Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_27.102278.846ON25425412711e-179
KLTH0C03740g8.846ON2542547012e-92
SAKL0D01320g8.846ON2602515362e-67
ABL120W8.846ON2492514952e-61
KLLA0D01430g8.846ON2632184813e-59
Ecym_46178.846ON2492514656e-57
NDAI0K003308.846ON3132944629e-56
NCAS0C003808.846ON2762244391e-52
TPHA0I002808.846ON3012974332e-51
Smik_13.4948.846ON3042854262e-50
KAFR0B039608.846ON2782754242e-50
YMR281W (GPI12)8.846ON3042854211e-49
Suva_13.4708.846ON3032864183e-49
Kpol_1068.48.846ON2912744165e-49
ZYRO0G14300g8.846ON2802724146e-49
TDEL0B005208.846ON2682684137e-49
KNAG0J002408.846ON2862733991e-46
Skud_13.4538.846ON3002833992e-46
CAGL0M03047g8.846ON3042833592e-40
TBLA0B033008.846ON3193083584e-40
YPL009C (TAE2)8.75ON103872693.3
KAFR0A031007.528ON31790665.1
YOL107W3.76ON34241666.5
Smik_16.2278.75ON72888659.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_27.10227
         (254 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_27.10227 s27 complement(249716..250480) [765 bp, 254 aa] {O...   494   e-179
KLTH0C03740g Chr3 complement(323371..324135) [765 bp, 254 aa] {O...   274   2e-92
SAKL0D01320g Chr4 complement(99898..100680) [783 bp, 260 aa] {ON...   211   2e-67
ABL120W Chr2 (175065..175814) [750 bp, 249 aa] {ON} Syntenic hom...   195   2e-61
KLLA0D01430g Chr4 complement(122369..123160) [792 bp, 263 aa] {O...   189   3e-59
Ecym_4617 Chr4 (1209745..1210494) [750 bp, 249 aa] {ON} similar ...   183   6e-57
NDAI0K00330 Chr11 (63765..64706) [942 bp, 313 aa] {ON} Anc_8.846...   182   9e-56
NCAS0C00380 Chr3 complement(55971..56801) [831 bp, 276 aa] {ON} ...   173   1e-52
TPHA0I00280 Chr9 (54103..55008) [906 bp, 301 aa] {ON} Anc_8.846 ...   171   2e-51
Smik_13.494 Chr13 (815351..816265) [915 bp, 304 aa] {ON} YMR281W...   168   2e-50
KAFR0B03960 Chr2 (829312..830148) [837 bp, 278 aa] {ON} Anc_8.84...   167   2e-50
YMR281W Chr13 (832339..833253) [915 bp, 304 aa] {ON}  GPI12ER me...   166   1e-49
Suva_13.470 Chr13 (815029..815940) [912 bp, 303 aa] {ON} YMR281W...   165   3e-49
Kpol_1068.4 s1068 complement(6124..6999) [876 bp, 291 aa] {ON} c...   164   5e-49
ZYRO0G14300g Chr7 (1145709..1146551) [843 bp, 280 aa] {ON} simil...   164   6e-49
TDEL0B00520 Chr2 complement(94560..95366) [807 bp, 268 aa] {ON} ...   163   7e-49
KNAG0J00240 Chr10 complement(32153..33013) [861 bp, 286 aa] {ON}...   158   1e-46
Skud_13.453 Chr13 (805536..806438) [903 bp, 300 aa] {ON} YMR281W...   158   2e-46
CAGL0M03047g Chr13 (346435..347349) [915 bp, 304 aa] {ON} weakly...   142   2e-40
TBLA0B03300 Chr2 (771332..772291) [960 bp, 319 aa] {ON} Anc_8.84...   142   4e-40
YPL009C Chr16 complement(535820..538936) [3117 bp, 1038 aa] {ON}...    31   3.3  
KAFR0A03100 Chr1 complement(634622..635575) [954 bp, 317 aa] {ON...    30   5.1  
YOL107W Chr15 (112102..113130) [1029 bp, 342 aa] {ON} Putative p...    30   6.5  
Smik_16.227 Chr16 complement(413782..415968) [2187 bp, 728 aa] {...    30   9.1  

>Kwal_27.10227 s27 complement(249716..250480) [765 bp, 254 aa] {ON}
           YMR281W (GPI12) -
           N-acetylglucosaminylphosphatidylinositol de-N-acetylase
           [contig 39] FULL
          Length = 254

 Score =  494 bits (1271), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 242/254 (95%), Positives = 242/254 (95%)

Query: 1   MGAFRTVFKVSGILWLVYILGSVQIERSNRRALGSLFRGSAPTSINLVIAHPDDEVMFFA 60
           MGAFRTVFKVSGILWLVYILGSVQIERSNRRALGSLFRGSAPTSINLVIAHPDDEVMFFA
Sbjct: 1   MGAFRTVFKVSGILWLVYILGSVQIERSNRRALGSLFRGSAPTSINLVIAHPDDEVMFFA 60

Query: 61  PTLLQIDEWLPGSIEVNVISXXXXXXXXXXXXRTKELQDCVRLLLRKRKASVEVLDFLDG 120
           PTLLQIDEWLPGSIEVNVIS            RTKELQDCVRLLLRKRKASVEVLDFLDG
Sbjct: 61  PTLLQIDEWLPGSIEVNVISLTDGGADGLGDLRTKELQDCVRLLLRKRKASVEVLDFLDG 120

Query: 121 MDVEWDLERAVKALQERILDESPLFLTFDENGISGHVNHISCYKAVQKVRKHYSKSSCFK 180
           MDVEWDLERAVKALQERILDESPLFLTFDENGISGHVNHISCYKAVQKVRKHYSKSSCFK
Sbjct: 121 MDVEWDLERAVKALQERILDESPLFLTFDENGISGHVNHISCYKAVQKVRKHYSKSSCFK 180

Query: 181 LVSKRYLFEKYSGFIPALFHSFISSSPSTLINSFRQYLLALSSMMNAHVSQMVWFRYGWW 240
           LVSKRYLFEKYSGFIPALFHSFISSSPSTLINSFRQYLLALSSMMNAHVSQMVWFRYGWW
Sbjct: 181 LVSKRYLFEKYSGFIPALFHSFISSSPSTLINSFRQYLLALSSMMNAHVSQMVWFRYGWW 240

Query: 241 LFSYYVYANELQAF 254
           LFSYYVYANELQAF
Sbjct: 241 LFSYYVYANELQAF 254

>KLTH0C03740g Chr3 complement(323371..324135) [765 bp, 254 aa] {ON}
           weakly similar to uniprot|P23797 Saccharomyces
           cerevisiae YMR281W GPI12 ER membrane protein involved in
           the second step of glycosylphosphatidylinositol (GPI)
           anchor assembly the de-N-acetylation of the N-
           acetylglucosaminylphosphatidylinositol intermediate
           functional homolog of human PIG-Lp
          Length = 254

 Score =  274 bits (701), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 129/254 (50%), Positives = 176/254 (69%)

Query: 1   MGAFRTVFKVSGILWLVYILGSVQIERSNRRALGSLFRGSAPTSINLVIAHPDDEVMFFA 60
           M   + V K+  +L ++Y   S +I+ SN +A  +LF    PTSINLVIAHPDDEVMFFA
Sbjct: 1   MRILKVVCKLLAVLCILYFASSARIKASNEQAFTTLFSVLNPTSINLVIAHPDDEVMFFA 60

Query: 61  PTLLQIDEWLPGSIEVNVISXXXXXXXXXXXXRTKELQDCVRLLLRKRKASVEVLDFLDG 120
           PTLLQ+D +    I V+V S            R +EL+D V LL R+RKA V VL+F DG
Sbjct: 61  PTLLQLDHYFDTDIPVSVFSLTDGGADGLGKLREEELRDSVHLLFRRRKAEVTVLNFEDG 120

Query: 121 MDVEWDLERAVKALQERILDESPLFLTFDENGISGHVNHISCYKAVQKVRKHYSKSSCFK 180
           M VEWDL++  +AL+++++ + PLFLTFD++G+S H+NHISCY+ V+ +R  + +S  F 
Sbjct: 121 MKVEWDLQKTSEALRKQVVGDQPLFLTFDDHGVSSHINHISCYETVRNLRAAHPESRSFS 180

Query: 181 LVSKRYLFEKYSGFIPALFHSFISSSPSTLINSFRQYLLALSSMMNAHVSQMVWFRYGWW 240
           L SKR +F+KY+ F+P+L      S  +  +++F+QYLLALS MMNAH SQMVWFRYGWW
Sbjct: 181 LTSKRSIFQKYTAFVPSLITVLRGSRQAVFMSTFKQYLLALSVMMNAHTSQMVWFRYGWW 240

Query: 241 LFSYYVYANELQAF 254
            FS YV+ANE++ F
Sbjct: 241 FFSCYVFANEVREF 254

>SAKL0D01320g Chr4 complement(99898..100680) [783 bp, 260 aa] {ON}
           similar to uniprot|P23797 Saccharomyces cerevisiae
           YMR281W GPI12 ER membrane protein involved in the second
           step of glycosylphosphatidylinositol (GPI) anchor
           assembly the de-N-acetylation of the N-
           acetylglucosaminylphosphatidylinositol intermediate
           functional homolog of human PIG-Lp
          Length = 260

 Score =  211 bits (536), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 108/251 (43%), Positives = 147/251 (58%), Gaps = 4/251 (1%)

Query: 7   VFKVSGILWLVYILGSVQIERSNRRALGSLFRGSAPTSINLVIAHPDDEVMFFAPTLLQI 66
           + K   +L ++YI  S +I   NR+   ++F    PTS+NL++AHPDDE MFF+PTLLQ+
Sbjct: 10  LLKAYALLSVLYICVSQRIAAHNRQVFRNVFPSRTPTSVNLIVAHPDDETMFFSPTLLQL 69

Query: 67  DEWLPGSIEVNVISXXXXXXXXXXXXRTKELQDCVRLLLRKRKASVEVLDFLDGMDVEWD 126
               P S+ + VI             R +EL+  ++LLL  R  SV V  F DGM VEWD
Sbjct: 70  HVNYPPSVPLRVICLTNGDADGLGAVREQELRLSMQLLLPARNTSVIVEGFEDGMGVEWD 129

Query: 127 LERAVKALQERILDESPLFLTFDENGISGHVNHISCYKA----VQKVRKHYSKSSCFKLV 182
             + V  +   + D SPL LTFDE+G+SGHVNH+SC  A    V++  +   + +   L 
Sbjct: 130 TRQVVATINRHVSDASPLLLTFDEHGVSGHVNHVSCNTAVSALVEQREQREQRFTALYLN 189

Query: 183 SKRYLFEKYSGFIPALFHSFISSSPSTLINSFRQYLLALSSMMNAHVSQMVWFRYGWWLF 242
           SKRY   KY  F   L        P   +++F QYLL+L++M NAHVSQMVWFR+GWWL 
Sbjct: 190 SKRYFPPKYGSFAVDLARIITGRQPPVFMSTFPQYLLSLAAMCNAHVSQMVWFRWGWWLA 249

Query: 243 SYYVYANELQA 253
           S +V+ NEL  
Sbjct: 250 SRFVFVNELHG 260

>ABL120W Chr2 (175065..175814) [750 bp, 249 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR281W (GPI12)
          Length = 249

 Score =  195 bits (495), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 111/251 (44%), Positives = 144/251 (57%), Gaps = 7/251 (2%)

Query: 2   GAFRTVFKVSGILWLVYILGSVQIERSNRRALGSLFRG-SAPTSINLVIAHPDDEVMFFA 60
           G+F  V K+  +L  VY     ++ER N +    L  G S  TS+ LVIAHPDDEVMFFA
Sbjct: 3   GSFFAVVKLYLLLLAVYCWSRRRLERHNTQVFERLVGGDSQHTSLTLVIAHPDDEVMFFA 62

Query: 61  PTLLQIDEWLPGSIEVNVISXXXXXXXXXXXXRTKELQDCVRLLLRKRKASVEVLDFLDG 120
           PTLLQ+D  LP  +   V+             R  ELQ  +RLL+ +   ++EV DF DG
Sbjct: 63  PTLLQLDARLPAWMPFRVVCLTDGGAEGLGQLRRAELQKALRLLVLEHDVTLEVADFTDG 122

Query: 121 MDVEWDLERAVKALQERILDESPLFLTFDENGISGHVNHISCYKAVQKVRKHYSKSSCFK 180
           M  +WDL      L E + D  PL LTFDE G+SGH NHI C  A  ++       + F 
Sbjct: 123 MKEDWDLAEVRTRLGELVTDAKPLVLTFDERGVSGHRNHIGCALAAARL----GHKTLF- 177

Query: 181 LVSKRYLFEKYSGFIPALFHSFISSSPSTL-INSFRQYLLALSSMMNAHVSQMVWFRYGW 239
           L S+R L  KYS F+  +F     + P T+ +++  QYL AL +M+ AH SQMVWFR+GW
Sbjct: 178 LRSERNLLRKYSFFVLDVFRVVFGTPPPTVFVSTLAQYLHALVAMVVAHRSQMVWFRWGW 237

Query: 240 WLFSYYVYANE 250
           W+ S YVYANE
Sbjct: 238 WMASRYVYANE 248

>KLLA0D01430g Chr4 complement(122369..123160) [792 bp, 263 aa] {ON}
           similar to uniprot|Q75DZ3 Ashbya gossypii ABL120W
           ABL120Wp and weakly similar to YMR281W uniprot|P23797
           Saccharomyces cerevisiae YMR281W GPI12 ER membrane
           protein involved in the second step of
           glycosylphosphatidylinositol (GPI) anchor assembly the
           de- N-acetylation of the N-
           acetylglucosaminylphosphatidylinositol intermediate
           functional homolog of human PIG-Lp
          Length = 263

 Score =  189 bits (481), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 102/218 (46%), Positives = 132/218 (60%), Gaps = 10/218 (4%)

Query: 40  SAPTSINLVIAHPDDEVMFFAPTLLQIDEWLPGSIEVNVISXXXXXXXXXXXXRTKELQD 99
           S  TS+ LV+AHPDDEVMFF+PTL Q +E LP SI +NV+             R +EL D
Sbjct: 46  SKLTSVTLVVAHPDDEVMFFSPTLTQFNELLPISIPINVVCMTAGDADGLGHIRKQELVD 105

Query: 100 CVRLLLRKRKASVEVLDFLDGMDVEWDLERAVKALQERILDESPLFLTFDENGISGHVNH 159
            +R++   R+   +VLDF DGMD  WD     K L+  I D +PL LTFD+ G+SGH+NH
Sbjct: 106 SLRIMFHGRQFGCDVLDFEDGMDAVWDQVLLEKQLRSSIPDSNPLVLTFDQFGVSGHINH 165

Query: 160 ISCYKAVQKVRKHYSKSSCFKLVSKRYLFEKYSGFIPALFHSFISS------SPSTLINS 213
           ISC + V+K+   YS      L S + ++ KYS FI  +F   IS+       P   I++
Sbjct: 166 ISCGRLVEKLP--YSHK--LHLRSDQPIYVKYSAFIAGIFQLGISTVYPDYGKPRCFIST 221

Query: 214 FRQYLLALSSMMNAHVSQMVWFRYGWWLFSYYVYANEL 251
             QYLLA S+M  AH SQMVWFR GWWLFS + + NEL
Sbjct: 222 LPQYLLAASAMSLAHTSQMVWFRVGWWLFSRFCFINEL 259

>Ecym_4617 Chr4 (1209745..1210494) [750 bp, 249 aa] {ON} similar to
           Ashbya gossypii ABL120W
          Length = 249

 Score =  183 bits (465), Expect = 6e-57,   Method: Compositional matrix adjust.
 Identities = 104/251 (41%), Positives = 137/251 (54%), Gaps = 7/251 (2%)

Query: 2   GAFRTVFKVSGILWLVYILGSVQIERSNRRALGSLFRGSAP-TSINLVIAHPDDEVMFFA 60
           G+F  V K+  +L  VY      +E  N +    L       TS+ L+IAHPDDEVMFFA
Sbjct: 3   GSFFAVIKLYLVLLAVYCGSYKHLETHNSKVYEYLVGSHGNYTSVTLIIAHPDDEVMFFA 62

Query: 61  PTLLQIDEWLPGSIEVNVISXXXXXXXXXXXXRTKELQDCVRLLLRKRKASVEVLDFLDG 120
           PTLLQ+D  +  S+   V+             R +EL   +RLL+ +R   +++  F DG
Sbjct: 63  PTLLQLDARMAQSVPFRVVCLTDGDADGLGEVRRRELHKALRLLVLERDVEIQMGGFKDG 122

Query: 121 MDVEWDLERAVKALQERILDESPLFLTFDENGISGHVNHISCYKAVQKVRKHYSKSSCFK 180
           MD EW +E   + L + + D  PL LTFDE G+SGH NHI+C  A  K+  H        
Sbjct: 123 MDEEWKMEVVREELAQVVTDRRPLVLTFDERGVSGHRNHIACAHAAAKLGHH-----TLH 177

Query: 181 LVSKRYLFEKYSGFIPALFH-SFISSSPSTLINSFRQYLLALSSMMNAHVSQMVWFRYGW 239
           L S   L  KYS F   LF   F    P+  +++F QYL +L +M+ AH SQMVWFR+GW
Sbjct: 178 LDSGHNLIRKYSFFFVDLFRLLFGYPMPTVFLSTFSQYLHSLVTMLVAHKSQMVWFRWGW 237

Query: 240 WLFSYYVYANE 250
           W  S YVYANE
Sbjct: 238 WTASRYVYANE 248

>NDAI0K00330 Chr11 (63765..64706) [942 bp, 313 aa] {ON} Anc_8.846
           YMR281W
          Length = 313

 Score =  182 bits (462), Expect = 9e-56,   Method: Compositional matrix adjust.
 Identities = 112/294 (38%), Positives = 161/294 (54%), Gaps = 52/294 (17%)

Query: 8   FKVSGILWLVYILGSVQIERSNRRA-----LGSLFRG-------SAP-TSINLVIAHPDD 54
           FK+  +LW+ Y++ + +I   N+++     L  + R        S P T ++LVIAHPDD
Sbjct: 13  FKLFLLLWMFYMISTQKISSYNKKSFDNSVLNQILRQDHSHADISEPITQLSLVIAHPDD 72

Query: 55  EVMFFAPTLLQIDEWLPGSIEVNVISXXXXXXXXXXXXRTKELQDCVRLLL---RKRKAS 111
           E+MFFAPTLLQ++ +LP SI  N+I             R KEL D + LLL     RK +
Sbjct: 73  ELMFFAPTLLQLNRFLPTSIPFNIICFSDGDAEGLGYLRRKELHDSINLLLSSSNNRKIN 132

Query: 112 VEVLDFLDGMDVEWDLERAVKALQERILDESP------LFLTFDENGISGHVNHISCYKA 165
           + +LDF+DGMD  WD ++ + +LQ  +L   P      + LTFD NGIS H NHI+C KA
Sbjct: 133 ISILDFIDGMDQVWDGKQLLSSLQNELLVNVPPSIKNNILLTFDANGISNHPNHIACNKA 192

Query: 166 VQKVRKH---------------YSKSSCFKLVSKRYLFEKYSGFIPALFHSF-------- 202
           V  +  +                SKS  + +V    L  KY+ F+  L   +        
Sbjct: 193 VHDLISYDGGKDKEMNIIGLMLSSKSDEYNIVMN--LLSKYTFFVIDLVKVYWNLATGTF 250

Query: 203 --ISSSPS---TLINSFRQYLLALSSMMNAHVSQMVWFRYGWWLFSYYVYANEL 251
             I +S S   + IN++ QY+L+ +SM+N H SQMVWFRYGWW FS +V++N+L
Sbjct: 251 NTIPNSASLELSFINTYSQYILSYASMLNTHKSQMVWFRYGWWWFSRFVFSNDL 304

>NCAS0C00380 Chr3 complement(55971..56801) [831 bp, 276 aa] {ON}
           Anc_8.846 YMR281W
          Length = 276

 Score =  173 bits (439), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 94/224 (41%), Positives = 133/224 (59%), Gaps = 17/224 (7%)

Query: 43  TSINLVIAHPDDEVMFFAPTLLQIDEWLPGSIEVNVISXXXXXXXXXXXXRTKELQDCVR 102
           T++NLVIAHPDDEVMFFAPTLLQ+D  +P SI +NVI             R  ELQ  + 
Sbjct: 53  TTLNLVIAHPDDEVMFFAPTLLQLDNLMPLSIPINVICFSNGDAQGLGEKRQHELQSSIH 112

Query: 103 LLLR-KRKASVEVLDFLDGMDVEWDLERAVKALQERILDESPLFLTFDENGISGHVNHIS 161
            L++ +R+ +V VL F DG D  WD+++  + L +   ++   FLTFD +G+SGH NHI+
Sbjct: 113 ALIQNQRQTNVTVLHFQDGNDQIWDIDQMTQYLPQ---NDHQAFLTFDSHGVSGHKNHIA 169

Query: 162 CYKAVQKVRKHYSKSSCFKLVSKRY-LFEKYSGFIPALFH------------SFISSSPS 208
           C+ AV  ++   +  +   L S  + L  KY+ FI  L               + S    
Sbjct: 170 CHNAVWNLKNTNNNVTILTLDSIHHSLLAKYTFFIIDLVKLYWNLWKDQQQPQWESHDKI 229

Query: 209 TLINSFRQYLLALSSMMNAHVSQMVWFRYGWWLFSYYVYANELQ 252
           T  N++ QY+LA S+M+NAH SQ+VWFRYGWW FS +V++N L+
Sbjct: 230 TFFNAYSQYILAYSTMLNAHKSQVVWFRYGWWAFSRFVFSNHLK 273

>TPHA0I00280 Chr9 (54103..55008) [906 bp, 301 aa] {ON} Anc_8.846
           YMR281W
          Length = 301

 Score =  171 bits (433), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 106/297 (35%), Positives = 153/297 (51%), Gaps = 45/297 (15%)

Query: 1   MGAFRTVFKVSGILWLVYILGSVQIERSNRRALGSLFR----GSAPTSINLVIAHPDDEV 56
           MG    +FK   IL ++YI  +  IE  N ++  S  +      +  S+NL+IAHPDDEV
Sbjct: 1   MGILFKLFKCYCILSILYIWLTPHIEDLNLKSFYSNVQLNISQQSLKSVNLIIAHPDDEV 60

Query: 57  MFFAPTLLQIDEWLPGSIEVNVISXXXXXXX---XXXXXRTKELQDCVRLLLRKRKASV- 112
           MFF PTLLQ+D+ LP  +  NVI                R+ E+ D + +LL  R+A + 
Sbjct: 61  MFFTPTLLQLDDILPTHVPFNVICLSKGVDVDGRAVGDLRSNEIMDSLTMLLGHRRAGLN 120

Query: 113 -EV----LDFLDGMDVEWDLERAVKALQERILDESPL------FLTFDENGISGHVNHIS 161
            EV     ++ DGMD +WD+ + V  +Q  I  ES +       LTFD  G+S H NHI+
Sbjct: 121 REVKLHQFEYEDGMDKQWDISKVVTDIQNTISMESNVDGLKHWLLTFDAQGVSEHPNHIA 180

Query: 162 CYKAVQKVRKHYSKSSCFKLVS----KRYLFEKYSGFIPALFHSFIS------------- 204
           CY A+  +++  S    + L++       +  KYS F+P +F   I+             
Sbjct: 181 CYDAMMTLKQKSSNPGDYLLMTLNSYGSNIILKYSSFLPVVFKLLINIINDKFRIFELKQ 240

Query: 205 ---------SSPSTLINSFRQYLLALSSMMNAHVSQMVWFRYGWWLFSYYVYANELQ 252
                          IN+F  Y++ALSSM+N+H SQMVWFRYGWW FS +V+ N+L 
Sbjct: 241 VPFLSMHKEHDQIQFINTFPHYIMALSSMLNSHTSQMVWFRYGWWSFSRFVFVNDLH 297

>Smik_13.494 Chr13 (815351..816265) [915 bp, 304 aa] {ON} YMR281W
           (REAL)
          Length = 304

 Score =  168 bits (426), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 99/285 (34%), Positives = 153/285 (53%), Gaps = 37/285 (12%)

Query: 7   VFKVSGILWLVYILGSVQIERSNRRALGSLFRGS-APTSINLVIAHPDDEVMFFAPTLLQ 65
           + K+S +L ++YI  + +I   N  +L  +F    +   INL+IAHPDDEVMFF+P + Q
Sbjct: 18  ITKLSIVLTILYIYFTPKIISRNNESLQHVFPNKYSDYQINLIIAHPDDEVMFFSPMISQ 77

Query: 66  IDEWLPGSIEVNVISXXXXXXXXXXXXRTKELQDCVRLLLRKRKA-SVEVLDFLDGMDVE 124
           +  + P ++  N+I             R +EL D   LLL   +A SV+V+DF DGM+  
Sbjct: 78  LHSYFPNTVPFNIICLSKGNAEGLGQTRVRELNDSAALLLHNERAVSVQVMDFQDGMNEV 137

Query: 125 WDLERAVKALQERI----LDESPLFLTFDENGISGHVNHISCYKAVQKVRKHYSKSSCFK 180
           WD++     L + I     + + + +TFD  G+SGH+NH SC+ AV+K+   Y++S+  K
Sbjct: 138 WDIDSITSTLSQTIGINNNELNQIIVTFDSYGVSGHINHKSCHTAVRKLIADYTRSNVRK 197

Query: 181 -----LVSKRYLFE-------KYSGFIPAL----------FHSFISSSPST--------- 209
                L++  YL         KY+ FI  +          F     + PS          
Sbjct: 198 EVKTPLITALYLRSYKNNIVLKYNSFIWEILRMLYGLISPFRKTTQALPSDVVAEKNSLL 257

Query: 210 LINSFRQYLLALSSMMNAHVSQMVWFRYGWWLFSYYVYANELQAF 254
           L+N+  QY+LA ++M+NAH SQ+VWFRYGWW+ S +V+ NE   +
Sbjct: 258 LMNTHAQYILAFAAMLNAHKSQVVWFRYGWWILSRFVFVNEFDVY 302

>KAFR0B03960 Chr2 (829312..830148) [837 bp, 278 aa] {ON} Anc_8.846
           YMR281W
          Length = 278

 Score =  167 bits (424), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 95/275 (34%), Positives = 152/275 (55%), Gaps = 36/275 (13%)

Query: 7   VFKVSGILWLVYILGSVQIERSNRRALGSLF------RGSAPTSINLVIAHPDDEVMFFA 60
           + K++ I W +YI+ S +I+ SN + L +        R + P S+ LV+AHPDDEVMFF+
Sbjct: 11  ITKLTLIFWCLYIVLSPKIQLSNDQILNTFIPSLIKDRSNDP-SLTLVVAHPDDEVMFFS 69

Query: 61  PTLLQIDEWLPGSIEVNVISXXXXXXXXXXXXRTKELQDCVRLLLRKRKASVEVLDFLDG 120
           PTLLQ+D  LP + + N+IS            R+ EL   + +L+ +R   + + +  DG
Sbjct: 70  PTLLQLDSHLPPNCKFNIISYSDGDAEGLGSLRSNELAHSIDMLIPRRNKEIFIFNHTDG 129

Query: 121 MDVEWDLERAVKALQERILD-ESPLFLTFDENGISGHVNHISCYKAVQKVRKHYSKSSCF 179
           M+  WD +  +  L+  + D ++ + LTFD+ G+S H+NH +C++ V    + ++K++ F
Sbjct: 130 MNEVWDNKLMLHQLESILSDSQTNILLTFDQFGVSNHINHKACHQVVTSYIQSHAKNN-F 188

Query: 180 KLVSKRY---LFEKYSGF-----------------IPALFHSFISSSPSTLINSFRQYLL 219
            L+   Y   L +KY+GF                 +P L H         L N +  Y+ 
Sbjct: 189 ALLLDSYSSNLLKKYTGFAWQLVFLAKNYWIHGKTLPNLDH-------LALFNPYSDYIT 241

Query: 220 ALSSMMNAHVSQMVWFRYGWWLFSYYVYANELQAF 254
           A ++M+ AH SQMVWFRYGWW FS +VY N+L+ +
Sbjct: 242 AYATMLKAHKSQMVWFRYGWWFFSRFVYVNDLKLY 276

>YMR281W Chr13 (832339..833253) [915 bp, 304 aa] {ON}  GPI12ER
           membrane protein involved in the second step of
           glycosylphosphatidylinositol (GPI) anchor assembly, the
           de-N-acetylation of the
           N-acetylglucosaminylphosphatidylinositol intermediate;
           functional homolog of human PIG-Lp
          Length = 304

 Score =  166 bits (421), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 96/285 (33%), Positives = 153/285 (53%), Gaps = 37/285 (12%)

Query: 7   VFKVSGILWLVYILGSVQIERSNRRALGSLF-RGSAPTSINLVIAHPDDEVMFFAPTLLQ 65
           + K++ +L ++YI  + +I   N  +L  +F        INLVIAHPDDEVMFF+P + Q
Sbjct: 18  ITKLAIVLTILYIYFTPKIVSRNNASLQHIFPHKYGDYEINLVIAHPDDEVMFFSPIISQ 77

Query: 66  IDEWLPGSIEVNVISXXXXXXXXXXXXRTKELQDCVRLLLRKRKA-SVEVLDFLDGMDVE 124
           ++ + P ++  N+I             R +EL +   LLL   +A SV+V+DF DGMD  
Sbjct: 78  LNSYFPRTVPFNIICLSKGNAEGLGETRVRELNESAALLLHNERAVSVQVMDFQDGMDEI 137

Query: 125 WDLERAVKALQERI----LDESPLFLTFDENGISGHVNHISCYKAVQKVRKHYSK----- 175
           WD++    +L ++I     + + + +TFD  G+S H+NH SCY AV+K+   Y++     
Sbjct: 138 WDIDSITSSLSQKIDIKNHNLNQIIVTFDSYGVSNHINHKSCYAAVKKLVDDYAQPKTKR 197

Query: 176 -------SSCFKLVSKRYLFEKYSGFIPAL----------FHSFISSSPS---------T 209
                  ++ +    K  +  KY+ FI  +          F   I + P          +
Sbjct: 198 NEQPPHVTALYLRSYKNNIVLKYNSFIWEILKILYDLISPFRRIIQALPPNTAAEKDKLS 257

Query: 210 LINSFRQYLLALSSMMNAHVSQMVWFRYGWWLFSYYVYANELQAF 254
           L+N+  QY+LA ++M+NAH SQ+VWFRYGWW+FS +V+ NE   +
Sbjct: 258 LMNTHAQYVLAFATMLNAHESQVVWFRYGWWIFSRFVFVNEFDVY 302

>Suva_13.470 Chr13 (815029..815940) [912 bp, 303 aa] {ON} YMR281W
           (REAL)
          Length = 303

 Score =  165 bits (418), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 102/286 (35%), Positives = 150/286 (52%), Gaps = 38/286 (13%)

Query: 7   VFKVSGILWLVYILGSVQIERSNRRALGSLFRGSAPTS-INLVIAHPDDEVMFFAPTLLQ 65
           + K++ +L ++YI  + +I   N  +L  +F      S INLVIAHPDDEVMFF+P + Q
Sbjct: 16  ITKLAIVLTVLYIYFTPKILSRNTDSLQHVFPHRDRNSQINLVIAHPDDEVMFFSPVISQ 75

Query: 66  IDEWLPGSIEVNVISXXXXXXXXXXXXRTKELQDCVRLLLR-KRKASVEVLDFLDGMDVE 124
           +  + P ++  N++             R KEL D   LLLR +R  SV+V+DF DGMD  
Sbjct: 76  LHAYFPDTVPFNILCLSKGDAEGLGETRAKELNDSAVLLLRNERPVSVQVMDFEDGMDEV 135

Query: 125 WDLERAVKALQERI----LDESPLFLTFDENGISGHVNHISCYKAVQKVRKHYSKSSCFK 180
           WD++     L + I       S + +TFD  G+S H+NH SC+ AV+K    Y  S   +
Sbjct: 136 WDIDSITSTLSQTIDVNNEKVSQIIVTFDSYGVSNHINHKSCHIAVEKFIDDYVGSKTKE 195

Query: 181 LVS------------KRYLFEKYSGFI---PALFHSFIS---------SSPST------- 209
                          K  +F KY+ FI     + +  +S         ++PST       
Sbjct: 196 KAENAHITALYLRSYKNNIFLKYNSFIWEILKMLYRTVSPFGRSIQPLAAPSTTTEKNGL 255

Query: 210 -LINSFRQYLLALSSMMNAHVSQMVWFRYGWWLFSYYVYANELQAF 254
            L+N+  QY+LA ++M+NAH SQ+VWFRYGWW+ S +V+ NE   F
Sbjct: 256 LLMNTHSQYILAFAAMLNAHKSQVVWFRYGWWILSRFVFVNEFDIF 301

>Kpol_1068.4 s1068 complement(6124..6999) [876 bp, 291 aa] {ON}
           complement(6124..6999) [876 nt, 292 aa]
          Length = 291

 Score =  164 bits (416), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 101/274 (36%), Positives = 142/274 (51%), Gaps = 28/274 (10%)

Query: 9   KVSGILWLVYILGSVQIERSNRRALGSLFRGSAPTSINLVIAHPDDEVMFFAPTLLQIDE 68
           K+  +LW  Y+  +  I   N R +      S  +S+NLVIAHPDDEVMFF+PTL+Q+D 
Sbjct: 12  KLYFLLWCGYVWFAGAIRGENARQVRGPGYFSGSSSVNLVIAHPDDEVMFFSPTLMQLDN 71

Query: 69  WLPGSIEVNVISXXXXXX---XXXXXXRTKELQDCVRLLL-RKRKASVEVLDFLDGMDVE 124
           WLP  + +NVI                R +EL+  V +L+   R  +V  LD+ DG D  
Sbjct: 72  WLPNDVAINVICFSKGVNVDGSIAGESRARELKKSVSMLIEHDRPVTVHQLDYKDGKDQI 131

Query: 125 WDLERAVKALQERI-----LDESPLFLTFDENGISGHVNHISCYKAVQKVRKHYSKSSCF 179
           WDL+  V  L+  I          L +TFDE+G+S H NHI+C+ AV ++ +       +
Sbjct: 132 WDLDSMVWDLKTLINPSKDYKRKDLLITFDEHGVSDHPNHIACHNAVHRLIEEEPLFMAY 191

Query: 180 KLVSKRY-LFEKYSGFIPALF-------HSFISSSPS-----------TLINSFRQYLLA 220
           +L S    +  KYS F   +        H  I    S            L N+  +Y++A
Sbjct: 192 QLESHSTNVILKYSFFAREIVKYFYNYCHQRIKGQTSLNKNMDVPYEYVLFNTHSEYIMA 251

Query: 221 LSSMMNAHVSQMVWFRYGWWLFSYYVYANELQAF 254
            ++M+NAH SQ+VWFRYGWW FS   YANEL+ F
Sbjct: 252 YATMLNAHESQVVWFRYGWWFFSRLTYANELKLF 285

>ZYRO0G14300g Chr7 (1145709..1146551) [843 bp, 280 aa] {ON} similar
           to uniprot|P23797 Saccharomyces cerevisiae YMR281W GPI12
           ER membrane protein involved in the second step of
           glycosylphosphatidylinositol (GPI) anchor assembly the
           de-N-acetylation of the N-
           acetylglucosaminylphosphatidylinositol intermediate
           functional homolog of human PIG-Lp
          Length = 280

 Score =  164 bits (414), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 97/272 (35%), Positives = 156/272 (57%), Gaps = 32/272 (11%)

Query: 9   KVSGILWLVYILGSVQIERSNRRALGSLFRGSAP-----TSINLVIAHPDDEVMFFAPTL 63
           KV  +LW+++I  SV+I+  N    GS+F  +        S++LV+AHPDDEVMFFAPT+
Sbjct: 9   KVYFLLWVLFIAFSVRIKSRN----GSVFNDNLKFLDEIDSLSLVVAHPDDEVMFFAPTI 64

Query: 64  LQIDEWLPGSIEVNVISXXXXXXXXXXXXRTKELQDCVRLLL--RKRKASVEVLDFLDGM 121
           L++D  LP ++E NV+             R +EL++ V LLL   KR+  ++  D+ DG 
Sbjct: 65  LELDSRLPPNVEFNVVCLSKGGADELGDTRVQELKESVNLLLANSKRQYQLQQHDYPDGH 124

Query: 122 DVEWDLERAVKALQERILD--ESPLFLTFDENGISGHVNHISCYKAVQKVRKHYS--KSS 177
           +  WD E     +++ +L    S + LTFD+ G+S HVNHI+C++AV  + +  S  K++
Sbjct: 125 EETWDQESVQSTIKDSVLQGRRSSVLLTFDDKGVSKHVNHIACHEAVSNLVQDESNVKAA 184

Query: 178 CFKLVSKRYLFEKYSGFIPALFH--------------SFISSSPS---TLINSFRQYLLA 220
            +       +  KYS F   ++               S+  + P+   TL++ +  Y+L+
Sbjct: 185 LYLDSYGDNIVLKYSAFFWEIWKLTRDWFLHRVLPTSSYNENKPATEITLMSDYSSYILS 244

Query: 221 LSSMMNAHVSQMVWFRYGWWLFSYYVYANELQ 252
            +SM+++H SQMVWFRYGWW FS +V+ N+L+
Sbjct: 245 FASMLHSHKSQMVWFRYGWWTFSRFVFVNDLK 276

>TDEL0B00520 Chr2 complement(94560..95366) [807 bp, 268 aa] {ON}
           Anc_8.846 YMR281W
          Length = 268

 Score =  163 bits (413), Expect = 7e-49,   Method: Compositional matrix adjust.
 Identities = 100/268 (37%), Positives = 145/268 (54%), Gaps = 24/268 (8%)

Query: 2   GAFRTVFKVSGILWLVYILGSVQIERSNR-------RALGSLFRGSAPTSINLVIAHPDD 54
           G    VFK+   L ++Y+  + +I   N         A+G+      P S+ L+IAHPDD
Sbjct: 5   GGAVKVFKLLFFLSILYVALTARINGRNEVQWQQHAAAIGT------PESLTLLIAHPDD 58

Query: 55  EVMFFAPTLLQIDEWLPGSIEVNVISXXXXXXXXXXXXRTKELQDCVRLLLR--KRKASV 112
           EVMFF+P+LLQ+D  LP S+  N +             R  ELQ  + LL    +RK  +
Sbjct: 59  EVMFFSPSLLQLDRLLPQSVRFNFVCLSKGDADHLGETRELELQRSLNLLTSNSQRKTQL 118

Query: 113 EVLDFLDGMDVEWDLERAVKALQERILDESP--LFLTFDENGISGHVNHISCYKAVQKVR 170
              D+ DG D +W++E  V  ++ ++   S   L LTFD +G+S H NH++C+ AV ++ 
Sbjct: 119 YQFDYPDGFDEKWEIESVVSIVESKVFIGSGFNLLLTFDAHGVSNHPNHVACHNAVARLI 178

Query: 171 KHYSKSSCFKLVSKRYLFEKYSGFIPALFHSFISS------SPSTLINSFRQYLLALSSM 224
           +   K+      S R L  KYSGFI  L      S      +  T +NSF QY+LA ++M
Sbjct: 179 EKGHKALYLNSHS-RNLPLKYSGFIWELIRMLSDSVMKLERTGLTFMNSFPQYILAFAAM 237

Query: 225 MNAHVSQMVWFRYGWWLFSYYVYANELQ 252
            NAH SQ+VWFRYGWW  S +V+ N+L+
Sbjct: 238 ANAHESQLVWFRYGWWSLSRFVFVNDLE 265

>KNAG0J00240 Chr10 complement(32153..33013) [861 bp, 286 aa] {ON}
           Anc_8.846 YMR281W
          Length = 286

 Score =  158 bits (399), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 98/273 (35%), Positives = 148/273 (54%), Gaps = 28/273 (10%)

Query: 7   VFKVSGILWLVYILGSV-QIERSNRRALGSLFRGSAPTSINLVIAHPDDEVMFFAPTLLQ 65
           V K+S +L ++YI  S  +I   N   L +L       S+NLVIAHPDDEVMFFAP+L+ 
Sbjct: 13  VTKLSLLLGILYIYASTSKIGSFNYTNLETLGEHDI-NSVNLVIAHPDDEVMFFAPSLIN 71

Query: 66  IDEWL--PGSIEVNVISXXXXXXXXXXXXRTKELQDCVRLLLRKRKASVEVLDFLDGMDV 123
           ++E +  P ++  N+I             R +EL D + +LL  R  S+ VLDF DGM  
Sbjct: 72  LNEQIRDPSTV-FNIICFSNGGADGLGNVREQELSDSIAMLLPTRNTSIVVLDFKDGMKE 130

Query: 124 EWDLERAVKALQERILD-ESPLFLTFDENGISGHVNHISCYKAVQKVRKHYSKSSCFKLV 182
           +WD++  +  L+  +      + LTFD  G+SGH+NHI+CY+A       +       ++
Sbjct: 131 KWDVKEMIAKLRNIVPKLGHNVLLTFDGKGVSGHLNHIACYRAALGYYNEFKSKQKLTVL 190

Query: 183 S----KRYLFEKYSGFIPALFHSFISS-SPS-----------------TLINSFRQYLLA 220
           S     + + +KYS +I  L     SS  PS                 T+ +++ QY+L+
Sbjct: 191 SLQSYSKNIVKKYSSYIWELIKLLYSSWVPSRLGNVLPKRGSNVARKITIFSTYPQYVLS 250

Query: 221 LSSMMNAHVSQMVWFRYGWWLFSYYVYANELQA 253
           L++M+NAH +Q+VWFRYGWW FS  V+ N+L  
Sbjct: 251 LAAMLNAHKTQVVWFRYGWWFFSRLVFVNDLDV 283

>Skud_13.453 Chr13 (805536..806438) [903 bp, 300 aa] {ON} YMR281W
           (REAL)
          Length = 300

 Score =  158 bits (399), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 100/283 (35%), Positives = 150/283 (53%), Gaps = 35/283 (12%)

Query: 7   VFKVSGILWLVYILGSVQIERSNRRALGSLF-RGSAPTSINLVIAHPDDEVMFFAPTLLQ 65
           + K++ +L ++YI  + +I   N   L  +F   +  + INLVIAHPDDEVMFF+P + Q
Sbjct: 16  ITKLAIVLTILYIFFTPKIISRNDELLQHVFPHKNRDSQINLVIAHPDDEVMFFSPVISQ 75

Query: 66  IDEWLPGSIEVNVISXXXXXXXXXXXXRTKELQDCVRLLLR-KRKASVEVLDFLDGMDVE 124
           +  + P ++  N+I             R KEL     LLL+ +R  SV+V+DF DGMD  
Sbjct: 76  LHSYFPITVPFNIICLSKGNADGLGESRVKELNGSAALLLQNERPVSVQVMDFEDGMDEV 135

Query: 125 WDLERAVKALQERI-LDESPL---FLTFDENGISGHVNHISCYKAVQKVRKHYSKS---- 176
           WD+   V  + + I L    L    +TFD  G+S H+NH SC+ AV+++   Y++S    
Sbjct: 136 WDINSIVSTISQTIDLSNEQLNQIIVTFDSYGVSDHINHKSCHTAVKRLIDRYAESKAET 195

Query: 177 -------SCFKLVS-KRYLFEKYSGFI---PALFHSFISSSPST--------------LI 211
                  +   L S K  +  KY+ FI     + +S I   P T              L+
Sbjct: 196 NEETPHITALYLKSYKNNIVLKYNSFIWEILKILYSVIVPFPKTIQPPTTTTQRSKLLLM 255

Query: 212 NSFRQYLLALSSMMNAHVSQMVWFRYGWWLFSYYVYANELQAF 254
           N+  QY+LA ++M+NAH SQ+VWFRYGWW+ S +V+ NE   +
Sbjct: 256 NTHAQYVLAYAAMLNAHKSQVVWFRYGWWILSRFVFVNEFDVY 298

>CAGL0M03047g Chr13 (346435..347349) [915 bp, 304 aa] {ON} weakly
           similar to uniprot|P23797 Saccharomyces cerevisiae
           YMR281w GPI12 N-acetylglucosaminyl phosphatidylinositol
           deacetylase
          Length = 304

 Score =  142 bits (359), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 100/283 (35%), Positives = 142/283 (50%), Gaps = 50/283 (17%)

Query: 9   KVSGILWLVYILGSVQIERSNRRALGSLFRGSAPTS-----INLVIAHPDDEVMFFAPTL 63
           K++ I  ++YI  + ++E  N+  L  L     PT      +NLVIAHPDDE+MFF+PT+
Sbjct: 27  KLTIIFQVLYIYFTPKVEDLNKENLTKLL----PTHDNFGVLNLVIAHPDDEIMFFSPTI 82

Query: 64  LQIDEWLPGSIEVNVISXXXXXXXXXXXXRTKELQDCVRLLLRKRK---ASVEVLDFLDG 120
           LQ+ + +    E+NV+             R KEL+D +  L   R     S+ +LD+ DG
Sbjct: 83  LQLIDHVQ---ELNVVCLSNGDADGLGELRAKELKDAIGYLTVNRNLRNVSLNILDYTDG 139

Query: 121 MDVEWDLERAVKALQERILDESP------LFLTFDENGISGHVNHISCYKAVQKVRKHYS 174
            +  W        L++ IL   P      + LTFD  GISGH NHI+C + V    K   
Sbjct: 140 QNEVW--SGVATDLKKYILTSEPGVKQKDIILTFDREGISGHRNHIACNEGVISYLKTI- 196

Query: 175 KSSCF-----KLVSKRYLFEKYSGFIPALFH-----------SFISSSPS---------- 208
           KS+ F     K +S   +  KYSG +P L             +F+S  P+          
Sbjct: 197 KSNSFVFLELKSLSTWQIISKYSGVVPKLLEIIYNKIRASNKTFVSYLPNRDSIATDSNV 256

Query: 209 TLINSFRQYLLALSSMMNAHVSQMVWFRYGWWLFSYYVYANEL 251
             I++F QY L+ ++M  AH SQMVWFRY WW FS YV+ N+L
Sbjct: 257 CFISTFDQYALSFAAMCYAHKSQMVWFRYLWWSFSRYVFVNDL 299

>TBLA0B03300 Chr2 (771332..772291) [960 bp, 319 aa] {ON} Anc_8.846
           YMR281W
          Length = 319

 Score =  142 bits (358), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 101/308 (32%), Positives = 145/308 (47%), Gaps = 62/308 (20%)

Query: 5   RTVFKVSGILWLVYILGSVQIERSNRRALG------SLFRGSAPTSIN---LVIAHPDDE 55
           RTV K+  I WL+YI  S  I+  N ++         L        IN   L+IAHPDDE
Sbjct: 9   RTV-KLILIFWLIYIFNSNSIKLLNDQSFNYFNKHIQLMSNKQHVKINSLSLIIAHPDDE 67

Query: 56  VMFFAPTLLQIDEWLPGSIEVNVISXXXXXXXXXXX---XRTKELQDCVRLLLRK----- 107
           +MFF+PTLLQ++ +L   I  NV+                R  EL D + LL  +     
Sbjct: 68  IMFFSPTLLQLNNYLEKDIMFNVVCLSQGLDSTGSFKDPQRVHELNDSLNLLFNRGSNNE 127

Query: 108 --RKASVEVLDFLDGMDVEWDLERAVKALQERI--LDES-PLFLTFDENGISGHVNHISC 162
             R   +  LD+ DGM   W+++  V  L + +   D    L LTFD++G+S H NH++C
Sbjct: 128 HNRNFKLIQLDYTDGMKEIWNMDLIVDDLLQNLNFTDNGINLLLTFDKSGVSNHKNHLAC 187

Query: 163 YKAVQKVRKHYSKSS----CFKLVSKRYLFEKYSGFIP--------------ALFHSFIS 204
            +AV K+ K+ +  S     F     +  F KYS F+               +LF+SF  
Sbjct: 188 NEAVTKLLKYSNPDSNLIGIFLNSHSKNFFLKYSFFVSKLFTIIKLKFFRSISLFYSFCF 247

Query: 205 SSPS---------------------TLINSFRQYLLALSSMMNAHVSQMVWFRYGWWLFS 243
            +                       T  N F +Y+L+ S+M+NAH SQMVWFRY WW+FS
Sbjct: 248 PNSDFLQSYQIISHYDLNTKTNLSFTFFNPFAKYMLSYSTMLNAHESQMVWFRYLWWIFS 307

Query: 244 YYVYANEL 251
            + + N+L
Sbjct: 308 RFAFINDL 315

>YPL009C Chr16 complement(535820..538936) [3117 bp, 1038 aa] {ON}
           TAE2Protein of unknown function, involved in protein
           translation; may interact with ribosomes, based on
           co-purification experiments; green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm
          Length = 1038

 Score = 31.2 bits (69), Expect = 3.3,   Method: Composition-based stats.
 Identities = 22/72 (30%), Positives = 36/72 (50%), Gaps = 6/72 (8%)

Query: 164 KAVQKVRKHYSKS-SCFKLVSKRYLFEKYSGFIPAL-FHSFISSSPSTLINSFRQYL--- 218
           K  Q+++K    S S  K +   Y FEKYS FI +  F   +  SP+     + +Y+   
Sbjct: 549 KIDQQLKKKLKDSHSVLKKIRTPYFFEKYSWFISSEGFLVMMGKSPAETDQIYSKYIEDD 608

Query: 219 -LALSSMMNAHV 229
            + +S+  N+HV
Sbjct: 609 DIYMSNSFNSHV 620

>KAFR0A03100 Chr1 complement(634622..635575) [954 bp, 317 aa] {ON}
           Anc_7.528 YLR455W
          Length = 317

 Score = 30.0 bits (66), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 26/90 (28%), Positives = 42/90 (46%), Gaps = 11/90 (12%)

Query: 104 LLRKRKASVEVLDFLDGMDVEWDLERAVKALQERILDESPLFLTFDENGISGHVNHISCY 163
           +LRKRK     + F +     W+    +K+L ++I+      + F E   S   + I  Y
Sbjct: 35  VLRKRKPDCVAVCFFNDPTYYWEQPHRLKSLDDKII------VQFLEAKSSNQTDLIEAY 88

Query: 164 KAVQKVRKHYSKSSCFKLVSKRYLFEKYSG 193
           K      K+Y K+   KL+ KR++ EK  G
Sbjct: 89  KQA----KNY-KNDLKKLIVKRFVEEKRKG 113

>YOL107W Chr15 (112102..113130) [1029 bp, 342 aa] {ON} Putative
           protein of unknown function; green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm and
           colocalizes in a punctate pattern with the early
           golgi/COPI vesicles; YOL107W is not an essential protein
          Length = 342

 Score = 30.0 bits (66), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 23/41 (56%)

Query: 206 SPSTLINSFRQYLLALSSMMNAHVSQMVWFRYGWWLFSYYV 246
           +P  L  +FR  LL +  M    V+Q++WF +   LFS +V
Sbjct: 182 TPQFLAKNFRFKLLPIFVMFTMTVTQIIWFHHFAQLFSIWV 222

>Smik_16.227 Chr16 complement(413782..415968) [2187 bp, 728 aa] {ON}
           YPL009C (REAL)
          Length = 728

 Score = 29.6 bits (65), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 22/88 (25%), Positives = 37/88 (42%), Gaps = 1/88 (1%)

Query: 150 ENGISGHVNHISCYKAVQKVRKHYSKSSCFKLVSKRYLFEKYSGFIPAL-FHSFISSSPS 208
           E  ++  + +I      Q  RK     S  K +   Y FEKYS FI +  F   +  SP+
Sbjct: 533 EKNVNKAMKNIEIKTDQQLKRKLKDSHSVLKKIRTPYFFEKYSWFISSEGFLVMMGKSPA 592

Query: 209 TLINSFRQYLLALSSMMNAHVSQMVWFR 236
                + +Y+      M+ + +  VW +
Sbjct: 593 ETDQIYSKYIEDDDIYMSNNFNTHVWIK 620

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.325    0.138    0.420 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 24,363,804
Number of extensions: 929131
Number of successful extensions: 3212
Number of sequences better than 10.0: 31
Number of HSP's gapped: 3222
Number of HSP's successfully gapped: 31
Length of query: 254
Length of database: 53,481,399
Length adjustment: 107
Effective length of query: 147
Effective length of database: 41,212,137
Effective search space: 6058184139
Effective search space used: 6058184139
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 64 (29.3 bits)