Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_27.102328.845ON1209120954830.0
KLTH0C03762g8.845ON1206121038910.0
SAKL0D01342g8.845ON1270129928240.0
ABL121C8.845ON1285133123120.0
TDEL0B005308.845ON1301120422680.0
KLLA0D01452g8.845ON1445131221300.0
ZYRO0G14278g8.845ON1250118720780.0
Suva_13.4688.845ON141894515770.0
YMR280C (CAT8)8.845ON143395315630.0
Smik_13.4938.845ON143394415520.0
NCAS0C003908.845ON116494015210.0
Skud_13.4528.845ON143294615310.0
Ecym_46168.845ON157773914890.0
KNAG0J002508.845ON123794114401e-178
KAFR0B039508.845ON124677913861e-170
CAGL0M03025g8.845ON125495713011e-157
NDAI0K003908.845ON149570611911e-140
Kpol_1016.201.277ON1086692231e-17
KAFR0A014801.277ON725582113e-16
AFR096W1.277ON852482088e-16
Smik_10.1531.277ON829572052e-15
TPHA0I028201.277ON1044502052e-15
ZYRO0G15136g1.277ON1027482052e-15
KLLA0F14322g1.277ON717662042e-15
Suva_6.1611.277ON832562042e-15
KLTH0D03564g1.277ON862482033e-15
Ecym_63401.277ON952482033e-15
SAKL0D05654g1.277ON919482024e-15
YJL089W (SIP4)1.277ON829482008e-15
Kwal_26.7397singletonOFF201621851e-14
Skud_10.1251.277ON833481981e-14
TDEL0D014501.277ON945641963e-14
CAGL0L03377g1.277ON1209481919e-14
NDAI0G055301.277ON1186481901e-13
KNAG0B018401.277ON1072491864e-13
TBLA0D054201.277ON757551801e-12
NCAS0A094101.277ON932451579e-10
KLLA0C10923g5.235ON775581301e-06
KLLA0E13993gsingletonON678441273e-06
TBLA0G026102.231ON1000421264e-06
NCAS0D025405.235ON890661238e-06
TPHA0F013802.231ON890461212e-05
SAKL0C02024gsingletonON898481212e-05
NDAI0F012206.279ON960511212e-05
SAKL0G11902g5.235ON906481202e-05
KLLA0F04609g2.231ON916331202e-05
YPL248C (GAL4)6.279ON881471202e-05
Smik_6.4526.279ON878471202e-05
Kpol_1018.306.279ON881511192e-05
KNAG0D006906.279ON875511193e-05
NCAS0D041906.279ON890451184e-05
NDAI0A087907.17ON1059341184e-05
ZYRO0E08272g6.279ON794471184e-05
KAFR0J017102.231ON848331184e-05
NCAS0B065502.231ON906331174e-05
KLTH0E08778gna 1ON8731981174e-05
NDAI0B038502.231ON930411175e-05
Smik_9.392.231ON1012331175e-05
Skud_9.372.231ON954451175e-05
YIL130W (ASG1)2.231ON964331166e-05
KNAG0B051205.235ON888441166e-05
Suva_9.592.231ON926331166e-05
Ecym_7440na 2ON898421166e-05
TDEL0C044802.231ON852411167e-05
NCAS0G011006.279ON935451167e-05
Kwal_47.17681na 1ON8541981157e-05
Kpol_495.213.109ON1085511158e-05
KLTH0G09108g2.231ON782331158e-05
CAGL0G08844g2.231ON847411158e-05
SAKL0E08998g2.231ON823411158e-05
Kwal_23.47542.231ON812331158e-05
SAKL0A02860g6.279ON745451149e-05
KNAG0E017602.231ON902331149e-05
KLTH0G07898g5.235ON866781141e-04
KLLA0A02585gna 3ON370551131e-04
Kpol_1039.112.231ON992331141e-04
NDAI0I023505.235ON889441141e-04
YOR380W (RDR1)na 4ON546581131e-04
KLTH0D07260g2.547ON979501141e-04
KAFR0J006905.235ON864441131e-04
Suva_10.945.235ON906711132e-04
KAFR0F014901.128ON658601122e-04
Suva_16.596.279ON895451122e-04
Kwal_23.29055.235ON881481122e-04
TPHA0H019806.279ON993471122e-04
KLTH0D02222gna 5ON847501122e-04
KLTH0E14454gna 2ON902451112e-04
TDEL0E039105.235ON862441112e-04
SAKL0H24860gna 6ON971651112e-04
TBLA0G018006.279ON1154451113e-04
TDEL0E00160singletonON631471103e-04
ZYRO0A10956g5.235ON855441103e-04
Smik_1.137.17ON1046631103e-04
NDAI0I007406.279ON1033471104e-04
KNAG0E002107.17ON948331094e-04
ZYRO0E06270g2.565ON912461094e-04
Skud_12.825.235ON899751094e-04
KLTH0H16170gna 7ON619371084e-04
CAGL0M12298g7.17ON994461094e-04
TPHA0N002307.17ON1232331095e-04
Smik_2.438na 8ON469421085e-04
Smik_12.775.235ON903441085e-04
SAKL0C03938g1.128ON780331085e-04
TDEL0C056801.128ON691501085e-04
YBR297W (MAL33)na 8ON468421076e-04
KAFR0C049807.17ON951411086e-04
CAGL0A00451g4.113ON1107681086e-04
SAKL0C09944g3.109ON1061621077e-04
SAKL0B06732gna 2ON878451077e-04
KAFR0F010406.279ON834471077e-04
KAFR0F034104.113ON995371077e-04
Skud_15.546na 4ON542591067e-04
YLR014C (PPR1)5.235ON904441077e-04
SAKL0D14542gna 9ON946441078e-04
Skud_1.107.17ON1040751078e-04
Suva_6.2851.128ON7862091068e-04
SAKL0B04620gna 3ON362411059e-04
AER370W2.231ON801331060.001
YJL206C1.128ON7582131060.001
TBLA0A012101.380ON1422301060.001
Smik_18.8singletonON775381060.001
YAL051W (OAF1)7.17ON1047631060.001
AER183Cna 2ON879691050.001
Ecym_53972.231ON826331050.001
SAKL0A09856g2.547ON1020501050.001
TBLA0D006307.389ON1077591050.001
KLTH0B00352gsingletonON934431050.001
Suva_1.147.17ON1045461050.001
NCAS0I002707.17ON944421040.001
NDAI0D00900singletonON865331040.002
ADR403C7.17ON970461040.002
KAFR0I002307.17ON1045331040.002
Skud_15.5327.17ON1000591040.002
ZYRO0C18150g1.128ON571381030.002
Kpol_538.427.17ON1088421040.002
KLTH0H02684g6.279ON749451030.002
SAKL0D14520g7.17ON983331030.002
SAKL0A00704gna 10ON718461030.002
SAKL0H00682gna 11ON922461030.002
CAGL0J07150g7.17ON1022431030.002
TBLA0C040504.113ON1207361030.002
ZYRO0C00726g7.17ON1035461030.002
CAGL0I07755g3.109ON1053571030.002
KLLA0D12672g6.279ON865451030.002
TDEL0H043407.17ON989471030.002
Ecym_50177.17ON978461030.002
Suva_8.436na 4ON545431020.003
KAFR0C03730singletonON791501020.003
NDAI0G052601.380ON1581601030.003
TPHA0A045403.109ON1178371020.003
NDAI0F00110singletonON508331010.003
TDEL0D036103.264ON724561020.003
TBLA0E007007.17ON1274481020.003
TDEL0D051503.109ON996471010.003
Skud_11.1902.547ON1171771010.003
SAKL0D00264g8.879ON848411010.004
SAKL0D01100g4.113ON940391010.004
Skud_2.427na 8ON468391000.004
TBLA0G011308.879ON1132381010.004
Suva_15.773.109ON1029471010.004
TPHA0A06090singletonON847331000.004
KLLA0F22990g1.380ON1253301010.004
YGL013C (PDR1)4.113ON1068381000.005
Smik_15.561na 4ON54638990.005
TBLA0C062306.60ON795331000.005
Kwal_26.81092.547ON970501000.005
Smik_17.27singletonON68833990.006
KNAG0E041507.17ON113646990.006
KAFR0B014502.547ON108878990.006
YOR363C (PIP2)7.17ON99659990.006
KAFR0I020301.380ON123341990.007
KLLA0F09559gsingletonON65838980.007
NDAI0H019907.17ON116133990.007
NCAS0A035804.113ON111337990.007
KLLA0C14212gna 11ON104036980.007
Smik_7.2774.113ON106938980.008
Smik_2.3836.154ON44849970.008
CAGL0K05841g1.380ON137230980.008
Skud_7.2744.113ON108038980.008
KLLA0A09119g4.113ON108261980.008
TBLA0A097606.75ON153043980.008
NCAS0D04860singletonON70139980.009
Smik_13.1832.565ON91146980.009
NCAS0A03070singletonON65633970.009
Kwal_26.68057.17ON94450980.009
AFL160C6.279ON64847970.010
KLLA0D10153gsingletonON65538970.010
Ecym_2522na 10ON92634970.010
CAGL0B03421g1.380ON135530970.010
NCAS0C002208.879ON83929970.010
KLLA0A10329gna 12ON63939970.010
CAGL0F07909g3.109ON104936970.010
TBLA0A058601.128aON81046970.011
AFR117C1.380ON115242970.011
Kpol_467.11.380ON128930970.011
Skud_15.643.109ON103239970.012
KNAG0I014501.380ON147630970.012
ZYRO0G22550gsingletonON72437960.012
SAKL0H00616gna 13ON726179960.012
CAGL0F09229gna 14ON83533970.012
Ecym_8404na 6ON88572970.012
NCAS0A076107.17ON102233970.012
KAFR0A021302.565ON70757960.012
Ecym_27321.380ON119830970.013
KLLA0C18953gna 15ON703161960.013
Smik_10.251.128ON772210960.014
Kwal_34.15751na 7ON62833960.014
YGR288W (MAL13)na 16ON47330950.014
Suva_8.4217.17ON100259960.014
KLLA0F19602g8.283ON60340960.014
TPHA0H012405.59ON87739960.014
Skud_2.3726.154ON45249950.014
Skud_3.181singletonON83150960.015
NCAS0C027308.423ON77539960.015
NCAS0A088401.380ON147830960.015
NDAI0D035504.113ON111842960.015
KNAG0A02300singletonON72931960.015
Kwal_YGOB_0.1391.380ON124040960.015
Klac_YGOB_39601.128aON81037960.016
CAGL0F07865g8.423ON84450950.016
Skud_10.101.128ON833208950.016
SAKL0D07898g1.380ON124430960.017
YLR266C (PDR8)6.60ON70151950.017
TBLA0E034803.109ON104676950.017
TBLA0G005106.60ON93546950.017
ADR404Cna 9ON87537950.018
Smik_11.2102.547ON116977950.018
TDEL0D00260singletonON647114950.019
TPHA0B036301.380ON142932950.019
KNAG0A025508.423ON73038950.019
SAKL0B01870gsingletonON100947950.019
KNAG0A071002.547ON128650950.019
KLTH0H11572g1.380ON123730950.019
KLLA0F02750g3.109ON114836950.020
Kwal_26.7095na 5ON83851950.020
KLLA0A03421gna 9ON88034950.020
TDEL0B004808.879ON83541950.021
TBLA0G00490singletonON91838950.021
Skud_9.220singletonON79335950.021
Skud_7.638singletonON47339940.021
NCAS0A047502.547ON114167950.021
YLR256W (HAP1)1.380ON150230950.022
Kpol_538.528.879ON90738940.022
Ecym_22636.154ON50861940.022
Kpol_260.25.59ON75641940.022
KLLA0A03443g7.17ON97533940.024
KLLA0F25630g2.547ON100769940.024
ZYRO0G19338gna 17ON65329940.024
NCAS0H00780singletonON90938940.024
YBR240C (THI2)6.154ON45048930.024
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_27.10232
         (1209 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_27.10232 s27 (251015..254644) [3630 bp, 1209 aa] {ON} YMR28...  2116   0.0  
KLTH0C03762g Chr3 (324666..328286) [3621 bp, 1206 aa] {ON} simil...  1503   0.0  
SAKL0D01342g Chr4 (101095..104907) [3813 bp, 1270 aa] {ON} simil...  1092   0.0  
ABL121C Chr2 complement(170782..174639) [3858 bp, 1285 aa] {ON} ...   895   0.0  
TDEL0B00530 Chr2 (95898..99803) [3906 bp, 1301 aa] {ON} Anc_8.84...   878   0.0  
KLLA0D01452g Chr4 (124018..128355) [4338 bp, 1445 aa] {ON} simil...   825   0.0  
ZYRO0G14278g Chr7 complement(1141297..1145049) [3753 bp, 1250 aa...   805   0.0  
Suva_13.468 Chr13 complement(809712..812654,812694..814007) [425...   612   0.0  
YMR280C Chr13 complement(827028..831329) [4302 bp, 1433 aa] {ON}...   606   0.0  
Smik_13.493 Chr13 complement(810035..814336) [4302 bp, 1433 aa] ...   602   0.0  
NCAS0C00390 Chr3 (57333..60827) [3495 bp, 1164 aa] {ON} Anc_8.845     590   0.0  
Skud_13.452 Chr13 complement(800289..804587) [4299 bp, 1432 aa] ...   594   0.0  
Ecym_4616 Chr4 complement(1204091..1208824) [4734 bp, 1577 aa] {...   578   0.0  
KNAG0J00250 Chr10 (33322..37035) [3714 bp, 1237 aa] {ON} Anc_8.8...   559   e-178
KAFR0B03950 Chr2 complement(823760..827500) [3741 bp, 1246 aa] {...   538   e-170
CAGL0M03025g Chr13 complement(341849..345613) [3765 bp, 1254 aa]...   505   e-157
NDAI0K00390 Chr11 (84641..89128) [4488 bp, 1495 aa] {ON} Anc_8.845    463   e-140
Kpol_1016.20 s1016 (51828..55088) [3261 bp, 1086 aa] {ON} (51828...    91   1e-17
KAFR0A01480 Chr1 (294040..296217) [2178 bp, 725 aa] {ON} Anc_1.2...    86   3e-16
AFR096W Chr6 (606993..609551) [2559 bp, 852 aa] {ON} Syntenic ho...    85   8e-16
Smik_10.153 Chr10 (257677..260166) [2490 bp, 829 aa] {ON} YJL089...    84   2e-15
TPHA0I02820 Chr9 complement(620925..624059) [3135 bp, 1044 aa] {...    84   2e-15
ZYRO0G15136g Chr7 complement(1218989..1222072) [3084 bp, 1027 aa...    84   2e-15
KLLA0F14322g Chr6 (1328925..1331078) [2154 bp, 717 aa] {ON} unip...    83   2e-15
Suva_6.161 Chr6 complement(283370..284500,284547..284764,284948....    83   2e-15
KLTH0D03564g Chr4 (343546..346134) [2589 bp, 862 aa] {ON} weakly...    83   3e-15
Ecym_6340 Chr6 complement(652943..655801) [2859 bp, 952 aa] {ON}...    83   3e-15
SAKL0D05654g Chr4 (457485..460244) [2760 bp, 919 aa] {ON} weakly...    82   4e-15
YJL089W Chr10 (265926..268415) [2490 bp, 829 aa] {ON}  SIP4C6 zi...    82   8e-15
Kwal_26.7397 s26 complement(342483..343085) [603 bp, 201 aa] {OF...    76   1e-14
Skud_10.125 Chr10 (233921..236422) [2502 bp, 833 aa] {ON} YJL089...    81   1e-14
TDEL0D01450 Chr4 (284869..287706) [2838 bp, 945 aa] {ON} Anc_1.2...    80   3e-14
CAGL0L03377g Chr12 complement(384929..388558) [3630 bp, 1209 aa]...    78   9e-14
NDAI0G05530 Chr7 (1360413..1363973) [3561 bp, 1186 aa] {ON}            78   1e-13
KNAG0B01840 Chr2 (345204..348422) [3219 bp, 1072 aa] {ON} Anc_1....    76   4e-13
TBLA0D05420 Chr4 complement(1334955..1337228) [2274 bp, 757 aa] ...    74   1e-12
NCAS0A09410 Chr1 complement(1865924..1868722) [2799 bp, 932 aa] ...    65   9e-10
KLLA0C10923g Chr3 complement(939148..941475) [2328 bp, 775 aa] {...    55   1e-06
KLLA0E13993g Chr5 complement(1239566..1241602) [2037 bp, 678 aa]...    54   3e-06
TBLA0G02610 Chr7 complement(689843..692845) [3003 bp, 1000 aa] {...    53   4e-06
NCAS0D02540 Chr4 complement(484060..486732) [2673 bp, 890 aa] {O...    52   8e-06
TPHA0F01380 Chr6 complement(318207..320879) [2673 bp, 890 aa] {O...    51   2e-05
SAKL0C02024g Chr3 complement(174858..177554) [2697 bp, 898 aa] {...    51   2e-05
NDAI0F01220 Chr6 complement(295418..298300) [2883 bp, 960 aa] {O...    51   2e-05
SAKL0G11902g Chr7 (1016915..1019635) [2721 bp, 906 aa] {ON} simi...    51   2e-05
KLLA0F04609g Chr6 complement(451579..454329) [2751 bp, 916 aa] {...    51   2e-05
YPL248C Chr16 complement(79711..82356) [2646 bp, 881 aa] {ON}  G...    51   2e-05
Smik_6.452 Chr6 (741922..744558) [2637 bp, 878 aa] {ON} YPL248C ...    51   2e-05
Kpol_1018.30 s1018 complement(81534..83840,83842..84180) [2646 b...    50   2e-05
KNAG0D00690 Chr4 (105640..108267) [2628 bp, 875 aa] {ON} Anc_6.2...    50   3e-05
NCAS0D04190 Chr4 (793242..795914) [2673 bp, 890 aa] {ON} Anc_6.279     50   4e-05
NDAI0A08790 Chr1 complement(2026171..2029350) [3180 bp, 1059 aa]...    50   4e-05
ZYRO0E08272g Chr5 (651705..654089) [2385 bp, 794 aa] {ON} simila...    50   4e-05
KAFR0J01710 Chr10 complement(327570..330116) [2547 bp, 848 aa] {...    50   4e-05
NCAS0B06550 Chr2 complement(1242371..1245091) [2721 bp, 906 aa] ...    50   4e-05
KLTH0E08778g Chr5 complement(795841..798462) [2622 bp, 873 aa] {...    50   4e-05
NDAI0B03850 Chr2 complement(970366..973158) [2793 bp, 930 aa] {O...    50   5e-05
Smik_9.39 Chr9 (80510..83548) [3039 bp, 1012 aa] {ON} YIL130W (R...    50   5e-05
Skud_9.37 Chr9 (79947..82811) [2865 bp, 954 aa] {ON} YIL130W (REAL)    50   5e-05
YIL130W Chr9 (102782..105676) [2895 bp, 964 aa] {ON}  ASG1Zinc c...    49   6e-05
KNAG0B05120 Chr2 (982236..984902) [2667 bp, 888 aa] {ON}               49   6e-05
Suva_9.59 Chr9 (97521..100298) [2778 bp, 926 aa] {ON} YIL130W (R...    49   6e-05
Ecym_7440 Chr7 complement(902108..904804) [2697 bp, 898 aa] {ON}...    49   6e-05
TDEL0C04480 Chr3 (799022..801580) [2559 bp, 852 aa] {ON} Anc_2.2...    49   7e-05
NCAS0G01100 Chr7 complement(193052..195859) [2808 bp, 935 aa] {O...    49   7e-05
Kwal_47.17681 s47 complement(513119..515683) [2565 bp, 854 aa] {...    49   7e-05
Kpol_495.21 s495 (71447..74704) [3258 bp, 1085 aa] {ON} (71447.....    49   8e-05
KLTH0G09108g Chr7 (744062..746410) [2349 bp, 782 aa] {ON} weakly...    49   8e-05
CAGL0G08844g Chr7 complement(846590..849133) [2544 bp, 847 aa] {...    49   8e-05
SAKL0E08998g Chr5 complement(747085..749556) [2472 bp, 823 aa] {...    49   8e-05
Kwal_23.4754 s23 (845550..847988) [2439 bp, 812 aa] {ON} YIL130W...    49   8e-05
SAKL0A02860g Chr1 complement(259388..261625) [2238 bp, 745 aa] {...    49   9e-05
KNAG0E01760 Chr5 (350254..352962) [2709 bp, 902 aa] {ON} Anc_2.2...    49   9e-05
KLTH0G07898g Chr7 (636890..639490) [2601 bp, 866 aa] {ON} simila...    49   1e-04
KLLA0A02585g Chr1 complement(226562..227674) [1113 bp, 370 aa] {...    48   1e-04
Kpol_1039.11 s1039 (29727..32705) [2979 bp, 992 aa] {ON} (29727....    49   1e-04
NDAI0I02350 Chr9 (536448..539117) [2670 bp, 889 aa] {ON} Anc_5.235     49   1e-04
YOR380W Chr15 (1051290..1052930) [1641 bp, 546 aa] {ON}  RDR1Tra...    48   1e-04
KLTH0D07260g Chr4 complement(635598..638537) [2940 bp, 979 aa] {...    49   1e-04
KAFR0J00690 Chr10 (124449..127043) [2595 bp, 864 aa] {ON} Anc_5....    48   1e-04
Suva_10.94 Chr10 complement(178366..181086) [2721 bp, 906 aa] {O...    48   2e-04
KAFR0F01490 Chr6 complement(290988..292964) [1977 bp, 658 aa] {O...    48   2e-04
Suva_16.59 Chr16 complement(88631..91318) [2688 bp, 895 aa] {ON}...    48   2e-04
Kwal_23.2905 s23 (69235..71880) [2646 bp, 881 aa] {ON} YLR014C (...    48   2e-04
TPHA0H01980 Chr8 (467688..470669) [2982 bp, 993 aa] {ON} Anc_6.2...    48   2e-04
KLTH0D02222g Chr4 (220570..223113) [2544 bp, 847 aa] {ON} weakly...    48   2e-04
KLTH0E14454g Chr5 complement(1282704..1285412) [2709 bp, 902 aa]...    47   2e-04
TDEL0E03910 Chr5 (732533..735121) [2589 bp, 862 aa] {ON} Anc_5.2...    47   2e-04
SAKL0H24860g Chr8 complement(2162455..2165370) [2916 bp, 971 aa]...    47   2e-04
TBLA0G01800 Chr7 complement(469668..473132) [3465 bp, 1154 aa] {...    47   3e-04
TDEL0E00160 Chr5 (16083..17978) [1896 bp, 631 aa] {ON}                 47   3e-04
ZYRO0A10956g Chr1 (881429..883996) [2568 bp, 855 aa] {ON} simila...    47   3e-04
Smik_1.13 Chr1 (31514..34654) [3141 bp, 1046 aa] {ON} YAL051W (R...    47   3e-04
NDAI0I00740 Chr9 complement(160212..163313) [3102 bp, 1033 aa] {...    47   4e-04
KNAG0E00210 Chr5 (24545..27391) [2847 bp, 948 aa] {ON} Anc_7.17 ...    47   4e-04
ZYRO0E06270g Chr5 (475960..478698) [2739 bp, 912 aa] {ON} weakly...    47   4e-04
Skud_12.82 Chr12 complement(164119..166818) [2700 bp, 899 aa] {O...    47   4e-04
KLTH0H16170g Chr8 complement(1391996..1393855) [1860 bp, 619 aa]...    46   4e-04
CAGL0M12298g Chr13 complement(1227303..1230287) [2985 bp, 994 aa...    47   4e-04
TPHA0N00230 Chr14 (39855..43553) [3699 bp, 1232 aa] {ON} Anc_7.1...    47   5e-04
Smik_2.438 Chr2 (786437..787846) [1410 bp, 469 aa] {ON} YBR297W ...    46   5e-04
Smik_12.77 Chr12 complement(159125..161836) [2712 bp, 903 aa] {O...    46   5e-04
SAKL0C03938g Chr3 complement(377431..379773) [2343 bp, 780 aa] {...    46   5e-04
TDEL0C05680 Chr3 complement(1020646..1022721) [2076 bp, 691 aa] ...    46   5e-04
YBR297W Chr2 (800523..801929) [1407 bp, 468 aa] {ON}  MAL33MAL-a...    46   6e-04
KAFR0C04980 Chr3 (987900..990755) [2856 bp, 951 aa] {ON} Anc_7.1...    46   6e-04
CAGL0A00451g Chr1 (47557..50880) [3324 bp, 1107 aa] {ON} similar...    46   6e-04
SAKL0C09944g Chr3 complement(899127..902312) [3186 bp, 1061 aa] ...    46   7e-04
SAKL0B06732g Chr2 complement(578508..581144) [2637 bp, 878 aa] {...    46   7e-04
KAFR0F01040 Chr6 complement(195192..197696) [2505 bp, 834 aa] {O...    46   7e-04
KAFR0F03410 Chr6 complement(677156..680143) [2988 bp, 995 aa] {O...    46   7e-04
Skud_15.546 Chr15 (990335..991963) [1629 bp, 542 aa] {ON} YOR380...    45   7e-04
YLR014C Chr12 complement(172268..174982) [2715 bp, 904 aa] {ON} ...    46   7e-04
SAKL0D14542g Chr4 complement(1195951..1198791) [2841 bp, 946 aa]...    46   8e-04
Skud_1.10 Chr1 (24510..27632) [3123 bp, 1040 aa] {ON} YAL051W (R...    46   8e-04
Suva_6.285 Chr6 (499581..501941) [2361 bp, 786 aa] {ON} YJL206C ...    45   8e-04
SAKL0B04620g Chr2 complement(406622..407710) [1089 bp, 362 aa] {...    45   9e-04
AER370W Chr5 (1320487..1322892) [2406 bp, 801 aa] {ON} Syntenic ...    45   0.001
YJL206C Chr10 complement(47659..49935) [2277 bp, 758 aa] {ON} Pu...    45   0.001
TBLA0A01210 Chr1 (276151..280419) [4269 bp, 1422 aa] {ON} Anc_1....    45   0.001
Smik_18.8 Chr18 (12069..14396) [2328 bp, 775 aa] {ON} YOR172W (R...    45   0.001
YAL051W Chr1 (48564..51707) [3144 bp, 1047 aa] {ON}  OAF1Oleate-...    45   0.001
AER183C Chr5 complement(975879..978518) [2640 bp, 879 aa] {ON} N...    45   0.001
Ecym_5397 Chr5 (805712..808192) [2481 bp, 826 aa] {ON} similar t...    45   0.001
SAKL0A09856g Chr1 complement(867959..871021) [3063 bp, 1020 aa] ...    45   0.001
TBLA0D00630 Chr4 complement(164651..167884) [3234 bp, 1077 aa] {...    45   0.001
KLTH0B00352g Chr2 complement(31952..34756) [2805 bp, 934 aa] {ON...    45   0.001
Suva_1.14 Chr1 (25653..28790) [3138 bp, 1045 aa] {ON} YAL051W (R...    45   0.001
NCAS0I00270 Chr9 complement(33129..35963) [2835 bp, 944 aa] {ON}...    45   0.001
NDAI0D00900 Chr4 (205039..207636) [2598 bp, 865 aa] {ON}               45   0.002
ADR403C Chr4 complement(1429115..1432027) [2913 bp, 970 aa] {ON}...    45   0.002
KAFR0I00230 Chr9 (48095..51232) [3138 bp, 1045 aa] {ON} Anc_7.17...    45   0.002
Skud_15.532 Chr15 complement(959437..962439) [3003 bp, 1000 aa] ...    45   0.002
ZYRO0C18150g Chr3 (1418645..1420360) [1716 bp, 571 aa] {ON} some...    44   0.002
Kpol_538.42 s538 complement(89752..93018) [3267 bp, 1088 aa] {ON...    45   0.002
KLTH0H02684g Chr8 complement(235527..237776) [2250 bp, 749 aa] {...    44   0.002
SAKL0D14520g Chr4 complement(1192788..1195739) [2952 bp, 983 aa]...    44   0.002
SAKL0A00704g Chr1 complement(78811..80967) [2157 bp, 718 aa] {ON...    44   0.002
SAKL0H00682g Chr8 complement(81989..84757) [2769 bp, 922 aa] {ON...    44   0.002
CAGL0J07150g Chr10 complement(688858..691926) [3069 bp, 1022 aa]...    44   0.002
TBLA0C04050 Chr3 complement(980010..983633) [3624 bp, 1207 aa] {...    44   0.002
ZYRO0C00726g Chr3 (53977..57084) [3108 bp, 1035 aa] {ON} similar...    44   0.002
CAGL0I07755g Chr9 complement(745585..748746) [3162 bp, 1053 aa] ...    44   0.002
KLLA0D12672g Chr4 complement(1076011..1078608) [2598 bp, 865 aa]...    44   0.002
TDEL0H04340 Chr8 complement(746566..749535) [2970 bp, 989 aa] {O...    44   0.002
Ecym_5017 Chr5 (36647..39583) [2937 bp, 978 aa] {ON} similar to ...    44   0.002
Suva_8.436 Chr8 (788699..790336) [1638 bp, 545 aa] {ON} YOR380W ...    44   0.003
KAFR0C03730 Chr3 (759382..761757) [2376 bp, 791 aa] {ON}               44   0.003
NDAI0G05260 Chr7 (1277631..1282376) [4746 bp, 1581 aa] {ON} Anc_...    44   0.003
TPHA0A04540 Chr1 (1031790..1035326) [3537 bp, 1178 aa] {ON} Anc_...    44   0.003
NDAI0F00110 Chr6 (10745..12271) [1527 bp, 508 aa] {ON}                 44   0.003
TDEL0D03610 Chr4 (664819..666993) [2175 bp, 724 aa] {ON} Anc_3.2...    44   0.003
TBLA0E00700 Chr5 complement(138121..141945) [3825 bp, 1274 aa] {...    44   0.003
TDEL0D05150 Chr4 (932888..935878) [2991 bp, 996 aa] {ON} Anc_3.1...    44   0.003
Skud_11.190 Chr11 (345221..348736) [3516 bp, 1171 aa] {ON} YKL03...    44   0.003
SAKL0D00264g Chr4 complement(24754..27300) [2547 bp, 848 aa] {ON...    44   0.004
SAKL0D01100g Chr4 complement(81235..84057) [2823 bp, 940 aa] {ON...    44   0.004
Skud_2.427 Chr2 (769889..771295) [1407 bp, 468 aa] {ON} YGR288W ...    43   0.004
TBLA0G01130 Chr7 (287952..291350) [3399 bp, 1132 aa] {ON} Anc_8....    44   0.004
Suva_15.77 Chr15 complement(123654..126743) [3090 bp, 1029 aa] {...    44   0.004
TPHA0A06090 Chr1 complement(1372559..1375102) [2544 bp, 847 aa] ...    43   0.004
KLLA0F22990g Chr6 (2134385..2138146) [3762 bp, 1253 aa] {ON} uni...    44   0.004
YGL013C Chr7 complement(469092..472298) [3207 bp, 1068 aa] {ON} ...    43   0.005
Smik_15.561 Chr15 (997239..998879) [1641 bp, 546 aa] {ON} YOR380...    43   0.005
TBLA0C06230 Chr3 (1509702..1512089) [2388 bp, 795 aa] {ON} Anc_6...    43   0.005
Kwal_26.8109 s26 complement(650270..653182) [2913 bp, 970 aa] {O...    43   0.005
Smik_17.27 Chr17 complement(29476..31542) [2067 bp, 688 aa] {ON}...    43   0.006
KNAG0E04150 Chr5 complement(823063..826473) [3411 bp, 1136 aa] {...    43   0.006
KAFR0B01450 Chr2 (273614..276880) [3267 bp, 1088 aa] {ON} Anc_2....    43   0.006
YOR363C Chr15 complement(1020222..1023212) [2991 bp, 996 aa] {ON...    43   0.006
KAFR0I02030 Chr9 complement(416471..420172) [3702 bp, 1233 aa] {...    43   0.007
KLLA0F09559g Chr6 complement(876719..878695) [1977 bp, 658 aa] {...    42   0.007
NDAI0H01990 Chr8 complement(481983..485468) [3486 bp, 1161 aa] {...    43   0.007
NCAS0A03580 Chr1 complement(712039..715380) [3342 bp, 1113 aa] {...    43   0.007
KLLA0C14212g Chr3 complement(1229219..1232341) [3123 bp, 1040 aa...    42   0.007
Smik_7.277 Chr7 complement(461108..464317) [3210 bp, 1069 aa] {O...    42   0.008
Smik_2.383 Chr2 complement(686676..688022) [1347 bp, 448 aa] {ON...    42   0.008
CAGL0K05841g Chr11 (573144..577262) [4119 bp, 1372 aa] {ON} simi...    42   0.008
Skud_7.274 Chr7 complement(472171..475413) [3243 bp, 1080 aa] {O...    42   0.008
KLLA0A09119g Chr1 complement(797533..800781) [3249 bp, 1082 aa] ...    42   0.008
TBLA0A09760 Chr1 complement(2398683..2403275) [4593 bp, 1530 aa]...    42   0.008
NCAS0D04860 Chr4 (933920..936025) [2106 bp, 701 aa] {ON}               42   0.009
Smik_13.183 Chr13 (304049..304060,304064..306787) [2736 bp, 911 ...    42   0.009
NCAS0A03070 Chr1 (603639..605609) [1971 bp, 656 aa] {ON}               42   0.009
Kwal_26.6805 s26 (71596..74430) [2835 bp, 944 aa] {ON} YAL051W (...    42   0.009
AFL160C Chr6 complement(130842..132788) [1947 bp, 648 aa] {ON} S...    42   0.010
KLLA0D10153g Chr4 (858016..859983) [1968 bp, 655 aa] {ON} some s...    42   0.010
Ecym_2522 Chr2 (1017930..1020710) [2781 bp, 926 aa] {ON} similar...    42   0.010
CAGL0B03421g Chr2 complement(336071..340138) [4068 bp, 1355 aa] ...    42   0.010
NCAS0C00220 Chr3 (22532..25051) [2520 bp, 839 aa] {ON} Anc_8.879       42   0.010
KLLA0A10329g Chr1 (903873..905792) [1920 bp, 639 aa] {ON} conser...    42   0.010
CAGL0F07909g Chr6 (776659..779808) [3150 bp, 1049 aa] {ON} some ...    42   0.010
TBLA0A05860 Chr1 (1449582..1452014) [2433 bp, 810 aa] {ON}             42   0.011
AFR117C Chr6 complement(646829..650287) [3459 bp, 1152 aa] {ON} ...    42   0.011
Kpol_467.1 s467 (471..4340) [3870 bp, 1289 aa] {ON} (471..4340) ...    42   0.011
Skud_15.64 Chr15 complement(109746..112844) [3099 bp, 1032 aa] {...    42   0.012
KNAG0I01450 Chr9 (277513..281943) [4431 bp, 1476 aa] {ON}              42   0.012
ZYRO0G22550g Chr7 complement(1856064..1858238) [2175 bp, 724 aa]...    42   0.012
SAKL0H00616g Chr8 (73754..75934) [2181 bp, 726 aa] {ON} some sim...    42   0.012
CAGL0F09229g Chr6 complement(908186..910693) [2508 bp, 835 aa] {...    42   0.012
Ecym_8404 Chr8 complement(834988..837645) [2658 bp, 885 aa] {ON}...    42   0.012
NCAS0A07610 Chr1 complement(1512914..1515982) [3069 bp, 1022 aa]...    42   0.012
KAFR0A02130 Chr1 (447063..449186) [2124 bp, 707 aa] {ON} Anc_2.5...    42   0.012
Ecym_2732 Chr2 (1410290..1413886) [3597 bp, 1198 aa] {ON} simila...    42   0.013
KLLA0C18953g Chr3 (1682246..1684357) [2112 bp, 703 aa] {ON} some...    42   0.013
Smik_10.25 Chr10 complement(45977..48295) [2319 bp, 772 aa] {ON}...    42   0.014
Kwal_34.15751 s34 (40148..42034) [1887 bp, 628 aa] {ON} [contig ...    42   0.014
YGR288W Chr7 (1070293..1071714) [1422 bp, 473 aa] {ON}  MAL13MAL...    41   0.014
Suva_8.421 Chr8 complement(757924..760932) [3009 bp, 1002 aa] {O...    42   0.014
KLLA0F19602g Chr6 complement(1814949..1816760) [1812 bp, 603 aa]...    42   0.014
TPHA0H01240 Chr8 (274496..277129) [2634 bp, 877 aa] {ON} Anc_5.5...    42   0.014
Skud_2.372 Chr2 complement(669194..670552) [1359 bp, 452 aa] {ON...    41   0.014
Skud_3.181 Chr3 (293773..296268) [2496 bp, 831 aa] {ON} YCR106W ...    42   0.015
NCAS0C02730 Chr3 (513280..515607) [2328 bp, 775 aa] {ON} Anc_8.423     42   0.015
NCAS0A08840 Chr1 (1746841..1751277) [4437 bp, 1478 aa] {ON} Anc_...    42   0.015
NDAI0D03550 Chr4 complement(843265..846621) [3357 bp, 1118 aa] {...    42   0.015
KNAG0A02300 Chr1 (214177..216363) [2187 bp, 729 aa] {ON}  gene e...    42   0.015
Kwal_YGOB_0.139 s0 complement(61752..63560,63594..65507) [3723 b...    42   0.015
Klac_YGOB_3960 Chr3 (291786..293297,293300..294220) [2433 bp, 81...    42   0.016
CAGL0F07865g Chr6 complement(768270..770804) [2535 bp, 844 aa] {...    41   0.016
Skud_10.10 Chr10 complement(21672..24173) [2502 bp, 833 aa] {ON}...    41   0.016
SAKL0D07898g Chr4 complement(653332..657066) [3735 bp, 1244 aa] ...    42   0.017
YLR266C Chr12 complement(675619..677724) [2106 bp, 701 aa] {ON} ...    41   0.017
TBLA0E03480 Chr5 (865043..868183) [3141 bp, 1046 aa] {ON} Anc_3....    41   0.017
TBLA0G00510 Chr7 (104797..107604) [2808 bp, 935 aa] {ON} Anc_6.6...    41   0.017
ADR404C Chr4 complement(1432320..1434947) [2628 bp, 875 aa] {ON}...    41   0.018
Smik_11.210 Chr11 (352056..355565) [3510 bp, 1169 aa] {ON} YKL03...    41   0.018
TDEL0D00260 Chr4 complement(44685..46628) [1944 bp, 647 aa] {ON}       41   0.019
TPHA0B03630 Chr2 (844571..848860) [4290 bp, 1429 aa] {ON} Anc_1....    41   0.019
KNAG0A02550 Chr1 complement(262867..265059) [2193 bp, 730 aa] {O...    41   0.019
SAKL0B01870g Chr2 (185897..188926) [3030 bp, 1009 aa] {ON} weakl...    41   0.019
KNAG0A07100 Chr1 complement(1113008..1116868) [3861 bp, 1286 aa]...    41   0.019
KLTH0H11572g Chr8 complement(989095..992808) [3714 bp, 1237 aa] ...    41   0.019
KLLA0F02750g Chr6 complement(250368..253814) [3447 bp, 1148 aa] ...    41   0.020
Kwal_26.7095 s26 (211883..214399) [2517 bp, 838 aa] {ON} YOR363C...    41   0.020
KLLA0A03421g Chr1 (308414..311056) [2643 bp, 880 aa] {ON} weakly...    41   0.020
TDEL0B00480 Chr2 (83911..86418) [2508 bp, 835 aa] {ON} Anc_8.879...    41   0.021
TBLA0G00490 Chr7 (99344..102100) [2757 bp, 918 aa] {ON}                41   0.021
Skud_9.220 Chr9 complement(396576..398957) [2382 bp, 793 aa] {ON...    41   0.021
Skud_7.638 Chr7 (1060062..1061483) [1422 bp, 473 aa] {ON} YFL052...    41   0.021
NCAS0A04750 Chr1 (944929..948354) [3426 bp, 1141 aa] {ON} Anc_2....    41   0.021
YLR256W Chr12 (646415..650923) [4509 bp, 1502 aa] {ON}  HAP1Zinc...    41   0.022
Kpol_538.52 s538 (126243..128966) [2724 bp, 907 aa] {ON} (126243...    41   0.022
Ecym_2263 Chr2 (518089..519615) [1527 bp, 508 aa] {ON} similar t...    41   0.022
Kpol_260.2 s260 complement(3488..5758) [2271 bp, 756 aa] {ON} co...    41   0.022
KLLA0A03443g Chr1 (311628..314555) [2928 bp, 975 aa] {ON} simila...    41   0.024
KLLA0F25630g Chr6 (2378464..2381487) [3024 bp, 1007 aa] {ON} som...    41   0.024
ZYRO0G19338g Chr7 complement(1601895..1603856) [1962 bp, 653 aa]...    41   0.024
NCAS0H00780 Chr8 complement(140472..143201) [2730 bp, 909 aa] {O...    41   0.024
YBR240C Chr2 complement(700490..701842) [1353 bp, 450 aa] {ON}  ...    40   0.024
Kwal_0.142 s0 complement(63621..65507) [1887 bp, 629 aa] {OFF} Y...    41   0.025
NDAI0C04840 Chr3 (1117201..1120047) [2847 bp, 948 aa] {ON} Anc_8...    41   0.025
Suva_7.268 Chr7 complement(460629..463631) [3003 bp, 1000 aa] {O...    41   0.025
ZYRO0A13596g Chr1 complement(1080653..1082599) [1947 bp, 648 aa]...    41   0.025
KLLA0A06039g Chr1 (557368..559341) [1974 bp, 657 aa] {ON} weakly...    41   0.025
TDEL0A02690 Chr1 (485785..487953) [2169 bp, 722 aa] {ON}               41   0.026
YKL038W Chr11 (365605..369117) [3513 bp, 1170 aa] {ON}  RGT1Gluc...    41   0.026
ACL058W Chr3 (261723..264176) [2454 bp, 817 aa] {ON} NOHBY305; N...    41   0.027
Suva_13.186 Chr13 (302887..305571) [2685 bp, 894 aa] {ON} YMR019...    41   0.028
KLTH0E05786g Chr5 (517896..520349) [2454 bp, 817 aa] {ON} weakly...    40   0.028
Smik_12.327 Chr12 (590984..595495) [4512 bp, 1503 aa] {ON} YLR25...    40   0.031
TDEL0B06260 Chr2 (1104557..1108300) [3744 bp, 1247 aa] {ON} Anc_...    40   0.031
KNAG0M00120 Chr13 complement(12320..14965) [2646 bp, 881 aa] {ON}      40   0.031
NCAS0A01630 Chr1 complement(317259..320390) [3132 bp, 1043 aa] {...    40   0.031
Skud_5.331 Chr5 complement(543439..543951) [513 bp, 170 aa] {ON}...    39   0.031
Kwal_23.3122 s23 complement(166388..168754) [2367 bp, 788 aa] {O...    40   0.031
Smik_3.209 Chr3 (306620..309118) [2499 bp, 832 aa] {ON} YCR106W ...    40   0.031
Suva_11.187 Chr11 (348570..352085) [3516 bp, 1171 aa] {ON} YKL03...    40   0.031
Skud_12.335 Chr12 (592952..597391) [4440 bp, 1479 aa] {ON} YLR25...    40   0.032
NDAI0K00150 Chr11 complement(20792..23653) [2862 bp, 953 aa] {ON...    40   0.032
ZYRO0A00440g Chr1 complement(27895..30447) [2553 bp, 850 aa] {ON...    40   0.032
ZYRO0E05412g Chr5 (410945..414679) [3735 bp, 1244 aa] {ON} simil...    40   0.033
Suva_10.351 Chr10 (613486..614460) [975 bp, 324 aa] {ON} YLR256W...    40   0.033
Kpol_1061.11 s1061 complement(31679..33880) [2202 bp, 733 aa] {O...    40   0.034
NDAI0A03420 Chr1 complement(782010..785336) [3327 bp, 1108 aa] {...    40   0.034
Smik_16.20 Chr16 complement(26236..27657) [1422 bp, 473 aa] {ON}...    40   0.034
NDAI0E03460 Chr5 (742144..744993) [2850 bp, 949 aa] {ON} Anc_8.423     40   0.035
Suva_10.323 Chr10 complement(566314..568755) [2442 bp, 813 aa] {...    40   0.035
KAFR0E02330 Chr5 (468300..470414) [2115 bp, 704 aa] {ON} Anc_5.5...    40   0.035
TBLA0B04800 Chr2 complement(1127000..1129333) [2334 bp, 777 aa] ...    40   0.035
CAGL0L01903g Chr12 (220700..224563) [3864 bp, 1287 aa] {ON} simi...    40   0.036
KLLA0C03201g Chr3 complement(286973..288925) [1953 bp, 650 aa] {...    40   0.037
Smik_12.357 Chr12 complement(638342..642208) [3867 bp, 1288 aa] ...    40   0.038
Suva_10.364 Chr10 complement(637047..639170) [2124 bp, 707 aa] {...    40   0.039
TBLA0G01100 Chr7 complement(279553..281454) [1902 bp, 633 aa] {O...    40   0.041
NCAS0C04780 Chr3 (974254..976998) [2745 bp, 914 aa] {ON}               40   0.041
NDAI0G04140 Chr7 (994071..997076) [3006 bp, 1001 aa] {ON} Anc_3....    40   0.042
CAGL0D02904g Chr4 complement(302952..305615) [2664 bp, 887 aa] {...    40   0.042
Skud_15.326 Chr15 complement(588275..590731) [2457 bp, 818 aa] {...    40   0.043
KLLA0D05038g Chr4 (433653..435674) [2022 bp, 673 aa] {ON} simila...    40   0.043
YLR278C Chr12 complement(699999..704024) [4026 bp, 1341 aa] {ON}...    40   0.043
Suva_10.376 Chr10 complement(660780..664688) [3909 bp, 1302 aa] ...    40   0.044
AGL233C Chr7 complement(260414..263032) [2619 bp, 872 aa] {ON} N...    40   0.045
TPHA0F00830 Chr6 complement(188299..191877) [3579 bp, 1192 aa] {...    40   0.046
YOR162C Chr15 complement(639560..641992) [2433 bp, 810 aa] {ON} ...    40   0.046
Skud_13.173 Chr13 (298693..298722,298729..301461) [2763 bp, 920 ...    40   0.046
Skud_12.361 Chr12 complement(641047..645075) [4029 bp, 1342 aa] ...    40   0.046
Kwal_27.9688 s27 complement(21328..23853) [2526 bp, 841 aa] {ON}...    40   0.047
YMR019W Chr13 (312156..315005) [2850 bp, 949 aa] {ON}  STB4Putat...    40   0.048
KNAG0C05980 Chr3 complement(1164771..1167677) [2907 bp, 968 aa] ...    40   0.052
KAFR0G02450 Chr7 (508147..511353) [3207 bp, 1068 aa] {ON} Anc_6....    40   0.053
TPHA0O00600 Chr15 complement(107944..112062) [4119 bp, 1372 aa] ...    40   0.053
TPHA0F02540 Chr6 (556797..559178) [2382 bp, 793 aa] {ON} Anc_6.6...    40   0.053
KLLA0A04169g Chr1 complement(376273..378600) [2328 bp, 775 aa] {...    40   0.053
YOL089C Chr15 complement(150398..153490) [3093 bp, 1030 aa] {ON}...    40   0.054
TBLA0C01120 Chr3 complement(233451..237911) [4461 bp, 1486 aa] {...    40   0.055
KNAG0I00560 Chr9 complement(93785..95776) [1992 bp, 663 aa] {ON}...    40   0.057
Smik_15.547 Chr15 complement(966368..969355) [2988 bp, 995 aa] {...    40   0.057
YDR213W Chr4 (889751..892492) [2742 bp, 913 aa] {ON}  UPC2Sterol...    40   0.058
TBLA0A00730 Chr1 (156043..159156) [3114 bp, 1037 aa] {ON} Anc_2....    40   0.059
Kwal_23.6529 s23 (1627853..1629649) [1797 bp, 598 aa] {ON} YDR03...    39   0.059
CAGL0L04400g Chr12 complement(513759..516722) [2964 bp, 987 aa] ...    40   0.059
Smik_4.460 Chr4 (833609..836365) [2757 bp, 918 aa] {ON} YDR213W ...    40   0.060
KLTH0E16500g Chr5 (1460844..1463345) [2502 bp, 833 aa] {ON} simi...    40   0.060
ZYRO0G21626g Chr7 complement(1781790..1783031) [1242 bp, 413 aa]...    39   0.061
TPHA0N01100 Chr14 (231308..232501) [1194 bp, 397 aa] {ON} Anc_6....    39   0.063
Kpol_1061.26 s1061 (69833..73657) [3825 bp, 1274 aa] {ON} (69833...    40   0.064
Suva_2.187 Chr2 complement(320833..323187) [2355 bp, 784 aa] {ON...    39   0.064
KLTH0A03498g Chr1 complement(301696..303915) [2220 bp, 739 aa] {...    39   0.064
Skud_12.346 Chr12 complement(616734..618818) [2085 bp, 694 aa] {...    39   0.064
KAFR0A03060 Chr1 complement(626316..628898) [2583 bp, 860 aa] {O...    39   0.065
TPHA0L01060 Chr12 (220857..223778) [2922 bp, 973 aa] {ON} Anc_8....    39   0.066
Suva_2.381 Chr2 (669136..671892) [2757 bp, 918 aa] {ON} YDR213W ...    39   0.067
NDAI0D03480 Chr4 complement(818292..820418) [2127 bp, 708 aa] {O...    39   0.067
Skud_4.475 Chr4 (844018..846759) [2742 bp, 913 aa] {ON} YDR213W ...    39   0.068
KLTH0F07854g Chr6 complement(677647..680013) [2367 bp, 788 aa] {...    39   0.068
SAKL0H25146g Chr8 complement(2185695..2187632) [1938 bp, 645 aa]...    39   0.073
NDAI0D03540 Chr4 complement(838966..842289) [3324 bp, 1107 aa] {...    39   0.077
Kwal_8.580 s8 (13266..15182) [1917 bp, 638 aa] {ON} [contig 311]...    39   0.078
Ecym_4686 Chr4 complement(1336279..1339581) [3303 bp, 1100 aa] {...    39   0.079
KAFR0L02130 Chr12 (403953..406601) [2649 bp, 882 aa] {ON} Anc_8....    39   0.080
YBL066C Chr2 complement(96669..100115) [3447 bp, 1148 aa] {ON}  ...    39   0.081
Smik_2.50 Chr2 complement(90559..94011) [3453 bp, 1150 aa] {ON} ...    39   0.082
Suva_2.51 Chr2 complement(93709..97176) [3468 bp, 1155 aa] {ON} ...    39   0.083
Suva_4.499 Chr4 complement(871565..872917) [1353 bp, 450 aa] {ON...    39   0.083
ZYRO0G10252g Chr7 (819658..822768) [3111 bp, 1036 aa] {ON} simil...    39   0.085
Skud_2.39 Chr2 complement(80293..83772) [3480 bp, 1159 aa] {ON} ...    39   0.086
KNAG0J00210 Chr10 (26132..28717) [2586 bp, 861 aa] {ON} Anc_8.87...    39   0.086
Smik_15.342 Chr15 complement(595611..595820,595851..598070) [243...    39   0.090
YLR228C Chr12 complement(600019..602463) [2445 bp, 814 aa] {ON} ...    39   0.093
Smik_12.289 Chr12 complement(540824..543262) [2439 bp, 812 aa] {...    39   0.094
Kwal_47.18089 s47 complement(680481..682718) [2238 bp, 745 aa] {...    39   0.096
KLLA0D11286g Chr4 complement(964642..966678) [2037 bp, 678 aa] {...    39   0.096
KLLA0D10197g Chr4 complement(861726..864296) [2571 bp, 856 aa] {...    39   0.096
TPHA0N00440 Chr14 complement(82249..84522) [2274 bp, 757 aa] {ON...    39   0.098
Skud_12.296 Chr12 complement(540407..542851) [2445 bp, 814 aa] {...    39   0.098
KLLA0E19603g Chr5 complement(1739869..1741914) [2046 bp, 681 aa]...    39   0.099
Kpol_1042.6 s1042 (9848..11548,11550..11612,11615..12193) [2343 ...    39   0.10 
Suva_8.216 Chr8 complement(389549..391894) [2346 bp, 781 aa] {ON...    39   0.10 
Kpol_1009.5 s1009 complement(10170..13706) [3537 bp, 1178 aa] {O...    39   0.10 
KNAG0M00970 Chr13 (169393..172926) [3534 bp, 1177 aa] {ON} Anc_6...    39   0.10 
TPHA0C04980 Chr3 (1072547..1075105) [2559 bp, 852 aa] {ON} Anc_8...    39   0.11 
Kpol_1061.42 s1061 complement(116430..119819) [3390 bp, 1129 aa]...    39   0.11 
YKL015W Chr11 (408544..411483) [2940 bp, 979 aa] {ON}  PUT3Trans...    39   0.11 
SAKL0D13464g Chr4 (1116277..1118340) [2064 bp, 687 aa] {ON} weak...    39   0.11 
NCAS0A12720 Chr1 (2510574..2512853) [2280 bp, 759 aa] {ON} Anc_2...    39   0.11 
KAFR0E01250 Chr5 complement(249538..251748) [2211 bp, 736 aa] {O...    39   0.11 
CAGL0C01199g Chr3 complement(121944..124712) [2769 bp, 922 aa] {...    39   0.11 
SAKL0H00660g Chr8 complement(78740..81478) [2739 bp, 912 aa] {ON...    39   0.12 
KAFR0G02540 Chr7 complement(524919..527486) [2568 bp, 855 aa] {O...    39   0.12 
KAFR0G01360 Chr7 complement(305620..308121) [2502 bp, 833 aa] {O...    39   0.12 
CAGL0F02519g Chr6 (245120..247618) [2499 bp, 832 aa] {ON} weakly...    39   0.12 
KLLA0F10373g Chr6 (957948..958994) [1047 bp, 348 aa] {ON} some s...    38   0.12 
CAGL0L04576g Chr12 (528957..531554) [2598 bp, 865 aa] {ON} simil...    39   0.12 
KAFR0H01800 Chr8 complement(333664..336048) [2385 bp, 794 aa] {O...    39   0.12 
Kwal_47.17506 s47 (431921..434695) [2775 bp, 924 aa] {ON} YGL013...    39   0.12 
SAKL0H13024g Chr8 complement(1119585..1121849) [2265 bp, 754 aa]...    39   0.12 
Smik_16.15 Chr16 complement(14421..15812) [1392 bp, 463 aa] {ON}...    38   0.12 
NDAI0B01540 Chr2 complement(359639..362050) [2412 bp, 803 aa] {O...    39   0.13 
SAKL0H01958g Chr8 complement(193079..195055) [1977 bp, 658 aa] {...    39   0.13 
KNAG0H00250 Chr8 (37360..40050) [2691 bp, 896 aa] {ON} Anc_2.654...    39   0.13 
KNAG0E00450 Chr5 complement(74721..76853) [2133 bp, 710 aa] {ON}...    39   0.13 
Suva_16.25 Chr16 complement(31437..31868) [432 bp, 143 aa] {ON} ...    37   0.13 
ZYRO0B02574g Chr2 complement(204817..206541) [1725 bp, 574 aa] {...    38   0.13 
Skud_7.627 Chr7 (1048240..1049664) [1425 bp, 474 aa] {ON} YBR297...    38   0.13 
KLTH0C10516g Chr3 (871091..872776) [1686 bp, 561 aa] {ON} simila...    38   0.13 
TDEL0G04090 Chr7 complement(744499..746730) [2232 bp, 743 aa] {O...    39   0.14 
TBLA0F01200 Chr6 (295744..299004) [3261 bp, 1086 aa] {ON} Anc_3....    39   0.14 
SAKL0G07634g Chr7 (636596..639364) [2769 bp, 922 aa] {ON} some s...    39   0.14 
TBLA0B07920 Chr2 complement(1877300..1879603) [2304 bp, 767 aa] ...    38   0.15 
KNAG0A02290 Chr1 (211626..214028) [2403 bp, 800 aa] {ON}               38   0.15 
SAKL0B10538g Chr2 (910662..912767) [2106 bp, 701 aa] {ON} simila...    38   0.15 
CAGL0E05434g Chr5 (532814..535264) [2451 bp, 816 aa] {ON} simila...    38   0.16 
Suva_8.387 Chr8 (696078..698357) [2280 bp, 759 aa] {ON} YOR337W ...    38   0.16 
TPHA0C02180 Chr3 complement(493972..496632) [2661 bp, 886 aa] {O...    38   0.17 
Kwal_23.6425 s23 (1574518..1576725) [2208 bp, 735 aa] {ON} YKL22...    38   0.18 
KNAG0D03520 Chr4 complement(642517..645609) [3093 bp, 1030 aa] {...    38   0.18 
ZYRO0A03058g Chr1 (247954..250164) [2211 bp, 736 aa] {ON} simila...    38   0.18 
Kpol_1002.5 s1002 (11943..14819) [2877 bp, 958 aa] {ON} (11943.....    38   0.18 
NDAI0K01800 Chr11 (401055..404687) [3633 bp, 1210 aa] {ON} Anc_2...    38   0.18 
SAKL0F11616g Chr6 complement(901066..902841) [1776 bp, 591 aa] {...    38   0.18 
TDEL0F02330 Chr6 complement(429974..433234) [3261 bp, 1086 aa] {...    38   0.19 
KLTH0C00814g Chr3 (76637..79141) [2505 bp, 834 aa] {ON} similar ...    38   0.19 
Smik_11.240 Chr11 (395459..395932,395981..398437) [2931 bp, 976 ...    38   0.19 
TPHA0G00380 Chr7 complement(65673..68294) [2622 bp, 873 aa] {ON}       38   0.19 
NCAS0E02620 Chr5 complement(523279..526626) [3348 bp, 1115 aa] {...    38   0.20 
Skud_2.106 Chr2 (200722..203754) [3033 bp, 1010 aa] {ON} YBL005W...    38   0.20 
KAFR0G02520 Chr7 complement(522206..524722) [2517 bp, 838 aa] {O...    38   0.20 
KAFR0A03180 Chr1 complement(655176..657716) [2541 bp, 846 aa] {O...    38   0.20 
ZYRO0D06688g Chr4 (577455..577507,577577..579311) [1788 bp, 595 ...    38   0.20 
NDAI0A05750 Chr1 complement(1302180..1304459) [2280 bp, 759 aa] ...    38   0.20 
Smik_15.67 Chr15 complement(113506..116598) [3093 bp, 1030 aa] {...    38   0.21 
YOR172W Chr15 (654210..656570) [2361 bp, 786 aa] {ON}  YRM1Zn2-C...    38   0.21 
Kpol_1049.19 s1049 (38439..41270) [2832 bp, 943 aa] {ON} (38439....    38   0.21 
KLLA0D00484g Chr4 (44879..47893) [3015 bp, 1004 aa] {ON} conserv...    38   0.22 
Ecym_4286 Chr4 (613587..615470) [1884 bp, 627 aa] {ON} similar t...    38   0.22 
KLTH0B08580g Chr2 (697066..698970) [1905 bp, 634 aa] {ON} simila...    38   0.22 
TPHA0E00880 Chr5 complement(177030..180164) [3135 bp, 1044 aa] {...    38   0.22 
Ecym_2345 Chr2 (676841..678754) [1914 bp, 637 aa] {ON} similar t...    38   0.22 
CAGL0A04455g Chr1 (437546..440842) [3297 bp, 1098 aa] {ON} simil...    38   0.23 
KLTH0C07480g Chr3 (645219..647546) [2328 bp, 775 aa] {ON} simila...    38   0.23 
Smik_12.6 Chr12 complement(17429..19966) [2538 bp, 845 aa] {ON} ...    38   0.23 
Smik_15.350 Chr15 (610312..612666) [2355 bp, 784 aa] {ON} YOR172...    38   0.23 
Kwal_23.4370 s23 complement(689686..691764) [2079 bp, 692 aa] {O...    38   0.23 
Kwal_23.6537 s23 complement(1632048..1633706) [1659 bp, 552 aa] ...    37   0.23 
Kwal_56.23058 s56 complement(381390..383717) [2328 bp, 775 aa] {...    37   0.25 
KLLA0D12650g Chr4 complement(1073580..1075535) [1956 bp, 651 aa]...    37   0.25 
Kpol_529.15 s529 complement(38664..41510) [2847 bp, 948 aa] {ON}...    37   0.25 
KLLA0C17050g Chr3 (1490472..1493339) [2868 bp, 955 aa] {ON} cons...    37   0.25 
KNAG0M02120 Chr13 (395195..397021) [1827 bp, 608 aa] {ON} Anc_2....    37   0.25 
Ecym_5015 Chr5 (29616..32099) [2484 bp, 827 aa] {ON} similar to ...    37   0.26 
Kpol_455.10 s455 (12074..14566) [2493 bp, 830 aa] {ON} (12074..1...    37   0.26 
Kpol_1031.47 s1031 (125242..127926) [2685 bp, 894 aa] {ON} (1252...    37   0.26 
KLTH0C10098g Chr3 complement(836528..838843) [2316 bp, 771 aa] {...    37   0.26 
Ecym_7235 Chr7 (489574..492405) [2832 bp, 943 aa] {ON} similar t...    37   0.26 
NDAI0B01680 Chr2 (398598..401372) [2775 bp, 924 aa] {ON} Anc_2.547     37   0.26 
TDEL0F05470 Chr6 (1017743..1020175) [2433 bp, 810 aa] {ON} Anc_8...    37   0.28 
AFR171W Chr6 (752589..754427) [1839 bp, 612 aa] {ON} NOHBY629; N...    37   0.28 
Suva_15.415 Chr15 (726296..728899) [2604 bp, 867 aa] {ON} YCR106...    37   0.28 
TBLA0E01900 Chr5 (462299..464821) [2523 bp, 840 aa] {ON} Anc_7.5...    37   0.30 
TDEL0G03970 Chr7 (720080..723187) [3108 bp, 1035 aa] {ON} Anc_6....    37   0.30 
TDEL0C01880 Chr3 (332932..334554) [1623 bp, 540 aa] {ON} Anc_7.3...    37   0.30 
AGL099C Chr7 complement(516587..518830) [2244 bp, 747 aa] {ON} S...    37   0.30 
ZYRO0D14058g Chr4 (1188615..1190891) [2277 bp, 758 aa] {ON} simi...    37   0.30 
YCR106W Chr3 (310958..313456) [2499 bp, 832 aa] {ON}  RDS1Putati...    37   0.31 
ABL099W Chr2 (212830..215232) [2403 bp, 800 aa] {ON} Syntenic ho...    37   0.31 
CAGL0G09757g Chr7 (930351..934622) [4272 bp, 1423 aa] {ON} some ...    37   0.31 
NCAS0F00370 Chr6 complement(61819..65148) [3330 bp, 1109 aa] {ON...    37   0.31 
KLTH0E07854g Chr5 (719642..722458) [2817 bp, 938 aa] {ON} weakly...    37   0.31 
KLTH0D01804g Chr4 complement(173650..175608) [1959 bp, 652 aa] {...    37   0.31 
Skud_15.334 Chr15 (602966..605338) [2373 bp, 790 aa] {ON} YOR172...    37   0.32 
SAKL0G19470g Chr7 complement(1677759..1680254) [2496 bp, 831 aa]...    37   0.32 
Kpol_2001.16 s2001 (44110..46518) [2409 bp, 802 aa] {ON} (44110....    37   0.32 
Kpol_345.3 s345 complement(7411..11517) [4107 bp, 1368 aa] {ON} ...    37   0.32 
ADR405C Chr4 complement(1435702..1438125) [2424 bp, 807 aa] {ON}...    37   0.33 
TPHA0F02550 Chr6 (559614..562013) [2400 bp, 799 aa] {ON} Anc_6.6...    37   0.34 
TBLA0G00520 Chr7 (108060..110696) [2637 bp, 878 aa] {ON} Anc_6.6...    37   0.34 
Smik_25.2 Chr25 (2105..4462) [2358 bp, 785 aa] {ON} YER184C (REAL)     37   0.35 
TPHA0K01100 Chr11 (228134..231619) [3486 bp, 1161 aa] {ON} Anc_6...    37   0.35 
YBR150C Chr2 complement(541209..544493) [3285 bp, 1094 aa] {ON} ...    37   0.35 
NCAS0A10550 Chr1 (2100725..2102950) [2226 bp, 741 aa] {ON} Anc_3...    37   0.35 
CAGL0H01507g Chr8 complement(147689..150073) [2385 bp, 794 aa] {...    37   0.36 
YER184C Chr5 complement(556296..558680) [2385 bp, 794 aa] {ON} P...    37   0.37 
Suva_13.49 Chr13 complement(75704..78352) [2649 bp, 882 aa] {ON}...    37   0.37 
Smik_4.269 Chr4 complement(491110..493446) [2337 bp, 778 aa] {ON...    37   0.37 
YDR034C Chr4 complement(509737..512109) [2373 bp, 790 aa] {ON}  ...    37   0.37 
YPR196W Chr16 (931376..932788) [1413 bp, 470 aa] {ON} Putative m...    37   0.38 
NCAS0A15020 Chr1 (2957420..2959849) [2430 bp, 809 aa] {ON} Anc_7...    37   0.39 
KAFR0C03660 Chr3 complement(745068..747611) [2544 bp, 847 aa] {O...    37   0.39 
KNAG0K00820 Chr11 complement(153470..156622) [3153 bp, 1050 aa] ...    37   0.39 
Skud_4.287 Chr4 complement(501344..503698) [2355 bp, 784 aa] {ON...    37   0.39 
ZYRO0A09350g Chr1 (749695..752076) [2382 bp, 793 aa] {ON} simila...    37   0.39 
Sklu_YGOB_gneas1 Chr3 complement(352893..354335) [1443 bp, 480 a...    37   0.39 
KLLA0C04620g Chr3 complement(422705..426514) [3810 bp, 1269 aa] ...    37   0.40 
NDAI0A03410 Chr1 complement(778569..781511) [2943 bp, 980 aa] {O...    37   0.41 
ZYRO0D14080g Chr4 (1191418..1194183) [2766 bp, 921 aa] {ON} weak...    37   0.42 
Suva_10.18 Chr10 complement(36048..38576) [2529 bp, 842 aa] {ON}...    37   0.42 
Ecym_5183 Chr5 complement(385669..388101) [2433 bp, 810 aa] {ON}...    37   0.42 
Suva_2.121 Chr2 (211466..214381) [2916 bp, 971 aa] {ON} YBL005W ...    37   0.42 
Ecym_4144 Chr4 complement(306206..308728) [2523 bp, 840 aa] {ON}...    37   0.42 
TDEL0G04100 Chr7 complement(746975..749074) [2100 bp, 699 aa] {O...    37   0.45 
KLLA0E18129g Chr5 (1613115..1615712) [2598 bp, 865 aa] {ON} simi...    37   0.45 
NCAS0E02310 Chr5 (452368..454524) [2157 bp, 718 aa] {ON} Anc_7.56      37   0.46 
TPHA0F02630 Chr6 complement(583511..587299) [3789 bp, 1262 aa] {...    37   0.46 
KLTH0A00484g Chr1 (42443..44149) [1707 bp, 568 aa] {ON} conserve...    37   0.46 
Skud_15.502 Chr15 (894741..897020) [2280 bp, 759 aa] {ON} YOR337...    37   0.47 
TDEL0E00300 Chr5 (64461..66374) [1914 bp, 637 aa] {ON}                 37   0.47 
NCAS0F00310 Chr6 (49514..52084) [2571 bp, 856 aa] {ON}                 37   0.47 
KNAG0M00620 Chr13 (99320..100699) [1380 bp, 459 aa] {ON} Anc_6.1...    36   0.47 
KLTH0E00176g Chr5 (8605..10311) [1707 bp, 568 aa] {ON} conserved...    37   0.49 
KAFR0D04590 Chr4 (900318..902840) [2523 bp, 840 aa] {ON} Anc_5.3...    37   0.50 
Ecym_6141 Chr6 complement(258221..258565) [345 bp, 114 aa] {ON} ...    34   0.51 
Kpol_1061.37 s1061 complement(102667..104616) [1950 bp, 649 aa] ...    36   0.52 
ADR365W Chr4 (1355407..1357512) [2106 bp, 701 aa] {ON} Syntenic ...    36   0.54 
SAKL0D03586g Chr4 (290224..292629) [2406 bp, 801 aa] {ON} simila...    37   0.54 
Skud_7.646 Chr7 (1073386..1074795) [1410 bp, 469 aa] {ON} YPR196...    36   0.55 
ZYRO0C18282g Chr3 (1431515..1433665) [2151 bp, 716 aa] {ON} cons...    36   0.56 
Skud_7.2 Chr7 (5094..6749) [1656 bp, 551 aa] {ON} YLR098C (REAL)       36   0.56 
NDAI0I01940 Chr9 (450330..454112) [3783 bp, 1260 aa] {ON} Anc_6.75     36   0.58 
NDAI0F02050 Chr6 complement(503400..504740) [1341 bp, 446 aa] {O...    36   0.59 
ZYRO0E00572g Chr5 (35940..38456) [2517 bp, 838 aa] {ON} similar ...    36   0.61 
Kwal_26.6664 s26 complement(11094..12833) [1740 bp, 579 aa] {ON}...    36   0.63 
KLTH0G13200g Chr7 (1133333..1133382,1133450..1135100) [1701 bp, ...    36   0.64 
SAKL0C05918g Chr3 complement(558911..561538) [2628 bp, 875 aa] {...    36   0.64 
Kpol_1061.19 s1061 (51386..54709) [3324 bp, 1107 aa] {ON} (51386...    36   0.66 
Ecym_3001 Chr3 (1150..3042) [1893 bp, 630 aa] {ON} similar to As...    36   0.67 
Kwal_56.23308 s56 complement(485779..487092) [1314 bp, 438 aa] {...    36   0.68 
CAGL0H00396g Chr8 complement(37005..39827) [2823 bp, 940 aa] {ON...    36   0.70 
KLTH0E03256g Chr5 complement(294997..297021) [2025 bp, 674 aa] {...    36   0.70 
YBL005W Chr2 (217470..220400) [2931 bp, 976 aa] {ON}  PDR3Transc...    36   0.70 
KNAG0B02380 Chr2 complement(466392..469595) [3204 bp, 1067 aa] {...    36   0.70 
SAKL0C03960g Chr3 (380387..383488) [3102 bp, 1033 aa] {ON} conse...    36   0.71 
TBLA0C03390 Chr3 complement(814708..818028) [3321 bp, 1106 aa] {...    36   0.74 
Kwal_55.20722 s55 (530982..533465) [2484 bp, 827 aa] {ON} YCR106...    36   0.76 
KAFR0A04940 Chr1 (975356..978913) [3558 bp, 1185 aa] {ON} Anc_6....    36   0.76 
Kwal_47.17233 s47 (309658..312504) [2847 bp, 948 aa] {ON} [conti...    36   0.77 
ACL096W Chr3 (169508..172015) [2508 bp, 835 aa] {ON} Syntenic ho...    36   0.77 
Skud_16.500 Chr16 (874371..876485) [2115 bp, 704 aa] {ON} YKL222...    36   0.78 
TPHA0C02220 Chr3 (504550..506658) [2109 bp, 702 aa] {ON} Anc_8.4...    36   0.80 
CAGL0K11902g Chr11 complement(1149210..1151705) [2496 bp, 831 aa...    36   0.82 
Smik_15.515 Chr15 (903950..906229) [2280 bp, 759 aa] {ON} YOR337...    36   0.82 
ZYRO0G17512g Chr7 complement(1447970..1449541) [1572 bp, 523 aa]...    36   0.82 
NDAI0D02730 Chr4 (629970..633647) [3678 bp, 1225 aa] {ON} Anc_6....    36   0.83 
TDEL0C05790 Chr3 (1045249..1047057) [1809 bp, 602 aa] {ON}             36   0.84 
KLTH0E06666g Chr5 (611348..614188) [2841 bp, 946 aa] {ON} conser...    36   0.85 
NDAI0K02840 Chr11 (640461..643634) [3174 bp, 1057 aa] {ON} Anc_6...    36   0.86 
CAGL0L09691g Chr12 complement(1041796..1044270) [2475 bp, 824 aa...    36   0.86 
Suva_15.425 Chr15 (750153..752087) [1935 bp, 644 aa] {ON} YLR098...    36   0.88 
ZYRO0D14432g Chr4 complement(1222977..1226489) [3513 bp, 1170 aa...    36   0.89 
TDEL0C01580 Chr3 complement(272178..275687) [3510 bp, 1169 aa] {...    36   0.90 
Ecym_3392 Chr3 (741359..743902) [2544 bp, 847 aa] {ON} similar t...    36   0.91 
TBLA0F03550 Chr6 complement(875734..876630) [897 bp, 298 aa] {ON...    35   0.91 
KLLA0F02387g Chr6 complement(213669..215852) [2184 bp, 727 aa] {...    35   0.97 
KNAG0A04550 Chr1 (642548..645208) [2661 bp, 886 aa] {ON} Anc_8.4...    35   0.98 
Kwal_56.24670 s56 complement(1099601..1101532) [1932 bp, 643 aa]...    35   0.98 
NDAI0D01770 Chr4 (411567..413924) [2358 bp, 785 aa] {ON} Anc_5.322     35   1.00 
KLTH0D07898g Chr4 (672516..674534) [2019 bp, 672 aa] {ON} weakly...    35   1.0  
KLTH0A06644g Chr1 complement(553084..555270) [2187 bp, 728 aa] {...    35   1.0  
KLLA0C19228g Chr3 (1713787..1715562) [1776 bp, 591 aa] {ON} simi...    35   1.0  
CAGL0H06875g Chr8 complement(682518..684626) [2109 bp, 702 aa] {...    35   1.0  
AGL091W Chr7 (535317..537917) [2601 bp, 866 aa] {ON} Syntenic ho...    35   1.0  
NDAI0D00220 Chr4 complement(43353..46187) [2835 bp, 944 aa] {ON}...    35   1.0  
AER291C Chr5 complement(1172383..1174374) [1992 bp, 663 aa] {ON}...    35   1.1  
TBLA0A07010 Chr1 (1713923..1716046) [2124 bp, 707 aa] {ON}             35   1.1  
KLLA0F04213g Chr6 (400673..402979) [2307 bp, 768 aa] {ON} simila...    35   1.1  
Ecym_2672 Chr2 (1294580..1296799) [2220 bp, 739 aa] {ON} similar...    35   1.1  
NDAI0C03450 Chr3 (789514..791844) [2331 bp, 776 aa] {ON} Anc_5.59      35   1.1  
AGR280C Chr7 complement(1266912..1270232) [3321 bp, 1106 aa] {ON...    35   1.1  
AAL175W Chr1 (32874..35525) [2652 bp, 883 aa] {ON} Non-syntenic ...    35   1.1  
NDAI0J00440 Chr10 complement(78052..80523) [2472 bp, 823 aa] {ON...    35   1.1  
SAKL0D02596g Chr4 (204347..206599) [2253 bp, 750 aa] {ON} conser...    35   1.2  
TDEL0B07490 Chr2 complement(1314447..1317044) [2598 bp, 865 aa] ...    35   1.2  
KNAG0G02130 Chr7 complement(482333..484231) [1899 bp, 632 aa] {O...    35   1.2  
TBLA0D01210 Chr4 complement(305406..306464) [1059 bp, 352 aa] {O...    35   1.2  
TPHA0M01040 Chr13 complement(202491..204803) [2313 bp, 770 aa] {...    35   1.2  
NCAS0H01240 Chr8 (235885..237312) [1428 bp, 475 aa] {ON} Anc_6.154     35   1.2  
Smik_26.8 Chr26 (8892..9242) [351 bp, 117 aa] {ON} YER184C (REAL)      33   1.2  
TBLA0G02350 Chr7 complement(605666..610141) [4476 bp, 1491 aa] {...    35   1.2  
YOR337W Chr15 (954344..956623) [2280 bp, 759 aa] {ON}  TEA1Ty1 e...    35   1.3  
Ecym_4153 Chr4 complement(330831..333281) [2451 bp, 816 aa] {ON}...    35   1.4  
NCAS0D02960 Chr4 complement(563406..566924) [3519 bp, 1172 aa] {...    35   1.4  
Suva_11.213 Chr11 (392506..392993,393045..395514) [2958 bp, 985 ...    35   1.4  
KNAG0F02830 Chr6 (536483..538723) [2241 bp, 746 aa] {ON}               35   1.4  
KLLA0F20680g Chr6 (1924148..1926511) [2364 bp, 787 aa] {ON} weak...    35   1.4  
TBLA0H03910 Chr8 complement(943931..946234) [2304 bp, 767 aa] {O...    35   1.4  
Smik_4.696 Chr4 (1232828..1235677) [2850 bp, 949 aa] {ON} YDR421...    35   1.4  
SAKL0G14256g Chr7 (1230063..1232306) [2244 bp, 747 aa] {ON} cons...    35   1.5  
Smik_4.68 Chr4 (133172..134758) [1587 bp, 528 aa] {ON} YDL170W (...    35   1.5  
NDAI0E03850 Chr5 (846504..848810) [2307 bp, 768 aa] {ON} Anc_7.56      35   1.5  
NDAI0I02190 Chr9 (501867..504074) [2208 bp, 735 aa] {ON} Anc_6.6...    35   1.5  
KAFR0C01320 Chr3 (273213..276233) [3021 bp, 1006 aa] {ON} Anc_3....    35   1.5  
TDEL0H03950 Chr8 (674423..676411) [1989 bp, 662 aa] {ON} Anc_7.5...    35   1.5  
Suva_8.225 Chr8 (404288..406693) [2406 bp, 801 aa] {ON} YOR172W ...    35   1.5  
Ecym_8159 Chr8 (330207..332933) [2727 bp, 908 aa] {ON} similar t...    35   1.6  
CAGL0L09383g Chr12 (1020856..1021956) [1101 bp, 366 aa] {ON} som...    35   1.6  
SAKL0B12518g Chr2 (1072142..1073932) [1791 bp, 596 aa] {ON} cons...    35   1.6  
TBLA0B07050 Chr2 (1669768..1671996) [2229 bp, 742 aa] {ON}             35   1.6  
ZYRO0G00374g Chr7 complement(28649..30553) [1905 bp, 634 aa] {ON...    35   1.7  
KAFR0C03230 Chr3 complement(655300..656520) [1221 bp, 406 aa] {O...    35   1.7  
Smik_12.341 Chr12 complement(613817..615922) [2106 bp, 701 aa] {...    35   1.7  
ZYRO0E05676g Chr5 complement(439616..442816) [3201 bp, 1066 aa] ...    35   1.7  
AGR061C Chr7 complement(831052..832890) [1839 bp, 612 aa] {ON} S...    35   1.7  
Ecym_3112 Chr3 (203876..207310) [3435 bp, 1144 aa] {ON} similar ...    35   1.7  
SAKL0A01386g Chr1 (132287..134599) [2313 bp, 770 aa] {ON} conser...    35   1.7  
TPHA0M00150 Chr13 (29607..31919) [2313 bp, 770 aa] {ON}                35   1.7  
AFR722C Chr6 complement(1765861..1768293) [2433 bp, 810 aa] {ON}...    35   1.8  
ACR241C Chr3 complement(784358..786745) [2388 bp, 795 aa] {ON} S...    35   1.8  
Kwal_55.20674 s55 complement(515392..516147) [756 bp, 252 aa] {O...    34   1.8  
Ecym_7239 Chr7 (501580..504774) [3195 bp, 1064 aa] {ON} similar ...    35   1.8  
NCAS0A03570 Chr1 complement(708718..711654) [2937 bp, 978 aa] {O...    35   1.9  
TDEL0B06360 Chr2 complement(1127150..1130095) [2946 bp, 981 aa] ...    35   1.9  
NDAI0F04500 Chr6 complement(1093752..1096181) [2430 bp, 809 aa] ...    35   1.9  
KNAG0E00780 Chr5 (140071..142353) [2283 bp, 760 aa] {ON} Anc_5.5...    35   1.9  
AGR369W Chr7 (1412833..1415988) [3156 bp, 1051 aa] {ON} Syntenic...    35   1.9  
Kwal_YGOB_gneas1 s33 complement(285483..287042) [1560 bp, 519 aa...    34   1.9  
Skud_20.3 Chr20 (4504..5916) [1413 bp, 470 aa] {ON} YBR297W (REAL)     34   2.0  
KLTH0H05720g Chr8 (505672..507006) [1335 bp, 444 aa] {ON} simila...    34   2.0  
NCAS0B08200 Chr2 (1561174..1563801) [2628 bp, 875 aa] {ON} Anc_1...    35   2.1  
TDEL0A03890 Chr1 (695880..698375) [2496 bp, 831 aa] {ON} Anc_5.5...    35   2.1  
SAKL0A08074g Chr1 (711985..715425) [3441 bp, 1146 aa] {ON} simil...    35   2.1  
Kpol_1042.7 s1042 (12882..15233) [2352 bp, 783 aa] {ON} (12882.....    35   2.1  
TDEL0G00830 Chr7 complement(170169..172229) [2061 bp, 686 aa] {O...    34   2.1  
YKL222C Chr11 complement(3503..5620) [2118 bp, 705 aa] {ON} Prot...    34   2.1  
Kwal_14.1631 s14 (397794..399125) [1332 bp, 443 aa] {ON} YBR240C...    34   2.1  
Kwal_56.22605 s56 (200072..202669) [2598 bp, 865 aa] {ON} YOL089...    35   2.1  
ZYRO0D12518g Chr4 (1055521..1058166) [2646 bp, 881 aa] {ON} simi...    35   2.1  
KLTH0G15180g Chr7 (1326581..1329871) [3291 bp, 1096 aa] {ON} sim...    34   2.2  
TBLA0C02060 Chr3 (486966..489920) [2955 bp, 984 aa] {ON} Anc_1.1...    34   2.2  
KLLA0A03091g Chr1 (276333..277484) [1152 bp, 383 aa] {ON} some s...    34   2.3  
SAKL0G02992g Chr7 (243859..247044) [3186 bp, 1061 aa] {ON} conse...    34   2.3  
ZYRO0C11880g Chr3 (929030..930943) [1914 bp, 637 aa] {ON} simila...    34   2.3  
CAGL0H01683g Chr8 (162753..164852) [2100 bp, 699 aa] {ON} simila...    34   2.3  
Suva_2.701 Chr2 complement(1233963..1236344) [2382 bp, 793 aa] {...    34   2.4  
CAGL0I02552g Chr9 (227257..230274) [3018 bp, 1005 aa] {ON} weakl...    34   2.5  
SAKL0H13266g Chr8 (1138536..1140362) [1827 bp, 608 aa] {ON} some...    34   2.5  
Kwal_14.819 s14 complement(63184..64890) [1707 bp, 568 aa] {ON} ...    34   2.5  
Smik_23.3 Chr23 complement(4675..6111) [1437 bp, 478 aa] {ON} YB...    34   2.5  
KLTH0H00968g Chr8 (103482..105353) [1872 bp, 623 aa] {ON} simila...    34   2.5  
KLTH0F18392g Chr6 (1484590..1487211) [2622 bp, 873 aa] {ON} simi...    34   2.6  
Suva_15.3 Chr15 complement(4971..6152) [1182 bp, 393 aa] {ON} YK...    34   2.6  
Skud_14.399 Chr14 (715444..717267) [1824 bp, 607 aa] {ON} YNR063...    34   2.6  
YHR178W Chr8 (459299..461530) [2232 bp, 743 aa] {ON}  STB5Transc...    34   2.8  
KLTH0F03014g Chr6 (260568..262406) [1839 bp, 612 aa] {ON} simila...    34   3.0  
KNAG0D02330 Chr4 complement(407687..408490) [804 bp, 267 aa] {ON...    33   3.1  
SAKL0A06072g Chr1 (551181..552518) [1338 bp, 445 aa] {ON} simila...    34   3.1  
KLTH0F03300g Chr6 complement(283918..285474) [1557 bp, 518 aa] {...    33   3.3  
KAFR0G03520 Chr7 complement(728360..729694) [1335 bp, 444 aa] {O...    33   3.5  
KAFR0A06690 Chr1 complement(1354262..1357255) [2994 bp, 997 aa] ...    34   3.6  
TBLA0E01110 Chr5 (243534..246755) [3222 bp, 1073 aa] {ON} Anc_6....    33   4.0  
TDEL0D06620 Chr4 (1197405..1199084) [1680 bp, 559 aa] {ON}             33   4.0  
TBLA0H00720 Chr8 (157413..159269) [1857 bp, 618 aa] {ON} Anc_8.4...    33   4.1  
Skud_6.15 Chr6 complement(24031..25701) [1671 bp, 556 aa] {ON} Y...    33   4.3  
ZYRO0E00638g Chr5 complement(44716..48036) [3321 bp, 1106 aa] {O...    33   4.6  
Skud_8.242 Chr8 (430739..432958) [2220 bp, 739 aa] {ON} YHR178W ...    33   4.7  
Skud_11.214 Chr11 (389377..389855,389895..392361) [2946 bp, 981 ...    33   4.8  
KLTH0E06116g Chr5 complement(553784..556297) [2514 bp, 837 aa] {...    33   4.9  
SAKL0C00242g Chr3 (14453..16954) [2502 bp, 833 aa] {ON} weakly s...    33   5.2  
KLLA0A09251g Chr1 (808253..810319) [2067 bp, 688 aa] {ON} simila...    33   5.3  
TDEL0B04000 Chr2 (715716..716981) [1266 bp, 421 aa] {ON} Anc_6.1...    33   5.4  
NDAI0C00260 Chr3 (40019..43144) [3126 bp, 1041 aa] {ON} Anc_2.65...    33   5.5  
Kpol_534.28 s534 (64772..66079) [1308 bp, 435 aa] {ON} (64772..6...    33   5.5  
TPHA0L02050 Chr12 complement(423921..426563) [2643 bp, 880 aa] {...    33   5.6  
NDAI0E04190 Chr5 complement(944753..948466) [3714 bp, 1237 aa] {...    33   5.6  
SAKL0G19404g Chr7 (1667193..1670582) [3390 bp, 1129 aa] {ON} sim...    33   6.0  
Smik_8.262 Chr8 (436380..438584) [2205 bp, 734 aa] {ON} YHR178W ...    33   6.2  
TDEL0G04920 Chr7 complement(912754..914844) [2091 bp, 696 aa] {O...    33   6.3  
Suva_15.378 Chr15 (665572..667815) [2244 bp, 747 aa] {ON} YHR178...    33   6.5  
SAKL0F16588g Chr6 complement(1369763..1371610) [1848 bp, 615 aa]...    33   6.8  
KLTH0B09262g Chr2 (758773..761235) [2463 bp, 820 aa] {ON} weakly...    33   7.1  
Smik_4.453 Chr4 complement(820614..823172) [2559 bp, 852 aa] {ON...    33   7.4  
KLTH0C06776g Chr3 complement(586976..590140) [3165 bp, 1054 aa] ...    33   7.6  
YDR207C Chr4 complement(865012..867522) [2511 bp, 836 aa] {ON}  ...    33   7.6  
YFL052W Chr6 (28232..29629) [1398 bp, 465 aa] {ON} Putative zinc...    32   8.5  
AGL083W Chr7 (550291..552861) [2571 bp, 856 aa] {ON} Syntenic ho...    32   9.4  
Skud_6.7 Chr6 (12394..13791) [1398 bp, 465 aa] {ON} YPR196W (REAL)     32   9.7  
KLLA0E18195g Chr5 complement(1622300..1625701) [3402 bp, 1133 aa...    32   9.7  

>Kwal_27.10232 s27 (251015..254644) [3630 bp, 1209 aa] {ON} YMR280C
            (CAT8) - Zinc-cluster protein involved in activating
            gluconeogenic genes; related to Gal4p [contig 39] FULL
          Length = 1209

 Score = 2116 bits (5483), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1046/1209 (86%), Positives = 1046/1209 (86%)

Query: 1    MGERENESFGPRFIRTLGSQSLSGTNPLXXXXXXXXXXXXXXRTNNSAAPNAARSISPVT 60
            MGERENESFGPRFIRTLGSQSLSGTNPL              RTNNSAAPNAARSISPVT
Sbjct: 1    MGERENESFGPRFIRTLGSQSLSGTNPLSSQPSSISQSPAQPRTNNSAAPNAARSISPVT 60

Query: 61   SATPTSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGYXXXX 120
            SATPTSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGY    
Sbjct: 61   SATPTSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGYTETL 120

Query: 121  XXXXXXXXXXXXXXXXXCDLKDEQMHLVSKYSSNKRHEPSSTEEGRMLEQLSNSDGGSLR 180
                             CDLKDEQMHLVSKYSSNKRHEPSSTEEGRMLEQLSNSDGGSLR
Sbjct: 121  EERVRELEAENRRLVALCDLKDEQMHLVSKYSSNKRHEPSSTEEGRMLEQLSNSDGGSLR 180

Query: 181  VSSTNLYLLNKTTPAVQDGSELHKCQGLGCNHASHPHLHEKPVSTSLSDPAAISFEQNEA 240
            VSSTNLYLLNKTTPAVQDGSELHKCQGLGCNHASHPHLHEKPVSTSLSDPAAISFEQNEA
Sbjct: 181  VSSTNLYLLNKTTPAVQDGSELHKCQGLGCNHASHPHLHEKPVSTSLSDPAAISFEQNEA 240

Query: 241  PGLPAVKALNTMANHEYSAQLAYLVALSVPRSTDEILFIPQLLARLGQVHGLTSKQCXXX 300
            PGLPAVKALNTMANHEYSAQLAYLVALSVPRSTDEILFIPQLLARLGQVHGLTSKQC   
Sbjct: 241  PGLPAVKALNTMANHEYSAQLAYLVALSVPRSTDEILFIPQLLARLGQVHGLTSKQCLYS 300

Query: 301  XXXXXXXXXXXQTSFQGSPDYKDLKDKSLWEIDDCMTFFKTGCKFNLTSSKDAXXXXXXX 360
                       QTSFQGSPDYKDLKDKSLWEIDDCMTFFKTGCKFNLTSSKDA       
Sbjct: 301  ASLLAALKESSQTSFQGSPDYKDLKDKSLWEIDDCMTFFKTGCKFNLTSSKDAECLTISE 360

Query: 361  XXXXXXXYFGECHALIPVLNEAEFYKYYNKFKSNLTTDPEFFKTSTPSFAQRSKSISYKI 420
                   YFGECHALIPVLNEAEFYKYYNKFKSNLTTDPEFFKTSTPSFAQRSKSISYKI
Sbjct: 361  IEELISIYFGECHALIPVLNEAEFYKYYNKFKSNLTTDPEFFKTSTPSFAQRSKSISYKI 420

Query: 421  FACILLVICQFGLMAKVKREQLPTKNKFSLLMSYYSNALLALKTNPYFSVKNXXXXXXXX 480
            FACILLVICQFGLMAKVKREQLPTKNKFSLLMSYYSNALLALKTNPYFSVKN        
Sbjct: 421  FACILLVICQFGLMAKVKREQLPTKNKFSLLMSYYSNALLALKTNPYFSVKNTSIQTLQL 480

Query: 481  XXXXXXXXXNVGEVSSVYEIRGTVVSMAQQLRLHRCPSAVLGTEGSTMSKSEQGDRRLLF 540
                     NVGEVSSVYEIRGTVVSMAQQLRLHRCPSAVLGTEGSTMSKSEQGDRRLLF
Sbjct: 481  LSLLLFYYLNVGEVSSVYEIRGTVVSMAQQLRLHRCPSAVLGTEGSTMSKSEQGDRRLLF 540

Query: 541  WGIYYLDVFGALQLGVPRLLKDHEIECALPISEHAHAGVSLADQVIKLEGQVSELSLSLL 600
            WGIYYLDVFGALQLGVPRLLKDHEIECALPISEHAHAGVSLADQVIKLEGQVSELSLSLL
Sbjct: 541  WGIYYLDVFGALQLGVPRLLKDHEIECALPISEHAHAGVSLADQVIKLEGQVSELSLSLL 600

Query: 601  RFSKILGNILDSIFKRGMTSSAAQQVALIHENALDNWRRGLPKNLTFELDVNGTIKIEEL 660
            RFSKILGNILDSIFKRGMTSSAAQQVALIHENALDNWRRGLPKNLTFELDVNGTIKIEEL
Sbjct: 601  RFSKILGNILDSIFKRGMTSSAAQQVALIHENALDNWRRGLPKNLTFELDVNGTIKIEEL 660

Query: 661  TGSAQNNQDFTKNASSDKKILMLLYFLVKCLVHLPVLAAKPLLGGSSEPDKDATPXXXXX 720
            TGSAQNNQDFTKNASSDKKILMLLYFLVKCLVHLPVLAAKPLLGGSSEPDKDATP     
Sbjct: 661  TGSAQNNQDFTKNASSDKKILMLLYFLVKCLVHLPVLAAKPLLGGSSEPDKDATPAFDDA 720

Query: 721  XXXXXXXXXXYVLLQQATNTFLSVQSCFKTRHLPLAIDLPRIKARFALLSARGILEYTKG 780
                      YVLLQQATNTFLSVQSCFKTRHLPLAIDLPRIKARFALLSARGILEYTKG
Sbjct: 721  SSGADRSSSSYVLLQQATNTFLSVQSCFKTRHLPLAIDLPRIKARFALLSARGILEYTKG 780

Query: 781  GALFQDNXXXXXXXXXXXXXXXXXXXPGSLSWHSLILLDMATLLIMQPPQTKTDKLDKLL 840
            GALFQDN                   PGSLSWHSLILLDMATLLIMQPPQTKTDKLDKLL
Sbjct: 781  GALFQDNKALLLEVVKELEASKKLELPGSLSWHSLILLDMATLLIMQPPQTKTDKLDKLL 840

Query: 841  ETRLNYYNKLMGRSTLTSNGKRKNEENDATSKVSKLTPLSSEYNTPSDKRIKVESIGSSG 900
            ETRLNYYNKLMGRSTLTSNGKRKNEENDATSKVSKLTPLSSEYNTPSDKRIKVESIGSSG
Sbjct: 841  ETRLNYYNKLMGRSTLTSNGKRKNEENDATSKVSKLTPLSSEYNTPSDKRIKVESIGSSG 900

Query: 901  NVPSNSESVHHFDDIQNDKFSTNWPSNNPQPNAIAEAFHLDPVLNGNPFSNGDLTAFFNS 960
            NVPSNSESVHHFDDIQNDKFSTNWPSNNPQPNAIAEAFHLDPVLNGNPFSNGDLTAFFNS
Sbjct: 901  NVPSNSESVHHFDDIQNDKFSTNWPSNNPQPNAIAEAFHLDPVLNGNPFSNGDLTAFFNS 960

Query: 961  DNGIPQIGGGSSVLNLAGIXXXXXXXXXXXXXXXXXXXPRKVATTVNDGLFRVPSNGDFL 1020
            DNGIPQIGGGSSVLNLAGI                   PRKVATTVNDGLFRVPSNGDFL
Sbjct: 961  DNGIPQIGGGSSVLNLAGIGAANSNELNNNNNEAAGGGPRKVATTVNDGLFRVPSNGDFL 1020

Query: 1021 KDYYRIPGASSSQLNLMFMGPGNTGXXXXXXXXXXXXFTVPGFGFTVDASLGLAPLLAWS 1080
            KDYYRIPGASSSQLNLMFMGPGNTG            FTVPGFGFTVDASLGLAPLLAWS
Sbjct: 1021 KDYYRIPGASSSQLNLMFMGPGNTGANQNAPNNQKNNFTVPGFGFTVDASLGLAPLLAWS 1080

Query: 1081 PEAPQPSMPEIAQNADRRDSDPLSRTRLPSATIPASDPTHVISQDSNNVHLREQYRSNSF 1140
            PEAPQPSMPEIAQNADRRDSDPLSRTRLPSATIPASDPTHVISQDSNNVHLREQYRSNSF
Sbjct: 1081 PEAPQPSMPEIAQNADRRDSDPLSRTRLPSATIPASDPTHVISQDSNNVHLREQYRSNSF 1140

Query: 1141 NQLYAQDQSLDDTAITIPTRSHRGPRRRWNSSNGTTVITXXXXXXXXXXXXXXXXXXYKD 1200
            NQLYAQDQSLDDTAITIPTRSHRGPRRRWNSSNGTTVIT                  YKD
Sbjct: 1141 NQLYAQDQSLDDTAITIPTRSHRGPRRRWNSSNGTTVITPNSDRPRNPPSSESENENYKD 1200

Query: 1201 LFRWQNSGF 1209
            LFRWQNSGF
Sbjct: 1201 LFRWQNSGF 1209

>KLTH0C03762g Chr3 (324666..328286) [3621 bp, 1206 aa] {ON} similar to
            uniprot|P39113 Saccharomyces cerevisiae YMR280C CAT8 Zinc
            cluster transcriptional activator
          Length = 1206

 Score = 1503 bits (3891), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 767/1210 (63%), Positives = 865/1210 (71%), Gaps = 5/1210 (0%)

Query: 1    MGERENESFGPRFIRTLGSQSLSGTNPLXXXXXXXXXXXXXXRTNNSAAPNAARSISPVT 60
            MGERENESFGPRFIRTLGSQS+S  NPL              + N +    A  SISP  
Sbjct: 1    MGERENESFGPRFIRTLGSQSISVINPLSSQPSSISQSPAQPKANTNTQTTATASISPTA 60

Query: 61   SATPTSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGYXXXX 120
            S TP+SNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGY    
Sbjct: 61   SVTPSSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGYTETL 120

Query: 121  XXXXXXXXXXXXXXXXXCDLKDEQMHLVSKYSSNKRHEPSSTEEGRMLEQLSNSDGGSLR 180
                             CDLKDEQMHLV KYSSNKR EPSSTEE +MLEQLS+S+GGSLR
Sbjct: 121  EERVRELEAENRRLVALCDLKDEQMHLVYKYSSNKRPEPSSTEEEQMLEQLSSSNGGSLR 180

Query: 181  VSSTNLYLLNKTTPAVQDGSELHKCQGLGCNHASHPHLHEKPVSTSLSDPAAISFEQNEA 240
            VSSTNLYLLNKT+PA  +  E HKCQG+ CNH SHPHLHEKPVST+LSDP  ISFEQ+EA
Sbjct: 181  VSSTNLYLLNKTSPAGHEVPENHKCQGIDCNHTSHPHLHEKPVSTTLSDPTTISFEQHEA 240

Query: 241  PGLPAVKALNTMANHEYSAQLAYLVALSVPRSTDEILFIPQLLARLGQVHGLTSKQCXXX 300
            PGLPAVKAL++MANHEYS QLA LVALSVPRST+EILFIPQLLARLGQVHGLTSKQC   
Sbjct: 241  PGLPAVKALSSMANHEYSTQLACLVALSVPRSTEEILFIPQLLARLGQVHGLTSKQCLYT 300

Query: 301  XXXXXXXXXXXQTSFQGSPDYKDLKDKSLWEIDDCMTFFKTGCKFNLTSSKDAXXXXXXX 360
                       Q     +    +LK  SLWEIDD M FFK  CKFNL S  D        
Sbjct: 301  ASLLASLKEPSQAVVPTTDGLTELKCTSLWEIDDPMRFFKDSCKFNLGSDNDVELLSISE 360

Query: 361  XXXXXXXYFGECHALIPVLNEAEFYKYYNKFKSNLTTDPEFFKTSTPSFAQRSKSISYKI 420
                   YF ECHALIPVLNE EFYKYYNKFK +LT DP FF  +  SFA RSKSISYKI
Sbjct: 361  IEDLISIYFEECHALIPVLNENEFYKYYNKFKESLTVDPNFFGKANSSFAHRSKSISYKI 420

Query: 421  FACILLVICQFGLMAKVKREQLPTKNKFSLLMSYYSNALLALKTNPYFSVKNXXXXXXXX 480
            FACILLV+CQ G+M+KVKREQLP K+KFS +M+YY+NA+LALK NPYFSVK         
Sbjct: 421  FACILLVVCQLGIMSKVKREQLPAKSKFSRIMAYYNNAILALKLNPYFSVKTTSVKTLQL 480

Query: 481  XXXXXXXXXNVGEVSSVYEIRGTVVSMAQQLRLHRCPSAVLGTEGSTMSKSEQGDRRLLF 540
                     NVGEVSSVYE+RGT+VSMAQQLRLHRCPSAVLGTEGSTMSKSEQGDRRLLF
Sbjct: 481  MSLLLFYFLNVGEVSSVYELRGTIVSMAQQLRLHRCPSAVLGTEGSTMSKSEQGDRRLLF 540

Query: 541  WGIYYLDVFGALQLGVPRLLKDHEIECALPISEHAHAGVSLADQVIKLEGQVSELSLSLL 600
            WGIYYLDVF ALQLGVPRLLKDHEIECALPISE+ H GVSLADQVI+LEGQVSE SLSLL
Sbjct: 541  WGIYYLDVFSALQLGVPRLLKDHEIECALPISENGHPGVSLADQVIRLEGQVSEFSLSLL 600

Query: 601  RFSKILGNILDSIFKRGMTSSAAQQVALIHENALDNWRRGLPKNLTFELDVNGTIKIEEL 660
            RFSKILGNILDSIFKRGMTSS AQQVALIHENALD+WRRGLPKNLTFELDVNGTI +EEL
Sbjct: 601  RFSKILGNILDSIFKRGMTSSIAQQVALIHENALDSWRRGLPKNLTFELDVNGTINMEEL 660

Query: 661  TGSAQNNQDFTKNASSDKKILMLLYFLVKCLVHLPVLAAKPLLGGSSEPDKDATPXXXXX 720
               +   +D++   S D + LM+LYFLVKCLVHLPVLAAKPLLGG+SE D DAT      
Sbjct: 661  NSGSHWKKDYSTAPSCDNRTLMVLYFLVKCLVHLPVLAAKPLLGGASEVDTDATLAFDDA 720

Query: 721  XXXXXXXXXXYVLLQQATNTFLSVQSCFKTRHLPLAIDLPRIKARFALLSARGILEYTKG 780
                      YVLLQQATNTFLSVQS  K+RHLPLA++LPRIKARFALLSARGILEYTKG
Sbjct: 721  SSGADRSSSSYVLLQQATNTFLSVQSSLKSRHLPLALNLPRIKARFALLSARGILEYTKG 780

Query: 781  GALFQDNXXXXXXXXXXXXXXXXXXXPGSLSWHSLILLDMATLLIMQPPQTKTDKLDKLL 840
            GALFQ N                   PGSLSWHSLILLDMA  LIMQPP TK  KLDKLL
Sbjct: 781  GALFQGNKALLLDVVKELETTKRLEIPGSLSWHSLILLDMAVSLIMQPPHTKAGKLDKLL 840

Query: 841  ETRLNYYNKLMGRSTLTSNGKRKNEE-NDATSKVSKLTPLSSEYNTPSDKRIKVESIGSS 899
            E +L+YYNKLMGRS   ++ KRK EE N + S  +KLTPLSS+ ++PS+KR+K+E     
Sbjct: 841  EAKLSYYNKLMGRSANVASTKRKKEEDNTSLSNATKLTPLSSDSSSPSEKRVKLEHTDKV 900

Query: 900  GNVPSNSESVHHFDDIQNDKFSTNWPSNNPQPNAIAEAFHLDPVLNGNPFSNGDLTAFFN 959
            G  P   E+    +    + ++  W + N   + +AEAFHLDPVLN NPFSNGDLTAFF+
Sbjct: 901  GETPVGVENTGQPNGNTQEHYAATWSNQNQPHSTVAEAFHLDPVLNNNPFSNGDLTAFFS 960

Query: 960  SDNGIPQIGGGSSVLNLAGIXXXXXXXXXXXXXXXXXXXPRKVATTVNDGLFRVPSNGDF 1019
            +DNG+P + GG+S+LN+ G+                    +  +T  NDGLFRVPSNGDF
Sbjct: 961  TDNGMPNLSGGASMLNMVGVDQAHSTAGNDAQNTVNANSQQ--STLFNDGLFRVPSNGDF 1018

Query: 1020 LKDYYRIPGASSSQLNLMFMGPGNTGXXXXXXXXXXXXFTVPGFGFTVDASLGLAPLLAW 1079
            LKDYYR+PGASSSQLNLM MG G++G             T PGFGFTVDASLGLAPLLAW
Sbjct: 1019 LKDYYRVPGASSSQLNLMLMGSGSSGSNQRQAKQQQTNTTDPGFGFTVDASLGLAPLLAW 1078

Query: 1080 SPEAPQPSMPEIAQNADRRDSDPLSRTRLPSATIPASDPTHVISQDSNNVHLREQYRSNS 1139
            SPEA Q  + E + +  R DS    ++   +A +  +  +  ++  S +   ++Q R  S
Sbjct: 1079 SPEAAQEPIAETSDHDTRNDSGLRRKSGAETAGVLVAGHSQ-LADSSTDPASQQQRRVGS 1137

Query: 1140 FNQLYAQDQSLDDTAITIPTRSHRGPRRRWNSSNGTTVITXXXXXXXXXXXXXXXXXXYK 1199
            ++  YAQDQS++D+AIT+PTR HRGPRRRWNS+ G   IT                   +
Sbjct: 1138 YDHTYAQDQSVEDSAITMPTRPHRGPRRRWNSTTGAAAIT-PNSDRPRNAPASETDENLQ 1196

Query: 1200 DLFRWQNSGF 1209
            DLFRWQNSGF
Sbjct: 1197 DLFRWQNSGF 1206

>SAKL0D01342g Chr4 (101095..104907) [3813 bp, 1270 aa] {ON} similar to
            uniprot|Q75DZ4 Ashbya gossypii ABL121C ABL121Cp and
            similar to YMR280C uniprot|P39113 Saccharomyces
            cerevisiae YMR280C CAT8 Zinc cluster transcriptional
            activator
          Length = 1270

 Score = 1092 bits (2824), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 629/1299 (48%), Positives = 785/1299 (60%), Gaps = 119/1299 (9%)

Query: 1    MGERENESFGPRFIRTLGSQSLSGTNPLXXXXXXXXXXXXXXRTN--NSAAPNAARSISP 58
            M +RE E+F PR IRTLGSQSLSG NP                +   + AA N   S +P
Sbjct: 1    MSKRERETFAPRIIRTLGSQSLSGLNPFSSSNPSSLSQSPATSSTVPHVAANNTTMSPTP 60

Query: 59   -----------VTSATPT----SNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKV 103
                       VTS   T    SNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECK+
Sbjct: 61   LNSNNMGTGTSVTSGADTPASASNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKI 120

Query: 104  SDKLSRRAFPRGYXXXXXXXXXXXXXXXXXXXXXCDLKDEQMHLVSKYSSNKRHEPSSTE 163
            SDKLSRRAFPRGY                     CDLK+EQ+HLVSKYS+ +  E S  E
Sbjct: 121  SDKLSRRAFPRGYTETLEERVRELEAENRRLVALCDLKEEQLHLVSKYSNKRTSEISENE 180

Query: 164  EGRMLEQLSNSDGGSLRVSSTNLYLLNKTTPAVQDGSELH-------KCQGLGCNHASHP 216
            + ++L+QLS ++GGSLRVSSTNLYLLNKTTP  Q   E          C G+GCNH+  P
Sbjct: 181  DEQILQQLSAANGGSLRVSSTNLYLLNKTTPGDQQDEEDQMSSKTTVDCNGVGCNHSHQP 240

Query: 217  HLHEKPVSTSLSDPAAISFEQNEAPGLPAVKALNTMANHEYSAQLAYLVALSVPRSTDEI 276
            ++H+KPVST+L+DP +ISFEQNEAPGLPAVKAL +MANHE+S QLA LVALSVPRST+EI
Sbjct: 241  NIHDKPVSTNLNDPTSISFEQNEAPGLPAVKALTSMANHEHSVQLATLVALSVPRSTEEI 300

Query: 277  LFIPQLLARLGQVHGLTSKQCXXXXXXXXXXXXXXQTSFQGSPDYKDLKDKSLWEIDDCM 336
            L IPQLLAR+GQVHGLTSKQ                 +   + D   LK  +LWE+DD +
Sbjct: 301  LLIPQLLARIGQVHGLTSKQSLYTASLLASLKESIPLTLPTNVDM--LKSTNLWEVDDVI 358

Query: 337  TFFKTGCKFNL---TSSKDAXXXXXXXXXXXXXXYFGECHALIPVLNEAEFYKYYNKFKS 393
             FF+T  KF++   +S+                 +F + +  IP+L++ EFY YYNKFK+
Sbjct: 359  QFFQTVFKFDIQAESSTTSQDHLIATEIDGLVSDFFSQWYNFIPILDKDEFYNYYNKFKT 418

Query: 394  NLTTDPEFFKTSTPSFAQRSKSISYKIFACILLVICQFGLMAKVKREQLPTKNKFSLLMS 453
            +L  DP FF      F +R+KSISYKIF CILL+ICQ GL++KVK E LP  NK+S LM+
Sbjct: 419  DLM-DPNFFDDEKNLFNKRNKSISYKIFGCILLIICQMGLISKVKAENLPATNKYSQLMA 477

Query: 454  YYSNALLALKTNPYFSVKNXXXXXXXXXXXXXXXXXNVGEVSSVYEIRGTVVSMAQQLRL 513
            YY   +  L  NPYF++K+                 N+GEVSSVY++RG VVSM+QQLRL
Sbjct: 478  YYDIVVRQLMMNPYFNLKSTSIQSLQFTSLQLFYFLNIGEVSSVYDLRGKVVSMSQQLRL 537

Query: 514  HRCPSAVLGTEGSTMSKSEQGDRRLLFWGIYYLDVFGALQLGVPRLLKDHEIECALPISE 573
            HRCPSAVLG  GS +SK++QG+RR+LFWGIYYLDVF ALQLGVPRLLKDHEIECALP+++
Sbjct: 538  HRCPSAVLGGNGSAVSKAQQGERRILFWGIYYLDVFSALQLGVPRLLKDHEIECALPVAD 597

Query: 574  HAHAGVSLADQVIKLEGQVSELSLSLLRFSKILGNILDSIFKRGMTSSAAQQVALIHENA 633
            +    V+LA Q+I LEG+VS LSLS++RF+K+LGNILDSIFKRGM++S  +Q++L+HENA
Sbjct: 598  NDDQKVNLAGQMIALEGRVSMLSLSVIRFAKVLGNILDSIFKRGMSASLTKQISLVHENA 657

Query: 634  LDNWRRGLPKNLTFELDVNGTIKIEELTGSAQNNQDFTKNA-SSDKKILMLLYFLVKCLV 692
            LDNWRRGLP+ L FELDVNGTI ++E     Q   D + N  S + K LM+LYF+ KC++
Sbjct: 658  LDNWRRGLPQQLKFELDVNGTINMDEFNHLKQ--LDTSGNMYSKENKSLMVLYFMAKCMI 715

Query: 693  HLPVLAAKPLLGGSSEPDKDATPXXXXXXXXXXXXXXXYVLLQQATNTFLSVQSCFKTRH 752
            HLPV+A +PL+    +  + +TP               YVLLQQATNT L+V +  +  +
Sbjct: 716  HLPVVAKRPLVNDPEQSPESSTP----SNNCGDRSSSSYVLLQQATNTLLNVFTSLRNVY 771

Query: 753  LPLAIDLPRIKARFALLSARGILEYTKGGALFQDNXXXXXXXXXXXXXXXXXXXPGSLSW 812
             P+ I++ R K RF+LLSARG LEYTKGGALFQDN                   PG+LSW
Sbjct: 772  PPIPINVSRTKTRFSLLSARGSLEYTKGGALFQDNKALLLDLVKELEVDKKLELPGTLSW 831

Query: 813  HSLILLDMATLLIMQPPQTKTDKLDKLLETRLNYYNKLMGR----------STLTSNGKR 862
            HSL LLDM+  LI+QP  TK +KL+K+L+ +LNYYNKL  R          S+   N KR
Sbjct: 832  HSLKLLDMSISLILQPANTKPEKLEKMLQRKLNYYNKLTNRRSNLGGGRSASSPGGNSKR 891

Query: 863  KNEENDATSKVSKLTPLSSEYNTPSDKRIKVESIGSSGNVPSNSESVHHFDDIQNDKFST 922
            K +EN  +++  KLTP SS+ +TP DK+IK+E    +G VP  + S H   D  ++KF  
Sbjct: 892  KLDENQGSAEPPKLTPASSKGDTPPDKKIKLE---DTGFVPVRAVSQHSQSD--SEKFEN 946

Query: 923  NWPSNNPQPNAIAEAFHLDPVLNGNPFSNGDLTAFFNSDNG-IP-QIGGGSSVLNLAGIX 980
              P   PQ N+IAEAFHLDPVLN NPFSN DL AFFN++NG +P  +  G S+ N+A   
Sbjct: 947  FQPPVAPQ-NSIAEAFHLDPVLNNNPFSNTDLNAFFNTNNGNVPAALRSGGSLFNIAATA 1005

Query: 981  XXXXXXXXXXXXXXXXXXPRKVATTVNDGLFRVPSNGDFLKDYYRIPGASSSQLNLMFM- 1039
                                  + T+N+GLF+VPSNGDFLKDYY +PGASSSQLNL+F+ 
Sbjct: 1006 AASGNNANSTAP----------SNTLNEGLFKVPSNGDFLKDYYNVPGASSSQLNLLFLN 1055

Query: 1040 -----GPGNTGXXXXXXXXXXXXFTVPGFGFTVDASLGLAPLLAWSPEAPQPSMPE---- 1090
                 G                     GFGF VDAS GLAPLL WSP A +P  P     
Sbjct: 1056 NNASNGKPQLNGSSAHSGTQAQNNDNNGFGFAVDASWGLAPLLEWSP-AGKPVDPGTCNA 1114

Query: 1091 ------IAQNADRRDSDPLSRTRLPSATIPASD-------PTHVISQDSNNVHLR----- 1132
                  +  +A   +S+  +  RL S T   +D       PT   S+       R     
Sbjct: 1115 NENSIILDTSAANMESEMATGGRLHSNTRSYTDAKNLDIVPTLPSSKQQQQQQHRLQKGA 1174

Query: 1133 -EQYRSNSFNQLYAQDQSL------------DDTAITIPTRSHRGPRRRWNSSNGTTVIT 1179
             +Q RS S   +  + QSL            DD  +T+ TR+HRGPRRRWNS+ G    T
Sbjct: 1175 SQQPRSAS---IPTRKQSLCESNPTTATGSRDDGVLTMGTRNHRGPRRRWNSTTGQNTRT 1231

Query: 1180 XXXXXXXXXXXXXXXXX---------XYKDLFRWQNSGF 1209
                                         DLFRWQNSG 
Sbjct: 1232 QLATMNTPQSERSKSQNIGEPGSTEDSLHDLFRWQNSGL 1270

>ABL121C Chr2 complement(170782..174639) [3858 bp, 1285 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YMR280C
            (CAT8)
          Length = 1285

 Score =  895 bits (2312), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 567/1331 (42%), Positives = 720/1331 (54%), Gaps = 177/1331 (13%)

Query: 4    RENESFGPRFIRTLGSQSLSGTNPLXXXXXXXXXXXXXXRTNNSAAPNAA---RSISPVT 60
            +E + +GPR IRTLGSQ+L G                       A+P AA    + +P++
Sbjct: 6    KEKDGYGPRIIRTLGSQALGGAGGSSRASSVSQSPGGPEGATGGASPAAAPQSTTGTPLS 65

Query: 61   SATPTSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGYXXXX 120
            S TPT NYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECK+SDKLSRRAFPRGY    
Sbjct: 66   SLTPT-NYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGYTETL 124

Query: 121  XXXXXXXXXXXXXXXXXCDLKDEQMHLVSKYS-----------SNKRHEPSST--EEGRM 167
                             CDLK+EQ+ LVSKY            +NK+ +   T  E+ ++
Sbjct: 125  EERVRELEAENRRLVALCDLKEEQLRLVSKYGCASAPATSSSSANKKGDSDHTTLEDEQI 184

Query: 168  LEQLSNSDGGSLRVSSTNLYLLNKTTPA-------------VQDGSELHKCQGLGCNHAS 214
            L+QLSNSDGG+LRVSSTNLYLLNK T A              Q  S  +    L  +H +
Sbjct: 185  LQQLSNSDGGALRVSSTNLYLLNKKTAAFPLVQPVQQNLSPTQLRSNPYTRATLSPSHVA 244

Query: 215  HPH--------LHEKPVS-------------TSLSDPAAISFEQNEAPGLPAVKALNTMA 253
                       L   PV+             T+L+DP +ISFEQ++APGLPAVKAL+++A
Sbjct: 245  EADHVTDLRKGLPANPVAISSSVGQVPPYPFTNLNDPTSISFEQDQAPGLPAVKALSSLA 304

Query: 254  NHEYSAQLAYLVALSVPRSTDEILFIPQLLARLGQVHGLTSKQCXXXXXXXXXXXXXXQT 313
            +HE S+QLA LVA+S+PR+T+EILF+PQLLAR+GQ+HG TSKQC               T
Sbjct: 305  SHEESSQLAALVAVSIPRTTEEILFVPQLLARIGQMHGFTSKQCLYTASVLASLKEI--T 362

Query: 314  SFQGSPDYKDLKDKSLWEIDDCMTFFKTGCK----------FNLTS------------SK 351
              + S   + LK K+LWEID+  TF   G +          FNL +            +K
Sbjct: 363  PRKTSSILEQLKAKNLWEIDNVDTFLLEGLQIDIRRGSSGDFNLENPNGYKLENEYHQTK 422

Query: 352  DAXXXXXXXX-------XXXXXXYFGECHALIPVLNEAEFYKYYNKFKSNLTTDPEFFKT 404
            DA                     +F + ++LIP+ + +EF  Y+ KFK N++T P FF +
Sbjct: 423  DAHPELQELTPLTFQEIEELIQLFFDDWYSLIPIFDRSEFESYWVKFKDNVST-PGFFTS 481

Query: 405  STPSFAQRSKSISYKIFACILLVICQFGLMAKVKREQLPTKNKFSLLMSYYSNALLALKT 464
                F +R KSISYKIFAC+LL +CQ GLM+KVKRE+    ++ + LM+YY  A+  +  
Sbjct: 482  GDTLFDRRHKSISYKIFACLLLTVCQMGLMSKVKRERHERGDRLNNLMTYYDRAISHVIM 541

Query: 465  NPYFSVKNXXXXXXXXXXXXXXXXXNVGEVSSVYEIRGTVVSMAQQLRLHRCPSAVLGTE 524
            NPYFS  +                 NVG+VS+VYE+RG VVS+ QQLRLHRCPSAVLG++
Sbjct: 542  NPYFSSSSTSIQSLQLLSLLLFYFLNVGDVSNVYELRGKVVSLTQQLRLHRCPSAVLGSD 601

Query: 525  GSTMSKSEQGDRRLLFWGIYYLDVFGALQLGVPRLLKDHEIECALPISEHAHAGVSLADQ 584
            GST+ K +QG+RR+LFWG+YYLDVF +LQLGVPRL+KDHEIECALP+S      V+LA Q
Sbjct: 602  GSTVGKIQQGERRVLFWGVYYLDVFSSLQLGVPRLMKDHEIECALPVSSDDDNHVNLAGQ 661

Query: 585  VIKLEGQVSELSLSLLRFSKILGNILDSIFKRGMTSSAAQQVALIHENALDNWRRGLPKN 644
            +I LEG++S  SLS++RFSK+LGN+LDSIFKRGMT S  +QVAL+HENALDNWR  LP N
Sbjct: 662  MIALEGKMSPFSLSIIRFSKVLGNVLDSIFKRGMTESMTKQVALVHENALDNWRHALPDN 721

Query: 645  LTFELDVNGTIKIEELTGSAQNNQDFTKNASSDK---KILMLLYFLVKCLVHLPVLAAKP 701
            L F+LDVNGTI +E+L    Q  +D+    ++ K    I M LYFL K ++HLPV+A KP
Sbjct: 722  LRFQLDVNGTINMEDLN---QLKRDYLNKDTALKLNNAIFMALYFLAKIMIHLPVVATKP 778

Query: 702  LLGGSSEPDKDATPXXXXXXXXXXXXXXXYVLLQQATNTFLSVQSCFKTRHLPLAIDLPR 761
            ++    +P  D                  YVLLQQATNTFL+V S   + +LPL +++ R
Sbjct: 779  II-DKPQPVVDTN----IPGSQIDRSSSSYVLLQQATNTFLNVLSSVSSLYLPLPLNITR 833

Query: 762  IKARFALLSARGILEYTKGGALFQDNXXXXXXXXXXXXXXXXXXXPGSLSWHSLILLDMA 821
             K RF L+SARG LEYTKGGALFQDN                   PG++SWHSL LLDMA
Sbjct: 834  TKTRFGLVSARGSLEYTKGGALFQDNKNLLLDLLKDLEADKKLNMPGTISWHSLKLLDMA 893

Query: 822  TLLIMQPPQTKTDKLDKLLETRLNYYNKLMGR-----STLTSNGK---RKNEENDATSKV 873
              LI+QPP TK +K +KLL+ ++NYYNKL+       ++L + G+   RK E   A    
Sbjct: 894  VNLILQPPNTKPEKQEKLLQKKINYYNKLIDSHLGPTASLPTPGQTAPRKPEPAHARPIP 953

Query: 874  SKLTPLSSEYNTPSD-----------KRIKVESIGSSGNVPSNSESVHHFDDIQ------ 916
             K  P SS+ +   D           K++K+E+  S+   P    S  H D  +      
Sbjct: 954  EKEKPPSSKRHRGDDNAAASMPPLLEKKVKLEAPASNMPTPPAPISALHEDVPRVLDGHL 1013

Query: 917  --NDKFSTNWPSNNPQ-------PNAIAEAFHLDPVLNGNPFSNGDLTAFFNSDNGIPQI 967
              N   +     + P+        NAI EAF LDP+L   PFSN DL +FF    G+ Q 
Sbjct: 1014 GANSSLAVLAAKHEPEGSLHSSAGNAITEAFQLDPILQPTPFSNTDLPSFF----GVDQY 1069

Query: 968  GGGSSVLNL-AGIXXXXXXXXXXXXXXXXXXXPRKVATTVNDGLFRVPSNGDFLKDYYRI 1026
                 +    AG                    P     +  D LF+VPSNGDFLKDYY  
Sbjct: 1070 AAPPELQPFPAGYAAPDKVPQAAAQGPSATAGP---PLSSKDSLFKVPSNGDFLKDYYS- 1125

Query: 1027 PGASSSQLNLMFMGPGNTGXXXXXXXXXXXXF----TVPGFGFTVDASLGLAPLLAWSPE 1082
             G SS+QLN +F  P                       PG+GF VDASLGLAPLLAWSP 
Sbjct: 1126 -GMSSAQLNSLFTAPDRRDVRPRAPQPDRAPSDGLQQQPGYGFVVDASLGLAPLLAWSP- 1183

Query: 1083 APQPSMPEIAQNADRRDSDPLSRTRLPSATIPASDPTHVISQDSNNVHLREQYRSNS--- 1139
                           R +D L      +    A   THV    S    +  Q    S   
Sbjct: 1184 ---------------RPADDLLLDDKGAKLASARSFTHVNKLSSIPTLMSTQPPPASAPH 1228

Query: 1140 --FNQLYAQDQSLDDTAITIPTRSHRGPRRRWNSSNGTTVITXXXXXXXXXXXXXXXXXX 1197
                Q    DQ  DD  +TIP R  RGPRR WNS+                         
Sbjct: 1229 AKLGQPAPPDQ--DDGILTIPPRDQRGPRRLWNSA------------LNQARPAAALDDS 1274

Query: 1198 YKDLFRWQNSG 1208
              DLFRWQNSG
Sbjct: 1275 ISDLFRWQNSG 1285

>TDEL0B00530 Chr2 (95898..99803) [3906 bp, 1301 aa] {ON} Anc_8.845
            YMR280C
          Length = 1301

 Score =  878 bits (2268), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 528/1204 (43%), Positives = 670/1204 (55%), Gaps = 146/1204 (12%)

Query: 1    MGERENESFGPRFIRTLGSQSLSGTNPLXXXXXXXXXXXXXXRT----NNSAAPNAARSI 56
            M E   +  GP++IRT+GSQSLSG NPL                    N S    +A+  
Sbjct: 1    MKEMAAKDGGPKYIRTMGSQSLSGLNPLSSGGSSQVSISHSPSVLLDDNGSEDVRSAKRK 60

Query: 57   SP-VTSATPT-----------------------SNYRVAQACDRCRSKKTRCDGKRPQCS 92
            SP + + TP+                       SN RVAQACDRCRSKKTRCDGKRPQCS
Sbjct: 61   SPSLLAGTPSQRPRLNTEVSEVASYTSVNSAANSNLRVAQACDRCRSKKTRCDGKRPQCS 120

Query: 93   QCAAVGFECKVSDKLSRRAFPRGYXXXXXXXXXXXXXXXXXXXXXCDLKDEQMHLVSKYS 152
            QCAAVGFEC++SDKLSRRAFPRGY                     CD+K++Q+HLVS + 
Sbjct: 121  QCAAVGFECRISDKLSRRAFPRGYTETLEERVRELEAENRRLVALCDIKEQQIHLVSHFP 180

Query: 153  SNKRHEPSSTEEGRMLEQLSNSDGGSLRVSSTNLYLLNKT----TPA-VQDGSE------ 201
            +NK+    + E+  ML++L+ ++ G LR+SSTNL+LLNK      PA + +G +      
Sbjct: 181  TNKKKIGGNDEQ--MLQELTGANNGRLRISSTNLFLLNKARDGKQPATISNGDDHMTKPD 238

Query: 202  -----LHKCQGLGCNHASHPHLHEKPVSTSLSDPAAISFEQNEAPGLPAVKALNTMANHE 256
                  H+C  L CN+     LH KPVST+L+DP AISFEQNEAPGLPAVKAL +MA  E
Sbjct: 239  HEHTGKHRCDELDCNNK----LHSKPVSTNLNDPTAISFEQNEAPGLPAVKALTSMATRE 294

Query: 257  YSAQLAYLVALSVPRSTDEILFIPQLLARLGQVHGLTSKQCXXXXXXXXXXXXXX---QT 313
             S QLA LVALSVPRST+EILFIPQLLAR+ Q+HG TSKQC                 Q 
Sbjct: 295  QSTQLATLVALSVPRSTEEILFIPQLLARIIQIHGFTSKQCLYSVSLLASLKNNLPGPQL 354

Query: 314  SFQGSPDYKDLKDKSLWEIDDCMTFFKTGCKFNL-----TSSKDAXXXXXXXXXXXXXXY 368
                  DY  LK  +LWE+D+   FF    KFN+     +   ++              +
Sbjct: 355  VKWDELDY--LKTTNLWEVDNLDKFFHETLKFNILRPGVSDDGESLGLSIKEIDELVNLF 412

Query: 369  FGECHALIPVLNEAEFYKYYNKFKSNLTTDPEFFKTSTPSFAQRSKSISYKIFACILLVI 428
            F      IP+L++ EF+ YY+K K +++T P  F+    +FA+R+K ISYKIFACIL  +
Sbjct: 413  FDSWAVHIPILDKEEFFSYYDKLKKDISTQPGLFQEGPSNFARRNKIISYKIFACILFTV 472

Query: 429  CQFGLMAKVKREQLPTKNK-FSLLMSYYSNALLALKTNPYFSVKNXXXXXXXXXXXXXXX 487
            CQ GL+ KVK E++ + +  +  L SYY  A+  +  NPYF V                 
Sbjct: 473  CQMGLLTKVKGEKITSADSPYVKLTSYYHRAISLIYLNPYFGVLTTSLQSLQFLSLLLFY 532

Query: 488  XXNVGEVSSVYEIRGTVVSMAQQLRLHRCPSAVLGTEGSTMSKSEQGDRRLLFWGIYYLD 547
              N G VS++YE+RG VVSMAQQLRLHRCPSAVLG  GSTM+K EQGDRR+LFWGIYYLD
Sbjct: 533  FVNTGNVSAIYELRGRVVSMAQQLRLHRCPSAVLGGSGSTMNKREQGDRRVLFWGIYYLD 592

Query: 548  VFGALQLGVPRLLKDHEIECALPISEHAHAGVSLADQVIKLEGQVSELSLSLLRFSKILG 607
            VF ALQLGVPRL+KD EIECALP++E+    VSLA Q+I+LEG+VS+ SL+++RF+K+LG
Sbjct: 593  VFSALQLGVPRLIKDFEIECALPVAENDDREVSLAGQMIRLEGRVSQFSLAIIRFAKVLG 652

Query: 608  NILDSIFKRGMTSSAAQQVALIHENALDNWRRGLPKNLTFELDVNGTIKIEELTGSAQNN 667
            NILD++FKRGMT S ++++ALIHENALDNWRRGLP  L FE++VNGTI +++     QNN
Sbjct: 653  NILDTVFKRGMTESVSKKLALIHENALDNWRRGLPAELIFEIEVNGTINMDKFNEMKQNN 712

Query: 668  QDFTKNASSDKKILMLLYFLVKCLVHLPVLAAKPLLGGSSEPDKDATPXXXXXXXX---- 723
                   + ++ +L++ YFL KC++HLPV+A +P L  S +P+ D               
Sbjct: 713  ATV---ENVEQMVLLVSYFLAKCMIHLPVVATRP-LPSSDDPNSDIKEEEEVNDKNGESN 768

Query: 724  -XXXXXXXYVLLQQATNTFLSVQSCFKTRHLPLAIDLPRIKARFALLSARGILEYTKGGA 782
                    YVLLQQATNT L+V    K+ +LPL  ++ R KARFALLSARG LEY KGGA
Sbjct: 769  FAIRSSSSYVLLQQATNTMLNVLESLKSIYLPLPFNVARTKARFALLSARGSLEYIKGGA 828

Query: 783  LFQDNXXXXXXXXXXXXXXXXXXXPGSLSWHSLILLDMATLLIMQPPQTKTDKLDKLLET 842
            LF DN                   PG +SWH L LLDM   L++QPP TK +KLD+LL+ 
Sbjct: 829  LFLDNKALLLDVVKSIEEDRKLEIPGVISWHGLKLLDMTISLLLQPPNTKVEKLDRLLKK 888

Query: 843  RLNYYNKLMGRSTLTS-------NGKRKNEENDATS--------KVSKLTPLSSEYN-TP 886
            +LNYY+++MGR  L +       NGKR+N  +D  S        + + LTP+SS+ + +P
Sbjct: 889  KLNYYSRVMGRPILKTSSLRQEANGKRRNSSDDKLSRSGTEENFRATNLTPISSKSDGSP 948

Query: 887  SDKRIKVESIGSSGNVPSNSESVHHFDDIQNDKFSTNWPSNNPQ-----PNAIAEAFHLD 941
             +K+IK+E         S+  S    D    D  S++  +N PQ       AIAEA HLD
Sbjct: 949  VEKKIKLED-------ESSDTSNALVDKSYTDDLSSS--ANQPQVPASTQTAIAEALHLD 999

Query: 942  PVLNGNPFSNGDLTAFFNSDNGIPQIGGG--SSVLNLAGIXXXXXXXXXXXXXXXXXXXP 999
            PVLN N  S  DL AFF  +  +P  GG   SS  N                        
Sbjct: 1000 PVLNNNILSVADLAAFFGGN--MPAAGGNQHSSYTNQNDFAPKHMRKEKEPAAFSDLAHK 1057

Query: 1000 RKVATTVNDGLFRVPSNGDFLKDYYRIPGASSSQLNLMFMGPGN------TGXXXXXXXX 1053
            +   T V DGLFRVPSN DFL D Y   G S   L L      N                
Sbjct: 1058 KSSVTGV-DGLFRVPSNADFLMDEYYPSGTSHINLTLFNNNANNHDDTFGLSDGHGKDTG 1116

Query: 1054 XXXXFTVPG-----------------------------------FGFTVDASLGLAPLLA 1078
                F V G                                   F F VDASLGLAPLL 
Sbjct: 1117 VNTNFNVKGGHQSTNHSHLTNFNDRLQGNQLGFTNSGNMNSGSDFNFAVDASLGLAPLLD 1176

Query: 1079 WSPE 1082
            WSPE
Sbjct: 1177 WSPE 1180

>KLLA0D01452g Chr4 (124018..128355) [4338 bp, 1445 aa] {ON} similar to
            uniprot|Q75DZ4 Ashbya gossypii ABL121C ABL121Cp and
            similar to YMR280C uniprot|P39113 Saccharomyces
            cerevisiae YMR280C CAT8 Zinc cluster transcriptional
            activator
          Length = 1445

 Score =  825 bits (2130), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 512/1312 (39%), Positives = 681/1312 (51%), Gaps = 218/1312 (16%)

Query: 68   YRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGYXXXXXXXXXXX 127
            YRVAQACDRCR+KK RCDGKRPQC+QCAAVGFECK+SDKLSRRAFPRGY           
Sbjct: 177  YRVAQACDRCRAKKIRCDGKRPQCTQCAAVGFECKISDKLSRRAFPRGYTETLEERVREL 236

Query: 128  XXXXXXXXXXCDLKDEQMHLVSKYSSNKRH---EPSSTEEGRMLEQLSNSDGGSLRVSST 184
                      CDLK+EQ+HLVSKYS++K     E  STEE ++L +LS ++GGSLRVSST
Sbjct: 237  EAENRRLVALCDLKEEQLHLVSKYSNSKDENGVEIPSTEEEQILHELSKTNGGSLRVSST 296

Query: 185  NLYLLNK------------------------TTPA---------VQDGSELHKCQGLGCN 211
            NLYLLNK                        T P+         V D        G   +
Sbjct: 297  NLYLLNKKASPGDDSHIESSEPSIPVRKVAITAPSPRIMSPRNSVADSDPSQTNTGNNDH 356

Query: 212  HASHPHLHEKPVSTSLSDPAAISFEQNEAPGLPAVKALNTMANHEYSAQLAYLVALSVPR 271
              S+ + H +  ST   DP  ISFEQNEAPGLPA+KAL++++ ++   QLA LVA+SVPR
Sbjct: 357  IHSNNNNHNQNNST---DPYGISFEQNEAPGLPALKALSSLSKYKQGTQLATLVAVSVPR 413

Query: 272  STDEILFIPQLLARLGQVHGLTSKQCXXXXXXXXXXXXXXQTSFQGSPDYKDLKDKSLWE 331
            +T+EILF+PQLLAR+GQ+HG TSKQC               +S    P+ + LK+ +LWE
Sbjct: 414  TTEEILFVPQLLARIGQIHGFTSKQCIYTASVLASLKENNISSI--PPELEVLKNHNLWE 471

Query: 332  IDDCMTFFKTGCKFNLTS----SKDAXXXXXXXXXXXXXXYFGECHALIPVLNEAEFYKY 387
            IDD + F+K   K +  +       +              +F + + LIP+ ++ EF  Y
Sbjct: 472  IDDVLHFWKNVFKLDFMTHTAVDHSSTHLNFAEVEELMQLFFQDWYELIPLFDKNEFNSY 531

Query: 388  YNKFKSNLTTDPEFF-KTSTPSFAQRSKSISYKIFACILLVICQFGLMAKVKREQLPTKN 446
            Y KFK N+T DP FF +     F  R++SISYKIF+C+L++I Q G+++K+KR+++ T  
Sbjct: 532  YEKFKLNVT-DPNFFVRKDDTVFNNRTRSISYKIFSCLLIIIVQMGMLSKIKRDKI-TSG 589

Query: 447  KFSLLMSYYSNALLALKTNPYFSVKNXXXXXXXXXXXXXXXXXNVGEVSSVYEIRGTVVS 506
            K S LM YY   +  +  NPYF+ +N                 NVG++SS+YE+RG VVS
Sbjct: 590  KLSTLMKYYDKLMTHIWINPYFNSRNTSIQVLQCLSMLLFYMLNVGDISSIYELRGKVVS 649

Query: 507  MAQQLRLHRCPSAVLGTEGSTMSKSEQGDRRLLFWGIYYLDVFGALQLGVPRLLKDHEIE 566
            M+QQLRLHRCPSAVLG +GST+SK +QG+RR+LFW IYYLDVF ALQLGVPRLLKD EIE
Sbjct: 650  MSQQLRLHRCPSAVLGGDGSTVSKVQQGERRILFWSIYYLDVFSALQLGVPRLLKDFEIE 709

Query: 567  CALPISEHAHAGVSLADQVIKLEGQVSELSLSLLRFSKILGNILDSIFKRGMTSSAAQQV 626
            CALP++      V+LA Q+I LEG+VS+ SLS++RF+K++GNILDS FKRGMT+S  +Q 
Sbjct: 710  CALPVTSDDDRQVNLAGQMIALEGKVSQFSLSVIRFAKVMGNILDSTFKRGMTTSLTKQA 769

Query: 627  ALIHENALDNWRRGLPKNLTFELDVNGTIKIEELTGSAQNNQDFTKNASS---DKKILML 683
            AL+HENALDNWR GL K+L F+LDVNGTI ++E     Q ++  +   ++   +  +LM 
Sbjct: 770  ALVHENALDNWRHGLQKDLFFQLDVNGTINMDEFNQQKQYSKSLSPRTAAFTHNSLVLMT 829

Query: 684  LYFLVKCLVHLPVLAAKPLLGGSSEPDKDATPXXXXXXXXXXXXXXXYVLLQQATNTFLS 743
            LYF+ KC++HLPV+A KPL+  + +   D                  YVLLQQATNT L+
Sbjct: 830  LYFMAKCMIHLPVVATKPLVAEAIQTPTD----NQTENGSVDRSLSSYVLLQQATNTLLN 885

Query: 744  VQSCFKTRHLPLAIDLPRIKARFALLSARGILEYTKGGALFQDNXXXXXXXXXXXXXXXX 803
            V +   + +LPL I+L R K RF L SARG LEYTKGGALFQDN                
Sbjct: 886  VLTALNSIYLPLPINLARTKTRFGLFSARGSLEYTKGGALFQDNKALLLDLVKELETDKK 945

Query: 804  XXXPGSLSWHSLILLDMATLLIMQPPQTKTDKLDKLLETRLNYYNKLMGRSTLTSNGKRK 863
               PG+ SWHSL L D++  LI+QP  +  +K +K+++ ++NYYNKLMG+ T+    KR 
Sbjct: 946  LELPGNTSWHSLKLFDLSINLILQPVNSNPEKTEKMIQKKINYYNKLMGQPTVAVKRKRD 1005

Query: 864  NEENDATSKVSKLTPLSSEYNTPSDKRIKVESIGSSGNVPSNSESVHHFDDIQNDKFSTN 923
             +  + TS                 K++KVE   S  N+  N  +    D + +++   +
Sbjct: 1006 PKATENTS-----------------KKVKVEDDHSQDNL-HNITTGETTDTVHSEELVKD 1047

Query: 924  WPSN-NPQP---NAIAEAFHLDPVLNGNPFSNGDLTAFFNS------------------- 960
             P   N  P     I EAF +DPVLN N FSN DL   FNS                   
Sbjct: 1048 VPKELNVYPENYTTIEEAFQMDPVLNTNLFSNTDLKTLFNSGIFENAGSIHNNINDNNNN 1107

Query: 961  ---------------------------DNGIPQIGGGSSVLNLAGIXXXXXXXXXXXXXX 993
                                       D+G+      +S+LNL+                
Sbjct: 1108 NNNTNNTNNNNGSSRNIHNLGAGIEDIDHGMSLRSNDASLLNLSNALGNHGNSAEGMKDG 1167

Query: 994  XXXXXPRKVATTVNDGLFRVPSNGDFLKDYY----------------RIPGASSSQLNLM 1037
                    ++T+  D LF+VPSNGDFLKDYY                   G S SQL  +
Sbjct: 1168 TSVSNLLNLSTS--DSLFKVPSNGDFLKDYYINNMSNTGLSNLHTSSVNKGPSLSQLGSL 1225

Query: 1038 FMGPGNTGXXXXXXXXXXXXF-------------TVPGFGFTVDASLGLAPLLAWSPEA- 1083
            FM  G+                             + GF F  DASLGLAPLLAWSP+A 
Sbjct: 1226 FMSSGSGTNLPYSNVRGESKHPSGVNLNKQRAQPAMDGFSFAADASLGLAPLLAWSPDAK 1285

Query: 1084 PQ-----------PSMPEIAQNADRRDSDPLSRTRLPSATIPASDPTHVIS--------- 1123
            PQ           P+   + ++ D   ++                P+H  S         
Sbjct: 1286 PQLNSNNGNDGLNPATGIVLESGDNDSTNASVVQLQQHQQQTHHPPSHNSSSIPMGKQSS 1345

Query: 1124 -QDSNNVHLREQYRSNSFNQLYA-------------QDQSL--------DDTAI------ 1155
              D  N H   Q    SF+ +++             Q Q L         DT        
Sbjct: 1346 TSDRQNSH--HQDNVGSFHSMHSPTIPEQTSAQGLHQHQMLGMPNSTLNSDTNTGGANVT 1403

Query: 1156 -TIPTRSHRGPRRRWNSSNGTTVITXXXXXXXXXXXXXXXXXXYKDLFRWQN 1206
             +I + + RGPRRRWN++  ++                       DL RWQN
Sbjct: 1404 NSISSTNRRGPRRRWNNAASSS------------DPNSAGDSSVSDLLRWQN 1443

 Score = 40.8 bits (94), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 18/19 (94%), Positives = 18/19 (94%)

Query: 10 GPRFIRTLGSQSLSGTNPL 28
          GPRFIRTLGSQSLSG NPL
Sbjct: 19 GPRFIRTLGSQSLSGLNPL 37

>ZYRO0G14278g Chr7 complement(1141297..1145049) [3753 bp, 1250 aa]
            {ON} similar to uniprot|Q75DZ4 Ashbya gossypii ABL121C
            ABL121Cp and similar to YMR280C uniprot|P39113
            Saccharomyces cerevisiae YMR280C CAT8 Zinc cluster
            transcriptional activator
          Length = 1250

 Score =  805 bits (2078), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 507/1187 (42%), Positives = 636/1187 (53%), Gaps = 158/1187 (13%)

Query: 10   GPRFIRTLGSQSLSG----------TNPLXXXXXXXXXXXXXXRT---NNSAAPNAARS- 55
            GPR+IRTLGSQSL G          T+P               ++     S++ NA R  
Sbjct: 24   GPRYIRTLGSQSLGGLAGSNSSRSSTSPPYEQDDDSKESSSVPQSASMTGSSSQNAQREG 83

Query: 56   --ISPVTSATPTSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFP 113
                 + S   + N RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECK+SD+LSRRAFP
Sbjct: 84   GGNGSIASPAGSQNLRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDRLSRRAFP 143

Query: 114  RGYXXXXXXXXXXXXXXXXXXXXXCDLKDEQMHLVSKYSSNKRHEPSS--TEEGRMLEQL 171
            RGY                     CD+K++Q+HL S+     +H P     ++ RML +L
Sbjct: 144  RGYTETLEERVRELEAENRRLVALCDIKEQQIHLFSQ-----QHSPGGRRKDDERMLREL 198

Query: 172  SNSDGGSLRVSSTNLYLLNKTT-------------PAVQDGSELHKCQGLGCNHASHPHL 218
             +++GGSL +SSTNLYLLN  +                Q   + H C GL C       L
Sbjct: 199  QSANGGSLNISSTNLYLLNTGSHQRQGPQGPQQQEQLTQQKRQPHVCDGLCCAGK----L 254

Query: 219  HEKPVSTSLSDPAAISFEQNEAPGLPAVKALNTMANHEYSAQLAYLVALSVPRSTDEILF 278
            H KPVST+L+DP ++SFEQ+EAPGLPAV+AL ++A  E S QLA LVALSVPRST+EILF
Sbjct: 255  HVKPVSTNLNDPTSVSFEQSEAPGLPAVQALTSVATREQSNQLATLVALSVPRSTEEILF 314

Query: 279  IPQLLARLGQVHGLTSKQCXXXXXXXXXXXXXX-QTSFQGSPDYKDLKDKSLWEIDDCMT 337
            IPQLLAR+ Q++G TSKQC               +         + L   +LWE+DD   
Sbjct: 315  IPQLLARIRQIYGFTSKQCLYTVSLLSSLKSSLPEPHLVKHEPLETLASTNLWEMDDLEQ 374

Query: 338  FFKTGCKFNL-----TSSKDAXXXXXXXXXXXXXXYFGECHALIPVLNEAEFYKYYNKFK 392
            FF    KF L     +S K                +F      IP+L + EFY Y+N+FK
Sbjct: 375  FFAEIFKFKLESKSPSSYKGGAQLNLSEIEELISIFFEHSSIHIPILVKDEFYHYFNQFK 434

Query: 393  SNLTTDPEFFKT--STPSF-AQRSKSISYKIFACILLVICQFGLMAKVKREQLPTKNKFS 449
             N+  + EF KT    P+  A+R K ISYKIF CI+L++CQ GL++K+K E L   +K  
Sbjct: 435  ENVLQNLEFLKTPLQGPALTARRGKIISYKIFGCIILMLCQLGLLSKIKAENLGATSKHH 494

Query: 450  LLMSYYSNALLALKTNPYFSVKNXXXXXXXXXXXXXXXXXNVGEVSSVYEIRGTVVSMAQ 509
             L SYY  A+  +  NPYF V +                 N+G VS++YE+RG VVSMAQ
Sbjct: 495  RLASYYHKAISLVYMNPYFGVLSTSLQSLQFLSLVLFYFLNIGNVSAIYELRGRVVSMAQ 554

Query: 510  QLRLHRCPSAVLGTEGSTMSKSEQGDRRLLFWGIYYLDVFGALQLGVPRLLKDHEIECAL 569
            QLRLHRCPSAVLG  GSTM+K EQGDRR+LFWGIYYLDVF ALQLGVPRL+KD EIECAL
Sbjct: 555  QLRLHRCPSAVLGGAGSTMNKREQGDRRVLFWGIYYLDVFSALQLGVPRLIKDFEIECAL 614

Query: 570  PISEHAHAGVSLADQVIKLEGQVSELSLSLLRFSKILGNILDSIFKRGMTSSAAQQVALI 629
            P++++    V+LA Q I+LEGQV+  SL+++RFSK+LGNILDSIFKRGMT S  +QV+LI
Sbjct: 615  PVADNDDRTVNLAGQQIRLEGQVTNYSLAIIRFSKVLGNILDSIFKRGMTESITKQVSLI 674

Query: 630  HENALDNWRRGLPKNLTFELDVNGTIKIEELTGSAQNNQDFTKNASSDKKILMLLYFLVK 689
            HENALDNWR GLPK L FELDVNGTI I+E     Q N    +   S+   L+++YFL K
Sbjct: 675  HENALDNWRHGLPKELIFELDVNGTINIDEFNRLKQMNVTVER---SENMTLLVMYFLAK 731

Query: 690  CLVHLPVLAAKPLLGGSSEPDKDAT-------------PXXXXXXXXXXXXXXXYVLLQQ 736
            C++HLPV+A +PL    S    + +             P               YVLLQQ
Sbjct: 732  CMIHLPVVATRPLPTNDSNDTGETSNATSNGNNVRARDPSTERNQAAADRSSSSYVLLQQ 791

Query: 737  ATNTFLSVQSCFKTRHLPLAIDLPRIKARFALLSARGILEYTKGGALFQDNXXXXXXXXX 796
            ATNT L+V    KT  LPL +++ R KARFALLSARG LEYTKGGALF DN         
Sbjct: 792  ATNTMLNVLESLKTLFLPLPLNISRTKARFALLSARGSLEYTKGGALFLDNKSLLLDVIK 851

Query: 797  XXXXXXXXXXPGSLSWHSLILLDMATLLIMQPPQTKTDKLDKLLETRLNYYNKLMGRSTL 856
                      PG +SW+SL LLDM+  L++QPP T+  KLD+LL+ +LNYYN+LMGR T+
Sbjct: 852  DLEEDRKLDLPGVISWNSLKLLDMSINLLLQPPNTEVGKLDRLLKKKLNYYNRLMGRPTV 911

Query: 857  TSNGKRKNEENDATSKVSKLTPLSS--EYNTPSDKRIKVESIGSSGNVPSNSESVHHFDD 914
                     + +  SK   LTP SS  E +TP+ KRIK+E       VP   + +     
Sbjct: 912  ---------KQEPASKGHDLTPASSKDEEDTPAAKRIKIEETSIPLAVPQQQQHMQAPAP 962

Query: 915  IQNDK-----------------FSTNWPSNNPQPNAIAEAFHLDPVLNGN-PFSNGDLTA 956
            +   +                              A AEA  LDPVLN N  F N   T 
Sbjct: 963  VMVQEKQQPQPQPQPQPQPQPQLQPQPQQLQLPQTAFAEALQLDPVLNSNVSFQNAPPTT 1022

Query: 957  FFNSDNGIPQIGGGSSVLNLAGIXXXXXXXXXXXXXXXXXXXPR--KVATTVND---GLF 1011
             ++  +  P                                 P+   + T  +D   GLF
Sbjct: 1023 LYDGPHDQPH-----------------------QYQHHAQTQPQDPHLDTRSSDKLHGLF 1059

Query: 1012 RVPSNGDFLKD-------------------------YYRIPGASS--------SQLNL-- 1036
            +VPS  DFL D                         Y   PG+ S        S LNL  
Sbjct: 1060 KVPSTADFLMDDSANSQLNFLLGTTELGVLDPSQPSYTNNPGSGSAIGINNMPSGLNLSN 1119

Query: 1037 MFMGPGNTGX-XXXXXXXXXXXFTVPGFGFTVDASLGLAPLLAWSPE 1082
            +F   G+T                  GF F VDASLGLAPLLAW+P+
Sbjct: 1120 LFDLEGSTDQPPTNTNATQATQANSGGFNFAVDASLGLAPLLAWTPD 1166

>Suva_13.468 Chr13 complement(809712..812654,812694..814007) [4257
           bp, 1418 aa] {ON} YMR280C (REAL)
          Length = 1418

 Score =  612 bits (1577), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 368/945 (38%), Positives = 497/945 (52%), Gaps = 129/945 (13%)

Query: 5   ENESFGPRFIRTLGSQSLSGTNPLXXXXXXXXXXXXXXRTNNSAAPNAARSI-------- 56
           + +   PR IRTLGSQ+L  TN                  N  A PN + +I        
Sbjct: 6   DRQGLEPRIIRTLGSQTLGTTN------------APHKALNTEANPNFSENIKEALIKTN 53

Query: 57  SPVTSATPTSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGY 116
           SP   +TP   YR+AQACDRCRSKKTRCDGKRPQCSQCAAVGFEC++SDKL R+A+P+GY
Sbjct: 54  SPTPLSTPI--YRIAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLLRKAYPKGY 111

Query: 117 XXXXXXXXXXXXXXXXXXXXXCDLKDEQMHLVSKYSSNKRHEPSSTEEGRMLEQLSNSDG 176
                                CD+K++Q++LVS+        P+S +         +   
Sbjct: 112 TESLEERVRELEAENKRLLALCDIKEQQINLVSQ-----SRPPTSLDNTVSDNFKQDLKD 166

Query: 177 GSLRVSSTNLYLLNKTT-PAVQDGS---------------------ELHKCQGLGCNHAS 214
             L +SSTN+YLLN+T    +Q+G                      + H C G+ C +  
Sbjct: 167 APLNLSSTNIYLLNQTVNKQLQNGKIDTNRSDSTMGLLATSPPLPQKDHVCDGVSCTN-- 224

Query: 215 HPHLHEKPVSTSLSDPAAISFEQNEAPGLPAVKALNTMANHEYSAQLAYLVALSVPRSTD 274
             +LH KP STSL+DP AISFEQNEAPGLPAVKAL +M  H+ S QLA LV+LS+PRST+
Sbjct: 225 --NLHAKPTSTSLNDPTAISFEQNEAPGLPAVKALKSMTTHQRSTQLATLVSLSIPRSTE 282

Query: 275 EILFIPQLLARLGQVHGLTSKQCXXXXXXXXXXX----------XXXQTSFQGSPDYKDL 324
           EILFIPQLL R+ Q+ G  SKQC                         T  + + D K L
Sbjct: 283 EILFIPQLLTRIRQIFGFNSKQCLYTVSLLSSLKNRLPAPKLLLSSTSTKIKENDDSKFL 342

Query: 325 ---KDKSLWEIDDCMTFFKTGCKFNLTSSKDAXXXXXXXXXXXXXXYFGECHAL------ 375
              +  SL E  D   F     KF++ S  +                  E   L      
Sbjct: 343 NTFETTSLAEFGDLKKFL-ISLKFDINSFSNQQPEVQNNKSDNDLLSLNEIKELLHLFFK 401

Query: 376 -----IPVLNEAEFYKYYNKFKSNLTTDP-EFFKTSTPSFAQRSKSISYKIFACILLVIC 429
                + +LN   F  Y+N F   +   P E  KT+     +   + +++IFA  LL++ 
Sbjct: 402 FWSNQVSILNNDHFLLYFNNFVEVIKALPLELKKTNG---TKTHATTNHQIFALKLLIML 458

Query: 430 QFGLMAKVKREQLP------TKNKFSLLMSYYSNALLALKTNPYF-SVKNXXXXXXXXXX 482
           Q GL+ KVKRE++         +KF+ LM YY      +  NPYF ++            
Sbjct: 459 QMGLLIKVKREKIKDTVPGNQNSKFAKLMVYYHQVSSIIPKNPYFLNMSTTSLPSLQLLS 518

Query: 483 XXXXXXXNVGEVSSVYEIRGTVVSMAQQLRLHRCPSAVLGTEGS-TMSKSEQGDRRLLFW 541
                  NVG++ ++Y +RG +VSM+QQLRLHRCPSAVL    +  + + EQ +RRLLFW
Sbjct: 519 LTSFYFLNVGDIPAIYGLRGRIVSMSQQLRLHRCPSAVLSVHSNPVLQRFEQSERRLLFW 578

Query: 542 GIYYLDVFGALQLGVPRLLKDHEIECALPISEHAHAGVSLADQV-------------IKL 588
            +YY+DVF +LQLGVPRLLKD +IECALPIS+     V   DQ+             I+L
Sbjct: 579 AVYYIDVFASLQLGVPRLLKDFDIECALPISD-----VEFEDQLASENEKTKNKTKKIQL 633

Query: 589 EGQVSELSLSLLRFSKILGNILDSIFKRGMTSS-AAQQVALIHENALDNWRRGLPKNLTF 647
           +GQVS  SL ++RF+KILGNILDSIFKRGM       +VAL+HENALDNWR  LP+   F
Sbjct: 634 QGQVSSFSLQIIRFAKILGNILDSIFKRGMMDERVTSEVALVHENALDNWRNQLPEMYYF 693

Query: 648 ELDVNGTIKIEELTGSAQNNQDFTKNASS----DKKILMLLYFLVKCLVHLPVLAAKPL- 702
           ++ VNGT+ ++++  +   N +   +       +K +L+L YFL K ++HLPV+A KPL 
Sbjct: 694 QITVNGTVNLDDIRANNSRNTEAKFDRKDIICFEKNVLLLFYFLAKSMIHLPVIATKPLP 753

Query: 703 --LGGSSEP-------------DKDATPXXXXXXXXXXXXXXXYVLLQQATNTFLSVQSC 747
             +  S++              ++D +                Y++LQQATN  L++   
Sbjct: 754 KTVDNSTKKKHSMFNNDTKSINNQDHSVVDVDMTSPAIRTSSSYIILQQATNATLTLFQS 813

Query: 748 FKTRHLPLAIDLPRIKARFALLSARGILEYTKGGALFQDNXXXXXXXXXXXXXXXXXXXP 807
             + +LPL +++ R   RF+LL ARG LEYTKGGALF DN                   P
Sbjct: 814 INSVYLPLPLNVSRTLIRFSLLCARGSLEYTKGGALFLDNKNLLLDTIKDIENDRLLDLP 873

Query: 808 GSLSWHSLILLDMATLLIMQPPQTKTDKLDKLLETRLNYYNKLMG 852
           G  SWH+L L DM   L+++ P  K ++LDK LE +LNYYN+LMG
Sbjct: 874 GVASWHTLKLFDMTINLLLKAPNVKVERLDKFLEKKLNYYNRLMG 918

>YMR280C Chr13 complement(827028..831329) [4302 bp, 1433 aa] {ON}
           CAT8Zinc cluster transcriptional activator necessary for
           derepression of a variety of genes under
           non-fermentative growth conditions, active after diauxic
           shift, binds carbon source responsive elements
          Length = 1433

 Score =  606 bits (1563), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 378/953 (39%), Positives = 501/953 (52%), Gaps = 138/953 (14%)

Query: 5   ENESFGPRFIRTLGSQSLSGTNPLXXXXXXXXXXXXXXRTNNSAA-----PNAARSISPV 59
           + +   PR IRTLGSQ+LSG                  RT++S A      N   ++   
Sbjct: 7   DRQGLEPRVIRTLGSQALSGP-------------SISNRTSSSEANPHFSKNVKEAMIKT 53

Query: 60  TSATPTSN--YRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGYX 117
            S TP S   YR+AQACDRCRSKKTRCDGKRPQCSQCAAVGFEC++SDKL R+A+P+GY 
Sbjct: 54  ASPTPLSTPIYRIAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLLRKAYPKGYT 113

Query: 118 XXXXXXXXXXXXXXXXXXXXCDLKDEQMHLVSKYSSNKRHEPSSTEEGRMLEQLSNSDGG 177
                               CD+K++Q+ LVS+  S  +    +T  G     L ++   
Sbjct: 114 ESLEERVRELEAENKRLLALCDIKEQQISLVSQ--SRPQTSTDNTINGNFKHDLKDA--- 168

Query: 178 SLRVSSTNLYLLNKTT-PAVQDGS---------------------ELHKCQGLGCNHASH 215
            L +SSTN+YLLN+T    +Q+G                      + H C G+ C +   
Sbjct: 169 PLNLSSTNIYLLNQTVNKQLQNGKMDGDNSGSAMSPLGAPPPPPHKDHLCDGVSCTN--- 225

Query: 216 PHLHEKPVSTSLSDPAAISFEQNEAPGLPAVKALNTMANHEYSAQLAYLVALSVPRSTDE 275
            HLH KP STSL+DP AISFEQ+EAPGLPAVKAL +M  H+ S QLA LV+LS+PRST+E
Sbjct: 226 -HLHVKPTSTSLNDPTAISFEQDEAPGLPAVKALKSMTTHQRSTQLATLVSLSIPRSTEE 284

Query: 276 ILFIPQLLARLGQVHGLTSKQCXXXXXXXXXXXXXXQTSFQGSPD--------------- 320
           ILFIPQLL R+ Q+ G  SKQC                    +P                
Sbjct: 285 ILFIPQLLTRIRQIFGFNSKQCLYTVSLLSSLKNRLPAPRLLAPSTSTKLKEKDEDKKLD 344

Query: 321 -----YKDLKDKSLWEIDDCMTFFKTGCKFNLTS----------SKDAXXXXXXXXXXXX 365
                 K  +  +L E  D   F     KFN+ S           +D             
Sbjct: 345 DDSAFVKRFQSTNLSEFVDLKKFL-ISLKFNINSFSKQSEKPANDQDDELLSLTEIKELL 403

Query: 366 XXYFGECHALIPVLNEAEFYKYYNKFKS---NLTTDPEFFKTSTPSFAQRSKSISYKIFA 422
             +F      +P+LN   F  Y+N F     +L+T+       T +  + + + +++IFA
Sbjct: 404 HLFFKFWSNQVPILNNDHFLIYFNNFVEVVKHLSTE----NLETNNTTKSTVTTNHEIFA 459

Query: 423 CILLVICQFGLMAKVKREQLPT------KNKFSLLMSYYSNALLALKTNPYF-SVKNXXX 475
             LL++ Q GL+ K+K E++        K K++ LM+YY    L +  NPYF ++     
Sbjct: 460 LKLLMMLQMGLLVKIKMEKIKYTVPKNPKAKYARLMAYYHQLSLIIPKNPYFLNMSTTSL 519

Query: 476 XXXXXXXXXXXXXXNVGEVSSVYEIRGTVVSMAQQLRLHRCPSAVLGTEGS-TMSKSEQG 534
                         NVG++S++Y +RG +VSMAQQLRLHRCPSAVL    +  + K EQ 
Sbjct: 520 PSLQLLSLASFYYLNVGDISAIYGVRGRIVSMAQQLRLHRCPSAVLSVHSNPVLQKFEQS 579

Query: 535 DRRLLFWGIYYLDVFGALQLGVPRLLKDHEIECALPISEHAHAGVSLADQV--------- 585
           +RRLLFW IYY+DVF +LQLGVPRLLKD +IECALPIS+     V   DQ+         
Sbjct: 580 ERRLLFWAIYYVDVFASLQLGVPRLLKDFDIECALPISD-----VEYKDQLSMENEKADK 634

Query: 586 ----IKLEGQVSELSLSLLRFSKILGNILDSIFKRGMTSS-AAQQVALIHENALDNWRRG 640
               I+L+GQVS  SL ++RF+KILGNILDSIFKRGM       +VAL+HENALDNWR  
Sbjct: 635 KAKKIQLQGQVSSFSLQIIRFAKILGNILDSIFKRGMMDERITSEVALVHENALDNWRNQ 694

Query: 641 LPKNLTFELDVNGTIKIEELTGSAQNNQDFTKNASSD-----KKILMLLYFLVKCLVHLP 695
           LP+   F++ VNGT+ ++E+  + Q N + TK    D     KKIL+L YFL K ++HLP
Sbjct: 695 LPEMYYFQITVNGTVNLDEIRATNQRNTE-TKFDKKDIILFEKKILLLFYFLAKSMIHLP 753

Query: 696 VLAAKPLLGGSSEPDK----------------DATPXXXXXXXXXXXXXXXYVLLQQATN 739
           V+A KPL        K                D                  Y++LQQATN
Sbjct: 754 VIATKPLPKNVDNATKKKQSMFNNDSKGATNQDHMILDVDMTSPAIRTSSSYIILQQATN 813

Query: 740 TFLSVQSCFKTRHLPLAIDLPRIKARFALLSARGILEYTKGGALFQDNXXXXXXXXXXXX 799
             L++     + +LPL +++ R   RF+LL ARG LEYTKGGALF DN            
Sbjct: 814 ATLTIFQAINSMYLPLPLNVSRTLIRFSLLCARGSLEYTKGGALFLDNKNLLLDTIKDIE 873

Query: 800 XXXXXXXPGSLSWHSLILLDMATLLIMQPPQTKTDKLDKLLETRLNYYNKLMG 852
                  PG  SWH+L L DM+  L+++ P  K ++LDK LE +LNYYN+LMG
Sbjct: 874 NDRLLDLPGIASWHTLKLFDMSINLLLKAPNVKVERLDKFLEKKLNYYNRLMG 926

>Smik_13.493 Chr13 complement(810035..814336) [4302 bp, 1433 aa]
           {ON} YMR280C (REAL)
          Length = 1433

 Score =  602 bits (1552), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 375/944 (39%), Positives = 495/944 (52%), Gaps = 120/944 (12%)

Query: 5   ENESFGPRFIRTLGSQSLSGTNPLXXXXXXXXXXXXXXRTNNSAAPNAARSISPVTSATP 64
           + +   PR IRTLGSQ+LSG N                  N+ ++ N   ++   TS TP
Sbjct: 7   DRQGLEPRVIRTLGSQALSGPN--------ISNRTLSSEANSHSSENTKDAMIKTTSPTP 58

Query: 65  TSN--YRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGYXXXXXX 122
            S   YR+AQACDRCRSKKTRCDGKRPQCSQCAAVGFEC++SDKL R+A+P+GY      
Sbjct: 59  LSTPIYRIAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLLRKAYPKGYTESLEE 118

Query: 123 XXXXXXXXXXXXXXXCDLKDEQMHLVSKYSSNKRHEPSSTEEGRMLEQLSNSDGGSLRVS 182
                          CD+K++Q+ LVS+  S       +T  G   ++L +     L +S
Sbjct: 119 RVRELEAENKRLLALCDIKEQQISLVSQ--SRPPTSMDNTANGSFKQELKD---APLNLS 173

Query: 183 STNLYLLNKTT-PAVQDGS---------------------ELHKCQGLGCNHASHPHLHE 220
           STN+YLLN+T    +Q+G                      + H C G+ C +    HLH 
Sbjct: 174 STNIYLLNQTVNKQLQNGKMDSDNSNTVMNSLAAAPLPPQKDHVCDGISCTN----HLHV 229

Query: 221 KPVSTSLSDPAAISFEQNEAPGLPAVKALNTMANHEYSAQLAYLVALSVPRSTDEILFIP 280
           KP STSL+DP AISFEQ+EAPGLPAVKAL  M  H+ S QLA LV+LS+PRST+EILFIP
Sbjct: 230 KPTSTSLNDPTAISFEQDEAPGLPAVKALKLMTTHQRSTQLATLVSLSIPRSTEEILFIP 289

Query: 281 QLLARLGQVHGLTSKQCXXXXXXXXXXXXXXQTSFQGSPDYK-DLKDKSLWEI-DDCMTF 338
           QLL R+ Q+ G  SKQC                     P     LK+K   +I DD   F
Sbjct: 290 QLLTRIRQIFGFNSKQCLYTVSLLSSLKNRLPAPRLLPPSTSTKLKEKGEDKILDDDSAF 349

Query: 339 FK-----------------TGCKF----------NLTSSKDAXXXXXXXXXXXXXXYFGE 371
           FK                    KF          NL +  D               +F  
Sbjct: 350 FKKFQTTNLSEFVDLKGFLVSLKFDIDSFSKQSENLPNDHDNELLSLTEIKELLHLFFKF 409

Query: 372 CHALIPVLNEAEFYKYYNKFKSNLTTDPEFFKTSTPSFAQRSKSISYKIFACILLVICQF 431
               +P+LN   F  Y+N F   +  D       T        + ++++FA  L ++   
Sbjct: 410 WSNQVPILNNDHFLLYFNNFVE-VVKDLSSANLKTNVTNTSIVTTNHELFALKLSMMLLM 468

Query: 432 GLMAKVKREQLPT------KNKFSLLMSYYSNALLALKTNPYF-SVKNXXXXXXXXXXXX 484
           GL+ K+K E++         +K++ LM+YY    L +  NPYF ++              
Sbjct: 469 GLLVKIKMEKIKYTVPKNPNSKYARLMAYYHQLSLIIPKNPYFLNMSTTSLPSLQLLSLA 528

Query: 485 XXXXXNVGEVSSVYEIRGTVVSMAQQLRLHRCPSAVLGTEGS-TMSKSEQGDRRLLFWGI 543
                NVG++S++Y +RG +VSMAQQLRLHRCPSAVL    +  + K EQ +RRLLFW I
Sbjct: 529 SFYYLNVGDISAIYGVRGRIVSMAQQLRLHRCPSAVLSVHSNPVLQKFEQSERRLLFWAI 588

Query: 544 YYLDVFGALQLGVPRLLKDHEIECALPISEHAHAGVSLADQV-------------IKLEG 590
           YY+DVF +LQLGVPRLLKD +IECALPIS+     V   DQ+             I+L+G
Sbjct: 589 YYVDVFASLQLGVPRLLKDFDIECALPISD-----VEYKDQLFMENKKTNKKAKKIQLQG 643

Query: 591 QVSELSLSLLRFSKILGNILDSIFKRGMTSS-AAQQVALIHENALDNWRRGLPKNLTFEL 649
           QVS  SL ++RF+KILGNILDSIFKRGM       +VAL+HENALDNWR  LPK   F++
Sbjct: 644 QVSSFSLQIIRFAKILGNILDSIFKRGMMDERITSEVALVHENALDNWRSQLPKMYYFQI 703

Query: 650 DVNGTIKIEELTGSAQNNQDFTKNASSD-----KKILMLLYFLVKCLVHLPVLAAKPLL- 703
            VNGT+ ++E+  +   N + T+    D     KKIL+L YFL K ++HLPV+A KPL  
Sbjct: 704 TVNGTVNLDEIRVNDSKNIE-TRFEKKDIILFEKKILLLFYFLAKSMIHLPVIATKPLPK 762

Query: 704 ---GGSSEP------------DKDATPXXXXXXXXXXXXXXXYVLLQQATNTFLSVQSCF 748
               G+ +             D+D                  Y++LQQATN  L +    
Sbjct: 763 NIDNGTKKKQSVFSNDSKGSNDQDHMIVDVDMTSPAIRTSSSYIILQQATNATLMIFQTI 822

Query: 749 KTRHLPLAIDLPRIKARFALLSARGILEYTKGGALFQDNXXXXXXXXXXXXXXXXXXXPG 808
              ++PL +++ R   RF+LL ARG LEYTKGGALF DN                   PG
Sbjct: 823 NWMYIPLPLNVSRTLIRFSLLCARGSLEYTKGGALFLDNKNLLLDTIKDIENDRLLDLPG 882

Query: 809 SLSWHSLILLDMATLLIMQPPQTKTDKLDKLLETRLNYYNKLMG 852
           + SWH+L L DM   L+++ P  K ++LDK LE +LNYYN+LMG
Sbjct: 883 TASWHTLKLYDMTINLLLKAPNVKVERLDKFLEKKLNYYNRLMG 926

>NCAS0C00390 Chr3 (57333..60827) [3495 bp, 1164 aa] {ON} Anc_8.845
          Length = 1164

 Score =  590 bits (1521), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 364/940 (38%), Positives = 497/940 (52%), Gaps = 111/940 (11%)

Query: 66  SNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGYXXXXXXXXX 125
           SN R+AQACDRCRSKKTRCDGKRPQCSQCA VGFECK+SDKL R++FPRGY         
Sbjct: 73  SNLRIAQACDRCRSKKTRCDGKRPQCSQCAIVGFECKISDKLQRKSFPRGYTETLEEKVR 132

Query: 126 XXXXXXXXXXXXCDLKDEQMHLVSKYSSNKRHEPSSTEEGRMLEQLSNSDGGSLRVSSTN 185
                       C     Q         N   + S+T+E          +  S+R +S  
Sbjct: 133 ELENENRRLLAICQFNKLQSQ------KNDTIDNSTTQE----------EVYSIRSNSA- 175

Query: 186 LYLLNKTTPAVQDGSELHKCQGLGCNHASHPHLHEKPVSTSLSDPAAISFEQNEAPGLPA 245
                 ++ A++  S +  C    CN+ +H HLH KPVST       ISFEQNEAPGL A
Sbjct: 176 ------SSTAIETDSNITTCLDTNCNNDTHNHLHMKPVSTK-PPQNIISFEQNEAPGLSA 228

Query: 246 VKALNTMANHEYSAQLAYLVALSVPRSTDEILFIPQLLARLGQVHGLTSKQCXXXXXXXX 305
           VKAL +MANHE S QLA LVAL++PRSTDEILFIPQLL+++ Q  G TSK C        
Sbjct: 229 VKALKSMANHEQSTQLATLVALAIPRSTDEILFIPQLLSKIRQNFGFTSKHCLYTVSLLS 288

Query: 306 XXX------XXXQTSFQGSPDY-KDLKDKSLWEIDDCMTFFKTGCKFNLTSSKDAXXXXX 358
                         + + +      LK  +LW+ DD   F     K +  + K++     
Sbjct: 289 SLKPNLPPPKMIANNLEMTKKLLNQLKITNLWKFDDLSQFINQYLKLDPLNQKNSNDLLN 348

Query: 359 XXXXXXXXXYF-GECHALIPVLNEAEFYKYYNKFKSNLTTDPEFFKTSTPSFAQRSKSIS 417
                    +F  + + +IP++N+ EF   YN FK +L       K S       +  ++
Sbjct: 349 QIEMDELINFFFQDWNDIIPIINKEEFLSNYNAFKLDL-------KNSERDKLSSNLKMN 401

Query: 418 YKIFACILLVICQFGLMAKVKREQLPTKNKFSL--LMSYYSNALLALKTNPYFSVKNXXX 475
           YKIF CIL+++CQ GL+ K+K     +     L  +M+YY   +  L  N +F +     
Sbjct: 402 YKIFGCILVLMCQMGLLTKIKATNGKSSPNIHLKSIMAYYHQLIANLPINNFFQIATISI 461

Query: 476 XXXXXXXXXXXXXXNVGEVSSVYEIRGTVVSMAQQLRLHRCPSAVLGTEGSTMSKSEQGD 535
                         NVG++S++YE+RG ++SM+QQLRLHRCPSAVL     TM+K +Q +
Sbjct: 462 PQLKLYVLILFYNLNVGDISAIYELRGRIISMSQQLRLHRCPSAVLSGSSLTMNKLDQSN 521

Query: 536 RRLLFWGIYYLDVFGALQLGVPRLLKDHEIECALPISEHAHAGVSLADQV-IKLEGQVSE 594
           RR+LFW IY LD   +LQLGVPRLLKD+EIECALPI+          D+  IKLEG VS 
Sbjct: 522 RRILFWTIYSLDALSSLQLGVPRLLKDYEIECALPITMEDKE----RDKTKIKLEGTVSP 577

Query: 595 LSLSLLRFSKILGNILDSIFKRGMTSSAAQQVALIHENALDNWRRGLPKNLTFELDVNGT 654
            SL++ RFSKILGNILD IFKR MT S  + V+LIHENALD WR  LP++LTF+L++ G+
Sbjct: 578 FSLAIFRFSKILGNILDMIFKRNMTESMTKSVSLIHENALDQWRYDLPEDLTFKLNIQGS 637

Query: 655 IKIEELTGSAQNNQDFTKNASSDKK--ILMLLYFLVKCLVHLPVLAAKPLLGGSSEPDKD 712
           I +  +            N++  KK  ILM  YF    ++HLPV+AA+PL   ++ PD+ 
Sbjct: 638 IDLNVMHQG---------NSTPGKKNLILMFFYFFAVSMIHLPVVAARPLDVKNAMPDRS 688

Query: 713 ATPXXXXXXXXXXXXXXXYVLLQQATNTFLSVQSCF----KTRHLPLAIDLPRIKARFAL 768
           ++                Y+ LQ A NT L+V        K  +LP+ I++ R++ R AL
Sbjct: 689 SS---------------SYIALQHAINTMLNVLELLNNQPKNYYLPVPINMSRLQIRSAL 733

Query: 769 LSARGILEYTKGGALFQDNXXXXXXXXXXXXXXXXXXXPGSLSWHSLILLDMATLLIMQP 828
           +S+RG+L+Y KGGALF DN                   PG +SWHSL L D+   L +Q 
Sbjct: 734 ISSRGMLDYIKGGALFLDNKTLLLQVIKNLERDRTLDLPGVVSWHSLKLFDLTITLFIQN 793

Query: 829 PQTKTDKLDKLLETRLNYYNKLMGR------STLTSNGKRKNEENDATSKVSKLTPLSSE 882
              K +KLDK+LE + NYYNKLMG+      +   S+ KRK E    T ++S  +P S  
Sbjct: 794 SNIKLEKLDKILEKKSNYYNKLMGKPTSNNTNNNISSKKRKQE----TIEISTPSPTSPP 849

Query: 883 YNTPSDKRIKVESIGSSGNVPSNSESVHHFDDIQNDKFSTNWPSNNPQPNAIAEAFHLDP 942
               S K      I  S  +PS +   ++ +                    +A+A   DP
Sbjct: 850 LKKMSKK--SKSPILQSTILPSQTLQNYNNNIQN----------------QLADALQFDP 891

Query: 943 VLNGNP--FSNGDLTAFFNSDNG-----IPQIGGGSSVLN 975
           +LN N   FSN DL+ +F  +       +P++   ++V N
Sbjct: 892 ILNSNSYNFSNFDLSNYFQPNENEKTVQLPKLTTNNNVTN 931

>Skud_13.452 Chr13 complement(800289..804587) [4299 bp, 1432 aa]
           {ON} YMR280C (REAL)
          Length = 1432

 Score =  594 bits (1531), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 378/946 (39%), Positives = 495/946 (52%), Gaps = 124/946 (13%)

Query: 5   ENESFGPRFIRTLGSQSLSGTNPLXXXXXXXXXXXXXXRTNNSAAPNAARSISPVTSATP 64
           + +   PR IRTLGSQ+LSG+                   N   + N   +    TS TP
Sbjct: 6   DRQGLEPRIIRTLGSQTLSGS--------TVPNRTLSSEANPHFSENIKEATVNTTSPTP 57

Query: 65  TSN--YRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGYXXXXXX 122
            S   YR+AQACDRCRSKKTRCDGKRPQCSQCAAVGFEC++SDKL R+A+P+GY      
Sbjct: 58  LSTPIYRIAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLLRKAYPKGYTESLEE 117

Query: 123 XXXXXXXXXXXXXXXCDLKDEQMHLVSKYSSNKRHEPSSTEEGRMLEQLSNSDGGSLRVS 182
                          CD+K++Q+ LVS+  S       S  +G   ++L +     L +S
Sbjct: 118 RVRELEAENKRLLALCDIKEQQISLVSQ--SRPSTSLDSNVDGNCKKELKD---APLNLS 172

Query: 183 STNLYLLNKTT-PAVQDGS---------------------ELHKCQGLGCNHASHPHLHE 220
           STN+YLLN+T    +Q G                      + H C G+ C +     LH 
Sbjct: 173 STNIYLLNQTVNKQLQSGKMDNDNSDAAIDSLAASPSPPPKDHVCDGVSCTN----RLHV 228

Query: 221 KPVSTSLSDPAAISFEQNEAPGLPAVKALNTMANHEYSAQLAYLVALSVPRSTDEILFIP 280
           KP STSLSDP AISFEQNEAPGLPAVKAL +M  H+ S QLA LV+LS+PRST+EILFIP
Sbjct: 229 KPTSTSLSDPTAISFEQNEAPGLPAVKALKSMTTHQRSTQLATLVSLSIPRSTEEILFIP 288

Query: 281 QLLARLGQVHGLTSKQCXXX--------------------XXXXXXXXXXXQTSFQGSPD 320
           QLL R+ Q+ G  SKQC                                  +T    S  
Sbjct: 289 QLLTRIRQIFGFNSKQCLYTVSLLSSLKNRLPAPSILLPSTSTNSKEKNEDKTPNDDSAF 348

Query: 321 YKDLKDKSLWEIDDCMTFFKTGCKFNLTS----------SKDAXXXXXXXXXXXXXXYFG 370
            K  +  SL E  D   F     KF++ S            D+              +F 
Sbjct: 349 LKTFQSTSLSEFVDLKKFL-ISLKFDIDSFSKQPEKQANGHDSDLLSLTEIKELLHLFFK 407

Query: 371 ECHALIPVLNEAEFYKYYNKFKSNLTTDPEFFKTSTPSFAQRSKSISYKIFACILLVICQ 430
                +P+LN   F  Y+N F   +  D     T   S  + + + +++IF   LL++ Q
Sbjct: 408 FWSNQVPILNNDHFLLYFNNFVE-IIKDFSLISTKANSTTKNNVTTNHEIFTLKLLMMLQ 466

Query: 431 FGLMAKVKREQ----LP--TKNKFSLLMSYYSNALLALKTNPYF-SVKNXXXXXXXXXXX 483
            GL+ K+K+++    +P  +  K+  LMSYY    L +  NPYF ++             
Sbjct: 467 MGLLIKIKKDKIKDTVPRNSNAKYIRLMSYYHQISLIIPKNPYFLNMSTTSLPSLQLLSL 526

Query: 484 XXXXXXNVGEVSSVYEIRGTVVSMAQQLRLHRCPSAVLGTEGS-TMSKSEQGDRRLLFWG 542
                 NVG++S++Y IRG +VSMAQQLRLHRCPSAVL    +  + K EQ +RRLLFW 
Sbjct: 527 ASFYYLNVGDISAIYGIRGRIVSMAQQLRLHRCPSAVLSVHSNPVLQKFEQSERRLLFWA 586

Query: 543 IYYLDVFGALQLGVPRLLKDHEIECALPISEHAHAGVSLADQV-------------IKLE 589
           IYY+DVF +LQLGVPRLLKD +IECALPIS+     V   DQ+             I+L+
Sbjct: 587 IYYVDVFASLQLGVPRLLKDFDIECALPISD-----VEYKDQLSMENEKMKNKAKKIQLQ 641

Query: 590 GQVSELSLSLLRFSKILGNILDSIFKRGMTSS-AAQQVALIHENALDNWRRGLPKNLTFE 648
           GQVS  SL ++RF+KILGNILDSIFKRGM     + +VAL+HENALDNWR  LP+   F+
Sbjct: 642 GQVSSFSLQIIRFAKILGNILDSIFKRGMMDERISSEVALVHENALDNWRNQLPEMYYFK 701

Query: 649 LDVNGTIKIEELTGSAQNNQDF-----TKNAS-SDKKILMLLYFLVKCLVHLPVLAAKPL 702
           + VNGT+ ++E+   A N++D      TK+    +KKIL+L YFL K ++HLPV+A KPL
Sbjct: 702 ITVNGTVNLDEI--RANNSRDIETPFETKDIILFEKKILLLFYFLAKSMIHLPVIATKPL 759

Query: 703 LGGSSEPDK----------------DATPXXXXXXXXXXXXXXXYVLLQQATNTFLSVQS 746
                   K                D                  Y++LQQATN  L++  
Sbjct: 760 SKNVDNVMKKKQSMFNNDSKGTNNHDHMAVDVDMTSPAIRTSSSYIILQQATNATLTIFQ 819

Query: 747 CFKTRHLPLAIDLPRIKARFALLSARGILEYTKGGALFQDNXXXXXXXXXXXXXXXXXXX 806
                +LPL +++ R   RF+LL ARG LEYTKGGALF DN                   
Sbjct: 820 SINWMYLPLPLNVSRTLVRFSLLCARGSLEYTKGGALFLDNKNLLLDTIKDIENDRLLEL 879

Query: 807 PGSLSWHSLILLDMATLLIMQPPQTKTDKLDKLLETRLNYYNKLMG 852
           PG  SWH+L L DM   L+++ P  K ++LDK LE +LNYYN+LMG
Sbjct: 880 PGIASWHTLKLFDMTINLLLKAPNVKVERLDKFLEKKLNYYNRLMG 925

>Ecym_4616 Chr4 complement(1204091..1208824) [4734 bp, 1577 aa] {ON}
            similar to Ashbya gossypii ABL121C
          Length = 1577

 Score =  578 bits (1489), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/739 (44%), Positives = 433/739 (58%), Gaps = 78/739 (10%)

Query: 368  YFGECHALIPVLNEAEFYKYYNKFKSNLTTDPEFFKTSTPSFAQRSKSISYKIFACILLV 427
            +F E ++LIP+ +++EF  Y+ KFK N++T PEFF +    FA+R KSISYKIFAC+L+ 
Sbjct: 606  FFDEWYSLIPIFDKSEFDNYWQKFKENVST-PEFFTSGDTIFAKRHKSISYKIFACLLVT 664

Query: 428  ICQFGLMAKVKREQLPTKNKFSLLMSYYSNALLALKTNPYFSVKNXXXXXXXXXXXXXXX 487
            + Q GLM KVKRE L  ++K ++LM+YY  AL  + TNPYF   +               
Sbjct: 665  VVQMGLMTKVKRENLGRRHKLNILMTYYDRALSHIITNPYFGSNSTSIQSLQLLSLLLFY 724

Query: 488  XXNVGEVSSVYEIRGTVVSMAQQLRLHRCPSAVLGTEGSTMSKSEQGDRRLLFWGIYYLD 547
              NVG++S++YE+RG VVS AQQLRLHRCPSAVLG +G T+S+ +QG+RR+LFWG+YYLD
Sbjct: 725  FLNVGDISNIYELRGKVVSFAQQLRLHRCPSAVLGGDGCTVSRIQQGERRVLFWGVYYLD 784

Query: 548  VFGALQLGVPRLLKDHEIECALPISEHAHAGVSLADQVIKLEGQVSELSLSLLRFSKILG 607
            VF +LQLGVPRLLKDHEIECALP+S  +   V+LA Q+I LEG++S  SLS++RFSK+LG
Sbjct: 785  VFASLQLGVPRLLKDHEIECALPVSSDSDRQVNLAGQMISLEGKMSPFSLSVIRFSKVLG 844

Query: 608  NILDSIFKRGMTSSAAQQVALIHENALDNWRRGLPKNLTFELDVNGTIKIEELTGSAQNN 667
            N+LDSIFKRGMT S  ++VAL+HENALDNWR GLP  L F+LDVNGTI ++E     Q  
Sbjct: 845  NVLDSIFKRGMTISITKEVALVHENALDNWRHGLPDGLRFQLDVNGTINMDEFN---QLK 901

Query: 668  QDFTKNASS----DKKILMLLYFLVKCLVHLPVLAAKPLLGGSSEPDKDATPXXXXXXXX 723
             ++  N +S    +  I M LYFL K ++H+PV+A KP +  S +   D           
Sbjct: 902  HEYLNNDNSKFNKENFIFMTLYFLAKSMIHIPVVAGKPPVDTSVQEKNDPA-----ISRQ 956

Query: 724  XXXXXXXYVLLQQATNTFLSVQSCFKTRHLPLAIDLPRIKARFALLSARGILEYTKGGAL 783
                   Y+LLQQATNTFL+V +  +T +LPL I++ R K RF L SARG LEYTKGGAL
Sbjct: 957  ADRSSSSYILLQQATNTFLNVLTSMRTAYLPLPINISRAKTRFGLFSARGSLEYTKGGAL 1016

Query: 784  FQDNXXXXXXXXXXXXXXXXXXXPGSLSWHSLILLDMATLLIMQPPQTKTDKLDKLLETR 843
            FQDN                   PG++SWHSL L DMA  LI+QPP TK +K +KLL+ +
Sbjct: 1017 FQDNKSLLLNLIKELEVDRKLGIPGTISWHSLKLFDMAINLILQPPNTKPEKEEKLLQKK 1076

Query: 844  LNYYNKL------MGRSTLTSNG---------------------KRKNEENDATSKVSKL 876
            ++YYNKL      M  S +TS                        ++N+ N A  K    
Sbjct: 1077 ISYYNKLIDHSVGMHASVITSAAIQHQRQQQQQQQQQQQQQQLHYKENKGNGAKRKPEIG 1136

Query: 877  TPLSSEYNTPSDKRIKVESIGSSGNVPSNSE--SVHHFDDIQ-----------------N 917
            +  S+  N   +KR+K+E    S  +P+++   S  H DD +                  
Sbjct: 1137 S--STTTNMSLNKRVKMEE--PSVKIPTSNGPLSALHEDDSEMLGKSLRSNTIVSDVPTG 1192

Query: 918  DKFSTNWPSNNPQPNAIAEAFHLDPVLNGNPFSNGDLTAFFNSD-----------NGIPQ 966
             K  +  P +    NAIAEAF LDPVL+  PFS+ DLT+F N +                
Sbjct: 1193 QKMESEIPVSMSATNAIAEAFQLDPVLHATPFSSTDLTSFLNGEVVTNASMFADTMHTTG 1252

Query: 967  IGGG-SSVLNLAGIXXXXXXXXXXXXXXXXXXXPRKVATTVNDGLFRVPSNGDFLKDYYR 1025
            IGGG + V    G+                   P     +  DGLF+VPSNGDFLKDYY 
Sbjct: 1253 IGGGLTDVSGHNGLPSNNSLLNMSSIGFGIGSGPSLANLSSKDGLFKVPSNGDFLKDYYS 1312

Query: 1026 IPGASSSQLNLMFMGPGNT 1044
              G SS+QL  +F+  GNT
Sbjct: 1313 --GMSSAQLASLFVN-GNT 1328

 Score =  285 bits (728), Expect = 5e-78,   Method: Compositional matrix adjust.
 Identities = 172/399 (43%), Positives = 214/399 (53%), Gaps = 105/399 (26%)

Query: 57  SPVTSATPTSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGY 116
           +P++S TP S YRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECK+SDKLSRRAFPRGY
Sbjct: 113 TPLSSMTPMS-YRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGY 171

Query: 117 XXXXXXXXXXXXXXXXXXXXXCDLKDEQMHLVSKYSS----------------------- 153
                                CDLK+EQ+ LVSKYS+                       
Sbjct: 172 TETLEERVRELEAENRRLVALCDLKEEQLRLVSKYSAGSVGVGVGGPVTAGTTVGNRSSV 231

Query: 154 ---------------------------NKR---HEPSSTEEGRMLEQLSNSDGGSLRVSS 183
                                      NK+    + ++ EE R+L+QLS SDGG+LRVSS
Sbjct: 232 NGAVNESASSTVGSIATAGSTAGLAHQNKKCAGSDSTTPEEDRILQQLSKSDGGTLRVSS 291

Query: 184 TNLYLLNKTT--------PAVQDGSEL-----------HKCQGLGCNHAS---------H 215
           TNLYLLNK T        P   + SE             + Q    +H +          
Sbjct: 292 TNLYLLNKKTSGQQQLLLPGSANKSEAFPIQPDSYKLQQRSQSTASSHVADSDNPAEFQK 351

Query: 216 PHLHEK-----PVSTS----------------LSDPAAISFEQNEAPGLPAVKALNTMAN 254
            HL  +     PV+++                L+DP +ISFEQ++APGL AVKAL+TMAN
Sbjct: 352 EHLQPRTLPNIPVASTAIPSAPPGVTAYSLANLNDPTSISFEQDQAPGLSAVKALSTMAN 411

Query: 255 HEYSAQLAYLVALSVPRSTDEILFIPQLLARLGQVHGLTSKQCXXXXXXXXXXXXXXQTS 314
           HE S+QLA LVA+S+PR+T+EILF+PQLLAR+GQVHG TSKQC                 
Sbjct: 412 HEQSSQLATLVAMSIPRTTEEILFVPQLLARIGQVHGFTSKQCLYTASVLASLKEI--VP 469

Query: 315 FQGSPDYKDLKDKSLWEIDDCMTFFKTGCKFNLTSSKDA 353
           +Q SP+ + L+ KSLWEIDD  +F   G +F+  S+  A
Sbjct: 470 YQTSPELELLRSKSLWEIDDVDSFLSKGLRFSFPSATSA 508

 Score = 63.5 bits (153), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 55/180 (30%), Positives = 78/180 (43%), Gaps = 35/180 (19%)

Query: 1062 GFGFTVDASLGLAPLLAWSPEAPQPSMPEIAQNADRRDSDP------------------- 1102
            G+GF VDASLGLA LL WSP+ P      I  +  + DS+P                   
Sbjct: 1400 GYGFVVDASLGLASLLGWSPK-PGNDDAIILGSDPKDDSEPKLNTARSFTTVNKLDMIPT 1458

Query: 1103 -LSRTR----------LPSATIPASDPTHV-ISQDSNNVHLREQYR--SNSFNQLYAQDQ 1148
             +S T+          LPS+  P  +P  + + Q+   +  R+Q+    N     ++ D 
Sbjct: 1459 LMSTTKSTTTAPSDAGLPSSIRPNQNPASIKLVQNPLPLSTRKQFAQAGNPSRYPFSPDL 1518

Query: 1149 SLDDTAITIPTRSHRGPRRRWNSSNGTTVITXXXXXXXXXXXXXXXXXXYKDLFRWQNSG 1208
              +D  +TI TRS RGPRR WN++  +T                       DLF+WQNSG
Sbjct: 1519 LQEDGMLTINTRSPRGPRRYWNNTASST-DQPQIHKNNTQQQSQQLDDNINDLFKWQNSG 1577

 Score = 37.0 bits (84), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 13/24 (54%), Positives = 21/24 (87%)

Query: 1  MGERENESFGPRFIRTLGSQSLSG 24
          +G+++ +++GPR IRTLGSQ+L G
Sbjct: 5  IGKKDKDTYGPRIIRTLGSQALGG 28

>KNAG0J00250 Chr10 (33322..37035) [3714 bp, 1237 aa] {ON} Anc_8.845
            YMR280C
          Length = 1237

 Score =  559 bits (1440), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 344/941 (36%), Positives = 477/941 (50%), Gaps = 122/941 (12%)

Query: 58   PVTSATPTSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGYX 117
            P+ S+ P +  R +QACDRCR KK +CD KRPQCS CA+VGFECK+SDKL+R +FPRGY 
Sbjct: 160  PLLSSRPDAAGRASQACDRCRLKKIKCDLKRPQCSSCASVGFECKLSDKLTRNSFPRGYT 219

Query: 118  XXXXXXXXXXXXXXXXXXXXCDLKDEQMHLVSKYSSNKRHEPSSTEEGRMLEQLSNSDGG 177
                                 DLK++Q+  +          P   +    ++   NS   
Sbjct: 220  ESLEERIRELESENRRLLAMNDLKEQQLFKI----------PEDIQSVVDVDAELNSSN- 268

Query: 178  SLRVSSTNLYLLNKTTPAVQDGSELHKCQGLGCNHASHPHLHEKPVSTS--LSDPAAISF 235
                 + N+Y               H C G+ C       LH +PV+T+  L+DP ++SF
Sbjct: 269  ----QTKNMY-------------ATHVCDGICCQDTK---LHSRPVATNFNLNDPTSVSF 308

Query: 236  EQNEAPGLPAVKALNTMANHEYSAQLAYLVALSVPRSTDEILFIPQLLARLGQVHGLTSK 295
            EQNEAPGL A +A++ ++NHE S QLA LV+LS+PRST+EILFIPQLLA++ QV G TSK
Sbjct: 309  EQNEAPGLMAARAIDQISNHEQSTQLAILVSLSIPRSTEEILFIPQLLAKIRQVFGFTSK 368

Query: 296  QCXXXXXXXXXXX---------XXXQTSFQGSPDYKDLKDKSLWEIDDCMTFFKTGCKFN 346
            QC                       +   Q S ++  L   +LW +++   FF+   K N
Sbjct: 369  QCLYTVSLLSSLKDDLPPPNLLKNSKMILQNSSNFDILTSVNLWHLENLSNFFQNVLKLN 428

Query: 347  LTSSKDAXXX------XXXXXXXXXXXYFGECHALIPVLNEAEFYKYYNKFKSNLTTDPE 400
            +    D                     YF      IP+ NE EF   Y  FK++L     
Sbjct: 429  ILPDDDDHLKKNDDHLALSEIDELVALYFKYWSDSIPIFNEKEFNSNYRVFKADL----- 483

Query: 401  FFKTSTPSFAQRSKSISYKIFACILLVICQFGLMAKVK--REQLPTKNKFSLLMSYYSNA 458
              K S    +     ++ KIF C+L VICQ G++ K K  + + P   KF  L+SYY + 
Sbjct: 484  -MKLSKNGPSSLENILNIKIFGCLLTVICQMGILIKYKNFKNKSP---KFEKLLSYYHHL 539

Query: 459  LLALKTNPYFSVKNXXXXXXXXXXXXXXXXXNVGEVSSVYEIRGTVVSMAQQLRLHRCPS 518
            +  L  N YF V                   N G++  +Y++RG ++SMAQQLRLHRCPS
Sbjct: 540  MYVLPKNSYFGVITTSIKTVQILSLILFYHLNTGDIIQIYDLRGMIISMAQQLRLHRCPS 599

Query: 519  AVLGTEGSTMSKSEQGDRRLLFWGIYYLDVFGALQLGVPRLLKDHEIECALPISEHAHAG 578
            AVL   GS M + EQG+RR LFW IYYLDVF +LQLGVPRL+KDHEIECALP+S   H  
Sbjct: 600  AVLTGSGSKMDRLEQGNRRTLFWCIYYLDVFCSLQLGVPRLIKDHEIECALPLSSEIHNT 659

Query: 579  VSLADQVIKLEGQVSELSLSLLRFSKILGNILDSIFKRGMTSSAAQQVALIHENALDNWR 638
              +    ++LEG +SE SLS++R +K+LGNILDSIFKR M+ S  +QV  IHENALD+WR
Sbjct: 660  DKMDG--VQLEGTMSEFSLSVVRCAKVLGNILDSIFKRNMSESITEQVYTIHENALDSWR 717

Query: 639  RGLPKNLTFELDVNGTIKIEELTGSAQNNQDFTKNASSDKKILMLLYFLVKCLVHLPVLA 698
              LPK   F+L+ NG + +E L     N+++                   K ++++P+ +
Sbjct: 718  TKLPKKYQFKLNANGMVDLEHL-----NHENLILVLLFFLV---------KSMIYMPLSS 763

Query: 699  AKPLLGGSSEPDKDATPXXXXXXXXXXXXXXXYVLLQQATNTFLSVQSCFKTRHLPLAID 758
            A   L  + +   D                  +  LQQ+ N  LSV      ++LPL ++
Sbjct: 764  AITELANNPKVKND----------YYMNHKVSHTSLQQSINALLSVFKNINNQYLPLPLN 813

Query: 759  LPRIKARFALLSARGILEYTKGGALFQDNXXXXXXXXXXXXXXXXXXXPGSLSWHSLILL 818
              R   RFAL+SA+G LEY KGG LF+DN                   PG + WHSL LL
Sbjct: 814  SSRTMTRFALVSAKGSLEYKKGGLLFEDNKVLLLSVIQEIEKDRKLELPGIIPWHSLKLL 873

Query: 819  DMATLLIMQPPQTKTDKLDKLLETRLNYYNKLMGRSTLT----SNGKRKNEENDA-TSKV 873
            D+A  L +  P   +DKL+K L+ ++NYYNK+MG+  +T    S  KRK  + D  T+  
Sbjct: 874  DLAVNLFLLGPTINSDKLEKFLQKKINYYNKIMGKPLITSLPSSKTKRKQSKEDLFTANK 933

Query: 874  SKLTPLSSEYNTPSDKR----IKVESIGSSGNVPSNSESVHHFDDIQNDKFSTNWPSNNP 929
             +   + +E +T   KR    +++      GN   +++S                     
Sbjct: 934  KRKQQVKTELSTLEVKREPQQVQLLKREGQGNTTESTQS--------------------- 972

Query: 930  QPNAIAEAFHLDPVLNGN--PFSNGDLTAFF--NSDNGIPQ 966
               A  EA  LDP+LN N   FS  DL+ FF  N +  +P+
Sbjct: 973  ---AFVEALQLDPILNANIYNFSGTDLSNFFISNQNGDVPR 1010

 Score = 38.1 bits (87), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 27/50 (54%), Gaps = 3/50 (6%)

Query: 1063 FGFTVDASLGLAPLLAWSPEAPQPSMPEIAQNADRRDSDPLSRTRLPSAT 1112
            FG  VDASLGLAPLL  +PE   P  PE   N+D      L+   +P A 
Sbjct: 1126 FGMIVDASLGLAPLLNEAPEI--PGQPEFF-NSDEMSPSQLTGKLMPMAV 1172

>KAFR0B03950 Chr2 complement(823760..827500) [3741 bp, 1246 aa] {ON}
           Anc_8.845 YMR280C
          Length = 1246

 Score =  538 bits (1386), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 321/779 (41%), Positives = 434/779 (55%), Gaps = 70/779 (8%)

Query: 203 HKCQGLGCNHASHPHLHEKPVSTSLSDPAAISFEQNEAPGLPAVKALNTMANHEYSAQLA 262
           H C G+ C    HP    +PV+T+ +DP +ISFEQ+EAPGL A KAL ++ N E + QLA
Sbjct: 243 HVCDGICCTDKLHP----QPVATNYNDPTSISFEQSEAPGLVAAKALKSINNQEEATQLA 298

Query: 263 YLVALSVPRSTDEILFIPQLLARLGQVHGLTSKQCXXXXXXXXXXXXXX---QTSF--QG 317
            LV+LSVPRST+EILFIPQLLA++ QVHG TSKQC                 ++ F    
Sbjct: 299 ILVSLSVPRSTEEILFIPQLLAKIRQVHGFTSKQCLYTVSLLSSLKNSLPSPKSDFLMDN 358

Query: 318 SPDYKDLKDKSLWEIDDCMTFFKTGCKFNLTS-SKDAXXXXXXXXXXXXXXYFGECHALI 376
           S +   LK+ ++W+I+D   FF    KFN+++ SK +              YF     LI
Sbjct: 359 SQNSLLLKNTNIWQINDLNVFFTDLLKFNISNDSKTSTLLSFDDIDDLTNLYFNHWSNLI 418

Query: 377 PVLNEAEFYKYYNKFKSNLTTDPEFFKTSTPSFAQRSKSIS---YKIFACILLVICQFGL 433
           PVLNE EF+  YN FK               SF Q ++S +   YK F C L+V+CQ GL
Sbjct: 419 PVLNEEEFFNRYNNFK-----------IQCQSFIQGNQSNNLRDYKFFGCFLMVMCQMGL 467

Query: 434 MAKVKREQLPTKNKFSLLMSYYSNALLALKTNPYFSVKNXXXXXXXXXXXXXXXXXNVGE 493
           + K+K  +  + N    +++YY      L  NP +                     N+G 
Sbjct: 468 LIKLKEHK--SNNSLFKILTYYHQLTYILPKNPVYDFATTSIKSVQLLALLLFYHLNMGN 525

Query: 494 VSSVYEIRGTVVSMAQQLRLHRCPSAVLGTEGSTMSKSEQGDRRLLFWGIYYLDVFGALQ 553
           +  +YE+RG ++SMA QLRLHRCPSAVL   GSTM K EQ +RRLLFW IYYLDVF +LQ
Sbjct: 526 IEQIYELRGNIISMAHQLRLHRCPSAVLTGSGSTMQKLEQSNRRLLFWTIYYLDVFSSLQ 585

Query: 554 LGVPRLLKDHEIECALPISEHAHAGVSLADQVIKLEGQVSELSLSLLRFSKILGNILDSI 613
           LGVPRLLKD+EIECALP+ ++     ++    IKLEG VS++SL+L RF+K+LGNI+DSI
Sbjct: 586 LGVPRLLKDYEIECALPV-DNTTTMDAIDGTSIKLEGTVSQISLTLFRFAKVLGNIVDSI 644

Query: 614 FKRGMTSSAAQQVALIHENALDNWRRGLPKNLTFELDVNGTIKIEELTGSAQNNQDFTKN 673
           FKR M++S ++QVALIHENALDNWR  LP+   F+LDVNGTI + +L          T+N
Sbjct: 645 FKRNMSTSISRQVALIHENALDNWRSRLPEQFQFKLDVNGTINLNDLD---------TEN 695

Query: 674 ASSDKKILMLLYFLVKCLVHLPVLAAKPLLGGSSEPDKDATPXXXXXXXXXXXXXXXYVL 733
             SD   L++ YFL KC++HLPV + K  L       +D                  YV 
Sbjct: 696 --SDTIFLIVFYFLAKCMIHLPVCSTKVDL-------EDKVTETGNDVIYNDRFSTSYVS 746

Query: 734 LQQATNTFLSVQSCFKTRHLPLAIDLPRIKARFALLSARGILEYTKGGALFQDNXXXXXX 793
           LQQ+TNT L+     + ++LP+  ++ R   RF L+SA+G L+Y KGG+LF DN      
Sbjct: 747 LQQSTNTMLNALRMIRDKYLPMPFNVSRTLTRFTLISAKGSLDYIKGGSLFIDNKKLLLD 806

Query: 794 XXXXXXXXXXXXXPGSLSWHSLILLDMATLLIMQPPQTKTDKLDKLLETRLNYYNKLMGR 853
                        PG +SWHSL LLD+   L +Q   TK +K++KLL+ +LNYYNKLMG+
Sbjct: 807 CVQDIEANRKLDLPGIISWHSLKLLDLTLNLFLQNSNTKPEKIEKLLQKKLNYYNKLMGK 866

Query: 854 STLTS------NGKRKNEENDATSKVSKLTPLSSEYNTPSDKRIKVESIGSSGNVPSNSE 907
             + +        + K   ND  S+      L ++ N+     +    I + G  PS++ 
Sbjct: 867 PLVKNLPIQKRTNQNKGNNNDEPSRKKVKKELENDINS-----LHPILIDNEGVTPSDAA 921

Query: 908 SVHHFDDIQNDKFSTNWPSNNP---QPNAIAEAFHLDPVLNGN--PFSNGDLTAFFNSD 961
            + +          TN  +NNP     N  AEA  +DP+LN +   FSN DL   FNSD
Sbjct: 922 PLIN---------KTNSNTNNPVVTTQNEFAEALQVDPILNSDYYQFSNLDLATLFNSD 971

 Score =  136 bits (342), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 70/148 (47%), Positives = 89/148 (60%), Gaps = 20/148 (13%)

Query: 65  TSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGYXXXXXXXX 124
           +SNYRV QACDRCRSKKTRCDG++PQCSQCAAVGFECKVSDKL R+A+PRGY        
Sbjct: 23  SSNYRVTQACDRCRSKKTRCDGRKPQCSQCAAVGFECKVSDKLIRKAYPRGYTESIEERV 82

Query: 125 XXXXXXXXXXXXXCDLKDEQMHLVSKYSSNKRH---------------EPSSTEEGRMLE 169
                        CDLK++Q+ LV+KYSSNK +               + ++  +G + +
Sbjct: 83  RELEAENRRLLALCDLKEQQISLVAKYSSNKSNILPTDRCIIELNSDSDCTNNIKGELNK 142

Query: 170 QLSNS-----DGGSLRVSSTNLYLLNKT 192
              N      +   L +S TNLYLLN+T
Sbjct: 143 DRQNDVTTIPNSLPLNISQTNLYLLNQT 170

>CAGL0M03025g Chr13 complement(341849..345613) [3765 bp, 1254 aa]
           {ON} similar to uniprot|P39113 Saccharomyces cerevisiae
           YMR280c CAT8 transcription factor involved in
           gluconeogenesis
          Length = 1254

 Score =  505 bits (1301), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 345/957 (36%), Positives = 499/957 (52%), Gaps = 102/957 (10%)

Query: 48  AAPNAARSISPVTS----ATPTSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKV 103
           A P    S+S   +    +TPT  YRVAQACDRCR KKT+CDGK PQCSQCA VGFECK+
Sbjct: 32  AGPANGNSVSGSNTGSRGSTPT--YRVAQACDRCRLKKTKCDGKIPQCSQCALVGFECKI 89

Query: 104 SDKLSRRAFPRGYXXXXXXXXXXXXXXXXXXXXXCDLKDEQMHLVSKYSSNKRHEPSSTE 163
           SD+L+R++FPRGY                     C+         S   SN R +    +
Sbjct: 90  SDRLNRKSFPRGYTETLEERVRELETENKRLMALCN---------SDLGSNTRSDGLEKQ 140

Query: 164 EGRMLEQLSNSDGGSLRVSSTNLYLLNKTTPAVQDGSELHKCQGLGCNHASHPHLHEKPV 223
                ++  + +  S R  + N+ L       +Q       C   G +  +H  +H KPV
Sbjct: 141 SPSKRKRSPSMERDSERGFTENMEL------QLQ-----QSCSSCGNSDPNHRCVHLKPV 189

Query: 224 STSL--SDPAAISFEQNEAPGLPAVKALNTMANHEYSAQLAYLVALSVPRSTDEILFIPQ 281
            +++       +SFEQN APGLPAVKALN+MA  E SAQLA LV+L++PRST+EILFIPQ
Sbjct: 190 VSNIIVDSNTDVSFEQNVAPGLPAVKALNSMAEREESAQLAMLVSLALPRSTEEILFIPQ 249

Query: 282 LLARLGQVHGLTSKQCXXXXXXXXXXXXXXQTSFQGSPDYKDLKDKSLWEIDDCMTFFKT 341
           L+A + +  G +SKQ                T    S D ++L   + +  +D   FF  
Sbjct: 250 LMANIQKTFGFSSKQSLYTVSLLSSLKKNLPTPNSNSSD-ENLS-PNYYVSEDFRPFFYE 307

Query: 342 GCKFNLT--------------------SSKDAXXXXXXXXXXXXXXYFGECHA-LIPVLN 380
             KF++                     +S+                YF EC +  IP+ +
Sbjct: 308 VLKFDILGETETENGSNRNESPDSTIPNSRSDDLLSWMEIQRLVDVYF-ECWSNTIPIFS 366

Query: 381 EAEFYKYYNKFKSNLTTDPEFFKTSTPSFAQRSKSISY-KIFACILLVICQFGLMAKVKR 439
              F K    FK+ +    +F       +      I++ KIFA +L V+CQ  L++++K+
Sbjct: 367 RKLFIKQMKAFKTEV---DKFGDRLFEVYKTEQIKINFLKIFATVLAVMCQMALLSRLKQ 423

Query: 440 EQLPTKN----KFSLLMSYYSNALLALKTNPYFS-VKNXXXXXXXXXXXXXXXXXNVGEV 494
            +  T+     +   L+++Y+  +  +  + +F  +                   NVG++
Sbjct: 424 LEATTQELECKRTQNLIAHYNQLIEKIHLDSFFQDMSTTTVQSLQLLSFISFYFLNVGDI 483

Query: 495 SSVYEIRGTVVSMAQQLRLHRCPSAVL-GTEGSTMSKSEQGDRRLLFWGIYYLDVFGALQ 553
             +Y++RGTV+SMAQQLRLHRCPSAVL    GSTM K EQG+RRLLFW IYYLDVF +LQ
Sbjct: 484 PRLYQLRGTVISMAQQLRLHRCPSAVLLSASGSTMQKFEQGERRLLFWAIYYLDVFYSLQ 543

Query: 554 LGVPRLLKDHEIECALPISEHAHAGVSLADQVIKLEGQVSELSLSLLRFSKILGNILDSI 613
           LGVPRL+KDHEIECALP+SE   +         +LEG+VS+ SL+++R++K+LGNILDSI
Sbjct: 544 LGVPRLIKDHEIECALPVSEEEDS---------QLEGRVSDFSLAVIRYAKVLGNILDSI 594

Query: 614 FKRGMTSSAA-QQVALIHENALDNWRRGLPKNLTFELDVNGTIKIEELTGSAQNNQDFTK 672
           FKR M S AA + +A +HE ALD W+  LP+   F L+ NG    +ELT    + +D  +
Sbjct: 595 FKRNMMSEAATESMAFVHEKALDIWKNRLPEKYGFRLEANGLFNFDELTVVKNSEKDLIE 654

Query: 673 NASSDKKILMLLYFLVKCLVHLPVLAAKPL-----LGGSSEPDKDATPXXXXXXXXXXXX 727
            +S     ++L YFL KC++HLPV+A +       L   +  D   TP            
Sbjct: 655 KSS-----ILLFYFLAKCMIHLPVIATRSASLEQQLQPGTSSDTSETP-KESQNKTPTRV 708

Query: 728 XXXYVLLQQATNTFLSVQSCFKTRHLPLAIDLPRIKARFALLSARGILEYTKGGALFQDN 787
              Y+L+Q+A +T L V       +LP  I++ R KARFALL+A   +EY KGG+L+ + 
Sbjct: 709 CPSYILMQKAASTMLQVMHYTSEYYLPSPINISRTKARFALLTACSAVEYLKGGSLYVET 768

Query: 788 XXXXXXXXXXXXXXXXXXXPGSLSWHSLILLDMATLLIMQPPQTKTDKLDKLLETRLNYY 847
                              PG +SWHSL LLDMA +L++Q P TK +KLDKL++ ++N+Y
Sbjct: 769 KNLLENLIIKLELERKLDLPGIISWHSLKLLDMALMLLLQSPTTKMEKLDKLVQKKINHY 828

Query: 848 NKLMGRSTLTSNGKRKNEENDATSKVSKLTPLSSEYNTPSDKRIKVESIGSSGNVPSNSE 907
           N+ MG   +  +  RKN      +K  KL   SS+ ++ S+   K       G + S+S 
Sbjct: 829 NRQMGIPAMKLSNSRKN------NKKIKLENESSQLSSTSNPIAK-------GELKSDSV 875

Query: 908 SVHHFDDIQNDKFST--NWPSNNP--QPNAIAEAFHLDPVLNGNPFSNGDLTAFFNS 960
                D++ +++ +T      NN    PN I +    + +     FS+ DL+A FN+
Sbjct: 876 VCEEDDNVNDNEVTTTAKLEENNEFINPNKIEQGVTSNTL--AFSFSSTDLSALFNA 930

>NDAI0K00390 Chr11 (84641..89128) [4488 bp, 1495 aa] {ON} Anc_8.845
          Length = 1495

 Score =  463 bits (1191), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 269/706 (38%), Positives = 375/706 (53%), Gaps = 78/706 (11%)

Query: 203 HKCQGLGCNHASHPHLHEKPVSTSLSDPAAISFEQNEAPGLPAVKALNTMANHEYSAQLA 262
           H   G      +  HLH KPVST+ +   +ISFEQNEAPGL  VKAL +M N E + QLA
Sbjct: 275 HTTNGKLHRDTNDHHLHPKPVSTNSNGLNSISFEQNEAPGLSTVKALKSMVNDEKNTQLA 334

Query: 263 YLVALSVPRSTDEILFIPQLLARLGQVHGLTSKQCXXXXXXXXXXXXXXQTSFQ----GS 318
            LV+L++PRST+EILFIPQ+LA++ Q  G TSK C                S       S
Sbjct: 335 TLVSLAIPRSTEEILFIPQILAKVRQNFGFTSKHCLYTVSLLSSLKSFLSNSNNSISAAS 394

Query: 319 PDYKDL---KDKSLWEIDDCMTFFKTGCKFNL-----------------------TSSKD 352
            D K+L   K+ +LW+ +    FF    K +                        ++++D
Sbjct: 395 ADNKNLETLKNTNLWKFNALFQFFTAFLKLDFLDSSLEKQNKGKKNGKVNNNNNNSANQD 454

Query: 353 AXX-XXXXXXXXXXXXYFGECHALIPVLNEAEFYKYYNKFKSNLTTDPEFFKTSTPSFAQ 411
                           +F      + ++NE EFY+YY+ FKS+L       + +  S   
Sbjct: 455 GISPLSSSEIDELLKLFFQNWSDFVLMINEKEFYQYYSVFKSDL-------QNNNISKMS 507

Query: 412 RSKSISYKIFACILLVICQFGLMAKVKREQLPTKNK-------FSLLMSYYSNALLALKT 464
            S  ++YKIF  I+L+ CQ GL++K+K     TK+K          +M+YY N +  L  
Sbjct: 508 LSTLMNYKIFGLIILLFCQMGLLSKIKLSSNNTKSKNFKQQYHLKKVMNYYHNLINKLMW 567

Query: 465 NPYFSVKNXXXXXXXXXXXXXXXXXNVGEVSSVYEIRGTVVSMAQQLRLHRCPSAVLGTE 524
           N +F + N                 ++G +S++YE+R  V+SM+QQLRLHRCPSAVL   
Sbjct: 568 NEFFKISNVTLQSLKLLSLILFYNLHMGNISNIYELRSKVISMSQQLRLHRCPSAVLCGS 627

Query: 525 GSTMSKSEQGDRRLLFWGIYYLDVFGALQLGVPRLLKDHEIECALPI------------S 572
              + K EQ +RRLLFW IYYLD+F +LQLGVPRLLKDHEIECALPI             
Sbjct: 628 TLKIHKLEQSNRRLLFWNIYYLDIFASLQLGVPRLLKDHEIECALPIPMDTDSKSDNQSQ 687

Query: 573 EHAHAGVSLADQVIKLEGQVSELSLSLLRFSKILGNILDSIFKRGMTSSAAQQVALIHEN 632
             A       D  IKLEG VS LSL ++R+S+I+GNILD IFKR MT S  + +ALIH +
Sbjct: 688 RSAATNAENDDNKIKLEGCVSHLSLVIIRYSQIVGNILDMIFKRNMTESMTKSIALIHIH 747

Query: 633 ALDNWRRGLPKNLTFELDVNGTIKIEELTGSAQNNQDFTKNASSDKKILMLLYFLVKCLV 692
           ALD+WR  LP NL F+L+VNG+I +       QN  +  +     K +++ LYF    ++
Sbjct: 748 ALDDWRNTLPSNLKFDLNVNGSIDLSSFID-QQNLNEEEQRTQQQKLLVIFLYFFGVNMI 806

Query: 693 HLPVLAAKPLLGGSSE-----PDKDATPXXXXXXXXXXXXXXXYVLLQQATNTFLSVQSC 747
           H+PV+A++PL    ++     PD+ ++                Y+ LQ ATNT L+V   
Sbjct: 807 HMPVVASRPLPLVENDSLNQIPDRSSS---------------SYIALQHATNTMLNVLDL 851

Query: 748 FKTRHLPLAIDLPRIKARFALLSARGILEYTKGGALFQDNXXXXXXXXXXXXXXXXXXXP 807
               ++PL I++ R   RF+++SA G+L++ KGG+LF +N                   P
Sbjct: 852 LSPTYVPLPINMSRTMVRFSMISACGMLDFIKGGSLFLENKALLAQVVKNIETDRFLDLP 911

Query: 808 GSLSWHSLILLDMATLLIMQPPQTKTDKLDKLLETRLNYYNKLMGR 853
           G +SWHSL L D+   L  Q    K +KLDKLLE + NYYN+LMG+
Sbjct: 912 GVISWHSLKLFDLTLTLFFQNTNIKLEKLDKLLEKKSNYYNRLMGK 957

 Score =  110 bits (274), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 47/75 (62%), Positives = 59/75 (78%), Gaps = 2/75 (2%)

Query: 44  TNNSAAPNAARSISPVTSATPTSNY--RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 101
           +N+S+      S+S   + + + NY  R++QACDRCRSKKTRCDGKRPQCSQCA VGFEC
Sbjct: 76  SNSSSTDTKDDSVSISITDSTSGNYSKRISQACDRCRSKKTRCDGKRPQCSQCAIVGFEC 135

Query: 102 KVSDKLSRRAFPRGY 116
           KVSDKL R+++PRGY
Sbjct: 136 KVSDKLQRKSYPRGY 150

 Score = 35.8 bits (81), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 29/108 (26%), Positives = 44/108 (40%), Gaps = 31/108 (28%)

Query: 1060 VPGFGFTVDASLGLAPLLAWS------PEAPQP-----------------------SMPE 1090
            +P + + VDASLGLAPLL         PE  QP                       +MP 
Sbjct: 1372 IPDYNYFVDASLGLAPLLETQRRHNSFPETSQPLVNTSNAMNLGNASLSSTANNNNTMPS 1431

Query: 1091 IAQNADRRDSDPLSRTRLPSATIPASDPTHVI--SQDSNNVHLREQYR 1136
            IA N    +   LS ++     +P +D   ++  + D +N++ R   R
Sbjct: 1432 IANNVGYNNPPLLSSSKQKPRHLPTNDTGDILNFNGDLSNLNFRRDVR 1479

>Kpol_1016.20 s1016 (51828..55088) [3261 bp, 1086 aa] {ON}
           (51828..55088) [3261 nt, 1087 aa]
          Length = 1086

 Score = 90.5 bits (223), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 40/69 (57%), Positives = 46/69 (66%), Gaps = 7/69 (10%)

Query: 55  SISPVT----SATPTSNY---RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKL 107
           SI P T    S    SN+   R++QACDRCR KK +CDG +P CSQC  V F CK SDKL
Sbjct: 72  SIQPTTLVKTSVNIDSNFLSNRLSQACDRCRLKKIKCDGLKPNCSQCLKVNFICKTSDKL 131

Query: 108 SRRAFPRGY 116
           +RR FPRGY
Sbjct: 132 TRRGFPRGY 140

>KAFR0A01480 Chr1 (294040..296217) [2178 bp, 725 aa] {ON} Anc_1.277
           YJL089W
          Length = 725

 Score = 85.9 bits (211), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 30/58 (51%), Positives = 43/58 (74%)

Query: 59  VTSATPTSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGY 116
           + +++  S +RV+QACDRCR KK +CDG++P+CS C  + F C +S KLSRR  P+GY
Sbjct: 1   MNTSSELSKFRVSQACDRCRLKKIKCDGQKPRCSNCKKINFNCAISTKLSRRGLPKGY 58

>AFR096W Chr6 (606993..609551) [2559 bp, 852 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YJL089W (SIP4)
          Length = 852

 Score = 84.7 bits (208), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 31/48 (64%), Positives = 38/48 (79%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGY 116
           R +QACDRCR KK +CDG RP C+ C  +G++CK SDKL+RR FPRGY
Sbjct: 24  RSSQACDRCRLKKIKCDGLRPSCTSCKKIGYQCKTSDKLTRRGFPRGY 71

>Smik_10.153 Chr10 (257677..260166) [2490 bp, 829 aa] {ON} YJL089W
           (REAL)
          Length = 829

 Score = 83.6 bits (205), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 33/57 (57%), Positives = 39/57 (68%)

Query: 60  TSATPTSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGY 116
           ++AT   + R A ACDRCR KK RCDG +P CS C  + F CK SDKLSRR  P+GY
Sbjct: 32  SNATTDFSVRKAHACDRCRLKKIRCDGLKPNCSNCTKINFPCKTSDKLSRRGLPKGY 88

>TPHA0I02820 Chr9 complement(620925..624059) [3135 bp, 1044 aa] {ON}
           Anc_1.277 YJL089W
          Length = 1044

 Score = 83.6 bits (205), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 39/50 (78%)

Query: 67  NYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGY 116
           N R++QACDRCR KK +CDG +P C+ C+ + F CK SD+L+RR FP+GY
Sbjct: 77  NIRLSQACDRCRLKKIKCDGLKPSCTHCSKIKFACKTSDRLTRRGFPKGY 126

>ZYRO0G15136g Chr7 complement(1218989..1222072) [3084 bp, 1027 aa]
           {ON} weakly similar to uniprot|P46954 Saccharomyces
           cerevisiae YJL089W SIP4 Possibly involved in Snf1p
           regulated transcriptional activation shows homology to
           DNA binding domain of Gal4p has a leucine zipper motif
           and acidic region lexA-Sip4p activates transcription
          Length = 1027

 Score = 83.6 bits (205), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 31/48 (64%), Positives = 37/48 (77%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGY 116
           R +QACDRCR KK +CDG +P CSQC  V F C+ SD+L+RR FPRGY
Sbjct: 33  RQSQACDRCRLKKIKCDGMKPTCSQCTKVNFTCRTSDRLTRRGFPRGY 80

>KLLA0F14322g Chr6 (1328925..1331078) [2154 bp, 717 aa] {ON}
           uniprot|Q7Z8R2 Kluyveromyces lactis Sip4 protein
          Length = 717

 Score = 83.2 bits (204), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 34/66 (51%), Positives = 42/66 (63%), Gaps = 3/66 (4%)

Query: 51  NAARSISPVTSATPTSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRR 110
           N  + + P  S   T   R +QACDRCR KK +CDG +P CS C  +G+ C  SDKL+RR
Sbjct: 43  NEKKLLMPTAS---TKVKRFSQACDRCRLKKIKCDGIKPSCSNCKKIGYHCSTSDKLTRR 99

Query: 111 AFPRGY 116
            FPRGY
Sbjct: 100 GFPRGY 105

>Suva_6.161 Chr6
           complement(283370..284500,284547..284764,284948..285781,
           285812..286127) [2499 bp, 832 aa] {ON} YJL089W (REAL)
          Length = 832

 Score = 83.2 bits (204), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 32/56 (57%), Positives = 38/56 (67%)

Query: 61  SATPTSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGY 116
           +A P  + R A ACDRCR KK +CDG +P CS C  + F CK SDKLSRR  P+GY
Sbjct: 33  NAVPDFSVRKAHACDRCRLKKIKCDGLKPNCSNCGKIDFPCKTSDKLSRRGLPKGY 88

>KLTH0D03564g Chr4 (343546..346134) [2589 bp, 862 aa] {ON} weakly
           similar to uniprot|P46954 Saccharomyces cerevisiae
           YJL089W SIP4 Possibly involved in Snf1p regulated
           transcriptional activation shows homology to DNA binding
           domain of Gal4p has a leucine zipper motif and acidic
           region lexA-Sip4p activates transcription
          Length = 862

 Score = 82.8 bits (203), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 31/48 (64%), Positives = 38/48 (79%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGY 116
           R++QACDRCR KK +CDG +P C+ C  +GF C+ SDKLSRR FPRGY
Sbjct: 24  RMSQACDRCRLKKIKCDGIKPTCTPCTKIGFHCQTSDKLSRRGFPRGY 71

>Ecym_6340 Chr6 complement(652943..655801) [2859 bp, 952 aa] {ON}
           similar to Ashbya gossypii AFR096W
          Length = 952

 Score = 82.8 bits (203), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 30/48 (62%), Positives = 38/48 (79%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGY 116
           R +QACDRCR KK +CDG RP C+ C  +G++C+ SDKL+RR FPRGY
Sbjct: 25  RSSQACDRCRLKKIKCDGVRPSCTSCKKIGYQCRTSDKLTRRGFPRGY 72

>SAKL0D05654g Chr4 (457485..460244) [2760 bp, 919 aa] {ON} weakly
           similar to uniprot|P46954 Saccharomyces cerevisiae
           YJL089W SIP4 Possibly involved in Snf1p regulated
           transcriptional activation shows homology to DNA binding
           domain of Gal4p has a leucine zipper motif and acidic
           region lexA-Sip4p activates transcription
          Length = 919

 Score = 82.4 bits (202), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 31/48 (64%), Positives = 37/48 (77%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGY 116
           R +QACDRCR KK +CDG +P C+ C  VGF C+ SDKL+RR FPRGY
Sbjct: 24  RSSQACDRCRLKKIKCDGLKPNCTSCKKVGFHCQTSDKLTRRGFPRGY 71

>YJL089W Chr10 (265926..268415) [2490 bp, 829 aa] {ON}  SIP4C6 zinc
           cluster transcriptional activator that binds to the
           carbon source-responsive element (CSRE) of gluconeogenic
           genes; involved in the positive regulation of
           gluconeogenesis; regulated by Snf1p protein kinase;
           localized to the nucleus
          Length = 829

 Score = 81.6 bits (200), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 31/48 (64%), Positives = 35/48 (72%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGY 116
           R A ACDRCR KK +CDG +P CS CA + F CK SDKLSRR  P+GY
Sbjct: 41  RKAHACDRCRLKKIKCDGLKPNCSNCAKIDFPCKTSDKLSRRGLPKGY 88

>Kwal_26.7397 s26 complement(342483..343085) [603 bp, 201 aa] {OFF}
           YJL089W (SIP4) - shows homology to DNA binding domain of
           Gal4p, has a leucine zipper motif and acidic region;
           lexA-Sip4p activates transcription [contig 304] PARTIAL
          Length = 201

 Score = 75.9 bits (185), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 34/62 (54%), Positives = 43/62 (69%), Gaps = 1/62 (1%)

Query: 56  ISPVTSATPTSNY-RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPR 114
           +SP  +    SN  R++QACDRCR KK +CDG +P C  C+ + F C+ SDKLSRR FPR
Sbjct: 10  LSPKATQLLLSNQARMSQACDRCRLKKIKCDGVKPTCGPCSKIKFHCQTSDKLSRRGFPR 69

Query: 115 GY 116
           GY
Sbjct: 70  GY 71

>Skud_10.125 Chr10 (233921..236422) [2502 bp, 833 aa] {ON} YJL089W
           (REAL)
          Length = 833

 Score = 80.9 bits (198), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 30/48 (62%), Positives = 35/48 (72%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGY 116
           R A ACDRCR KK +CDG +P CS C+ + F CK SDKLSRR  P+GY
Sbjct: 41  RKAHACDRCRLKKIKCDGLKPNCSNCSKIDFPCKTSDKLSRRGLPKGY 88

>TDEL0D01450 Chr4 (284869..287706) [2838 bp, 945 aa] {ON} Anc_1.277
           YJL089W
          Length = 945

 Score = 80.1 bits (196), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 36/64 (56%), Positives = 42/64 (65%), Gaps = 4/64 (6%)

Query: 57  SPVTSAT--PTSNYRV--AQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAF 112
           +PV   T   T N RV  + ACDRCR KK RCDG +P CSQC+   F C  SDKL+RR F
Sbjct: 38  APVKEKTLLVTKNERVRHSHACDRCRLKKVRCDGLKPSCSQCSRANFRCTTSDKLTRRGF 97

Query: 113 PRGY 116
           P+GY
Sbjct: 98  PKGY 101

>CAGL0L03377g Chr12 complement(384929..388558) [3630 bp, 1209 aa]
           {ON} some similarities with uniprot|P46954 Saccharomyces
           cerevisiae YJL089w SIP4 interacts with SNF1 protein
           kinase
          Length = 1209

 Score = 78.2 bits (191), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 31/48 (64%), Positives = 37/48 (77%), Gaps = 1/48 (2%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGY 116
           R +QACDRCRSKK +CDG +P CS CA +G+ C  SDKLSRR  P+GY
Sbjct: 24  RHSQACDRCRSKKIKCDGLQP-CSNCAKIGYNCVTSDKLSRRGLPKGY 70

>NDAI0G05530 Chr7 (1360413..1363973) [3561 bp, 1186 aa] {ON} 
          Length = 1186

 Score = 77.8 bits (190), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 29/48 (60%), Positives = 34/48 (70%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGY 116
           R  QACDRCR KK +CD  +P CSQC    F+CK +DKL+RR F RGY
Sbjct: 117 RKIQACDRCRLKKIKCDDLKPSCSQCLKADFQCKTTDKLARRGFSRGY 164

>KNAG0B01840 Chr2 (345204..348422) [3219 bp, 1072 aa] {ON} Anc_1.277
           YJL089W
          Length = 1072

 Score = 76.3 bits (186), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 29/49 (59%), Positives = 35/49 (71%)

Query: 68  YRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGY 116
           +R  QACDRCR KK +CDG +P C+ CA + F CK S KLSRR  P+GY
Sbjct: 22  FRKNQACDRCRLKKIKCDGLKPTCTNCAKINFLCKTSHKLSRRGLPKGY 70

>TBLA0D05420 Chr4 complement(1334955..1337228) [2274 bp, 757 aa]
           {ON} Anc_1.277 YJL089W
          Length = 757

 Score = 73.9 bits (180), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 28/55 (50%), Positives = 36/55 (65%)

Query: 62  ATPTSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGY 116
           AT  +  R +QACDRCR KK +CDG  P C+ C  + F C+ + KLSRR  P+GY
Sbjct: 89  ATIPTGRRHSQACDRCRLKKIKCDGLIPHCTNCRKINFNCQTTHKLSRRGLPKGY 143

>NCAS0A09410 Chr1 complement(1865924..1868722) [2799 bp, 932 aa]
           {ON} Anc_1.277
          Length = 932

 Score = 65.1 bits (157), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 22/45 (48%), Positives = 30/45 (66%)

Query: 72  QACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGY 116
           QACDRCR KK +CD + P C+ C   G  C+ +++L RR F +GY
Sbjct: 43  QACDRCRLKKIKCDDRTPDCTPCMKAGIPCRTTERLKRRGFAKGY 87

>KLLA0C10923g Chr3 complement(939148..941475) [2328 bp, 775 aa] {ON}
           weakly similar to uniprot|P07272 Saccharomyces
           cerevisiae YLR014C PPR1 Zinc finger transcription factor
           containing a Zn(2)-Cys(6) binuclear cluster domain
           positively regulates transcription of genes involved in
           uracil biosynthesis activity may be modulated by
           interaction with Tup1p
          Length = 775

 Score = 54.7 bits (130), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 30/58 (51%)

Query: 59  VTSATPTSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGY 116
           VT  +  + YR   AC RCR +K +CD K P C++C      C   D  +RR  PR Y
Sbjct: 5   VTKESSGNIYRSVAACKRCRIRKIKCDNKFPSCTKCIQAQEPCITIDPSTRREIPRSY 62

>KLLA0E13993g Chr5 complement(1239566..1241602) [2037 bp, 678 aa]
           {ON} some similarities with uniprot|P07272 Saccharomyces
           cerevisiae YLR014C PPR1 Zinc finger transcription factor
           containing a Zn(2)-Cys(6) binuclear cluster domain
           positively regulates transcription of genes involved in
           uracil biosynthesis activity may be modulated by
           interaction with Tup1p
          Length = 678

 Score = 53.5 bits (127), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 25/44 (56%)

Query: 73  ACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGY 116
           AC  C+ ++ RCDG  PQC  C   G +C   DK++ R  PR Y
Sbjct: 66  ACCFCKRRRKRCDGGFPQCGACVNAGIQCTFVDKITGRELPRDY 109

>TBLA0G02610 Chr7 complement(689843..692845) [3003 bp, 1000 aa] {ON}
           Anc_2.231 YIL130W
          Length = 1000

 Score = 53.1 bits (126), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 19/42 (45%), Positives = 26/42 (61%), Gaps = 1/42 (2%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRR 110
           RV +ACD CR KK +CDG++P C  C    +EC  +   +RR
Sbjct: 61  RVTRACDECRKKKVKCDGQQP-CIHCTVYSYECTYNQPSTRR 101

 Score = 40.8 bits (94), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 42/81 (51%), Gaps = 2/81 (2%)

Query: 492 GEVSSVYEIRGTVVSMAQQLRLHRC-PSAVLGT-EGSTMSKSEQGDRRLLFWGIYYLDVF 549
             +S+ Y   G  +  A +  LHR  P+  +GT   S  +  E   R+ LF+ IY LD++
Sbjct: 392 ARLSTCYSYIGVALRSALREGLHRVIPTNKIGTGTDSRFNCIEIEMRKRLFYTIYKLDIY 451

Query: 550 GALQLGVPRLLKDHEIECALP 570
               LG+PR +  ++ + +LP
Sbjct: 452 VNAMLGLPRSISPNDFDQSLP 472

>NCAS0D02540 Chr4 complement(484060..486732) [2673 bp, 890 aa] {ON}
           Anc_5.235
          Length = 890

 Score = 52.0 bits (123), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 36/66 (54%), Gaps = 2/66 (3%)

Query: 51  NAARSISPVTSATPTSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRR 110
           N+ ++ SP +S   TS  +   AC RCRSKK +CD K P C +CA +   C   D  + +
Sbjct: 20  NSLKNGSPSSSTFNTS--KSKSACKRCRSKKIKCDQKFPSCDRCAHLKVPCVSVDPATGQ 77

Query: 111 AFPRGY 116
             PR Y
Sbjct: 78  DVPRSY 83

>TPHA0F01380 Chr6 complement(318207..320879) [2673 bp, 890 aa] {ON}
           Anc_2.231 YIL130W
          Length = 890

 Score = 51.2 bits (121), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 20/46 (43%), Positives = 26/46 (56%), Gaps = 1/46 (2%)

Query: 56  ISPVTSATPTSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 101
           +S V S T     RV +ACD CR KK +CDG+ P C  C    ++C
Sbjct: 54  LSNVASVTQKKRRRVTRACDECRKKKVKCDGQNP-CIHCTVYSYKC 98

 Score = 46.6 bits (109), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 41/165 (24%), Positives = 69/165 (41%), Gaps = 23/165 (13%)

Query: 492 GEVSSVYEIRGTVVSMAQQLRLHRCPSAVLGTEGSTMSKSEQGDRRLLFWGIYYLDVFGA 551
             +++ Y   G  +  A +   HR     +    +T++  E   R+ +F+ IY LDV+  
Sbjct: 433 ARLTTCYSYIGAALRAALKEGYHR----RVDPNNTTLNPIEIEMRKRIFYTIYKLDVYVN 488

Query: 552 LQLGVPRLLKDHEIECALPISEHAHAGVSLADQVIKLEGQVSEL------SLSLLRFSKI 605
             +G+PR L + + +  LPI         ++D+ I   G +SE       S+S+  +   
Sbjct: 489 SMMGLPRSLSEDDFDQELPI--------EISDECITENGYLSEQEGQQLSSISIANYHTK 540

Query: 606 LGNILDSIFKR-----GMTSSAAQQVALIHENALDNWRRGLPKNL 645
           L  IL  I +R         S  +   +  EN L  W   LP  L
Sbjct: 541 LYLILADIVQRLYSIKKKNRSITENTVISLENKLRKWADSLPHEL 585

>SAKL0C02024g Chr3 complement(174858..177554) [2697 bp, 898 aa] {ON}
           similar to uniprot|P07272 Saccharomyces cerevisiae
           YLR014C PPR1 Zinc finger transcription factor containing
           a Zn(2)-Cys(6) binuclear cluster domain positively
           regulates transcription of genes involved in uracil
           biosynthesis activity may be modulated by interaction
           with Tup1p
          Length = 898

 Score = 51.2 bits (121), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 21/48 (43%), Positives = 29/48 (60%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGY 116
           R   AC+RCR+KKT+CD   P C++CA++G  C   D  + R   R Y
Sbjct: 48  RSIVACERCRTKKTKCDQNFPSCARCASLGEPCISVDPATGRVVSRSY 95

>NDAI0F01220 Chr6 complement(295418..298300) [2883 bp, 960 aa] {ON}
           Anc_6.279
          Length = 960

 Score = 51.2 bits (121), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 29/51 (56%)

Query: 66  SNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGY 116
           S  +  QACD CR KK +C  ++P+C++C   G+EC  S K  R    R +
Sbjct: 4   STEKSEQACDICRIKKLKCSREKPKCAKCMKNGWECCYSPKAKRSPLTRAH 54

>SAKL0G11902g Chr7 (1016915..1019635) [2721 bp, 906 aa] {ON} similar
           to uniprot|P07272 Saccharomyces cerevisiae YLR014C PPR1
           Zinc finger transcription factor containing a
           Zn(2)-Cys(6) binuclear cluster domain positively
           regulates transcription of genes involved in uracil
           biosynthesis activity may be modulated by interaction
           with Tup1p
          Length = 906

 Score = 50.8 bits (120), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/48 (45%), Positives = 26/48 (54%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGY 116
           R   AC RCR KK +CD K P CS+CA+    C   D  + R  PR Y
Sbjct: 38  RSIAACKRCRLKKVKCDQKFPSCSKCASANEPCVSLDPATGRDVPRSY 85

>KLLA0F04609g Chr6 complement(451579..454329) [2751 bp, 916 aa] {ON}
           similar to uniprot|P40467 Saccharomyces cerevisiae
           YIL130W ASG1 Proposed transcriptional activator member
           of the Gal4p family of zinc cluster proteins
          Length = 916

 Score = 50.8 bits (120), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 18/33 (54%), Positives = 22/33 (66%), Gaps = 1/33 (3%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 101
           RV +ACD CR KK +CDGK+P C  C    +EC
Sbjct: 9   RVTRACDECRKKKVKCDGKQP-CIHCTVYNYEC 40

>YPL248C Chr16 complement(79711..82356) [2646 bp, 881 aa] {ON}
           GAL4DNA-binding transcription factor required for the
           activation of the GAL genes in response to galactose;
           repressed by Gal80p and activated by Gal3p
          Length = 881

 Score = 50.8 bits (120), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 28/47 (59%)

Query: 70  VAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGY 116
           + QACD CR KK +C  ++P+C++C    +EC+ S K  R    R +
Sbjct: 7   IEQACDICRLKKLKCSKEKPKCAKCLKNNWECRYSPKTKRSPLTRAH 53

>Smik_6.452 Chr6 (741922..744558) [2637 bp, 878 aa] {ON} YPL248C
           (REAL)
          Length = 878

 Score = 50.8 bits (120), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 28/47 (59%)

Query: 70  VAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGY 116
           + QACD CR KK +C  ++P+C++C    +EC+ S K  R    R +
Sbjct: 7   IEQACDICRLKKLKCSKEKPKCAKCLKNNWECRYSPKTKRSPLTRAH 53

>Kpol_1018.30 s1018 complement(81534..83840,83842..84180) [2646 bp,
           881 aa] {ON} complement(81534..83840,83842..84180) [2646
           nt, 882 aa]
          Length = 881

 Score = 50.4 bits (119), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 27/51 (52%)

Query: 66  SNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGY 116
           SN    Q CD CR KK +C  ++P+C +C    +EC  S K+ R    R +
Sbjct: 2   SNIITNQVCDSCRLKKLKCSKEKPKCFKCLKHNWECNYSPKIKRSPLTRAH 52

>KNAG0D00690 Chr4 (105640..108267) [2628 bp, 875 aa] {ON} Anc_6.279
           YPL248C
          Length = 875

 Score = 50.4 bits (119), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 26/51 (50%)

Query: 66  SNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGY 116
           +N    QACD CR KK +C   +P C +CA  G+ C  S K  R    R +
Sbjct: 13  ANSSTDQACDLCRIKKLKCSKDKPACRKCAKNGWNCTYSPKAKRSPLTRAH 63

 Score = 33.9 bits (76), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 48/233 (20%), Positives = 90/233 (38%), Gaps = 42/233 (18%)

Query: 368 YFGECHALIPVLNEAEFYKYYNKFKSNLTTDPEFFKTSTPSFAQRSKSISYKIFACILLV 427
           YF + H   P++NE EF  ++ K +  L    +    ++      + +I ++    I+L 
Sbjct: 253 YFEKFHPFHPIINEREFMAHF-KSRDTLMVPDDIKDWASTKKTLSTDNIEWQFLLSIVLA 311

Query: 428 I---CQFGLMAKVKREQLPTKNKF-----SLLMSYYSNALLALKT-NPYFSVKNXXXXXX 478
           +   C  G    + R    +   +      LL +   N ++ L   + Y ++KN      
Sbjct: 312 LGSWCNDGESTDIDRYYYKSAAFYLNDANMLLFTSSVNLIVTLNLFSLYLTIKNTFW--- 368

Query: 479 XXXXXXXXXXXNVGEVSSVYEIRGTVVSMAQQLRLH--RCPSAVLGTEGSTMSKSEQGDR 536
                          ++S Y+I G  + MA  L L+    P++   TE  TM K     R
Sbjct: 369 -------------NNLNSAYQINGLAIRMAVSLGLNIKDIPTS---TENVTMLKQ----R 408

Query: 537 RLLFWGIYYLDVFGALQLGVPRLLKD------HEIECALPISEHAHAGVSLAD 583
           +LL++ +   D+   +      L          E++  L  +EH    +S+ D
Sbjct: 409 KLLWYALVNQDILLNMHFDRSNLFNSLNYIPIDELQIFLNANEHKEF-ISITD 460

>NCAS0D04190 Chr4 (793242..795914) [2673 bp, 890 aa] {ON} Anc_6.279
          Length = 890

 Score = 50.1 bits (118), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 26/45 (57%)

Query: 70  VAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPR 114
           + QACD CR KK +C  + P+CS+C   G +C  S K+ R    R
Sbjct: 16  IEQACDNCRLKKLKCSKETPKCSKCLKNGMKCLYSPKVKRSPLTR 60

>NDAI0A08790 Chr1 complement(2026171..2029350) [3180 bp, 1059 aa]
           {ON} Anc_7.17
          Length = 1059

 Score = 50.1 bits (118), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 22/34 (64%)

Query: 68  YRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 101
           YR++  C  CR  KT+CD ++P CS+C  +G  C
Sbjct: 47  YRLSFVCQECRKSKTKCDKEKPSCSRCLKIGITC 80

>ZYRO0E08272g Chr5 (651705..654089) [2385 bp, 794 aa] {ON} similar
           to uniprot|P04386 Saccharomyces cerevisiae YPL248C GAL4
           DNA-binding transcription factor required for the
           activation of the GAL genes in response to galactose
           repressed by Gal80p and activated by Gal3p
          Length = 794

 Score = 50.1 bits (118), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 27/47 (57%)

Query: 70  VAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGY 116
           +  ACD CR KK RC  + P+C++C   G+EC  S K +R    R +
Sbjct: 7   IDHACDSCRQKKLRCSKEEPKCAKCIQNGWECCYSPKANRTPLTRAH 53

>KAFR0J01710 Chr10 complement(327570..330116) [2547 bp, 848 aa] {ON}
           Anc_2.231 YIL130W
          Length = 848

 Score = 50.1 bits (118), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 22/33 (66%), Gaps = 1/33 (3%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 101
           RV +ACD CR KK +CDG++P C  C    +EC
Sbjct: 13  RVTRACDECRKKKVKCDGQQP-CIHCTVYSYEC 44

 Score = 37.0 bits (84), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 31/59 (52%), Gaps = 8/59 (13%)

Query: 536 RRLLFWGIYYLDVFGALQLGVPRLLKDHEIECALPISEHAHAGVSLADQVIKLEGQVSE 594
           ++ LF+ +Y +D++    LG+PR L+  + +  LPI         L+D+ I  EG   E
Sbjct: 372 KKRLFYNVYKMDIYINAMLGLPRSLRVEDFDQTLPI--------ELSDENITAEGYFYE 422

>NCAS0B06550 Chr2 complement(1242371..1245091) [2721 bp, 906 aa]
           {ON} Anc_2.231
          Length = 906

 Score = 49.7 bits (117), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 22/33 (66%), Gaps = 1/33 (3%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 101
           RV +ACD CR KK +CDG++P C  C    +EC
Sbjct: 32  RVTRACDECRKKKVKCDGQQP-CIHCTVYSYEC 63

 Score = 36.2 bits (82), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 33/126 (26%), Positives = 53/126 (42%), Gaps = 19/126 (15%)

Query: 536 RRLLFWGIYYLDVFGALQLGVPRLLKDHEIECALPISEHAHAGVSLADQVIKLEGQVSEL 595
           R+ LF+ IY LD++    LG+PR +   + +  LPI         L+D+ I   G + E 
Sbjct: 408 RKRLFYTIYKLDIYVNAMLGLPRSISPDDFDQTLPI--------ELSDENITEHGYLPEN 459

Query: 596 SLSLLRFSKI------LGNILDSIFK-----RGMTSSAAQQVALIHENALDNWRRGLPKN 644
              +L  + I      L  IL+SI +     +   +  + +     E  L  W   LP  
Sbjct: 460 QNGVLSSTGIANQHTKLLMILNSIVRELYPIKKTNNLISHETVTRLELKLRTWMDELPTE 519

Query: 645 LTFELD 650
           L   L+
Sbjct: 520 LVPNLE 525

>KLTH0E08778g Chr5 complement(795841..798462) [2622 bp, 873 aa] {ON}
           conserved hypothetical protein
          Length = 873

 Score = 49.7 bits (117), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 45/198 (22%), Positives = 85/198 (42%), Gaps = 42/198 (21%)

Query: 505 VSMAQQLRLHRCPSAVLGTEGSTMSKSEQGDRRLLFWGIYYLDVFGALQLGVPRLLKDHE 564
           V++AQ   LHR           T++ +E+  R+L++W +Y +D   ++ +G P+ +    
Sbjct: 332 VTIAQTYGLHRS-----ADFHPTLTANEKRARKLIWWILYVIDTLVSISIGRPQAINLD- 385

Query: 565 IECALPISEHAHAGVSLADQVIKLEGQVSELSL---------SLLRFSKILGNILDSIFK 615
            +C +P+  H        D  +  EG+  E S+         S ++ ++I+  I   + +
Sbjct: 386 -DCDVPVLTH--------DDFV-FEGEAPEHSMPVDHMDCIISTVQIAEIMSRISRELNR 435

Query: 616 RGMTSSAAQQVALIHENALDNWRRGLPKNLTFELDVNGTIKIEELTGSAQNNQDFTKNAS 675
                  A+ +    +  L  WR  LP++LT+                  N + FTK+ S
Sbjct: 436 PAAAHCDAKFLIQHFDLLLQRWRNNLPESLTYH----------------SNAEIFTKH-S 478

Query: 676 SDKKILMLLYFLVKCLVH 693
             K  +  LY+   CL+H
Sbjct: 479 IPKAFVNALYYKTLCLLH 496

 Score = 38.5 bits (88), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 21/38 (55%), Gaps = 1/38 (2%)

Query: 69  RVAQACDRCRSKKTRCDGK-RPQCSQCAAVGFECKVSD 105
           R ++AC+ C  +K RCD   R  C+ C   G  C++ D
Sbjct: 14  RTSRACEVCHDRKVRCDANIRVPCTSCQTFGLVCRLRD 51

>NDAI0B03850 Chr2 complement(970366..973158) [2793 bp, 930 aa] {ON}
           Anc_2.231 YIL130W
          Length = 930

 Score = 49.7 bits (117), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 24/41 (58%), Gaps = 1/41 (2%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSR 109
           RV +ACD CR KK +CDG++P C  C    +EC  +    R
Sbjct: 34  RVTRACDECRKKKVKCDGQQP-CIHCTVYSYECTYNQPTKR 73

 Score = 43.1 bits (100), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 46/171 (26%), Positives = 74/171 (43%), Gaps = 26/171 (15%)

Query: 492 GEVSSVYEIRGTVVSMAQQLRLHRCPSAVLGTEGSTMSKSEQGDRRLLFWGIYYLDVFGA 551
             +S+ Y   G  +  A +  LHR     +G   S  +  E   R+ LF+ IY LD++  
Sbjct: 392 ARLSTCYSYIGVAMRSALREGLHR----QVG-PNSGFNPIEIEMRKRLFYTIYKLDIYVN 446

Query: 552 LQLGVPRLLKDHEIECALPISEHAHAGVSLADQVIKLEGQVSELSLSLLRFSKI------ 605
             LG+PR +  ++ +  LP+         L+D+ I  +G   E    +L  + I      
Sbjct: 447 AMLGLPRSISANDFDQTLPL--------ELSDENITEQGYFPENQNGVLSSTGIANEHTK 498

Query: 606 LGNILDSI------FKRGMTSSAAQQVALIHENALDNWRRGLPKNLTFELD 650
           L  ILD+I       K+  T  + + +A + E  L NW   LP  L   L+
Sbjct: 499 LLMILDAIVGELYPIKKTNTFISHETIATL-EQKLRNWLDDLPNELAPNLE 548

>Smik_9.39 Chr9 (80510..83548) [3039 bp, 1012 aa] {ON} YIL130W
           (REAL)
          Length = 1012

 Score = 49.7 bits (117), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 22/33 (66%), Gaps = 1/33 (3%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 101
           RV +ACD CR KK +CDG++P C  C    +EC
Sbjct: 16  RVTRACDECRKKKVKCDGQQP-CIHCTVYSYEC 47

 Score = 41.6 bits (96), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 43/165 (26%), Positives = 67/165 (40%), Gaps = 24/165 (14%)

Query: 492 GEVSSVYEIRGTVVSMAQQLRLHRCPSAVLGTEGSTMSKSEQGDRRLLFWGIYYLDVFGA 551
             +S+ Y   G  +  A +   HR  S+      S  S  E   R+ LF+ IY LDV+  
Sbjct: 363 ARLSTCYTYIGVAMRSALRAGFHRKLSS-----SSGFSPIEIEMRKRLFYTIYKLDVYIN 417

Query: 552 LQLGVPRLLKDHEIECALPISEHAHAGVSLADQVIKLEGQVSELSLSLL----------R 601
             LG+PR +   + +  LP+         L+D+ I     + E   S+L          +
Sbjct: 418 AMLGLPRSISPDDFDQTLPL--------DLSDENITEVAYLPENQHSVLSSTGISNEHTK 469

Query: 602 FSKILGNILDSIFKRGMTSS-AAQQVALIHENALDNWRRGLPKNL 645
              IL  I+  ++    TS+  + +     E  L NW   LPK L
Sbjct: 470 LFLILNEIISELYPIKKTSNIISHETVTSLELKLRNWLDSLPKEL 514

>Skud_9.37 Chr9 (79947..82811) [2865 bp, 954 aa] {ON} YIL130W (REAL)
          Length = 954

 Score = 49.7 bits (117), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 24/45 (53%), Gaps = 1/45 (2%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFP 113
           RV +ACD CR KK +CDG++P C  C    +EC       R   P
Sbjct: 16  RVTRACDECRKKKVKCDGQQP-CIHCTVYSYECTYKKPTKRTQNP 59

 Score = 42.7 bits (99), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 46/162 (28%), Positives = 70/162 (43%), Gaps = 18/162 (11%)

Query: 492 GEVSSVYEIRGTVVSMAQQLRLHRCPSAVLGTEGSTMSKSEQGDRRLLFWGIYYLDVFGA 551
             +S+ Y   G  +  A +   HR     LGT  S  S  E   R+ LF+ IY LDV+  
Sbjct: 361 ARLSTCYTYIGVAMRSALRAGFHR----KLGT-NSGFSPIEIEMRKRLFYTIYKLDVYIN 415

Query: 552 LQLGVPRLLKDHEIECALP-------ISEHAHAGVSLADQVIKLEGQVSELSLSLLRFSK 604
             LG+PR +   + +  LP       I+E A+   +  + V+   G  +E +   L    
Sbjct: 416 AMLGLPRSISPDDFDQTLPLDLSDENITETAYLPEN-QNAVLSSTGISNEHTKLFL---- 470

Query: 605 ILGNILDSIFKRGMTSS-AAQQVALIHENALDNWRRGLPKNL 645
           IL  I+  ++    TS+  + +     E  L NW   LPK L
Sbjct: 471 ILNEIISELYPIKKTSNIISHETVTSLELKLRNWLDSLPKEL 512

>YIL130W Chr9 (102782..105676) [2895 bp, 964 aa] {ON}  ASG1Zinc
           cluster protein proposed to function as a
           transcriptional regulator involved in the stress
           response; null mutants have a respiratory deficiency,
           calcofluor white sensitivity and slightly increased
           cycloheximide resistance
          Length = 964

 Score = 49.3 bits (116), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 22/33 (66%), Gaps = 1/33 (3%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 101
           RV +ACD CR KK +CDG++P C  C    +EC
Sbjct: 16  RVTRACDECRKKKVKCDGQQP-CIHCTVYSYEC 47

 Score = 41.6 bits (96), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 43/165 (26%), Positives = 66/165 (40%), Gaps = 24/165 (14%)

Query: 492 GEVSSVYEIRGTVVSMAQQLRLHRCPSAVLGTEGSTMSKSEQGDRRLLFWGIYYLDVFGA 551
             +S+ Y   G  +  A +   HR  S       S  S  E   R+ LF+ IY LDV+  
Sbjct: 360 ARLSTCYTYIGVAMRSALRAGFHRKLSP-----NSGFSPIEIEMRKRLFYTIYKLDVYIN 414

Query: 552 LQLGVPRLLKDHEIECALPISEHAHAGVSLADQVIKLEGQVSELSLSLL----------R 601
             LG+PR +   + +  LP+         L+D+ I     + E   S+L          +
Sbjct: 415 AMLGLPRSISPDDFDQTLPL--------DLSDENITEVAYLPENQHSVLSSTGISNEHTK 466

Query: 602 FSKILGNILDSIFKRGMTSS-AAQQVALIHENALDNWRRGLPKNL 645
              IL  I+  ++    TS+  + +     E  L NW   LPK L
Sbjct: 467 LFLILNEIISELYPIKKTSNIISHETVTSLELKLRNWLDSLPKEL 511

>KNAG0B05120 Chr2 (982236..984902) [2667 bp, 888 aa] {ON} 
          Length = 888

 Score = 49.3 bits (116), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 20/44 (45%), Positives = 24/44 (54%)

Query: 73  ACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGY 116
           AC RCRSKKT+CD K P C +C  +   C   D  +    PR Y
Sbjct: 45  ACKRCRSKKTKCDQKLPSCGKCTKLNTPCISVDPATGEDVPRSY 88

>Suva_9.59 Chr9 (97521..100298) [2778 bp, 926 aa] {ON} YIL130W
           (REAL)
          Length = 926

 Score = 49.3 bits (116), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 22/33 (66%), Gaps = 1/33 (3%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 101
           RV +ACD CR KK +CDG++P C  C    +EC
Sbjct: 16  RVTRACDECRKKKVKCDGQQP-CIHCTVYSYEC 47

 Score = 40.4 bits (93), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 41/161 (25%), Positives = 66/161 (40%), Gaps = 16/161 (9%)

Query: 492 GEVSSVYEIRGTVVSMAQQLRLHRCPSAVLGTEGSTMSKSEQGDRRLLFWGIYYLDVFGA 551
             +S+ Y   G  +  A +   HR  SA      S  +  E   R+ LF+ IY LDV+  
Sbjct: 360 ARLSTCYTYIGVAMRSALRAGFHRKLSA-----NSGFTPIEIEMRKRLFYTIYKLDVYIN 414

Query: 552 LQLGVPRLLKDHEIECALPISEHAHAGVSLA------DQVIKLEGQVSELSLSLLRFSKI 605
             LG+PR +   + +  LP+         +A      + V+   G  +E +   L    I
Sbjct: 415 AMLGLPRSISPEDFDQTLPLDLSDENITEVAYLPENQNAVLSSTGISNEHTKLFL----I 470

Query: 606 LGNILDSIFKRGMTSS-AAQQVALIHENALDNWRRGLPKNL 645
           L  I+  ++    T++  + +     E  L NW   LPK L
Sbjct: 471 LNEIISELYPIKKTNNIISHETVTSLELKLRNWLDSLPKEL 511

>Ecym_7440 Chr7 complement(902108..904804) [2697 bp, 898 aa] {ON}
           similar to Ashbya gossypii AER183C
          Length = 898

 Score = 49.3 bits (116), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 19/42 (45%), Positives = 27/42 (64%), Gaps = 1/42 (2%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRR 110
           RV++ACD CR+KK +C+G+ P CS C     EC  +  + RR
Sbjct: 22  RVSKACDTCRAKKIKCNGEEP-CSNCGKHDLECAYTHVIKRR 62

>TDEL0C04480 Chr3 (799022..801580) [2559 bp, 852 aa] {ON} Anc_2.231
           YIL130W possible pseudogene; NNN added to avoid internal
           stop codon
          Length = 852

 Score = 49.3 bits (116), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 24/41 (58%), Gaps = 1/41 (2%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSR 109
           RV +ACD CR KK +CDG++P C  C    +EC  +    R
Sbjct: 15  RVTRACDECRKKKVKCDGQQP-CIHCTVYSYECTYNQPTKR 54

 Score = 48.5 bits (114), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 53/217 (24%), Positives = 87/217 (40%), Gaps = 42/217 (19%)

Query: 492 GEVSSVYEIRGTVVSMAQQLRLHRCPSAVLGTEGSTMSKSEQGDRRLLFWGIYYLDVFGA 551
             +S+ Y   G  +  A +  LHR  S       S  S  E   R+ LF+ IY LDV+  
Sbjct: 346 ARLSTCYAYIGVAMRSALREGLHRSVSP-----DSGFSPIEIEMRKRLFYTIYKLDVYVN 400

Query: 552 LQLGVPRLLKDHEIECALPISEHAHAGVSLADQVIKLEGQV----------SELSLSLLR 601
             LG+PR +  ++ +  LPI         L+D+ I  EG            +E++    +
Sbjct: 401 AMLGLPRSISSNDFDQTLPI--------ELSDENITEEGYFPENQKGKLSSAEIANQHTK 452

Query: 602 FSKILGNILDSIFK-RGMTSSAAQQVALIHENALDNWRRGLPKNLTFELDVNGTIKIEEL 660
              IL  I+  ++  R   +    +V    E  L  W  GLP+ L     + G       
Sbjct: 453 LIMILNVIVGELYPIRKTNNLIRHEVVTELELKLRQWLDGLPREL-----IPGI------ 501

Query: 661 TGSAQNNQDFTKNASSDKKILMLLYFLVKCLVHLPVL 697
                  +D  K   +  K+L L +F V+ +++ P +
Sbjct: 502 -------KDVPKEYETANKLLHLSFFHVQLILYRPFI 531

>NCAS0G01100 Chr7 complement(193052..195859) [2808 bp, 935 aa] {ON}
           Anc_6.279
          Length = 935

 Score = 49.3 bits (116), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 26/45 (57%)

Query: 72  QACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGY 116
           QACD CR KK +C  ++P+C++C    +EC  S K  R    R +
Sbjct: 11  QACDLCRVKKLKCSKEKPKCAKCLKNNWECCYSPKTRRSPLTRAH 55

>Kwal_47.17681 s47 complement(513119..515683) [2565 bp, 854 aa] {ON}
           [contig 206] FULL
          Length = 854

 Score = 48.9 bits (115), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 48/198 (24%), Positives = 87/198 (43%), Gaps = 42/198 (21%)

Query: 505 VSMAQQLRLHRCPSAVLGTEGSTMSKSEQGDRRLLFWGIYYLDVFGALQLGVPRLLKDHE 564
           V++AQ   LHR           T++ +E+  R+L++W +Y +D   ++ +G P+ +    
Sbjct: 314 VTVAQTYGLHRS-----ADFHPTLTANEKRTRKLIWWILYVIDTLVSISIGRPQAINLD- 367

Query: 565 IECALPISEHAHAGVSLADQVIKLEGQVSELSLSLLRFSKILGNI----LDSIFKRGMTS 620
            +C +P+  H        D  I  EG   + ++++     I+  +    + S   R +  
Sbjct: 368 -DCDVPVLTH--------DDFI-FEGGAPDHAVAVDYMDCIISTVQIVEIMSRISRELNR 417

Query: 621 SAAQQ----VALIH-ENALDNWRRGLPKNLTFELDVNGTIKIEELTGSAQNNQDFTKNAS 675
            AA Q    V + H +  L  WR+ LP++LT+                  N + FTK+ S
Sbjct: 418 PAASQCDAKVLIQHFDMLLQRWRKNLPESLTYH----------------SNAEIFTKH-S 460

Query: 676 SDKKILMLLYFLVKCLVH 693
             K  +  LY+   CL+H
Sbjct: 461 IPKAFVNALYYKTLCLLH 478

 Score = 38.1 bits (87), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 24/49 (48%), Gaps = 6/49 (12%)

Query: 63  TPTSNYRVAQ-----ACDRCRSKKTRCDGK-RPQCSQCAAVGFECKVSD 105
           T  S YRV +     AC+ C  +K RCD   R  C+ C   G  C++ D
Sbjct: 3   TERSGYRVRKPRTNRACEVCHDRKVRCDANIRVPCTSCQTFGLVCRLRD 51

>Kpol_495.21 s495 (71447..74704) [3258 bp, 1085 aa] {ON}
           (71447..74704) [3258 nt, 1086 aa]
          Length = 1085

 Score = 48.9 bits (115), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 27/51 (52%), Gaps = 4/51 (7%)

Query: 55  SISPVTSATPTSNYRVAQACDRCRSKKTRCDG----KRPQCSQCAAVGFEC 101
           +I    S T     RVA+ACDRCR +K +CD     K  +CS C   G EC
Sbjct: 104 AIKSNVSTTKVQKRRVARACDRCRKRKIKCDEIKNLKVNKCSNCVKYGAEC 154

>KLTH0G09108g Chr7 (744062..746410) [2349 bp, 782 aa] {ON} weakly
           similar to uniprot|P40467 Saccharomyces cerevisiae
           YIL130W ASG1 Proposed transcriptional activator member
           of the Gal4p family of zinc cluster proteins
          Length = 782

 Score = 48.9 bits (115), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 22/33 (66%), Gaps = 1/33 (3%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 101
           RV +ACD CR KK +CDG++P C  C    +EC
Sbjct: 10  RVTRACDECRKKKVKCDGQQP-CIHCTVYSYEC 41

 Score = 39.3 bits (90), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 40/165 (24%), Positives = 67/165 (40%), Gaps = 23/165 (13%)

Query: 492 GEVSSVYEIRGTVVSMAQQLRLHRCPSAVLGTEGSTMSKSEQGDRRLLFWGIYYLDVFGA 551
             +S+ Y   G  +  A +  +HR     L  +  + +  E   R+ LF+ IY +DV+  
Sbjct: 308 ARLSTCYTYIGVAMRNALREGMHRN----LNADTHSYNPIEIEMRKRLFYTIYKMDVYVN 363

Query: 552 LQLGVPRLLKDHEIECALPISEHAHAGVSLADQVIKLEGQVSELSLSLL----------R 601
             LG+PR +   + + ALP          L D+ I  +G   E   ++L          +
Sbjct: 364 TMLGLPRSVSQRDFDQALP--------AELTDEFITKDGLHFEKQGNVLSSAGIANQHTK 415

Query: 602 FSKILGNILDSIFKRGMTSS-AAQQVALIHENALDNWRRGLPKNL 645
              IL NI+  ++    T++  +  V    E  L  W   LP  L
Sbjct: 416 LIMILDNIVAELYPVKKTNNLISHDVVTQLELKLRQWLDNLPPEL 460

>CAGL0G08844g Chr7 complement(846590..849133) [2544 bp, 847 aa] {ON}
           similar to uniprot|P40467 Saccharomyces cerevisiae
           YIL130w
          Length = 847

 Score = 48.9 bits (115), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 24/41 (58%), Gaps = 1/41 (2%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSR 109
           +V +ACD CR KK +CDG +P C  C    +EC  +  L R
Sbjct: 15  KVTRACDDCRKKKVKCDGNQP-CIHCTVYSYECTYNHPLKR 54

>SAKL0E08998g Chr5 complement(747085..749556) [2472 bp, 823 aa] {ON}
           similar to uniprot|P40467 Saccharomyces cerevisiae
           YIL130W ASG1 Proposed transcriptional activator member
           of the Gal4p family of zinc cluster proteins
          Length = 823

 Score = 48.9 bits (115), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 24/41 (58%), Gaps = 1/41 (2%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSR 109
           RV +ACD CR KK +CDG++P C  C    +EC  +    R
Sbjct: 10  RVTRACDECRKKKVKCDGQQP-CIHCTVYSYECTYNQPTKR 49

 Score = 41.6 bits (96), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 40/160 (25%), Positives = 70/160 (43%), Gaps = 13/160 (8%)

Query: 492 GEVSSVYEIRGTVVSMAQQLRLHRCPSAVLGTEGSTMSKSEQGDRRLLFWGIYYLDVFGA 551
             +S+ Y   G  +  A +  LHR  +  +G  G T  + E   R+ LF+ IY +D++  
Sbjct: 294 ARLSTCYAYIGVAMRSALREGLHR--NLTMGAPGFTPIEIEM--RKRLFFTIYKMDIYLN 349

Query: 552 LQLGVPRLLKDHEIECALPISEHAHAGVSLADQVIKLEGQVSELSLSLL-----RFSKIL 606
             LG+PR +   + + + P+         + +  I  E Q  ELS + +     +   IL
Sbjct: 350 TMLGLPRAISQRDFDQSFPLEIDDEY---ITEDGIYPERQGDELSSAGIANQHTKLIMIL 406

Query: 607 GNILDSIFKRGMTSS-AAQQVALIHENALDNWRRGLPKNL 645
            NI+  ++    T++  + +V    E  L  W   LP  L
Sbjct: 407 DNIVSELYPIKKTNNLISHEVVTNLELKLRQWLNQLPPEL 446

>Kwal_23.4754 s23 (845550..847988) [2439 bp, 812 aa] {ON} YIL130W
           (GIN1) - 1:1 [contig 5] FULL
          Length = 812

 Score = 48.9 bits (115), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 22/33 (66%), Gaps = 1/33 (3%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 101
           RV +ACD CR KK +CDG++P C  C    +EC
Sbjct: 10  RVTRACDECRKKKVKCDGQQP-CIHCTVYSYEC 41

 Score = 43.1 bits (100), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 43/166 (25%), Positives = 67/166 (40%), Gaps = 23/166 (13%)

Query: 492 GEVSSVYEIRGTVVSMAQQLRLHRCPSAVLGTEGSTMSKSEQGDRRLLFWGIYYLDVFGA 551
             +S+ Y   G  +  A +  +HR     L T+    S  E   R+ LF+ IY +DV+  
Sbjct: 339 ARLSTCYTYIGVAMRNALREGMHRN----LNTDTHGYSPIEIEMRKRLFYTIYKMDVYVN 394

Query: 552 LQLGVPRLLKDHEIECALPISEHAHAGVSLADQVIKLEGQVSELSLSLL----------R 601
             LG+PR +   + + ALP          L D+ I  +G   E    +L          +
Sbjct: 395 TMLGLPRSVSQRDFDQALP--------AELTDEYITEDGLHPEKQGDVLSSAGIANQHTK 446

Query: 602 FSKILGNILDSIFKRGMTSS-AAQQVALIHENALDNWRRGLPKNLT 646
              IL NI+  ++    T++  +  V    E  L  W   LP  LT
Sbjct: 447 LIMILDNIVAELYPVKKTNNLISHDVVTQLEFKLRQWLDNLPPELT 492

>SAKL0A02860g Chr1 complement(259388..261625) [2238 bp, 745 aa] {ON}
           similar to uniprot|P04386 Saccharomyces cerevisiae
           YPL248C GAL4 DNA-binding transcription factor required
           for the activation of the GAL genes in response to
           galactose repressed by Gal80p and activated by Gal3p
          Length = 745

 Score = 48.5 bits (114), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 25/45 (55%)

Query: 70  VAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPR 114
           V QACD CR +K RC  + P+CS+C    +EC  S K  R    R
Sbjct: 5   VQQACDSCRKRKLRCSKELPKCSKCLKHNWECCYSPKAVRSPLTR 49

>KNAG0E01760 Chr5 (350254..352962) [2709 bp, 902 aa] {ON} Anc_2.231
           YIL130W
          Length = 902

 Score = 48.5 bits (114), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 22/33 (66%), Gaps = 1/33 (3%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 101
           RV +ACD CR KK +CDG++P C  C    +EC
Sbjct: 32  RVTRACDECRKKKVKCDGQQP-CIHCTVYSYEC 63

 Score = 39.3 bits (90), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 41/158 (25%), Positives = 67/158 (42%), Gaps = 10/158 (6%)

Query: 492 GEVSSVYEIRGTVVSMAQQLRLHRCPSAVLGTEGSTMSKSEQGDRRLLFWGIYYLDVFGA 551
             +S+ Y   G  +  A +   HR     +G E S +S  E   R+ LF+ IY LDV+  
Sbjct: 392 ARLSTCYAYIGVAMRSALREGFHR----KVGPE-SDLSPLEIEIRKRLFYTIYKLDVYVN 446

Query: 552 LQLGVPRLLKDHEIECALPISEHAHAGVSLADQVIKLEGQVSELSLS--LLRFSKILGNI 609
             LG+PR +   + +  LP+          A    + +G +S   ++    R   IL  I
Sbjct: 447 AMLGLPRSISPEDFDQVLPLELSDENITEQAYYPEREDGSLSSTGIANCHTRLIMILDTI 506

Query: 610 LDSIF--KRGMTSSAAQQVALIHENALDNWRRGLPKNL 645
           +  ++  KR     + + V  + E  L +W   LP  L
Sbjct: 507 MRKLYPIKRPNNVISHETVTNL-EKLLRDWTNTLPAEL 543

>KLTH0G07898g Chr7 (636890..639490) [2601 bp, 866 aa] {ON} similar
           to uniprot|P07272 Saccharomyces cerevisiae YLR014C PPR1
           Zinc finger transcription factor containing a
           Zn(2)-Cys(6) binuclear cluster domain positively
           regulates transcription of genes involved in uracil
           biosynthesis activity may be modulated by interaction
           with Tup1p
          Length = 866

 Score = 48.5 bits (114), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 28/78 (35%), Positives = 34/78 (43%), Gaps = 6/78 (7%)

Query: 43  RTNNSAAPNAARSISPVTSATPTSNY----RVAQACDRCRSKKTRCDGKRPQCSQCAAVG 98
           R    +A NA  S+       PTS      R   AC RCR +K +CD K P CS+C    
Sbjct: 5   RKRRGSAANAEESVD--RKRRPTSAIMGISRSIAACKRCRVRKVKCDQKFPSCSRCVTAN 62

Query: 99  FECKVSDKLSRRAFPRGY 116
             C   D  + R  PR Y
Sbjct: 63  EPCVSVDPATGRDVPRSY 80

>KLLA0A02585g Chr1 complement(226562..227674) [1113 bp, 370 aa] {ON}
           conserved hypothetical protein
          Length = 370

 Score = 48.1 bits (113), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/55 (43%), Positives = 33/55 (60%), Gaps = 5/55 (9%)

Query: 51  NAARSISPVTSATPTSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSD 105
           N +RS    ++  PT   RV++ACD CR  KT+CDG+RP CS+C      C  S+
Sbjct: 3   NGSRS----SAELPTIKRRVSKACDACRKSKTKCDGERP-CSRCLKENKLCTYSN 52

>Kpol_1039.11 s1039 (29727..32705) [2979 bp, 992 aa] {ON}
           (29727..32705) [2979 nt, 993 aa]
          Length = 992

 Score = 48.5 bits (114), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 21/33 (63%), Gaps = 1/33 (3%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 101
           RV +ACD CR KK +CDG++P C  C    + C
Sbjct: 31  RVTRACDECRKKKVKCDGQQP-CIHCTVYSYNC 62

 Score = 40.8 bits (94), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 38/165 (23%), Positives = 72/165 (43%), Gaps = 23/165 (13%)

Query: 492 GEVSSVYEIRGTVVSMAQQLRLHRCPSAVLGTEGSTMSKSEQGDRRLLFWGIYYLDVFGA 551
             +S+ Y   G  +  A +  LHR     +  + S ++  +   R+ +F+ IY  D++  
Sbjct: 484 ARLSNCYSYIGIALRNALREGLHR----FVNPKSSNLNPLDIEMRKRVFYTIYKCDLYLN 539

Query: 552 LQLGVPRLLKDHEIECALPISEHAHAGVSLADQVIKLEG-----QVSELSLSLL-----R 601
             LG+P+ L   + +  LP        V L+D+ I  EG     Q  E+S + +     +
Sbjct: 540 SMLGLPKSLSSADFDQVLP--------VELSDENITEEGYFPDKQNGEVSSAAIANYHTK 591

Query: 602 FSKILGNILDSIFKRGMTSSAAQQVALIH-ENALDNWRRGLPKNL 645
              IL +I   ++    +++      +   E  L+NW + LP+ L
Sbjct: 592 LMLILADITKELYPNKKSNNIVSHETVTQLEMRLENWIQSLPQQL 636

>NDAI0I02350 Chr9 (536448..539117) [2670 bp, 889 aa] {ON} Anc_5.235
          Length = 889

 Score = 48.5 bits (114), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 23/44 (52%)

Query: 73  ACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGY 116
           AC RCR KK +CD   P CS+CA +   C   D  +    PR Y
Sbjct: 21  ACKRCRLKKIKCDNNVPSCSRCAKLRVPCVAVDSATGEDVPRSY 64

>YOR380W Chr15 (1051290..1052930) [1641 bp, 546 aa] {ON}
           RDR1Transcriptional repressor involved in the control of
           multidrug resistance; negatively regulates expression of
           the PDR5 gene; member of the Gal4p family of zinc
           cluster proteins
          Length = 546

 Score = 48.1 bits (113), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 31/58 (53%), Gaps = 1/58 (1%)

Query: 57  SPVTSATPTSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPR 114
           SP ++A P    RV +AC  CR +K +C+GK P C  C A G+ C   D     A P+
Sbjct: 3   SPGSTALPHKRQRVRKACVPCRERKRKCNGKSP-CEMCVAYGYVCHYIDGRVPSASPQ 59

>KLTH0D07260g Chr4 complement(635598..638537) [2940 bp, 979 aa] {ON}
           some similarities with uniprot|P32862 Saccharomyces
           cerevisiae YKL038W RGT1 Glucose-responsive transcription
           factor that regulates expression of several glucose
           transporter (HXT) genes in response to glucose binds to
           promoters and acts both as a transcriptional activator
           and repressor
          Length = 979

 Score = 48.5 bits (114), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 29/50 (58%), Gaps = 2/50 (4%)

Query: 69  RVAQACDRCRSKKTRCD--GKRPQCSQCAAVGFECKVSDKLSRRAFPRGY 116
           + ++ACD+CR KKTRCD   +RP CS C  +G  C       +R   +GY
Sbjct: 30  KTSRACDQCREKKTRCDFSDERPICSACQRMGKTCTFERVPMKRGPTKGY 79

>KAFR0J00690 Chr10 (124449..127043) [2595 bp, 864 aa] {ON} Anc_5.235
           YLR014C
          Length = 864

 Score = 48.1 bits (113), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 24/44 (54%)

Query: 73  ACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGY 116
           AC RCR+KK +CD + P C +CA V   C   D  +    PR Y
Sbjct: 33  ACKRCRAKKIKCDQEFPSCGKCAKVNEPCVSIDPATGEDIPRSY 76

>Suva_10.94 Chr10 complement(178366..181086) [2721 bp, 906 aa] {ON}
           YLR014C (REAL)
          Length = 906

 Score = 48.1 bits (113), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 35/71 (49%), Gaps = 3/71 (4%)

Query: 49  APNAARSISPVTSATPTSNYRVAQ---ACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSD 105
           A N   SI+ +     + N  +++   AC RCR KK +CD + P C +CA +   C   D
Sbjct: 6   ATNKKNSITHLPKKGDSPNIGISKSRTACKRCRQKKIKCDQEFPSCKRCAKLKVPCVSLD 65

Query: 106 KLSRRAFPRGY 116
             + +  PR Y
Sbjct: 66  PATGKDVPRSY 76

>KAFR0F01490 Chr6 complement(290988..292964) [1977 bp, 658 aa] {ON}
           Anc_1.128 YJL206C
          Length = 658

 Score = 47.8 bits (112), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 31/60 (51%), Gaps = 6/60 (10%)

Query: 57  SPVTSATPTSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGY 116
           S     TPT   RV +AC  CR KK RCDGK P CS CA     C+ ++     A PR +
Sbjct: 16  SKTKKLTPT-RLRVFKACIACRKKKRRCDGKSP-CSHCARTSIICEYTNT----ARPRSH 69

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 46/165 (27%), Positives = 68/165 (41%), Gaps = 25/165 (15%)

Query: 492 GEVSSVYEIRGTVVSMAQQLRLHRCPSAVLGTEGSTMSKSEQGDRRLLFWGIYYLDVFGA 551
           G++ + Y   G  + +A +  LHR PS      G T  + E   R  LFW IY +D++  
Sbjct: 257 GDLKACYYYIGIALRIAIRENLHRKPSLT----GPTAIEDETKKR--LFWSIYKVDIYMN 310

Query: 552 LQLGVPRLLKDHEIECALPISEHAHAGVSLADQVI-----------KLEGQVSELSLSLL 600
             LG+P  L +  I+  LP        VS  D VI            +  + ++L L +L
Sbjct: 311 CTLGLPASLNESFIDQELPYDVDDEKIVS--DGVIFNENSNIISSCGMNNEHTKLILIML 368

Query: 601 RFSKILGNILDSIFKRGMTSSAAQQVALIHENALDNWRRGLPKNL 645
           +  + L +I   I K          V L  E+ L  W   LP  L
Sbjct: 369 KIYRTLYSIDVEILK------IDANVVLHLEDILFTWYNNLPLQL 407

>Suva_16.59 Chr16 complement(88631..91318) [2688 bp, 895 aa] {ON}
           YPL248C (REAL)
          Length = 895

 Score = 47.8 bits (112), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 26/45 (57%)

Query: 70  VAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPR 114
           + QACD CR KK +C  ++P+CS+C    +EC  S K  R    R
Sbjct: 7   MEQACDICRLKKLKCSKEKPKCSKCLKNNWECCYSPKTKRSPLTR 51

>Kwal_23.2905 s23 (69235..71880) [2646 bp, 881 aa] {ON} YLR014C
           (PPR1) - zinc-finger transcription factor of the
           Zn(2)-Cys(6) binuclear cluster domain type [contig 246]
           FULL
          Length = 881

 Score = 47.8 bits (112), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 25/48 (52%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGY 116
           R   AC RCR +K +CD K P CS+C +    C   D  + R  PR Y
Sbjct: 44  RSIAACKRCRIRKVKCDQKFPSCSRCVSANEPCVSIDPATGRDVPRSY 91

>TPHA0H01980 Chr8 (467688..470669) [2982 bp, 993 aa] {ON} Anc_6.279
           YPL248C
          Length = 993

 Score = 47.8 bits (112), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 26/47 (55%)

Query: 70  VAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGY 116
           V QACD CR KK RC  + P+C++C    +EC  S +  R    R +
Sbjct: 8   VDQACDSCRIKKLRCSKENPKCAKCLKNKWECCYSPRKRRSPLTRAH 54

>KLTH0D02222g Chr4 (220570..223113) [2544 bp, 847 aa] {ON} weakly
           similar to uniprot|P52960 Saccharomyces cerevisiae
           YOR363C PIP2 peroxisome induction pathway 2 (PIP2)
           transcriptional activator of peroxisome proliferation
           may form heterodimer with Oaf1 to activate
           oleate-inducible gene expression activator of peroxisome
           proliferation
          Length = 847

 Score = 47.8 bits (112), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 31/50 (62%), Gaps = 2/50 (4%)

Query: 66  SNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECK--VSDKLSRRAFP 113
           S  R++  C  CR +K +CD  +P+C +CA +G EC   +S+++S +  P
Sbjct: 24  SRLRLSFVCRNCRKRKIKCDKAQPKCGRCAKLGLECNYDLSEQISLKKTP 73

>KLTH0E14454g Chr5 complement(1282704..1285412) [2709 bp, 902 aa]
           {ON} some similarities with uniprot|Q12180 Saccharomyces
           cerevisiae YOL089C HAL9 Putative transcription factor
           containing a zinc finger; overexpression increases salt
           tolerance through increased expression of the
           ENA1(Na+/Li+ extrusion pump) gene while gene disruption
           decreases both salt tolerance and ENA1 expression
          Length = 902

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/45 (46%), Positives = 28/45 (62%), Gaps = 1/45 (2%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFP 113
           RV++ACD CR+KK +CDG  P CS C  V  EC  +  + +R  P
Sbjct: 9   RVSKACDACRAKKIKCDGCDP-CSNCKKVSQECGYTYVVKKRQKP 52

>TDEL0E03910 Chr5 (732533..735121) [2589 bp, 862 aa] {ON} Anc_5.235
           YLR014C
          Length = 862

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/44 (45%), Positives = 24/44 (54%)

Query: 73  ACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGY 116
           AC RCR KK +CD + P C +CA V   C   D  + R  PR Y
Sbjct: 29  ACKRCRLKKIKCDQEFPSCLKCARVKVPCVSLDPATGRDVPRSY 72

>SAKL0H24860g Chr8 complement(2162455..2165370) [2916 bp, 971 aa]
           {ON} conserved hypothetical protein
          Length = 971

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/65 (36%), Positives = 38/65 (58%), Gaps = 4/65 (6%)

Query: 507 MAQQLRLHRCPSAVLGTEGSTMSKSEQGDRRLLFWGIYYLDVFGALQLGVPRLLKDHEIE 566
           +AQ++ L R P++  G    T+ +S    RR+LFW I+ LD   +L   +P L+K  E +
Sbjct: 388 LAQRVMLTRDPTSYHGITDPTLVQS----RRILFWQIFQLDTLTSLHNNLPPLIKLDEFD 443

Query: 567 CALPI 571
            ALP+
Sbjct: 444 TALPV 448

>TBLA0G01800 Chr7 complement(469668..473132) [3465 bp, 1154 aa] {ON}
           Anc_6.279 YPL248C
          Length = 1154

 Score = 47.4 bits (111), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 26/45 (57%)

Query: 72  QACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGY 116
           QACD CR KK +C  ++P+C++C    +EC  S +  R    R +
Sbjct: 16  QACDSCRLKKLKCSKEKPKCAKCLKNIWECCYSPRAKRSPLTRNH 60

>TDEL0E00160 Chr5 (16083..17978) [1896 bp, 631 aa] {ON} 
          Length = 631

 Score = 47.0 bits (110), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 27/47 (57%)

Query: 68  YRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPR 114
           + + +ACD CR KK +C   RP+C +C   G++C  S ++ R    R
Sbjct: 2   FEMDRACDSCRHKKLKCSKTRPKCKKCLKNGWDCCYSPRIKRSPLTR 48

>ZYRO0A10956g Chr1 (881429..883996) [2568 bp, 855 aa] {ON} similar
           to uniprot|P07272 Saccharomyces cerevisiae YLR014C PPR1
           Zinc finger transcription factor containing a
           Zn(2)-Cys(6) binuclear cluster domain positively
           regulates transcription of genes involved in uracil
           biosynthesis activity may be modulated by interaction
           with Tup1p
          Length = 855

 Score = 47.0 bits (110), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 24/44 (54%)

Query: 73  ACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGY 116
           AC RCR+KK +CD + P C +CA     C   D  + R  PR Y
Sbjct: 32  ACKRCRTKKIKCDHEFPSCKKCARANKPCVSLDPATGRDVPRSY 75

>Smik_1.13 Chr1 (31514..34654) [3141 bp, 1046 aa] {ON} YAL051W
           (REAL)
          Length = 1046

 Score = 47.0 bits (110), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 36/63 (57%), Gaps = 5/63 (7%)

Query: 55  SISPVTSATPTSNY---RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRA 111
           S SP    + T N    R++  C  CR  KT+CD ++P+CS+C   G +C V D +S++ 
Sbjct: 44  STSPAPENSETHNRKRNRISFVCQACRKSKTKCDREKPECSRCIKHGLKC-VYD-VSKQP 101

Query: 112 FPR 114
            PR
Sbjct: 102 APR 104

>NDAI0I00740 Chr9 complement(160212..163313) [3102 bp, 1033 aa] {ON}
           Anc_6.279 YPL248C
          Length = 1033

 Score = 47.0 bits (110), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 24/47 (51%)

Query: 70  VAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGY 116
           + QACD CR KK +C    P+C QC    + C  S K+ R    R +
Sbjct: 7   IEQACDNCRLKKLKCSKHFPKCGQCLKNNWPCIYSPKVKRSPLTRVH 53

>KNAG0E00210 Chr5 (24545..27391) [2847 bp, 948 aa] {ON} Anc_7.17
           YOR363C
          Length = 948

 Score = 46.6 bits (109), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 22/33 (66%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 101
           R++  C  CR+ K +CD ++PQC +C  +G EC
Sbjct: 24  RLSYVCKACRTAKAKCDKEKPQCGRCYKLGVEC 56

>ZYRO0E06270g Chr5 (475960..478698) [2739 bp, 912 aa] {ON} weakly
           similar to uniprot|P50104 Saccharomyces cerevisiae
           YMR019W STB4 Protein that binds Sin3p in a two- hybrid
           assay
          Length = 912

 Score = 46.6 bits (109), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 27/46 (58%), Gaps = 1/46 (2%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPR 114
           RV +AC+ C+ +K +CDG +P C+ C   G ECK      RR + R
Sbjct: 12  RVRKACEICKRRKVKCDGSQP-CANCVKHGQECKYISGTVRRRYRR 56

>Skud_12.82 Chr12 complement(164119..166818) [2700 bp, 899 aa] {ON}
           YLR014C (REAL)
          Length = 899

 Score = 46.6 bits (109), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 36/75 (48%), Gaps = 1/75 (1%)

Query: 43  RTNNSAAPNAARSISPVTSATPTSNYRVAQ-ACDRCRSKKTRCDGKRPQCSQCAAVGFEC 101
           +  N  A  + R+  P    +P   +  ++ AC RCR KK +CD + P C +CA +   C
Sbjct: 2   KQRNINAKKSNRTHLPRIDGSPNIGFSKSRTACKRCRLKKIKCDQEFPSCKRCANLEVPC 61

Query: 102 KVSDKLSRRAFPRGY 116
              D  + +  PR Y
Sbjct: 62  VSLDPATGKDVPRSY 76

>KLTH0H16170g Chr8 complement(1391996..1393855) [1860 bp, 619 aa]
           {ON} some similarities with uniprot|P52960 Saccharomyces
           cerevisiae YOR363C PIP2 peroxisome induction pathway 2
           (PIP2) transcriptional activator of peroxisome
           proliferation may form heterodimer with Oaf1 to activate
           oleate-inducible gene expression activator of peroxisome
           proliferation
          Length = 619

 Score = 46.2 bits (108), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 21/37 (56%)

Query: 65  TSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 101
           T   R    CD CR +K +CD  +P CS+CA  G EC
Sbjct: 6   TKRNRRLHVCDACRIRKLKCDKAKPNCSRCAKHGLEC 42

>CAGL0M12298g Chr13 complement(1227303..1230287) [2985 bp, 994 aa]
           {ON} similar to uniprot|P39720 Saccharomyces cerevisiae
           YAL051w OAF1 peroxisome proliferating transcription
           factor or uniprot|P52960 Saccharomyces cerevisiae
           YOR363c PIP2
          Length = 994

 Score = 46.6 bits (109), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 30/46 (65%), Gaps = 2/46 (4%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPR 114
           R++  C  CR  KTRCD ++P C++C  +  EC V D +++++ PR
Sbjct: 22  RISFVCQACRRSKTRCDKEKPICTRCKKLKLEC-VYD-MAKQSAPR 65

>TPHA0N00230 Chr14 (39855..43553) [3699 bp, 1232 aa] {ON} Anc_7.17
           YOR363C
          Length = 1232

 Score = 46.6 bits (109), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 21/33 (63%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 101
           R++  C  CR  KT+CD K+P C++C   G +C
Sbjct: 47  RISFVCQHCRKSKTKCDKKQPHCARCIKHGIQC 79

>Smik_2.438 Chr2 (786437..787846) [1410 bp, 469 aa] {ON} YBR297W
           (REAL)
          Length = 469

 Score = 46.2 bits (108), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 19/42 (45%), Positives = 25/42 (59%), Gaps = 1/42 (2%)

Query: 70  VAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRA 111
           V  ACD CR ++ +CDGK+P CS+C    FEC     L +R 
Sbjct: 4   VKYACDFCRVRRVKCDGKKP-CSRCIQHDFECTYQQPLRKRG 44

>Smik_12.77 Chr12 complement(159125..161836) [2712 bp, 903 aa] {ON}
           YLR014C (REAL)
          Length = 903

 Score = 46.2 bits (108), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 24/44 (54%)

Query: 73  ACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGY 116
           AC RCR KK +CD + P C +CA +   C   D  + +  PR Y
Sbjct: 32  ACKRCRLKKIKCDQEFPSCKRCAKLQVPCVSLDPATGKDVPRSY 75

>SAKL0C03938g Chr3 complement(377431..379773) [2343 bp, 780 aa] {ON}
           weakly similar to uniprot|P40467 Saccharomyces
           cerevisiae YIL130W ASG1 Proposed transcriptional
           activator member of the Gal4p family of zinc cluster
           proteins and to YJL206C uniprot|P39529 Saccharomyces
           cerevisiae YJL206C
          Length = 780

 Score = 46.2 bits (108), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 22/33 (66%), Gaps = 1/33 (3%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 101
           RV++ACD CR +K RCDG++P C  C    + C
Sbjct: 27  RVSRACDVCRQRKVRCDGRQP-CIHCTVYSYNC 58

 Score = 34.7 bits (78), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 36/74 (48%), Gaps = 6/74 (8%)

Query: 492 GEVSSVYEIRGTVVSMAQQLRLHRCPSAVLGTEGSTMSKSEQGDRRLLFWGIYYLDVFGA 551
            ++++ Y   G  +  A    LH      + T G +  ++E   R  LFW IY +DV+  
Sbjct: 355 AKLTTCYSYIGVALRAAITQGLH----TKVSTAGKSPVEAETCKR--LFWTIYKMDVYMN 408

Query: 552 LQLGVPRLLKDHEI 565
             LG+PR + + ++
Sbjct: 409 CILGLPRSISEEDV 422

>TDEL0C05680 Chr3 complement(1020646..1022721) [2076 bp, 691 aa]
           {ON} Anc_1.128 YJL206C
          Length = 691

 Score = 46.2 bits (108), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 30/50 (60%), Gaps = 1/50 (2%)

Query: 49  APNAARSISPVTSATPTSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVG 98
           A     S++  T    TS  RV++AC+ CRSKK +CDG++P C  C  VG
Sbjct: 105 AKMMVLSMNASTKRLTTSKGRVSRACEFCRSKKKKCDGQQP-CDLCKLVG 153

 Score = 34.7 bits (78), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 35/79 (44%), Gaps = 6/79 (7%)

Query: 492 GEVSSVYEIRGTVVSMAQQLRLHRCPSAVLGTEGSTMSKSEQGDRRLLFWGIYYLDVFGA 551
             + + Y   G  +  A    LHR  S +    G T  + E   R  LFW +Y +D++  
Sbjct: 307 ANLKTCYSYIGIALRAAISEGLHRKNSLI----GPTPIEDETKKR--LFWSVYKVDLYMN 360

Query: 552 LQLGVPRLLKDHEIECALP 570
             LG+PR L +  I   LP
Sbjct: 361 CILGLPRTLSESAINQELP 379

>YBR297W Chr2 (800523..801929) [1407 bp, 468 aa] {ON}
           MAL33MAL-activator protein, part of complex locus MAL3;
           nonfunctional in genomic reference strain S288C
          Length = 468

 Score = 45.8 bits (107), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 25/42 (59%), Gaps = 1/42 (2%)

Query: 70  VAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRA 111
           V  ACD CR ++ +CDGK+P CS+C    F+C     L +R 
Sbjct: 4   VKYACDYCRVRRVKCDGKKP-CSRCIEHNFDCTYQQPLKKRG 44

>KAFR0C04980 Chr3 (987900..990755) [2856 bp, 951 aa] {ON} Anc_7.17
           YOR363C
          Length = 951

 Score = 46.2 bits (108), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 23/41 (56%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSR 109
           R++  C  CR  KT+CD ++P CS+C     EC    +L R
Sbjct: 60  RISFVCQACRKAKTKCDKEKPMCSRCRKQDLECVYDIELQR 100

>CAGL0A00451g Chr1 (47557..50880) [3324 bp, 1107 aa] {ON} similar to
           uniprot|P12383 Saccharomyces cerevisiae YGL013c PDR1
           transcription factor
          Length = 1107

 Score = 46.2 bits (108), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 34/68 (50%), Gaps = 6/68 (8%)

Query: 43  RTNNSAAPNAARSISPVTSATPTSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECK 102
            T + + P   ++  P T  T     +V +ACD CR +K +C+G +P C  C   G EC 
Sbjct: 5   ETTSKSNPGEVKAQKPSTRRT-----KVGKACDSCRRRKIKCNGLKP-CPSCTIYGCECT 58

Query: 103 VSDKLSRR 110
            +D  S +
Sbjct: 59  YTDAKSTK 66

 Score = 36.6 bits (83), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 35/72 (48%), Gaps = 6/72 (8%)

Query: 499 EIRGTVVSMAQQLRLHRCPSAVLGTEGSTMSKSEQGDRRLLFWGIYYLDVFGALQLGVPR 558
           ++    V+ A+++  HR    V G E ST  K     RRLL+W +Y  +    ++ G   
Sbjct: 561 KVLNVAVANAKKMGFHRWEFYV-GYEESTAEK-----RRLLWWKLYNYEKASTMKKGFFS 614

Query: 559 LLKDHEIECALP 570
           ++ D  + C LP
Sbjct: 615 VIDDATVNCLLP 626

>SAKL0C09944g Chr3 complement(899127..902312) [3186 bp, 1061 aa]
           {ON} weakly similar to uniprot|Q12180 Saccharomyces
           cerevisiae YOL089C HAL9 Putative transcription factor
           containing a zinc finger overexpression increases salt
           tolerance through increased expression of the ENA1 (Na
           /Li extrusion pump) gene while gene disruption decreases
           both salt tolerance and ENA1 expression
          Length = 1061

 Score = 45.8 bits (107), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 36/62 (58%), Gaps = 7/62 (11%)

Query: 44  TNNSAAPNAARSISPV-TSATPTSNYRVAQACDRCRSKKTRCDGKRP---QCSQCAAVGF 99
           T+++ +P A  SISP+  S  P    RV++ACD CR +K +CD  +P   +CS C     
Sbjct: 111 TSHTESP-AFTSISPLDVSGAPKK--RVSKACDHCRKRKIKCDDVKPRTGKCSNCTKFNA 167

Query: 100 EC 101
           EC
Sbjct: 168 EC 169

 Score = 41.6 bits (96), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 40/176 (22%), Positives = 67/176 (38%), Gaps = 31/176 (17%)

Query: 498 YEIRGTVVSMAQQLRLHRCPSAVLGTEGSTMSKSEQGDRRLLFWGIYYLDVFGALQLGVP 557
           Y I  T V  AQ + LH   +         +S  E   RR+L+W  Y  D F +L+L  P
Sbjct: 518 YSIFATAVRFAQDMSLHNLDTY------KRLSYKECLKRRILWWHCYTTDKFLSLKLCKP 571

Query: 558 RLLKDHEIECALPIS-----------------EHAHAGVSLADQVIKLEGQVSELSLSLL 600
            L+ + ++      S                 E      ++ + + KLE   S L + + 
Sbjct: 572 SLINERDMTVLTDESYVVLIKGQLLPQVGTDREAIDQITTIEEALRKLEEHCSFLPVFIS 631

Query: 601 RFSKILGNILDSIFK--------RGMTSSAAQQVALIHENALDNWRRGLPKNLTFE 648
            ++  L  I   I+         +G T        L  +N+L +W + LP ++  E
Sbjct: 632 YYTTKLARISSKIYYSFFTPTSLKGQTFDTMIDRVLEIKNSLSDWEKYLPGSIRLE 687

>SAKL0B06732g Chr2 complement(578508..581144) [2637 bp, 878 aa] {ON}
           some similarities with uniprot|Q12180 Saccharomyces
           cerevisiae YOL089C HAL9 Putative transcription factor
           containing a zinc finger overexpression increases salt
           tolerance through increased expression of the ENA1 (Na
           /Li extrusion pump) gene while gene disruption decreases
           both salt tolerance and ENA1 expression
          Length = 878

 Score = 45.8 bits (107), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 28/45 (62%), Gaps = 1/45 (2%)

Query: 66  SNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRR 110
           S  RV++ACD CRSKK +C+G++  CS C   G  C  +  + +R
Sbjct: 8   SRRRVSKACDSCRSKKIKCNGEQ-TCSNCLKYGCPCTYTHTIKKR 51

>KAFR0F01040 Chr6 complement(195192..197696) [2505 bp, 834 aa] {ON}
           Anc_6.279 YPL248C
          Length = 834

 Score = 45.8 bits (107), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 23/47 (48%)

Query: 70  VAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGY 116
           + QACD CR KK RC  ++P C +C      C  S +  R    R +
Sbjct: 1   MEQACDICRVKKLRCSKEKPSCFKCLKNNLTCTYSPRAKRSPLTRAH 47

>KAFR0F03410 Chr6 complement(677156..680143) [2988 bp, 995 aa] {ON}
           Anc_4.113 YGL013C
          Length = 995

 Score = 45.8 bits (107), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 18/37 (48%), Positives = 24/37 (64%), Gaps = 1/37 (2%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSD 105
           +V QACD CR +K +C GK+P CS C A   +C  S+
Sbjct: 18  KVRQACDNCRKRKLKCTGKQP-CSTCEAYSCDCIYSE 53

>Skud_15.546 Chr15 (990335..991963) [1629 bp, 542 aa] {ON} YOR380W
           (REAL)
          Length = 542

 Score = 45.4 bits (106), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 31/59 (52%), Gaps = 1/59 (1%)

Query: 56  ISPVTSATPTSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPR 114
           +S  +++ P    RV +AC  CR +K +C+GK P C  C A G+ C  +D       PR
Sbjct: 2   VSSGSNSQPYKRQRVRKACVPCRERKRKCNGKSP-CEMCIAYGYACHYTDVDGSSTSPR 59

>YLR014C Chr12 complement(172268..174982) [2715 bp, 904 aa] {ON}
           PPR1Zinc finger transcription factor containing a
           Zn(2)-Cys(6) binuclear cluster domain, positively
           regulates transcription of URA1, URA3, URA4, and URA10,
           which are involved in de novo pyrimidine biosynthesis,
           in response to pyrimidine starvation; activity may be
           modulated by interaction with Tup1p
          Length = 904

 Score = 45.8 bits (107), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 24/44 (54%)

Query: 73  ACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGY 116
           AC RCR KK +CD + P C +CA +   C   D  + +  PR Y
Sbjct: 33  ACKRCRLKKIKCDQEFPSCKRCAKLEVPCVSLDPATGKDVPRSY 76

>SAKL0D14542g Chr4 complement(1195951..1198791) [2841 bp, 946 aa]
           {ON} similar to gnl|GLV|KLLA0A03421g Kluyveromyces
           lactis KLLA0A03421g and weakly similar to YAL051W
           uniprot|P39720 Saccharomyces cerevisiae YAL051W OAF1
           Oleate- activated transcription factor acts alone and as
           a heterodimer with Pip2p activates genes involved in
           beta- oxidation of fatty acids and peroxisome
           organization and biogenesis
          Length = 946

 Score = 45.8 bits (107), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 26/44 (59%)

Query: 58  PVTSATPTSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 101
           P+ +A      +++  C  CR  KT+CD ++P CS+C  +G +C
Sbjct: 13  PIGAAIGKKRNKLSFVCQSCRKSKTKCDKQKPSCSRCLRLGHQC 56

>Skud_1.10 Chr1 (24510..27632) [3123 bp, 1040 aa] {ON} YAL051W
           (REAL)
          Length = 1040

 Score = 45.8 bits (107), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 26/75 (34%), Positives = 39/75 (52%), Gaps = 8/75 (10%)

Query: 46  NSAAPNAA---RSISPVTSATPTSNY---RVAQACDRCRSKKTRCDGKRPQCSQCAAVGF 99
           N+A P       S SP    + T N    R++  C  CR  KT+CD ++P+C +C   G 
Sbjct: 32  NNATPGLEAEHSSTSPAPENSETHNRKRNRISFVCQACRKSKTKCDREKPECGRCIKHGL 91

Query: 100 ECKVSDKLSRRAFPR 114
           +C V D +S++  PR
Sbjct: 92  KC-VYD-VSKQPAPR 104

>Suva_6.285 Chr6 (499581..501941) [2361 bp, 786 aa] {ON} YJL206C
           (REAL)
          Length = 786

 Score = 45.4 bits (106), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 48/209 (22%), Positives = 94/209 (44%), Gaps = 17/209 (8%)

Query: 492 GEVSSVYEIRGTVVSMAQQLRLHRCPSAVLGTEGSTMSKSEQGDRRLLFWGIYYLDVFGA 551
             + + Y   G  +  A +  LHR  S      G T  + E   R  LFW +Y LD++  
Sbjct: 324 ANLKACYSFIGIALRAALKEGLHRKSSIT----GPTAIQDETKKR--LFWSVYKLDLYMN 377

Query: 552 LQLGVPRLLKDHEIECALPISEH----AHAGVSLAD-QVIKLEGQVSELSLSLLRFSKIL 606
             LG P  + + +I+   P+       +  G+   D ++I   G  +E +  +L  S+I 
Sbjct: 378 CILGFPSGIDESDIDQEFPLDVDDENISTMGIKFQDWRMISSCGMNNEHTKLILIMSRIY 437

Query: 607 GNILDSIFKRGMTSSAAQQVALIHENALDNWRRGLPKNLTFELDVNGTIKIEELTGSAQN 666
             ++ S+ ++ +   +  Q+  +++  L+NW   LP  L  +  +    ++     ++ N
Sbjct: 438 -KLMYSLRRKPLEEDSRLQIVSLNDQ-LENWYAQLPDILKVDKIIYREPQLPLHICASDN 495

Query: 667 NQDFTKNASSDKKILMLLYFLVKCLVHLP 695
           +  +TK     KK+L L + L K +++ P
Sbjct: 496 SSPYTK----PKKLLYLDFLLSKIVLYKP 520

>SAKL0B04620g Chr2 complement(406622..407710) [1089 bp, 362 aa] {ON}
           conserved hypothetical protein
          Length = 362

 Score = 45.1 bits (105), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 27/41 (65%), Gaps = 1/41 (2%)

Query: 65  TSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSD 105
           T+  RV++ACD CR  KT+CDG+RP C +C +    C  S+
Sbjct: 2   TTKKRVSKACDTCRKSKTKCDGERP-CQRCLSENKICTYSN 41

>AER370W Chr5 (1320487..1322892) [2406 bp, 801 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL130W
          Length = 801

 Score = 45.4 bits (106), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 20/33 (60%), Gaps = 1/33 (3%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 101
           RV +ACD CR KK +CD + P C  C    +EC
Sbjct: 13  RVTRACDECRKKKVKCDSRHP-CIHCTVYSYEC 44

>YJL206C Chr10 complement(47659..49935) [2277 bp, 758 aa] {ON}
           Putative protein of unknown function; similar to
           transcriptional regulators from the Zn[2]-Cys[6]
           binuclear cluster protein family; mRNA is weakly cell
           cycle regulated, peaking in S phase; induced rapidly
           upon MMS treatment
          Length = 758

 Score = 45.4 bits (106), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 53/213 (24%), Positives = 95/213 (44%), Gaps = 25/213 (11%)

Query: 492 GEVSSVYEIRGTVVSMAQQLRLHRCPSAVLGTEGSTMSKSEQGDRRLLFWGIYYLDVFGA 551
             + + Y   G  +  A +  LHR  S V    G T  + E   R  LFW +Y LD++  
Sbjct: 303 ANLKACYSFIGIALRAALKEGLHRRSSIV----GPTPIQDETKKR--LFWSVYKLDLYMN 356

Query: 552 LQLGVPRLLKDHEIECALPISEH----AHAGVSLAD-QVIKLEGQVSELSLSLLRFSKIL 606
             LG P  + + +I+   P+       +  G+   D + I   G  ++ +  +L  S+I 
Sbjct: 357 CILGFPSGIDESDIDQEFPLDVDDENISTIGIKFQDWRTISSCGMNNKHTKLILIMSRIY 416

Query: 607 GNILDSIFKRGMTSSAAQQVALIHENALDNWRRGLPKNLTFELDVNGTIKIEE----LTG 662
             ++ S+ ++ +   +  Q+  +++  LDNW   LP  L  +     TI+  +    LT 
Sbjct: 417 -KLMYSLRRKPLEEDSRTQIVSLNDQ-LDNWYAQLPDILKVD-----TIRYRQTQPPLTV 469

Query: 663 SAQNNQDFTKNASSDKKILMLLYFLVKCLVHLP 695
           SA    D +   +  KK+L L + L K +++ P
Sbjct: 470 SA---NDTSSPYTKPKKLLYLDFLLSKIVLYKP 499

 Score = 37.0 bits (84), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 18/34 (52%), Gaps = 1/34 (2%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECK 102
           R  +AC  CR +K RC G  P C  C    +ECK
Sbjct: 42  RAHRACIACRKRKVRCSGNIP-CRLCQTNSYECK 74

>TBLA0A01210 Chr1 (276151..280419) [4269 bp, 1422 aa] {ON} Anc_1.380
           YLR256W
          Length = 1422

 Score = 45.4 bits (106), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 19/30 (63%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVG 98
           R+  +C  CR +K +CD KRP C+QC   G
Sbjct: 113 RIPLSCTICRKRKVKCDKKRPHCNQCTKTG 142

>Smik_18.8 Chr18 (12069..14396) [2328 bp, 775 aa] {ON} YOR172W
           (REAL)
          Length = 775

 Score = 45.4 bits (106), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 24/38 (63%), Gaps = 9/38 (23%)

Query: 72  QACDRCRSKKTRCDGKRPQCSQCA---------AVGFE 100
           ++C+ CR +K RCDGKRP+CS C          A+GFE
Sbjct: 10  RSCELCRKRKLRCDGKRPRCSTCVRKKSSECTYAIGFE 47

>YAL051W Chr1 (48564..51707) [3144 bp, 1047 aa] {ON}
           OAF1Oleate-activated transcription factor, acts alone
           and as a heterodimer with Pip2p; activates genes
           involved in beta-oxidation of fatty acids and peroxisome
           organization and biogenesis
          Length = 1047

 Score = 45.4 bits (106), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 34/63 (53%), Gaps = 5/63 (7%)

Query: 55  SISPVTSATPTSNY---RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRA 111
           S SP    + T N    R+   C  CR  KT+CD ++P+C +C   G +C V D +S++ 
Sbjct: 44  STSPAPENSETHNRKRNRILFVCQACRKSKTKCDREKPECGRCVKHGLKC-VYD-VSKQP 101

Query: 112 FPR 114
            PR
Sbjct: 102 APR 104

>AER183C Chr5 complement(975879..978518) [2640 bp, 879 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YOL089C
           (HAL9)
          Length = 879

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 32/69 (46%), Gaps = 3/69 (4%)

Query: 44  TNNSAAPNAARSISP--VTSATPTSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 101
           + N  A       +P  +T        RV++ACD CR+KK RC+G+ P C  C      C
Sbjct: 49  SKNCCAAALTHRFAPEAMTETKTVMRKRVSKACDICRAKKIRCNGEEP-CVNCEKFNLGC 107

Query: 102 KVSDKLSRR 110
             +  + RR
Sbjct: 108 TYTHVIKRR 116

>Ecym_5397 Chr5 (805712..808192) [2481 bp, 826 aa] {ON} similar to
           Ashbya gossypii AER370W
          Length = 826

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 20/33 (60%), Gaps = 1/33 (3%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 101
           R+ +ACD CR KK +CD + P C  C    +EC
Sbjct: 17  RITRACDECRKKKVKCDNRHP-CIHCTVYSYEC 48

>SAKL0A09856g Chr1 complement(867959..871021) [3063 bp, 1020 aa]
           {ON} some similarities with uniprot|P32862 Saccharomyces
           cerevisiae YKL038W RGT1 Glucose-responsive transcription
           factor that regulates expression of several glucose
           transporter (HXT) genes in response to glucose binds to
           promoters and acts both as a transcriptional activator
           and repressor
          Length = 1020

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 27/50 (54%), Gaps = 2/50 (4%)

Query: 69  RVAQACDRCRSKKTRCD--GKRPQCSQCAAVGFECKVSDKLSRRAFPRGY 116
           +V++ACD+CR KK +CD     P CS C  VG  C       +R   +GY
Sbjct: 31  KVSRACDQCRKKKIKCDVSEDNPVCSGCFKVGDRCTFERVPLKRGPSKGY 80

>TBLA0D00630 Chr4 complement(164651..167884) [3234 bp, 1077 aa] {ON}
           Anc_7.389 YBL066C
          Length = 1077

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 35/59 (59%), Gaps = 5/59 (8%)

Query: 49  APNAARSISPVTSATPT-SNYRVAQACDRCRSKKTRCDG--KRPQ-CSQCAAVGFECKV 103
           AP+AA   +P   A P  +N+R   +C  CR +K RC+   K+PQ C++CA +  +C +
Sbjct: 6   APHAALH-TPHDDALPAATNHRPVTSCTHCRQQKIRCNALQKQPQPCTRCAKLNLKCNI 63

>KLTH0B00352g Chr2 complement(31952..34756) [2805 bp, 934 aa] {ON}
           weakly similar to uniprot|P25611 Saccharomyces
           cerevisiae YCR106W RDS1 Regulator of drug sensitivity
           transcriptional regulator
          Length = 934

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 18/43 (41%), Positives = 23/43 (53%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRA 111
           R +  C  CR +K +CD KRP+CS+C   G  C      SR A
Sbjct: 14  RPSFVCQECRRRKIKCDKKRPRCSRCVDTGLPCTYLASGSRSA 56

>Suva_1.14 Chr1 (25653..28790) [3138 bp, 1045 aa] {ON} YAL051W
           (REAL)
          Length = 1045

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 29/46 (63%), Gaps = 2/46 (4%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPR 114
           R++  C  CR  KT+CD ++P+C +C   G +C V D +S++  PR
Sbjct: 61  RISFVCQACRKSKTKCDREKPECGRCTKHGLKC-VYD-VSKQPAPR 104

>NCAS0I00270 Chr9 complement(33129..35963) [2835 bp, 944 aa] {ON}
           Anc_7.17 YAL051W
          Length = 944

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 15/42 (35%), Positives = 23/42 (54%)

Query: 60  TSATPTSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 101
           +  T    YR++  C  CR  K +CD ++P CS+C+    EC
Sbjct: 26  SQVTKKKRYRLSFVCQGCRRSKVKCDQEKPVCSRCSKHDLEC 67

>NDAI0D00900 Chr4 (205039..207636) [2598 bp, 865 aa] {ON} 
          Length = 865

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 22/33 (66%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 101
           R +  C  C+++K RCD +RP CS+C  +G +C
Sbjct: 26  RRSHVCITCKNQKLRCDRERPSCSRCRRIGRDC 58

>ADR403C Chr4 complement(1429115..1432027) [2913 bp, 970 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YAL051W
           (OAF1) and YOR363C (PIP2); Tandem gene triplication in
           this genome
          Length = 970

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/46 (43%), Positives = 29/46 (63%), Gaps = 2/46 (4%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPR 114
           R++  C  CR  KT+CD ++P+CS+CA    +C V D   +RA PR
Sbjct: 27  RISFVCQACRKSKTKCDREKPRCSRCAKNNVKC-VYDIEKQRA-PR 70

>KAFR0I00230 Chr9 (48095..51232) [3138 bp, 1045 aa] {ON} Anc_7.17
           YOR363C
          Length = 1045

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 21/33 (63%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 101
           R++  C  CR  KT+CD ++P+CS+CA     C
Sbjct: 24  RISLVCQACRKSKTKCDREKPRCSRCAKNNLRC 56

>Skud_15.532 Chr15 complement(959437..962439) [3003 bp, 1000 aa]
           {ON} YAL051W (REAL)
          Length = 1000

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 31/59 (52%), Gaps = 2/59 (3%)

Query: 57  SPVTSATPTSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRG 115
           SP T        R++  C  CR  KT+CD ++P+C +C      C + D ++R+A PR 
Sbjct: 8   SPTTDRISRKRNRLSFVCQACRKAKTKCDQEKPRCGRCTKQNLFC-IYD-VARQAAPRN 64

>ZYRO0C18150g Chr3 (1418645..1420360) [1716 bp, 571 aa] {ON} some
           similarities with uniprot|P39529 Saccharomyces
           cerevisiae YJL206C
          Length = 571

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 24/38 (63%), Gaps = 1/38 (2%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDK 106
           RV+ ACD CR KK +CDG++P C  C     EC  SD+
Sbjct: 23  RVSHACDNCRLKKKKCDGQQP-CKLCKNSENECIYSDR 59

 Score = 32.3 bits (72), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 19/79 (24%), Positives = 36/79 (45%), Gaps = 6/79 (7%)

Query: 492 GEVSSVYEIRGTVVSMAQQLRLHRCPSAVLGTEGSTMSKSEQGDRRLLFWGIYYLDVFGA 551
           G +   Y   G  +  A    LHR  S+++G      +  E   ++ LFW +Y +D++  
Sbjct: 203 GNLKRCYSYMGIALRAAIAEGLHR-KSSLMGP-----TPIEDESKKRLFWTVYKVDIYMN 256

Query: 552 LQLGVPRLLKDHEIECALP 570
             +G+P+ +    +   LP
Sbjct: 257 CIMGLPQSISQKTVNMELP 275

>Kpol_538.42 s538 complement(89752..93018) [3267 bp, 1088 aa] {ON}
           complement(89752..93018) [3267 nt, 1089 aa]
          Length = 1088

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 14/42 (33%), Positives = 24/42 (57%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRR 110
           R++  C +CR  KTRCD ++P C++C      C    +L ++
Sbjct: 34  RISFVCQQCRKAKTRCDKEQPNCTRCIKNNLNCIYDIELQKK 75

>KLTH0H02684g Chr8 complement(235527..237776) [2250 bp, 749 aa] {ON}
           weakly similar to uniprot|P04386 Saccharomyces
           cerevisiae YPL248C GAL4 DNA-binding transcription factor
           required for the activation of the GAL genes in response
           to galactose repressed by Gal80p and activated by Gal3p
          Length = 749

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 23/45 (51%)

Query: 72  QACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGY 116
           QACD CR KK +C  + P CS C    ++C  S K  R    R +
Sbjct: 9   QACDWCRRKKLKCSREHPICSNCFKHNWDCHYSPKKVRSPLTRAH 53

>SAKL0D14520g Chr4 complement(1192788..1195739) [2952 bp, 983 aa]
           {ON} similar to uniprot|P39720 Saccharomyces cerevisiae
           YAL051W OAF1 Oleate-activated transcription factor acts
           alone and as a heterodimer with Pip2p activates genes
           involved in beta-oxidation of fatty acids and peroxisome
           organization and biogenesis
          Length = 983

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 21/33 (63%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 101
           R++  C  CR  KT+CD ++P C++C   G EC
Sbjct: 23  RISFVCKACRKSKTKCDREKPSCTRCIKNGIEC 55

>SAKL0A00704g Chr1 complement(78811..80967) [2157 bp, 718 aa] {ON}
           similar to uniprot|P35995 Saccharomyces cerevisiae
           YKL222C Hypothetical ORF and similar to uniprot|Q12340
           Saccharomyces cerevisiae YOR172W
          Length = 718

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 27/46 (58%), Gaps = 1/46 (2%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGF-ECKVSDKLSRRAFP 113
           +V ++C  CR +K +CD K+P+CS CAA    EC   +K +    P
Sbjct: 14  KVIKSCLFCRKRKLKCDHKKPKCSTCAARNLPECVYVEKFTHEIDP 59

>SAKL0H00682g Chr8 complement(81989..84757) [2769 bp, 922 aa] {ON}
           weakly similar to uniprot|P39720 Saccharomyces
           cerevisiae YAL051W OAF1 Oleate-activated transcription
           factor acts alone and as a heterodimer with Pip2p
           activates genes involved in beta-oxidation of fatty
           acids and peroxisome organization and biogenesis
          Length = 922

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/46 (43%), Positives = 27/46 (58%), Gaps = 2/46 (4%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPR 114
           R++  C  CR +K +CD +RP C QCA  G  C V D + R+  PR
Sbjct: 20  RLSFVCLECRRRKIKCDKQRPCCIQCAEQGLTC-VYD-IERQPAPR 63

>CAGL0J07150g Chr10 complement(688858..691926) [3069 bp, 1022 aa]
           {ON} similar to uniprot|P39720 Saccharomyces cerevisiae
           YAL051w OAF1 peroxisome proliferating transcription
           factor or uniprot|P52960 Saccharomyces cerevisiae
           YOR363c PIP2
          Length = 1022

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/43 (41%), Positives = 26/43 (60%), Gaps = 1/43 (2%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRA 111
           R++  C  CR  KT+CD ++P CS+C   G  C V D  S++A
Sbjct: 18  RLSFVCQGCRKAKTKCDKEKPACSRCLKHGIRC-VYDLTSQKA 59

>TBLA0C04050 Chr3 complement(980010..983633) [3624 bp, 1207 aa] {ON}
           Anc_4.113 YGL013C
          Length = 1207

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 23/36 (63%), Gaps = 1/36 (2%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVS 104
           +V++ACD CR +K +C G+RP C+ C     EC  S
Sbjct: 12  KVSKACDNCRRRKIKCSGERP-CAGCKTYNCECIFS 46

 Score = 35.8 bits (81), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 24/93 (25%), Positives = 40/93 (43%), Gaps = 18/93 (19%)

Query: 536 RRLLFWGIYYLDVFGALQLGVPRLLKDHEIECALP--------ISEHAHAGVSLADQVIK 587
           RR L+W +Y ++    ++ G P ++ + +I C LP        +  + +           
Sbjct: 612 RRQLWWKLYMIEKLHCMKRGFPSVINEDKINCLLPEKFRFLGYLDSNDYFNKINNPNFNN 671

Query: 588 LEGQVSELSLSLLR----------FSKILGNIL 610
           L   +S+LSLS L+          FSK   NIL
Sbjct: 672 LSENLSKLSLSDLKDYGNLGLTIIFSKFSNNIL 704

>ZYRO0C00726g Chr3 (53977..57084) [3108 bp, 1035 aa] {ON} similar to
           uniprot|P39720 Saccharomyces cerevisiae YAL051W OAF1
           Oleate-activated transcription factor acts alone and as
           a heterodimer with Pip2p activates genes involved in
           beta-oxidation of fatty acids and peroxisome
           organization and biogenesis
          Length = 1035

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 28/46 (60%), Gaps = 2/46 (4%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPR 114
           R++  C  CR  KT+CD ++P+C +C   G  C V D + ++A PR
Sbjct: 55  RISFVCKACRRSKTKCDREKPKCGRCVQHGIAC-VYD-VEKQAAPR 98

>CAGL0I07755g Chr9 complement(745585..748746) [3162 bp, 1053 aa]
           {ON} similar to uniprot|Q12180 Saccharomyces cerevisiae
           YOL089c HAL9
          Length = 1053

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 29/57 (50%), Gaps = 3/57 (5%)

Query: 48  AAPNAARSISPVTSATPTSNYRVAQACDRCRSKKTRCDGKRP---QCSQCAAVGFEC 101
            + N   +IS +         R A+AC+ CR +KT+CD   P   +CS C+  G +C
Sbjct: 152 VSANYMNNISQMPGQLHKEKRRAAKACEYCRKRKTKCDEVSPYTNKCSNCSKAGVDC 208

>KLLA0D12672g Chr4 complement(1076011..1078608) [2598 bp, 865 aa]
           {ON} uniprot|P08657 Kluyveromyces lactis LAC9 Lactose
           regulatory protein LAC9
          Length = 865

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 22/45 (48%)

Query: 72  QACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGY 116
           QACD CR KK +C    P C+ C     +C  S ++ R    R +
Sbjct: 93  QACDACRKKKWKCSKTVPTCTNCLKYNLDCVYSPQVVRTPLTRAH 137

>TDEL0H04340 Chr8 complement(746566..749535) [2970 bp, 989 aa] {ON}
           Anc_7.17 YOR363C
          Length = 989

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 25/47 (53%)

Query: 55  SISPVTSATPTSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 101
           S+SP          R++  C  CR  KT+CD ++P+C +C   G +C
Sbjct: 26  SLSPGFETHVKRRNRISFVCQACRRSKTKCDREKPRCGRCQQHGLQC 72

>Ecym_5017 Chr5 (36647..39583) [2937 bp, 978 aa] {ON} similar to
           Ashbya gossypii ADR403C
          Length = 978

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 30/46 (65%), Gaps = 2/46 (4%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPR 114
           R++  C  CR  KT+CD ++P+CS+CA    +C V D + +++ PR
Sbjct: 27  RISFVCQACRKSKTKCDREKPRCSRCAKNNIKC-VYD-IEKQSAPR 70

>Suva_8.436 Chr8 (788699..790336) [1638 bp, 545 aa] {ON} YOR380W
           (REAL)
          Length = 545

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 25/43 (58%), Gaps = 1/43 (2%)

Query: 64  PTSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDK 106
           P    RV +AC  CR +K +C+GK P C  C A G+ C  +++
Sbjct: 10  PYKRQRVRKACVPCRERKRKCNGKSP-CEMCVAYGYVCHYTEE 51

>KAFR0C03730 Chr3 (759382..761757) [2376 bp, 791 aa] {ON} 
          Length = 791

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 30/50 (60%), Gaps = 1/50 (2%)

Query: 52  AARSISPVTSATPTSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 101
           A  SI+   +    S++RV++AC+ CR +K +C+G +P CS+C      C
Sbjct: 2   AGSSITKPYTYNKRSSHRVSRACNSCRKRKVKCNGVQP-CSKCITSNLRC 50

 Score = 34.7 bits (78), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 20/89 (22%), Positives = 42/89 (47%), Gaps = 7/89 (7%)

Query: 492 GEVSSVYEIRGTVVSMAQQLRLHRCPSAVLGTEGSTMSKSEQGDRRLLFWGIYYLDVFGA 551
            E +++  + G +V +   L  +R    +       + ++E  +RR ++W  Y+ D +G+
Sbjct: 338 AETTALNRLIGPIVRLGIDLGFNRWEFYL------NLDENEANERRKMWWKCYWWDKYGS 391

Query: 552 LQLGVPRLLKDHEIECALPISEHAHAGVS 580
           L  G    + + ++ C LP  E    GV+
Sbjct: 392 LLTGKQFQIMEEQMACLLP-KEWIELGVN 419

>NDAI0G05260 Chr7 (1277631..1282376) [4746 bp, 1581 aa] {ON}
          Anc_1.380 YLR256W
          Length = 1581

 Score = 44.3 bits (103), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 25/60 (41%), Positives = 31/60 (51%), Gaps = 7/60 (11%)

Query: 45 NNSAAPNAARSISPVTSATPTSNY------RVAQACDRCRSKKTRCDGKRPQCSQCAAVG 98
          N+S +PN A S S    +T TSN       RV  +C  CR +K +CD  RP C QC   G
Sbjct: 32 NSSNSPNLA-SNSKKHDSTNTSNKVKRKRNRVPLSCTICRKRKVKCDKIRPHCQQCTKTG 90

>TPHA0A04540 Chr1 (1031790..1035326) [3537 bp, 1178 aa] {ON}
           Anc_3.109 YOL089C
          Length = 1178

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 22/37 (59%), Gaps = 4/37 (10%)

Query: 69  RVAQACDRCRSKKTRCDGKRP----QCSQCAAVGFEC 101
           RV++ACD CR +K +CD KR     +CS C     EC
Sbjct: 248 RVSRACDHCRKRKIKCDEKRDPNTNKCSNCIKYNSEC 284

>NDAI0F00110 Chr6 (10745..12271) [1527 bp, 508 aa] {ON} 
          Length = 508

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 21/33 (63%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 101
           R    C  CR++K +CD +RP+C +C  +G EC
Sbjct: 15  RSYSGCWTCRARKVKCDTQRPKCCRCKQLGIEC 47

>TDEL0D03610 Chr4 (664819..666993) [2175 bp, 724 aa] {ON} Anc_3.264
           YDR034C
          Length = 724

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 29/56 (51%), Gaps = 5/56 (8%)

Query: 51  NAARSISPVTSATPTSNYRVAQ-----ACDRCRSKKTRCDGKRPQCSQCAAVGFEC 101
           +AA   +PVTS    SN  V +      C  C+ ++ +CD  +P C QCA +  EC
Sbjct: 95  SAAMPPTPVTSTVKDSNGNVKRKYSRNGCTECKRRRIKCDETKPTCWQCARLNREC 150

>TBLA0E00700 Chr5 complement(138121..141945) [3825 bp, 1274 aa] {ON}
           Anc_7.17 YOR363C
          Length = 1274

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 27/48 (56%), Gaps = 4/48 (8%)

Query: 57  SPVTS---ATPTSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 101
           SP+TS    T   N R++  C  CR  KT+C+  +P CS+C  +G  C
Sbjct: 55  SPITSPGHITKKRN-RISFVCQSCRKSKTKCNKDKPSCSRCKKLGIFC 101

>TDEL0D05150 Chr4 (932888..935878) [2991 bp, 996 aa] {ON} Anc_3.109
           YOL089C
          Length = 996

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/47 (42%), Positives = 26/47 (55%), Gaps = 5/47 (10%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQ---CSQCAAVGFEC--KVSDKLSRR 110
           RVA+ACD CR +K +CD   PQ   CS C      C  +V D + +R
Sbjct: 113 RVARACDHCRRRKIKCDPVNPQTNKCSNCTKYDANCTFRVRDDVEKR 159

>Skud_11.190 Chr11 (345221..348736) [3516 bp, 1171 aa] {ON} YKL038W
           (REAL)
          Length = 1171

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 34/77 (44%), Gaps = 4/77 (5%)

Query: 44  TNNSAAPNAARSISPV--TSATPTSNYRVAQACDRCRSKKTRCDGK--RPQCSQCAAVGF 99
           T N    N+   + P   TS       + ++ACD+CR KK +CD K  R  CS C   G 
Sbjct: 15  TKNGGTSNSPEDMDPAAATSHAMKKRTKASRACDQCRKKKIKCDYKDERGVCSNCQRNGD 74

Query: 100 ECKVSDKLSRRAFPRGY 116
            C       +R   +GY
Sbjct: 75  RCSFERVPLKRGPSKGY 91

>SAKL0D00264g Chr4 complement(24754..27300) [2547 bp, 848 aa] {ON}
           similar to uniprot|P05085 Saccharomyces cerevisiae
           YML099C ARG81 Zinc-finger transcription factor of the
           Zn(2)-Cys(6) binuclear cluster domain type involved in
           the regulation of arginine-responsive genes acts with
           Arg80p and Arg82p
          Length = 848

 Score = 43.5 bits (101), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 22/41 (53%)

Query: 73  ACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFP 113
            C  CRS+K +CD  RP C +C   GFEC   D   R + P
Sbjct: 19  GCWTCRSRKVKCDLGRPSCKRCERSGFECGGYDIKLRWSKP 59

>SAKL0D01100g Chr4 complement(81235..84057) [2823 bp, 940 aa] {ON}
           weakly similar to uniprot|P33200 Saccharomyces
           cerevisiae YBL005W PDR3 Transcriptional activator of the
           pleiotropic drug resistance network regulates expression
           of ATP-binding cassette (ABC) transporters through
           binding to cis-acting sites known as PDREs (PDR
           responsive elements)
          Length = 940

 Score = 43.5 bits (101), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 26/39 (66%), Gaps = 1/39 (2%)

Query: 66  SNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVS 104
           S+ +V++ACD CR +K +C GK+P CS C A    C+ S
Sbjct: 20  SSSKVSRACDNCRRRKIKCTGKQP-CSNCQAYQCHCEYS 57

>Skud_2.427 Chr2 (769889..771295) [1407 bp, 468 aa] {ON} YGR288W
           (REAL)
          Length = 468

 Score = 43.1 bits (100), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 23/39 (58%), Gaps = 1/39 (2%)

Query: 73  ACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRA 111
           ACD CR ++ +CDGK+P C +C    FEC     L +R 
Sbjct: 7   ACDYCRVRRVKCDGKKP-CRRCLQHNFECTHQQPLKKRG 44

>TBLA0G01130 Chr7 (287952..291350) [3399 bp, 1132 aa] {ON} Anc_8.879
           YML099C
          Length = 1132

 Score = 43.5 bits (101), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 22/38 (57%)

Query: 65  TSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECK 102
           T+  R    C  CRS+K +CD ++PQC +C     +C+
Sbjct: 7   TARNRTYSGCWTCRSRKIKCDQQKPQCKRCLKANLKCE 44

>Suva_15.77 Chr15 complement(123654..126743) [3090 bp, 1029 aa] {ON}
           YOL089C (REAL)
          Length = 1029

 Score = 43.5 bits (101), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 20/47 (42%), Positives = 26/47 (55%), Gaps = 5/47 (10%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQ---CSQCAAVGFEC--KVSDKLSRR 110
           RV++ACD CR +K RCD   PQ   CS C      C  K  D++ R+
Sbjct: 128 RVSKACDHCRKRKIRCDEVDPQTNKCSNCVKFQSACTFKHRDEILRK 174

>TPHA0A06090 Chr1 complement(1372559..1375102) [2544 bp, 847 aa]
           {ON} 
          Length = 847

 Score = 43.1 bits (100), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 19/33 (57%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 101
           R+   C  CR+KK +CD K+P C +C   G  C
Sbjct: 9   RLNNGCWTCRTKKVKCDSKKPFCDKCKDSGLHC 41

>KLLA0F22990g Chr6 (2134385..2138146) [3762 bp, 1253 aa] {ON}
          uniprot|Q6DR96 Kluyveromyces lactis HAP1
          Length = 1253

 Score = 43.5 bits (101), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 18/30 (60%)

Query: 69 RVAQACDRCRSKKTRCDGKRPQCSQCAAVG 98
          RV  +C  CR +K +CD  RPQC QC   G
Sbjct: 20 RVPLSCTICRKRKVKCDKGRPQCQQCVKTG 49

>YGL013C Chr7 complement(469092..472298) [3207 bp, 1068 aa] {ON}
           PDR1Zinc cluster protein that is a master regulator
           involved in recruiting other zinc cluster proteins to
           pleiotropic drug response elements (PDREs) to fine tune
           the regulation of multidrug resistance genes
          Length = 1068

 Score = 43.1 bits (100), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 24/38 (63%), Gaps = 1/38 (2%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDK 106
           +V++ACD CR +K +C+GK P C+ C     EC  S +
Sbjct: 41  KVSKACDNCRKRKIKCNGKFP-CASCEIYSCECTFSTR 77

>Smik_15.561 Chr15 (997239..998879) [1641 bp, 546 aa] {ON} YOR380W
           (REAL)
          Length = 546

 Score = 42.7 bits (99), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 23/38 (60%), Gaps = 1/38 (2%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDK 106
           RV +AC  CR +K +C+GK P C  C + G+ C   DK
Sbjct: 15  RVRKACVPCRERKRKCNGKSP-CEMCISYGYVCHYMDK 51

>TBLA0C06230 Chr3 (1509702..1512089) [2388 bp, 795 aa] {ON} Anc_6.60
           YLR266C
          Length = 795

 Score = 43.1 bits (100), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 12/33 (36%), Positives = 21/33 (63%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 101
           ++ +AC  CR +K +CD  +P+C QC++    C
Sbjct: 9   KIIKACVFCRKRKLKCDLTKPKCKQCSSRNLNC 41

>Kwal_26.8109 s26 complement(650270..653182) [2913 bp, 970 aa] {ON}
           YKL038W (RGT1) - 1:1 [contig 55] FULL
          Length = 970

 Score = 43.1 bits (100), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 27/50 (54%), Gaps = 2/50 (4%)

Query: 69  RVAQACDRCRSKKTRCD--GKRPQCSQCAAVGFECKVSDKLSRRAFPRGY 116
           + ++ACD+CR KKTRCD   + P C+ C  +   C       +R   +GY
Sbjct: 34  KTSRACDQCRGKKTRCDFSDENPVCTSCQRMSKTCTFERVPMKRGPTKGY 83

>Smik_17.27 Chr17 complement(29476..31542) [2067 bp, 688 aa] {ON}
           YKL222C (REAL)
          Length = 688

 Score = 42.7 bits (99), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 19/33 (57%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 101
           +  +AC  CR KK +CD  RPQC QC     EC
Sbjct: 11  KAIKACLNCRRKKQKCDQARPQCYQCRIRKTEC 43

>KNAG0E04150 Chr5 complement(823063..826473) [3411 bp, 1136 aa] {ON}
           
          Length = 1136

 Score = 42.7 bits (99), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 27/46 (58%), Gaps = 2/46 (4%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPR 114
           R++  C  CR  K +CD ++P+C++C   G +C   ++  R+  PR
Sbjct: 45  RISFVCQNCRKSKMKCDREKPECTRCLKQGIKCVYDEE--RQPRPR 88

>KAFR0B01450 Chr2 (273614..276880) [3267 bp, 1088 aa] {ON} Anc_2.547
           YKL038W
          Length = 1088

 Score = 42.7 bits (99), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 37/78 (47%), Gaps = 14/78 (17%)

Query: 44  TNNSAAPNAARSISPVTSATPTSNYR---VAQACDRCRSKKTRCDG--KRPQCSQCAAVG 98
           +N   A NA+RS         +SN R    ++ACD+CR KK +CD    R  C+ C   G
Sbjct: 39  SNTEEANNASRS---------SSNKRRTKASRACDQCRKKKVKCDNGDDRSVCTNCQRNG 89

Query: 99  FECKVSDKLSRRAFPRGY 116
            +C       +R   +GY
Sbjct: 90  EKCTFERVPLKRGPSKGY 107

>YOR363C Chr15 complement(1020222..1023212) [2991 bp, 996 aa] {ON}
           PIP2Autoregulatory oleate-specific transcriptional
           activator of peroxisome proliferation, contains
           Zn(2)-Cys(6) cluster domain, forms heterodimer with
           Oaf1p, binds oleate response elements (OREs), activates
           beta-oxidation genes
          Length = 996

 Score = 42.7 bits (99), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 31/59 (52%), Gaps = 2/59 (3%)

Query: 57  SPVTSATPTSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRG 115
           SP  +       R++  C  CR  KT+CD ++P+C +C      C + D ++R+A PR 
Sbjct: 8   SPAMNRVGKKRNRLSFVCQACRKAKTKCDQEKPRCGRCTKQNLFC-IYD-VARQAAPRN 64

>KAFR0I02030 Chr9 complement(416471..420172) [3702 bp, 1233 aa]
          {ON} Anc_1.380 YLR256W
          Length = 1233

 Score = 42.7 bits (99), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 22/41 (53%), Gaps = 1/41 (2%)

Query: 58 PVTSATPTSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVG 98
          P+T      N R+  +C  CR +K +CD  RP C+QC   G
Sbjct: 23 PITKQKRKRN-RIPLSCTICRKRKVKCDKIRPHCNQCTKTG 62

>KLLA0F09559g Chr6 complement(876719..878695) [1977 bp, 658 aa] {ON}
           some similarities with uniprot|P35995 Saccharomyces
           cerevisiae YKL222c
          Length = 658

 Score = 42.4 bits (98), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 23/38 (60%), Gaps = 1/38 (2%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGF-ECKVSD 105
           +V ++C  CR +K +CD KRP C+ C   G  EC  +D
Sbjct: 85  KVIKSCTFCRKRKLKCDRKRPMCTGCKMRGLSECVYTD 122

>NDAI0H01990 Chr8 complement(481983..485468) [3486 bp, 1161 aa] {ON}
           Anc_7.17
          Length = 1161

 Score = 42.7 bits (99), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 12/33 (36%), Positives = 20/33 (60%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 101
           R++  C  CR  KT+CD ++P C++C     +C
Sbjct: 64  RISFVCQECRKAKTKCDKEKPYCTRCVKQNIKC 96

>NCAS0A03580 Chr1 complement(712039..715380) [3342 bp, 1113 aa] {ON}
           
          Length = 1113

 Score = 42.7 bits (99), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 22/37 (59%), Gaps = 1/37 (2%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSD 105
           +V++AC  CR +K +C G  P CS CAA   EC   D
Sbjct: 32  KVSKACANCRRRKIKCTGTYP-CSNCAAYQCECIFDD 67

>KLLA0C14212g Chr3 complement(1229219..1232341) [3123 bp, 1040 aa]
           {ON} weakly similar to uniprot|P25611 Saccharomyces
           cerevisiae YCR106W RDS1 Regulator of drug sensitivity
           transcriptional regulator
          Length = 1040

 Score = 42.4 bits (98), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 22/36 (61%), Gaps = 1/36 (2%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVS 104
           RV+  C  CR +KTRCD   P CS+C A+  EC  S
Sbjct: 70  RVSYVCYACRRRKTRCDRGNP-CSKCVALSTECVYS 104

>Smik_7.277 Chr7 complement(461108..464317) [3210 bp, 1069 aa] {ON}
           YGL013C (REAL)
          Length = 1069

 Score = 42.4 bits (98), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 24/38 (63%), Gaps = 1/38 (2%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDK 106
           +V++ACD CR +K +C+GK P C+ C     EC  + +
Sbjct: 38  KVSKACDNCRKRKIKCNGKFP-CASCEIYSCECTFTTR 74

>Smik_2.383 Chr2 complement(686676..688022) [1347 bp, 448 aa] {ON}
           YBR240C (REAL)
          Length = 448

 Score = 42.0 bits (97), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 21/49 (42%), Positives = 24/49 (48%)

Query: 59  VTSATPTSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKL 107
           V+S  P +  R    C  CR KK RCD  RP CS CA  G  C    +L
Sbjct: 15  VSSKAPPTKGRTFTGCWACRFKKRRCDENRPICSLCAKHGDNCSYDIRL 63

>CAGL0K05841g Chr11 (573144..577262) [4119 bp, 1372 aa] {ON}
          similar to uniprot|P12351 Saccharomyces cerevisiae
          YLR256w HAP1 transcription factor
          Length = 1372

 Score = 42.4 bits (98), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 18/30 (60%)

Query: 69 RVAQACDRCRSKKTRCDGKRPQCSQCAAVG 98
          RV  +C  CR +K +CD  RP C+QC   G
Sbjct: 66 RVPLSCTICRRRKVKCDKSRPNCTQCVKTG 95

>Skud_7.274 Chr7 complement(472171..475413) [3243 bp, 1080 aa] {ON}
           YGL013C (REAL)
          Length = 1080

 Score = 42.4 bits (98), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 24/38 (63%), Gaps = 1/38 (2%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDK 106
           +V++ACD CR +K +C+GK P C+ C     EC  + +
Sbjct: 38  KVSKACDNCRKRKIKCNGKFP-CASCEIYSCECTFTSR 74

>KLLA0A09119g Chr1 complement(797533..800781) [3249 bp, 1082 aa]
           {ON} weakly similar to uniprot|P12383 Saccharomyces
           cerevisiae YGL013C PDR1 Zinc cluster protein that is a
           master regulator involved in recruiting other zinc
           cluster proteins to pleiotropic drug response elements
           (PDREs) to fine tune the regulation of multidrug
           resistance genes
          Length = 1082

 Score = 42.4 bits (98), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 29/61 (47%), Gaps = 4/61 (6%)

Query: 47  SAAPNAARSISPVTS---ATPTSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKV 103
           S+  N  R+  P  S    T     +V++ACD CR KK +C G  P C  C   G EC  
Sbjct: 25  SSGVNGDRTAIPRDSNGNGTGKPRRKVSRACDSCRKKKIKCSGTLP-CKSCETYGCECVY 83

Query: 104 S 104
           S
Sbjct: 84  S 84

>TBLA0A09760 Chr1 complement(2398683..2403275) [4593 bp, 1530 aa]
           {ON} Anc_6.75 YLR278C
          Length = 1530

 Score = 42.4 bits (98), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 23/43 (53%)

Query: 71  AQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFP 113
           +++C  CR +K RCD K P C+ C   G +C    + S  A P
Sbjct: 38  SKSCLLCRRRKQRCDHKLPSCTACLKAGVKCVQPARYSNNAAP 80

>NCAS0D04860 Chr4 (933920..936025) [2106 bp, 701 aa] {ON} 
          Length = 701

 Score = 42.4 bits (98), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 24/39 (61%), Gaps = 1/39 (2%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGF-ECKVSDK 106
           RV ++C  CR +K++CD  +P CS C   G  EC+  D+
Sbjct: 21  RVPKSCTVCRLRKSKCDRIKPYCSSCVLHGIKECRYDDR 59

>Smik_13.183 Chr13 (304049..304060,304064..306787) [2736 bp, 911 aa]
           {ON} YMR019W (REAL)
          Length = 911

 Score = 42.4 bits (98), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 26/46 (56%), Gaps = 1/46 (2%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPR 114
           RV +AC+ C+ +K +CDG RP C  C+    EC+   K + R   R
Sbjct: 41  RVQKACEICKRRKVKCDGNRP-CLNCSKHKKECRYDFKATNRRKKR 85

>NCAS0A03070 Chr1 (603639..605609) [1971 bp, 656 aa] {ON} 
          Length = 656

 Score = 42.0 bits (97), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 20/33 (60%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 101
           R    C  CR++K RC+ +RP CS+C  +G  C
Sbjct: 10  RPTHVCAACRTQKLRCNRERPSCSRCQRIGRTC 42

>Kwal_26.6805 s26 (71596..74430) [2835 bp, 944 aa] {ON} YAL051W
           (OAF1) - transcription factor [contig 44] FULL
          Length = 944

 Score = 42.4 bits (98), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 24/50 (48%)

Query: 52  AARSISPVTSATPTSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 101
           A + +    SA      R++  C  CR  KT+CD  +P CS+C   G  C
Sbjct: 7   AGQEVKTTQSAHSGRRNRLSFVCQSCRKGKTKCDRAKPSCSRCLKHGIRC 56

>AFL160C Chr6 complement(130842..132788) [1947 bp, 648 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL248C
           (GAL4)
          Length = 648

 Score = 42.0 bits (97), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 24/47 (51%)

Query: 70  VAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGY 116
           V QACD CR +K +C    P+C++C      C  S K+ R    R +
Sbjct: 5   VIQACDSCRRRKMKCSKTFPKCAKCREDNRVCLYSPKIRRSPLTRAH 51

>KLLA0D10153g Chr4 (858016..859983) [1968 bp, 655 aa] {ON} some
           similarities with uniprot|P35995 Saccharomyces
           cerevisiae YKL222C Hypothetical ORF
          Length = 655

 Score = 42.0 bits (97), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 22/38 (57%)

Query: 64  PTSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 101
           P S  +  ++C  C+ +K +CD K P CS C   G+EC
Sbjct: 2   PKSRNKPTRSCLMCQRRKKKCDRKAPSCSACLKKGYEC 39

>Ecym_2522 Chr2 (1017930..1020710) [2781 bp, 926 aa] {ON} similar to
           Ashbya gossypii AGL233C
          Length = 926

 Score = 42.0 bits (97), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 23/34 (67%), Gaps = 1/34 (2%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGF-EC 101
           +V+++C  CR ++ +CD  RP+CS C + G  EC
Sbjct: 14  KVSKSCVFCRKRRVKCDKARPKCSTCVSKGLPEC 47

>CAGL0B03421g Chr2 complement(336071..340138) [4068 bp, 1355 aa]
          {ON} similar to uniprot|P12351 Saccharomyces cerevisiae
          YLR256w HAP1 transcription factor
          Length = 1355

 Score = 42.0 bits (97), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 18/30 (60%)

Query: 69 RVAQACDRCRSKKTRCDGKRPQCSQCAAVG 98
          R+  +C  CR +K +CD  RP C+QC   G
Sbjct: 18 RIPLSCTICRKRKVKCDKTRPHCNQCTKTG 47

>NCAS0C00220 Chr3 (22532..25051) [2520 bp, 839 aa] {ON} Anc_8.879
          Length = 839

 Score = 42.0 bits (97), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 18/29 (62%)

Query: 73  ACDRCRSKKTRCDGKRPQCSQCAAVGFEC 101
            C  CRS+K +CD +RP C +C   G EC
Sbjct: 20  GCWTCRSRKVKCDLRRPGCVRCDKSGLEC 48

>KLLA0A10329g Chr1 (903873..905792) [1920 bp, 639 aa] {ON} conserved
           hypothetical protein
          Length = 639

 Score = 42.0 bits (97), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 20/39 (51%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKL 107
           R    C +C+S K +CD  +P C  C   GF+C  S  L
Sbjct: 12  RSYMGCQKCKSLKKKCDEVKPHCGYCKKRGFQCDYSRTL 50

>CAGL0F07909g Chr6 (776659..779808) [3150 bp, 1049 aa] {ON} some
           similarities with uniprot|Q12180 Saccharomyces
           cerevisiae YOL089c HAL9 or uniprot|P38114 Saccharomyces
           cerevisiae YBR150c TBS1
          Length = 1049

 Score = 42.0 bits (97), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 19/36 (52%), Gaps = 3/36 (8%)

Query: 69  RVAQACDRCRSKKTRCDGKRP---QCSQCAAVGFEC 101
           R  +ACD CR +K RCD   P   +CS C     EC
Sbjct: 36  RSTKACDHCRKRKIRCDEVNPVTNKCSNCVKFKVEC 71

>TBLA0A05860 Chr1 (1449582..1452014) [2433 bp, 810 aa] {ON} 
          Length = 810

 Score = 42.0 bits (97), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 21/46 (45%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPR 114
           R  Q CDRCR  K +C G   QC+ C      C     L RR  P+
Sbjct: 38  RRDQVCDRCRKLKKKCYGLGRQCNNCQLSNNPCTTMATLKRRRKPK 83

>AFR117C Chr6 complement(646829..650287) [3459 bp, 1152 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YLR256W
          (HAP1)
          Length = 1152

 Score = 42.0 bits (97), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 23/42 (54%), Gaps = 1/42 (2%)

Query: 57 SPVTSATPTSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVG 98
          SP  S+    N RV  +C  CR +K +CD  RP C+QC   G
Sbjct: 3  SPTASSKRKRN-RVPLSCTICRKRKVKCDKTRPHCNQCTKTG 43

 Score = 37.0 bits (84), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 39/71 (54%), Gaps = 9/71 (12%)

Query: 503 TVVSMAQQLRLHRCP-------SAVLGTEGSTMSKSEQGDR--RLLFWGIYYLDVFGALQ 553
           ++V MA    LHR P       S +L T   T++ +E+     R +++ I  LD+  +L 
Sbjct: 470 SIVQMAFSCGLHRDPDNFPQLSSTLLKTTKDTITNTERLKHTWRKMWYFILSLDIQQSLS 529

Query: 554 LGVPRLLKDHE 564
           LG PRLL++H+
Sbjct: 530 LGSPRLLRNHK 540

>Kpol_467.1 s467 (471..4340) [3870 bp, 1289 aa] {ON} (471..4340)
          [3870 nt, 1290 aa]
          Length = 1289

 Score = 42.0 bits (97), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 18/30 (60%)

Query: 69 RVAQACDRCRSKKTRCDGKRPQCSQCAAVG 98
          R+  +C  CR +K +CD  RP C+QC   G
Sbjct: 22 RIPLSCTICRKRKVKCDKTRPHCNQCTKTG 51

>Skud_15.64 Chr15 complement(109746..112844) [3099 bp, 1032 aa] {ON}
           YOL089C (REAL)
          Length = 1032

 Score = 42.0 bits (97), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 21/39 (53%), Gaps = 3/39 (7%)

Query: 66  SNYRVAQACDRCRSKKTRCDGKRPQ---CSQCAAVGFEC 101
           S  RV++ACD CR +K RCD   PQ   CS C      C
Sbjct: 128 SKKRVSKACDHCRKRKIRCDEVDPQTDKCSNCVKFQSVC 166

>KNAG0I01450 Chr9 (277513..281943) [4431 bp, 1476 aa] {ON} 
          Length = 1476

 Score = 42.0 bits (97), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 18/30 (60%)

Query: 69 RVAQACDRCRSKKTRCDGKRPQCSQCAAVG 98
          R+  +C  CR +K +CD  RP C+QC   G
Sbjct: 47 RIPLSCTICRKRKVKCDKTRPHCNQCTKTG 76

>ZYRO0G22550g Chr7 complement(1856064..1858238) [2175 bp, 724 aa]
           {ON} weakly similar to uniprot|P39961 Saccharomyces
           cerevisiae YER184C Hypothetical ORF
          Length = 724

 Score = 41.6 bits (96), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 22/37 (59%), Gaps = 1/37 (2%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSD 105
           +V +AC  CR +K RCDG  P CS C ++  EC   D
Sbjct: 8   KVKRACQICRRRKIRCDGYLP-CSSCVSLKKECNYHD 43

>SAKL0H00616g Chr8 (73754..75934) [2181 bp, 726 aa] {ON} some
           similarities with uniprot|Q12180 Saccharomyces
           cerevisiae YOL089C HAL9 Putative transcription factor
           containing a zinc finger overexpression increases salt
           tolerance through increased expression of the ENA1 (Na
           /Li extrusion pump) gene while gene disruption decreases
           both salt tolerance and ENA1 expression
          Length = 726

 Score = 41.6 bits (96), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 40/179 (22%), Positives = 80/179 (44%), Gaps = 34/179 (18%)

Query: 492 GEVSSVYEIRGTVVSMAQQLRLHRCPSAVLGTEGSTMSKSEQGDRRLLFWGIYYLDVFGA 551
           G   + + +  + + +AQ L LH    + +  EG  +SK E   RR ++W   + D   A
Sbjct: 317 GAFHNSFMMVSSAIRLAQDLGLH----SEVTFEG--LSKEEAQKRRKVWWLCLFFDQRLA 370

Query: 552 LQLGVPRLLKDHEIECALPISEHAHAGVSLADQ-----------------------VIKL 588
           + LG P ++ ++++    P    A+  + L DQ                       V++ 
Sbjct: 371 VVLGRPPVVAEYDMTTRFP---EANKKLKLLDQVTLSSSTTAKDYDEDFAQKMFDIVLRS 427

Query: 589 EGQVSELSLSLLRFSKILGNILDSIFKRGMTSSAAQQVALIHE--NALDNWRRGLPKNL 645
           EG V+  +  + + SK+ G I   ++   + + + +QV +I++  N L  ++  +PK L
Sbjct: 428 EGFVTLSAHYINKLSKMTGRIYIELYSASIINGSVEQVKIINKLLNDLSTFKLSIPKTL 486

>CAGL0F09229g Chr6 complement(908186..910693) [2508 bp, 835 aa] {ON}
           weakly similar to uniprot|P39961 Saccharomyces
           cerevisiae YER184c
          Length = 835

 Score = 42.0 bits (97), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 20/33 (60%), Gaps = 1/33 (3%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 101
           RV +ACD CR +K +CDG +P CS C      C
Sbjct: 16  RVIRACDVCRKRKVKCDGDQP-CSSCMTASTVC 47

>Ecym_8404 Chr8 complement(834988..837645) [2658 bp, 885 aa] {ON}
           similar to Ashbya gossypii ACL058W
          Length = 885

 Score = 42.0 bits (97), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 39/72 (54%), Gaps = 5/72 (6%)

Query: 507 MAQQLRLHRCPSAVLGTEGSTMSKSEQGDRRLLFWGIYYLDVFGALQLGVPRLLKDHEIE 566
           +AQ+++L   P +  G     + +S    RR+LFW I+YLD   +L   +P L+K  E +
Sbjct: 326 LAQKIQLTLDPVSYHGMTDQALIRS----RRILFWQIFYLDTITSLHNNLPPLIKPGEFD 381

Query: 567 CALPISEHAHAG 578
             L ++E  H G
Sbjct: 382 TVL-MTELDHNG 392

 Score = 38.5 bits (88), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 21/38 (55%), Gaps = 2/38 (5%)

Query: 74  CDRCRSKKTRCDGKRPQCSQCAAVGFECK--VSDKLSR 109
           C  C  +K +C  +RP C  C    FEC   V+D++SR
Sbjct: 38  CMPCHKRKVKCSRERPSCDNCLRNSFECVYFVNDRVSR 75

>NCAS0A07610 Chr1 complement(1512914..1515982) [3069 bp, 1022 aa]
           {ON} Anc_7.17
          Length = 1022

 Score = 42.0 bits (97), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 12/33 (36%), Positives = 19/33 (57%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 101
           R++  C  CR  KT+CD ++P C++C      C
Sbjct: 41  RISFVCQECRKAKTKCDKEKPACTRCVKQNLAC 73

>KAFR0A02130 Chr1 (447063..449186) [2124 bp, 707 aa] {ON} Anc_2.565
           YMR019W
          Length = 707

 Score = 41.6 bits (96), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 29/57 (50%), Gaps = 2/57 (3%)

Query: 59  VTSATPTSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDK-LSRRAFPR 114
           ++ +T     RV +ACD C+ +K +CDG  P CS C     +C    +  + R  PR
Sbjct: 1   MSKSTTKQRLRVQKACDICKRRKVKCDGLSP-CSNCIRHNVDCTYDYRTFASRKKPR 56

>Ecym_2732 Chr2 (1410290..1413886) [3597 bp, 1198 aa] {ON} similar
          to Ashbya gossypii AFR117C
          Length = 1198

 Score = 42.0 bits (97), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 18/30 (60%)

Query: 69 RVAQACDRCRSKKTRCDGKRPQCSQCAAVG 98
          R+  +C  CR +K RCD  +P C+QC   G
Sbjct: 14 RIPLSCTICRKRKVRCDKTKPHCTQCVKTG 43

>KLLA0C18953g Chr3 (1682246..1684357) [2112 bp, 703 aa] {ON} some
           similarities with uniprot|P25502 Saccharomyces
           cerevisiae YKL015W PUT3 Positive regulator of PUT
           (proline utilization) genes zinc-finger transcription
           factor of the Zn(2)-Cys(6) binuclear cluster domain type
          Length = 703

 Score = 41.6 bits (96), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 40/161 (24%), Positives = 71/161 (44%), Gaps = 27/161 (16%)

Query: 491 VGEVSSVYEIRGTVVSMAQQLRLHRCPSAVLGTEGSTMSKSEQGDRRLLFWGIYYLDVFG 550
           V + +  Y + G  + +A  L +H+             S + + +R  +FW  +  D   
Sbjct: 323 VDKSAFAYVMVGNAIRIAFTLGIHKT------------SATPKNNR--IFWLCFLYDRLL 368

Query: 551 ALQLGVPRLLKDHEIECALP-ISEHAHAGVSLADQVIKLEGQVSELSLSLLRFSKILGNI 609
           A++ G P L+  +EIE  +P  S      +S++ +    E QVS         +KI  NI
Sbjct: 369 AIRFGFPLLI--NEIEIEIPSCSSFDTDFLSISLEKYHFEAQVS--------LAKITTNI 418

Query: 610 LDSIFKRGMTSSAAQQVALIHENALDNWRRGLPKNLTFELD 650
           +  I+ +  +S      A++ E  L +W  GLP  L F+ +
Sbjct: 419 IKRIYTKNSSSFVHNCHAVLKE--LKDWFDGLPSELKFDYN 457

 Score = 34.3 bits (77), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 12/32 (37%), Positives = 18/32 (56%), Gaps = 1/32 (3%)

Query: 67 NYRVAQACDRCRSKKTRCDGKRPQCSQCAAVG 98
          N +  +AC+ C+ +K RC G  P C  C  +G
Sbjct: 11 NAKSKRACETCKRRKKRCSGGLP-CEYCVKIG 41

>Smik_10.25 Chr10 complement(45977..48295) [2319 bp, 772 aa] {ON}
           YJL206C (REAL)
          Length = 772

 Score = 41.6 bits (96), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 49/210 (23%), Positives = 92/210 (43%), Gaps = 19/210 (9%)

Query: 492 GEVSSVYEIRGTVVSMAQQLRLHRCPSAVLGTEGSTMSKSEQGDRRLLFWGIYYLDVFGA 551
             + + Y   G  +  A +  LHR  S V    G T  + E   R  LFW +Y LD++  
Sbjct: 315 ANLKACYSFIGIALRAALKDGLHRKSSIV----GPTPIEDETKKR--LFWSVYKLDLYMN 368

Query: 552 LQLGVPRLLKDHEIECALPISEH----AHAGVSLAD-QVIKLEGQVSELSLSLLRFSKIL 606
             LG P  + + +I+   P+       +  G+   D + I   G  ++ +  +L  S+I 
Sbjct: 369 CILGFPSGIDESDIDQEFPLDVDDENISTTGIKFQDWRTISSCGMNNKHTKLILIMSRIY 428

Query: 607 GNILDSIFKRGMTSSAAQQVALIHENALDNWRRGLPKNLTFELDVNGTIKIEELTGS-AQ 665
             ++ S+ ++ +   +  Q+  +++  LD+W   LP  L  +     TI+  +     + 
Sbjct: 429 -KLMYSLRRKPLEEDSRLQIVSLNDQ-LDDWYTQLPDTLKVD-----TIRYHQPQPPLSI 481

Query: 666 NNQDFTKNASSDKKILMLLYFLVKCLVHLP 695
              D   + S  KK+L L + L K +++ P
Sbjct: 482 CTNDRNSSYSKPKKLLYLDFLLSKIVLYKP 511

 Score = 38.9 bits (89), Expect = 0.099,   Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 19/34 (55%), Gaps = 1/34 (2%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECK 102
           R  +AC  CR +K RC G+ P C  C    FECK
Sbjct: 53  RAHRACVACRKRKVRCSGQTP-CRLCQNNSFECK 85

>Kwal_34.15751 s34 (40148..42034) [1887 bp, 628 aa] {ON} [contig
           274] FULL
          Length = 628

 Score = 41.6 bits (96), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 12/33 (36%), Positives = 21/33 (63%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 101
           R++  CD CR +K +C+ ++P CS+C     +C
Sbjct: 10  RISHVCDACRIRKLKCNKQKPSCSRCVKHDLQC 42

>YGR288W Chr7 (1070293..1071714) [1422 bp, 473 aa] {ON}
           MAL13MAL-activator protein, part of complex locus MAL1;
           nonfunctional in genomic reference strain S288C
          Length = 473

 Score = 41.2 bits (95), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 16/30 (53%), Positives = 20/30 (66%), Gaps = 1/30 (3%)

Query: 72  QACDRCRSKKTRCDGKRPQCSQCAAVGFEC 101
           QACD CR ++ +CDGKRP CS C     +C
Sbjct: 11  QACDCCRIRRVKCDGKRP-CSSCLQNSLDC 39

>Suva_8.421 Chr8 complement(757924..760932) [3009 bp, 1002 aa] {ON}
           YOR363C (REAL)
          Length = 1002

 Score = 41.6 bits (96), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 31/59 (52%), Gaps = 2/59 (3%)

Query: 57  SPVTSATPTSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRG 115
           SP  ++      R++  C  CR  KT+CD ++P+C +C      C + D ++R+  PR 
Sbjct: 8   SPTMNSIGKKRNRLSFVCQACRKAKTKCDQEKPRCGRCTKQNLFC-IYD-VARQKAPRN 64

>KLLA0F19602g Chr6 complement(1814949..1816760) [1812 bp, 603 aa]
           {ON} similar to uniprot|P43634 Saccharomyces cerevisiae
           YLR098C CHA4 Zinc-finger protein with Zn[2]-Cys[6]
           fungal- type binuclear cluster domain DNA-binding
           transcriptional activator or CHA1 and some similarities
           to YOR337W uniprot|P47988 Saccharomyces cerevisiae
           YOR337W TEA1 Mutants are defective in Ty1
           Enhancer-mediated Activation Ty1 enhancer activator
          Length = 603

 Score = 41.6 bits (96), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 24/40 (60%), Gaps = 3/40 (7%)

Query: 73  ACDRCRSKKTRCDGKRPQCSQCAAVGFECKV--SDKLSRR 110
           AC  CR K+ +CD +RP CS C   G EC    +DK ++R
Sbjct: 16  ACQNCRIKRRKCDMERP-CSNCLKYGIECITVNNDKRTKR 54

>TPHA0H01240 Chr8 (274496..277129) [2634 bp, 877 aa] {ON} Anc_5.59
           YHR178W
          Length = 877

 Score = 41.6 bits (96), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 23/39 (58%)

Query: 73  ACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRA 111
           +C RCR  K +C  + P+CS C A  + C+   +L RR+
Sbjct: 97  SCSRCRRLKKKCLRQMPKCSNCVASHYACEYIGRLPRRS 135

>Skud_2.372 Chr2 complement(669194..670552) [1359 bp, 452 aa] {ON}
           YBR240C (REAL)
          Length = 452

 Score = 41.2 bits (95), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 24/49 (48%)

Query: 59  VTSATPTSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKL 107
           ++S  P +  R    C  CR KK RCD  RP CS CA  G  C    +L
Sbjct: 15  LSSKAPPTKGRTFTGCWACRFKKRRCDENRPICSLCAKHGDNCSYDIRL 63

>Skud_3.181 Chr3 (293773..296268) [2496 bp, 831 aa] {ON} YCR106W
           (REAL)
          Length = 831

 Score = 41.6 bits (96), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 25/50 (50%), Gaps = 2/50 (4%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDK--LSRRAFPRGY 116
           R+   C +C+  K +CD  RP CS+C     ECK  D   LS +    G+
Sbjct: 10  RLRLVCLQCKRIKRKCDKLRPVCSRCQQHSLECKYEDSADLSSKVIASGF 59

>NCAS0C02730 Chr3 (513280..515607) [2328 bp, 775 aa] {ON} Anc_8.423
          Length = 775

 Score = 41.6 bits (96), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 13/39 (33%), Positives = 21/39 (53%)

Query: 73  ACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRA 111
            CD C+ ++ +CD  +P C +C  +  EC  S    R+A
Sbjct: 57  GCDNCKRRRVKCDELKPTCQKCINMNLECVYSMPKPRKA 95

>NCAS0A08840 Chr1 (1746841..1751277) [4437 bp, 1478 aa] {ON}
          Anc_1.380
          Length = 1478

 Score = 41.6 bits (96), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 17/30 (56%)

Query: 69 RVAQACDRCRSKKTRCDGKRPQCSQCAAVG 98
          RV  +C  CR +K +CD  RP C QC   G
Sbjct: 38 RVPLSCTICRKRKVKCDKIRPHCQQCTKTG 67

>NDAI0D03550 Chr4 complement(843265..846621) [3357 bp, 1118 aa] {ON}
           Anc_4.113
          Length = 1118

 Score = 41.6 bits (96), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 24/42 (57%), Gaps = 1/42 (2%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRR 110
           +V +ACD CR +K +C GK P C+ C A    C  S +  R+
Sbjct: 58  KVTKACDNCRRRKIKCTGKTP-CATCEAYQCLCIYSTQRGRK 98

>KNAG0A02300 Chr1 (214177..216363) [2187 bp, 729 aa] {ON}  gene
           extends into a gap in the genome sequence
          Length = 729

 Score = 41.6 bits (96), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 17/31 (54%), Positives = 19/31 (61%), Gaps = 1/31 (3%)

Query: 72  QACDRCRSKKTRCDGKRPQCSQCAAVGF-EC 101
           + C  CR +K RCD  RP CS C A GF EC
Sbjct: 23  RTCTFCRQRKVRCDQGRPLCSSCKARGFSEC 53

>Kwal_YGOB_0.139 s0 complement(61752..63560,63594..65507) [3723
          bp, 1240 aa] {ON} ANNOTATED BY YGOB -
          Length = 1240

 Score = 41.6 bits (96), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 21/40 (52%)

Query: 59 VTSATPTSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVG 98
          +TS       RV  +C  CR +K +CD  RP C QC+  G
Sbjct: 1  MTSQLKRKRNRVPLSCTICRKRKVKCDKTRPHCQQCSKTG 40

>Klac_YGOB_3960 Chr3 (291786..293297,293300..294220) [2433 bp, 810
           aa] {ON} ANNOTATED BY YGOB - Artificial frameshift
           joining KLLA0C03223g and KLLA0C03234g
          Length = 810

 Score = 41.6 bits (96), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 18/37 (48%)

Query: 71  AQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKL 107
           AQ CDRCR  K +C G  P C  C      C V+  L
Sbjct: 49  AQVCDRCRKLKKKCYGTGPSCVNCVVTNNPCTVTTTL 85

>CAGL0F07865g Chr6 complement(768270..770804) [2535 bp, 844 aa] {ON}
           similar to uniprot|Q12151 Saccharomyces cerevisiae
           YDR213w UPC2
          Length = 844

 Score = 41.2 bits (95), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 11/50 (22%), Positives = 24/50 (48%)

Query: 52  AARSISPVTSATPTSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 101
             + +S  ++     + +    CD C+ ++ +CD  +P C +C  +  EC
Sbjct: 32  GGKKVSTTSTGKRKFHNKSKNGCDHCKRRRVKCDEGKPMCDKCVKMKLEC 81

>Skud_10.10 Chr10 complement(21672..24173) [2502 bp, 833 aa] {ON}
           YJL206C (REAL)
          Length = 833

 Score = 41.2 bits (95), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 49/208 (23%), Positives = 93/208 (44%), Gaps = 19/208 (9%)

Query: 494 VSSVYEIRGTVVSMAQQLRLHRCPSAVLGTEGSTMSKSEQGDRRLLFWGIYYLDVFGALQ 553
           + + Y   G  +  A +  LHR  S V    G T  + E   R  LFW +Y LD++    
Sbjct: 293 LKACYSFIGIALRAALKEGLHRKSSIV----GPTPIQDETKKR--LFWSVYKLDLYMNCI 346

Query: 554 LGVPRLLKDHEIECALPI----SEHAHAGVSLAD-QVIKLEGQVSELSLSLLRFSKILGN 608
           LG P  + + +I+   P+       +  G+   D + I   G  ++ +  +L  S+I   
Sbjct: 347 LGFPSGIDESDIDQEFPLDVDDENISTMGIKFQDWRTISSCGMNNKHTKLILIMSRIY-K 405

Query: 609 ILDSIFKRGMTSSAAQQVALIHENALDNWRRGLPKNLTFELDVNGTIKIEELTGSAQNNQ 668
           ++ S+ ++ +   +  Q+  +++  L+NW   LP  L  +     TI+  +    A    
Sbjct: 406 LMYSLRRKPLEEDSRSQIVSLNDQ-LENWYTQLPDILKVD-----TIRYRQPQPPANVCA 459

Query: 669 DFTKNASSD-KKILMLLYFLVKCLVHLP 695
           D + +  +  KK+L L + L K +++ P
Sbjct: 460 DESSSPYTKPKKLLYLDFLLSKIVLYKP 487

 Score = 38.9 bits (89), Expect = 0.094,   Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 19/34 (55%), Gaps = 1/34 (2%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECK 102
           R  +AC  CR +K RC G+ P C  C    FECK
Sbjct: 29  RAHRACVACRKRKVRCSGQTP-CRLCQNNSFECK 61

>SAKL0D07898g Chr4 complement(653332..657066) [3735 bp, 1244 aa]
          {ON} similar to uniprot|P12351 Saccharomyces cerevisiae
          YLR256W HAP1
          Length = 1244

 Score = 41.6 bits (96), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 18/30 (60%)

Query: 69 RVAQACDRCRSKKTRCDGKRPQCSQCAAVG 98
          RV  +C  CR +K +CD  RP C QC+  G
Sbjct: 11 RVPLSCTICRKRKVKCDKTRPHCQQCSKTG 40

>YLR266C Chr12 complement(675619..677724) [2106 bp, 701 aa] {ON}
          PDR8Transcription factor; targets include ATP-binding
          cassette (ABC) transporters, major facilitator
          superfamily transporters, and other genes involved in
          the pleiotropic drug resistance (PDR) phenomenon
          Length = 701

 Score = 41.2 bits (95), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 25/51 (49%)

Query: 45 NNSAAPNAARSISPVTSATPTSNYRVAQACDRCRSKKTRCDGKRPQCSQCA 95
          + S  P  + +  PV+S       +V ++C  CR +K +C   RP C QC 
Sbjct: 2  DGSHFPMKSTTGEPVSSGKKGKRRKVIKSCAFCRKRKLKCSQARPMCQQCV 52

>TBLA0E03480 Chr5 (865043..868183) [3141 bp, 1046 aa] {ON} Anc_3.109
           YOL089C
          Length = 1046

 Score = 41.2 bits (95), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 35/76 (46%), Gaps = 18/76 (23%)

Query: 48  AAPNAARSISPVTSA-----TPTSN----------YRVAQACDRCRSKKTRCDGKRP--- 89
            +PN A +I  +TS+      PTSN           RV +AC  CR +K +CD   P   
Sbjct: 122 VSPNNAITIPKLTSSEKNSNKPTSNDNFISQHPYKRRVVKACYNCRRRKIKCDAIDPSKN 181

Query: 90  QCSQCAAVGFECKVSD 105
           +CS C  +   C  S+
Sbjct: 182 KCSNCLKLNKICSFSE 197

>TBLA0G00510 Chr7 (104797..107604) [2808 bp, 935 aa] {ON} Anc_6.60
           YLR266C
          Length = 935

 Score = 41.2 bits (95), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 23/46 (50%), Gaps = 1/46 (2%)

Query: 61  SATPTSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGF-ECKVSD 105
           S T      + + C  CR KK +CD +RP CS C A  F EC   D
Sbjct: 69  SGTRKKRKTIIKTCLFCREKKLKCDKRRPLCSSCIARNFTECVYVD 114

>ADR404C Chr4 complement(1432320..1434947) [2628 bp, 875 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YAL051W
           (OAF1) and YOR363C (PIP2); Tandem gene triplication in
           this genome
          Length = 875

 Score = 41.2 bits (95), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 22/37 (59%)

Query: 65  TSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 101
           T   +++  C  CR  KT+CD  +P CS+CA +G  C
Sbjct: 15  THKRKLSYVCIPCRKCKTKCDKLKPTCSRCAELGLYC 51

>Smik_11.210 Chr11 (352056..355565) [3510 bp, 1169 aa] {ON} YKL038W
           (REAL)
          Length = 1169

 Score = 41.2 bits (95), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 35/77 (45%), Gaps = 4/77 (5%)

Query: 44  TNNSAAPNAARSISPVTSATPTSNYRV--AQACDRCRSKKTRCDGK--RPQCSQCAAVGF 99
           T N    N+   ++P  ++      R   ++ACD+CR KK +CD K  R  C+ C   G 
Sbjct: 15  TKNGGTSNSPDDMNPAAASGHAMKKRTKASRACDQCRKKKIKCDYKDERGVCTNCQRNGD 74

Query: 100 ECKVSDKLSRRAFPRGY 116
            C       +R   +GY
Sbjct: 75  RCSFERVPLKRGPSKGY 91

>TDEL0D00260 Chr4 complement(44685..46628) [1944 bp, 647 aa] {ON} 
          Length = 647

 Score = 41.2 bits (95), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 33/114 (28%), Positives = 52/114 (45%), Gaps = 14/114 (12%)

Query: 539 LFWGIYYLDVFGALQLGVPRLLKDHEIEC-ALP-ISEHAHAGVSLADQVIKLEGQVSELS 596
           +FW  Y  D   A++ G P  L D +++  +LP + E  +  VSL  +      QV    
Sbjct: 322 IFWLCYIYDRLVAVRFGFPLNLDDLDVDVLSLPLVDEKGYYSVSL--ETCHFVSQV---- 375

Query: 597 LSLLRFSKILGNILDSIFKRGMTSSAAQQVALIHENALDNWRRGLPKNLTFELD 650
               + ++I   IL SI+ +   S      A++ E  L  W   LP+NL  +LD
Sbjct: 376 ----KLARITTRILRSIYTKNSISFIQNCNAVLKE--LKTWFDDLPQNLILDLD 423

 Score = 38.5 bits (88), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 20/30 (66%), Gaps = 1/30 (3%)

Query: 69 RVAQACDRCRSKKTRCDGKRPQCSQCAAVG 98
          RV++ACD C+ +K RC G+ P C  C  +G
Sbjct: 5  RVSKACDVCKHRKKRCTGELP-CDYCTRIG 33

>TPHA0B03630 Chr2 (844571..848860) [4290 bp, 1429 aa] {ON} Anc_1.380
           YLR256W
          Length = 1429

 Score = 41.2 bits (95), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 12/32 (37%), Positives = 18/32 (56%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFE 100
           R+  +C  CR +K +CD   P C+QC   G +
Sbjct: 40  RIPLSCTICRKRKVKCDKTHPHCNQCVKTGVQ 71

>KNAG0A02550 Chr1 complement(262867..265059) [2193 bp, 730 aa] {ON}
           Anc_8.423 YLR228C
          Length = 730

 Score = 41.2 bits (95), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 13/38 (34%), Positives = 21/38 (55%)

Query: 73  ACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRR 110
            CD C+ ++ +CD  +P C +CA +  EC  +    RR
Sbjct: 33  GCDNCKRRRVKCDEGKPFCQKCANMRLECVFTPPQPRR 70

>SAKL0B01870g Chr2 (185897..188926) [3030 bp, 1009 aa] {ON} weakly
           similar to uniprot|P39720 Saccharomyces cerevisiae
           YAL051W OAF1 Oleate-activated transcription factor acts
           alone and as a heterodimer with Pip2p activates genes
           involved in beta-oxidation of fatty acids and peroxisome
           organization and biogenesis
          Length = 1009

 Score = 41.2 bits (95), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 25/47 (53%)

Query: 56  ISPVTSATPTSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECK 102
           + P+     + N +V+ AC+ C  KK +CD   P C+ C   G +CK
Sbjct: 58  VRPMVDRPRSFNIKVSPACEACNVKKIKCDRGFPVCNTCLKRGTQCK 104

>KNAG0A07100 Chr1 complement(1113008..1116868) [3861 bp, 1286 aa]
           {ON} Anc_2.547 YKL038W
          Length = 1286

 Score = 41.2 bits (95), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 26/50 (52%), Gaps = 2/50 (4%)

Query: 69  RVAQACDRCRSKKTRCD--GKRPQCSQCAAVGFECKVSDKLSRRAFPRGY 116
           + ++ACD+CR KK +CD    R  C+ C  +G  C       +R   +GY
Sbjct: 50  KASRACDQCRRKKIKCDYNDMRNICTNCQRIGERCSFERVPLKRGPTKGY 99

>KLTH0H11572g Chr8 complement(989095..992808) [3714 bp, 1237 aa]
          {ON} similar to uniprot|P12351 Saccharomyces cerevisiae
          YLR256W HAP1
          Length = 1237

 Score = 41.2 bits (95), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 18/30 (60%)

Query: 69 RVAQACDRCRSKKTRCDGKRPQCSQCAAVG 98
          RV  +C  CR +K +CD  RP C QC+  G
Sbjct: 11 RVPLSCTICRKRKVKCDKTRPHCQQCSKTG 40

>KLLA0F02750g Chr6 complement(250368..253814) [3447 bp, 1148 aa]
           {ON} some similarities with uniprot|Q12180 Saccharomyces
           cerevisiae YOL089C HAL9 Putative transcription factor
           containing a zinc finger overexpression increases salt
           tolerance through increased expression of the ENA1 (Na
           /Li extrusion pump) gene while gene disruption decreases
           both salt tolerance and ENA1 expression
          Length = 1148

 Score = 41.2 bits (95), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 21/36 (58%), Gaps = 3/36 (8%)

Query: 69  RVAQACDRCRSKKTRCDGKRP---QCSQCAAVGFEC 101
           RV++ACDRCR +K +CD   P   +CS C      C
Sbjct: 29  RVSKACDRCRRRKIKCDDLDPVSGKCSNCIKYKVPC 64

>Kwal_26.7095 s26 (211883..214399) [2517 bp, 838 aa] {ON} YOR363C
           (PIP2) - activator of peroxisome proliferation [contig
           46] FULL
          Length = 838

 Score = 41.2 bits (95), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 25/51 (49%), Gaps = 3/51 (5%)

Query: 66  SNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKV---SDKLSRRAFP 113
           S  R +  C  C+ +K +CD  RP C +C+ +  EC      +K  RR  P
Sbjct: 22  SRMRQSFVCRNCKKRKIKCDKARPSCGRCSKLELECVYDFQENKDGRRGLP 72

>KLLA0A03421g Chr1 (308414..311056) [2643 bp, 880 aa] {ON} weakly
           similar to uniprot|P39720 Saccharomyces cerevisiae
           YAL051W OAF1 Oleate-activated transcription factor acts
           alone and as a heterodimer with Pip2p activates genes
           involved in beta-oxidation of fatty acids and peroxisome
           organization and biogenesis
          Length = 880

 Score = 41.2 bits (95), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 21/34 (61%)

Query: 68  YRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 101
           Y+++  C  CR  KT+CD K+P C++C  +   C
Sbjct: 15  YKLSFVCQLCRKSKTKCDRKKPSCARCQRLNKPC 48

>TDEL0B00480 Chr2 (83911..86418) [2508 bp, 835 aa] {ON} Anc_8.879
           YML099C
          Length = 835

 Score = 41.2 bits (95), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 22/41 (53%)

Query: 73  ACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFP 113
            C  CRS+K +CD +RP C +C   G +C   D   R + P
Sbjct: 27  GCWTCRSRKVKCDLQRPNCGRCEKSGLDCGGYDIKLRWSNP 67

>TBLA0G00490 Chr7 (99344..102100) [2757 bp, 918 aa] {ON} 
          Length = 918

 Score = 41.2 bits (95), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 23/38 (60%), Gaps = 1/38 (2%)

Query: 72  QACDRCRSKKTRCDGKRPQCSQCAAVGF-ECKVSDKLS 108
           ++C  CR +K +CD  +P CS C A  F EC  SD ++
Sbjct: 33  KSCSFCRRRKLKCDKSKPLCSTCRARNFTECIYSDAIN 70

>Skud_9.220 Chr9 complement(396576..398957) [2382 bp, 793 aa] {ON}
           YER184C (REAL)
          Length = 793

 Score = 41.2 bits (95), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 17/35 (48%), Positives = 23/35 (65%), Gaps = 1/35 (2%)

Query: 67  NYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 101
           N RV++AC+RC  KK +CD K+P C  CA    +C
Sbjct: 11  NSRVSKACERCHRKKIKCDSKKP-CFGCAGSRSKC 44

>Skud_7.638 Chr7 (1060062..1061483) [1422 bp, 473 aa] {ON} YFL052W
           (REAL)
          Length = 473

 Score = 40.8 bits (94), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 24/39 (61%), Gaps = 1/39 (2%)

Query: 72  QACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRR 110
           QACD CR ++ +CDGK+P C++C     +C     L +R
Sbjct: 11  QACDCCRVRRVKCDGKKP-CNRCLQHDLKCTYLQPLRKR 48

>NCAS0A04750 Chr1 (944929..948354) [3426 bp, 1141 aa] {ON} Anc_2.547
          Length = 1141

 Score = 41.2 bits (95), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 34/67 (50%), Gaps = 2/67 (2%)

Query: 52  AARSISPVTSATPTSNYRVAQACDRCRSKKTRCD--GKRPQCSQCAAVGFECKVSDKLSR 109
           AA + +   S++     + ++ACD+CR KK +CD   ++  CS C   G +C       +
Sbjct: 53  AAGTNAASNSSSQKKRTKASRACDQCRKKKIKCDFSEEKTLCSNCQRNGEKCTFERVPLK 112

Query: 110 RAFPRGY 116
           R   +GY
Sbjct: 113 RGPSKGY 119

>YLR256W Chr12 (646415..650923) [4509 bp, 1502 aa] {ON}  HAP1Zinc
          finger transcription factor involved in the complex
          regulation of gene expression in response to levels of
          heme and oxygen; the S288C sequence differs from other
          strain backgrounds due to a Ty1 insertion in the
          carboxy terminus
          Length = 1502

 Score = 41.2 bits (95), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 17/30 (56%)

Query: 69 RVAQACDRCRSKKTRCDGKRPQCSQCAAVG 98
          R+  +C  CR +K +CD  RP C QC   G
Sbjct: 59 RIPLSCTICRKRKVKCDKLRPHCQQCTKTG 88

>Kpol_538.52 s538 (126243..128966) [2724 bp, 907 aa] {ON}
           (126243..128966) [2724 nt, 908 aa]
          Length = 907

 Score = 40.8 bits (94), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 22/38 (57%)

Query: 65  TSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECK 102
           T+  +    C  CRS+K +CD  RP+C +C  +G  C+
Sbjct: 8   TTKRKSFNGCWTCRSRKVKCDLNRPKCQRCDRLGIICE 45

>Ecym_2263 Chr2 (518089..519615) [1527 bp, 508 aa] {ON} similar to
           Ashbya gossypii AFL033W
          Length = 508

 Score = 40.8 bits (94), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 27/61 (44%), Gaps = 3/61 (4%)

Query: 50  PNAARSISPVTS---ATPTSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDK 106
           P     I+P  +   A P S  R    C  CR KK RCD +RP CS C   G  C    +
Sbjct: 15  PGETGGITPAGASLKALPKSKARSFTGCWACRFKKRRCDERRPFCSLCTKHGDSCSYDVR 74

Query: 107 L 107
           L
Sbjct: 75  L 75

>Kpol_260.2 s260 complement(3488..5758) [2271 bp, 756 aa] {ON}
           complement(3488..5758) [2271 nt, 757 aa]
          Length = 756

 Score = 40.8 bits (94), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 21/41 (51%)

Query: 71  AQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRA 111
           A +C RCR  K +C  +RP C+ C   G  C    +  RR+
Sbjct: 40  AYSCSRCRKLKRKCQKQRPSCANCMNAGATCNYPGRAPRRS 80

>KLLA0A03443g Chr1 (311628..314555) [2928 bp, 975 aa] {ON} similar
           to uniprot|Q758X5 Ashbya gossypii ADR403C ADR403Cp and
           weakly similar to YAL051W uniprot|P39720 Saccharomyces
           cerevisiae YAL051W OAF1 Oleate-activated transcription
           factor acts alone and as a heterodimer with Pip2p
           activates genes involved in beta-oxidation of fatty
           acids and peroxisome organization and biogenesis
          Length = 975

 Score = 40.8 bits (94), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 12/33 (36%), Positives = 20/33 (60%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 101
           R++  C  CR  KT+CD ++P+C +C     +C
Sbjct: 30  RISFVCQACRKNKTKCDREKPRCGRCVKYHLKC 62

>KLLA0F25630g Chr6 (2378464..2381487) [3024 bp, 1007 aa] {ON} some
           similarities with uniprot|P32862 Saccharomyces
           cerevisiae YKL038W RGT1 Glucose-responsive transcription
           factor that regulates expression of several glucose
           transporter (HXT) genes in response to glucose binds to
           promoters and acts both as a transcriptional activator
           and repressor
          Length = 1007

 Score = 40.8 bits (94), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 34/69 (49%), Gaps = 9/69 (13%)

Query: 57  SPVTSATPTSNYR--VAQACDRCRSKKTRCD-------GKRPQCSQCAAVGFECKVSDKL 107
           S V++AT  S  R  V++ACD+CR KK +CD            C+ C  +G +C      
Sbjct: 98  SNVSTATTESRRRSKVSRACDQCRKKKIKCDFIEGHDINPDQSCTGCRKIGEKCSFERIP 157

Query: 108 SRRAFPRGY 116
            +R   +GY
Sbjct: 158 LKRGPSKGY 166

>ZYRO0G19338g Chr7 complement(1601895..1603856) [1962 bp, 653 aa]
           {ON} similar to uniprot|Q754A1 Ashbya gossypii AFR171W
           AFR171Wp and some similarites with YDR034C
           uniprot|P40971 Saccharomyces cerevisiae YDR034C LYS14
           Transcriptional activator involved in regulation of
           genes of the lysine biosynthesis pathway requires
           2-aminoadipate semialdehyde as co-inducer
          Length = 653

 Score = 40.8 bits (94), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 11/29 (37%), Positives = 21/29 (72%)

Query: 73  ACDRCRSKKTRCDGKRPQCSQCAAVGFEC 101
            C+ C+ +K +CD ++P+C QC+ +G +C
Sbjct: 20  GCNECKKRKVKCDEQKPECWQCSHLGKKC 48

>NCAS0H00780 Chr8 complement(140472..143201) [2730 bp, 909 aa] {ON} 
          Length = 909

 Score = 40.8 bits (94), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 20/38 (52%), Gaps = 3/38 (7%)

Query: 67  NYRVAQ---ACDRCRSKKTRCDGKRPQCSQCAAVGFEC 101
           NYR A+    C  CRSKK +CD  RP C +C      C
Sbjct: 5   NYRKARPSFVCLVCRSKKVKCDKARPSCGRCRKTNKLC 42

>YBR240C Chr2 complement(700490..701842) [1353 bp, 450 aa] {ON}
           THI2Transcriptional activator of thiamine biosynthetic
           genes; interacts with regulatory factor Thi3p to control
           expression of thiamine biosynthetic genes with respect
           to thiamine availability; acts together with Pdc2p to
           respond to thiaminediphosphate demand, possibly as
           related to carbon source availability; zinc finger
           protein of the Zn(II)2Cys6 type
          Length = 450

 Score = 40.4 bits (93), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 23/48 (47%)

Query: 60  TSATPTSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKL 107
           +S  P +  R    C  CR KK RCD  RP CS CA  G  C    +L
Sbjct: 16  SSKVPPTKGRTFTGCWACRFKKRRCDENRPICSLCAKHGDNCSYDIRL 63

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.131    0.385 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 112,298,814
Number of extensions: 4491503
Number of successful extensions: 16584
Number of sequences better than 10.0: 696
Number of HSP's gapped: 16954
Number of HSP's successfully gapped: 776
Length of query: 1209
Length of database: 53,481,399
Length adjustment: 121
Effective length of query: 1088
Effective length of database: 39,606,813
Effective search space: 43092212544
Effective search space used: 43092212544
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 72 (32.3 bits)