ + +EF  Y+ KFK N++T P FF +
Sbjct: 423  DAHPELQELTPLTFQEIEELIQLFFDDWYSLIPIFDRSEFESYWVKFKDNVST-PGFFTS 481

Query: 1213 STPSFAQRSKSISYKIFACILLVICQFGLMAKVKREQLPTKNKFSLLMSYYSNALLALKT 1392
                F +R KSISYKIFAC+LL +CQ GLM+KVKRE+    ++ + LM+YY  A+  +  
Sbjct: 482  GDTLFDRRHKSISYKIFACLLLTVCQMGLMSKVKRERHERGDRLNNLMTYYDRAISHVIM 541

Query: 1393 NPYFSVKNXXXXXXXXXXXXXXXXXNVGEVSSVYEIRGTVVSMAQQLRLHRCPSAVLGTE 1572
            NPYFS  +                 NVG+VS+VYE+RG VVS+ QQLRLHRCPSAVLG++
Sbjct: 542  NPYFSSSSTSIQSLQLLSLLLFYFLNVGDVSNVYELRGKVVSLTQQLRLHRCPSAVLGSD 601

Query: 1573 GSTMSKSEQGDRRLLFWGIYYLDVFGALQLGVPRLLKDHEIECALPISEHAHAGVSLADQ 1752
            GST+ K +QG+RR+LFWG+YYLDVF +LQLGVPRL+KDHEIECALP+S      V+LA Q
Sbjct: 602  GSTVGKIQQGERRVLFWGVYYLDVFSSLQLGVPRLMKDHEIECALPVSSDDDNHVNLAGQ 661

Query: 1753 VIKLEGQVSELSLSLLRFSKILGNILDSIFKRGMTSSAAQQVALIHENALDNWRRGLPKN 1932
            +I LEG++S  SLS++RFSK+LGN+LDSIFKRGMT S  +QVAL+HENALDNWR  LP N
Sbjct: 662  MIALEGKMSPFSLSIIRFSKVLGNVLDSIFKRGMTESMTKQVALVHENALDNWRHALPDN 721

Query: 1933 LTFELDVNGTIKIEELTGSAQNNQDFTKNASSDKKILMLLYFLVKCLVHLPVLAAKPLLG 2112
            L F+LDVNGTI +E+L    ++  +       +  I M LYFL K ++HLPV+A KP++ 
Sbjct: 722  LRFQLDVNGTINMEDLNQLKRDYLNKDTALKLNNAIFMALYFLAKIMIHLPVVATKPII- 780

Query: 2113 GSSEPDKDATPXXXXXXXXXXXXXXXYVLLQQATNTFLSVQSCFKTRHLPLAIDLPRIKA 2292
               +P  D                  YVLLQQATNTFL+V S   + +LPL +++ R K 
Sbjct: 781  DKPQPVVDTN----IPGSQIDRSSSSYVLLQQATNTFLNVLSSVSSLYLPLPLNITRTKT 836

Query: 2293 RFALLSARGILEYTKGGALFQDNXXXXXXXXXXXXXXXXXXXPGSLSWHSLILLDMATLL 2472
            RF L+SARG LEYTKGGALFQDN                   PG++SWHSL LLDMA  L
Sbjct: 837  RFGLVSARGSLEYTKGGALFQDNKNLLLDLLKDLEADKKLNMPGTISWHSLKLLDMAVNL 896

Query: 2473 IMQPPQTKTDKLDKLLETRLNYYNKLMG-----RSTLTSNGK---RKNEENDATSKVSKL 2628
            I+QPP TK +K +KLL+ ++NYYNKL+       ++L + G+   RK E   A     K 
Sbjct: 897  ILQPPNTKPEKQEKLLQKKINYYNKLIDSHLGPTASLPTPGQTAPRKPEPAHARPIPEKE 956

Query: 2629 TPLSSEYNTPSD-----------KRIKVESIGSSGNVPSNSESVHHFDDIQ--------N 2751
             P SS+ +   D           K++K+E+  S+   P    S  H D  +        N
Sbjct: 957  KPPSSKRHRGDDNAAASMPPLLEKKVKLEAPASNMPTPPAPISALHEDVPRVLDGHLGAN 1016

Query: 2752 DKFSTNWPSNNPQ-------PNAIAEAFHLDPVLNGNPFSNGDLTAFFNSDNGIPQIGGG 2910
               +     + P+        NAI EAF LDP+L   PFSN DL +FF    G+ Q    
Sbjct: 1017 SSLAVLAAKHEPEGSLHSSAGNAITEAFQLDPILQPTPFSNTDLPSFF----GVDQYAAP 1072

Query: 2911 SSVLNL-AGIXXXXXXXXXXXXXXXXXXXPRKVATTVNDGLFRVPSNGDFLKDYYRIPGA 3087
              +    AG                    P     +  D LF+VPSNGDFLKDYY   G 
Sbjct: 1073 PELQPFPAGYAAPDKVPQAAAQGPSATAGP---PLSSKDSLFKVPSNGDFLKDYY--SGM 1127

Query: 3088 SSSQLNLMFMGPGNTGXXXXXXXXXXXXF----TVPGFGFTVDASLGLAPLLAWSPEAPQ 3255
            SS+QLN +F  P                       PG+GF VDASLGLAPLLAWSP    
Sbjct: 1128 SSAQLNSLFTAPDRRDVRPRAPQPDRAPSDGLQQQPGYGFVVDASLGLAPLLAWSP---- 1183

Query: 3256 PSMPEIAQNADRRDSDPLSRTRLPSATIPASDPTHVISQDSNNVHLREQYRSNS-----F 3420
                        R +D L      +    A   THV    S    +  Q    S      
Sbjct: 1184 ------------RPADDLLLDDKGAKLASARSFTHVNKLSSIPTLMSTQPPPASAPHAKL 1231

Query: 3421 NQLYAQDQSLDDTAITIPTRSHRGPRRRWNSSNGTTVITXXXXXXXXXXXXXXXXXXYKD 3600
             Q    DQ  DD  +TIP R  RGPRR WNS+                           D
Sbjct: 1232 GQPAPPDQ--DDGILTIPPRDQRGPRRLWNSA------------LNQARPAAALDDSISD 1277

Query: 3601 LFRWQNSG 3624
            LFRWQNSG
Sbjct: 1278 LFRWQNSG 1285

>TDEL0B00530 Chr2 (95898..99803) [3906 bp, 1301 aa] {ON} Anc_8.845
            YMR280C
          Length = 1301

 Score =  858 bits (2217), Expect = 0.0
 Identities = 550/1332 (41%), Positives = 711/1332 (53%), Gaps = 125/1332 (9%)
 Frame = +1

Query: 1    MGERENESFGPRFIRTLGSQSLSGTNPLXXXXXXXXXXXXXXRT----NNSAAPNAARSI 168
            M E   +  GP++IRT+GSQSLSG NPL                    N S    +A+  
Sbjct: 1    MKEMAAKDGGPKYIRTMGSQSLSGLNPLSSGGSSQVSISHSPSVLLDDNGSEDVRSAKRK 60

Query: 169  SP-VTSATPT-----------------------SNYRVAQACDRCRSKKTRCDGKRPQCS 276
            SP + + TP+                       SN RVAQACDRCRSKKTRCDGKRPQCS
Sbjct: 61   SPSLLAGTPSQRPRLNTEVSEVASYTSVNSAANSNLRVAQACDRCRSKKTRCDGKRPQCS 120

Query: 277  QCAAVGFECKVSDKLSRRAFPRGYXXXXXXXXXXXXXXXXXXXXXCDLKDEQMHLVSKYS 456
            QCAAVGFEC++SDKLSRRAFPRGY                     CD+K++Q+HLVS + 
Sbjct: 121  QCAAVGFECRISDKLSRRAFPRGYTETLEERVRELEAENRRLVALCDIKEQQIHLVSHFP 180

Query: 457  SNKRHEPSSTEEGRMLEQLSNSDGGSLRVSSTNLYLLNKTTPAVQ--------------- 591
            +NK+    + E+  ML++L+ ++ G LR+SSTNL+LLNK     Q               
Sbjct: 181  TNKKKIGGNDEQ--MLQELTGANNGRLRISSTNLFLLNKARDGKQPATISNGDDHMTKPD 238

Query: 592  -DGSELHKCQGLGCNHASHPHLHEKPVSTSLSDPAAISFEQNEAPGLPAVKALNTMANHE 768
             + +  H+C  L CN+     LH KPVST+L+DP AISFEQNEAPGLPAVKAL +MA  E
Sbjct: 239  HEHTGKHRCDELDCNNK----LHSKPVSTNLNDPTAISFEQNEAPGLPAVKALTSMATRE 294

Query: 769  YSAQLAYLVALSVPRSTDEILFIPQLLARLGQVHGLTSKQCXXXXXXXXXXXXXXQTSFQ 948
             S QLA LVALSVPRST+EILFIPQLLAR+ Q+HG TSKQC                   
Sbjct: 295  QSTQLATLVALSVPRSTEEILFIPQLLARIIQIHGFTSKQCLYSVSLLASLKNNLPGPQL 354

Query: 949  GSPDYKD-LKDKSLWEIDDCMTFFKTGCKFNL-----TSSKDAXXXXXXXXXXXXXXYFG 1110
               D  D LK  +LWE+D+   FF    KFN+     +   ++              +F 
Sbjct: 355  VKWDELDYLKTTNLWEVDNLDKFFHETLKFNILRPGVSDDGESLGLSIKEIDELVNLFFD 414

Query: 1111 ECHALIPVLNEAEFYKYYNKFKSNLTTDPEFFKTSTPSFAQRSKSISYKIFACILLVICQ 1290
                 IP+L++ EF+ YY+K K +++T P  F+    +FA+R+K ISYKIFACIL  +CQ
Sbjct: 415  SWAVHIPILDKEEFFSYYDKLKKDISTQPGLFQEGPSNFARRNKIISYKIFACILFTVCQ 474

Query: 1291 FGLMAKVKREQLPTKNK-FSLLMSYYSNALLALKTNPYFSVKNXXXXXXXXXXXXXXXXX 1467
             GL+ KVK E++ + +  +  L SYY  A+  +  NPYF V                   
Sbjct: 475  MGLLTKVKGEKITSADSPYVKLTSYYHRAISLIYLNPYFGVLTTSLQSLQFLSLLLFYFV 534

Query: 1468 NVGEVSSVYEIRGTVVSMAQQLRLHRCPSAVLGTEGSTMSKSEQGDRRLLFWGIYYLDVF 1647
            N G VS++YE+RG VVSMAQQLRLHRCPSAVLG  GSTM+K EQGDRR+LFWGIYYLDVF
Sbjct: 535  NTGNVSAIYELRGRVVSMAQQLRLHRCPSAVLGGSGSTMNKREQGDRRVLFWGIYYLDVF 594

Query: 1648 GALQLGVPRLLKDHEIECALPISEHAHAGVSLADQVIKLEGQVSELSLSLLRFSKILGNI 1827
             ALQLGVPRL+KD EIECALP++E+    VSLA Q+I+LEG+VS+ SL+++RF+K+LGNI
Sbjct: 595  SALQLGVPRLIKDFEIECALPVAENDDREVSLAGQMIRLEGRVSQFSLAIIRFAKVLGNI 654

Query: 1828 LDSIFKRGMTSSAAQQVALIHENALDNWRRGLPKNLTFELDVNGTIKIEELTGSAQNNQD 2007
            LD++FKRGMT S ++++ALIHENALDNWRRGLP  L FE++VNGTI +++     QNN  
Sbjct: 655  LDTVFKRGMTESVSKKLALIHENALDNWRRGLPAELIFEIEVNGTINMDKFNEMKQNNAT 714

Query: 2008 FTKNASSDKKILMLLYFLVKCLVHLPVLAAKPLLGGSSEPDKD-----ATPXXXXXXXXX 2172
                 + ++ +L++ YFL KC++HLPV+A +P L  S +P+ D                 
Sbjct: 715  V---ENVEQMVLLVSYFLAKCMIHLPVVATRP-LPSSDDPNSDIKEEEEVNDKNGESNFA 770

Query: 2173 XXXXXXYVLLQQATNTFLSVQSCFKTRHLPLAIDLPRIKARFALLSARGILEYTKGGALF 2352
                  YVLLQQATNT L+V    K+ +LPL  ++ R KARFALLSARG LEY KGGALF
Sbjct: 771  IRSSSSYVLLQQATNTMLNVLESLKSIYLPLPFNVARTKARFALLSARGSLEYIKGGALF 830

Query: 2353 QDNXXXXXXXXXXXXXXXXXXXPGSLSWHSLILLDMATLLIMQPPQTKTDKLDKLLETRL 2532
             DN                   PG +SWH L LLDM   L++QPP TK +KLD+LL+ +L
Sbjct: 831  LDNKALLLDVVKSIEEDRKLEIPGVISWHGLKLLDMTISLLLQPPNTKVEKLDRLLKKKL 890

Query: 2533 NYYNKLMGRSTL-------TSNGKRKNEENDATS--------KVSKLTPLSSEYN-TPSD 2664
            NYY+++MGR  L        +NGKR+N  +D  S        + + LTP+SS+ + +P +
Sbjct: 891  NYYSRVMGRPILKTSSLRQEANGKRRNSSDDKLSRSGTEENFRATNLTPISSKSDGSPVE 950

Query: 2665 KRIKVESIGSSGNVPSNSESVHHFDDIQNDKFSTNWPSNNPQPNAIAEAFHLDPVLNGNP 2844
            K+IK+E    S +  +      + DD+ +       P++     AIAEA HLDPVLN N 
Sbjct: 951  KKIKLED--ESSDTSNALVDKSYTDDLSSSANQPQVPAST--QTAIAEALHLDPVLNNNI 1006

Query: 2845 FSNGDLTAFFNSDNGIPQIGGG--SSVLNLAGIXXXXXXXXXXXXXXXXXXXPRKVATTV 3018
             S  DL AFF  +  +P  GG   SS  N                        +   T V
Sbjct: 1007 LSVADLAAFFGGN--MPAAGGNQHSSYTNQNDFAPKHMRKEKEPAAFSDLAHKKSSVTGV 1064

Query: 3019 NDGLFRVPSNGDFLKDYYRIPGASSSQLNLMFMGPGN------TGXXXXXXXXXXXXFTV 3180
             DGLFRVPSN DFL D Y   G S   L L      N                    F V
Sbjct: 1065 -DGLFRVPSNADFLMDEYYPSGTSHINLTLFNNNANNHDDTFGLSDGHGKDTGVNTNFNV 1123

Query: 3181 PG-----------------------------------FGFTVDASLGLAPLLAWSPEAPQ 3255
             G                                   F F VDASLGLAPLL WSPE   
Sbjct: 1124 KGGHQSTNHSHLTNFNDRLQGNQLGFTNSGNMNSGSDFNFAVDASLGLAPLLDWSPEM-H 1182

Query: 3256 PSMPEIAQNADRR-----DSDPLSRTRLPSATIPASDPTHVISQDSNNVHLREQYRSNSF 3420
                 ++  +DR       S P S   L S      + T  +   +   H  +   +   
Sbjct: 1183 THGKTVSHASDRSGIILDSSIPQSEDAL-STLADRVNKTQSVPVPTLASHGYKNLPATQS 1241

Query: 3421 NQL-YAQDQSLDDTAITIPTRSHRGPRRR----WNSSNGTTVITXXXXXXXXXXXXXXXX 3585
             QL +  D + D+    +   S RGPRRR    +NS++ T+                   
Sbjct: 1242 EQLAHGIDSNDDNGPAMLTLGSRRGPRRRRQMDYNSTSNTS-------------NRVPQE 1288

Query: 3586 XXYKDLFRWQNS 3621
                +LF WQNS
Sbjct: 1289 ANLSNLFHWQNS 1300

>ZYRO0G14278g Chr7 complement(1141297..1145049) [3753 bp, 1250 aa]
            {ON} similar to uniprot|Q75DZ4 Ashbya gossypii ABL121C
            ABL121Cp and similar to YMR280C uniprot|P39113
            Saccharomyces cerevisiae YMR280C CAT8 Zinc cluster
            transcriptional activator
          Length = 1250

 Score =  803 bits (2073), Expect = 0.0
 Identities = 509/1185 (42%), Positives = 635/1185 (53%), Gaps = 112/1185 (9%)
 Frame = +1

Query: 28   GPRFIRTLGSQSLSG----------TNPLXXXXXXXXXXXXXXRT---NNSAAPNAARS- 165
            GPR+IRTLGSQSL G          T+P               ++     S++ NA R  
Sbjct: 24   GPRYIRTLGSQSLGGLAGSNSSRSSTSPPYEQDDDSKESSSVPQSASMTGSSSQNAQREG 83

Query: 166  --ISPVTSATPTSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFP 339
                 + S   + N RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECK+SD+LSRRAFP
Sbjct: 84   GGNGSIASPAGSQNLRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDRLSRRAFP 143

Query: 340  RGYXXXXXXXXXXXXXXXXXXXXXCDLKDEQMHLVSKYSSNKRHEPSST--EEGRMLEQL 513
            RGY                     CD+K++Q+HL S+     +H P     ++ RML +L
Sbjct: 144  RGYTETLEERVRELEAENRRLVALCDIKEQQIHLFSQ-----QHSPGGRRKDDERMLREL 198

Query: 514  SNSDGGSLRVSSTNLYLLN-------------KTTPAVQDGSELHKCQGLGCNHASHPHL 654
             +++GGSL +SSTNLYLLN             +     Q   + H C GL C       L
Sbjct: 199  QSANGGSLNISSTNLYLLNTGSHQRQGPQGPQQQEQLTQQKRQPHVCDGLCCAGK----L 254

Query: 655  HEKPVSTSLSDPAAISFEQNEAPGLPAVKALNTMANHEYSAQLAYLVALSVPRSTDEILF 834
            H KPVST+L+DP ++SFEQ+EAPGLPAV+AL ++A  E S QLA LVALSVPRST+EILF
Sbjct: 255  HVKPVSTNLNDPTSVSFEQSEAPGLPAVQALTSVATREQSNQLATLVALSVPRSTEEILF 314

Query: 835  IPQLLARLGQVHGLTSKQCXXXXXXXXXXXXXX-QTSFQGSPDYKDLKDKSLWEIDDCMT 1011
            IPQLLAR+ Q++G TSKQC               +         + L   +LWE+DD   
Sbjct: 315  IPQLLARIRQIYGFTSKQCLYTVSLLSSLKSSLPEPHLVKHEPLETLASTNLWEMDDLEQ 374

Query: 1012 FFKTGCKFNLTSS-----KDAXXXXXXXXXXXXXXYFGECHALIPVLNEAEFYKYYNKFK 1176
            FF    KF L S      K                +F      IP+L + EFY Y+N+FK
Sbjct: 375  FFAEIFKFKLESKSPSSYKGGAQLNLSEIEELISIFFEHSSIHIPILVKDEFYHYFNQFK 434

Query: 1177 SNLTTDPEFFKTSTPS---FAQRSKSISYKIFACILLVICQFGLMAKVKREQLPTKNKFS 1347
             N+  + EF KT        A+R K ISYKIF CI+L++CQ GL++K+K E L   +K  
Sbjct: 435  ENVLQNLEFLKTPLQGPALTARRGKIISYKIFGCIILMLCQLGLLSKIKAENLGATSKHH 494

Query: 1348 LLMSYYSNALLALKTNPYFSVKNXXXXXXXXXXXXXXXXXNVGEVSSVYEIRGTVVSMAQ 1527
             L SYY  A+  +  NPYF V +                 N+G VS++YE+RG VVSMAQ
Sbjct: 495  RLASYYHKAISLVYMNPYFGVLSTSLQSLQFLSLVLFYFLNIGNVSAIYELRGRVVSMAQ 554

Query: 1528 QLRLHRCPSAVLGTEGSTMSKSEQGDRRLLFWGIYYLDVFGALQLGVPRLLKDHEIECAL 1707
            QLRLHRCPSAVLG  GSTM+K EQGDRR+LFWGIYYLDVF ALQLGVPRL+KD EIECAL
Sbjct: 555  QLRLHRCPSAVLGGAGSTMNKREQGDRRVLFWGIYYLDVFSALQLGVPRLIKDFEIECAL 614

Query: 1708 PISEHAHAGVSLADQVIKLEGQVSELSLSLLRFSKILGNILDSIFKRGMTSSAAQQVALI 1887
            P++++    V+LA Q I+LEGQV+  SL+++RFSK+LGNILDSIFKRGMT S  +QV+LI
Sbjct: 615  PVADNDDRTVNLAGQQIRLEGQVTNYSLAIIRFSKVLGNILDSIFKRGMTESITKQVSLI 674

Query: 1888 HENALDNWRRGLPKNLTFELDVNGTIKIEELTGSAQNNQDFTKNASSDKKILMLLYFLVK 2067
            HENALDNWR GLPK L FELDVNGTI I+E     Q N    +   S+   L+++YFL K
Sbjct: 675  HENALDNWRHGLPKELIFELDVNGTINIDEFNRLKQMNVTVER---SENMTLLVMYFLAK 731

Query: 2068 CLVHLPVLAAKPLLGGSSEPDKDAT-------------PXXXXXXXXXXXXXXXYVLLQQ 2208
            C++HLPV+A +PL    S    + +             P               YVLLQQ
Sbjct: 732  CMIHLPVVATRPLPTNDSNDTGETSNATSNGNNVRARDPSTERNQAAADRSSSSYVLLQQ 791

Query: 2209 ATNTFLSVQSCFKTRHLPLAIDLPRIKARFALLSARGILEYTKGGALFQDNXXXXXXXXX 2388
            ATNT L+V    KT  LPL +++ R KARFALLSARG LEYTKGGALF DN         
Sbjct: 792  ATNTMLNVLESLKTLFLPLPLNISRTKARFALLSARGSLEYTKGGALFLDNKSLLLDVIK 851

Query: 2389 XXXXXXXXXXPGSLSWHSLILLDMATLLIMQPPQTKTDKLDKLLETRLNYYNKLMGRSTL 2568
                      PG +SW+SL LLDM+  L++QPP T+  KLD+LL+ +LNYYN+LMGR T+
Sbjct: 852  DLEEDRKLDLPGVISWNSLKLLDMSINLLLQPPNTEVGKLDRLLKKKLNYYNRLMGRPTV 911

Query: 2569 TSNGKRKNEENDATSKVSKLTPLSS--EYNTPSDKRIKVESIGSSGNVPSNSESVHHFDD 2742
                     + +  SK   LTP SS  E +TP+ KRIK+E       VP   + +     
Sbjct: 912  ---------KQEPASKGHDLTPASSKDEEDTPAAKRIKIEETSIPLAVPQQQQHMQAPAP 962

Query: 2743 IQNDKFSTNWPSNNPQP-----------------NAIAEAFHLDPVLNGN-PFSNGDLTA 2868
            +   +     P   PQP                  A AEA  LDPVLN N  F N   T 
Sbjct: 963  VMVQEKQQPQPQPQPQPQPQPQLQPQPQQLQLPQTAFAEALQLDPVLNSNVSFQNAPPTT 1022

Query: 2869 FFNSDNGIPQIGGGSSVLNLAGIXXXXXXXXXXXXXXXXXXXPRKVATTVND---GLFRV 3039
             ++  +  P                                    + T  +D   GLF+V
Sbjct: 1023 LYDGPHDQPH---------------------QYQHHAQTQPQDPHLDTRSSDKLHGLFKV 1061

Query: 3040 PSNGDFLKD-------------------------YYRIPGASS--------SQLNL--MF 3114
            PS  DFL D                         Y   PG+ S        S LNL  +F
Sbjct: 1062 PSTADFLMDDSANSQLNFLLGTTELGVLDPSQPSYTNNPGSGSAIGINNMPSGLNLSNLF 1121

Query: 3115 MGPGNTG-XXXXXXXXXXXXFTVPGFGFTVDASLGLAPLLAWSPE 3246
               G+T                  GF F VDASLGLAPLLAW+P+
Sbjct: 1122 DLEGSTDQPPTNTNATQATQANSGGFNFAVDASLGLAPLLAWTPD 1166

>KLLA0D01452g Chr4 (124018..128355) [4338 bp, 1445 aa] {ON} similar to
            uniprot|Q75DZ4 Ashbya gossypii ABL121C ABL121Cp and
            similar to YMR280C uniprot|P39113 Saccharomyces
            cerevisiae YMR280C CAT8 Zinc cluster transcriptional
            activator
          Length = 1445

 Score =  800 bits (2067), Expect = 0.0
 Identities = 508/1317 (38%), Positives = 690/1317 (52%), Gaps = 170/1317 (12%)
 Frame = +1

Query: 178  TSATPTSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGYXXX 357
            T+ T T +YRVAQACDRCR+KK RCDGKRPQC+QCAAVGFECK+SDKLSRRAFPRGY   
Sbjct: 169  TNGTTTPSYRVAQACDRCRAKKIRCDGKRPQCTQCAAVGFECKISDKLSRRAFPRGYTET 228

Query: 358  XXXXXXXXXXXXXXXXXXCDLKDEQMHLVSKYSSNKRH---EPSSTEEGRMLEQLSNSDG 528
                              CDLK+EQ+HLVSKYS++K     E  STEE ++L +LS ++G
Sbjct: 229  LEERVRELEAENRRLVALCDLKEEQLHLVSKYSNSKDENGVEIPSTEEEQILHELSKTNG 288

Query: 529  GSLRVSSTNLYLLNKTTPAVQDG---------------------------SELHKCQGLG 627
            GSLRVSSTNLYLLNK      D                            + +       
Sbjct: 289  GSLRVSSTNLYLLNKKASPGDDSHIESSEPSIPVRKVAITAPSPRIMSPRNSVADSDPSQ 348

Query: 628  CNHASHPHLHEKPVS---TSLSDPAAISFEQNEAPGLPAVKALNTMANHEYSAQLAYLVA 798
             N  ++ H+H    +    + +DP  ISFEQNEAPGLPA+KAL++++ ++   QLA LVA
Sbjct: 349  TNTGNNDHIHSNNNNHNQNNSTDPYGISFEQNEAPGLPALKALSSLSKYKQGTQLATLVA 408

Query: 799  LSVPRSTDEILFIPQLLARLGQVHGLTSKQCXXXXXXXXXXXXXXQTSFQGSPDYKDLKD 978
            +SVPR+T+EILF+PQLLAR+GQ+HG TSKQC               +S    P+ + LK+
Sbjct: 409  VSVPRTTEEILFVPQLLARIGQIHGFTSKQCIYTASVLASLKENNISSIP--PELEVLKN 466

Query: 979  KSLWEIDDCMTFFKTGCKFNLTS----SKDAXXXXXXXXXXXXXXYFGECHALIPVLNEA 1146
             +LWEIDD + F+K   K +  +       +              +F + + LIP+ ++ 
Sbjct: 467  HNLWEIDDVLHFWKNVFKLDFMTHTAVDHSSTHLNFAEVEELMQLFFQDWYELIPLFDKN 526

Query: 1147 EFYKYYNKFKSNLTTDPEFF-KTSTPSFAQRSKSISYKIFACILLVICQFGLMAKVKREQ 1323
            EF  YY KFK N+T DP FF +     F  R++SISYKIF+C+L++I Q G+++K+KR++
Sbjct: 527  EFNSYYEKFKLNVT-DPNFFVRKDDTVFNNRTRSISYKIFSCLLIIIVQMGMLSKIKRDK 585

Query: 1324 LPTKNKFSLLMSYYSNALLALKTNPYFSVKNXXXXXXXXXXXXXXXXXNVGEVSSVYEIR 1503
            + T  K S LM YY   +  +  NPYF+ +N                 NVG++SS+YE+R
Sbjct: 586  I-TSGKLSTLMKYYDKLMTHIWINPYFNSRNTSIQVLQCLSMLLFYMLNVGDISSIYELR 644

Query: 1504 GTVVSMAQQLRLHRCPSAVLGTEGSTMSKSEQGDRRLLFWGIYYLDVFGALQLGVPRLLK 1683
            G VVSM+QQLRLHRCPSAVLG +GST+SK +QG+RR+LFW IYYLDVF ALQLGVPRLLK
Sbjct: 645  GKVVSMSQQLRLHRCPSAVLGGDGSTVSKVQQGERRILFWSIYYLDVFSALQLGVPRLLK 704

Query: 1684 DHEIECALPISEHAHAGVSLADQVIKLEGQVSELSLSLLRFSKILGNILDSIFKRGMTSS 1863
            D EIECALP++      V+LA Q+I LEG+VS+ SLS++RF+K++GNILDS FKRGMT+S
Sbjct: 705  DFEIECALPVTSDDDRQVNLAGQMIALEGKVSQFSLSVIRFAKVMGNILDSTFKRGMTTS 764

Query: 1864 AAQQVALIHENALDNWRRGLPKNLTFELDVNGTIKIEELTGSAQNNQDFTKNASS---DK 2034
              +Q AL+HENALDNWR GL K+L F+LDVNGTI ++E     Q ++  +   ++   + 
Sbjct: 765  LTKQAALVHENALDNWRHGLQKDLFFQLDVNGTINMDEFNQQKQYSKSLSPRTAAFTHNS 824

Query: 2035 KILMLLYFLVKCLVHLPVLAAKPLLGGSSEPDKDATPXXXXXXXXXXXXXXXYVLLQQAT 2214
             +LM LYF+ KC++HLPV+A KPL+  + +   D                  YVLLQQAT
Sbjct: 825  LVLMTLYFMAKCMIHLPVVATKPLVAEAIQTPTD----NQTENGSVDRSLSSYVLLQQAT 880

Query: 2215 NTFLSVQSCFKTRHLPLAIDLPRIKARFALLSARGILEYTKGGALFQDNXXXXXXXXXXX 2394
            NT L+V +   + +LPL I+L R K RF L SARG LEYTKGGALFQDN           
Sbjct: 881  NTLLNVLTALNSIYLPLPINLARTKTRFGLFSARGSLEYTKGGALFQDNKALLLDLVKEL 940

Query: 2395 XXXXXXXXPGSLSWHSLILLDMATLLIMQPPQTKTDKLDKLLETRLNYYNKLMGRSTLTS 2574
                    PG+ SWHSL L D++  LI+QP  +  +K +K+++ ++NYYNKLMG+ T+  
Sbjct: 941  ETDKKLELPGNTSWHSLKLFDLSINLILQPVNSNPEKTEKMIQKKINYYNKLMGQPTVAV 1000

Query: 2575 NGKRKNEENDATSKVSKLTPLSSEYNTPSDKRIKVESIGSSGNVPS-----NSESVHHFD 2739
              KR  +  + TS                 K++KVE   S  N+ +      +++VH  +
Sbjct: 1001 KRKRDPKATENTS-----------------KKVKVEDDHSQDNLHNITTGETTDTVHSEE 1043

Query: 2740 DIQNDKFSTN-WPSNNPQPNAIAEAFHLDPVLNGNPFSNGDLTAFFNS------------ 2880
             +++     N +P N      I EAF +DPVLN N FSN DL   FNS            
Sbjct: 1044 LVKDVPKELNVYPENY---TTIEEAFQMDPVLNTNLFSNTDLKTLFNSGIFENAGSIHNN 1100

Query: 2881 ----------------------------------DNGIPQIGGGSSVLNLAGIXXXXXXX 2958
                                              D+G+      +S+LNL+         
Sbjct: 1101 INDNNNNNNNTNNTNNNNGSSRNIHNLGAGIEDIDHGMSLRSNDASLLNLSNALGNHGNS 1160

Query: 2959 XXXXXXXXXXXXPRKVATTVNDGLFRVPSNGDFLKDYY----------------RIPGAS 3090
                           ++T  +D LF+VPSNGDFLKDYY                   G S
Sbjct: 1161 AEGMKDGTSVSNLLNLST--SDSLFKVPSNGDFLKDYYINNMSNTGLSNLHTSSVNKGPS 1218

Query: 3091 SSQLNLMFMGPGNTGXXXXXXXXXXXXF-------------TVPGFGFTVDASLGLAPLL 3231
             SQL  +FM  G+                             + GF F  DASLGLAPLL
Sbjct: 1219 LSQLGSLFMSSGSGTNLPYSNVRGESKHPSGVNLNKQRAQPAMDGFSFAADASLGLAPLL 1278

Query: 3232 AWSPEA-PQ-----------PSMPEIAQNADRRDSDP--------LSRTRLPSATIPASD 3351
            AWSP+A PQ           P+   + ++ D   ++           +T  P +   +S 
Sbjct: 1279 AWSPDAKPQLNSNNGNDGLNPATGIVLESGDNDSTNASVVQLQQHQQQTHHPPSHNSSSI 1338

Query: 3352 PTHVISQDSNNVHLREQYRSNSFNQLYA-------------QDQSLD------------- 3453
            P    S  S+  +   Q    SF+ +++             Q Q L              
Sbjct: 1339 PMGKQSSTSDRQNSHHQDNVGSFHSMHSPTIPEQTSAQGLHQHQMLGMPNSTLNSDTNTG 1398

Query: 3454 --DTAITIPTRSHRGPRRRWNSSNGTTVITXXXXXXXXXXXXXXXXXXYKDLFRWQN 3618
              +   +I + + RGPRRRWN++  ++                       DL RWQN
Sbjct: 1399 GANVTNSISSTNRRGPRRRWNNAASSS------------DPNSAGDSSVSDLLRWQN 1443

 Score = 39.7 bits (91), Expect = 0.065
 Identities = 18/19 (94%), Positives = 18/19 (94%)
 Frame = +1

Query: 28 GPRFIRTLGSQSLSGTNPL 84
          GPRFIRTLGSQSLSG NPL
Sbjct: 19 GPRFIRTLGSQSLSGLNPL 37

>YMR280C Chr13 complement(827028..831329) [4302 bp, 1433 aa] {ON}
            CAT8Zinc cluster transcriptional activator necessary for
            derepression of a variety of genes under non-fermentative
            growth conditions, active after diauxic shift, binds
            carbon source responsive elements
          Length = 1433

 Score =  602 bits (1553), Expect = 0.0
 Identities = 416/1097 (37%), Positives = 557/1097 (50%), Gaps = 138/1097 (12%)
 Frame = +1

Query: 13   ENESFGPRFIRTLGSQSLSGTNPLXXXXXXXXXXXXXXRTNNSAA-----PNAARSISPV 177
            + +   PR IRTLGSQ+LSG +                RT++S A      N   ++   
Sbjct: 7    DRQGLEPRVIRTLGSQALSGPS-------------ISNRTSSSEANPHFSKNVKEAMIKT 53

Query: 178  TSATPTSN--YRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGYX 351
             S TP S   YR+AQACDRCRSKKTRCDGKRPQCSQCAAVGFEC++SDKL R+A+P+GY 
Sbjct: 54   ASPTPLSTPIYRIAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLLRKAYPKGYT 113

Query: 352  XXXXXXXXXXXXXXXXXXXXCDLKDEQMHLVSKYSSNKRHEPSSTEEGRMLEQLSNSDGG 531
                                CD+K++Q+ LVS+  S  +    +T  G     L ++   
Sbjct: 114  ESLEERVRELEAENKRLLALCDIKEQQISLVSQ--SRPQTSTDNTINGNFKHDLKDAP-- 169

Query: 532  SLRVSSTNLYLLNKTT-PAVQDGS---------------------ELHKCQGLGCNHASH 645
             L +SSTN+YLLN+T    +Q+G                      + H C G+ C +   
Sbjct: 170  -LNLSSTNIYLLNQTVNKQLQNGKMDGDNSGSAMSPLGAPPPPPHKDHLCDGVSCTN--- 225

Query: 646  PHLHEKPVSTSLSDPAAISFEQNEAPGLPAVKALNTMANHEYSAQLAYLVALSVPRSTDE 825
             HLH KP STSL+DP AISFEQ+EAPGLPAVKAL +M  H+ S QLA LV+LS+PRST+E
Sbjct: 226  -HLHVKPTSTSLNDPTAISFEQDEAPGLPAVKALKSMTTHQRSTQLATLVSLSIPRSTEE 284

Query: 826  ILFIPQLLARLGQVHGLTSKQCXXXXXXXXXXXXXX----------QTSFQGSPDYKDLK 975
            ILFIPQLL R+ Q+ G  SKQC                         T  +   + K L 
Sbjct: 285  ILFIPQLLTRIRQIFGFNSKQCLYTVSLLSSLKNRLPAPRLLAPSTSTKLKEKDEDKKLD 344

Query: 976  DKS----------LWEIDDCMTFFKTGCKFNLTS----------SKDAXXXXXXXXXXXX 1095
            D S          L E  D   F     KFN+ S           +D             
Sbjct: 345  DDSAFVKRFQSTNLSEFVDLKKFL-ISLKFNINSFSKQSEKPANDQDDELLSLTEIKELL 403

Query: 1096 XXYFGECHALIPVLNEAEFYKYYNKFKS---NLTTDPEFFKTSTPSFAQRSKSISYKIFA 1266
              +F      +P+LN   F  Y+N F     +L+T+       T +  + + + +++IFA
Sbjct: 404  HLFFKFWSNQVPILNNDHFLIYFNNFVEVVKHLSTE----NLETNNTTKSTVTTNHEIFA 459

Query: 1267 CILLVICQFGLMAKVKREQLP------TKNKFSLLMSYYSNALLALKTNPYF-SVKNXXX 1425
              LL++ Q GL+ K+K E++        K K++ LM+YY    L +  NPYF ++     
Sbjct: 460  LKLLMMLQMGLLVKIKMEKIKYTVPKNPKAKYARLMAYYHQLSLIIPKNPYFLNMSTTSL 519

Query: 1426 XXXXXXXXXXXXXXNVGEVSSVYEIRGTVVSMAQQLRLHRCPSAVLGTEGS-TMSKSEQG 1602
                          NVG++S++Y +RG +VSMAQQLRLHRCPSAVL    +  + K EQ 
Sbjct: 520  PSLQLLSLASFYYLNVGDISAIYGVRGRIVSMAQQLRLHRCPSAVLSVHSNPVLQKFEQS 579

Query: 1603 DRRLLFWGIYYLDVFGALQLGVPRLLKDHEIECALPISEHAHAGVSLADQV--------- 1755
            +RRLLFW IYY+DVF +LQLGVPRLLKD +IECALPIS+     V   DQ+         
Sbjct: 580  ERRLLFWAIYYVDVFASLQLGVPRLLKDFDIECALPISD-----VEYKDQLSMENEKADK 634

Query: 1756 ----IKLEGQVSELSLSLLRFSKILGNILDSIFKRGMTSS-AAQQVALIHENALDNWRRG 1920
                I+L+GQVS  SL ++RF+KILGNILDSIFKRGM       +VAL+HENALDNWR  
Sbjct: 635  KAKKIQLQGQVSSFSLQIIRFAKILGNILDSIFKRGMMDERITSEVALVHENALDNWRNQ 694

Query: 1921 LPKNLTFELDVNGTIKIEELTGSAQNNQDFTKNASSD-----KKILMLLYFLVKCLVHLP 2085
            LP+   F++ VNGT+ ++E+  + Q N + TK    D     KKIL+L YFL K ++HLP
Sbjct: 695  LPEMYYFQITVNGTVNLDEIRATNQRNTE-TKFDKKDIILFEKKILLLFYFLAKSMIHLP 753

Query: 2086 VLAAKPL----------------LGGSSEPDKDATPXXXXXXXXXXXXXXXYVLLQQATN 2217
            V+A KPL                       ++D                  Y++LQQATN
Sbjct: 754  VIATKPLPKNVDNATKKKQSMFNNDSKGATNQDHMILDVDMTSPAIRTSSSYIILQQATN 813

Query: 2218 TFLSVQSCFKTRHLPLAIDLPRIKARFALLSARGILEYTKGGALFQDNXXXXXXXXXXXX 2397
              L++     + +LPL +++ R   RF+LL ARG LEYTKGGALF DN            
Sbjct: 814  ATLTIFQAINSMYLPLPLNVSRTLIRFSLLCARGSLEYTKGGALFLDNKNLLLDTIKDIE 873

Query: 2398 XXXXXXXPGSLSWHSLILLDMATLLIMQPPQTKTDKLDKLLETRLNYYNKLMG------- 2556
                   PG  SWH+L L DM+  L+++ P  K ++LDK LE +LNYYN+LMG       
Sbjct: 874  NDRLLDLPGIASWHTLKLFDMSINLLLKAPNVKVERLDKFLEKKLNYYNRLMGLPPATTT 933

Query: 2557 ----------RSTL-----TSNGKRKNEE------NDATSKVSKLTPLSSEYNTPS-DKR 2670
                      +++L     T N KR+N E      ND+ +  +     S   NT + +KR
Sbjct: 934  SLKPLFGSQSKNSLENRQRTPNVKRENPEHEYLYGNDSNNNNNSEAGHSPMTNTTNGNKR 993

Query: 2671 IKVES----IGSSGNVPSNSESVHHFDDIQNDKFSTNWPSNNPQPNAIAEAFHLDPVLNG 2838
            +K E         G + S  E+ H+F   QND    N  ++N  P +             
Sbjct: 994  LKYEKDAKRNAKDGGI-SKGENAHNF---QNDT-KKNMSTSNLFPFS------------- 1035

Query: 2839 NPFSNGDLTAFFNSDNG 2889
              FSN DLTA F    G
Sbjct: 1036 --FSNTDLTALFTHPEG 1050

 Score = 37.7 bits (86), Expect = 0.25
 Identities = 43/180 (23%), Positives = 65/180 (36%), Gaps = 35/180 (19%)
 Frame = +1

Query: 3187 FGFTVDASLGLAPLLAWSPEAPQPSMPEIAQNADRRD-------SDPLSRTRLPSATIPA 3345
            + + VDASLGLAPLL  +P+    +      N  +         +D L R+R+ +  +  
Sbjct: 1266 YDYIVDASLGLAPLLVDTPDISNTNTTSTTSNRSKNSIILDTTFNDDLDRSRMNAREV-- 1323

Query: 3346 SDPTHVISQDSNNVHLREQYRSNSFNQLYAQDQSLD---------------DTAITI--- 3471
             +PT  I        +  +  SN  +     D   D               DT  T+   
Sbjct: 1324 LNPTDSILSQGMVSSVSTRNTSNQRSLSSGNDSKGDSSSQENSKSATGNQLDTPSTLFQM 1383

Query: 3472 ------PTRSHRGPRR----RWNSSNGTTVITXXXXXXXXXXXXXXXXXXYKDLFRWQNS 3621
                  P+ SHRGPRR    R+N+    +                       DLF+WQN+
Sbjct: 1384 RRTSSGPSASHRGPRRPQKNRYNTDRSKS-----------SGGGSSNTDNVSDLFQWQNA 1432

>Skud_13.452 Chr13 complement(800289..804587) [4299 bp, 1432 aa] {ON}
            YMR280C (REAL)
          Length = 1432

 Score =  598 bits (1542), Expect = 0.0
 Identities = 400/1074 (37%), Positives = 538/1074 (50%), Gaps = 120/1074 (11%)
 Frame = +1

Query: 13   ENESFGPRFIRTLGSQSLSGTNPLXXXXXXXXXXXXXXRTNNSAAPNAARSISPVTSATP 192
            + +   PR IRTLGSQ+LSG+                   N   + N   +    TS TP
Sbjct: 6    DRQGLEPRIIRTLGSQTLSGST--------VPNRTLSSEANPHFSENIKEATVNTTSPTP 57

Query: 193  TSN--YRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGYXXXXXX 366
             S   YR+AQACDRCRSKKTRCDGKRPQCSQCAAVGFEC++SDKL R+A+P+GY      
Sbjct: 58   LSTPIYRIAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLLRKAYPKGYTESLEE 117

Query: 367  XXXXXXXXXXXXXXXCDLKDEQMHLVSKYSSNKRHEPSSTEEGRMLEQLSNSDGGSLRVS 546
                           CD+K++Q+ LVS+  S       S  +G   ++L ++    L +S
Sbjct: 118  RVRELEAENKRLLALCDIKEQQISLVSQ--SRPSTSLDSNVDGNCKKELKDAP---LNLS 172

Query: 547  STNLYLLNKTTPAVQDGSEL----------------------HKCQGLGCNHASHPHLHE 660
            STN+YLLN+T        ++                      H C G+ C +     LH 
Sbjct: 173  STNIYLLNQTVNKQLQSGKMDNDNSDAAIDSLAASPSPPPKDHVCDGVSCTN----RLHV 228

Query: 661  KPVSTSLSDPAAISFEQNEAPGLPAVKALNTMANHEYSAQLAYLVALSVPRSTDEILFIP 840
            KP STSLSDP AISFEQNEAPGLPAVKAL +M  H+ S QLA LV+LS+PRST+EILFIP
Sbjct: 229  KPTSTSLSDPTAISFEQNEAPGLPAVKALKSMTTHQRSTQLATLVSLSIPRSTEEILFIP 288

Query: 841  QLLARLGQVHGLTSKQCXXXXXXXXXXXXXX--------------------QTSFQGSPD 960
            QLL R+ Q+ G  SKQC                                  +T    S  
Sbjct: 289  QLLTRIRQIFGFNSKQCLYTVSLLSSLKNRLPAPSILLPSTSTNSKEKNEDKTPNDDSAF 348

Query: 961  YKDLKDKSLWEIDDCMTFFKTGCKFNLTS----------SKDAXXXXXXXXXXXXXXYFG 1110
             K  +  SL E  D   F     KF++ S            D+              +F 
Sbjct: 349  LKTFQSTSLSEFVDLKKFL-ISLKFDIDSFSKQPEKQANGHDSDLLSLTEIKELLHLFFK 407

Query: 1111 ECHALIPVLNEAEFYKYYNKFKSNLTTDPEFFKTSTPSFAQRSKSISYKIFACILLVICQ 1290
                 +P+LN   F  Y+N F   +  D     T   S  + + + +++IF   LL++ Q
Sbjct: 408  FWSNQVPILNNDHFLLYFNNFVE-IIKDFSLISTKANSTTKNNVTTNHEIFTLKLLMMLQ 466

Query: 1291 FGLMAKVKREQLP------TKNKFSLLMSYYSNALLALKTNPYF-SVKNXXXXXXXXXXX 1449
             GL+ K+K++++       +  K+  LMSYY    L +  NPYF ++             
Sbjct: 467  MGLLIKIKKDKIKDTVPRNSNAKYIRLMSYYHQISLIIPKNPYFLNMSTTSLPSLQLLSL 526

Query: 1450 XXXXXXNVGEVSSVYEIRGTVVSMAQQLRLHRCPSAVLGTEGS-TMSKSEQGDRRLLFWG 1626
                  NVG++S++Y IRG +VSMAQQLRLHRCPSAVL    +  + K EQ +RRLLFW 
Sbjct: 527  ASFYYLNVGDISAIYGIRGRIVSMAQQLRLHRCPSAVLSVHSNPVLQKFEQSERRLLFWA 586

Query: 1627 IYYLDVFGALQLGVPRLLKDHEIECALPISEHAHAGVSLADQV-------------IKLE 1767
            IYY+DVF +LQLGVPRLLKD +IECALPIS+     V   DQ+             I+L+
Sbjct: 587  IYYVDVFASLQLGVPRLLKDFDIECALPISD-----VEYKDQLSMENEKMKNKAKKIQLQ 641

Query: 1768 GQVSELSLSLLRFSKILGNILDSIFKRGMTSS-AAQQVALIHENALDNWRRGLPKNLTFE 1944
            GQVS  SL ++RF+KILGNILDSIFKRGM     + +VAL+HENALDNWR  LP+   F+
Sbjct: 642  GQVSSFSLQIIRFAKILGNILDSIFKRGMMDERISSEVALVHENALDNWRNQLPEMYYFK 701

Query: 1945 LDVNGTIKIEELTGSAQNNQDF-----TKN-ASSDKKILMLLYFLVKCLVHLPVLAAKPL 2106
            + VNGT+ ++E+   A N++D      TK+    +KKIL+L YFL K ++HLPV+A KPL
Sbjct: 702  ITVNGTVNLDEI--RANNSRDIETPFETKDIILFEKKILLLFYFLAKSMIHLPVIATKPL 759

Query: 2107 L----------------GGSSEPDKDATPXXXXXXXXXXXXXXXYVLLQQATNTFLSVQS 2238
                                   + D                  Y++LQQATN  L++  
Sbjct: 760  SKNVDNVMKKKQSMFNNDSKGTNNHDHMAVDVDMTSPAIRTSSSYIILQQATNATLTIFQ 819

Query: 2239 CFKTRHLPLAIDLPRIKARFALLSARGILEYTKGGALFQDNXXXXXXXXXXXXXXXXXXX 2418
                 +LPL +++ R   RF+LL ARG LEYTKGGALF DN                   
Sbjct: 820  SINWMYLPLPLNVSRTLVRFSLLCARGSLEYTKGGALFLDNKNLLLDTIKDIENDRLLEL 879

Query: 2419 PGSLSWHSLILLDMATLLIMQPPQTKTDKLDKLLETRLNYYNKLMGRSTLTS-------- 2574
            PG  SWH+L L DM   L+++ P  K ++LDK LE +LNYYN+LMG    T+        
Sbjct: 880  PGIASWHTLKLFDMTINLLLKAPNVKVERLDKFLEKKLNYYNRLMGLPLATTTSLKPLFG 939

Query: 2575 -NGKRKNEENDATSKVSKLTPLSSEY---------NTPSDKRIKVESIGSSGN----VPS 2712
               K   E     S V + TP  ++Y         N P   + +  ++G++         
Sbjct: 940  FQSKNSPETKPRKSTVKRETP-DNDYLYGNDTNNNNNPETDQPRTANVGNTNKRLKYAKD 998

Query: 2713 NSESVHHFDDIQNDKFSTNWPSNNPQPNAIAEAFHLDPVLNGNPFSNGDLTAFF 2874
              +SV   D I   + ++N+  +N +  + +  F          FSN DLTA F
Sbjct: 999  TRQSVDK-DGIAKAQDASNFHHDNKKTMSASNLFPFS-------FSNTDLTALF 1044

>NCAS0C00390 Chr3 (57333..60827) [3495 bp, 1164 aa] {ON} Anc_8.845
          Length = 1164

 Score =  587 bits (1514), Expect = 0.0
 Identities = 369/952 (38%), Positives = 506/952 (53%), Gaps = 23/952 (2%)
 Frame = +1

Query: 139  SAAPNAARSISPVTSATPTSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDK 318
            S  P    S S   +    SN R+AQACDRCRSKKTRCDGKRPQCSQCA VGFECK+SDK
Sbjct: 54   SVQPPPPSSTSSSVAPNEDSNLRIAQACDRCRSKKTRCDGKRPQCSQCAIVGFECKISDK 113

Query: 319  LSRRAFPRGYXXXXXXXXXXXXXXXXXXXXXCDLKDEQMHLVSKYSSNKRHEPSSTEEGR 498
            L R++FPRGY                      +L++E   L++    NK     S +   
Sbjct: 114  LQRKSFPRGYTETLEEKVR-------------ELENENRRLLAICQFNKLQ---SQKNDT 157

Query: 499  MLEQLSNSDGGSLRVSSTNLYLLNKTTPAVQDGSELHKCQGLGCNHASHPHLHEKPVSTS 678
            +    +  +  S+R +S +       + A++  S +  C    CN+ +H HLH KPVST 
Sbjct: 158  IDNSTTQEEVYSIRSNSAS-------STAIETDSNITTCLDTNCNNDTHNHLHMKPVSTK 210

Query: 679  LSDPAAISFEQNEAPGLPAVKALNTMANHEYSAQLAYLVALSVPRSTDEILFIPQLLARL 858
                  ISFEQNEAPGL AVKAL +MANHE S QLA LVAL++PRSTDEILFIPQLL+++
Sbjct: 211  -PPQNIISFEQNEAPGLSAVKALKSMANHEQSTQLATLVALAIPRSTDEILFIPQLLSKI 269

Query: 859  GQVHGLTSKQCXXXXXXXXXXXXXXQTSFQGSPDYK-------DLKDKSLWEIDDCMTFF 1017
             Q  G TSK C                    + + +        LK  +LW+ DD   F 
Sbjct: 270  RQNFGFTSKHCLYTVSLLSSLKPNLPPPKMIANNLEMTKKLLNQLKITNLWKFDDLSQFI 329

Query: 1018 KTGCKFNLTSSKDAXXXXXXXXXXXXXXYF-GECHALIPVLNEAEFYKYYNKFKSNLTTD 1194
                K +  + K++              +F  + + +IP++N+ EF   YN FK +L   
Sbjct: 330  NQYLKLDPLNQKNSNDLLNQIEMDELINFFFQDWNDIIPIINKEEFLSNYNAFKLDL--- 386

Query: 1195 PEFFKTSTPSFAQRSKSISYKIFACILLVICQFGLMAKVKREQLPTKNKFSL--LMSYYS 1368
                K S       +  ++YKIF CIL+++CQ GL+ K+K     +     L  +M+YY 
Sbjct: 387  ----KNSERDKLSSNLKMNYKIFGCILVLMCQMGLLTKIKATNGKSSPNIHLKSIMAYYH 442

Query: 1369 NALLALKTNPYFSVKNXXXXXXXXXXXXXXXXXNVGEVSSVYEIRGTVVSMAQQLRLHRC 1548
              +  L  N +F +                   NVG++S++YE+RG ++SM+QQLRLHRC
Sbjct: 443  QLIANLPINNFFQIATISIPQLKLYVLILFYNLNVGDISAIYELRGRIISMSQQLRLHRC 502

Query: 1549 PSAVLGTEGSTMSKSEQGDRRLLFWGIYYLDVFGALQLGVPRLLKDHEIECALPISEHAH 1728
            PSAVL     TM+K +Q +RR+LFW IY LD   +LQLGVPRLLKD+EIECALPI+    
Sbjct: 503  PSAVLSGSSLTMNKLDQSNRRILFWTIYSLDALSSLQLGVPRLLKDYEIECALPITME-- 560

Query: 1729 AGVSLADQVIKLEGQVSELSLSLLRFSKILGNILDSIFKRGMTSSAAQQVALIHENALDN 1908
                     IKLEG VS  SL++ RFSKILGNILD IFKR MT S  + V+LIHENALD 
Sbjct: 561  -DKERDKTKIKLEGTVSPFSLAIFRFSKILGNILDMIFKRNMTESMTKSVSLIHENALDQ 619

Query: 1909 WRRGLPKNLTFELDVNGTIKIEELTGSAQNNQDFTKNASSDKK--ILMLLYFLVKCLVHL 2082
            WR  LP++LTF+L++ G+I +         N     N++  KK  ILM  YF    ++HL
Sbjct: 620  WRYDLPEDLTFKLNIQGSIDL---------NVMHQGNSTPGKKNLILMFFYFFAVSMIHL 670

Query: 2083 PVLAAKPLLGGSSEPDKDATPXXXXXXXXXXXXXXXYVLLQQATNTFLSVQSCF----KT 2250
            PV+AA+PL   ++ PD+ ++                Y+ LQ A NT L+V        K 
Sbjct: 671  PVVAARPLDVKNAMPDRSSS---------------SYIALQHAINTMLNVLELLNNQPKN 715

Query: 2251 RHLPLAIDLPRIKARFALLSARGILEYTKGGALFQDNXXXXXXXXXXXXXXXXXXXPGSL 2430
             +LP+ I++ R++ R AL+S+RG+L+Y KGGALF DN                   PG +
Sbjct: 716  YYLPVPINMSRLQIRSALISSRGMLDYIKGGALFLDNKTLLLQVIKNLERDRTLDLPGVV 775

Query: 2431 SWHSLILLDMATLLIMQPPQTKTDKLDKLLETRLNYYNKLMGRSTLTSNGKRKNEENDAT 2610
            SWHSL L D+   L +Q    K +KLDK+LE + NYYNKLMG+ T        N  N+ +
Sbjct: 776  SWHSLKLFDLTITLFIQNSNIKLEKLDKILEKKSNYYNKLMGKPT------SNNTNNNIS 829

Query: 2611 SKVSKLTPLSSEYNTPSDKRIKVESIGSSGNVPSNSESVHHFDDIQNDKFSTNWPSNNPQ 2790
            SK  K   +  E +TPS     ++ +      P    ++     +QN         NN  
Sbjct: 830  SKKRKQETI--EISTPSPTSPPLKKMSKKSKSPILQSTILPSQTLQN--------YNNNI 879

Query: 2791 PNAIAEAFHLDPVLNGNP--FSNGDLTAFFNSDNG-----IPQIGGGSSVLN 2925
             N +A+A   DP+LN N   FSN DL+ +F  +       +P++   ++V N
Sbjct: 880  QNQLADALQFDPILNSNSYNFSNFDLSNYFQPNENEKTVQLPKLTTNNNVTN 931

>Smik_13.493 Chr13 complement(810035..814336) [4302 bp, 1433 aa] {ON}
            YMR280C (REAL)
          Length = 1433

 Score =  593 bits (1528), Expect = 0.0
 Identities = 405/1088 (37%), Positives = 537/1088 (49%), Gaps = 117/1088 (10%)
 Frame = +1

Query: 13   ENESFGPRFIRTLGSQSLSGTNPLXXXXXXXXXXXXXXRTNNSAAPNAARSISPVTSATP 192
            + +   PR IRTLGSQ+LSG N                  N+ ++ N   ++   TS TP
Sbjct: 7    DRQGLEPRVIRTLGSQALSGPN--------ISNRTLSSEANSHSSENTKDAMIKTTSPTP 58

Query: 193  TSN--YRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGYXXXXXX 366
             S   YR+AQACDRCRSKKTRCDGKRPQCSQCAAVGFEC++SDKL R+A+P+GY      
Sbjct: 59   LSTPIYRIAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLLRKAYPKGYTESLEE 118

Query: 367  XXXXXXXXXXXXXXXCDLKDEQMHLVSKYSSNKRHEPSSTEEGRMLEQLSNSDGGSLRVS 546
                           CD+K++Q+ LVS+  S       +T  G   ++L ++    L +S
Sbjct: 119  RVRELEAENKRLLALCDIKEQQISLVSQ--SRPPTSMDNTANGSFKQELKDAP---LNLS 173

Query: 547  STNLYLLNKTT-PAVQDGS---------------------ELHKCQGLGCNHASHPHLHE 660
            STN+YLLN+T    +Q+G                      + H C G+ C +    HLH 
Sbjct: 174  STNIYLLNQTVNKQLQNGKMDSDNSNTVMNSLAAAPLPPQKDHVCDGISCTN----HLHV 229

Query: 661  KPVSTSLSDPAAISFEQNEAPGLPAVKALNTMANHEYSAQLAYLVALSVPRSTDEILFIP 840
            KP STSL+DP AISFEQ+EAPGLPAVKAL  M  H+ S QLA LV+LS+PRST+EILFIP
Sbjct: 230  KPTSTSLNDPTAISFEQDEAPGLPAVKALKLMTTHQRSTQLATLVSLSIPRSTEEILFIP 289

Query: 841  QLLARLGQVHGLTSKQCXXXXXXXXXXXXXXQTSFQGSPDYKD-LKDKSLWEI-DDCMTF 1014
            QLL R+ Q+ G  SKQC                     P     LK+K   +I DD   F
Sbjct: 290  QLLTRIRQIFGFNSKQCLYTVSLLSSLKNRLPAPRLLPPSTSTKLKEKGEDKILDDDSAF 349

Query: 1015 FK-----------------TGCKF----------NLTSSKDAXXXXXXXXXXXXXXYFGE 1113
            FK                    KF          NL +  D               +F  
Sbjct: 350  FKKFQTTNLSEFVDLKGFLVSLKFDIDSFSKQSENLPNDHDNELLSLTEIKELLHLFFKF 409

Query: 1114 CHALIPVLNEAEFYKYYNKFKSNLTTDPEFFKTSTPSFAQRSKSISYKIFACILLVICQF 1293
                +P+LN   F  Y+N F   +  D       T        + ++++FA  L ++   
Sbjct: 410  WSNQVPILNNDHFLLYFNNFVE-VVKDLSSANLKTNVTNTSIVTTNHELFALKLSMMLLM 468

Query: 1294 GLMAKVKREQLP------TKNKFSLLMSYYSNALLALKTNPYF-SVKNXXXXXXXXXXXX 1452
            GL+ K+K E++         +K++ LM+YY    L +  NPYF ++              
Sbjct: 469  GLLVKIKMEKIKYTVPKNPNSKYARLMAYYHQLSLIIPKNPYFLNMSTTSLPSLQLLSLA 528

Query: 1453 XXXXXNVGEVSSVYEIRGTVVSMAQQLRLHRCPSAVLGTEGS-TMSKSEQGDRRLLFWGI 1629
                 NVG++S++Y +RG +VSMAQQLRLHRCPSAVL    +  + K EQ +RRLLFW I
Sbjct: 529  SFYYLNVGDISAIYGVRGRIVSMAQQLRLHRCPSAVLSVHSNPVLQKFEQSERRLLFWAI 588

Query: 1630 YYLDVFGALQLGVPRLLKDHEIECALPISEHAHAGVSLADQV-------------IKLEG 1770
            YY+DVF +LQLGVPRLLKD +IECALPIS+     V   DQ+             I+L+G
Sbjct: 589  YYVDVFASLQLGVPRLLKDFDIECALPISD-----VEYKDQLFMENKKTNKKAKKIQLQG 643

Query: 1771 QVSELSLSLLRFSKILGNILDSIFKRGMTSSA-AQQVALIHENALDNWRRGLPKNLTFEL 1947
            QVS  SL ++RF+KILGNILDSIFKRGM       +VAL+HENALDNWR  LPK   F++
Sbjct: 644  QVSSFSLQIIRFAKILGNILDSIFKRGMMDERITSEVALVHENALDNWRSQLPKMYYFQI 703

Query: 1948 DVNGTIKIEELTGSAQNNQDFTKNASSD-----KKILMLLYFLVKCLVHLPVLAAKPLL- 2109
             VNGT+ ++E+  +   N + T+    D     KKIL+L YFL K ++HLPV+A KPL  
Sbjct: 704  TVNGTVNLDEIRVNDSKNIE-TRFEKKDIILFEKKILLLFYFLAKSMIHLPVIATKPLPK 762

Query: 2110 ---------------GGSSEPDKDATPXXXXXXXXXXXXXXXYVLLQQATNTFLSVQSCF 2244
                                 D+D                  Y++LQQATN  L +    
Sbjct: 763  NIDNGTKKKQSVFSNDSKGSNDQDHMIVDVDMTSPAIRTSSSYIILQQATNATLMIFQTI 822

Query: 2245 KTRHLPLAIDLPRIKARFALLSARGILEYTKGGALFQDNXXXXXXXXXXXXXXXXXXXPG 2424
               ++PL +++ R   RF+LL ARG LEYTKGGALF DN                   PG
Sbjct: 823  NWMYIPLPLNVSRTLIRFSLLCARGSLEYTKGGALFLDNKNLLLDTIKDIENDRLLDLPG 882

Query: 2425 SLSWHSLILLDMATLLIMQPPQTKTDKLDKLLETRLNYYNKLMG---------RSTLTSN 2577
            + SWH+L L DM   L+++ P  K ++LDK LE +LNYYN+LMG         +  L S 
Sbjct: 883  TASWHTLKLYDMTINLLLKAPNVKVERLDKFLEKKLNYYNRLMGLPLATTTSIKPILGSQ 942

Query: 2578 GKRKNEENDATSKVSKLTPLSSEYNTPSDKRIKVESIGSSG---NVPSNSESVHHFDD-- 2742
             K   E     S V +  P   EY    D   K  S        N  + S+ + +  D  
Sbjct: 943  SKDSPETRPRKSIVKRENP-EYEYLYGKDDNKKNNSGPDQSPIENTSNGSKRLKYETDTK 1001

Query: 2743 -------IQNDKFSTNWPSNNPQPNAIAEAFHLDPVLNGNPFSNGDLTAFFNSDNGIPQI 2901
                   I   + + N+  NN +  + +  F          FSN DLTA F    G    
Sbjct: 1002 RGVDTGSIFKSQNAENFQHNNKKTMSTSNLFPFS-------FSNTDLTALFTHPEGANGA 1054

Query: 2902 GGGSSVLN 2925
               +S  N
Sbjct: 1055 NNNNSNFN 1062

>Suva_13.468 Chr13 complement(809712..812654,812694..814007) [4257 bp,
            1418 aa] {ON} YMR280C (REAL)
          Length = 1418

 Score =  588 bits (1517), Expect = 0.0
 Identities = 395/1072 (36%), Positives = 547/1072 (51%), Gaps = 112/1072 (10%)
 Frame = +1

Query: 13   ENESFGPRFIRTLGSQSLSGTNPLXXXXXXXXXXXXXXRTNNSAAPNAARSISPV----T 180
            + +   PR IRTLGSQ+L  TN                  N  A PN + +I        
Sbjct: 6    DRQGLEPRIIRTLGSQTLGTTNA------------PHKALNTEANPNFSENIKEALIKTN 53

Query: 181  SATPTSN--YRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGYXX 354
            S TP S   YR+AQACDRCRSKKTRCDGKRPQCSQCAAVGFEC++SDKL R+A+P+GY  
Sbjct: 54   SPTPLSTPIYRIAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLLRKAYPKGYTE 113

Query: 355  XXXXXXXXXXXXXXXXXXXCDLKDEQMHLVSKYSSNKRHEPSSTEEGRMLEQLSNSDGGS 534
                               CD+K++Q++LVS+  S       +T      + L ++    
Sbjct: 114  SLEERVRELEAENKRLLALCDIKEQQINLVSQ--SRPPTSLDNTVSDNFKQDLKDAP--- 168

Query: 535  LRVSSTNLYLLNKTT-PAVQDGS---------------------ELHKCQGLGCNHASHP 648
            L +SSTN+YLLN+T    +Q+G                      + H C G+ C +    
Sbjct: 169  LNLSSTNIYLLNQTVNKQLQNGKIDTNRSDSTMGLLATSPPLPQKDHVCDGVSCTN---- 224

Query: 649  HLHEKPVSTSLSDPAAISFEQNEAPGLPAVKALNTMANHEYSAQLAYLVALSVPRSTDEI 828
            +LH KP STSL+DP AISFEQNEAPGLPAVKAL +M  H+ S QLA LV+LS+PRST+EI
Sbjct: 225  NLHAKPTSTSLNDPTAISFEQNEAPGLPAVKALKSMTTHQRSTQLATLVSLSIPRSTEEI 284

Query: 829  LFIPQLLARLGQVHGLTSKQCXXXXXXXXXXXXXX----------QTSFQGSPDYKDL-- 972
            LFIPQLL R+ Q+ G  SKQC                         T  + + D K L  
Sbjct: 285  LFIPQLLTRIRQIFGFNSKQCLYTVSLLSSLKNRLPAPKLLLSSTSTKIKENDDSKFLNT 344

Query: 973  -KDKSLWEIDDCMTFFKTGCKFNLTSSKDAXXXXXXXXXXXXXXYFGECHAL-------- 1125
             +  SL E  D   F     KF++ S  +                  E   L        
Sbjct: 345  FETTSLAEFGDLKKFL-ISLKFDINSFSNQQPEVQNNKSDNDLLSLNEIKELLHLFFKFW 403

Query: 1126 ---IPVLNEAEFYKYYNKFKSNLTTDPEFFKTSTPSFAQRSKSISYKIFACILLVICQFG 1296
               + +LN   F  Y+N F   +   P   K +  +  +   + +++IFA  LL++ Q G
Sbjct: 404  SNQVSILNNDHFLLYFNNFVEVIKALPLELKKTNGT--KTHATTNHQIFALKLLIMLQMG 461

Query: 1297 LMAKVKREQLPT------KNKFSLLMSYYSNALLALKTNPYF-SVKNXXXXXXXXXXXXX 1455
            L+ KVKRE++         +KF+ LM YY      +  NPYF ++               
Sbjct: 462  LLIKVKREKIKDTVPGNQNSKFAKLMVYYHQVSSIIPKNPYFLNMSTTSLPSLQLLSLTS 521

Query: 1456 XXXXNVGEVSSVYEIRGTVVSMAQQLRLHRCPSAVLGTEGS-TMSKSEQGDRRLLFWGIY 1632
                NVG++ ++Y +RG +VSM+QQLRLHRCPSAVL    +  + + EQ +RRLLFW +Y
Sbjct: 522  FYFLNVGDIPAIYGLRGRIVSMSQQLRLHRCPSAVLSVHSNPVLQRFEQSERRLLFWAVY 581

Query: 1633 YLDVFGALQLGVPRLLKDHEIECALPISEHAHAGVSLADQV-------------IKLEGQ 1773
            Y+DVF +LQLGVPRLLKD +IECALPIS+     V   DQ+             I+L+GQ
Sbjct: 582  YIDVFASLQLGVPRLLKDFDIECALPISD-----VEFEDQLASENEKTKNKTKKIQLQGQ 636

Query: 1774 VSELSLSLLRFSKILGNILDSIFKRGMTSS-AAQQVALIHENALDNWRRGLPKNLTFELD 1950
            VS  SL ++RF+KILGNILDSIFKRGM       +VAL+HENALDNWR  LP+   F++ 
Sbjct: 637  VSSFSLQIIRFAKILGNILDSIFKRGMMDERVTSEVALVHENALDNWRNQLPEMYYFQIT 696

Query: 1951 VNGTIKIEELTGSAQNNQDFTKNASS----DKKILMLLYFLVKCLVHLPVLAAKPL---L 2109
            VNGT+ ++++  +   N +   +       +K +L+L YFL K ++HLPV+A KPL   +
Sbjct: 697  VNGTVNLDDIRANNSRNTEAKFDRKDIICFEKNVLLLFYFLAKSMIHLPVIATKPLPKTV 756

Query: 2110 GGSSEP-------------DKDATPXXXXXXXXXXXXXXXYVLLQQATNTFLSVQSCFKT 2250
              S++              ++D +                Y++LQQATN  L++     +
Sbjct: 757  DNSTKKKHSMFNNDTKSINNQDHSVVDVDMTSPAIRTSSSYIILQQATNATLTLFQSINS 816

Query: 2251 RHLPLAIDLPRIKARFALLSARGILEYTKGGALFQDNXXXXXXXXXXXXXXXXXXXPGSL 2430
             +LPL +++ R   RF+LL ARG LEYTKGGALF DN                   PG  
Sbjct: 817  VYLPLPLNVSRTLIRFSLLCARGSLEYTKGGALFLDNKNLLLDTIKDIENDRLLDLPGVA 876

Query: 2431 SWHSLILLDMATLLIMQPPQTKTDKLDKLLETRLNYYNKLMGRSTLTSNGKRKNEENDAT 2610
            SWH+L L DM   L+++ P  K ++LDK LE +LNYYN+LMG    T+            
Sbjct: 877  SWHTLKLFDMTINLLLKAPNVKVERLDKFLEKKLNYYNRLMGLPPTTT-----TSSEPLF 931

Query: 2611 SKVSKLTPLSSEYNT------PSDKRIKVESIGSSGNV----PSNSESVHHFDDIQNDK- 2757
            S  SK TP +   ++      P ++ +  + I ++GN     PS  ++ +    ++++K 
Sbjct: 932  SSQSKNTPANGSRSSIVKRENPENEYLYGDGI-NNGNTDMDKPSTEDARNVNKRLKHEKS 990

Query: 2758 FSTNWPSNNPQPNAIAEAFHLDPVLNGN-------PFSNGDLTAFFNSDNGI 2892
             S +   +N   N     F  D   N +        FSN DLTA F +  G+
Sbjct: 991  ISQSIDDDNMSRNQNGSKFQQDSKKNMSTSNLFPFSFSNTDLTALFTNPEGL 1042

>KNAG0J00250 Chr10 (33322..37035) [3714 bp, 1237 aa] {ON} Anc_8.845
            YMR280C
          Length = 1237

 Score =  553 bits (1425), Expect = e-175
 Identities = 348/939 (37%), Positives = 484/939 (51%), Gaps = 30/939 (3%)
 Frame = +1

Query: 172  PVTSATPTSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGYX 351
            P+ S+ P +  R +QACDRCR KK +CD KRPQCS CA+VGFECK+SDKL+R +FPRGY 
Sbjct: 160  PLLSSRPDAAGRASQACDRCRLKKIKCDLKRPQCSSCASVGFECKLSDKLTRNSFPRGYT 219

Query: 352  XXXXXXXXXXXXXXXXXXXXCDLKDEQMHLVSKYSSNKRHEPSSTEEGRMLEQLSNSDGG 531
                                 DLK++Q+  +          P   +    ++   NS   
Sbjct: 220  ESLEERIRELESENRRLLAMNDLKEQQLFKI----------PEDIQSVVDVDAELNSSNQ 269

Query: 532  SLRVSSTNLYLLNKTTPAVQDGSELHKCQGLGCNHASHPHLHEKPVSTS--LSDPAAISF 705
            +  + +T                  H C G+ C       LH +PV+T+  L+DP ++SF
Sbjct: 270  TKNMYAT------------------HVCDGICCQDTK---LHSRPVATNFNLNDPTSVSF 308

Query: 706  EQNEAPGLPAVKALNTMANHEYSAQLAYLVALSVPRSTDEILFIPQLLARLGQVHGLTSK 885
            EQNEAPGL A +A++ ++NHE S QLA LV+LS+PRST+EILFIPQLLA++ QV G TSK
Sbjct: 309  EQNEAPGLMAARAIDQISNHEQSTQLAILVSLSIPRSTEEILFIPQLLAKIRQVFGFTSK 368

Query: 886  QCXXXXXXXXXXXXXX---------QTSFQGSPDYKDLKDKSLWEIDDCMTFFKTGCKFN 1038
            QC                       +   Q S ++  L   +LW +++   FF+   K N
Sbjct: 369  QCLYTVSLLSSLKDDLPPPNLLKNSKMILQNSSNFDILTSVNLWHLENLSNFFQNVLKLN 428

Query: 1039 LTSS------KDAXXXXXXXXXXXXXXYFGECHALIPVLNEAEFYKYYNKFKSNLTTDPE 1200
            +         K+               YF      IP+ NE EF   Y  FK++L     
Sbjct: 429  ILPDDDDHLKKNDDHLALSEIDELVALYFKYWSDSIPIFNEKEFNSNYRVFKADL----- 483

Query: 1201 FFKTSTPSFAQRSKSISYKIFACILLVICQFGLMAKVKREQLPTKNKFSLLMSYYSNALL 1380
              K S    +     ++ KIF C+L VICQ G++ K K  +  +  KF  L+SYY + + 
Sbjct: 484  -MKLSKNGPSSLENILNIKIFGCLLTVICQMGILIKYKNFKNKSP-KFEKLLSYYHHLMY 541

Query: 1381 ALKTNPYFSVKNXXXXXXXXXXXXXXXXXNVGEVSSVYEIRGTVVSMAQQLRLHRCPSAV 1560
             L  N YF V                   N G++  +Y++RG ++SMAQQLRLHRCPSAV
Sbjct: 542  VLPKNSYFGVITTSIKTVQILSLILFYHLNTGDIIQIYDLRGMIISMAQQLRLHRCPSAV 601

Query: 1561 LGTEGSTMSKSEQGDRRLLFWGIYYLDVFGALQLGVPRLLKDHEIECALPISEHAHAGVS 1740
            L   GS M + EQG+RR LFW IYYLDVF +LQLGVPRL+KDHEIECALP+S   H    
Sbjct: 602  LTGSGSKMDRLEQGNRRTLFWCIYYLDVFCSLQLGVPRLIKDHEIECALPLSSEIHNTDK 661

Query: 1741 LADQVIKLEGQVSELSLSLLRFSKILGNILDSIFKRGMTSSAAQQVALIHENALDNWRRG 1920
            +    ++LEG +SE SLS++R +K+LGNILDSIFKR M+ S  +QV  IHENALD+WR  
Sbjct: 662  M--DGVQLEGTMSEFSLSVVRCAKVLGNILDSIFKRNMSESITEQVYTIHENALDSWRTK 719

Query: 1921 LPKNLTFELDVNGTIKIEELTGSAQNNQDFTKNASSDKKILMLLYFLVKCLVHLPVLAAK 2100
            LPK   F+L+ NG + +E L              + +  IL+LL+FLVK ++++P+ +A 
Sbjct: 720  LPKKYQFKLNANGMVDLEHL--------------NHENLILVLLFFLVKSMIYMPLSSAI 765

Query: 2101 PLLGGSSEPDKDATPXXXXXXXXXXXXXXXYVLLQQATNTFLSVQSCFKTRHLPLAIDLP 2280
              L  + +   D                  +  LQQ+ N  LSV      ++LPL ++  
Sbjct: 766  TELANNPKVKND----------YYMNHKVSHTSLQQSINALLSVFKNINNQYLPLPLNSS 815

Query: 2281 RIKARFALLSARGILEYTKGGALFQDNXXXXXXXXXXXXXXXXXXXPGSLSWHSLILLDM 2460
            R   RFAL+SA+G LEY KGG LF+DN                   PG + WHSL LLD+
Sbjct: 816  RTMTRFALVSAKGSLEYKKGGLLFEDNKVLLLSVIQEIEKDRKLELPGIIPWHSLKLLDL 875

Query: 2461 ATLLIMQPPQTKTDKLDKLLETRLNYYNKLMGRSTLT----SNGKRKNEENDA-TSKVSK 2625
            A  L +  P   +DKL+K L+ ++NYYNK+MG+  +T    S  KRK  + D  T+   +
Sbjct: 876  AVNLFLLGPTINSDKLEKFLQKKINYYNKIMGKPLITSLPSSKTKRKQSKEDLFTANKKR 935

Query: 2626 LTPLSSEYNTPSDKR----IKVESIGSSGNVPSNSESVHHFDDIQNDKFSTNWPSNNPQP 2793
               + +E +T   KR    +++      GN   +++S                       
Sbjct: 936  KQQVKTELSTLEVKREPQQVQLLKREGQGNTTESTQS----------------------- 972

Query: 2794 NAIAEAFHLDPVLNGN--PFSNGDLTAFF--NSDNGIPQ 2898
             A  EA  LDP+LN N   FS  DL+ FF  N +  +P+
Sbjct: 973  -AFVEALQLDPILNANIYNFSGTDLSNFFISNQNGDVPR 1010

 Score = 36.6 bits (83), Expect = 0.56
 Identities = 23/49 (46%), Positives = 27/49 (55%)
 Frame = +1

Query: 3187 FGFTVDASLGLAPLLAWSPEAPQPSMPEIAQNADRRDSDPLSRTRLPSA 3333
            FG  VDASLGLAPLL  +PE   P  PE   N+D      L+   +P A
Sbjct: 1126 FGMIVDASLGLAPLLNEAPEI--PGQPEFF-NSDEMSPSQLTGKLMPMA 1171

>Ecym_4616 Chr4 complement(1204091..1208824) [4734 bp, 1577 aa] {ON}
            similar to Ashbya gossypii ABL121C
          Length = 1577

 Score =  554 bits (1428), Expect = e-173
 Identities = 327/737 (44%), Positives = 427/737 (57%), Gaps = 60/737 (8%)
 Frame = +1

Query: 1102 YFGECHALIPVLNEAEFYKYYNKFKSNLTTDPEFFKTSTPSFAQRSKSISYKIFACILLV 1281
            +F E ++LIP+ +++EF  Y+ KFK N++T PEFF +    FA+R KSISYKIFAC+L+ 
Sbjct: 606  FFDEWYSLIPIFDKSEFDNYWQKFKENVST-PEFFTSGDTIFAKRHKSISYKIFACLLVT 664

Query: 1282 ICQFGLMAKVKREQLPTKNKFSLLMSYYSNALLALKTNPYFSVKNXXXXXXXXXXXXXXX 1461
            + Q GLM KVKRE L  ++K ++LM+YY  AL  + TNPYF   +               
Sbjct: 665  VVQMGLMTKVKRENLGRRHKLNILMTYYDRALSHIITNPYFGSNSTSIQSLQLLSLLLFY 724

Query: 1462 XXNVGEVSSVYEIRGTVVSMAQQLRLHRCPSAVLGTEGSTMSKSEQGDRRLLFWGIYYLD 1641
              NVG++S++YE+RG VVS AQQLRLHRCPSAVLG +G T+S+ +QG+RR+LFWG+YYLD
Sbjct: 725  FLNVGDISNIYELRGKVVSFAQQLRLHRCPSAVLGGDGCTVSRIQQGERRVLFWGVYYLD 784

Query: 1642 VFGALQLGVPRLLKDHEIECALPISEHAHAGVSLADQVIKLEGQVSELSLSLLRFSKILG 1821
            VF +LQLGVPRLLKDHEIECALP+S  +   V+LA Q+I LEG++S  SLS++RFSK+LG
Sbjct: 785  VFASLQLGVPRLLKDHEIECALPVSSDSDRQVNLAGQMISLEGKMSPFSLSVIRFSKVLG 844

Query: 1822 NILDSIFKRGMTSSAAQQVALIHENALDNWRRGLPKNLTFELDVNGTIKIEELTGSAQNN 2001
            N+LDSIFKRGMT S  ++VAL+HENALDNWR GLP  L F+LDVNGTI ++E     Q  
Sbjct: 845  NVLDSIFKRGMTISITKEVALVHENALDNWRHGLPDGLRFQLDVNGTINMDEFN---QLK 901

Query: 2002 QDFTKNASS----DKKILMLLYFLVKCLVHLPVLAAKPLLGGSSEPDKDATPXXXXXXXX 2169
             ++  N +S    +  I M LYFL K ++H+PV+A KP +  S +   D           
Sbjct: 902  HEYLNNDNSKFNKENFIFMTLYFLAKSMIHIPVVAGKPPVDTSVQEKNDPA-----ISRQ 956

Query: 2170 XXXXXXXYVLLQQATNTFLSVQSCFKTRHLPLAIDLPRIKARFALLSARGILEYTKGGAL 2349
                   Y+LLQQATNTFL+V +  +T +LPL I++ R K RF L SARG LEYTKGGAL
Sbjct: 957  ADRSSSSYILLQQATNTFLNVLTSMRTAYLPLPINISRAKTRFGLFSARGSLEYTKGGAL 1016

Query: 2350 FQDNXXXXXXXXXXXXXXXXXXXPGSLSWHSLILLDMATLLIMQPPQTKTDKLDKLLETR 2529
            FQDN                   PG++SWHSL L DMA  LI+QPP TK +K +KLL+ +
Sbjct: 1017 FQDNKSLLLNLIKELEVDRKLGIPGTISWHSLKLFDMAINLILQPPNTKPEKEEKLLQKK 1076

Query: 2530 LNYYNKL------MGRSTLTSNG---------------------KRKNEENDATSKVSKL 2628
            ++YYNKL      M  S +TS                        ++N+ N A  K    
Sbjct: 1077 ISYYNKLIDHSVGMHASVITSAAIQHQRQQQQQQQQQQQQQQLHYKENKGNGAKRKPE-- 1134

Query: 2629 TPLSSEYNTPSDKRIKVESIGSSGNVPSNSESVHHFDDIQ-----------------NDK 2757
               S+  N   +KR+K+E         +   S  H DD +                   K
Sbjct: 1135 IGSSTTTNMSLNKRVKMEEPSVKIPTSNGPLSALHEDDSEMLGKSLRSNTIVSDVPTGQK 1194

Query: 2758 FSTNWPSNNPQPNAIAEAFHLDPVLNGNPFSNGDLTAFFNSD-----------NGIPQIG 2904
              +  P +    NAIAEAF LDPVL+  PFS+ DLT+F N +                IG
Sbjct: 1195 MESEIPVSMSATNAIAEAFQLDPVLHATPFSSTDLTSFLNGEVVTNASMFADTMHTTGIG 1254

Query: 2905 GG-SSVLNLAGIXXXXXXXXXXXXXXXXXXXPRKVATTVNDGLFRVPSNGDFLKDYYRIP 3081
            GG + V    G+                   P     +  DGLF+VPSNGDFLKDYY   
Sbjct: 1255 GGLTDVSGHNGLPSNNSLLNMSSIGFGIGSGPSLANLSSKDGLFKVPSNGDFLKDYY--S 1312

Query: 3082 GASSSQLNLMFMGPGNT 3132
            G SS+QL  +F+  GNT
Sbjct: 1313 GMSSAQLASLFVN-GNT 1328

 Score =  271 bits (692), Expect = 2e-73
 Identities = 173/405 (42%), Positives = 216/405 (53%), Gaps = 102/405 (25%)
 Frame = +1

Query: 151  NAARSISPVTSATPTSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRR 330
            +A    +P++S TP S YRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECK+SDKLSRR
Sbjct: 107  SATPGSTPLSSMTPMS-YRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRR 165

Query: 331  AFPRGYXXXXXXXXXXXXXXXXXXXXXCDLKDEQMHLVSKYSS----------------- 459
            AFPRGY                     CDLK+EQ+ LVSKYS+                 
Sbjct: 166  AFPRGYTETLEERVRELEAENRRLVALCDLKEEQLRLVSKYSAGSVGVGVGGPVTAGTTV 225

Query: 460  ---------------------------------NKR---HEPSSTEEGRMLEQLSNSDGG 531
                                             NK+    + ++ EE R+L+QLS SDGG
Sbjct: 226  GNRSSVNGAVNESASSTVGSIATAGSTAGLAHQNKKCAGSDSTTPEEDRILQQLSKSDGG 285

Query: 532  SLRVSSTNLYLLNKTT------------------PAVQDGSELH-KCQGLGCNHASHP-- 648
            +LRVSSTNLYLLNK T                  P   D  +L  + Q    +H +    
Sbjct: 286  TLRVSSTNLYLLNKKTSGQQQLLLPGSANKSEAFPIQPDSYKLQQRSQSTASSHVADSDN 345

Query: 649  -------HLHEK-----PVSTS----------------LSDPAAISFEQNEAPGLPAVKA 744
                   HL  +     PV+++                L+DP +ISFEQ++APGL AVKA
Sbjct: 346  PAEFQKEHLQPRTLPNIPVASTAIPSAPPGVTAYSLANLNDPTSISFEQDQAPGLSAVKA 405

Query: 745  LNTMANHEYSAQLAYLVALSVPRSTDEILFIPQLLARLGQVHGLTSKQCXXXXXXXXXXX 924
            L+TMANHE S+QLA LVA+S+PR+T+EILF+PQLLAR+GQVHG TSKQC           
Sbjct: 406  LSTMANHEQSSQLATLVAMSIPRTTEEILFVPQLLARIGQVHGFTSKQCLYTASVLASLK 465

Query: 925  XXXQTSFQGSPDYKDLKDKSLWEIDDCMTFFKTGCKFNLTSSKDA 1059
                  +Q SP+ + L+ KSLWEIDD  +F   G +F+  S+  A
Sbjct: 466  EI--VPYQTSPELELLRSKSLWEIDDVDSFLSKGLRFSFPSATSA 508

 Score = 64.3 bits (155), Expect = 2e-09
 Identities = 55/180 (30%), Positives = 78/180 (43%), Gaps = 33/180 (18%)
 Frame = +1

Query: 3184 GFGFTVDASLGLAPLLAWSPEAPQPSMPEIAQNADRRDSDP------------------- 3306
            G+GF VDASLGLA LL WSP+ P      I  +  + DS+P                   
Sbjct: 1400 GYGFVVDASLGLASLLGWSPK-PGNDDAIILGSDPKDDSEPKLNTARSFTTVNKLDMIPT 1458

Query: 3307 -LSRTR----------LPSATIPASDPTHV-ISQDSNNVHLREQYRS--NSFNQLYAQDQ 3444
             +S T+          LPS+  P  +P  + + Q+   +  R+Q+    N     ++ D 
Sbjct: 1459 LMSTTKSTTTAPSDAGLPSSIRPNQNPASIKLVQNPLPLSTRKQFAQAGNPSRYPFSPDL 1518

Query: 3445 SLDDTAITIPTRSHRGPRRRWNSSNGTTVITXXXXXXXXXXXXXXXXXXYKDLFRWQNSG 3624
              +D  +TI TRS RGPRR WN++  +T                       DLF+WQNSG
Sbjct: 1519 LQEDGMLTINTRSPRGPRRYWNNTASST-DQPQIHKNNTQQQSQQLDDNINDLFKWQNSG 1577

 Score = 35.4 bits (80), Expect = 1.3
 Identities = 13/24 (54%), Positives = 21/24 (87%)
 Frame = +1

Query: 1  MGERENESFGPRFIRTLGSQSLSG 72
          +G+++ +++GPR IRTLGSQ+L G
Sbjct: 5  IGKKDKDTYGPRIIRTLGSQALGG 28

>KAFR0B03950 Chr2 complement(823760..827500) [3741 bp, 1246 aa] {ON}
            Anc_8.845 YMR280C
          Length = 1246

 Score =  529 bits (1363), Expect = e-166
 Identities = 320/779 (41%), Positives = 432/779 (55%), Gaps = 20/779 (2%)
 Frame = +1

Query: 607  HKCQGLGCNHASHPHLHEKPVSTSLSDPAAISFEQNEAPGLPAVKALNTMANHEYSAQLA 786
            H C G+ C    HP    +PV+T+ +DP +ISFEQ+EAPGL A KAL ++ N E + QLA
Sbjct: 243  HVCDGICCTDKLHP----QPVATNYNDPTSISFEQSEAPGLVAAKALKSINNQEEATQLA 298

Query: 787  YLVALSVPRSTDEILFIPQLLARLGQVHGLTSKQCXXXXXXXXXXXXXXQTS-----FQG 951
             LV+LSVPRST+EILFIPQLLA++ QVHG TSKQC               +         
Sbjct: 299  ILVSLSVPRSTEEILFIPQLLAKIRQVHGFTSKQCLYTVSLLSSLKNSLPSPKSDFLMDN 358

Query: 952  SPDYKDLKDKSLWEIDDCMTFFKTGCKFNLTS-SKDAXXXXXXXXXXXXXXYFGECHALI 1128
            S +   LK+ ++W+I+D   FF    KFN+++ SK +              YF     LI
Sbjct: 359  SQNSLLLKNTNIWQINDLNVFFTDLLKFNISNDSKTSTLLSFDDIDDLTNLYFNHWSNLI 418

Query: 1129 PVLNEAEFYKYYNKFKSNLTTDPEFFKTSTPSFAQRSKSIS---YKIFACILLVICQFGL 1299
            PVLNE EF+  YN FK               SF Q ++S +   YK F C L+V+CQ GL
Sbjct: 419  PVLNEEEFFNRYNNFK-----------IQCQSFIQGNQSNNLRDYKFFGCFLMVMCQMGL 467

Query: 1300 MAKVKREQLPTKNKFSLLMSYYSNALLALKTNPYFSVKNXXXXXXXXXXXXXXXXXNVGE 1479
            + K+K  +  + N    +++YY      L  NP +                     N+G 
Sbjct: 468  LIKLKEHK--SNNSLFKILTYYHQLTYILPKNPVYDFATTSIKSVQLLALLLFYHLNMGN 525

Query: 1480 VSSVYEIRGTVVSMAQQLRLHRCPSAVLGTEGSTMSKSEQGDRRLLFWGIYYLDVFGALQ 1659
            +  +YE+RG ++SMA QLRLHRCPSAVL   GSTM K EQ +RRLLFW IYYLDVF +LQ
Sbjct: 526  IEQIYELRGNIISMAHQLRLHRCPSAVLTGSGSTMQKLEQSNRRLLFWTIYYLDVFSSLQ 585

Query: 1660 LGVPRLLKDHEIECALPISEHAHAGVSLADQVIKLEGQVSELSLSLLRFSKILGNILDSI 1839
            LGVPRLLKD+EIECALP+ ++     ++    IKLEG VS++SL+L RF+K+LGNI+DSI
Sbjct: 586  LGVPRLLKDYEIECALPV-DNTTTMDAIDGTSIKLEGTVSQISLTLFRFAKVLGNIVDSI 644

Query: 1840 FKRGMTSSAAQQVALIHENALDNWRRGLPKNLTFELDVNGTIKIEELTGSAQNNQDFTKN 2019
            FKR M++S ++QVALIHENALDNWR  LP+   F+LDVNGTI + +L          T+N
Sbjct: 645  FKRNMSTSISRQVALIHENALDNWRSRLPEQFQFKLDVNGTINLNDLD---------TEN 695

Query: 2020 ASSDKKILMLLYFLVKCLVHLPVLAAKPLLGGSSEPDKDATPXXXXXXXXXXXXXXXYVL 2199
              SD   L++ YFL KC++HLPV + K  L       +D                  YV 
Sbjct: 696  --SDTIFLIVFYFLAKCMIHLPVCSTKVDL-------EDKVTETGNDVIYNDRFSTSYVS 746

Query: 2200 LQQATNTFLSVQSCFKTRHLPLAIDLPRIKARFALLSARGILEYTKGGALFQDNXXXXXX 2379
            LQQ+TNT L+     + ++LP+  ++ R   RF L+SA+G L+Y KGG+LF DN      
Sbjct: 747  LQQSTNTMLNALRMIRDKYLPMPFNVSRTLTRFTLISAKGSLDYIKGGSLFIDNKKLLLD 806

Query: 2380 XXXXXXXXXXXXXPGSLSWHSLILLDMATLLIMQPPQTKTDKLDKLLETRLNYYNKLMGR 2559
                         PG +SWHSL LLD+   L +Q   TK +K++KLL+ +LNYYNKLMG+
Sbjct: 807  CVQDIEANRKLDLPGIISWHSLKLLDLTLNLFLQNSNTKPEKIEKLLQKKLNYYNKLMGK 866

Query: 2560 STLTS------NGKRKNEENDATSKVSKLTPLSSEYNTPSDKRIKVESIGSSGNVPSNSE 2721
              + +        + K   ND  S+      L ++ N+     +    I + G  PS++ 
Sbjct: 867  PLVKNLPIQKRTNQNKGNNNDEPSRKKVKKELENDINS-----LHPILIDNEGVTPSDAA 921

Query: 2722 SVHHFDDIQNDKFSTNWPSNNP---QPNAIAEAFHLDPVLNGN--PFSNGDLTAFFNSD 2883
             + +          TN  +NNP     N  AEA  +DP+LN +   FSN DL   FNSD
Sbjct: 922  PLIN---------KTNSNTNNPVVTTQNEFAEALQVDPILNSDYYQFSNLDLATLFNSD 971

 Score =  131 bits (329), Expect = 6e-30
 Identities = 70/148 (47%), Positives = 89/148 (60%), Gaps = 20/148 (13%)
 Frame = +1

Query: 193 TSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGYXXXXXXXX 372
           +SNYRV QACDRCRSKKTRCDG++PQCSQCAAVGFECKVSDKL R+A+PRGY        
Sbjct: 23  SSNYRVTQACDRCRSKKTRCDGRKPQCSQCAAVGFECKVSDKLIRKAYPRGYTESIEERV 82

Query: 373 XXXXXXXXXXXXXCDLKDEQMHLVSKYSSNKRH---------------EPSSTEEGRMLE 507
                        CDLK++Q+ LV+KYSSNK +               + ++  +G + +
Sbjct: 83  RELEAENRRLLALCDLKEQQISLVAKYSSNKSNILPTDRCIIELNSDSDCTNNIKGELNK 142

Query: 508 QLSNS-----DGGSLRVSSTNLYLLNKT 576
              N      +   L +S TNLYLLN+T
Sbjct: 143 DRQNDVTTIPNSLPLNISQTNLYLLNQT 170

>NDAI0K00390 Chr11 (84641..89128) [4488 bp, 1495 aa] {ON} Anc_8.845
          Length = 1495

 Score =  527 bits (1358), Expect = e-163
 Identities = 370/1076 (34%), Positives = 513/1076 (47%), Gaps = 159/1076 (14%)
 Frame = +1

Query: 130  TNNSAAPNAARSISPVTSATPTSNY--RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 303
            +N+S+      S+S   + + + NY  R++QACDRCRSKKTRCDGKRPQCSQCA VGFEC
Sbjct: 76   SNSSSTDTKDDSVSISITDSTSGNYSKRISQACDRCRSKKTRCDGKRPQCSQCAIVGFEC 135

Query: 304  KVSDKLSRRAFPRGYXXXXXXXXXXXXXXXXXXXXXCDLKDEQMHLVSKYSSNKRHEPSS 483
            KVSDKL R+++PRGY                      +LK  Q+ + S  SS     P+ 
Sbjct: 136  KVSDKLQRKSYPRGYTETLEEKIRELQTENKRLLAIYNLKQNQLSVSSSSSSTS---PNK 192

Query: 484  TEEGRMLEQLSNSDGGSLRVSSTNLYLLNKTTPAVQDGSELHKCQGLG------------ 627
               G      SNS   S  ++ TN    N+T       S+L     +             
Sbjct: 193  KGNGNDCAVQSNSTSTSA-INDTNENGSNETAMKEIIQSQLIPLTNINSVHDPIQNNDDN 251

Query: 628  -----CNHA-------------------------SHPHLHEKPVSTSLSDPAAISFEQNE 717
                 CNH                          +  HLH KPVST+ +   +ISFEQNE
Sbjct: 252  THTDCCNHTIKTINPDNNNNYSTHTTNGKLHRDTNDHHLHPKPVSTNSNGLNSISFEQNE 311

Query: 718  APGLPAVKALNTMANHEYSAQLAYLVALSVPRSTDEILFIPQLLARLGQVHGLTSKQCXX 897
            APGL  VKAL +M N E + QLA LV+L++PRST+EILFIPQ+LA++ Q  G TSK C  
Sbjct: 312  APGLSTVKALKSMVNDEKNTQLATLVSLAIPRSTEEILFIPQILAKVRQNFGFTSKHCLY 371

Query: 898  XXXXXXXXXXXXQTSFQG----SPDYKDL---KDKSLWEIDDCMTFF------------- 1017
                          S       S D K+L   K+ +LW+ +    FF             
Sbjct: 372  TVSLLSSLKSFLSNSNNSISAASADNKNLETLKNTNLWKFNALFQFFTAFLKLDFLDSSL 431

Query: 1018 ------KTGCKFNLTSSKDAXXXXXXXXXXXXXX-----YFGECHALIPVLNEAEFYKYY 1164
                  K   K N  ++  A                   +F      + ++NE EFY+YY
Sbjct: 432  EKQNKGKKNGKVNNNNNNSANQDGISPLSSSEIDELLKLFFQNWSDFVLMINEKEFYQYY 491

Query: 1165 NKFKSNLTTDPEFFKTSTPSFAQRSKSISYKIFACILLVICQFGLMAKVKREQLPTKNK- 1341
            + FKS+L       + +  S    S  ++YKIF  I+L+ CQ GL++K+K     TK+K 
Sbjct: 492  SVFKSDL-------QNNNISKMSLSTLMNYKIFGLIILLFCQMGLLSKIKLSSNNTKSKN 544

Query: 1342 ------FSLLMSYYSNALLALKTNPYFSVKNXXXXXXXXXXXXXXXXXNVGEVSSVYEIR 1503
                     +M+YY N +  L  N +F + N                 ++G +S++YE+R
Sbjct: 545  FKQQYHLKKVMNYYHNLINKLMWNEFFKISNVTLQSLKLLSLILFYNLHMGNISNIYELR 604

Query: 1504 GTVVSMAQQLRLHRCPSAVLGTEGSTMSKSEQGDRRLLFWGIYYLDVFGALQLGVPRLLK 1683
              V+SM+QQLRLHRCPSAVL      + K EQ +RRLLFW IYYLD+F +LQLGVPRLLK
Sbjct: 605  SKVISMSQQLRLHRCPSAVLCGSTLKIHKLEQSNRRLLFWNIYYLDIFASLQLGVPRLLK 664

Query: 1684 DHEIECALPI------------SEHAHAGVSLADQVIKLEGQVSELSLSLLRFSKILGNI 1827
            DHEIECALPI               A       D  IKLEG VS LSL ++R+S+I+GNI
Sbjct: 665  DHEIECALPIPMDTDSKSDNQSQRSAATNAENDDNKIKLEGCVSHLSLVIIRYSQIVGNI 724

Query: 1828 LDSIFKRGMTSSAAQQVALIHENALDNWRRGLPKNLTFELDVNGTIKIEELTGSAQNNQD 2007
            LD IFKR MT S  + +ALIH +ALD+WR  LP NL F+L+VNG+I +       QN  +
Sbjct: 725  LDMIFKRNMTESMTKSIALIHIHALDDWRNTLPSNLKFDLNVNGSIDLSSFI-DQQNLNE 783

Query: 2008 FTKNASSDKKILMLLYFLVKCLVHLPVLAAKPLLGGSSE-----PDKDATPXXXXXXXXX 2172
              +     K +++ LYF    ++H+PV+A++PL    ++     PD+ ++          
Sbjct: 784  EEQRTQQQKLLVIFLYFFGVNMIHMPVVASRPLPLVENDSLNQIPDRSSS---------- 833

Query: 2173 XXXXXXYVLLQQATNTFLSVQSCFKTRHLPLAIDLPRIKARFALLSARGILEYTKGGALF 2352
                  Y+ LQ ATNT L+V       ++PL I++ R   RF+++SA G+L++ KGG+LF
Sbjct: 834  -----SYIALQHATNTMLNVLDLLSPTYVPLPINMSRTMVRFSMISACGMLDFIKGGSLF 888

Query: 2353 QDNXXXXXXXXXXXXXXXXXXXPGSLSWHSLILLDMATLLIMQPPQTKTDKLDKLLETRL 2532
             +N                   PG +SWHSL L D+   L  Q    K +KLDKLLE + 
Sbjct: 889  LENKALLAQVVKNIETDRFLDLPGVISWHSLKLFDLTLTLFFQNTNIKLEKLDKLLEKKS 948

Query: 2533 NYYNKLMGR-----------------------STLTSNGKRKNE----ENDATSKVS--- 2622
            NYYN+LMG+                       + L    K+K +    EN+  S V    
Sbjct: 949  NYYNRLMGKPIVRNPAEKNSTTVPASMSAVDETDLPRADKKKKDIVDTENEYVSSVPDTN 1008

Query: 2623 ----KLTPLSSEYNTPSD--------------------KRIKVESIGSSGNVPSNSESVH 2730
                K TP   + +T ++                    K+ K E I         +E   
Sbjct: 1009 NIVVKQTPEEWDTSTKTNVKDSTLAHKLTTIELPSTDKKKRKQEQISPVNKKAKKAEQEV 1068

Query: 2731 HFDDIQNDKFSTNWPSNNPQ----PNAIAEAFHLDPVLNGNP--FSNGDLTAFFNS 2880
                +   + ST+  + N       N  A+A   DP+LN N   FSN DL++ F +
Sbjct: 1069 SQTQVGVPRSSTSSTAQNSNYANIQNQFADALQFDPILNSNSFNFSNLDLSSLFKT 1124

 Score = 36.2 bits (82), Expect = 0.75
 Identities = 30/113 (26%), Positives = 45/113 (39%), Gaps = 31/113 (27%)
 Frame = +1

Query: 3178 VPGFGFTVDASLGLAPLLAWS------PEAPQP-----------------------SMPE 3270
            +P + + VDASLGLAPLL         PE  QP                       +MP 
Sbjct: 1372 IPDYNYFVDASLGLAPLLETQRRHNSFPETSQPLVNTSNAMNLGNASLSSTANNNNTMPS 1431

Query: 3271 IAQNADRRDSDPLSRTRLPSATIPASDPTHVI--SQDSNNVHLREQYRSNSFN 3423
            IA N    +   LS ++     +P +D   ++  + D +N++ R   R    N
Sbjct: 1432 IANNVGYNNPPLLSSSKQKPRHLPTNDTGDILNFNGDLSNLNFRRDVRRKREN 1484

>CAGL0M03025g Chr13 complement(341849..345613) [3765 bp, 1254 aa] {ON}
            similar to uniprot|P39113 Saccharomyces cerevisiae
            YMR280c CAT8 transcription factor involved in
            gluconeogenesis
          Length = 1254

 Score =  511 bits (1315), Expect = e-159
 Identities = 342/976 (35%), Positives = 502/976 (51%), Gaps = 44/976 (4%)
 Frame = +1

Query: 130  TNNSAAPNAARSISPVTSAT--PTSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 303
            + + A P    S+S   + +   T  YRVAQACDRCR KKT+CDGK PQCSQCA VGFEC
Sbjct: 28   SGSGAGPANGNSVSGSNTGSRGSTPTYRVAQACDRCRLKKTKCDGKIPQCSQCALVGFEC 87

Query: 304  KVSDKLSRRAFPRGYXXXXXXXXXXXXXXXXXXXXXCDLKDEQMHLVSKYSSNKRHEPSS 483
            K+SD+L+R++FPRGY                     C+         S   SN R +   
Sbjct: 88   KISDRLNRKSFPRGYTETLEERVRELETENKRLMALCN---------SDLGSNTRSDGLE 138

Query: 484  TEEGRMLEQLSNSDGGSLRVSSTNLYLLNKTTPAVQDGSELHKCQGLGCNHASHPHLHEK 663
             +     ++  + +  S R  + N+ L  + +           C   G +  +H  +H K
Sbjct: 139  KQSPSKRKRSPSMERDSERGFTENMELQLQQS-----------CSSCGNSDPNHRCVHLK 187

Query: 664  PVSTSL--SDPAAISFEQNEAPGLPAVKALNTMANHEYSAQLAYLVALSVPRSTDEILFI 837
            PV +++       +SFEQN APGLPAVKALN+MA  E SAQLA LV+L++PRST+EILFI
Sbjct: 188  PVVSNIIVDSNTDVSFEQNVAPGLPAVKALNSMAEREESAQLAMLVSLALPRSTEEILFI 247

Query: 838  PQLLARLGQVHGLTSKQCXXXXXXXXXXXXXXQTSFQGSPDYKDLKDKSLWEIDDCMTFF 1017
            PQL+A + +  G +SKQ                T    S D  +    + +  +D   FF
Sbjct: 248  PQLMANIQKTFGFSSKQSLYTVSLLSSLKKNLPTPNSNSSD--ENLSPNYYVSEDFRPFF 305

Query: 1018 KTGCKFNLT--------------------SSKDAXXXXXXXXXXXXXXYFGECHALIPVL 1137
                KF++                     +S+                YF      IP+ 
Sbjct: 306  YEVLKFDILGETETENGSNRNESPDSTIPNSRSDDLLSWMEIQRLVDVYFECWSNTIPIF 365

Query: 1138 NEAEFYKYYNKFKSNLTTDP----EFFKTSTPSFAQRSKSISYKIFACILLVICQFGLMA 1305
            +   F K    FK+ +        E +KT      ++ K    KIFA +L V+CQ  L++
Sbjct: 366  SRKLFIKQMKAFKTEVDKFGDRLFEVYKT------EQIKINFLKIFATVLAVMCQMALLS 419

Query: 1306 KVKREQLPTKN----KFSLLMSYYSNALLALKTNPYFS-VKNXXXXXXXXXXXXXXXXXN 1470
            ++K+ +  T+     +   L+++Y+  +  +  + +F  +                   N
Sbjct: 420  RLKQLEATTQELECKRTQNLIAHYNQLIEKIHLDSFFQDMSTTTVQSLQLLSFISFYFLN 479

Query: 1471 VGEVSSVYEIRGTVVSMAQQLRLHRCPSAVL-GTEGSTMSKSEQGDRRLLFWGIYYLDVF 1647
            VG++  +Y++RGTV+SMAQQLRLHRCPSAVL    GSTM K EQG+RRLLFW IYYLDVF
Sbjct: 480  VGDIPRLYQLRGTVISMAQQLRLHRCPSAVLLSASGSTMQKFEQGERRLLFWAIYYLDVF 539

Query: 1648 GALQLGVPRLLKDHEIECALPISEHAHAGVSLADQVIKLEGQVSELSLSLLRFSKILGNI 1827
             +LQLGVPRL+KDHEIECALP+SE         ++  +LEG+VS+ SL+++R++K+LGNI
Sbjct: 540  YSLQLGVPRLIKDHEIECALPVSE---------EEDSQLEGRVSDFSLAVIRYAKVLGNI 590

Query: 1828 LDSIFKRGMTSSAA-QQVALIHENALDNWRRGLPKNLTFELDVNGTIKIEELTGSAQNNQ 2004
            LDSIFKR M S AA + +A +HE ALD W+  LP+   F L+ NG    +ELT    + +
Sbjct: 591  LDSIFKRNMMSEAATESMAFVHEKALDIWKNRLPEKYGFRLEANGLFNFDELTVVKNSEK 650

Query: 2005 DFTKNASSDKKILMLLYFLVKCLVHLPVLAAKPL-----LGGSSEPDKDATPXXXXXXXX 2169
            D  + +S     ++L YFL KC++HLPV+A +       L   +  D   TP        
Sbjct: 651  DLIEKSS-----ILLFYFLAKCMIHLPVIATRSASLEQQLQPGTSSDTSETP-KESQNKT 704

Query: 2170 XXXXXXXYVLLQQATNTFLSVQSCFKTRHLPLAIDLPRIKARFALLSARGILEYTKGGAL 2349
                   Y+L+Q+A +T L V       +LP  I++ R KARFALL+A   +EY KGG+L
Sbjct: 705  PTRVCPSYILMQKAASTMLQVMHYTSEYYLPSPINISRTKARFALLTACSAVEYLKGGSL 764

Query: 2350 FQDNXXXXXXXXXXXXXXXXXXXPGSLSWHSLILLDMATLLIMQPPQTKTDKLDKLLETR 2529
            + +                    PG +SWHSL LLDMA +L++Q P TK +KLDKL++ +
Sbjct: 765  YVETKNLLENLIIKLELERKLDLPGIISWHSLKLLDMALMLLLQSPTTKMEKLDKLVQKK 824

Query: 2530 LNYYNKLMGRSTLTSNGKRKNEENDATSKVSKLTPLSSEYNTPSDKRIKVESIGSSGNVP 2709
            +N+YN+ MG   +  +  RKN      +K  KL   SS+ ++ S+   K       G + 
Sbjct: 825  INHYNRQMGIPAMKLSNSRKN------NKKIKLENESSQLSSTSNPIAK-------GELK 871

Query: 2710 SNSESVHHFDDIQNDKFST--NWPSNNP--QPNAIAEAFHLDPVLNGNPFSNGDLTAFFN 2877
            S+S      D++ +++ +T      NN    PN I +    + +     FS+ DL+A FN
Sbjct: 872  SDSVVCEEDDNVNDNEVTTTAKLEENNEFINPNKIEQGVTSNTL--AFSFSSTDLSALFN 929

Query: 2878 SDNGIPQIGGGSSVLN 2925
            +   + ++   ++  N
Sbjct: 930  APESLFKVPNENTQYN 945

>Kwal_27.10233 s27 complement(251120..251452) [333 bp, 110 aa] {OFF}
           [contig 39] FULL
          Length = 110

 Score =  221 bits (564), Expect = 8e-67
 Identities = 107/107 (100%), Positives = 107/107 (100%)
 Frame = -1

Query: 438 MHLLIFEVAQSNQSSILSLQFAHSLFECFCIATRKRSTRQLITNFALKTHSGALRALGPL 259
           MHLLIFEVAQSNQSSILSLQFAHSLFECFCIATRKRSTRQLITNFALKTHSGALRALGPL
Sbjct: 1   MHLLIFEVAQSNQSSILSLQFAHSLFECFCIATRKRSTRQLITNFALKTHSGALRALGPL 60

Query: 258 TVTTRLFGATPIAGLRHPIVRSWCSRSYGRDTARCVWSRAIVCSWLC 118
           TVTTRLFGATPIAGLRHPIVRSWCSRSYGRDTARCVWSRAIVCSWLC
Sbjct: 61  TVTTRLFGATPIAGLRHPIVRSWCSRSYGRDTARCVWSRAIVCSWLC 107

>Kwal_27.10235 s27 complement(253246..253491) [246 bp, 81 aa] {OFF}
            [contig 39] FULL
          Length = 81

 Score = 73.9 bits (180), Expect = 3e-15
 Identities = 44/81 (54%), Positives = 44/81 (54%)
 Frame = -2

Query: 2477 MINSVAISSRIKLCQDKEPGXXXXXXXXXXXXXXXXXXXXXXXXAPPFVYSKIPXXXXXX 2298
            MINSVAISSRIKLCQDKEPG                        APPFVYSKIP      
Sbjct: 1    MINSVAISSRIKLCQDKEPGSSSFLEASSSLTTSNNSALLSWNSAPPFVYSKIPRALRRA 60

Query: 2297 XXXXXXXRSIAKGKWRVLKQD 2235
                   RSIAKGKWRVLKQD
Sbjct: 61   NLALIRGRSIAKGKWRVLKQD 81

>Kpol_1016.20 s1016 (51828..55088) [3261 bp, 1086 aa] {ON}
           (51828..55088) [3261 nt, 1087 aa]
          Length = 1086

 Score = 83.2 bits (204), Expect = 3e-15
 Identities = 50/140 (35%), Positives = 71/140 (50%), Gaps = 6/140 (4%)
 Frame = +1

Query: 178 TSATPTSNY---RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGY 348
           TS    SN+   R++QACDRCR KK +CDG +P CSQC  V F CK SDKL+RR FPRGY
Sbjct: 81  TSVNIDSNFLSNRLSQACDRCRLKKIKCDGLKPNCSQCLKVNFICKTSDKLTRRGFPRGY 140

Query: 349 XXXXXXXXXXXXXXXXXXXXXCDLKDEQMHLVSKYSSNKRHEPSSTEEGRMLEQLSNSDG 528
                                  L  +++ L  +  SN + +  +T +G  +   + S  
Sbjct: 141 TEMLEKEVV--------------LLQKKLKLFEENHSNMKIDIQTTTDGSNIISTNCSSS 186

Query: 529 GS---LRVSSTNLYLLNKTT 579
           G+   +  S T++   NKT+
Sbjct: 187 GNENDIENSETDIITKNKTS 206

>Kwal_26.7397 s26 complement(342483..343085) [603 bp, 201 aa] {OFF}
           YJL089W (SIP4) - shows homology to DNA binding domain of
           Gal4p, has a leucine zipper motif and acidic region;
           lexA-Sip4p activates transcription [contig 304] PARTIAL
          Length = 201

 Score = 76.6 bits (187), Expect = 6e-15
 Identities = 34/62 (54%), Positives = 43/62 (69%), Gaps = 1/62 (1%)
 Frame = +1

Query: 166 ISPVTSATPTSNY-RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPR 342
           +SP  +    SN  R++QACDRCR KK +CDG +P C  C+ + F C+ SDKLSRR FPR
Sbjct: 10  LSPKATQLLLSNQARMSQACDRCRLKKIKCDGVKPTCGPCSKIKFHCQTSDKLSRRGFPR 69

Query: 343 GY 348
           GY
Sbjct: 70  GY 71

>AFR096W Chr6 (606993..609551) [2559 bp, 852 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YJL089W (SIP4)
          Length = 852

 Score = 79.0 bits (193), Expect = 5e-14
 Identities = 31/48 (64%), Positives = 38/48 (79%)
 Frame = +1

Query: 205 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGY 348
           R +QACDRCR KK +CDG RP C+ C  +G++CK SDKL+RR FPRGY
Sbjct: 24  RSSQACDRCRLKKIKCDGLRPSCTSCKKIGYQCKTSDKLTRRGFPRGY 71

>ZYRO0G15136g Chr7 complement(1218989..1222072) [3084 bp, 1027 aa]
           {ON} weakly similar to uniprot|P46954 Saccharomyces
           cerevisiae YJL089W SIP4 Possibly involved in Snf1p
           regulated transcriptional activation shows homology to
           DNA binding domain of Gal4p has a leucine zipper motif
           and acidic region lexA-Sip4p activates transcription
          Length = 1027

 Score = 79.0 bits (193), Expect = 6e-14
 Identities = 42/121 (34%), Positives = 57/121 (47%), Gaps = 12/121 (9%)
 Frame = +1

Query: 205 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGYXXXXXXXXXXXX 384
           R +QACDRCR KK +CDG +P CSQC  V F C+ SD+L+RR FPRGY            
Sbjct: 33  RQSQACDRCRLKKIKCDGMKPTCSQCTKVNFTCRTSDRLTRRGFPRGYTEMLESEVVRLQ 92

Query: 385 XXXXXXXXXCDLKDEQMHLVSKYSSNKRHEPSSTEEGRML------------EQLSNSDG 528
                     ++ DE ++  +  S N      S  +  M+              LSN++G
Sbjct: 93  KILEGKGISVEITDENINSSNDNSGNDNDNDDSDIKPTMIPSTYGDYSQEEERSLSNTNG 152

Query: 529 G 531
           G
Sbjct: 153 G 153

>KLTH0D03564g Chr4 (343546..346134) [2589 bp, 862 aa] {ON} weakly
           similar to uniprot|P46954 Saccharomyces cerevisiae
           YJL089W SIP4 Possibly involved in Snf1p regulated
           transcriptional activation shows homology to DNA binding
           domain of Gal4p has a leucine zipper motif and acidic
           region lexA-Sip4p activates transcription
          Length = 862

 Score = 78.6 bits (192), Expect = 7e-14
 Identities = 34/62 (54%), Positives = 44/62 (70%), Gaps = 1/62 (1%)
 Frame = +1

Query: 166 ISP-VTSATPTSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPR 342
           +SP  T    + + R++QACDRCR KK +CDG +P C+ C  +GF C+ SDKLSRR FPR
Sbjct: 10  LSPKATQLLLSKHARMSQACDRCRLKKIKCDGIKPTCTPCTKIGFHCQTSDKLSRRGFPR 69

Query: 343 GY 348
           GY
Sbjct: 70  GY 71

>KAFR0A01480 Chr1 (294040..296217) [2178 bp, 725 aa] {ON} Anc_1.277
           YJL089W
          Length = 725

 Score = 78.2 bits (191), Expect = 8e-14
 Identities = 30/58 (51%), Positives = 43/58 (74%)
 Frame = +1

Query: 175 VTSATPTSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGY 348
           + +++  S +RV+QACDRCR KK +CDG++P+CS C  + F C +S KLSRR  P+GY
Sbjct: 1   MNTSSELSKFRVSQACDRCRLKKIKCDGQKPRCSNCKKINFNCAISTKLSRRGLPKGY 58

>Smik_10.153 Chr10 (257677..260166) [2490 bp, 829 aa] {ON} YJL089W
           (REAL)
          Length = 829

 Score = 77.8 bits (190), Expect = 1e-13
 Identities = 33/57 (57%), Positives = 39/57 (68%)
 Frame = +1

Query: 178 TSATPTSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGY 348
           ++AT   + R A ACDRCR KK RCDG +P CS C  + F CK SDKLSRR  P+GY
Sbjct: 32  SNATTDFSVRKAHACDRCRLKKIRCDGLKPNCSNCTKINFPCKTSDKLSRRGLPKGY 88

>Ecym_6340 Chr6 complement(652943..655801) [2859 bp, 952 aa] {ON}
           similar to Ashbya gossypii AFR096W
          Length = 952

 Score = 77.8 bits (190), Expect = 1e-13
 Identities = 30/48 (62%), Positives = 38/48 (79%)
 Frame = +1

Query: 205 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGY 348
           R +QACDRCR KK +CDG RP C+ C  +G++C+ SDKL+RR FPRGY
Sbjct: 25  RSSQACDRCRLKKIKCDGVRPSCTSCKKIGYQCRTSDKLTRRGFPRGY 72

>KLLA0F14322g Chr6 (1328925..1331078) [2154 bp, 717 aa] {ON}
           uniprot|Q7Z8R2 Kluyveromyces lactis Sip4 protein
          Length = 717

 Score = 77.0 bits (188), Expect = 2e-13
 Identities = 34/66 (51%), Positives = 42/66 (63%)
 Frame = +1

Query: 151 NAARSISPVTSATPTSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRR 330
           N  + + P  S   T   R +QACDRCR KK +CDG +P CS C  +G+ C  SDKL+RR
Sbjct: 43  NEKKLLMPTAS---TKVKRFSQACDRCRLKKIKCDGIKPSCSNCKKIGYHCSTSDKLTRR 99

Query: 331 AFPRGY 348
            FPRGY
Sbjct: 100 GFPRGY 105

>Suva_6.161 Chr6
           complement(283370..284500,284547..284764,284948..285781,
           285812..286127) [2499 bp, 832 aa] {ON} YJL089W (REAL)
          Length = 832

 Score = 77.0 bits (188), Expect = 2e-13
 Identities = 32/56 (57%), Positives = 38/56 (67%)
 Frame = +1

Query: 181 SATPTSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGY 348
           +A P  + R A ACDRCR KK +CDG +P CS C  + F CK SDKLSRR  P+GY
Sbjct: 33  NAVPDFSVRKAHACDRCRLKKIKCDGLKPNCSNCGKIDFPCKTSDKLSRRGLPKGY 88

>SAKL0D05654g Chr4 (457485..460244) [2760 bp, 919 aa] {ON} weakly
           similar to uniprot|P46954 Saccharomyces cerevisiae
           YJL089W SIP4 Possibly involved in Snf1p regulated
           transcriptional activation shows homology to DNA binding
           domain of Gal4p has a leucine zipper motif and acidic
           region lexA-Sip4p activates transcription
          Length = 919

 Score = 77.0 bits (188), Expect = 2e-13
 Identities = 31/48 (64%), Positives = 37/48 (77%)
 Frame = +1

Query: 205 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGY 348
           R +QACDRCR KK +CDG +P C+ C  VGF C+ SDKL+RR FPRGY
Sbjct: 24  RSSQACDRCRLKKIKCDGLKPNCTSCKKVGFHCQTSDKLTRRGFPRGY 71

>TPHA0I02820 Chr9 complement(620925..624059) [3135 bp, 1044 aa] {ON}
           Anc_1.277 YJL089W
          Length = 1044

 Score = 76.3 bits (186), Expect = 4e-13
 Identities = 29/50 (58%), Positives = 39/50 (78%)
 Frame = +1

Query: 199 NYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGY 348
           N R++QACDRCR KK +CDG +P C+ C+ + F CK SD+L+RR FP+GY
Sbjct: 77  NIRLSQACDRCRLKKIKCDGLKPSCTHCSKIKFACKTSDRLTRRGFPKGY 126

>YJL089W Chr10 (265926..268415) [2490 bp, 829 aa] {ON}  SIP4C6 zinc
           cluster transcriptional activator that binds to the
           carbon source-responsive element (CSRE) of gluconeogenic
           genes; involved in the positive regulation of
           gluconeogenesis; regulated by Snf1p protein kinase;
           localized to the nucleus
          Length = 829

 Score = 75.5 bits (184), Expect = 6e-13
 Identities = 32/57 (56%), Positives = 39/57 (68%)
 Frame = +1

Query: 178 TSATPTSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGY 348
           ++A    + R A ACDRCR KK +CDG +P CS CA + F CK SDKLSRR  P+GY
Sbjct: 32  SNAITDFSVRKAHACDRCRLKKIKCDGLKPNCSNCAKIDFPCKTSDKLSRRGLPKGY 88

>TDEL0D01450 Chr4 (284869..287706) [2838 bp, 945 aa] {ON} Anc_1.277
           YJL089W
          Length = 945

 Score = 75.5 bits (184), Expect = 7e-13
 Identities = 33/54 (61%), Positives = 38/54 (70%), Gaps = 2/54 (3%)
 Frame = +1

Query: 193 TSNYRV--AQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGY 348
           T N RV  + ACDRCR KK RCDG +P CSQC+   F C  SDKL+RR FP+GY
Sbjct: 48  TKNERVRHSHACDRCRLKKVRCDGLKPSCSQCSRANFRCTTSDKLTRRGFPKGY 101

>Skud_10.125 Chr10 (233921..236422) [2502 bp, 833 aa] {ON} YJL089W
           (REAL)
          Length = 833

 Score = 74.3 bits (181), Expect = 1e-12
 Identities = 31/57 (54%), Positives = 39/57 (68%)
 Frame = +1

Query: 178 TSATPTSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGY 348
           ++A    + R A ACDRCR KK +CDG +P CS C+ + F CK SDKLSRR  P+GY
Sbjct: 32  SNAITDFSVRKAHACDRCRLKKIKCDGLKPNCSNCSKIDFPCKTSDKLSRRGLPKGY 88

>KNAG0B01840 Chr2 (345204..348422) [3219 bp, 1072 aa] {ON} Anc_1.277
           YJL089W
          Length = 1072

 Score = 73.2 bits (178), Expect = 4e-12
 Identities = 30/66 (45%), Positives = 42/66 (63%)
 Frame = +1

Query: 151 NAARSISPVTSATPTSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRR 330
           +++ S+   + +     +R  QACDRCR KK +CDG +P C+ CA + F CK S KLSRR
Sbjct: 5   SSSHSVVSASKSNQRVKFRKNQACDRCRLKKIKCDGLKPTCTNCAKINFLCKTSHKLSRR 64

Query: 331 AFPRGY 348
             P+GY
Sbjct: 65  GLPKGY 70

>CAGL0L03377g Chr12 complement(384929..388558) [3630 bp, 1209 aa]
           {ON} some similarities with uniprot|P46954 Saccharomyces
           cerevisiae YJL089w SIP4 interacts with SNF1 protein
           kinase
          Length = 1209

 Score = 72.0 bits (175), Expect = 8e-12
 Identities = 31/48 (64%), Positives = 37/48 (77%)
 Frame = +1

Query: 205 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGY 348
           R +QACDRCRSKK +CDG +P CS CA +G+ C  SDKLSRR  P+GY
Sbjct: 24  RHSQACDRCRSKKIKCDGLQP-CSNCAKIGYNCVTSDKLSRRGLPKGY 70

>NDAI0G05530 Chr7 (1360413..1363973) [3561 bp, 1186 aa] {ON} 
          Length = 1186

 Score = 71.2 bits (173), Expect = 1e-11
 Identities = 33/72 (45%), Positives = 39/72 (54%)
 Frame = +1

Query: 133 NNSAAPNAARSISPVTSATPTSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVS 312
           NN+   N  R              R  QACDRCR KK +CD  +P CSQC    F+CK +
Sbjct: 93  NNNININTERPKKKRKQIASIDKPRKIQACDRCRLKKIKCDDLKPSCSQCLKADFQCKTT 152

Query: 313 DKLSRRAFPRGY 348
           DKL+RR F RGY
Sbjct: 153 DKLARRGFSRGY 164

>TBLA0D05420 Chr4 complement(1334955..1337228) [2274 bp, 757 aa]
           {ON} Anc_1.277 YJL089W
          Length = 757

 Score = 70.9 bits (172), Expect = 2e-11
 Identities = 33/73 (45%), Positives = 43/73 (58%)
 Frame = +1

Query: 130 TNNSAAPNAARSISPVTSATPTSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKV 309
           TNNS   N    ++ +    PT   R +QACDRCR KK +CDG  P C+ C  + F C+ 
Sbjct: 76  TNNSGNTNTTNPLATI----PTGR-RHSQACDRCRLKKIKCDGLIPHCTNCRKINFNCQT 130

Query: 310 SDKLSRRAFPRGY 348
           + KLSRR  P+GY
Sbjct: 131 THKLSRRGLPKGY 143

>NCAS0A09410 Chr1 complement(1865924..1868722) [2799 bp, 932 aa]
           {ON} Anc_1.277
          Length = 932

 Score = 60.5 bits (145), Expect = 3e-08
 Identities = 22/45 (48%), Positives = 30/45 (66%)
 Frame = +1

Query: 214 QACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGY 348
           QACDRCR KK +CD + P C+ C   G  C+ +++L RR F +GY
Sbjct: 43  QACDRCRLKKIKCDDRTPDCTPCMKAGIPCRTTERLKRRGFAKGY 87

>KLLA0E13993g Chr5 complement(1239566..1241602) [2037 bp, 678 aa]
           {ON} some similarities with uniprot|P07272 Saccharomyces
           cerevisiae YLR014C PPR1 Zinc finger transcription factor
           containing a Zn(2)-Cys(6) binuclear cluster domain
           positively regulates transcription of genes involved in
           uracil biosynthesis activity may be modulated by
           interaction with Tup1p
          Length = 678

 Score = 54.7 bits (130), Expect = 1e-06
 Identities = 25/72 (34%), Positives = 37/72 (51%)
 Frame = +1

Query: 133 NNSAAPNAARSISPVTSATPTSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVS 312
           +N A  N++ + S  +SA+         AC  C+ ++ RCDG  PQC  C   G +C   
Sbjct: 38  DNDAVSNSSGNDSNSSSASKKRRKNQGVACCFCKRRRKRCDGGFPQCGACVNAGIQCTFV 97

Query: 313 DKLSRRAFPRGY 348
           DK++ R  PR Y
Sbjct: 98  DKITGRELPRDY 109

>SAKL0C02024g Chr3 complement(174858..177554) [2697 bp, 898 aa] {ON}
           similar to uniprot|P07272 Saccharomyces cerevisiae
           YLR014C PPR1 Zinc finger transcription factor containing
           a Zn(2)-Cys(6) binuclear cluster domain positively
           regulates transcription of genes involved in uracil
           biosynthesis activity may be modulated by interaction
           with Tup1p
          Length = 898

 Score = 52.4 bits (124), Expect = 8e-06
 Identities = 27/72 (37%), Positives = 41/72 (56%)
 Frame = +1

Query: 133 NNSAAPNAARSISPVTSATPTSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVS 312
           ++S   +++ S+S  TS    S  R   AC+RCR+KKT+CD   P C++CA++G  C   
Sbjct: 26  SSSCLASSSSSLSSPTSFLGIS--RSIVACERCRTKKTKCDQNFPSCARCASLGEPCISV 83

Query: 313 DKLSRRAFPRGY 348
           D  + R   R Y
Sbjct: 84  DPATGRVVSRSY 95

>KLLA0C10923g Chr3 complement(939148..941475) [2328 bp, 775 aa] {ON}
           weakly similar to uniprot|P07272 Saccharomyces
           cerevisiae YLR014C PPR1 Zinc finger transcription factor
           containing a Zn(2)-Cys(6) binuclear cluster domain
           positively regulates transcription of genes involved in
           uracil biosynthesis activity may be modulated by
           interaction with Tup1p
          Length = 775

 Score = 51.6 bits (122), Expect = 1e-05
 Identities = 23/58 (39%), Positives = 30/58 (51%)
 Frame = +1

Query: 175 VTSATPTSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGY 348
           VT  +  + YR   AC RCR +K +CD K P C++C      C   D  +RR  PR Y
Sbjct: 5   VTKESSGNIYRSVAACKRCRIRKIKCDNKFPSCTKCIQAQEPCITIDPSTRREIPRSY 62

>NCAS0D02540 Chr4 complement(484060..486732) [2673 bp, 890 aa] {ON}
           Anc_5.235
          Length = 890

 Score = 50.8 bits (120), Expect = 2e-05
 Identities = 26/66 (39%), Positives = 36/66 (54%)
 Frame = +1

Query: 151 NAARSISPVTSATPTSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRR 330
           N+ ++ SP +S   TS  +   AC RCRSKK +CD K P C +CA +   C   D  + +
Sbjct: 20  NSLKNGSPSSSTFNTSKSK--SACKRCRSKKIKCDQKFPSCDRCAHLKVPCVSVDPATGQ 77

Query: 331 AFPRGY 348
             PR Y
Sbjct: 78  DVPRSY 83

>TPHA0F01380 Chr6 complement(318207..320879) [2673 bp, 890 aa] {ON}
           Anc_2.231 YIL130W
          Length = 890

 Score = 48.9 bits (115), Expect = 9e-05
 Identities = 20/57 (35%), Positives = 29/57 (50%)
 Frame = +1

Query: 157 ARSISPVTSATPTSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSR 327
           +  +S V S T     RV +ACD CR KK +CDG+ P C  C    ++C     + +
Sbjct: 51  SNKLSNVASVTQKKRRRVTRACDECRKKKVKCDGQNP-CIHCTVYSYKCSYDQPVKK 106

 Score = 43.1 bits (100), Expect = 0.005
 Identities = 41/163 (25%), Positives = 69/163 (42%), Gaps = 11/163 (6%)
 Frame = +1

Query: 1480 VSSVYEIRGTVVSMAQQLRLHRCPSAVLGTEGSTMSKSEQGDRRLLFWGIYYLDVFGALQ 1659
            +++ Y   G  +  A +   HR     +    +T++  E   R+ +F+ IY LDV+    
Sbjct: 435  LTTCYSYIGAALRAALKEGYHRR----VDPNNTTLNPIEIEMRKRIFYTIYKLDVYVNSM 490

Query: 1660 LGVPRLLKDHEIECALPISEHAHAGVSLADQVIKLEGQVSE------LSLSLLRFSKILG 1821
            +G+PR L + + +  LPI         ++D+ I   G +SE       S+S+  +   L 
Sbjct: 491  MGLPRSLSEDDFDQELPI--------EISDECITENGYLSEQEGQQLSSISIANYHTKLY 542

Query: 1822 NILDSIFKR-----GMTSSAAQQVALIHENALDNWRRGLPKNL 1935
             IL  I +R         S  +   +  EN L  W   LP  L
Sbjct: 543  LILADIVQRLYSIKKKNRSITENTVISLENKLRKWADSLPHEL 585

>SAKL0G11902g Chr7 (1016915..1019635) [2721 bp, 906 aa] {ON} similar
           to uniprot|P07272 Saccharomyces cerevisiae YLR014C PPR1
           Zinc finger transcription factor containing a
           Zn(2)-Cys(6) binuclear cluster domain positively
           regulates transcription of genes involved in uracil
           biosynthesis activity may be modulated by interaction
           with Tup1p
          Length = 906

 Score = 48.9 bits (115), Expect = 9e-05
 Identities = 22/48 (45%), Positives = 26/48 (54%)
 Frame = +1

Query: 205 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGY 348
           R   AC RCR KK +CD K P CS+CA+    C   D  + R  PR Y
Sbjct: 38  RSIAACKRCRLKKVKCDQKFPSCSKCASANEPCVSLDPATGRDVPRSY 85

>KNAG0B05120 Chr2 (982236..984902) [2667 bp, 888 aa] {ON} 
          Length = 888

 Score = 48.5 bits (114), Expect = 1e-04
 Identities = 24/60 (40%), Positives = 30/60 (50%), Gaps = 2/60 (3%)
 Frame = +1

Query: 175 VTSATPTSNY--RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGY 348
           + SA   SN   +   AC RCRSKKT+CD K P C +C  +   C   D  +    PR Y
Sbjct: 29  IESAAKRSNSIPKSRSACKRCRSKKTKCDQKLPSCGKCTKLNTPCISVDPATGEDVPRSY 88

>KLTH0G07898g Chr7 (636890..639490) [2601 bp, 866 aa] {ON} similar
           to uniprot|P07272 Saccharomyces cerevisiae YLR014C PPR1
           Zinc finger transcription factor containing a
           Zn(2)-Cys(6) binuclear cluster domain positively
           regulates transcription of genes involved in uracil
           biosynthesis activity may be modulated by interaction
           with Tup1p
          Length = 866

 Score = 48.1 bits (113), Expect = 2e-04
 Identities = 28/78 (35%), Positives = 34/78 (43%), Gaps = 4/78 (5%)
 Frame = +1

Query: 127 RTNNSAAPNAARSISPVTSATPTSNY----RVAQACDRCRSKKTRCDGKRPQCSQCAAVG 294
           R    +A NA  S+       PTS      R   AC RCR +K +CD K P CS+C    
Sbjct: 5   RKRRGSAANAEESVD--RKRRPTSAIMGISRSIAACKRCRVRKVKCDQKFPSCSRCVTAN 62

Query: 295 FECKVSDKLSRRAFPRGY 348
             C   D  + R  PR Y
Sbjct: 63  EPCVSVDPATGRDVPRSY 80

>TBLA0G02610 Chr7 complement(689843..692845) [3003 bp, 1000 aa] {ON}
           Anc_2.231 YIL130W
          Length = 1000

 Score = 48.1 bits (113), Expect = 2e-04
 Identities = 23/58 (39%), Positives = 31/58 (53%), Gaps = 2/58 (3%)
 Frame = +1

Query: 163 SISPVTSATPTS--NYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRR 330
           SI+  T   P      RV +ACD CR KK +CDG++P C  C    +EC  +   +RR
Sbjct: 45  SINSNTQGNPIQLKRRRVTRACDECRKKKVKCDGQQP-CIHCTVYSYECTYNQPSTRR 101

 Score = 39.7 bits (91), Expect = 0.062
 Identities = 52/230 (22%), Positives = 98/230 (42%), Gaps = 26/230 (11%)
 Frame = +1

Query: 1480 VSSVYEIRGTVVSMAQQLRLHRC-PSAVLGT-EGSTMSKSEQGDRRLLFWGIYYLDVFGA 1653
            +S+ Y   G  +  A +  LHR  P+  +GT   S  +  E   R+ LF+ IY LD++  
Sbjct: 394  LSTCYSYIGVALRSALREGLHRVIPTNKIGTGTDSRFNCIEIEMRKRLFYTIYKLDIYVN 453

Query: 1654 LQLGVPRLLKDHEIECALPISEHAHAGVSLADQVIKLEGQVSELSLSLLRFSKI------ 1815
              LG+PR +  ++ + +LP          L+D+ I  +    +   ++L  + I      
Sbjct: 454  AMLGLPRSISPNDFDQSLPF--------DLSDENITKDEIFFDRQNNVLSSAGIANQHTK 505

Query: 1816 LGNILDSIFKRGMTSSAAQQVALIHEN------ALDNWRRGLP---KNLTFELDVNGTIK 1968
            L  I DSI           +  + H++       L++W   LP   KNL  +      ++
Sbjct: 506  LMMIFDSIITELYPIKKTSKFFISHDSITNFELKLNHWLNNLPIELKNLYTQ-----DVQ 560

Query: 1969 IEELTGSAQNNQDFTKNASSD---------KKILMLLYFLVKCLVHLPVL 2091
            +++L  +  N +D   +   D           +L L +F V+ +++ P +
Sbjct: 561  LDKLNKNKNNGKDGGGDDDDDNIPSKYERANNLLHLSFFHVQIILYRPFI 610

>TBLA0A01210 Chr1 (276151..280419) [4269 bp, 1422 aa] {ON} Anc_1.380
           YLR256W
          Length = 1422

 Score = 48.1 bits (113), Expect = 2e-04
 Identities = 25/66 (37%), Positives = 34/66 (51%), Gaps = 11/66 (16%)
 Frame = +1

Query: 130 TNNSAAPNAARSISPVTSATP---TSNY--------RVAQACDRCRSKKTRCDGKRPQCS 276
           TN S   N + S +  T++TP   TSN         R+  +C  CR +K +CD KRP C+
Sbjct: 77  TNTSTNTNTSNSSTSTTTSTPNHSTSNSSKPKRKRNRIPLSCTICRKRKVKCDKKRPHCN 136

Query: 277 QCAAVG 294
           QC   G
Sbjct: 137 QCTKTG 142

>KLLA0A02585g Chr1 complement(226562..227674) [1113 bp, 370 aa] {ON}
           conserved hypothetical protein
          Length = 370

 Score = 47.4 bits (111), Expect = 2e-04
 Identities = 24/55 (43%), Positives = 33/55 (60%)
 Frame = +1

Query: 151 NAARSISPVTSATPTSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSD 315
           N +RS    ++  PT   RV++ACD CR  KT+CDG+RP CS+C      C  S+
Sbjct: 3   NGSRS----SAELPTIKRRVSKACDACRKSKTKCDGERP-CSRCLKENKLCTYSN 52

>ZYRO0E08272g Chr5 (651705..654089) [2385 bp, 794 aa] {ON} similar
           to uniprot|P04386 Saccharomyces cerevisiae YPL248C GAL4
           DNA-binding transcription factor required for the
           activation of the GAL genes in response to galactose
           repressed by Gal80p and activated by Gal3p
          Length = 794

 Score = 47.8 bits (112), Expect = 2e-04
 Identities = 19/47 (40%), Positives = 27/47 (57%)
 Frame = +1

Query: 208 VAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGY 348
           +  ACD CR KK RC  + P+C++C   G+EC  S K +R    R +
Sbjct: 7   IDHACDSCRQKKLRCSKEEPKCAKCIQNGWECCYSPKANRTPLTRAH 53

>KLTH0E08778g Chr5 complement(795841..798462) [2622 bp, 873 aa] {ON}
            conserved hypothetical protein
          Length = 873

 Score = 47.8 bits (112), Expect = 2e-04
 Identities = 45/198 (22%), Positives = 85/198 (42%), Gaps = 9/198 (4%)
 Frame = +1

Query: 1513 VSMAQQLRLHRCPSAVLGTEGSTMSKSEQGDRRLLFWGIYYLDVFGALQLGVPRLLKDHE 1692
            V++AQ   LHR           T++ +E+  R+L++W +Y +D   ++ +G P+ +   +
Sbjct: 332  VTIAQTYGLHRSADF-----HPTLTANEKRARKLIWWILYVIDTLVSISIGRPQAINLDD 386

Query: 1693 IECALPISEHAHAGVSLADQVIKLEGQVSELSL---------SLLRFSKILGNILDSIFK 1845
              C +P+  H        D  +  EG+  E S+         S ++ ++I+  I   + +
Sbjct: 387  --CDVPVLTH--------DDFV-FEGEAPEHSMPVDHMDCIISTVQIAEIMSRISRELNR 435

Query: 1846 RGMTSSAAQQVALIHENALDNWRRGLPKNLTFELDVNGTIKIEELTGSAQNNQDFTKNAS 2025
                   A+ +    +  L  WR  LP++LT+                  N + FTK+ S
Sbjct: 436  PAAAHCDAKFLIQHFDLLLQRWRNNLPESLTYH----------------SNAEIFTKH-S 478

Query: 2026 SDKKILMLLYFLVKCLVH 2079
              K  +  LY+   CL+H
Sbjct: 479  IPKAFVNALYYKTLCLLH 496

 Score = 36.6 bits (83), Expect = 0.53
 Identities = 14/38 (36%), Positives = 21/38 (55%), Gaps = 1/38 (2%)
 Frame = +1

Query: 205 RVAQACDRCRSKKTRCDGK-RPQCSQCAAVGFECKVSD 315
           R ++AC+ C  +K RCD   R  C+ C   G  C++ D
Sbjct: 14  RTSRACEVCHDRKVRCDANIRVPCTSCQTFGLVCRLRD 51

>KAFR0F03410 Chr6 complement(677156..680143) [2988 bp, 995 aa] {ON}
           Anc_4.113 YGL013C
          Length = 995

 Score = 47.8 bits (112), Expect = 2e-04
 Identities = 20/42 (47%), Positives = 28/42 (66%)
 Frame = +1

Query: 205 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRR 330
           +V QACD CR +K +C GK+P CS C A   +C  S+K ++R
Sbjct: 18  KVRQACDNCRKRKLKCTGKQP-CSTCEAYSCDCIYSEKTTKR 58

>YOR380W Chr15 (1051290..1052930) [1641 bp, 546 aa] {ON}
           RDR1Transcriptional repressor involved in the control of
           multidrug resistance; negatively regulates expression of
           the PDR5 gene; member of the Gal4p family of zinc
           cluster proteins
          Length = 546

 Score = 47.4 bits (111), Expect = 2e-04
 Identities = 23/58 (39%), Positives = 31/58 (53%)
 Frame = +1

Query: 169 SPVTSATPTSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPR 342
           SP ++A P    RV +AC  CR +K +C+GK P C  C A G+ C   D     A P+
Sbjct: 3   SPGSTALPHKRQRVRKACVPCRERKRKCNGKSP-CEMCVAYGYVCHYIDGRVPSASPQ 59

>Kwal_47.17681 s47 complement(513119..515683) [2565 bp, 854 aa] {ON}
            [contig 206] FULL
          Length = 854

 Score = 47.4 bits (111), Expect = 3e-04
 Identities = 40/189 (21%), Positives = 81/189 (42%)
 Frame = +1

Query: 1513 VSMAQQLRLHRCPSAVLGTEGSTMSKSEQGDRRLLFWGIYYLDVFGALQLGVPRLLKDHE 1692
            V++AQ   LHR           T++ +E+  R+L++W +Y +D   ++ +G P+ +   +
Sbjct: 314  VTVAQTYGLHRSADF-----HPTLTANEKRTRKLIWWILYVIDTLVSISIGRPQAINLDD 368

Query: 1693 IECALPISEHAHAGVSLADQVIKLEGQVSELSLSLLRFSKILGNILDSIFKRGMTSSAAQ 1872
              C +P+  H             +     +  +S ++  +I+  I   + +   +   A+
Sbjct: 369  --CDVPVLTHDDFIFEGGAPDHAVAVDYMDCIISTVQIVEIMSRISRELNRPAASQCDAK 426

Query: 1873 QVALIHENALDNWRRGLPKNLTFELDVNGTIKIEELTGSAQNNQDFTKNASSDKKILMLL 2052
             +    +  L  WR+ LP++LT+                  N + FTK+ S  K  +  L
Sbjct: 427  VLIQHFDMLLQRWRKNLPESLTYH----------------SNAEIFTKH-SIPKAFVNAL 469

Query: 2053 YFLVKCLVH 2079
            Y+   CL+H
Sbjct: 470  YYKTLCLLH 478

 Score = 36.6 bits (83), Expect = 0.53
 Identities = 18/49 (36%), Positives = 24/49 (48%), Gaps = 6/49 (12%)
 Frame = +1

Query: 187 TPTSNYRVAQ-----ACDRCRSKKTRCDGK-RPQCSQCAAVGFECKVSD 315
           T  S YRV +     AC+ C  +K RCD   R  C+ C   G  C++ D
Sbjct: 3   TERSGYRVRKPRTNRACEVCHDRKVRCDANIRVPCTSCQTFGLVCRLRD 51

>Smik_6.452 Chr6 (741922..744558) [2637 bp, 878 aa] {ON} YPL248C
           (REAL)
          Length = 878

 Score = 47.4 bits (111), Expect = 3e-04
 Identities = 18/47 (38%), Positives = 28/47 (59%)
 Frame = +1

Query: 208 VAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGY 348
           + QACD CR KK +C  ++P+C++C    +EC+ S K  R    R +
Sbjct: 7   IEQACDICRLKKLKCSKEKPKCAKCLKNNWECRYSPKTKRSPLTRAH 53

>YPL248C Chr16 complement(79711..82356) [2646 bp, 881 aa] {ON}
           GAL4DNA-binding transcription factor required for the
           activation of the GAL genes in response to galactose;
           repressed by Gal80p and activated by Gal3p
          Length = 881

 Score = 47.4 bits (111), Expect = 3e-04
 Identities = 18/47 (38%), Positives = 28/47 (59%)
 Frame = +1

Query: 208 VAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGY 348
           + QACD CR KK +C  ++P+C++C    +EC+ S K  R    R +
Sbjct: 7   IEQACDICRLKKLKCSKEKPKCAKCLKNNWECRYSPKTKRSPLTRAH 53

>NCAS0D04190 Chr4 (793242..795914) [2673 bp, 890 aa] {ON} Anc_6.279
          Length = 890

 Score = 47.4 bits (111), Expect = 3e-04
 Identities = 19/45 (42%), Positives = 26/45 (57%)
 Frame = +1

Query: 208 VAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPR 342
           + QACD CR KK +C  + P+CS+C   G +C  S K+ R    R
Sbjct: 16  IEQACDNCRLKKLKCSKETPKCSKCLKNGMKCLYSPKVKRSPLTR 60

>NDAI0F01220 Chr6 complement(295418..298300) [2883 bp, 960 aa] {ON}
           Anc_6.279
          Length = 960

 Score = 47.4 bits (111), Expect = 3e-04
 Identities = 20/51 (39%), Positives = 29/51 (56%)
 Frame = +1

Query: 196 SNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGY 348
           S  +  QACD CR KK +C  ++P+C++C   G+EC  S K  R    R +
Sbjct: 4   STEKSEQACDICRIKKLKCSREKPKCAKCMKNGWECCYSPKAKRSPLTRAH 54

>KLLA0F04609g Chr6 complement(451579..454329) [2751 bp, 916 aa] {ON}
           similar to uniprot|P40467 Saccharomyces cerevisiae
           YIL130W ASG1 Proposed transcriptional activator member
           of the Gal4p family of zinc cluster proteins
          Length = 916

 Score = 47.0 bits (110), Expect = 4e-04
 Identities = 19/41 (46%), Positives = 24/41 (58%)
 Frame = +1

Query: 205 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSR 327
           RV +ACD CR KK +CDGK+P C  C    +EC  +    R
Sbjct: 9   RVTRACDECRKKKVKCDGKQP-CIHCTVYNYECTYNQPTRR 48

>KNAG0D00690 Chr4 (105640..108267) [2628 bp, 875 aa] {ON} Anc_6.279
           YPL248C
          Length = 875

 Score = 46.6 bits (109), Expect = 5e-04
 Identities = 20/51 (39%), Positives = 26/51 (50%)
 Frame = +1

Query: 196 SNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGY 348
           +N    QACD CR KK +C   +P C +CA  G+ C  S K  R    R +
Sbjct: 13  ANSSTDQACDLCRIKKLKCSKDKPACRKCAKNGWNCTYSPKAKRSPLTRAH 63

>Kpol_1018.30 s1018 complement(81534..83840,83842..84180) [2646 bp,
           881 aa] {ON} complement(81534..83840,83842..84180) [2646
           nt, 882 aa]
          Length = 881

 Score = 46.6 bits (109), Expect = 5e-04
 Identities = 19/51 (37%), Positives = 27/51 (52%)
 Frame = +1

Query: 196 SNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGY 348
           SN    Q CD CR KK +C  ++P+C +C    +EC  S K+ R    R +
Sbjct: 2   SNIITNQVCDSCRLKKLKCSKEKPKCFKCLKHNWECNYSPKIKRSPLTRAH 52

>Kwal_23.2905 s23 (69235..71880) [2646 bp, 881 aa] {ON} YLR014C
           (PPR1) - zinc-finger transcription factor of the
           Zn(2)-Cys(6) binuclear cluster domain type [contig 246]
           FULL
          Length = 881

 Score = 46.2 bits (108), Expect = 6e-04
 Identities = 20/48 (41%), Positives = 25/48 (52%)
 Frame = +1

Query: 205 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGY 348
           R   AC RCR +K +CD K P CS+C +    C   D  + R  PR Y
Sbjct: 44  RSIAACKRCRIRKVKCDQKFPSCSRCVSANEPCVSIDPATGRDVPRSY 91

>KNAG0E01760 Chr5 (350254..352962) [2709 bp, 902 aa] {ON} Anc_2.231
           YIL130W
          Length = 902

 Score = 46.2 bits (108), Expect = 6e-04
 Identities = 20/58 (34%), Positives = 28/58 (48%)
 Frame = +1

Query: 154 AARSISPVTSATPTSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSR 327
           A + + P          RV +ACD CR KK +CDG++P C  C    +EC  +    R
Sbjct: 15  AGQQLLPQQLQLQAKRRRVTRACDECRKKKVKCDGQQP-CIHCTVYSYECTYNHPTKR 71

 Score = 37.4 bits (85), Expect = 0.31
 Identities = 43/162 (26%), Positives = 68/162 (41%), Gaps = 2/162 (1%)
 Frame = +1

Query: 1480 VSSVYEIRGTVVSMAQQLRLHRCPSAVLGTEGSTMSKSEQGDRRLLFWGIYYLDVFGALQ 1659
            +S+ Y   G  +  A +   HR     +G E S +S  E   R+ LF+ IY LDV+    
Sbjct: 394  LSTCYAYIGVAMRSALREGFHR----KVGPE-SDLSPLEIEIRKRLFYTIYKLDVYVNAM 448

Query: 1660 LGVPRLLKDHEIECALPISEHAHAGVSLADQVIKLEGQVSELSLSLLRFSKILGNILDSI 1839
            LG+PR +   + +  LP+          A    + +G +S   ++      I+  ILD+I
Sbjct: 449  LGLPRSISPEDFDQVLPLELSDENITEQAYYPEREDGSLSSTGIANCHTRLIM--ILDTI 506

Query: 1840 FKRGMTSSAAQQVALIHENA--LDNWRRGLPKNLTFELDVNG 1959
             ++         V + HE    L+   R     L  EL  NG
Sbjct: 507  MRKLYPIKRPNNV-ISHETVTNLEKLLRDWTNTLPAELKPNG 547

>KLTH0D07260g Chr4 complement(635598..638537) [2940 bp, 979 aa] {ON}
           some similarities with uniprot|P32862 Saccharomyces
           cerevisiae YKL038W RGT1 Glucose-responsive transcription
           factor that regulates expression of several glucose
           transporter (HXT) genes in response to glucose binds to
           promoters and acts both as a transcriptional activator
           and repressor
          Length = 979

 Score = 46.2 bits (108), Expect = 6e-04
 Identities = 22/58 (37%), Positives = 32/58 (55%), Gaps = 2/58 (3%)
 Frame = +1

Query: 181 SATPTSNYRVAQACDRCRSKKTRCD--GKRPQCSQCAAVGFECKVSDKLSRRAFPRGY 348
           +A+     + ++ACD+CR KKTRCD   +RP CS C  +G  C       +R   +GY
Sbjct: 22  AASDRRRSKTSRACDQCREKKTRCDFSDERPICSACQRMGKTCTFERVPMKRGPTKGY 79

>Skud_15.546 Chr15 (990335..991963) [1629 bp, 542 aa] {ON} YOR380W
           (REAL)
          Length = 542

 Score = 45.8 bits (107), Expect = 7e-04
 Identities = 21/59 (35%), Positives = 31/59 (52%)
 Frame = +1

Query: 166 ISPVTSATPTSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPR 342
           +S  +++ P    RV +AC  CR +K +C+GK P C  C A G+ C  +D       PR
Sbjct: 2   VSSGSNSQPYKRQRVRKACVPCRERKRKCNGKSP-CEMCIAYGYACHYTDVDGSSTSPR 59

>KLTH0G09108g Chr7 (744062..746410) [2349 bp, 782 aa] {ON} weakly
           similar to uniprot|P40467 Saccharomyces cerevisiae
           YIL130W ASG1 Proposed transcriptional activator member
           of the Gal4p family of zinc cluster proteins
          Length = 782

 Score = 45.8 bits (107), Expect = 8e-04
 Identities = 19/43 (44%), Positives = 25/43 (58%)
 Frame = +1

Query: 205 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRA 333
           RV +ACD CR KK +CDG++P C  C    +EC  +    R A
Sbjct: 10  RVTRACDECRKKKVKCDGQQP-CIHCTVYSYECTYNQPSKRVA 51

 Score = 36.2 bits (82), Expect = 0.68
 Identities = 40/163 (24%), Positives = 67/163 (41%), Gaps = 11/163 (6%)
 Frame = +1

Query: 1480 VSSVYEIRGTVVSMAQQLRLHRCPSAVLGTEGSTMSKSEQGDRRLLFWGIYYLDVFGALQ 1659
            +S+ Y   G  +  A +  +HR     L  +  + +  E   R+ LF+ IY +DV+    
Sbjct: 310  LSTCYTYIGVAMRNALREGMHRN----LNADTHSYNPIEIEMRKRLFYTIYKMDVYVNTM 365

Query: 1660 LGVPRLLKDHEIECALPISEHAHAGVSLADQVIKLEGQVSELSLSLL----------RFS 1809
            LG+PR +   + + ALP          L D+ I  +G   E   ++L          +  
Sbjct: 366  LGLPRSVSQRDFDQALP--------AELTDEFITKDGLHFEKQGNVLSSAGIANQHTKLI 417

Query: 1810 KILGNILDSIFKRGMTSS-AAQQVALIHENALDNWRRGLPKNL 1935
             IL NI+  ++    T++  +  V    E  L  W   LP  L
Sbjct: 418  MILDNIVAELYPVKKTNNLISHDVVTQLELKLRQWLDNLPPEL 460

>Suva_6.285 Chr6 (499581..501941) [2361 bp, 786 aa] {ON} YJL206C
            (REAL)
          Length = 786

 Score = 45.8 bits (107), Expect = 8e-04
 Identities = 48/207 (23%), Positives = 94/207 (45%), Gaps = 5/207 (2%)
 Frame = +1

Query: 1480 VSSVYEIRGTVVSMAQQLRLHRCPSAVLGTEGSTMSKSEQGDRRLLFWGIYYLDVFGALQ 1659
            + + Y   G  +  A +  LHR  S      G T  + E   R  LFW +Y LD++    
Sbjct: 326  LKACYSFIGIALRAALKEGLHRKSSIT----GPTAIQDETKKR--LFWSVYKLDLYMNCI 379

Query: 1660 LGVPRLLKDHEIECALPI----SEHAHAGVSLAD-QVIKLEGQVSELSLSLLRFSKILGN 1824
            LG P  + + +I+   P+       +  G+   D ++I   G  +E +  +L  S+I   
Sbjct: 380  LGFPSGIDESDIDQEFPLDVDDENISTMGIKFQDWRMISSCGMNNEHTKLILIMSRIY-K 438

Query: 1825 ILDSIFKRGMTSSAAQQVALIHENALDNWRRGLPKNLTFELDVNGTIKIEELTGSAQNNQ 2004
            ++ S+ ++ +   +  Q+  +++  L+NW   LP  L  +  +    ++     ++ N+ 
Sbjct: 439  LMYSLRRKPLEEDSRLQIVSLNDQ-LENWYAQLPDILKVDKIIYREPQLPLHICASDNSS 497

Query: 2005 DFTKNASSDKKILMLLYFLVKCLVHLP 2085
             +TK     KK+L L + L K +++ P
Sbjct: 498  PYTK----PKKLLYLDFLLSKIVLYKP 520

>Kwal_23.4754 s23 (845550..847988) [2439 bp, 812 aa] {ON} YIL130W
           (GIN1) - 1:1 [contig 5] FULL
          Length = 812

 Score = 45.8 bits (107), Expect = 8e-04
 Identities = 19/43 (44%), Positives = 25/43 (58%)
 Frame = +1

Query: 205 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRA 333
           RV +ACD CR KK +CDG++P C  C    +EC  +    R A
Sbjct: 10  RVTRACDECRKKKVKCDGQQP-CIHCTVYSYECTYNQPSKRVA 51

 Score = 39.7 bits (91), Expect = 0.060
 Identities = 43/164 (26%), Positives = 67/164 (40%), Gaps = 11/164 (6%)
 Frame = +1

Query: 1480 VSSVYEIRGTVVSMAQQLRLHRCPSAVLGTEGSTMSKSEQGDRRLLFWGIYYLDVFGALQ 1659
            +S+ Y   G  +  A +  +HR     L T+    S  E   R+ LF+ IY +DV+    
Sbjct: 341  LSTCYTYIGVAMRNALREGMHRN----LNTDTHGYSPIEIEMRKRLFYTIYKMDVYVNTM 396

Query: 1660 LGVPRLLKDHEIECALPISEHAHAGVSLADQVIKLEGQVSELSLSLL----------RFS 1809
            LG+PR +   + + ALP          L D+ I  +G   E    +L          +  
Sbjct: 397  LGLPRSVSQRDFDQALP--------AELTDEYITEDGLHPEKQGDVLSSAGIANQHTKLI 448

Query: 1810 KILGNILDSIFKRGMTSS-AAQQVALIHENALDNWRRGLPKNLT 1938
             IL NI+  ++    T++  +  V    E  L  W   LP  LT
Sbjct: 449  MILDNIVAELYPVKKTNNLISHDVVTQLEFKLRQWLDNLPPELT 492

>SAKL0E08998g Chr5 complement(747085..749556) [2472 bp, 823 aa] {ON}
           similar to uniprot|P40467 Saccharomyces cerevisiae
           YIL130W ASG1 Proposed transcriptional activator member
           of the Gal4p family of zinc cluster proteins
          Length = 823

 Score = 45.8 bits (107), Expect = 8e-04
 Identities = 18/41 (43%), Positives = 24/41 (58%)
 Frame = +1

Query: 205 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSR 327
           RV +ACD CR KK +CDG++P C  C    +EC  +    R
Sbjct: 10  RVTRACDECRKKKVKCDGQQP-CIHCTVYSYECTYNQPTKR 49

 Score = 40.0 bits (92), Expect = 0.046
 Identities = 40/158 (25%), Positives = 70/158 (44%), Gaps = 6/158 (3%)
 Frame = +1

Query: 1480 VSSVYEIRGTVVSMAQQLRLHRCPSAVLGTEGSTMSKSEQGDRRLLFWGIYYLDVFGALQ 1659
            +S+ Y   G  +  A +  LHR  +  +G  G T  + E   R+ LF+ IY +D++    
Sbjct: 296  LSTCYAYIGVAMRSALREGLHR--NLTMGAPGFTPIEIEM--RKRLFFTIYKMDIYLNTM 351

Query: 1660 LGVPRLLKDHEIECALPISEHAHAGVSLADQVIKLEGQVSELSLSLL-----RFSKILGN 1824
            LG+PR +   + + + P+         + +  I  E Q  ELS + +     +   IL N
Sbjct: 352  LGLPRAISQRDFDQSFPLEIDDE---YITEDGIYPERQGDELSSAGIANQHTKLIMILDN 408

Query: 1825 ILDSIFKRGMTSS-AAQQVALIHENALDNWRRGLPKNL 1935
            I+  ++    T++  + +V    E  L  W   LP  L
Sbjct: 409  IVSELYPIKKTNNLISHEVVTNLELKLRQWLNQLPPEL 446

>TDEL0C04480 Chr3 (799022..801580) [2559 bp, 852 aa] {ON} Anc_2.231
           YIL130W possible pseudogene; NNN added to avoid internal
           stop codon
          Length = 852

 Score = 45.8 bits (107), Expect = 8e-04
 Identities = 18/41 (43%), Positives = 24/41 (58%)
 Frame = +1

Query: 205 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSR 327
           RV +ACD CR KK +CDG++P C  C    +EC  +    R
Sbjct: 15  RVTRACDECRKKKVKCDGQQP-CIHCTVYSYECTYNQPTKR 54

 Score = 44.3 bits (103), Expect = 0.002
 Identities = 52/215 (24%), Positives = 87/215 (40%), Gaps = 11/215 (5%)
 Frame = +1

Query: 1480 VSSVYEIRGTVVSMAQQLRLHRCPSAVLGTEGSTMSKSEQGDRRLLFWGIYYLDVFGALQ 1659
            +S+ Y   G  +  A +  LHR  S   G      S  E   R+ LF+ IY LDV+    
Sbjct: 348  LSTCYAYIGVAMRSALREGLHRSVSPDSG-----FSPIEIEMRKRLFYTIYKLDVYVNAM 402

Query: 1660 LGVPRLLKDHEIECALPISEHAHAGVSLADQVIKLEG----------QVSELSLSLLRFS 1809
            LG+PR +  ++ +  LPI         L+D+ I  EG            +E++    +  
Sbjct: 403  LGLPRSISSNDFDQTLPI--------ELSDENITEEGYFPENQKGKLSSAEIANQHTKLI 454

Query: 1810 KILGNILDSIFKRGMTSSAAQ-QVALIHENALDNWRRGLPKNLTFELDVNGTIKIEELTG 1986
             IL  I+  ++    T++  + +V    E  L  W  GLP+ L                 
Sbjct: 455  MILNVIVGELYPIRKTNNLIRHEVVTELELKLRQWLDGLPREL----------------- 497

Query: 1987 SAQNNQDFTKNASSDKKILMLLYFLVKCLVHLPVL 2091
                 +D  K   +  K+L L +F V+ +++ P +
Sbjct: 498  -IPGIKDVPKEYETANKLLHLSFFHVQLILYRPFI 531

>NDAI0I02350 Chr9 (536448..539117) [2670 bp, 889 aa] {ON} Anc_5.235
          Length = 889

 Score = 45.8 bits (107), Expect = 8e-04
 Identities = 19/44 (43%), Positives = 23/44 (52%)
 Frame = +1

Query: 217 ACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGY 348
           AC RCR KK +CD   P CS+CA +   C   D  +    PR Y
Sbjct: 21  ACKRCRLKKIKCDNNVPSCSRCAKLRVPCVAVDSATGEDVPRSY 64

>Suva_10.94 Chr10 complement(178366..181086) [2721 bp, 906 aa] {ON}
           YLR014C (REAL)
          Length = 906

 Score = 45.8 bits (107), Expect = 8e-04
 Identities = 23/71 (32%), Positives = 35/71 (49%), Gaps = 3/71 (4%)
 Frame = +1

Query: 145 APNAARSISPVTSATPTSNYRVAQ---ACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSD 315
           A N   SI+ +     + N  +++   AC RCR KK +CD + P C +CA +   C   D
Sbjct: 6   ATNKKNSITHLPKKGDSPNIGISKSRTACKRCRQKKIKCDQEFPSCKRCAKLKVPCVSLD 65

Query: 316 KLSRRAFPRGY 348
             + +  PR Y
Sbjct: 66  PATGKDVPRSY 76

>NDAI0B03850 Chr2 complement(970366..973158) [2793 bp, 930 aa] {ON}
           Anc_2.231 YIL130W
          Length = 930

 Score = 45.8 bits (107), Expect = 8e-04
 Identities = 18/41 (43%), Positives = 24/41 (58%)
 Frame = +1

Query: 205 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSR 327
           RV +ACD CR KK +CDG++P C  C    +EC  +    R
Sbjct: 34  RVTRACDECRKKKVKCDGQQP-CIHCTVYSYECTYNQPTKR 73

 Score = 40.0 bits (92), Expect = 0.047
 Identities = 44/169 (26%), Positives = 71/169 (42%), Gaps = 12/169 (7%)
 Frame = +1

Query: 1480 VSSVYEIRGTVVSMAQQLRLHRCPSAVLGTEGSTMSKSEQGDRRLLFWGIYYLDVFGALQ 1659
            +S+ Y   G  +  A +  LHR          S  +  E   R+ LF+ IY LD++    
Sbjct: 394  LSTCYSYIGVAMRSALREGLHRQVGP-----NSGFNPIEIEMRKRLFYTIYKLDIYVNAM 448

Query: 1660 LGVPRLLKDHEIECALPISEHAHAGVSLADQVIKLEGQVSELSLSLLRFSKILGN----- 1824
            LG+PR +  ++ +  LP+         L+D+ I  +G   E    +L  + I        
Sbjct: 449  LGLPRSISANDFDQTLPL--------ELSDENITEQGYFPENQNGVLSSTGIANEHTKLL 500

Query: 1825 -ILDSI------FKRGMTSSAAQQVALIHENALDNWRRGLPKNLTFELD 1950
             ILD+I       K+  T  + + +A + E  L NW   LP  L   L+
Sbjct: 501  MILDAIVGELYPIKKTNTFISHETIATL-EQKLRNWLDDLPNELAPNLE 548

>Skud_9.37 Chr9 (79947..82811) [2865 bp, 954 aa] {ON} YIL130W (REAL)
          Length = 954

 Score = 45.8 bits (107), Expect = 8e-04
 Identities = 19/45 (42%), Positives = 24/45 (53%)
 Frame = +1

Query: 205 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFP 339
           RV +ACD CR KK +CDG++P C  C    +EC       R   P
Sbjct: 16  RVTRACDECRKKKVKCDGQQP-CIHCTVYSYECTYKKPTKRTQNP 59

 Score = 40.8 bits (94), Expect = 0.027
 Identities = 43/158 (27%), Positives = 69/158 (43%), Gaps = 6/158 (3%)
 Frame = +1

Query: 1480 VSSVYEIRGTVVSMAQQLRLHRCPSAVLGTEGSTMSKSEQGDRRLLFWGIYYLDVFGALQ 1659
            +S+ Y   G  +  A +   HR     LGT  S  S  E   R+ LF+ IY LDV+    
Sbjct: 363  LSTCYTYIGVAMRSALRAGFHR----KLGTN-SGFSPIEIEMRKRLFYTIYKLDVYINAM 417

Query: 1660 LGVPRLLKDHEIECALPISEHAHAGVSLADQVIKLEGQVSELSLSLL-----RFSKILGN 1824
            LG+PR +   + +  LP+     +  ++ +     E Q + LS + +     +   IL  
Sbjct: 418  LGLPRSISPDDFDQTLPLD---LSDENITETAYLPENQNAVLSSTGISNEHTKLFLILNE 474

Query: 1825 ILDSIFKRGMTSS-AAQQVALIHENALDNWRRGLPKNL 1935
            I+  ++    TS+  + +     E  L NW   LPK L
Sbjct: 475  IISELYPIKKTSNIISHETVTSLELKLRNWLDSLPKEL 512

>NDAI0A08790 Chr1 complement(2026171..2029350) [3180 bp, 1059 aa]
           {ON} Anc_7.17
          Length = 1059

 Score = 45.8 bits (107), Expect = 8e-04
 Identities = 15/34 (44%), Positives = 22/34 (64%)
 Frame = +1

Query: 202 YRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 303
           YR++  C  CR  KT+CD ++P CS+C  +G  C
Sbjct: 47  YRLSFVCQECRKSKTKCDKEKPSCSRCLKIGITC 80

>TDEL0E00160 Chr5 (16083..17978) [1896 bp, 631 aa] {ON} 
          Length = 631

 Score = 45.4 bits (106), Expect = 0.001
 Identities = 17/47 (36%), Positives = 27/47 (57%)
 Frame = +1

Query: 202 YRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPR 342
           + + +ACD CR KK +C   RP+C +C   G++C  S ++ R    R
Sbjct: 2   FEMDRACDSCRHKKLKCSKTRPKCKKCLKNGWDCCYSPRIKRSPLTR 48

>SAKL0A02860g Chr1 complement(259388..261625) [2238 bp, 745 aa] {ON}
           similar to uniprot|P04386 Saccharomyces cerevisiae
           YPL248C GAL4 DNA-binding transcription factor required
           for the activation of the GAL genes in response to
           galactose repressed by Gal80p and activated by Gal3p
          Length = 745

 Score = 45.4 bits (106), Expect = 0.001
 Identities = 20/45 (44%), Positives = 25/45 (55%)
 Frame = +1

Query: 208 VAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPR 342
           V QACD CR +K RC  + P+CS+C    +EC  S K  R    R
Sbjct: 5   VQQACDSCRKRKLRCSKELPKCSKCLKHNWECCYSPKAVRSPLTR 49

>KAFR0J01710 Chr10 complement(327570..330116) [2547 bp, 848 aa] {ON}
           Anc_2.231 YIL130W
          Length = 848

 Score = 45.4 bits (106), Expect = 0.001
 Identities = 18/41 (43%), Positives = 24/41 (58%)
 Frame = +1

Query: 205 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSR 327
           RV +ACD CR KK +CDG++P C  C    +EC  +    R
Sbjct: 13  RVTRACDECRKKKVKCDGQQP-CIHCTVYSYECTYNQPSKR 52

 Score = 33.1 bits (74), Expect = 6.1
 Identities = 18/59 (30%), Positives = 31/59 (52%)
 Frame = +1

Query: 1606 RRLLFWGIYYLDVFGALQLGVPRLLKDHEIECALPISEHAHAGVSLADQVIKLEGQVSE 1782
            ++ LF+ +Y +D++    LG+PR L+  + +  LPI         L+D+ I  EG   E
Sbjct: 372  KKRLFYNVYKMDIYINAMLGLPRSLRVEDFDQTLPI--------ELSDENITAEGYFYE 422

>ZYRO0A10956g Chr1 (881429..883996) [2568 bp, 855 aa] {ON} similar
           to uniprot|P07272 Saccharomyces cerevisiae YLR014C PPR1
           Zinc finger transcription factor containing a
           Zn(2)-Cys(6) binuclear cluster domain positively
           regulates transcription of genes involved in uracil
           biosynthesis activity may be modulated by interaction
           with Tup1p
          Length = 855

 Score = 45.4 bits (106), Expect = 0.001
 Identities = 19/44 (43%), Positives = 24/44 (54%)
 Frame = +1

Query: 217 ACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGY 348
           AC RCR+KK +CD + P C +CA     C   D  + R  PR Y
Sbjct: 32  ACKRCRTKKIKCDHEFPSCKKCARANKPCVSLDPATGRDVPRSY 75

>KAFR0J00690 Chr10 (124449..127043) [2595 bp, 864 aa] {ON} Anc_5.235
           YLR014C
          Length = 864

 Score = 45.4 bits (106), Expect = 0.001
 Identities = 19/44 (43%), Positives = 24/44 (54%)
 Frame = +1

Query: 217 ACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGY 348
           AC RCR+KK +CD + P C +CA V   C   D  +    PR Y
Sbjct: 33  ACKRCRAKKIKCDQEFPSCGKCAKVNEPCVSIDPATGEDIPRSY 76

>Ecym_7440 Chr7 complement(902108..904804) [2697 bp, 898 aa] {ON}
           similar to Ashbya gossypii AER183C
          Length = 898

 Score = 45.4 bits (106), Expect = 0.001
 Identities = 19/42 (45%), Positives = 27/42 (64%)
 Frame = +1

Query: 205 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRR 330
           RV++ACD CR+KK +C+G+ P CS C     EC  +  + RR
Sbjct: 22  RVSKACDTCRAKKIKCNGEEP-CSNCGKHDLECAYTHVIKRR 62

>KLTH0E14454g Chr5 complement(1282704..1285412) [2709 bp, 902 aa]
           {ON} some similarities with uniprot|Q12180 Saccharomyces
           cerevisiae YOL089C HAL9 Putative transcription factor
           containing a zinc finger; overexpression increases salt
           tolerance through increased expression of the
           ENA1(Na+/Li+ extrusion pump) gene while gene disruption
           decreases both salt tolerance and ENA1 expression
          Length = 902

 Score = 45.4 bits (106), Expect = 0.001
 Identities = 41/160 (25%), Positives = 61/160 (38%), Gaps = 3/160 (1%)
 Frame = +1

Query: 205 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGYXXXXXXXXXXXX 384
           RV++ACD CR+KK +CDG  P CS C  V  EC  +  + +R  P               
Sbjct: 9   RVSKACDACRAKKIKCDGCDP-CSNCKKVSQECGYTYVVKKRQKPPTRVSNRKILADLSQ 67

Query: 385 XXXXXXXXXCDLKDEQMHLVS---KYSSNKRHEPSSTEEGRMLEQLSNSDGGSLRVSSTN 555
                      ++D  ++L       S +K H   +  E R    L  S       SS  
Sbjct: 68  RLVRLEGILTQIRDGPLNLDDASIAESDSKFHAAPALAELRSANPLRRSSESDSAQSSE- 126

Query: 556 LYLLNKTTPAVQDGSELHKCQGLGCNHASHPHLHEKPVST 675
             L ++  P+  D   L +   LG     H  + + P +T
Sbjct: 127 --LESELEPSDMDYEALPQSGSLGGYCGRHSEIDQGPSAT 164

>SAKL0B04620g Chr2 complement(406622..407710) [1089 bp, 362 aa] {ON}
           conserved hypothetical protein
          Length = 362

 Score = 44.7 bits (104), Expect = 0.001
 Identities = 19/41 (46%), Positives = 27/41 (65%)
 Frame = +1

Query: 193 TSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSD 315
           T+  RV++ACD CR  KT+CDG+RP C +C +    C  S+
Sbjct: 2   TTKKRVSKACDTCRKSKTKCDGERP-CQRCLSENKICTYSN 41

>KAFR0F01490 Chr6 complement(290988..292964) [1977 bp, 658 aa] {ON}
           Anc_1.128 YJL206C
          Length = 658

 Score = 45.1 bits (105), Expect = 0.001
 Identities = 30/108 (27%), Positives = 47/108 (43%)
 Frame = +1

Query: 169 SPVTSATPTSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGY 348
           S     TPT   RV +AC  CR KK RCDGK P CS CA     C+ ++    R+    +
Sbjct: 16  SKTKKLTPT-RLRVFKACIACRKKKRRCDGKSP-CSHCARTSIICEYTNTARPRSHSIAF 73

Query: 349 XXXXXXXXXXXXXXXXXXXXXCDLKDEQMHLVSKYSSNKRHEPSSTEE 492
                                 D+ ++ +HL+   +S++ H P  +++
Sbjct: 74  AN--------------------DVSND-IHLIDSTTSSRSHSPKLSDK 100

 Score = 40.8 bits (94), Expect = 0.025
 Identities = 46/165 (27%), Positives = 68/165 (41%), Gaps = 11/165 (6%)
 Frame = +1

Query: 1474 GEVSSVYEIRGTVVSMAQQLRLHRCPSAVLGTEGSTMSKSEQGDRRLLFWGIYYLDVFGA 1653
            G++ + Y   G  + +A +  LHR PS      G T  + E   R  LFW IY +D++  
Sbjct: 257  GDLKACYYYIGIALRIAIRENLHRKPSLT----GPTAIEDETKKR--LFWSIYKVDIYMN 310

Query: 1654 LQLGVPRLLKDHEIECALPISEHAHAGVSLADQVI-----------KLEGQVSELSLSLL 1800
              LG+P  L +  I+  LP        VS  D VI            +  + ++L L +L
Sbjct: 311  CTLGLPASLNESFIDQELPYDVDDEKIVS--DGVIFNENSNIISSCGMNNEHTKLILIML 368

Query: 1801 RFSKILGNILDSIFKRGMTSSAAQQVALIHENALDNWRRGLPKNL 1935
            +  + L +I   I K          V L  E+ L  W   LP  L
Sbjct: 369  KIYRTLYSIDVEILK------IDANVVLHLEDILFTWYNNLPLQL 407

>TDEL0C05680 Chr3 complement(1020646..1022721) [2076 bp, 691 aa]
           {ON} Anc_1.128 YJL206C
          Length = 691

 Score = 45.1 bits (105), Expect = 0.001
 Identities = 21/44 (47%), Positives = 29/44 (65%)
 Frame = +1

Query: 163 SISPVTSATPTSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVG 294
           S++  T    TS  RV++AC+ CRSKK +CDG++P C  C  VG
Sbjct: 111 SMNASTKRLTTSKGRVSRACEFCRSKKKKCDGQQP-CDLCKLVG 153

 Score = 33.5 bits (75), Expect = 4.5
 Identities = 24/77 (31%), Positives = 35/77 (45%)
 Frame = +1

Query: 1480 VSSVYEIRGTVVSMAQQLRLHRCPSAVLGTEGSTMSKSEQGDRRLLFWGIYYLDVFGALQ 1659
            + + Y   G  +  A    LHR  S +    G T  + E   R  LFW +Y +D++    
Sbjct: 309  LKTCYSYIGIALRAAISEGLHRKNSLI----GPTPIEDETKKR--LFWSVYKVDLYMNCI 362

Query: 1660 LGVPRLLKDHEIECALP 1710
            LG+PR L +  I   LP
Sbjct: 363  LGLPRTLSESAINQELP 379

>YJL206C Chr10 complement(47659..49935) [2277 bp, 758 aa] {ON}
            Putative protein of unknown function; similar to
            transcriptional regulators from the Zn[2]-Cys[6]
            binuclear cluster protein family; mRNA is weakly cell
            cycle regulated, peaking in S phase; induced rapidly upon
            MMS treatment
          Length = 758

 Score = 45.1 bits (105), Expect = 0.001
 Identities = 53/211 (25%), Positives = 95/211 (45%), Gaps = 9/211 (4%)
 Frame = +1

Query: 1480 VSSVYEIRGTVVSMAQQLRLHRCPSAVLGTEGSTMSKSEQGDRRLLFWGIYYLDVFGALQ 1659
            + + Y   G  +  A +  LHR  S V    G T  + E   R  LFW +Y LD++    
Sbjct: 305  LKACYSFIGIALRAALKEGLHRRSSIV----GPTPIQDETKKR--LFWSVYKLDLYMNCI 358

Query: 1660 LGVPRLLKDHEIECALPI----SEHAHAGVSLAD-QVIKLEGQVSELSLSLLRFSKILGN 1824
            LG P  + + +I+   P+       +  G+   D + I   G  ++ +  +L  S+I   
Sbjct: 359  LGFPSGIDESDIDQEFPLDVDDENISTIGIKFQDWRTISSCGMNNKHTKLILIMSRIY-K 417

Query: 1825 ILDSIFKRGMTSSAAQQVALIHENALDNWRRGLPKNLTFELDVNGTIKIEE----LTGSA 1992
            ++ S+ ++ +   +  Q+  +++  LDNW   LP  L  +     TI+  +    LT SA
Sbjct: 418  LMYSLRRKPLEEDSRTQIVSLNDQ-LDNWYAQLPDILKVD-----TIRYRQTQPPLTVSA 471

Query: 1993 QNNQDFTKNASSDKKILMLLYFLVKCLVHLP 2085
                D +   +  KK+L L + L K +++ P
Sbjct: 472  ---NDTSSPYTKPKKLLYLDFLLSKIVLYKP 499

 Score = 35.0 bits (79), Expect = 1.5
 Identities = 15/34 (44%), Positives = 18/34 (52%)
 Frame = +1

Query: 205 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECK 306
           R  +AC  CR +K RC G  P C  C    +ECK
Sbjct: 42  RAHRACIACRKRKVRCSGNIP-CRLCQTNSYECK 74

>AER370W Chr5 (1320487..1322892) [2406 bp, 801 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL130W
          Length = 801

 Score = 45.1 bits (105), Expect = 0.001
 Identities = 19/47 (40%), Positives = 24/47 (51%)
 Frame = +1

Query: 205 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRG 345
           RV +ACD CR KK +CD + P C  C    +EC  +    R    RG
Sbjct: 13  RVTRACDECRKKKVKCDSRHP-CIHCTVYSYECTYNQPARRAGGGRG 58

>KLTH0D02222g Chr4 (220570..223113) [2544 bp, 847 aa] {ON} weakly
           similar to uniprot|P52960 Saccharomyces cerevisiae
           YOR363C PIP2 peroxisome induction pathway 2 (PIP2)
           transcriptional activator of peroxisome proliferation
           may form heterodimer with Oaf1 to activate
           oleate-inducible gene expression activator of peroxisome
           proliferation
          Length = 847

 Score = 45.1 bits (105), Expect = 0.001
 Identities = 18/50 (36%), Positives = 31/50 (62%), Gaps = 2/50 (4%)
 Frame = +1

Query: 196 SNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECK--VSDKLSRRAFP 339
           S  R++  C  CR +K +CD  +P+C +CA +G EC   +S+++S +  P
Sbjct: 24  SRLRLSFVCRNCRKRKIKCDKAQPKCGRCAKLGLECNYDLSEQISLKKTP 73

>CAGL0G08844g Chr7 complement(846590..849133) [2544 bp, 847 aa] {ON}
           similar to uniprot|P40467 Saccharomyces cerevisiae
           YIL130w
          Length = 847

 Score = 45.1 bits (105), Expect = 0.001
 Identities = 18/41 (43%), Positives = 24/41 (58%)
 Frame = +1

Query: 205 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSR 327
           +V +ACD CR KK +CDG +P C  C    +EC  +  L R
Sbjct: 15  KVTRACDDCRKKKVKCDGNQP-CIHCTVYSYECTYNHPLKR 54

>TDEL0E03910 Chr5 (732533..735121) [2589 bp, 862 aa] {ON} Anc_5.235
           YLR014C
          Length = 862

 Score = 45.1 bits (105), Expect = 0.001
 Identities = 20/44 (45%), Positives = 24/44 (54%)
 Frame = +1

Query: 217 ACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGY 348
           AC RCR KK +CD + P C +CA V   C   D  + R  PR Y
Sbjct: 29  ACKRCRLKKIKCDQEFPSCLKCARVKVPCVSLDPATGRDVPRSY 72

>Suva_16.59 Chr16 complement(88631..91318) [2688 bp, 895 aa] {ON}
           YPL248C (REAL)
          Length = 895

 Score = 45.1 bits (105), Expect = 0.001
 Identities = 19/43 (44%), Positives = 25/43 (58%)
 Frame = +1

Query: 214 QACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPR 342
           QACD CR KK +C  ++P+CS+C    +EC  S K  R    R
Sbjct: 9   QACDICRLKKLKCSKEKPKCSKCLKNNWECCYSPKTKRSPLTR 51

>Skud_12.82 Chr12 complement(164119..166818) [2700 bp, 899 aa] {ON}
           YLR014C (REAL)
          Length = 899

 Score = 45.1 bits (105), Expect = 0.001
 Identities = 23/75 (30%), Positives = 36/75 (48%), Gaps = 1/75 (1%)
 Frame = +1

Query: 127 RTNNSAAPNAARSISPVTSATPTSNYRVAQ-ACDRCRSKKTRCDGKRPQCSQCAAVGFEC 303
           +  N  A  + R+  P    +P   +  ++ AC RCR KK +CD + P C +CA +   C
Sbjct: 2   KQRNINAKKSNRTHLPRIDGSPNIGFSKSRTACKRCRLKKIKCDQEFPSCKRCANLEVPC 61

Query: 304 KVSDKLSRRAFPRGY 348
              D  + +  PR Y
Sbjct: 62  VSLDPATGKDVPRSY 76

>NCAS0B06550 Chr2 complement(1242371..1245091) [2721 bp, 906 aa]
           {ON} Anc_2.231
          Length = 906

 Score = 45.1 bits (105), Expect = 0.001
 Identities = 17/33 (51%), Positives = 22/33 (66%)
 Frame = +1

Query: 205 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 303
           RV +ACD CR KK +CDG++P C  C    +EC
Sbjct: 32  RVTRACDECRKKKVKCDGQQP-CIHCTVYSYEC 63

 Score = 33.5 bits (75), Expect = 4.7
 Identities = 31/126 (24%), Positives = 52/126 (41%), Gaps = 11/126 (8%)
 Frame = +1

Query: 1606 RRLLFWGIYYLDVFGALQLGVPRLLKDHEIECALPISEHAHAGVSLADQVIKLEGQVSEL 1785
            R+ LF+ IY LD++    LG+PR +   + +  LPI         L+D+ I   G + E 
Sbjct: 408  RKRLFYTIYKLDIYVNAMLGLPRSISPDDFDQTLPI--------ELSDENITEHGYLPEN 459

Query: 1786 SLSLL----------RFSKILGNILDSIFKRGMTSSAAQQVALIH-ENALDNWRRGLPKN 1932
               +L          +   IL +I+  ++    T++      +   E  L  W   LP  
Sbjct: 460  QNGVLSSTGIANQHTKLLMILNSIVRELYPIKKTNNLISHETVTRLELKLRTWMDELPTE 519

Query: 1933 LTFELD 1950
            L   L+
Sbjct: 520  LVPNLE 525

>Suva_9.59 Chr9 (97521..100298) [2778 bp, 926 aa] {ON} YIL130W
           (REAL)
          Length = 926

 Score = 45.1 bits (105), Expect = 0.001
 Identities = 17/33 (51%), Positives = 22/33 (66%)
 Frame = +1

Query: 205 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 303
           RV +ACD CR KK +CDG++P C  C    +EC
Sbjct: 16  RVTRACDECRKKKVKCDGQQP-CIHCTVYSYEC 47

 Score = 38.9 bits (89), Expect = 0.11
 Identities = 40/155 (25%), Positives = 66/155 (42%), Gaps = 3/155 (1%)
 Frame = +1

Query: 1480 VSSVYEIRGTVVSMAQQLRLHRCPSAVLGTEGSTMSKSEQGDRRLLFWGIYYLDVFGALQ 1659
            +S+ Y   G  +  A +   HR  SA     G T  + E   R+ LF+ IY LDV+    
Sbjct: 362  LSTCYTYIGVAMRSALRAGFHRKLSA---NSGFTPIEIEM--RKRLFYTIYKLDVYINAM 416

Query: 1660 LGVPRLLKDHEIECALP--ISEHAHAGVSLADQVIKLEGQVSELSLSLLRFSKILGNILD 1833
            LG+PR +   + +  LP  +S+     V+   +        + +S    +   IL  I+ 
Sbjct: 417  LGLPRSISPEDFDQTLPLDLSDENITEVAYLPENQNAVLSSTGISNEHTKLFLILNEIIS 476

Query: 1834 SIFKRGMTSS-AAQQVALIHENALDNWRRGLPKNL 1935
             ++    T++  + +     E  L NW   LPK L
Sbjct: 477  ELYPIKKTNNIISHETVTSLELKLRNWLDSLPKEL 511

>YIL130W Chr9 (102782..105676) [2895 bp, 964 aa] {ON}  ASG1Zinc
           cluster protein proposed to function as a
           transcriptional regulator involved in the stress
           response; null mutants have a respiratory deficiency,
           calcofluor white sensitivity and slightly increased
           cycloheximide resistance
          Length = 964

 Score = 45.1 bits (105), Expect = 0.001
 Identities = 17/33 (51%), Positives = 22/33 (66%)
 Frame = +1

Query: 205 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 303
           RV +ACD CR KK +CDG++P C  C    +EC
Sbjct: 16  RVTRACDECRKKKVKCDGQQP-CIHCTVYSYEC 47

 Score = 39.7 bits (91), Expect = 0.062
 Identities = 42/158 (26%), Positives = 67/158 (42%), Gaps = 6/158 (3%)
 Frame = +1

Query: 1480 VSSVYEIRGTVVSMAQQLRLHRCPSAVLGTEGSTMSKSEQGDRRLLFWGIYYLDVFGALQ 1659
            +S+ Y   G  +  A +   HR  S       S  S  E   R+ LF+ IY LDV+    
Sbjct: 362  LSTCYTYIGVAMRSALRAGFHRKLSP-----NSGFSPIEIEMRKRLFYTIYKLDVYINAM 416

Query: 1660 LGVPRLLKDHEIECALPISEHAHAGVSLADQVIKLEGQVSELSLSLL-----RFSKILGN 1824
            LG+PR +   + +  LP+     +  ++ +     E Q S LS + +     +   IL  
Sbjct: 417  LGLPRSISPDDFDQTLPLD---LSDENITEVAYLPENQHSVLSSTGISNEHTKLFLILNE 473

Query: 1825 ILDSIFKRGMTSS-AAQQVALIHENALDNWRRGLPKNL 1935
            I+  ++    TS+  + +     E  L NW   LPK L
Sbjct: 474  IISELYPIKKTSNIISHETVTSLELKLRNWLDSLPKEL 511

>Smik_9.39 Chr9 (80510..83548) [3039 bp, 1012 aa] {ON} YIL130W
           (REAL)
          Length = 1012

 Score = 45.1 bits (105), Expect = 0.001
 Identities = 17/33 (51%), Positives = 22/33 (66%)
 Frame = +1

Query: 205 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 303
           RV +ACD CR KK +CDG++P C  C    +EC
Sbjct: 16  RVTRACDECRKKKVKCDGQQP-CIHCTVYSYEC 47

 Score = 40.4 bits (93), Expect = 0.036
 Identities = 42/158 (26%), Positives = 68/158 (43%), Gaps = 6/158 (3%)
 Frame = +1

Query: 1480 VSSVYEIRGTVVSMAQQLRLHRCPSAVLGTEGSTMSKSEQGDRRLLFWGIYYLDVFGALQ 1659
            +S+ Y   G  +  A +   HR  S+  G      S  E   R+ LF+ IY LDV+    
Sbjct: 365  LSTCYTYIGVAMRSALRAGFHRKLSSSSG-----FSPIEIEMRKRLFYTIYKLDVYINAM 419

Query: 1660 LGVPRLLKDHEIECALPISEHAHAGVSLADQVIKLEGQVSELSLSLL-----RFSKILGN 1824
            LG+PR +   + +  LP+     +  ++ +     E Q S LS + +     +   IL  
Sbjct: 420  LGLPRSISPDDFDQTLPLD---LSDENITEVAYLPENQHSVLSSTGISNEHTKLFLILNE 476

Query: 1825 ILDSIFKRGMTSS-AAQQVALIHENALDNWRRGLPKNL 1935
            I+  ++    TS+  + +     E  L NW   LPK L
Sbjct: 477  IISELYPIKKTSNIISHETVTSLELKLRNWLDSLPKEL 514

>Smik_1.13 Chr1 (31514..34654) [3141 bp, 1046 aa] {ON} YAL051W
           (REAL)
          Length = 1046

 Score = 45.1 bits (105), Expect = 0.001
 Identities = 22/63 (34%), Positives = 34/63 (53%), Gaps = 3/63 (4%)
 Frame = +1

Query: 163 SISPVTSATPTSNY---RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRA 333
           S SP    + T N    R++  C  CR  KT+CD ++P+CS+C   G +C     +S++ 
Sbjct: 44  STSPAPENSETHNRKRNRISFVCQACRKSKTKCDREKPECSRCIKHGLKCVYD--VSKQP 101

Query: 334 FPR 342
            PR
Sbjct: 102 APR 104

>CAGL0A00451g Chr1 (47557..50880) [3324 bp, 1107 aa] {ON} similar to
           uniprot|P12383 Saccharomyces cerevisiae YGL013c PDR1
           transcription factor
          Length = 1107

 Score = 45.1 bits (105), Expect = 0.001
 Identities = 22/67 (32%), Positives = 34/67 (50%)
 Frame = +1

Query: 130 TNNSAAPNAARSISPVTSATPTSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKV 309
           T + + P   ++  P T  T     +V +ACD CR +K +C+G +P C  C   G EC  
Sbjct: 6   TTSKSNPGEVKAQKPSTRRT-----KVGKACDSCRRRKIKCNGLKP-CPSCTIYGCECTY 59

Query: 310 SDKLSRR 330
           +D  S +
Sbjct: 60  TDAKSTK 66

 Score = 32.7 bits (73), Expect = 8.3
 Identities = 21/72 (29%), Positives = 35/72 (48%)
 Frame = +1

Query: 1495 EIRGTVVSMAQQLRLHRCPSAVLGTEGSTMSKSEQGDRRLLFWGIYYLDVFGALQLGVPR 1674
            ++    V+ A+++  HR    V G E ST  K     RRLL+W +Y  +    ++ G   
Sbjct: 561  KVLNVAVANAKKMGFHRWEFYV-GYEESTAEK-----RRLLWWKLYNYEKASTMKKGFFS 614

Query: 1675 LLKDHEIECALP 1710
            ++ D  + C LP
Sbjct: 615  VIDDATVNCLLP 626

>NCAS0G01100 Chr7 complement(193052..195859) [2808 bp, 935 aa] {ON}
           Anc_6.279
          Length = 935

 Score = 44.7 bits (104), Expect = 0.002
 Identities = 18/45 (40%), Positives = 26/45 (57%)
 Frame = +1

Query: 214 QACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGY 348
           QACD CR KK +C  ++P+C++C    +EC  S K  R    R +
Sbjct: 11  QACDLCRVKKLKCSKEKPKCAKCLKNNWECCYSPKTRRSPLTRAH 55

>SAKL0D14542g Chr4 complement(1195951..1198791) [2841 bp, 946 aa]
           {ON} similar to gnl|GLV|KLLA0A03421g Kluyveromyces
           lactis KLLA0A03421g and weakly similar to YAL051W
           uniprot|P39720 Saccharomyces cerevisiae YAL051W OAF1
           Oleate- activated transcription factor acts alone and as
           a heterodimer with Pip2p activates genes involved in
           beta- oxidation of fatty acids and peroxisome
           organization and biogenesis
          Length = 946

 Score = 44.7 bits (104), Expect = 0.002
 Identities = 16/49 (32%), Positives = 28/49 (57%)
 Frame = +1

Query: 157 ARSISPVTSATPTSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 303
           + S  P+ +A      +++  C  CR  KT+CD ++P CS+C  +G +C
Sbjct: 8   SHSQMPIGAAIGKKRNKLSFVCQSCRKSKTKCDKQKPSCSRCLRLGHQC 56

>YBR297W Chr2 (800523..801929) [1407 bp, 468 aa] {ON}
           MAL33MAL-activator protein, part of complex locus MAL3;
           nonfunctional in genomic reference strain S288C
          Length = 468

 Score = 44.3 bits (103), Expect = 0.002
 Identities = 18/41 (43%), Positives = 25/41 (60%)
 Frame = +1

Query: 208 VAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRR 330
           V  ACD CR ++ +CDGK+P CS+C    F+C     L +R
Sbjct: 4   VKYACDYCRVRRVKCDGKKP-CSRCIEHNFDCTYQQPLKKR 43

>Kpol_495.21 s495 (71447..74704) [3258 bp, 1085 aa] {ON}
           (71447..74704) [3258 nt, 1086 aa]
          Length = 1085

 Score = 44.7 bits (104), Expect = 0.002
 Identities = 22/51 (43%), Positives = 27/51 (52%), Gaps = 4/51 (7%)
 Frame = +1

Query: 163 SISPVTSATPTSNYRVAQACDRCRSKKTRCDG----KRPQCSQCAAVGFEC 303
           +I    S T     RVA+ACDRCR +K +CD     K  +CS C   G EC
Sbjct: 104 AIKSNVSTTKVQKRRVARACDRCRKRKIKCDEIKNLKVNKCSNCVKYGAEC 154

>Smik_2.438 Chr2 (786437..787846) [1410 bp, 469 aa] {ON} YBR297W
           (REAL)
          Length = 469

 Score = 44.3 bits (103), Expect = 0.002
 Identities = 19/41 (46%), Positives = 25/41 (60%)
 Frame = +1

Query: 208 VAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRR 330
           V  ACD CR ++ +CDGK+P CS+C    FEC     L +R
Sbjct: 4   VKYACDFCRVRRVKCDGKKP-CSRCIQHDFECTYQQPLRKR 43

>Skud_11.190 Chr11 (345221..348736) [3516 bp, 1171 aa] {ON} YKL038W
           (REAL)
          Length = 1171

 Score = 44.3 bits (103), Expect = 0.002
 Identities = 25/77 (32%), Positives = 34/77 (44%), Gaps = 4/77 (5%)
 Frame = +1

Query: 130 TNNSAAPNAARSISPV--TSATPTSNYRVAQACDRCRSKKTRCDGK--RPQCSQCAAVGF 297
           T N    N+   + P   TS       + ++ACD+CR KK +CD K  R  CS C   G 
Sbjct: 15  TKNGGTSNSPEDMDPAAATSHAMKKRTKASRACDQCRKKKIKCDYKDERGVCSNCQRNGD 74

Query: 298 ECKVSDKLSRRAFPRGY 348
            C       +R   +GY
Sbjct: 75  RCSFERVPLKRGPSKGY 91

>KLTH0H16170g Chr8 complement(1391996..1393855) [1860 bp, 619 aa]
           {ON} some similarities with uniprot|P52960 Saccharomyces
           cerevisiae YOR363C PIP2 peroxisome induction pathway 2
           (PIP2) transcriptional activator of peroxisome
           proliferation may form heterodimer with Oaf1 to activate
           oleate-inducible gene expression activator of peroxisome
           proliferation
          Length = 619

 Score = 43.9 bits (102), Expect = 0.003
 Identities = 17/37 (45%), Positives = 21/37 (56%)
 Frame = +1

Query: 193 TSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 303
           T   R    CD CR +K +CD  +P CS+CA  G EC
Sbjct: 6   TKRNRRLHVCDACRIRKLKCDKAKPNCSRCAKHGLEC 42

>Klac_YGOB_3960 Chr3 (291786..293297,293300..294220) [2433 bp, 810
           aa] {ON} ANNOTATED BY YGOB - Artificial frameshift
           joining KLLA0C03223g and KLLA0C03234g
          Length = 810

 Score = 43.9 bits (102), Expect = 0.003
 Identities = 18/44 (40%), Positives = 22/44 (50%)
 Frame = +1

Query: 211 AQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPR 342
           AQ CDRCR  K +C G  P C  C      C V+  L R+  P+
Sbjct: 49  AQVCDRCRKLKKKCYGTGPSCVNCVVTNNPCTVTTTLKRKRKPK 92

>SAKL0B06732g Chr2 complement(578508..581144) [2637 bp, 878 aa] {ON}
           some similarities with uniprot|Q12180 Saccharomyces
           cerevisiae YOL089C HAL9 Putative transcription factor
           containing a zinc finger overexpression increases salt
           tolerance through increased expression of the ENA1 (Na
           /Li extrusion pump) gene while gene disruption decreases
           both salt tolerance and ENA1 expression
          Length = 878

 Score = 43.9 bits (102), Expect = 0.003
 Identities = 19/45 (42%), Positives = 28/45 (62%)
 Frame = +1

Query: 196 SNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRR 330
           S  RV++ACD CRSKK +C+G++  CS C   G  C  +  + +R
Sbjct: 8   SRRRVSKACDSCRSKKIKCNGEQ-TCSNCLKYGCPCTYTHTIKKR 51

>Kpol_1039.11 s1039 (29727..32705) [2979 bp, 992 aa] {ON}
           (29727..32705) [2979 nt, 993 aa]
          Length = 992

 Score = 43.9 bits (102), Expect = 0.003
 Identities = 19/53 (35%), Positives = 26/53 (49%)
 Frame = +1

Query: 169 SPVTSATPTSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSR 327
           S   S+      RV +ACD CR KK +CDG++P C  C    + C  +    R
Sbjct: 19  SDTGSSQQPKRRRVTRACDECRKKKVKCDGQQP-CIHCTVYSYNCTYNQPSKR 70

 Score = 38.1 bits (87), Expect = 0.18
 Identities = 38/163 (23%), Positives = 72/163 (44%), Gaps = 11/163 (6%)
 Frame = +1

Query: 1480 VSSVYEIRGTVVSMAQQLRLHRCPSAVLGTEGSTMSKSEQGDRRLLFWGIYYLDVFGALQ 1659
            +S+ Y   G  +  A +  LHR     +  + S ++  +   R+ +F+ IY  D++    
Sbjct: 486  LSNCYSYIGIALRNALREGLHR----FVNPKSSNLNPLDIEMRKRVFYTIYKCDLYLNSM 541

Query: 1660 LGVPRLLKDHEIECALPISEHAHAGVSLADQVIKLEG-----QVSELSLSLL-----RFS 1809
            LG+P+ L   + +  LP        V L+D+ I  EG     Q  E+S + +     +  
Sbjct: 542  LGLPKSLSSADFDQVLP--------VELSDENITEEGYFPDKQNGEVSSAAIANYHTKLM 593

Query: 1810 KILGNILDSIFKRGMTSSAAQQVALIH-ENALDNWRRGLPKNL 1935
             IL +I   ++    +++      +   E  L+NW + LP+ L
Sbjct: 594  LILADITKELYPNKKSNNIVSHETVTQLEMRLENWIQSLPQQL 636

>TPHA0H01980 Chr8 (467688..470669) [2982 bp, 993 aa] {ON} Anc_6.279
           YPL248C
          Length = 993

 Score = 43.9 bits (102), Expect = 0.003
 Identities = 19/47 (40%), Positives = 26/47 (55%)
 Frame = +1

Query: 208 VAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGY 348
           V QACD CR KK RC  + P+C++C    +EC  S +  R    R +
Sbjct: 8   VDQACDSCRIKKLRCSKENPKCAKCLKNKWECCYSPRKRRSPLTRAH 54

>Skud_1.10 Chr1 (24510..27632) [3123 bp, 1040 aa] {ON} YAL051W
           (REAL)
          Length = 1040

 Score = 43.9 bits (102), Expect = 0.003
 Identities = 24/75 (32%), Positives = 37/75 (49%), Gaps = 6/75 (8%)
 Frame = +1

Query: 136 NSAAPNAAR---SISPVTSATPTSNY---RVAQACDRCRSKKTRCDGKRPQCSQCAAVGF 297
           N+A P       S SP    + T N    R++  C  CR  KT+CD ++P+C +C   G 
Sbjct: 32  NNATPGLEAEHSSTSPAPENSETHNRKRNRISFVCQACRKSKTKCDREKPECGRCIKHGL 91

Query: 298 ECKVSDKLSRRAFPR 342
           +C     +S++  PR
Sbjct: 92  KCVYD--VSKQPAPR 104

>Smik_12.77 Chr12 complement(159125..161836) [2712 bp, 903 aa] {ON}
           YLR014C (REAL)
          Length = 903

 Score = 43.5 bits (101), Expect = 0.004
 Identities = 18/44 (40%), Positives = 24/44 (54%)
 Frame = +1

Query: 217 ACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGY 348
           AC RCR KK +CD + P C +CA +   C   D  + +  PR Y
Sbjct: 32  ACKRCRLKKIKCDQEFPSCKRCAKLQVPCVSLDPATGKDVPRSY 75

>YLR014C Chr12 complement(172268..174982) [2715 bp, 904 aa] {ON}
           PPR1Zinc finger transcription factor containing a
           Zn(2)-Cys(6) binuclear cluster domain, positively
           regulates transcription of URA1, URA3, URA4, and URA10,
           which are involved in de novo pyrimidine biosynthesis,
           in response to pyrimidine starvation; activity may be
           modulated by interaction with Tup1p
          Length = 904

 Score = 43.5 bits (101), Expect = 0.004
 Identities = 18/44 (40%), Positives = 24/44 (54%)
 Frame = +1

Query: 217 ACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGY 348
           AC RCR KK +CD + P C +CA +   C   D  + +  PR Y
Sbjct: 33  ACKRCRLKKIKCDQEFPSCKRCAKLEVPCVSLDPATGKDVPRSY 76

>ZYRO0E06270g Chr5 (475960..478698) [2739 bp, 912 aa] {ON} weakly
           similar to uniprot|P50104 Saccharomyces cerevisiae
           YMR019W STB4 Protein that binds Sin3p in a two- hybrid
           assay
          Length = 912

 Score = 43.5 bits (101), Expect = 0.004
 Identities = 19/46 (41%), Positives = 27/46 (58%)
 Frame = +1

Query: 205 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPR 342
           RV +AC+ C+ +K +CDG +P C+ C   G ECK      RR + R
Sbjct: 12  RVRKACEICKRRKVKCDGSQP-CANCVKHGQECKYISGTVRRRYRR 56

>SAKL0H24860g Chr8 complement(2162455..2165370) [2916 bp, 971 aa] {ON}
            conserved hypothetical protein
          Length = 971

 Score = 43.5 bits (101), Expect = 0.004
 Identities = 24/65 (36%), Positives = 38/65 (58%)
 Frame = +1

Query: 1519 MAQQLRLHRCPSAVLGTEGSTMSKSEQGDRRLLFWGIYYLDVFGALQLGVPRLLKDHEIE 1698
            +AQ++ L R P++  G    T+ +S    RR+LFW I+ LD   +L   +P L+K  E +
Sbjct: 388  LAQRVMLTRDPTSYHGITDPTLVQS----RRILFWQIFQLDTLTSLHNNLPPLIKLDEFD 443

Query: 1699 CALPI 1713
             ALP+
Sbjct: 444  TALPV 448

>Smik_2.383 Chr2 complement(686676..688022) [1347 bp, 448 aa] {ON}
           YBR240C (REAL)
          Length = 448

 Score = 43.1 bits (100), Expect = 0.004
 Identities = 21/49 (42%), Positives = 24/49 (48%)
 Frame = +1

Query: 175 VTSATPTSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKL 321
           V+S  P +  R    C  CR KK RCD  RP CS CA  G  C    +L
Sbjct: 15  VSSKAPPTKGRTFTGCWACRFKKRRCDENRPICSLCAKHGDNCSYDIRL 63

>SAKL0C09944g Chr3 complement(899127..902312) [3186 bp, 1061 aa]
           {ON} weakly similar to uniprot|Q12180 Saccharomyces
           cerevisiae YOL089C HAL9 Putative transcription factor
           containing a zinc finger overexpression increases salt
           tolerance through increased expression of the ENA1 (Na
           /Li extrusion pump) gene while gene disruption decreases
           both salt tolerance and ENA1 expression
          Length = 1061

 Score = 43.5 bits (101), Expect = 0.004
 Identities = 25/62 (40%), Positives = 36/62 (58%), Gaps = 4/62 (6%)
 Frame = +1

Query: 130 TNNSAAPNAARSISPV-TSATPTSNYRVAQACDRCRSKKTRCDGKRP---QCSQCAAVGF 297
           T+++ +P A  SISP+  S  P    RV++ACD CR +K +CD  +P   +CS C     
Sbjct: 111 TSHTESP-AFTSISPLDVSGAPKK--RVSKACDHCRKRKIKCDDVKPRTGKCSNCTKFNA 167

Query: 298 EC 303
           EC
Sbjct: 168 EC 169

 Score = 37.4 bits (85), Expect = 0.32
 Identities = 40/176 (22%), Positives = 67/176 (38%), Gaps = 25/176 (14%)
 Frame = +1

Query: 1492 YEIRGTVVSMAQQLRLHRCPSAVLGTEGSTMSKSEQGDRRLLFWGIYYLDVFGALQLGVP 1671
            Y I  T V  AQ + LH   +         +S  E   RR+L+W  Y  D F +L+L  P
Sbjct: 518  YSIFATAVRFAQDMSLHNLDTY------KRLSYKECLKRRILWWHCYTTDKFLSLKLCKP 571

Query: 1672 RLLKDHEIECALPIS-----------------EHAHAGVSLADQVIKLEGQVSELSLSLL 1800
             L+ + ++      S                 E      ++ + + KLE   S L + + 
Sbjct: 572  SLINERDMTVLTDESYVVLIKGQLLPQVGTDREAIDQITTIEEALRKLEEHCSFLPVFIS 631

Query: 1801 RFSKILGNILDSIF--------KRGMTSSAAQQVALIHENALDNWRRGLPKNLTFE 1944
             ++  L  I   I+         +G T        L  +N+L +W + LP ++  E
Sbjct: 632  YYTTKLARISSKIYYSFFTPTSLKGQTFDTMIDRVLEIKNSLSDWEKYLPGSIRLE 687

>Smik_18.8 Chr18 (12069..14396) [2328 bp, 775 aa] {ON} YOR172W
           (REAL)
          Length = 775

 Score = 43.1 bits (100), Expect = 0.005
 Identities = 18/38 (47%), Positives = 24/38 (63%), Gaps = 9/38 (23%)
 Frame = +1

Query: 214 QACDRCRSKKTRCDGKRPQCSQCA---------AVGFE 300
           ++C+ CR +K RCDGKRP+CS C          A+GFE
Sbjct: 10  RSCELCRKRKLRCDGKRPRCSTCVRKKSSECTYAIGFE 47

>SAKL0C03938g Chr3 complement(377431..379773) [2343 bp, 780 aa] {ON}
           weakly similar to uniprot|P40467 Saccharomyces
           cerevisiae YIL130W ASG1 Proposed transcriptional
           activator member of the Gal4p family of zinc cluster
           proteins and to YJL206C uniprot|P39529 Saccharomyces
           cerevisiae YJL206C
          Length = 780

 Score = 43.1 bits (100), Expect = 0.005
 Identities = 17/42 (40%), Positives = 24/42 (57%)
 Frame = +1

Query: 178 TSATPTSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 303
           T+       RV++ACD CR +K RCDG++P C  C    + C
Sbjct: 18  TNRLQPKRLRVSRACDVCRQRKVRCDGRQP-CIHCTVYSYNC 58

 Score = 35.0 bits (79), Expect = 1.5
 Identities = 20/52 (38%), Positives = 30/52 (57%), Gaps = 2/52 (3%)
 Frame = +1

Query: 1561 LGTEGSTMSKS--EQGDRRLLFWGIYYLDVFGALQLGVPRLLKDHEIECALP 1710
            L T+ ST  KS  E    + LFW IY +DV+    LG+PR + + +++  LP
Sbjct: 376  LHTKVSTAGKSPVEAETCKRLFWTIYKMDVYMNCILGLPRSISEEDVDQDLP 427

>SAKL0D01100g Chr4 complement(81235..84057) [2823 bp, 940 aa] {ON}
           weakly similar to uniprot|P33200 Saccharomyces
           cerevisiae YBL005W PDR3 Transcriptional activator of the
           pleiotropic drug resistance network regulates expression
           of ATP-binding cassette (ABC) transporters through
           binding to cis-acting sites known as PDREs (PDR
           responsive elements)
          Length = 940

 Score = 43.1 bits (100), Expect = 0.005
 Identities = 19/48 (39%), Positives = 28/48 (58%)
 Frame = +1

Query: 196 SNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFP 339
           S+ +V++ACD CR +K +C GK+P CS C A    C+ S +      P
Sbjct: 20  SSSKVSRACDNCRRRKIKCTGKQP-CSNCQAYQCHCEYSIRRGNGIIP 66

>YAL051W Chr1 (48564..51707) [3144 bp, 1047 aa] {ON}
           OAF1Oleate-activated transcription factor, acts alone
           and as a heterodimer with Pip2p; activates genes
           involved in beta-oxidation of fatty acids and peroxisome
           organization and biogenesis
          Length = 1047

 Score = 43.1 bits (100), Expect = 0.005
 Identities = 21/63 (33%), Positives = 32/63 (50%), Gaps = 3/63 (4%)
 Frame = +1

Query: 163 SISPVTSATPTSNY---RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRA 333
           S SP    + T N    R+   C  CR  KT+CD ++P+C +C   G +C     +S++ 
Sbjct: 44  STSPAPENSETHNRKRNRILFVCQACRKSKTKCDREKPECGRCVKHGLKCVYD--VSKQP 101

Query: 334 FPR 342
            PR
Sbjct: 102 APR 104

>Ecym_5397 Chr5 (805712..808192) [2481 bp, 826 aa] {ON} similar to
           Ashbya gossypii AER370W
          Length = 826

 Score = 42.7 bits (99), Expect = 0.007
 Identities = 16/41 (39%), Positives = 22/41 (53%)
 Frame = +1

Query: 205 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSR 327
           R+ +ACD CR KK +CD + P C  C    +EC  +    R
Sbjct: 17  RITRACDECRKKKVKCDNRHP-CIHCTVYSYECTYNQPARR 56

>KLTH0B00352g Chr2 complement(31952..34756) [2805 bp, 934 aa] {ON}
           weakly similar to uniprot|P25611 Saccharomyces
           cerevisiae YCR106W RDS1 Regulator of drug sensitivity
           transcriptional regulator
          Length = 934

 Score = 42.7 bits (99), Expect = 0.007
 Identities = 18/43 (41%), Positives = 23/43 (53%)
 Frame = +1

Query: 205 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRA 333
           R +  C  CR +K +CD KRP+CS+C   G  C      SR A
Sbjct: 14  RPSFVCQECRRRKIKCDKKRPRCSRCVDTGLPCTYLASGSRSA 56

>SAKL0C03960g Chr3 (380387..383488) [3102 bp, 1033 aa] {ON}
           conserved hypothetical protein
          Length = 1033

 Score = 42.7 bits (99), Expect = 0.007
 Identities = 24/77 (31%), Positives = 38/77 (49%), Gaps = 10/77 (12%)
 Frame = +1

Query: 142 AAPNAARSISPVT-----SATPTSNYRV-----AQACDRCRSKKTRCDGKRPQCSQCAAV 291
           A+P+ + S+SPV+      AT + +        +Q CDRCR  K +C G   +C+ C   
Sbjct: 18  ASPSPSLSLSPVSVDNCPPATTSDSLENLLSCRSQVCDRCRKLKKKCYGTGAKCNNCLIS 77

Query: 292 GFECKVSDKLSRRAFPR 342
             EC  +  L R+  P+
Sbjct: 78  NQECATTKTLKRKRKPK 94

>NDAI0I00740 Chr9 complement(160212..163313) [3102 bp, 1033 aa] {ON}
           Anc_6.279 YPL248C
          Length = 1033

 Score = 42.7 bits (99), Expect = 0.007
 Identities = 18/45 (40%), Positives = 23/45 (51%)
 Frame = +1

Query: 208 VAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPR 342
           + QACD CR KK +C    P+C QC    + C  S K+ R    R
Sbjct: 7   IEQACDNCRLKKLKCSKHFPKCGQCLKNNWPCIYSPKVKRSPLTR 51

>YBR240C Chr2 complement(700490..701842) [1353 bp, 450 aa] {ON}
           THI2Transcriptional activator of thiamine biosynthetic
           genes; interacts with regulatory factor Thi3p to control
           expression of thiamine biosynthetic genes with respect
           to thiamine availability; acts together with Pdc2p to
           respond to thiaminediphosphate demand, possibly as
           related to carbon source availability; zinc finger
           protein of the Zn(II)2Cys6 type
          Length = 450

 Score = 42.4 bits (98), Expect = 0.007
 Identities = 22/62 (35%), Positives = 28/62 (45%)
 Frame = +1

Query: 136 NSAAPNAARSISPVTSATPTSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSD 315
           NS     ++ ++  +   PT   R    C  CR KK RCD  RP CS CA  G  C    
Sbjct: 3   NSKRQQRSKKVASSSKVPPTKG-RTFTGCWACRFKKRRCDENRPICSLCAKHGDNCSYDI 61

Query: 316 KL 321
           +L
Sbjct: 62  RL 63

>TBLA0G01800 Chr7 complement(469668..473132) [3465 bp, 1154 aa] {ON}
           Anc_6.279 YPL248C
          Length = 1154

 Score = 42.7 bits (99), Expect = 0.007
 Identities = 17/45 (37%), Positives = 26/45 (57%)
 Frame = +1

Query: 214 QACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGY 348
           QACD CR KK +C  ++P+C++C    +EC  S +  R    R +
Sbjct: 16  QACDSCRLKKLKCSKEKPKCAKCLKNIWECCYSPRAKRSPLTRNH 60

>TPHA0N00230 Chr14 (39855..43553) [3699 bp, 1232 aa] {ON} Anc_7.17
           YOR363C
          Length = 1232

 Score = 42.7 bits (99), Expect = 0.007
 Identities = 14/33 (42%), Positives = 21/33 (63%)
 Frame = +1

Query: 205 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 303
           R++  C  CR  KT+CD K+P C++C   G +C
Sbjct: 47  RISFVCQHCRKSKTKCDKKQPHCARCIKHGIQC 79

>NDAI0G05260 Chr7 (1277631..1282376) [4746 bp, 1581 aa] {ON}
           Anc_1.380 YLR256W
          Length = 1581

 Score = 42.7 bits (99), Expect = 0.008
 Identities = 25/60 (41%), Positives = 31/60 (51%), Gaps = 6/60 (10%)
 Frame = +1

Query: 133 NNSAAPNAARSISPVTSATPTSNY------RVAQACDRCRSKKTRCDGKRPQCSQCAAVG 294
           N+S +PN A S S    +T TSN       RV  +C  CR +K +CD  RP C QC   G
Sbjct: 32  NSSNSPNLA-SNSKKHDSTNTSNKVKRKRNRVPLSCTICRKRKVKCDKIRPHCQQCTKTG 90

>ZYRO0C18150g Chr3 (1418645..1420360) [1716 bp, 571 aa] {ON} some
           similarities with uniprot|P39529 Saccharomyces
           cerevisiae YJL206C
          Length = 571

 Score = 42.4 bits (98), Expect = 0.008
 Identities = 19/38 (50%), Positives = 24/38 (63%)
 Frame = +1

Query: 205 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDK 318
           RV+ ACD CR KK +CDG++P C  C     EC  SD+
Sbjct: 23  RVSHACDNCRLKKKKCDGQQP-CKLCKNSENECIYSDR 59

 Score = 35.8 bits (81), Expect = 0.83
 Identities = 35/163 (21%), Positives = 63/163 (38%), Gaps = 9/163 (5%)
 Frame = +1

Query: 1474 GEVSSVYEIRGTVVSMAQQLRLHRCPSAVLGTEGSTMSKSEQGDRRLLFWGIYYLDVFGA 1653
            G +   Y   G  +  A    LHR  S+++G      +  E   ++ LFW +Y +D++  
Sbjct: 203  GNLKRCYSYMGIALRAAIAEGLHR-KSSLMGP-----TPIEDESKKRLFWTVYKVDIYMN 256

Query: 1654 LQLGVPRLLKDHEIECALPISEHAHAGVSLADQVIKLEGQVSE---------LSLSLLRF 1806
              +G+P+ +    +   LP          L D+ I  +G + +         ++    + 
Sbjct: 257  CIMGLPQSISQKTVNMELP--------KDLDDENITNQGCIDQPWGKLSSTGMNNEHTKL 308

Query: 1807 SKILGNILDSIFKRGMTSSAAQQVALIHENALDNWRRGLPKNL 1935
              IL  I D+++             L  +N LD W   LP  L
Sbjct: 309  MLILSRIHDTLYPVLKWDEGTHNNILSLQNDLDQWLLQLPLQL 351

>Skud_5.331 Chr5 complement(543439..543951) [513 bp, 170 aa] {ON}
           YER184C (REAL)
          Length = 170

 Score = 40.4 bits (93), Expect = 0.009
 Identities = 16/38 (42%), Positives = 25/38 (65%)
 Frame = +1

Query: 205 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDK 318
           RV++AC+RCR KK +CD K+P C  C     +C+  ++
Sbjct: 13  RVSKACERCRRKKVKCDSKKP-CFGCIGSQSKCRYKNQ 49

>Smik_10.25 Chr10 complement(45977..48295) [2319 bp, 772 aa] {ON}
            YJL206C (REAL)
          Length = 772

 Score = 42.4 bits (98), Expect = 0.009
 Identities = 49/208 (23%), Positives = 91/208 (43%), Gaps = 6/208 (2%)
 Frame = +1

Query: 1480 VSSVYEIRGTVVSMAQQLRLHRCPSAVLGTEGSTMSKSEQGDRRLLFWGIYYLDVFGALQ 1659
            + + Y   G  +  A +  LHR  S V    G T  + E   R  LFW +Y LD++    
Sbjct: 317  LKACYSFIGIALRAALKDGLHRKSSIV----GPTPIEDETKKR--LFWSVYKLDLYMNCI 370

Query: 1660 LGVPRLLKDHEIECALPI----SEHAHAGVSLAD-QVIKLEGQVSELSLSLLRFSKILGN 1824
            LG P  + + +I+   P+       +  G+   D + I   G  ++ +  +L  S+I   
Sbjct: 371  LGFPSGIDESDIDQEFPLDVDDENISTTGIKFQDWRTISSCGMNNKHTKLILIMSRIY-K 429

Query: 1825 ILDSIFKRGMTSSAAQQVALIHENALDNWRRGLPKNLTFELDVNGTIKIEELTGSAQ-NN 2001
            ++ S+ ++ +   +  Q+  +++  LD+W   LP  L  +     TI+  +         
Sbjct: 430  LMYSLRRKPLEEDSRLQIVSLNDQ-LDDWYTQLPDTLKVD-----TIRYHQPQPPLSICT 483

Query: 2002 QDFTKNASSDKKILMLLYFLVKCLVHLP 2085
             D   + S  KK+L L + L K +++ P
Sbjct: 484  NDRNSSYSKPKKLLYLDFLLSKIVLYKP 511

 Score = 36.6 bits (83), Expect = 0.52
 Identities = 16/34 (47%), Positives = 19/34 (55%)
 Frame = +1

Query: 205 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECK 306
           R  +AC  CR +K RC G+ P C  C    FECK
Sbjct: 53  RAHRACVACRKRKVRCSGQTP-CRLCQNNSFECK 85

>Skud_10.10 Chr10 complement(21672..24173) [2502 bp, 833 aa] {ON}
            YJL206C (REAL)
          Length = 833

 Score = 42.4 bits (98), Expect = 0.009
 Identities = 49/208 (23%), Positives = 93/208 (44%), Gaps = 6/208 (2%)
 Frame = +1

Query: 1480 VSSVYEIRGTVVSMAQQLRLHRCPSAVLGTEGSTMSKSEQGDRRLLFWGIYYLDVFGALQ 1659
            + + Y   G  +  A +  LHR  S V    G T  + E   R  LFW +Y LD++    
Sbjct: 293  LKACYSFIGIALRAALKEGLHRKSSIV----GPTPIQDETKKR--LFWSVYKLDLYMNCI 346

Query: 1660 LGVPRLLKDHEIECALPI----SEHAHAGVSLAD-QVIKLEGQVSELSLSLLRFSKILGN 1824
            LG P  + + +I+   P+       +  G+   D + I   G  ++ +  +L  S+I   
Sbjct: 347  LGFPSGIDESDIDQEFPLDVDDENISTMGIKFQDWRTISSCGMNNKHTKLILIMSRIY-K 405

Query: 1825 ILDSIFKRGMTSSAAQQVALIHENALDNWRRGLPKNLTFELDVNGTIKIEELTGSAQNNQ 2004
            ++ S+ ++ +   +  Q+  +++  L+NW   LP  L  +     TI+  +    A    
Sbjct: 406  LMYSLRRKPLEEDSRSQIVSLNDQ-LENWYTQLPDILKVD-----TIRYRQPQPPANVCA 459

Query: 2005 DFTKNA-SSDKKILMLLYFLVKCLVHLP 2085
            D + +  +  KK+L L + L K +++ P
Sbjct: 460  DESSSPYTKPKKLLYLDFLLSKIVLYKP 487

 Score = 36.6 bits (83), Expect = 0.53
 Identities = 16/34 (47%), Positives = 19/34 (55%)
 Frame = +1

Query: 205 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECK 306
           R  +AC  CR +K RC G+ P C  C    FECK
Sbjct: 29  RAHRACVACRKRKVRCSGQTP-CRLCQNNSFECK 61

>KNAG0E00210 Chr5 (24545..27391) [2847 bp, 948 aa] {ON} Anc_7.17
           YOR363C
          Length = 948

 Score = 42.4 bits (98), Expect = 0.009
 Identities = 14/33 (42%), Positives = 22/33 (66%)
 Frame = +1

Query: 205 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 303
           R++  C  CR+ K +CD ++PQC +C  +G EC
Sbjct: 24  RLSYVCKACRTAKAKCDKEKPQCGRCYKLGVEC 56

>KAFR0C04980 Chr3 (987900..990755) [2856 bp, 951 aa] {ON} Anc_7.17
           YOR363C
          Length = 951

 Score = 42.4 bits (98), Expect = 0.009
 Identities = 16/41 (39%), Positives = 23/41 (56%)
 Frame = +1

Query: 205 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSR 327
           R++  C  CR  KT+CD ++P CS+C     EC    +L R
Sbjct: 60  RISFVCQACRKAKTKCDKEKPMCSRCRKQDLECVYDIELQR 100

>TDEL0H04340 Chr8 complement(746566..749535) [2970 bp, 989 aa] {ON}
           Anc_7.17 YOR363C
          Length = 989

 Score = 42.4 bits (98), Expect = 0.009
 Identities = 16/47 (34%), Positives = 25/47 (53%)
 Frame = +1

Query: 163 SISPVTSATPTSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 303
           S+SP          R++  C  CR  KT+CD ++P+C +C   G +C
Sbjct: 26  SLSPGFETHVKRRNRISFVCQACRRSKTKCDREKPRCGRCQQHGLQC 72

>TDEL0D05150 Chr4 (932888..935878) [2991 bp, 996 aa] {ON} Anc_3.109
           YOL089C
          Length = 996

 Score = 42.4 bits (98), Expect = 0.009
 Identities = 22/55 (40%), Positives = 29/55 (52%), Gaps = 5/55 (9%)
 Frame = +1

Query: 181 SATPTSNYRVAQACDRCRSKKTRCDGKRPQ---CSQCAAVGFEC--KVSDKLSRR 330
           S+   S  RVA+ACD CR +K +CD   PQ   CS C      C  +V D + +R
Sbjct: 105 SSPQQSKKRVARACDHCRRRKIKCDPVNPQTNKCSNCTKYDANCTFRVRDDVEKR 159

>Skud_15.532 Chr15 complement(959437..962439) [3003 bp, 1000 aa]
           {ON} YAL051W (REAL)
          Length = 1000

 Score = 42.4 bits (98), Expect = 0.009
 Identities = 19/58 (32%), Positives = 29/58 (50%)
 Frame = +1

Query: 169 SPVTSATPTSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPR 342
           SP T        R++  C  CR  KT+CD ++P+C +C      C     ++R+A PR
Sbjct: 8   SPTTDRISRKRNRLSFVCQACRKAKTKCDQEKPRCGRCTKQNLFCIYD--VARQAAPR 63

>Skud_2.372 Chr2 complement(669194..670552) [1359 bp, 452 aa] {ON}
           YBR240C (REAL)
          Length = 452

 Score = 42.0 bits (97), Expect = 0.010
 Identities = 20/49 (40%), Positives = 24/49 (48%)
 Frame = +1

Query: 175 VTSATPTSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKL 321
           ++S  P +  R    C  CR KK RCD  RP CS CA  G  C    +L
Sbjct: 15  LSSKAPPTKGRTFTGCWACRFKKRRCDENRPICSLCAKHGDNCSYDIRL 63

>Skud_2.427 Chr2 (769889..771295) [1407 bp, 468 aa] {ON} YGR288W
           (REAL)
          Length = 468

 Score = 42.0 bits (97), Expect = 0.010
 Identities = 17/38 (44%), Positives = 23/38 (60%)
 Frame = +1

Query: 217 ACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRR 330
           ACD CR ++ +CDGK+P C +C    FEC     L +R
Sbjct: 7   ACDYCRVRRVKCDGKKP-CRRCLQHNFECTHQQPLKKR 43

>Suva_8.436 Chr8 (788699..790336) [1638 bp, 545 aa] {ON} YOR380W
           (REAL)
          Length = 545

 Score = 42.0 bits (97), Expect = 0.010
 Identities = 17/43 (39%), Positives = 25/43 (58%)
 Frame = +1

Query: 190 PTSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDK 318
           P    RV +AC  CR +K +C+GK P C  C A G+ C  +++
Sbjct: 10  PYKRQRVRKACVPCRERKRKCNGKSP-CEMCVAYGYVCHYTEE 51

>Smik_15.561 Chr15 (997239..998879) [1641 bp, 546 aa] {ON} YOR380W
           (REAL)
          Length = 546

 Score = 42.0 bits (97), Expect = 0.010
 Identities = 22/59 (37%), Positives = 30/59 (50%), Gaps = 2/59 (3%)
 Frame = +1

Query: 169 SPVTSATPTSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDK--LSRRAFP 339
           S V +       RV +AC  CR +K +C+GK P C  C + G+ C   DK   S  +FP
Sbjct: 3   SSVPNIPSYKRQRVRKACVPCRERKRKCNGKSP-CEMCISYGYVCHYMDKDRSSSSSFP 60

>SAKL0A08250g Chr1 (734566..736671) [2106 bp, 701 aa] {ON} weakly
           similar to uniprot|Q6B2M3 Saccharomyces cerevisiae
           YOR172W YRM1 Zn2-Cys6 zinc-finger transcription factor
           that activates genes involved in multidrug resistance
           paralog of Yrr1p acting on an overlapping set of target
           genes
          Length = 701

 Score = 42.0 bits (97), Expect = 0.011
 Identities = 17/41 (41%), Positives = 26/41 (63%), Gaps = 1/41 (2%)
 Frame = +1

Query: 205 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGF-ECKVSDKLS 324
           +V ++C  CR +K +CD K+P CS C + G  EC  +D+ S
Sbjct: 17  KVIKSCTFCRKRKKKCDQKKPMCSNCLSKGLPECIYTDEFS 57

>KAFR0C03730 Chr3 (759382..761757) [2376 bp, 791 aa] {ON} 
          Length = 791

 Score = 42.0 bits (97), Expect = 0.012
 Identities = 18/50 (36%), Positives = 30/50 (60%)
 Frame = +1

Query: 154 AARSISPVTSATPTSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 303
           A  SI+   +    S++RV++AC+ CR +K +C+G +P CS+C      C
Sbjct: 2   AGSSITKPYTYNKRSSHRVSRACNSCRKRKVKCNGVQP-CSKCITSNLRC 50

 Score = 32.7 bits (73), Expect = 7.9
 Identities = 12/43 (27%), Positives = 25/43 (58%)
 Frame = +1

Query: 1582 MSKSEQGDRRLLFWGIYYLDVFGALQLGVPRLLKDHEIECALP 1710
            + ++E  +RR ++W  Y+ D +G+L  G    + + ++ C LP
Sbjct: 368  LDENEANERRKMWWKCYWWDKYGSLLTGKQFQIMEEQMACLLP 410

>AER183C Chr5 complement(975879..978518) [2640 bp, 879 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YOL089C
           (HAL9)
          Length = 879

 Score = 42.0 bits (97), Expect = 0.012
 Identities = 19/52 (36%), Positives = 27/52 (51%)
 Frame = +1

Query: 175 VTSATPTSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRR 330
           +T        RV++ACD CR+KK RC+G+ P C  C      C  +  + RR
Sbjct: 66  MTETKTVMRKRVSKACDICRAKKIRCNGEEP-CVNCEKFNLGCTYTHVIKRR 116

>Ecym_5017 Chr5 (36647..39583) [2937 bp, 978 aa] {ON} similar to
           Ashbya gossypii ADR403C
          Length = 978

 Score = 42.0 bits (97), Expect = 0.012
 Identities = 14/33 (42%), Positives = 22/33 (66%)
 Frame = +1

Query: 205 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 303
           R++  C  CR  KT+CD ++P+CS+CA    +C
Sbjct: 27  RISFVCQACRKSKTKCDREKPRCSRCAKNNIKC 59

>SAKL0D14520g Chr4 complement(1192788..1195739) [2952 bp, 983 aa]
           {ON} similar to uniprot|P39720 Saccharomyces cerevisiae
           YAL051W OAF1 Oleate-activated transcription factor acts
           alone and as a heterodimer with Pip2p activates genes
           involved in beta-oxidation of fatty acids and peroxisome
           organization and biogenesis
          Length = 983

 Score = 42.0 bits (97), Expect = 0.012
 Identities = 14/33 (42%), Positives = 21/33 (63%)
 Frame = +1

Query: 205 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 303
           R++  C  CR  KT+CD ++P C++C   G EC
Sbjct: 23  RISFVCKACRKSKTKCDREKPSCTRCIKNGIEC 55

>ZYRO0C00726g Chr3 (53977..57084) [3108 bp, 1035 aa] {ON} similar to
           uniprot|P39720 Saccharomyces cerevisiae YAL051W OAF1
           Oleate-activated transcription factor acts alone and as
           a heterodimer with Pip2p activates genes involved in
           beta-oxidation of fatty acids and peroxisome
           organization and biogenesis
          Length = 1035

 Score = 42.0 bits (97), Expect = 0.012
 Identities = 21/71 (29%), Positives = 35/71 (49%)
 Frame = +1

Query: 130 TNNSAAPNAARSISPVTSATPTSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKV 309
           T N A+ +   S +   S +     R++  C  CR  KT+CD ++P+C +C   G  C  
Sbjct: 30  TRNDASSSQDGSQNGDESNSIKKRNRISFVCKACRRSKTKCDREKPKCGRCVQHGIACVY 89

Query: 310 SDKLSRRAFPR 342
              + ++A PR
Sbjct: 90  D--VEKQAAPR 98

>KAFR0I00230 Chr9 (48095..51232) [3138 bp, 1045 aa] {ON} Anc_7.17
           YOR363C
          Length = 1045

 Score = 42.0 bits (97), Expect = 0.012
 Identities = 14/33 (42%), Positives = 21/33 (63%)
 Frame = +1

Query: 205 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 303
           R++  C  CR  KT+CD ++P+CS+CA     C
Sbjct: 24  RISLVCQACRKSKTKCDREKPRCSRCAKNNLRC 56

>Suva_1.14 Chr1 (25653..28790) [3138 bp, 1045 aa] {ON} YAL051W
           (REAL)
          Length = 1045

 Score = 42.0 bits (97), Expect = 0.012
 Identities = 16/46 (34%), Positives = 27/46 (58%)
 Frame = +1

Query: 205 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPR 342
           R++  C  CR  KT+CD ++P+C +C   G +C     +S++  PR
Sbjct: 61  RISFVCQACRKSKTKCDREKPECGRCTKHGLKCVYD--VSKQPAPR 104

>CAGL0I07755g Chr9 complement(745585..748746) [3162 bp, 1053 aa]
           {ON} similar to uniprot|Q12180 Saccharomyces cerevisiae
           YOL089c HAL9
          Length = 1053

 Score = 42.0 bits (97), Expect = 0.012
 Identities = 19/54 (35%), Positives = 28/54 (51%), Gaps = 3/54 (5%)
 Frame = +1

Query: 151 NAARSISPVTSATPTSNYRVAQACDRCRSKKTRCDGKRP---QCSQCAAVGFEC 303
           N   +IS +         R A+AC+ CR +KT+CD   P   +CS C+  G +C
Sbjct: 155 NYMNNISQMPGQLHKEKRRAAKACEYCRKRKTKCDEVSPYTNKCSNCSKAGVDC 208

>KNAG0E04150 Chr5 complement(823063..826473) [3411 bp, 1136 aa] {ON}
           
          Length = 1136

 Score = 42.0 bits (97), Expect = 0.013
 Identities = 17/59 (28%), Positives = 32/59 (54%), Gaps = 6/59 (10%)
 Frame = +1

Query: 172 PVTSATPTSNY------RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRR 330
           P +S++ +SN       R++  C  CR  K +CD ++P+C++C   G +C   ++   R
Sbjct: 28  PSSSSSSSSNIQLKKRNRISFVCQNCRKSKMKCDREKPECTRCLKQGIKCVYDEERQPR 86

>Ecym_2263 Chr2 (518089..519615) [1527 bp, 508 aa] {ON} similar to
           Ashbya gossypii AFL033W
          Length = 508

 Score = 41.6 bits (96), Expect = 0.013
 Identities = 23/61 (37%), Positives = 27/61 (44%), Gaps = 3/61 (4%)
 Frame = +1

Query: 148 PNAARSISPVTS---ATPTSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDK 318
           P     I+P  +   A P S  R    C  CR KK RCD +RP CS C   G  C    +
Sbjct: 15  PGETGGITPAGASLKALPKSKARSFTGCWACRFKKRRCDERRPFCSLCTKHGDSCSYDVR 74

Query: 319 L 321
           L
Sbjct: 75  L 75

>TDEL0D03610 Chr4 (664819..666993) [2175 bp, 724 aa] {ON} Anc_3.264
           YDR034C
          Length = 724

 Score = 41.6 bits (96), Expect = 0.015
 Identities = 20/56 (35%), Positives = 29/56 (51%), Gaps = 5/56 (8%)
 Frame = +1

Query: 151 NAARSISPVTSATPTSNYRVAQ-----ACDRCRSKKTRCDGKRPQCSQCAAVGFEC 303
           +AA   +PVTS    SN  V +      C  C+ ++ +CD  +P C QCA +  EC
Sbjct: 95  SAAMPPTPVTSTVKDSNGNVKRKYSRNGCTECKRRRIKCDETKPTCWQCARLNREC 150

>KLTH0H02684g Chr8 complement(235527..237776) [2250 bp, 749 aa] {ON}
           weakly similar to uniprot|P04386 Saccharomyces
           cerevisiae YPL248C GAL4 DNA-binding transcription factor
           required for the activation of the GAL genes in response
           to galactose repressed by Gal80p and activated by Gal3p
          Length = 749

 Score = 41.6 bits (96), Expect = 0.015
 Identities = 18/45 (40%), Positives = 23/45 (51%)
 Frame = +1

Query: 214 QACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGY 348
           QACD CR KK +C  + P CS C    ++C  S K  R    R +
Sbjct: 9   QACDWCRRKKLKCSREHPICSNCFKHNWDCHYSPKKVRSPLTRAH 53

>Kwal_26.6805 s26 (71596..74430) [2835 bp, 944 aa] {ON} YAL051W
           (OAF1) - transcription factor [contig 44] FULL
          Length = 944

 Score = 41.6 bits (96), Expect = 0.016
 Identities = 17/50 (34%), Positives = 24/50 (48%)
 Frame = +1

Query: 154 AARSISPVTSATPTSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 303
           A + +    SA      R++  C  CR  KT+CD  +P CS+C   G  C
Sbjct: 7   AGQEVKTTQSAHSGRRNRLSFVCQSCRKGKTKCDRAKPSCSRCLKHGIRC 56

>NCAS0I00270 Chr9 complement(33129..35963) [2835 bp, 944 aa] {ON}
           Anc_7.17 YAL051W
          Length = 944

 Score = 41.6 bits (96), Expect = 0.016
 Identities = 15/42 (35%), Positives = 23/42 (54%)
 Frame = +1

Query: 178 TSATPTSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 303
           +  T    YR++  C  CR  K +CD ++P CS+C+    EC
Sbjct: 26  SQVTKKKRYRLSFVCQGCRRSKVKCDQEKPVCSRCSKHDLEC 67

>Kwal_26.8109 s26 complement(650270..653182) [2913 bp, 970 aa] {ON}
           YKL038W (RGT1) - 1:1 [contig 55] FULL
          Length = 970

 Score = 41.6 bits (96), Expect = 0.016
 Identities = 19/58 (32%), Positives = 30/58 (51%), Gaps = 2/58 (3%)
 Frame = +1

Query: 181 SATPTSNYRVAQACDRCRSKKTRCD--GKRPQCSQCAAVGFECKVSDKLSRRAFPRGY 348
           +A+     + ++ACD+CR KKTRCD   + P C+ C  +   C       +R   +GY
Sbjct: 26  AASERRRSKTSRACDQCRGKKTRCDFSDENPVCTSCQRMSKTCTFERVPMKRGPTKGY 83

>ADR403C Chr4 complement(1429115..1432027) [2913 bp, 970 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YAL051W
           (OAF1) and YOR363C (PIP2); Tandem gene triplication in
           this genome
          Length = 970

 Score = 41.6 bits (96), Expect = 0.016
 Identities = 14/33 (42%), Positives = 22/33 (66%)
 Frame = +1

Query: 205 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 303
           R++  C  CR  KT+CD ++P+CS+CA    +C
Sbjct: 27  RISFVCQACRKSKTKCDREKPRCSRCAKNNVKC 59

>SAKL0A09856g Chr1 complement(867959..871021) [3063 bp, 1020 aa]
           {ON} some similarities with uniprot|P32862 Saccharomyces
           cerevisiae YKL038W RGT1 Glucose-responsive transcription
           factor that regulates expression of several glucose
           transporter (HXT) genes in response to glucose binds to
           promoters and acts both as a transcriptional activator
           and repressor
          Length = 1020

 Score = 41.6 bits (96), Expect = 0.016
 Identities = 20/50 (40%), Positives = 27/50 (54%), Gaps = 2/50 (4%)
 Frame = +1

Query: 205 RVAQACDRCRSKKTRCD--GKRPQCSQCAAVGFECKVSDKLSRRAFPRGY 348
           +V++ACD+CR KK +CD     P CS C  VG  C       +R   +GY
Sbjct: 31  KVSRACDQCRKKKIKCDVSEDNPVCSGCFKVGDRCTFERVPLKRGPSKGY 80

>KLLA0D10153g Chr4 (858016..859983) [1968 bp, 655 aa] {ON} some
           similarities with uniprot|P35995 Saccharomyces
           cerevisiae YKL222C Hypothetical ORF
          Length = 655

 Score = 41.2 bits (95), Expect = 0.019
 Identities = 15/38 (39%), Positives = 22/38 (57%)
 Frame = +1

Query: 190 PTSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 303
           P S  +  ++C  C+ +K +CD K P CS C   G+EC
Sbjct: 2   PKSRNKPTRSCLMCQRRKKKCDRKAPSCSACLKKGYEC 39

>KAFR0F01040 Chr6 complement(195192..197696) [2505 bp, 834 aa] {ON}
           Anc_6.279 YPL248C
          Length = 834

 Score = 41.2 bits (95), Expect = 0.020
 Identities = 17/45 (37%), Positives = 22/45 (48%)
 Frame = +1

Query: 214 QACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGY 348
           QACD CR KK RC  ++P C +C      C  S +  R    R +
Sbjct: 3   QACDICRVKKLRCSKEKPSCFKCLKNNLTCTYSPRAKRSPLTRAH 47

>CAGL0M12298g Chr13 complement(1227303..1230287) [2985 bp, 994 aa]
           {ON} similar to uniprot|P39720 Saccharomyces cerevisiae
           YAL051w OAF1 peroxisome proliferating transcription
           factor or uniprot|P52960 Saccharomyces cerevisiae
           YOR363c PIP2
          Length = 994

 Score = 41.2 bits (95), Expect = 0.021
 Identities = 20/59 (33%), Positives = 33/59 (55%), Gaps = 1/59 (1%)
 Frame = +1

Query: 169 SPVTSATPT-SNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPR 342
           SP  +A  T    R++  C  CR  KTRCD ++P C++C  +  EC     +++++ PR
Sbjct: 9   SPEGNAARTRKRNRISFVCQACRRSKTRCDKEKPICTRCKKLKLECVYD--MAKQSAPR 65

>SAKL0B01870g Chr2 (185897..188926) [3030 bp, 1009 aa] {ON} weakly
           similar to uniprot|P39720 Saccharomyces cerevisiae
           YAL051W OAF1 Oleate-activated transcription factor acts
           alone and as a heterodimer with Pip2p activates genes
           involved in beta-oxidation of fatty acids and peroxisome
           organization and biogenesis
          Length = 1009

 Score = 41.2 bits (95), Expect = 0.021
 Identities = 19/57 (33%), Positives = 30/57 (52%), Gaps = 1/57 (1%)
 Frame = +1

Query: 166 ISPVTSATPTSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVS-DKLSRRA 333
           + P+     + N +V+ AC+ C  KK +CD   P C+ C   G +CK + +K S  A
Sbjct: 58  VRPMVDRPRSFNIKVSPACEACNVKKIKCDRGFPVCNTCLKRGTQCKYNFEKYSNSA 114

>CAGL0J07150g Chr10 complement(688858..691926) [3069 bp, 1022 aa]
           {ON} similar to uniprot|P39720 Saccharomyces cerevisiae
           YAL051w OAF1 peroxisome proliferating transcription
           factor or uniprot|P52960 Saccharomyces cerevisiae
           YOR363c PIP2
          Length = 1022

 Score = 41.2 bits (95), Expect = 0.021
 Identities = 18/43 (41%), Positives = 26/43 (60%)
 Frame = +1

Query: 205 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRA 333
           R++  C  CR  KT+CD ++P CS+C   G  C V D  S++A
Sbjct: 18  RLSFVCQGCRKAKTKCDKEKPACSRCLKHGIRC-VYDLTSQKA 59

>KLLA0A09119g Chr1 complement(797533..800781) [3249 bp, 1082 aa]
           {ON} weakly similar to uniprot|P12383 Saccharomyces
           cerevisiae YGL013C PDR1 Zinc cluster protein that is a
           master regulator involved in recruiting other zinc
           cluster proteins to pleiotropic drug response elements
           (PDREs) to fine tune the regulation of multidrug
           resistance genes
          Length = 1082

 Score = 41.2 bits (95), Expect = 0.021
 Identities = 23/61 (37%), Positives = 29/61 (47%), Gaps = 3/61 (4%)
 Frame = +1

Query: 139 SAAPNAARSISPVTS---ATPTSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKV 309
           S+  N  R+  P  S    T     +V++ACD CR KK +C G  P C  C   G EC  
Sbjct: 25  SSGVNGDRTAIPRDSNGNGTGKPRRKVSRACDSCRKKKIKCSGTLP-CKSCETYGCECVY 83

Query: 310 S 312
           S
Sbjct: 84  S 84

>Smik_11.210 Chr11 (352056..355565) [3510 bp, 1169 aa] {ON} YKL038W
           (REAL)
          Length = 1169

 Score = 41.2 bits (95), Expect = 0.022
 Identities = 23/77 (29%), Positives = 35/77 (45%), Gaps = 4/77 (5%)
 Frame = +1

Query: 130 TNNSAAPNAARSISPVTSATPTSNYRV--AQACDRCRSKKTRCDGK--RPQCSQCAAVGF 297
           T N    N+   ++P  ++      R   ++ACD+CR KK +CD K  R  C+ C   G 
Sbjct: 15  TKNGGTSNSPDDMNPAAASGHAMKKRTKASRACDQCRKKKIKCDYKDERGVCTNCQRNGD 74

Query: 298 ECKVSDKLSRRAFPRGY 348
            C       +R   +GY
Sbjct: 75  RCSFERVPLKRGPSKGY 91

>YGR288W Chr7 (1070293..1071714) [1422 bp, 473 aa] {ON}
           MAL13MAL-activator protein, part of complex locus MAL1;
           nonfunctional in genomic reference strain S288C
          Length = 473

 Score = 40.8 bits (94), Expect = 0.022
 Identities = 18/39 (46%), Positives = 22/39 (56%)
 Frame = +1

Query: 187 TPTSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 303
           T T      QACD CR ++ +CDGKRP CS C     +C
Sbjct: 2   TLTKQTCAKQACDCCRIRRVKCDGKRP-CSSCLQNSLDC 39

>Suva_10.351 Chr10 (613486..614460) [975 bp, 324 aa] {ON} YLR256W
           (REAL)
          Length = 324

 Score = 40.4 bits (93), Expect = 0.023
 Identities = 18/55 (32%), Positives = 26/55 (47%)
 Frame = +1

Query: 130 TNNSAAPNAARSISPVTSATPTSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVG 294
           TN S+    +  +S  +S       R+  +C  CR +K +CD  RP C QC   G
Sbjct: 35  TNTSSNSPPSLHMSSESSKIKRKRNRIPLSCTICRKRKVKCDKFRPHCQQCTKTG 89

>SAKL0H25520g Chr8 (2233960..2236221) [2262 bp, 753 aa] {ON} some
           similarities with uniprot|P39720 Saccharomyces
           cerevisiae YAL051W OAF1 Oleate-activated transcription
           factor acts alone and as a heterodimer with Pip2p
           activates genes involved in beta-oxidation of fatty
           acids and peroxisome organization and biogenesis
          Length = 753

 Score = 40.8 bits (94), Expect = 0.026
 Identities = 15/36 (41%), Positives = 21/36 (58%)
 Frame = +1

Query: 196 SNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 303
           SN   + AC  CR +K +CD K+P C +C  +G  C
Sbjct: 10  SNKPASFACQSCRKRKRKCDRKKPVCERCKRLGVPC 45

>Kpol_260.2 s260 complement(3488..5758) [2271 bp, 756 aa] {ON}
           complement(3488..5758) [2271 nt, 757 aa]
          Length = 756

 Score = 40.8 bits (94), Expect = 0.026
 Identities = 16/52 (30%), Positives = 25/52 (48%)
 Frame = +1

Query: 178 TSATPTSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRA 333
           T +  +   + A +C RCR  K +C  +RP C+ C   G  C    +  RR+
Sbjct: 29  TESATSPGDKEAYSCSRCRKLKRKCQKQRPSCANCMNAGATCNYPGRAPRRS 80

>KLLA0D12672g Chr4 complement(1076011..1078608) [2598 bp, 865 aa]
           {ON} uniprot|P08657 Kluyveromyces lactis LAC9 Lactose
           regulatory protein LAC9
          Length = 865

 Score = 40.8 bits (94), Expect = 0.027
 Identities = 21/77 (27%), Positives = 33/77 (42%), Gaps = 4/77 (5%)
 Frame = +1

Query: 130 TNNSAAPNAARSISPVTSATPTSNYRVA----QACDRCRSKKTRCDGKRPQCSQCAAVGF 297
           T   A  N  ++ S   +    +N + +    QACD CR KK +C    P C+ C     
Sbjct: 61  TGTDAVSNGNKNDSNANNNNNNNNKKSSEVMHQACDACRKKKWKCSKTVPTCTNCLKYNL 120

Query: 298 ECKVSDKLSRRAFPRGY 348
           +C  S ++ R    R +
Sbjct: 121 DCVYSPQVVRTPLTRAH 137

>NDAI0D00900 Chr4 (205039..207636) [2598 bp, 865 aa] {ON} 
          Length = 865

 Score = 40.8 bits (94), Expect = 0.027
 Identities = 14/33 (42%), Positives = 22/33 (66%)
 Frame = +1

Query: 205 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 303
           R +  C  C+++K RCD +RP CS+C  +G +C
Sbjct: 26  RRSHVCITCKNQKLRCDRERPSCSRCRRIGRDC 58

>Suva_16.25 Chr16 complement(31437..31868) [432 bp, 143 aa] {ON}
           YGR288W (REAL)
          Length = 143

 Score = 38.5 bits (88), Expect = 0.027
 Identities = 17/41 (41%), Positives = 22/41 (53%)
 Frame = +1

Query: 208 VAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRR 330
           V QACD CR ++ +CDGK P C +C      C     L +R
Sbjct: 37  VKQACDCCRVRRVKCDGKGP-CGRCLQRDLNCTYLQPLRKR 76

>AFR117C Chr6 complement(646829..650287) [3459 bp, 1152 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR256W
           (HAP1)
          Length = 1152

 Score = 40.8 bits (94), Expect = 0.028
 Identities = 16/43 (37%), Positives = 24/43 (55%)
 Frame = +1

Query: 166 ISPVTSATPTSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVG 294
           +S  T+++     RV  +C  CR +K +CD  RP C+QC   G
Sbjct: 1   MSSPTASSKRKRNRVPLSCTICRKRKVKCDKTRPHCNQCTKTG 43

 Score = 34.7 bits (78), Expect = 2.1
 Identities = 24/71 (33%), Positives = 39/71 (54%), Gaps = 9/71 (12%)
 Frame = +1

Query: 1507 TVVSMAQQLRLHRCP-------SAVLGTEGSTMSKSEQGDR--RLLFWGIYYLDVFGALQ 1659
            ++V MA    LHR P       S +L T   T++ +E+     R +++ I  LD+  +L 
Sbjct: 470  SIVQMAFSCGLHRDPDNFPQLSSTLLKTTKDTITNTERLKHTWRKMWYFILSLDIQQSLS 529

Query: 1660 LGVPRLLKDHE 1692
            LG PRLL++H+
Sbjct: 530  LGSPRLLRNHK 540

>TBLA0E00700 Chr5 complement(138121..141945) [3825 bp, 1274 aa] {ON}
           Anc_7.17 YOR363C
          Length = 1274

 Score = 40.8 bits (94), Expect = 0.029
 Identities = 19/48 (39%), Positives = 27/48 (56%), Gaps = 3/48 (6%)
 Frame = +1

Query: 169 SPVTSA---TPTSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 303
           SP+TS    T   N R++  C  CR  KT+C+  +P CS+C  +G  C
Sbjct: 55  SPITSPGHITKKRN-RISFVCQSCRKSKTKCNKDKPSCSRCKKLGIFC 101

>NDAI0F00110 Chr6 (10745..12271) [1527 bp, 508 aa] {ON} 
          Length = 508

 Score = 40.4 bits (93), Expect = 0.030
 Identities = 14/33 (42%), Positives = 21/33 (63%)
 Frame = +1

Query: 205 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 303
           R    C  CR++K +CD +RP+C +C  +G EC
Sbjct: 15  RSYSGCWTCRARKVKCDTQRPKCCRCKQLGIEC 47

>SAKL0A00704g Chr1 complement(78811..80967) [2157 bp, 718 aa] {ON}
           similar to uniprot|P35995 Saccharomyces cerevisiae
           YKL222C Hypothetical ORF and similar to uniprot|Q12340
           Saccharomyces cerevisiae YOR172W
          Length = 718

 Score = 40.4 bits (93), Expect = 0.034
 Identities = 18/46 (39%), Positives = 27/46 (58%), Gaps = 1/46 (2%)
 Frame = +1

Query: 205 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGF-ECKVSDKLSRRAFP 339
           +V ++C  CR +K +CD K+P+CS CAA    EC   +K +    P
Sbjct: 14  KVIKSCLFCRKRKLKCDHKKPKCSTCAARNLPECVYVEKFTHEIDP 59

>Skud_9.220 Chr9 complement(396576..398957) [2382 bp, 793 aa] {ON}
           YER184C (REAL)
          Length = 793

 Score = 40.4 bits (93), Expect = 0.035
 Identities = 17/35 (48%), Positives = 23/35 (65%)
 Frame = +1

Query: 199 NYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 303
           N RV++AC+RC  KK +CD K+P C  CA    +C
Sbjct: 11  NSRVSKACERCHRKKIKCDSKKP-CFGCAGSRSKC 44

>SAKL0D00264g Chr4 complement(24754..27300) [2547 bp, 848 aa] {ON}
           similar to uniprot|P05085 Saccharomyces cerevisiae
           YML099C ARG81 Zinc-finger transcription factor of the
           Zn(2)-Cys(6) binuclear cluster domain type involved in
           the regulation of arginine-responsive genes acts with
           Arg80p and Arg82p
          Length = 848

 Score = 40.4 bits (93), Expect = 0.035
 Identities = 15/28 (53%), Positives = 18/28 (64%)
 Frame = +1

Query: 220 CDRCRSKKTRCDGKRPQCSQCAAVGFEC 303
           C  CRS+K +CD  RP C +C   GFEC
Sbjct: 20  CWTCRSRKVKCDLGRPSCKRCERSGFEC 47

>Suva_13.186 Chr13 (302887..305571) [2685 bp, 894 aa] {ON} YMR019W
           (REAL)
          Length = 894

 Score = 40.4 bits (93), Expect = 0.035
 Identities = 19/57 (33%), Positives = 30/57 (52%), Gaps = 4/57 (7%)
 Frame = +1

Query: 172 PVTSATPTSN----YRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRR 330
           P  +A    N     RV +AC+ C+ +K +CDG +P C  C+    EC+   K++ R
Sbjct: 12  PTNTAASNENSKTRLRVQKACELCKKRKVKCDGNKP-CLNCSKHQKECRYDFKVTNR 67

>Smik_13.183 Chr13 (304049..304060,304064..306787) [2736 bp, 911 aa]
           {ON} YMR019W (REAL)
          Length = 911

 Score = 40.4 bits (93), Expect = 0.036
 Identities = 20/66 (30%), Positives = 32/66 (48%)
 Frame = +1

Query: 133 NNSAAPNAARSISPVTSATPTSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVS 312
           N + A     + + V+        RV +AC+ C+ +K +CDG RP C  C+    EC+  
Sbjct: 17  NTTDALEINAAAAAVSKENGRGRLRVQKACEICKRRKVKCDGNRP-CLNCSKHKKECRYD 75

Query: 313 DKLSRR 330
            K + R
Sbjct: 76  FKATNR 81

>Skud_13.173 Chr13 (298693..298722,298729..301461) [2763 bp, 920 aa]
           {ON} YMR019W (REAL)
          Length = 920

 Score = 40.4 bits (93), Expect = 0.036
 Identities = 17/60 (28%), Positives = 31/60 (51%)
 Frame = +1

Query: 151 NAARSISPVTSATPTSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRR 330
           +A ++++  +        RV +AC+ C+ +K +CDG +P C  C     EC+   K + R
Sbjct: 34  DALQNVAAASKENSRGRLRVQKACELCKKRKVKCDGNKP-CLNCFKHQKECRYEFKATNR 92

>KAFR0C03230 Chr3 complement(655300..656520) [1221 bp, 406 aa] {ON}
           Anc_8.109 YGL162W
          Length = 406

 Score = 40.0 bits (92), Expect = 0.036
 Identities = 19/44 (43%), Positives = 27/44 (61%)
 Frame = +1

Query: 130 TNNSAAPNAARSISPVTSATPTSNYRVAQACDRCRSKKTRCDGK 261
           T++S +P+ + S S   S T T   RV  +CD+CR KK +CD K
Sbjct: 220 TSSSPSPSLSASFSS-NSNTTTKRQRVGPSCDKCRLKKIKCDAK 262

>YOR363C Chr15 complement(1020222..1023212) [2991 bp, 996 aa] {ON}
           PIP2Autoregulatory oleate-specific transcriptional
           activator of peroxisome proliferation, contains
           Zn(2)-Cys(6) cluster domain, forms heterodimer with
           Oaf1p, binds oleate response elements (OREs), activates
           beta-oxidation genes
          Length = 996

 Score = 40.4 bits (93), Expect = 0.036
 Identities = 18/58 (31%), Positives = 29/58 (50%)
 Frame = +1

Query: 169 SPVTSATPTSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPR 342
           SP  +       R++  C  CR  KT+CD ++P+C +C      C     ++R+A PR
Sbjct: 8   SPAMNRVGKKRNRLSFVCQACRKAKTKCDQEKPRCGRCTKQNLFCIYD--VARQAAPR 63

>YGL013C Chr7 complement(469092..472298) [3207 bp, 1068 aa] {ON}
           PDR1Zinc cluster protein that is a master regulator
           involved in recruiting other zinc cluster proteins to
           pleiotropic drug response elements (PDREs) to fine tune
           the regulation of multidrug resistance genes
          Length = 1068

 Score = 40.4 bits (93), Expect = 0.037
 Identities = 16/38 (42%), Positives = 24/38 (63%)
 Frame = +1

Query: 205 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDK 318
           +V++ACD CR +K +C+GK P C+ C     EC  S +
Sbjct: 41  KVSKACDNCRKRKIKCNGKFP-CASCEIYSCECTFSTR 77

>KAFR0B01450 Chr2 (273614..276880) [3267 bp, 1088 aa] {ON} Anc_2.547
           YKL038W
          Length = 1088

 Score = 40.4 bits (93), Expect = 0.037
 Identities = 24/75 (32%), Positives = 35/75 (46%), Gaps = 2/75 (2%)
 Frame = +1

Query: 130 TNNSAAPNAARSISPVTSATPTSNYRVAQACDRCRSKKTRCDG--KRPQCSQCAAVGFEC 303
           +N   A NA+RS S           + ++ACD+CR KK +CD    R  C+ C   G +C
Sbjct: 39  SNTEEANNASRSSSNKRRT------KASRACDQCRKKKVKCDNGDDRSVCTNCQRNGEKC 92

Query: 304 KVSDKLSRRAFPRGY 348
                  +R   +GY
Sbjct: 93  TFERVPLKRGPSKGY 107

>TBLA0G01130 Chr7 (287952..291350) [3399 bp, 1132 aa] {ON} Anc_8.879
           YML099C
          Length = 1132

 Score = 40.4 bits (93), Expect = 0.037
 Identities = 14/38 (36%), Positives = 22/38 (57%)
 Frame = +1

Query: 193 TSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECK 306
           T+  R    C  CRS+K +CD ++PQC +C     +C+
Sbjct: 7   TARNRTYSGCWTCRSRKIKCDQQKPQCKRCLKANLKCE 44

>TPHA0A04540 Chr1 (1031790..1035326) [3537 bp, 1178 aa] {ON}
           Anc_3.109 YOL089C
          Length = 1178

 Score = 40.4 bits (93), Expect = 0.037
 Identities = 25/73 (34%), Positives = 36/73 (49%), Gaps = 16/73 (21%)
 Frame = +1

Query: 133 NNSAAPNAARSISPVTSATPTSN------------YRVAQACDRCRSKKTRCDGKRP--- 267
           N+SA+   ++S+SP+ S     N             RV++ACD CR +K +CD KR    
Sbjct: 215 NDSAS---SKSVSPLESIPLQKNDLKPYDNPRSAKKRVSRACDHCRKRKIKCDEKRDPNT 271

Query: 268 -QCSQCAAVGFEC 303
            +CS C     EC
Sbjct: 272 NKCSNCIKYNSEC 284

>Kwal_0.142 s0 complement(63621..65507) [1887 bp, 629 aa] {OFF}
           YLR256W (HAP1) - zinc-finger transcription factor of the
           Zn(2)-Cys(6) binuclear cluster domain type [contig 78]
           PARTIAL
          Length = 629

 Score = 40.0 bits (92), Expect = 0.043
 Identities = 16/40 (40%), Positives = 21/40 (52%)
 Frame = +1

Query: 175 VTSATPTSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVG 294
           +TS       RV  +C  CR +K +CD  RP C QC+  G
Sbjct: 1   MTSQLKRKRNRVPLSCTICRKRKVKCDKTRPHCQQCSKTG 40

>AFL160C Chr6 complement(130842..132788) [1947 bp, 648 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL248C
           (GAL4)
          Length = 648

 Score = 40.0 bits (92), Expect = 0.043
 Identities = 17/47 (36%), Positives = 24/47 (51%)
 Frame = +1

Query: 208 VAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGY 348
           V QACD CR +K +C    P+C++C      C  S K+ R    R +
Sbjct: 5   VIQACDSCRRRKMKCSKTFPKCAKCREDNRVCLYSPKIRRSPLTRAH 51

>KLLA0A06039g Chr1 (557368..559341) [1974 bp, 657 aa] {ON} weakly
           similar to uniprot|P36023 Saccharomyces cerevisiae
           YKR064W
          Length = 657

 Score = 40.0 bits (92), Expect = 0.043
 Identities = 16/44 (36%), Positives = 22/44 (50%)
 Frame = +1

Query: 202 YRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRA 333
           +R    C  CR +KT+CD  +P CS C  +G  C  S+     A
Sbjct: 15  HRPTLVCLNCRRRKTKCDRGKPSCSNCLKLGETCVYSEDTDENA 58

>KLLA0A03421g Chr1 (308414..311056) [2643 bp, 880 aa] {ON} weakly
           similar to uniprot|P39720 Saccharomyces cerevisiae
           YAL051W OAF1 Oleate-activated transcription factor acts
           alone and as a heterodimer with Pip2p activates genes
           involved in beta-oxidation of fatty acids and peroxisome
           organization and biogenesis
          Length = 880

 Score = 40.0 bits (92), Expect = 0.046
 Identities = 13/34 (38%), Positives = 21/34 (61%)
 Frame = +1

Query: 202 YRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 303
           Y+++  C  CR  KT+CD K+P C++C  +   C
Sbjct: 15  YKLSFVCQLCRKSKTKCDRKKPSCARCQRLNKPC 48

>NDAI0D00220 Chr4 complement(43353..46187) [2835 bp, 944 aa] {ON}
           Anc_7.512
          Length = 944

 Score = 40.0 bits (92), Expect = 0.047
 Identities = 26/71 (36%), Positives = 37/71 (52%), Gaps = 3/71 (4%)
 Frame = +1

Query: 139 SAAPNAARSISPVTSATPTSNYRVAQACDRCRSKKTRCDG--KRPQ-CSQCAAVGFECKV 309
           S+ P     +SP TSA+ +S  +   AC  CR +K++CD   K P  C++C   G  C V
Sbjct: 21  SSDPMPNTLVSPSTSASVSSTKKRKFACVECRQQKSKCDAYDKAPDPCTKCQKKGVPC-V 79

Query: 310 SDKLSRRAFPR 342
             K  RR + R
Sbjct: 80  LKKDFRRTYKR 90

>Kpol_538.42 s538 complement(89752..93018) [3267 bp, 1088 aa] {ON}
           complement(89752..93018) [3267 nt, 1089 aa]
          Length = 1088

 Score = 40.0 bits (92), Expect = 0.048
 Identities = 14/42 (33%), Positives = 24/42 (57%)
 Frame = +1

Query: 205 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRR 330
           R++  C +CR  KTRCD ++P C++C      C    +L ++
Sbjct: 34  RISFVCQQCRKAKTRCDKEQPNCTRCIKNNLNCIYDIELQKK 75

>Suva_11.187 Chr11 (348570..352085) [3516 bp, 1171 aa] {ON} YKL038W
           (REAL)
          Length = 1171

 Score = 40.0 bits (92), Expect = 0.049
 Identities = 29/83 (34%), Positives = 41/83 (49%), Gaps = 10/83 (12%)
 Frame = +1

Query: 130 TNNS-AAPNAARSISP--VTSATPTSNY-----RVAQACDRCRSKKTRCDGK--RPQCSQ 279
           TN+S +A N   S SP  + SA   S+      + ++ACD+CR KK +CD K  +  CS 
Sbjct: 9   TNSSDSAKNGGLSNSPEDMDSAAAASHAIKKRTKASRACDQCRKKKIKCDYKDEKGLCSN 68

Query: 280 CAAVGFECKVSDKLSRRAFPRGY 348
           C   G  C       +R   +GY
Sbjct: 69  CQRNGDRCSFERVPLKRGPSKGY 91

>Kwal_YGOB_0.139 s0 complement(61752..63560,63594..65507) [3723 bp,
           1240 aa] {ON} ANNOTATED BY YGOB -
          Length = 1240

 Score = 40.0 bits (92), Expect = 0.049
 Identities = 16/40 (40%), Positives = 21/40 (52%)
 Frame = +1

Query: 175 VTSATPTSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVG 294
           +TS       RV  +C  CR +K +CD  RP C QC+  G
Sbjct: 1   MTSQLKRKRNRVPLSCTICRKRKVKCDKTRPHCQQCSKTG 40

>Suva_4.499 Chr4 complement(871565..872917) [1353 bp, 450 aa] {ON}
           YBR240C (REAL)
          Length = 450

 Score = 39.7 bits (91), Expect = 0.050
 Identities = 20/55 (36%), Positives = 27/55 (49%)
 Frame = +1

Query: 157 ARSISPVTSATPTSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKL 321
           ++ ++  +  +PT   R    C  CR KK RCD  RP CS CA  G  C    +L
Sbjct: 9   SKKVTLSSKPSPTKG-RTFTGCWACRFKKRRCDENRPICSLCAKHGDRCSYDIRL 62

>Skud_7.638 Chr7 (1060062..1061483) [1422 bp, 473 aa] {ON} YFL052W
           (REAL)
          Length = 473

 Score = 39.7 bits (91), Expect = 0.051
 Identities = 16/39 (41%), Positives = 24/39 (61%)
 Frame = +1

Query: 214 QACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRR 330
           QACD CR ++ +CDGK+P C++C     +C     L +R
Sbjct: 11  QACDCCRVRRVKCDGKKP-CNRCLQHDLKCTYLQPLRKR 48

>Kwal_34.15751 s34 (40148..42034) [1887 bp, 628 aa] {ON} [contig
           274] FULL
          Length = 628

 Score = 39.7 bits (91), Expect = 0.056
 Identities = 15/40 (37%), Positives = 24/40 (60%), Gaps = 1/40 (2%)
 Frame = +1

Query: 187 TPTSNY-RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 303
           TP S   R++  CD CR +K +C+ ++P CS+C     +C
Sbjct: 3   TPKSKKNRISHVCDACRIRKLKCNKQKPSCSRCVKHDLQC 42

>KNAG0I00560 Chr9 complement(93785..95776) [1992 bp, 663 aa] {ON}
           Anc_1.128 YJL206C
          Length = 663

 Score = 39.7 bits (91), Expect = 0.057
 Identities = 19/47 (40%), Positives = 24/47 (51%)
 Frame = +1

Query: 163 SISPVTSATPTSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 303
           S + VT        RV  AC  CR KK +CDG+ P CS C    ++C
Sbjct: 16  SANSVTRQLQLKEQRVRTACSMCRRKKRKCDGRVP-CSFCTKNHYQC 61

 Score = 34.3 bits (77), Expect = 2.6
 Identities = 32/125 (25%), Positives = 56/125 (44%), Gaps = 15/125 (12%)
 Frame = +1

Query: 1606 RRLLFWGIYYLDVFGALQLGVPRLLKDHEIECALP--ISEHAHAGVSLADQVIKLEGQVS 1779
            ++ LFW IY ++ +    LG P  L D  I+  +P  I +     + + + +    G  +
Sbjct: 321  KKRLFWSIYKMNAYLTSLLGFPTTLSDTLIDQEIPLDIDDDRITVLGIQEPLGTTAGDTT 380

Query: 1780 ELSLSLL-----RFSKILGNILD--SIFKRGMTSSAAQQVALIHEN------ALDNWRRG 1920
             +S   +     R   +L ++ +  S F  G T S   QV  I E+       +++WRR 
Sbjct: 381  RISSCGMNNEHTRLMTVLSHVYEYTSTFTLGATLS---QVDTIREHISSLEREIESWRRD 437

Query: 1921 LPKNL 1935
            LP+ L
Sbjct: 438  LPEPL 442

>TPHA0F02540 Chr6 (556797..559178) [2382 bp, 793 aa] {ON} Anc_6.60
           YLR266C
          Length = 793

 Score = 39.7 bits (91), Expect = 0.060
 Identities = 20/56 (35%), Positives = 32/56 (57%), Gaps = 4/56 (7%)
 Frame = +1

Query: 133 NNSAAPNAARSISPVTSATPTSNYR----VAQACDRCRSKKTRCDGKRPQCSQCAA 288
           NNS  P ++ + +   S T TS  R    + ++C  CR +K +CD  RP C+QC++
Sbjct: 19  NNSLTPESS-TYTISKSTTDTSQRRKKRKIPKSCYFCRKRKLKCDHSRPTCNQCSS 73

>ACL058W Chr3 (261723..264176) [2454 bp, 817 aa] {ON} NOHBY305; No
            homolog in Saccharomyces cerevisiae
          Length = 817

 Score = 39.7 bits (91), Expect = 0.060
 Identities = 26/77 (33%), Positives = 43/77 (55%)
 Frame = +1

Query: 1480 VSSVYEIRGTVVSMAQQLRLHRCPSAVLGTEGSTMSKSEQGDRRLLFWGIYYLDVFGALQ 1659
            +SSV ++      +AQ+L+L   P  V G+       ++   RR++FW I+ LD   +LQ
Sbjct: 270  ISSVAQL----ARLAQRLQLTADPEYVPGSR----EMADVQFRRIIFWQIFQLDTLTSLQ 321

Query: 1660 LGVPRLLKDHEIECALP 1710
              +P LL+ +E E +LP
Sbjct: 322  NRLPPLLRYNECETSLP 338

>ADR404C Chr4 complement(1432320..1434947) [2628 bp, 875 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YAL051W
           (OAF1) and YOR363C (PIP2); Tandem gene triplication in
           this genome
          Length = 875

 Score = 39.7 bits (91), Expect = 0.061
 Identities = 15/37 (40%), Positives = 22/37 (59%)
 Frame = +1

Query: 193 TSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 303
           T   +++  C  CR  KT+CD  +P CS+CA +G  C
Sbjct: 15  THKRKLSYVCIPCRKCKTKCDKLKPTCSRCAELGLYC 51

>KLLA0A03443g Chr1 (311628..314555) [2928 bp, 975 aa] {ON} similar
           to uniprot|Q758X5 Ashbya gossypii ADR403C ADR403Cp and
           weakly similar to YAL051W uniprot|P39720 Saccharomyces
           cerevisiae YAL051W OAF1 Oleate-activated transcription
           factor acts alone and as a heterodimer with Pip2p
           activates genes involved in beta-oxidation of fatty
           acids and peroxisome organization and biogenesis
          Length = 975

 Score = 39.7 bits (91), Expect = 0.062
 Identities = 14/42 (33%), Positives = 22/42 (52%)
 Frame = +1

Query: 178 TSATPTSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 303
           TS       R++  C  CR  KT+CD ++P+C +C     +C
Sbjct: 21  TSNGACKRQRISFVCQACRKNKTKCDREKPRCGRCVKYHLKC 62

>KLLA0C14212g Chr3 complement(1229219..1232341) [3123 bp, 1040 aa]
           {ON} weakly similar to uniprot|P25611 Saccharomyces
           cerevisiae YCR106W RDS1 Regulator of drug sensitivity
           transcriptional regulator
          Length = 1040

 Score = 39.7 bits (91), Expect = 0.063
 Identities = 18/36 (50%), Positives = 22/36 (61%)
 Frame = +1

Query: 205 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVS 312
           RV+  C  CR +KTRCD   P CS+C A+  EC  S
Sbjct: 70  RVSYVCYACRRRKTRCDRGNP-CSKCVALSTECVYS 104

>TBLA0D00630 Chr4 complement(164651..167884) [3234 bp, 1077 aa] {ON}
           Anc_7.389 YBL066C
          Length = 1077

 Score = 39.7 bits (91), Expect = 0.063
 Identities = 19/58 (32%), Positives = 32/58 (55%), Gaps = 3/58 (5%)
 Frame = +1

Query: 145 APNAARSISPVTSATPTSNYRVAQACDRCRSKKTRCDG--KRPQ-CSQCAAVGFECKV 309
           AP+AA       +    +N+R   +C  CR +K RC+   K+PQ C++CA +  +C +
Sbjct: 6   APHAALHTPHDDALPAATNHRPVTSCTHCRQQKIRCNALQKQPQPCTRCAKLNLKCNI 63

>Skud_7.274 Chr7 complement(472171..475413) [3243 bp, 1080 aa] {ON}
           YGL013C (REAL)
          Length = 1080

 Score = 39.7 bits (91), Expect = 0.063
 Identities = 15/38 (39%), Positives = 24/38 (63%)
 Frame = +1

Query: 205 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDK 318
           +V++ACD CR +K +C+GK P C+ C     EC  + +
Sbjct: 38  KVSKACDNCRKRKIKCNGKFP-CASCEIYSCECTFTSR 74

>YKL038W Chr11 (365605..369117) [3513 bp, 1170 aa] {ON}
           RGT1Glucose-responsive transcription factor that
           regulates expression of several glucose transporter
           (HXT) genes in response to glucose; binds to promoters
           and acts both as a transcriptional activator and
           repressor
          Length = 1170

 Score = 39.7 bits (91), Expect = 0.064
 Identities = 23/77 (29%), Positives = 34/77 (44%), Gaps = 4/77 (5%)
 Frame = +1

Query: 130 TNNSAAPNAARSISPVTSATPTSNYRV--AQACDRCRSKKTRCDGK--RPQCSQCAAVGF 297
           T N    N+   +    +A+     R   ++ACD+CR KK +CD K  +  CS C   G 
Sbjct: 15  TKNGGTSNSPDDMDSAAAASHAIKKRTKASRACDQCRKKKIKCDYKDEKGVCSNCQRNGD 74

Query: 298 ECKVSDKLSRRAFPRGY 348
            C       +R   +GY
Sbjct: 75  RCSFDRVPLKRGPSKGY 91

>TBLA0C04050 Chr3 complement(980010..983633) [3624 bp, 1207 aa] {ON}
           Anc_4.113 YGL013C
          Length = 1207

 Score = 39.7 bits (91), Expect = 0.064
 Identities = 15/33 (45%), Positives = 22/33 (66%)
 Frame = +1

Query: 205 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 303
           +V++ACD CR +K +C G+RP C+ C     EC
Sbjct: 12  KVSKACDNCRRRKIKCSGERP-CAGCKTYNCEC 43

>KLLA0F22990g Chr6 (2134385..2138146) [3762 bp, 1253 aa] {ON}
           uniprot|Q6DR96 Kluyveromyces lactis HAP1
          Length = 1253

 Score = 39.7 bits (91), Expect = 0.064
 Identities = 15/30 (50%), Positives = 18/30 (60%)
 Frame = +1

Query: 205 RVAQACDRCRSKKTRCDGKRPQCSQCAAVG 294
           RV  +C  CR +K +CD  RPQC QC   G
Sbjct: 20  RVPLSCTICRKRKVKCDKGRPQCQQCVKTG 49

>TPHA0O00600 Chr15 complement(107944..112062) [4119 bp, 1372 aa]
           {ON} Anc_1.380 YLR256W
          Length = 1372

 Score = 39.7 bits (91), Expect = 0.065
 Identities = 19/58 (32%), Positives = 27/58 (46%), Gaps = 4/58 (6%)
 Frame = +1

Query: 133 NNSAAPNAARSISPVTSATPTS----NYRVAQACDRCRSKKTRCDGKRPQCSQCAAVG 294
           N+S   N  ++ SP T  T         R+  +C  CR +K +CD  RP C  C+  G
Sbjct: 49  NHSEEMNLTQNSSPSTDDTKPKMKRKRNRIPLSCTICRKRKVKCDKTRPHCDPCSKTG 106

>TBLA0A09760 Chr1 complement(2398683..2403275) [4593 bp, 1530 aa]
           {ON} Anc_6.75 YLR278C
          Length = 1530

 Score = 39.7 bits (91), Expect = 0.066
 Identities = 16/43 (37%), Positives = 23/43 (53%)
 Frame = +1

Query: 211 AQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFP 339
           +++C  CR +K RCD K P C+ C   G +C    + S  A P
Sbjct: 38  SKSCLLCRRRKQRCDHKLPSCTACLKAGVKCVQPARYSNNAAP 80

>Kwal_23.6529 s23 (1627853..1629649) [1797 bp, 598 aa] {ON} YDR034C
           (LYS14) - transcription factor involved in lysine
           biosynthesis [contig 358] FULL
          Length = 598

 Score = 39.3 bits (90), Expect = 0.073
 Identities = 15/34 (44%), Positives = 18/34 (52%)
 Frame = +1

Query: 193 TSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVG 294
           T N R    C  C+  K +CD K+P C QCA  G
Sbjct: 5   TKNQRSRGGCINCKKSKIKCDEKKPMCGQCAKKG 38

>NCAS0A03070 Chr1 (603639..605609) [1971 bp, 656 aa] {ON} 
          Length = 656

 Score = 39.3 bits (90), Expect = 0.075
 Identities = 14/33 (42%), Positives = 20/33 (60%)
 Frame = +1

Query: 205 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 303
           R    C  CR++K RC+ +RP CS+C  +G  C
Sbjct: 10  RPTHVCAACRTQKLRCNRERPSCSRCQRIGRTC 42

>Smik_17.27 Chr17 complement(29476..31542) [2067 bp, 688 aa] {ON}
           YKL222C (REAL)
          Length = 688

 Score = 39.3 bits (90), Expect = 0.076
 Identities = 16/33 (48%), Positives = 19/33 (57%)
 Frame = +1

Query: 205 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 303
           +  +AC  CR KK +CD  RPQC QC     EC
Sbjct: 11  KAIKACLNCRRKKQKCDQARPQCYQCRIRKTEC 43

>NCAS0D04860 Chr4 (933920..936025) [2106 bp, 701 aa] {ON} 
          Length = 701

 Score = 39.3 bits (90), Expect = 0.076
 Identities = 16/39 (41%), Positives = 24/39 (61%), Gaps = 1/39 (2%)
 Frame = +1

Query: 205 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGF-ECKVSDK 318
           RV ++C  CR +K++CD  +P CS C   G  EC+  D+
Sbjct: 21  RVPKSCTVCRLRKSKCDRIKPYCSSCVLHGIKECRYDDR 59

>KAFR0E02330 Chr5 (468300..470414) [2115 bp, 704 aa] {ON} Anc_5.59
           YHR178W
          Length = 704

 Score = 39.3 bits (90), Expect = 0.076
 Identities = 15/38 (39%), Positives = 20/38 (52%)
 Frame = +1

Query: 217 ACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRR 330
           +C RCR  K +C  + P C  C  VG EC    + +RR
Sbjct: 14  SCSRCRKLKKKCPREVPVCGHCVRVGAECSYPGRAARR 51

>TDEL0A02690 Chr1 (485785..487953) [2169 bp, 722 aa] {ON} 
          Length = 722

 Score = 39.3 bits (90), Expect = 0.076
 Identities = 18/44 (40%), Positives = 24/44 (54%), Gaps = 1/44 (2%)
 Frame = +1

Query: 205 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGF-ECKVSDKLSRRA 333
           +  ++C  CR +K RCD K+P+CS C A    EC  S  L   A
Sbjct: 8   KAIKSCAFCRRRKLRCDQKKPRCSTCVARNLAECVYSQGLQHNA 51

>KNAG0A02300 Chr1 (214177..216363) [2187 bp, 729 aa] {ON}  gene
           extends into a gap in the genome sequence
          Length = 729

 Score = 39.3 bits (90), Expect = 0.077
 Identities = 20/45 (44%), Positives = 23/45 (51%), Gaps = 1/45 (2%)
 Frame = +1

Query: 172 PVTSATPTSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGF-EC 303
           P T  T      + + C  CR +K RCD  RP CS C A GF EC
Sbjct: 10  PATQDTRKKRKHI-RTCTFCRQRKVRCDQGRPLCSSCKARGFSEC 53

>KLTH0E05786g Chr5 (517896..520349) [2454 bp, 817 aa] {ON} weakly
           similar to uniprot|P39961 Saccharomyces cerevisiae
           YER184C Hypothetical ORF
          Length = 817

 Score = 39.3 bits (90), Expect = 0.079
 Identities = 23/56 (41%), Positives = 26/56 (46%), Gaps = 6/56 (10%)
 Frame = +1

Query: 154 AARSISPVTSATPTSNYRV------AQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 303
           A  S  P   ATP    R        QAC  CR +K +C+G RP CS C   G EC
Sbjct: 23  AQDSRPPQVMATPRVTKRAYTIRKTPQACISCRRRKVKCNGCRP-CSSCKTNGLEC 77

>CAGL0F09229g Chr6 complement(908186..910693) [2508 bp, 835 aa] {ON}
           weakly similar to uniprot|P39961 Saccharomyces
           cerevisiae YER184c
          Length = 835

 Score = 39.3 bits (90), Expect = 0.079
 Identities = 16/33 (48%), Positives = 20/33 (60%)
 Frame = +1

Query: 205 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 303
           RV +ACD CR +K +CDG +P CS C      C
Sbjct: 16  RVIRACDVCRKRKVKCDGDQP-CSSCMTASTVC 47

>Kwal_26.7095 s26 (211883..214399) [2517 bp, 838 aa] {ON} YOR363C
           (PIP2) - activator of peroxisome proliferation [contig
           46] FULL
          Length = 838

 Score = 39.3 bits (90), Expect = 0.079
 Identities = 20/68 (29%), Positives = 30/68 (44%), Gaps = 3/68 (4%)
 Frame = +1

Query: 145 APNAARSISPVTSATPTSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKV---SD 315
           +P+   S S        S  R +  C  C+ +K +CD  RP C +C+ +  EC      +
Sbjct: 5   SPSNTGSASSEPPEFKKSRMRQSFVCRNCKKRKIKCDKARPSCGRCSKLELECVYDFQEN 64

Query: 316 KLSRRAFP 339
           K  RR  P
Sbjct: 65  KDGRRGLP 72

>TPHA0A06090 Chr1 complement(1372559..1375102) [2544 bp, 847 aa]
           {ON} 
          Length = 847

 Score = 39.3 bits (90), Expect = 0.079
 Identities = 14/33 (42%), Positives = 19/33 (57%)
 Frame = +1

Query: 205 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 303
           R+   C  CR+KK +CD K+P C +C   G  C
Sbjct: 9   RLNNGCWTCRTKKVKCDSKKPFCDKCKDSGLHC 41

>SAKL0H00682g Chr8 complement(81989..84757) [2769 bp, 922 aa] {ON}
           weakly similar to uniprot|P39720 Saccharomyces
           cerevisiae YAL051W OAF1 Oleate-activated transcription
           factor acts alone and as a heterodimer with Pip2p
           activates genes involved in beta-oxidation of fatty
           acids and peroxisome organization and biogenesis
          Length = 922

 Score = 39.3 bits (90), Expect = 0.081
 Identities = 18/46 (39%), Positives = 25/46 (54%)
 Frame = +1

Query: 205 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPR 342
           R++  C  CR +K +CD +RP C QCA  G  C     + R+  PR
Sbjct: 20  RLSFVCLECRRRKIKCDKQRPCCIQCAEQGLTCVYD--IERQPAPR 63

>KLLA0F25630g Chr6 (2378464..2381487) [3024 bp, 1007 aa] {ON} some
           similarities with uniprot|P32862 Saccharomyces
           cerevisiae YKL038W RGT1 Glucose-responsive transcription
           factor that regulates expression of several glucose
           transporter (HXT) genes in response to glucose binds to
           promoters and acts both as a transcriptional activator
           and repressor
          Length = 1007

 Score = 39.3 bits (90), Expect = 0.082
 Identities = 23/69 (33%), Positives = 34/69 (49%), Gaps = 9/69 (13%)
 Frame = +1

Query: 169 SPVTSATPTSNYR--VAQACDRCRSKKTRCD-------GKRPQCSQCAAVGFECKVSDKL 321
           S V++AT  S  R  V++ACD+CR KK +CD            C+ C  +G +C      
Sbjct: 98  SNVSTATTESRRRSKVSRACDQCRKKKIKCDFIEGHDINPDQSCTGCRKIGEKCSFERIP 157

Query: 322 SRRAFPRGY 348
            +R   +GY
Sbjct: 158 LKRGPSKGY 166

>ZYRO0G21626g Chr7 complement(1781790..1783031) [1242 bp, 413 aa]
           {ON} weakly similar to uniprot|P38141 Saccharomyces
           cerevisiae YBR240C THI2 Zinc finger protein of the
           Zn(II)2Cys6 type probable transcriptional activator of
           thiamine biosynthetic genes
          Length = 413

 Score = 38.9 bits (89), Expect = 0.082
 Identities = 18/39 (46%), Positives = 20/39 (51%)
 Frame = +1

Query: 205 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKL 321
           R    C  CR KK RCD +RPQC+ CA     C    KL
Sbjct: 9   RTFTGCWACRLKKRRCDERRPQCTLCAKHNDSCCYDVKL 47

>Smik_7.277 Chr7 complement(461108..464317) [3210 bp, 1069 aa] {ON}
           YGL013C (REAL)
          Length = 1069

 Score = 39.3 bits (90), Expect = 0.083
 Identities = 15/33 (45%), Positives = 22/33 (66%)
 Frame = +1

Query: 205 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 303
           +V++ACD CR +K +C+GK P C+ C     EC
Sbjct: 38  KVSKACDNCRKRKIKCNGKFP-CASCEIYSCEC 69

>NCAS0A03580 Chr1 complement(712039..715380) [3342 bp, 1113 aa] {ON}
           
          Length = 1113

 Score = 39.3 bits (90), Expect = 0.083
 Identities = 21/62 (33%), Positives = 31/62 (50%)
 Frame = +1

Query: 130 TNNSAAPNAARSISPVTSATPTSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKV 309
           +N+ ++PN  +   P          +V++AC  CR +K +C G  P CS CAA   EC  
Sbjct: 15  SNSGSSPNNVKIKRP--------RKKVSKACANCRRRKIKCTGTYP-CSNCAAYQCECIF 65

Query: 310 SD 315
            D
Sbjct: 66  DD 67

>NCAS0A04750 Chr1 (944929..948354) [3426 bp, 1141 aa] {ON} Anc_2.547
          Length = 1141

 Score = 39.3 bits (90), Expect = 0.083
 Identities = 20/68 (29%), Positives = 35/68 (51%), Gaps = 2/68 (2%)
 Frame = +1

Query: 151 NAARSISPVTSATPTSNYRVAQACDRCRSKKTRCD--GKRPQCSQCAAVGFECKVSDKLS 324
           +AA + +   S++     + ++ACD+CR KK +CD   ++  CS C   G +C       
Sbjct: 52  SAAGTNAASNSSSQKKRTKASRACDQCRKKKIKCDFSEEKTLCSNCQRNGEKCTFERVPL 111

Query: 325 RRAFPRGY 348
           +R   +GY
Sbjct: 112 KRGPSKGY 119

>NDAI0H01990 Chr8 complement(481983..485468) [3486 bp, 1161 aa] {ON}
           Anc_7.17
          Length = 1161

 Score = 39.3 bits (90), Expect = 0.084
 Identities = 18/71 (25%), Positives = 32/71 (45%), Gaps = 14/71 (19%)
 Frame = +1

Query: 133 NNSAAPNAARSISPVTSATPTSNY--------------RVAQACDRCRSKKTRCDGKRPQ 270
           N++ + + + S S     +P SN               R++  C  CR  KT+CD ++P 
Sbjct: 26  NSTNSTSISTSFSQQNDTSPRSNSGSSSSHYNAIKKRNRISFVCQECRKAKTKCDKEKPY 85

Query: 271 CSQCAAVGFEC 303
           C++C     +C
Sbjct: 86  CTRCVKQNIKC 96

>KAFR0I02030 Chr9 complement(416471..420172) [3702 bp, 1233 aa] {ON}
           Anc_1.380 YLR256W
          Length = 1233

 Score = 39.3 bits (90), Expect = 0.084
 Identities = 17/48 (35%), Positives = 24/48 (50%)
 Frame = +1

Query: 151 NAARSISPVTSATPTSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVG 294
           N   +  P+T      N R+  +C  CR +K +CD  RP C+QC   G
Sbjct: 16  NNGNNRKPITKQKRKRN-RIPLSCTICRKRKVKCDKIRPHCNQCTKTG 62

>Skud_12.361 Chr12 complement(641047..645075) [4029 bp, 1342 aa]
           {ON} YLR278C (REAL)
          Length = 1342

 Score = 39.3 bits (90), Expect = 0.085
 Identities = 16/41 (39%), Positives = 22/41 (53%)
 Frame = +1

Query: 211 AQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRA 333
           +++C  CR +K RCD K P C+ C   G +C    K S  A
Sbjct: 38  SRSCLLCRRRKQRCDHKLPSCTACLKAGIKCVQPSKYSSSA 78

>Ecym_4286 Chr4 (613587..615470) [1884 bp, 627 aa] {ON} similar to
           Ashbya gossypii AGR061C
          Length = 627

 Score = 38.9 bits (89), Expect = 0.097
 Identities = 42/192 (21%), Positives = 70/192 (36%), Gaps = 23/192 (11%)
 Frame = +1

Query: 217 ACDRCRSKKTRCDGKRPQCSQCAAVGFEC-KVSDKLSRRAFPRGYXXXXXXXXXXXXXXX 393
           AC  CR ++ +CD + P C  C   G EC  +   L ++ +  GY               
Sbjct: 13  ACQSCRKRRRKCDLQMP-CLNCQKFGVECLPIDQDLRKKRYTTGYVQSL----------- 60

Query: 394 XXXXXXCDLKDEQMHLVSKYSSNKRHEPSSTEEGRMLEQLS----NSDGGSLRVS-STNL 558
                        + L+  Y    +      E  ++L  +S    N +  ++  S + + 
Sbjct: 61  ----------HSHISLLESYMRRLKEANDDNERNKILASISIDDINEENATITASMADSA 110

Query: 559 YLLN--KTTPAVQDGSE-----LHKCQGLGCNHASHPHLHEKPVSTSL----------SD 687
           YL+N  +T  AV+  SE     +        +H S  H   + VS+S+           D
Sbjct: 111 YLMNTSRTVGAVEHNSEPISTIITANASSATSHNSVVHTKNQVVSSSIYSSDSLYIRKRD 170

Query: 688 PAAISFEQNEAP 723
           P     + NEAP
Sbjct: 171 PVVPIGDANEAP 182

>KLLA0A10329g Chr1 (903873..905792) [1920 bp, 639 aa] {ON} conserved
           hypothetical protein
          Length = 639

 Score = 38.9 bits (89), Expect = 0.097
 Identities = 15/39 (38%), Positives = 20/39 (51%)
 Frame = +1

Query: 205 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKL 321
           R    C +C+S K +CD  +P C  C   GF+C  S  L
Sbjct: 12  RSYMGCQKCKSLKKKCDEVKPHCGYCKKRGFQCDYSRTL 50

>ZYRO0A13596g Chr1 complement(1080653..1082599) [1947 bp, 648 aa]
           {ON} similar to gnl|GLV|KLLA0D10153g Kluyveromyces
           lactis KLLA0D10153g and weakly similar to uniprot|P35995
           Saccharomyces cerevisiae YKL222C Hypothetical ORF
          Length = 648

 Score = 38.9 bits (89), Expect = 0.098
 Identities = 14/37 (37%), Positives = 22/37 (59%)
 Frame = +1

Query: 211 AQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKL 321
           ++ C  C+ KK RCD K P C+ C+  G+ C  + K+
Sbjct: 8   SKTCTNCQRKKVRCDRKVPACTACSERGYNCIYNVKI 44

>KAFR0A02130 Chr1 (447063..449186) [2124 bp, 707 aa] {ON} Anc_2.565
           YMR019W
          Length = 707

 Score = 38.9 bits (89), Expect = 0.100
 Identities = 16/43 (37%), Positives = 24/43 (55%)
 Frame = +1

Query: 175 VTSATPTSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 303
           ++ +T     RV +ACD C+ +K +CDG  P CS C     +C
Sbjct: 1   MSKSTTKQRLRVQKACDICKRRKVKCDGLSP-CSNCIRHNVDC 42

>ZYRO0G22550g Chr7 complement(1856064..1858238) [2175 bp, 724 aa]
           {ON} weakly similar to uniprot|P39961 Saccharomyces
           cerevisiae YER184C Hypothetical ORF
          Length = 724

 Score = 38.9 bits (89), Expect = 0.10
 Identities = 17/37 (45%), Positives = 22/37 (59%)
 Frame = +1

Query: 205 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSD 315
           +V +AC  CR +K RCDG  P CS C ++  EC   D
Sbjct: 8   KVKRACQICRRRKIRCDGYLP-CSSCVSLKKECNYHD 43

>Kpol_1061.11 s1061 complement(31679..33880) [2202 bp, 733 aa] {ON}
           complement(31679..33880) [2202 nt, 734 aa]
          Length = 733

 Score = 38.9 bits (89), Expect = 0.10
 Identities = 22/69 (31%), Positives = 35/69 (50%), Gaps = 11/69 (15%)
 Frame = +1

Query: 130 TNNSAAPN--AARSISPVTSATPT---SNYRVAQ------ACDRCRSKKTRCDGKRPQCS 276
           + N+++PN   A S+ P TS T T   S   V +       C  C+ ++ +CD  +P C 
Sbjct: 78  STNASSPNDYIAPSLKPKTSVTSTIKDSKGNVVKRKYSRNGCAECKRRRMKCDETKPTCW 137

Query: 277 QCAAVGFEC 303
           QC+ +  EC
Sbjct: 138 QCSRLNREC 146

>KLTH0A03498g Chr1 complement(301696..303915) [2220 bp, 739 aa] {ON}
           weakly similar to uniprot|Q6B2M3 Saccharomyces
           cerevisiae YOR172W YRM1 Zn2-Cys6 zinc-finger
           transcription factor that activates genes involved in
           multidrug resistance paralog of Yrr1p acting on an
           overlapping set of target genes
          Length = 739

 Score = 38.9 bits (89), Expect = 0.10
 Identities = 20/57 (35%), Positives = 29/57 (50%), Gaps = 1/57 (1%)
 Frame = +1

Query: 157 ARSISPVTSATPTSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGF-ECKVSDKLS 324
           A SI    +A      ++ ++C  CR +K +CD KRP+C  C A    EC   D L+
Sbjct: 7   AASIIDNDAAVRRRRRKIIKSCTFCRQRKLKCDHKRPKCGSCLARKLPECIYLDTLN 63

>TBLA0A05860 Chr1 (1449582..1452014) [2433 bp, 810 aa] {ON} 
          Length = 810

 Score = 38.9 bits (89), Expect = 0.10
 Identities = 25/71 (35%), Positives = 33/71 (46%), Gaps = 5/71 (7%)
 Frame = +1

Query: 145 APNAARSIS--PVTSATPT-SNY--RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKV 309
           AP+ + + S  P  S  P  +N+  R  Q CDRCR  K +C G   QC+ C      C  
Sbjct: 13  APHVSTNSSEQPAQSGPPDPANWESRRDQVCDRCRKLKKKCYGLGRQCNNCQLSNNPCTT 72

Query: 310 SDKLSRRAFPR 342
              L RR  P+
Sbjct: 73  MATLKRRRKPK 83

>TPHA0H01240 Chr8 (274496..277129) [2634 bp, 877 aa] {ON} Anc_5.59
           YHR178W
          Length = 877

 Score = 38.9 bits (89), Expect = 0.10
 Identities = 15/39 (38%), Positives = 23/39 (58%)
 Frame = +1

Query: 217 ACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRA 333
           +C RCR  K +C  + P+CS C A  + C+   +L RR+
Sbjct: 97  SCSRCRRLKKKCLRQMPKCSNCVASHYACEYIGRLPRRS 135

>Ecym_8404 Chr8 complement(834988..837645) [2658 bp, 885 aa] {ON}
            similar to Ashbya gossypii ACL058W
          Length = 885

 Score = 38.9 bits (89), Expect = 0.10
 Identities = 24/72 (33%), Positives = 39/72 (54%)
 Frame = +1

Query: 1519 MAQQLRLHRCPSAVLGTEGSTMSKSEQGDRRLLFWGIYYLDVFGALQLGVPRLLKDHEIE 1698
            +AQ+++L   P +  G     + +S    RR+LFW I+YLD   +L   +P L+K  E +
Sbjct: 326  LAQKIQLTLDPVSYHGMTDQALIRS----RRILFWQIFYLDTITSLHNNLPPLIKPGEFD 381

Query: 1699 CALPISEHAHAG 1734
              L ++E  H G
Sbjct: 382  TVL-MTELDHNG 392

 Score = 36.6 bits (83), Expect = 0.53
 Identities = 15/38 (39%), Positives = 21/38 (55%), Gaps = 2/38 (5%)
 Frame = +1

Query: 220 CDRCRSKKTRCDGKRPQCSQCAAVGFECK--VSDKLSR 327
           C  C  +K +C  +RP C  C    FEC   V+D++SR
Sbjct: 38  CMPCHKRKVKCSRERPSCDNCLRNSFECVYFVNDRVSR 75

>TBLA0G00510 Chr7 (104797..107604) [2808 bp, 935 aa] {ON} Anc_6.60
           YLR266C
          Length = 935

 Score = 38.9 bits (89), Expect = 0.11
 Identities = 19/46 (41%), Positives = 23/46 (50%), Gaps = 1/46 (2%)
 Frame = +1

Query: 181 SATPTSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGF-ECKVSD 315
           S T      + + C  CR KK +CD +RP CS C A  F EC   D
Sbjct: 69  SGTRKKRKTIIKTCLFCREKKLKCDKRRPLCSSCIARNFTECVYVD 114

>YKL015W Chr11 (408544..411483) [2940 bp, 979 aa] {ON}
            PUT3Transcriptional activator of proline utilization
            genes, constitutively binds PUT1 and PUT2 promoter
            sequences as a dimer and undergoes a conformational
            change to form the active state; differentially
            phosphorylated in the presence of different nitrogen
            sources; has a Zn(2)-Cys(6) binuclear cluster domain
          Length = 979

 Score = 38.9 bits (89), Expect = 0.11
 Identities = 36/155 (23%), Positives = 70/155 (45%), Gaps = 5/155 (3%)
 Frame = +1

Query: 1567 TEGSTMSKSEQGDRRLLFWGIYYLDVFGALQLGVPRLLKDHEIECALPISEHAHAGVSLA 1746
            ++  T+S+ E    R L+W +Y  +   + + G+P    D+ I  ALP          + 
Sbjct: 500  SQSDTLSRYEIEHHRRLWWTVYMFERMLSSKAGLPLSFTDYTISTALP--------ADID 551

Query: 1747 DQVIKLEG-----QVSELSLSLLRFSKILGNILDSIFKRGMTSSAAQQVALIHENALDNW 1911
            D+ I+ +      + +EL  + +   KI   IL  +++R   ++    + ++ +  L+ W
Sbjct: 552  DETIEEKNSHYVFRKAELISNCVTIVKINAQILSKLYQRQPETNIIITLKVVIKQLLE-W 610

Query: 1912 RRGLPKNLTFELDVNGTIKIEELTGSAQNNQDFTK 2016
            R     NL+  L V+ T K E+   S  +   FT+
Sbjct: 611  R----NNLSDSLQVDFTQKDEDFKISRLSTNMFTE 641

>Suva_8.421 Chr8 complement(757924..760932) [3009 bp, 1002 aa] {ON}
           YOR363C (REAL)
          Length = 1002

 Score = 38.9 bits (89), Expect = 0.11
 Identities = 14/45 (31%), Positives = 23/45 (51%)
 Frame = +1

Query: 169 SPVTSATPTSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 303
           SP  ++      R++  C  CR  KT+CD ++P+C +C      C
Sbjct: 8   SPTMNSIGKKRNRLSFVCQACRKAKTKCDQEKPRCGRCTKQNLFC 52

>SAKL0D07898g Chr4 complement(653332..657066) [3735 bp, 1244 aa]
           {ON} similar to uniprot|P12351 Saccharomyces cerevisiae
           YLR256W HAP1
          Length = 1244

 Score = 38.9 bits (89), Expect = 0.11
 Identities = 15/40 (37%), Positives = 21/40 (52%)
 Frame = +1

Query: 175 VTSATPTSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVG 294
           ++S       RV  +C  CR +K +CD  RP C QC+  G
Sbjct: 1   MSSQVKRKRNRVPLSCTICRKRKVKCDKTRPHCQQCSKTG 40

>Smik_16.20 Chr16 complement(26236..27657) [1422 bp, 473 aa] {ON}
           YGR288W (REAL)
          Length = 473

 Score = 38.5 bits (88), Expect = 0.12
 Identities = 16/32 (50%), Positives = 19/32 (59%)
 Frame = +1

Query: 208 VAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 303
           V QACD CR ++ +CD KRP CS C      C
Sbjct: 9   VKQACDCCRVRRVKCDSKRP-CSSCLQNNLSC 39

>TBLA0H00720 Chr8 (157413..159269) [1857 bp, 618 aa] {ON} Anc_8.416
           YDR207C
          Length = 618

 Score = 38.5 bits (88), Expect = 0.13
 Identities = 20/54 (37%), Positives = 25/54 (46%), Gaps = 7/54 (12%)
 Frame = +1

Query: 163 SISPVTSATPTS-------NYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 303
           S S  T+ATPTS       N R    C  CR +K +C  +RP C  C  +   C
Sbjct: 453 SPSATTTATPTSSDKKQTHNTRSRNGCWICRLRKKKCTEERPNCYNCQRLNLNC 506

>Kwal_8.580 s8 (13266..15182) [1917 bp, 638 aa] {ON} [contig 311]
           FULL
          Length = 638

 Score = 38.5 bits (88), Expect = 0.13
 Identities = 17/42 (40%), Positives = 23/42 (54%), Gaps = 1/42 (2%)
 Frame = +1

Query: 208 VAQACDRCRSKKTRCDGKRPQCSQCAAVG-FECKVSDKLSRR 330
           V++ACD CR +K +C G  P C  C+  G  +C  S    RR
Sbjct: 13  VSKACDNCRLRKAKCSGDLPVCRNCSTAGTIKCTYSLADKRR 54

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.132    0.387 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 323,878,762
Number of extensions: 6941067
Number of successful extensions: 21979
Number of sequences better than 10.0: 669
Number of HSP's gapped: 21709
Number of HSP's successfully gapped: 744
Length of query: 1210
Length of database: 53,481,399
Length adjustment: 121
Effective length of query: 1089
Effective length of database: 39,606,813
Effective search space: 43131819357
Effective search space used: 43131819357
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 35 (18.1 bits)