Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_27.102248.847ON54654628660.0
KLTH0C03718g8.847ON55155214870.0
SAKL0D01298g8.847ON5515639751e-125
TDEL0B005108.847ON5505567602e-93
ZYRO0G14322g8.847ON5505517072e-85
TPHA0I002908.847ON5694815537e-63
Kpol_1068.38.847ON5664885502e-62
Ecym_46188.847ON5274015202e-58
Skud_13.4548.847ON5804424662e-50
Smik_13.4958.847ON5764584582e-49
Suva_13.4718.847ON5814104266e-45
YMR282C (AEP2)8.847ON5804104152e-43
CAGL0M03069g8.847ON5484543571e-35
KAFR0B039708.847ON4744293504e-35
KLLA0D01408g8.847ON5184693499e-35
NCAS0C003708.847ON4954353101e-29
TBLA0B033108.847ON6134493076e-29
NDAI0K003408.847ON6244322996e-28
KNAG0J002308.847ON4744122922e-27
ABL119C8.847ON5373952072e-16
Smik_6.24na 1ON544128820.25
Kwal_27.108657.386ON64647780.75
KLLA0A02959g2.518ON55960742.0
NCAS0B080801.216ON410855742.2
KLTH0G10274g2.282ON55951723.4
Kpol_526.49singletonON47758689.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_27.10224
         (546 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_27.10224 s27 (248037..249677) [1641 bp, 546 aa] {ON} YMR282...  1108   0.0  
KLTH0C03718g Chr3 (321675..323330) [1656 bp, 551 aa] {ON} weakly...   577   0.0  
SAKL0D01298g Chr4 (98188..99843) [1656 bp, 551 aa] {ON} weakly s...   380   e-125
TDEL0B00510 Chr2 (92878..94530) [1653 bp, 550 aa] {ON} Anc_8.847...   297   2e-93
ZYRO0G14322g Chr7 complement(1146574..1148226) [1653 bp, 550 aa]...   276   2e-85
TPHA0I00290 Chr9 complement(55148..56857) [1710 bp, 569 aa] {ON}...   217   7e-63
Kpol_1068.3 s1068 (4295..5995) [1701 bp, 566 aa] {ON} (4295..599...   216   2e-62
Ecym_4618 Chr4 complement(1210600..1212183) [1584 bp, 527 aa] {O...   204   2e-58
Skud_13.454 Chr13 complement(806601..808343) [1743 bp, 580 aa] {...   184   2e-50
Smik_13.495 Chr13 complement(816375..818105) [1731 bp, 576 aa] {...   181   2e-49
Suva_13.471 Chr13 complement(816054..817799) [1746 bp, 581 aa] {...   168   6e-45
YMR282C Chr13 complement(833356..835098) [1743 bp, 580 aa] {ON} ...   164   2e-43
CAGL0M03069g Chr13 complement(347584..349230) [1647 bp, 548 aa] ...   142   1e-35
KAFR0B03970 Chr2 complement(830202..831626) [1425 bp, 474 aa] {O...   139   4e-35
KLLA0D01408g Chr4 (120712..122268) [1557 bp, 518 aa] {ON} weakly...   139   9e-35
NCAS0C00370 Chr3 (54433..55920) [1488 bp, 495 aa] {ON} Anc_8.847...   124   1e-29
TBLA0B03310 Chr2 complement(772555..774396) [1842 bp, 613 aa] {O...   122   6e-29
NDAI0K00340 Chr11 complement(64928..66802) [1875 bp, 624 aa] {ON...   119   6e-28
KNAG0J00230 Chr10 (30660..32084) [1425 bp, 474 aa] {ON} Anc_8.84...   117   2e-27
ABL119C Chr2 complement(175840..177453) [1614 bp, 537 aa] {ON} S...    84   2e-16
Smik_6.24 Chr6 (39520..41154) [1635 bp, 544 aa] {ON} YMR279C (REAL)    36   0.25 
Kwal_27.10865 s27 complement(532303..534243) [1941 bp, 646 aa] {...    35   0.75 
KLLA0A02959g Chr1 (260627..262306) [1680 bp, 559 aa] {ON} simila...    33   2.0  
NCAS0B08080 Chr2 complement(1532527..1544853) [12327 bp, 4108 aa...    33   2.2  
KLTH0G10274g Chr7 complement(868108..869787) [1680 bp, 559 aa] {...    32   3.4  
Kpol_526.49 s526 (113065..114498) [1434 bp, 477 aa] {ON} (113065...    31   9.3  

>Kwal_27.10224 s27 (248037..249677) [1641 bp, 546 aa] {ON} YMR282C
           (AEP2) - basic, hydrophilic 67.5 kDa protein [contig 39]
           FULL
          Length = 546

 Score = 1108 bits (2866), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 533/546 (97%), Positives = 533/546 (97%)

Query: 1   MLPKRHTAVRLAFKSFSSTLSVNYSARDESYNYRVIEQAHSQGRGNAIDLKRTMADAFQD 60
           MLPKRHTAVRLAFKSFSSTLSVNYSARDESYNYRVIEQAHSQGRGNAIDLKRTMADAFQD
Sbjct: 1   MLPKRHTAVRLAFKSFSSTLSVNYSARDESYNYRVIEQAHSQGRGNAIDLKRTMADAFQD 60

Query: 61  KTKGLICATNIHQAESPSSDTTQGMNRLRSLLNTKDYIKFMIELTIQSKLNSNFSHKIFE 120
           KTKGLICATNIHQAESPSSDTTQGMNRLRSLLNTKDYIKFMIELTIQSKLNSNFSHKIFE
Sbjct: 61  KTKGLICATNIHQAESPSSDTTQGMNRLRSLLNTKDYIKFMIELTIQSKLNSNFSHKIFE 120

Query: 121 DNLLTPNEFSTLLNGLLTERNLSTKLETVLPSVQSTEMIFGLYQTYLMTIPAGSLNPLQL 180
           DNLLTPNEFSTLLNGLLTERNLSTKLETVLPSVQSTEMIFGLYQTYLMTIPAGSLNPLQL
Sbjct: 121 DNLLTPNEFSTLLNGLLTERNLSTKLETVLPSVQSTEMIFGLYQTYLMTIPAGSLNPLQL 180

Query: 181 HDLNSFVQYFIETAQLGKAQIVLDRILASNNDQLPCDTTTGIHYLQLRCGALPRNWKVFD 240
           HDLNSFVQYFIETAQLGKAQIVLDRILASNNDQLPCDTTTGIHYLQLRCGALPRNWKVFD
Sbjct: 181 HDLNSFVQYFIETAQLGKAQIVLDRILASNNDQLPCDTTTGIHYLQLRCGALPRNWKVFD 240

Query: 241 SRVGHSCRLGSHRNKSQPVSHTYKALDQSSVLEFVNVLNDENSEWFHKKSPTLEAAVIYS 300
           SRVGHSCRLGSHRNKSQPVSHTYKALDQSSVLEFVNVLNDENSEWFHKKSPTLEAAVIYS
Sbjct: 241 SRVGHSCRLGSHRNKSQPVSHTYKALDQSSVLEFVNVLNDENSEWFHKKSPTLEAAVIYS 300

Query: 301 LGFMGQLTLLKEHIAVRWGITELGASLATEVNEVPPSPEVLIAIFTSFASHQEVTLGLRL 360
           LGFMGQLTLLKEHIAVRWGITELGASLATEVNEVPPSPEVLIAIFTSFASHQEVTLGLRL
Sbjct: 301 LGFMGQLTLLKEHIAVRWGITELGASLATEVNEVPPSPEVLIAIFTSFASHQEVTLGLRL 360

Query: 361 MDAFITKYSEINLDIVFWRRLFQWTNLVWDVKTDPRGDLSRGCWRVMTEWHEKGSKKLQP 420
           MDAFITKYSEINLDIVFWRRLFQWTNLVWDVKTDPRGDLSRGCWRVMTEWHEKGSKKLQP
Sbjct: 361 MDAFITKYSEINLDIVFWRRLFQWTNLVWDVKTDPRGDLSRGCWRVMTEWHEKGSKKLQP 420

Query: 421 DTTLLNERYFVLAQTNNYKEALTVISQSFPQLYEKPTLSSKEMAIVQKYSKLVLKSMAEL 480
           DTTLLNERYFVLAQTNNYKEALTVISQSFPQLYEKPTLSSKEMAIVQKYSKLVLKSMAEL
Sbjct: 421 DTTLLNERYFVLAQTNNYKEALTVISQSFPQLYEKPTLSSKEMAIVQKYSKLVLKSMAEL 480

Query: 481 GYYHKPLTFITEWSPNKAVEDSLRVYFKKHRDGFTXXXXXXXXXXXXXQNTYDDEEEDNM 540
           GYYHKPLTFITEWSPNKAVEDSLRVYFKKHRDGFT             QNTYDDEEEDNM
Sbjct: 481 GYYHKPLTFITEWSPNKAVEDSLRVYFKKHRDGFTKRKERLREESRRKQNTYDDEEEDNM 540

Query: 541 LLGRLW 546
           LLGRLW
Sbjct: 541 LLGRLW 546

>KLTH0C03718g Chr3 (321675..323330) [1656 bp, 551 aa] {ON} weakly
           similar to uniprot|P22136 Saccharomyces cerevisiae
           YMR282C AEP2 Mitochondrial protein likely involved in
           translation of the mitochondrial OLI1 mRNA exhibits
           genetic interaction with the OLI1 mRNA 5'- untranslated
           leader
          Length = 551

 Score =  577 bits (1487), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 274/552 (49%), Positives = 378/552 (68%), Gaps = 7/552 (1%)

Query: 1   MLPKRHTAVRLAFKSFSSTLSVNYSARDESYNYRVIEQAHSQGRGNAIDLKRTMADAFQD 60
           ML ++  ++ L  K+F+STLSV YSA D +    + + + +     A    +T+ DA ++
Sbjct: 1   MLSRKCGSLSLTLKNFNSTLSVAYSASDAALKIPIADPSENAASKYANKPAKTLNDAVRE 60

Query: 61  KTKGLICAT------NIHQAESPSSDTTQGMNRLRSLLNTKDYIKFMIELTIQSKLNSNF 114
           +++             +H+ E  SS  +   N+LRS L+++DY+ F++ELT+QS+++ NF
Sbjct: 61  RSERFRSRVYTAKIPKLHE-EQVSSGFSSPCNKLRSFLHSRDYMAFLVELTLQSRMDENF 119

Query: 115 SHKIFEDNLLTPNEFSTLLNGLLTERNLSTKLETVLPSVQSTEMIFGLYQTYLMTIPAGS 174
             K+F++N L+  EFS  + GLL+  NL  KL   LP+V  TEM+F LYQ YL T+  G 
Sbjct: 120 GAKMFQNNDLSIAEFSAFIEGLLSVNNLLHKLSATLPNVSGTEMVFSLYQLYLKTVTPGP 179

Query: 175 LNPLQLHDLNSFVQYFIETAQLGKAQIVLDRILASNNDQLPCDTTTGIHYLQLRCGALPR 234
           L+PLQLHD N F+++FI +AQL KAQ VLD IL SNN+QLPCD+ T  HYLQLRCGALPR
Sbjct: 180 LSPLQLHDFNKFIRFFIRSAQLRKAQTVLDCILKSNNNQLPCDSATATHYLQLRCGALPR 239

Query: 235 NWKVFDSRVGHSCRLGSHRNKSQPVSHTYKALDQSSVLEFVNVLNDENSEWFHKKSPTLE 294
           NWKV D  +G S RLG+ +N+ Q VSH+YKALD  SVL F+++L+D  S WFH+KS  LE
Sbjct: 240 NWKVLDENLGRSTRLGARKNRYQLVSHSYKALDHKSVLTFMSLLSDPKSVWFHRKSAALE 299

Query: 295 AAVIYSLGFMGQLTLLKEHIAVRWGITELGASLATEVNEVPPSPEVLIAIFTSFASHQEV 354
           +AV+YSLGFMGQL LL+EH+   WGI+    +  T+ +   PS EVL+A+ TS+AS++ +
Sbjct: 300 SAVVYSLGFMGQLKLLEEHVWRNWGISLQEHNQVTDASFTSPSSEVLVAVLTSYASNKNI 359

Query: 355 TLGLRLMDAFITKYSEINLDIVFWRRLFQWTNLVWDVKTDPRGDLSRGCWRVMTEWHEKG 414
           +  L L+D F+ KY  + LD VFWRRLFQW+  VW  KTDPRG+LSRGCWRVM EWH   
Sbjct: 360 SSALHLIDGFMAKYPTLELDHVFWRRLFQWSTRVWSEKTDPRGELSRGCWRVMREWHAAR 419

Query: 415 SKKLQPDTTLLNERYFVLAQTNNYKEALTVISQSFPQLYEKPTLSSKEMAIVQKYSKLVL 474
           +++L  D  LLNER+ VL++TNNY++A+ V+ Q +   ++K  LS  E  + QK++KL+L
Sbjct: 420 NRQLPADAVLLNERFVVLSRTNNYRDAIEVVEQCYSSFFQKANLSRHEAVLFQKFAKLIL 479

Query: 475 KSMAELGYYHKPLTFITEWSPNKAVEDSLRVYFKKHRDGFTXXXXXXXXXXXXXQNTYDD 534
           K+MA LGYYHKPL FI EWSPNK +E +LR YF+KHR+ ++             Q  +DD
Sbjct: 480 KNMAHLGYYHKPLKFIKEWSPNKLLEHTLRAYFEKHRNAYSARKQRRTEAAQKAQKRFDD 539

Query: 535 EEEDNMLLGRLW 546
           EEED+MLLGRLW
Sbjct: 540 EEEDSMLLGRLW 551

>SAKL0D01298g Chr4 (98188..99843) [1656 bp, 551 aa] {ON} weakly
           similar to uniprot|P22136 Saccharomyces cerevisiae
           YMR282C AEP2 Mitochondrial protein likely involved in
           translation of the mitochondrial OLI1 mRNA exhibits
           genetic interaction with the OLI1 mRNA 5'- untranslated
           leader
          Length = 551

 Score =  380 bits (975), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 212/563 (37%), Positives = 327/563 (58%), Gaps = 29/563 (5%)

Query: 1   MLPKRHTAVRLAFKSFSSTLSVNYSARDESYNYRVIEQAHSQGRGNAIDLKRTMADAFQD 60
           ML K+H   +L  K  SSTL  + S    S        +  Q  G   D   T      +
Sbjct: 1   MLSKKHCTHQLLLKGCSSTLLTSISHISTS-------ASPQQAIGTLADTTATKTTLPTE 53

Query: 61  KT----------KGLICATNIHQAESPSSDTTQGM--NRLRSLLNTKDYIKFMIELTIQS 108
           KT          K    +  +H+  + +      +  N LR  L   ++ KF++EL ++ 
Sbjct: 54  KTPRSLKIKLLLKEEKYSKQLHKWGTTAEQIKPSLPRNNLRQHLQDNEHAKFLVELLLEC 113

Query: 109 KLNSNFSHKIFEDNLLTPNEFSTLLNGLLTERNLSTKLETVLPSVQSTEMIFGLYQTYLM 168
           K +  F++++F + L+T  E+S  +N LL+  NL ++L  ++P    TE++F LY+ Y  
Sbjct: 114 KSDEGFANRMFSEKLITKLEYSVFVNKLLSNTNLKSELTNLIPGTVHTEVLFKLYEIYRD 173

Query: 169 TIPA-GSLNPLQLHDLNSFVQYFIETAQLGKAQIVLDRILASNNDQLPCDTTTGIHYLQL 227
           ++    +L P+QL+DLN F++ F   AQL KAQ VL  +L  N   +P D  T I+YL+L
Sbjct: 174 SVVGNATLTPVQLYDLNQFIKRFTGDAQLAKAQQVLGFVL-ENYGSIPRDPQTLINYLEL 232

Query: 228 RCGALPRNWKVFDSRVGHSCRLGSHRNKSQPVSHTYKALDQSSVLEFVNVLNDENSEWFH 287
           +CGA+PRNW +  SR      LGS    S  ++H+YK L+  ++L  ++ +  + + W +
Sbjct: 233 KCGAMPRNWSIPLSRPELGKTLGSQSFMSN-LAHSYKVLETEALLPLIDEMMKDRA-WHY 290

Query: 288 KKSPTLEAAVIYSLGFMGQLTLLKEHIAVRWGITELGASLATEVNEVP----PSPEVLIA 343
           K++  LEAAVIYSLG+MGQ  LL+ +I   WG++ + ++ +TEV EVP    P+  +LI+
Sbjct: 291 KRNCDLEAAVIYSLGYMGQFALLERYIKHTWGVS-VSSNTSTEV-EVPKNLYPTSNLLIS 348

Query: 344 IFTSFASHQEVTLGLRLMDAFITKYSEINLDIVFWRRLFQWTNLVWDVKTDPRGDLSRGC 403
           I + +A    +   L+++D+F++K+ +I L+ +FWRRLFQW+  +W+ KTDP+G+LS GC
Sbjct: 349 IVSCYAMKGNLHQALQIIDSFLSKFPQIELEPLFWRRLFQWSTRLWNQKTDPKGELSNGC 408

Query: 404 WRVMTEWHEKGSKKLQPDTTLLNERYFVLAQTNNYKEALTVISQSFPQLYEKPTLSSKEM 463
           W+VM +WH K  + L  D  +LNERY+VL +TNN+ EAL +  ++   LY K  L   E+
Sbjct: 409 WQVMKQWHNKQKRSLPIDLGILNERYYVLKRTNNFTEALRIHDEALAGLYMKRNLIDPEV 468

Query: 464 AIVQKYSKLVLKSMAELGYYHKPLTFITEWSPNKAVEDSLRVYFKKHRDGFTXXXXXXXX 523
            +++K+ KL+LK MA  GYYHKPL +I+EW  NK  E  +R YF +HR  +         
Sbjct: 469 DVIKKFQKLILKKMAGRGYYHKPLKYISEWCLNKRNELEMREYFDRHRKAYITRIEQRKQ 528

Query: 524 XXXXXQNTYDDEEEDNMLLGRLW 546
                Q T+D EEED+MLLGRLW
Sbjct: 529 KQETAQVTFDAEEEDDMLLGRLW 551

>TDEL0B00510 Chr2 (92878..94530) [1653 bp, 550 aa] {ON} Anc_8.847
           YMR282C
          Length = 550

 Score =  297 bits (760), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 193/556 (34%), Positives = 305/556 (54%), Gaps = 21/556 (3%)

Query: 4   KRHTAVRLAFKSFSSTLSVNYSARDESYNYRVI--EQAHSQG-RGNAIDLKRTMADAFQD 60
           +R+ +++  FK+F+STLSV+Y+A   S     +  E+ H+Q    ++I+  R++++  +D
Sbjct: 3   RRNHSIQQVFKAFNSTLSVDYAAAQASIVGAPVKHEERHTQTLTSSSINACRSISNV-RD 61

Query: 61  KTKGLICATNIHQAE-SPSSDTTQGMNRLRSLLNTKDYIKFMIELTIQSKLNSNFSHKIF 119
             +GL     +   E   S+  T   N+LR  L  K+Y+ F+I + +Q+ LN N+   +F
Sbjct: 62  TLRGLESLYALPGVEYGRSTRDTVSTNQLREYLRRKEYVDFLIHVMVQNHLNRNYIKSLF 121

Query: 120 EDNLLTPNEFSTLLNGLLTERNLSTKLETVLPSVQSTEMIFGLYQ---TYLMTIPAGSLN 176
           E   L+ +EFST +N LL E++L  KL  ++P    TE+IF LYQ   TY++      L 
Sbjct: 122 ETKELSTSEFSTFINRLLLEKDLDLKLSNIIPDTVHTEIIFNLYQIYCTYVIKDSQNGLT 181

Query: 177 PLQLHDLNSFVQYFIETAQLGKAQIVLDRILAS---NNDQLPCDTTTGIHYLQLRCGALP 233
           PLQ+HD+N F++ FI+ AQL KAQ  L  ++     +N     D  T   +LQLRCGAL 
Sbjct: 182 PLQVHDINRFIKRFIDEAQLKKAQECLQFLIDKQGLHNILQSGDVETITQFLQLRCGALQ 241

Query: 234 RNWKVFDSRVGHSCRLGSHRNKSQPVSHTYKALDQSSVLEFVNVLNDENSEWFHKKSPTL 293
           + W+V DS   +S ++    +K      +Y  L +   LE VN L  + S W  + SP +
Sbjct: 242 KFWRV-DS---NSTKVLGEDSKHFKSPKSYNLLKEQPFLEIVNFLLKDKS-WRLRSSPII 296

Query: 294 EAAVIYSLGFMGQLTLLKEHIAVRWGITELGASLATEVNEVPPSPEVLIAIFTSFA-SHQ 352
           ++A++YSL  +GQ  L+ ++I ++WGI+E G       NE  P  EVLI I +++   + 
Sbjct: 297 DSAIVYSLSNLGQTKLIDQYIQLKWGISEDGHVAVK--NEAVPGHEVLINIVSAYCLKNG 354

Query: 353 EVTLGLRLMDAFITKYSEINLDIVFWRRLFQWTNLVWDVKTDPRGDLSRGCWRVMTEWHE 412
           +   GLR++D F+ KY +  L+ +FWRRL Q +   WD + D +  +  GCW +M +WHE
Sbjct: 355 DTGKGLRILDQFMKKYPQTELEKLFWRRLLQLSFHNWDKQKDKKALVCHGCWNIMKQWHE 414

Query: 413 KGSKKLQPDTTLLNERYFVLAQTNNYKEALTVISQSFPQLYEKP--TLSSKEMAIVQKYS 470
           +    +  D+  L   Y +   T N + A  V+   F  +Y K    +S  EM ++  + 
Sbjct: 415 QKGVSITYDSGTLRLLYQLFKFTRNGRGAAEVVRTCFSSVYAKQPYQISKDEMDLLLMFQ 474

Query: 471 KLVLKSMAELGYYHKPLTFITEWSPNKAVEDSLRVYFKKHRDGFTXXXXXXXXXXXXXQN 530
           KL LK+MA  G Y++PL  I EW+ +K  +  L  YF +HR  +              Q 
Sbjct: 475 KLALKTMALKGRYNEPLQLIKEWNVDKINQHYLLDYFMRHRRKYDLTRDKARAKQQQQQA 534

Query: 531 TYDDEEEDNMLLGRLW 546
            YD+ EE++MLLGRLW
Sbjct: 535 QYDNMEEEDMLLGRLW 550

>ZYRO0G14322g Chr7 complement(1146574..1148226) [1653 bp, 550 aa]
           {ON} weakly similar to uniprot|P22136 Saccharomyces
           cerevisiae YMR282C AEP2 Mitochondrial protein likely
           involved in translation of the mitochondrial OLI1 mRNA
           exhibits genetic interaction with the OLI1 mRNA 5'-
           untranslated leader
          Length = 550

 Score =  276 bits (707), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 186/551 (33%), Positives = 294/551 (53%), Gaps = 27/551 (4%)

Query: 12  AFKSFSSTLSVNYSARDESYNYRVIE-QAHSQGRGNAIDLK-----RTMADAFQDKTKGL 65
            FK+FSS+L + ++    + +       A S G  +   LK     RT+ D   +  +  
Sbjct: 11  VFKAFSSSLMLEHALAAANSSGAAAPTNAASTGNSHDSTLKSELPLRTLNDELHNAERKY 70

Query: 66  ICATNIHQAESPSSDTTQGMNRLRSLLNTKDYIKFMIELTIQSKLNSNFSHKIFEDNLLT 125
           I    +  A   SS  T   +++R  L    Y K +I L++ + LN+ +   +F    LT
Sbjct: 71  I--KPLTNAPEWSSTRTGPNSKIREYLKNGQYTKLLIRLSVDNHLNNEYISGLFTTGGLT 128

Query: 126 PNEFSTLLNGLLTERNLSTKLETVLPSVQSTEMIFGLYQTYL-MTIPAGSLNPLQLHDLN 184
            +E+S  +N LL+E  L  KL  V+P    TE+I+ LY+ Y    +   +L PLQL+DLN
Sbjct: 129 KSEYSLFINKLLSEEELDVKLSNVIPDTPHTELIYKLYEFYCDHIVDQHNLTPLQLYDLN 188

Query: 185 SFVQYFIETAQLGKAQIVLDRILASN--NDQLP-CDTTTGIHYLQLRCGALPRNWKV--F 239
            F++ FI  AQL KA  VLD IL     ND L   D    I +L+L+CGAL + WK+   
Sbjct: 189 LFLKTFIAEAQLSKAHNVLDFILLRRPLNDLLANTDVEILIQFLRLKCGALSKFWKIQPA 248

Query: 240 DSRVGHSCRLGSHRNKSQPVSHTYKALDQSSVLEFVN-VLNDENSEWFHKKSPTLEAAVI 298
             R   +  LG   +    ++ +YK  ++  +L+ +N VL + N  W +++SP L+AA+I
Sbjct: 249 SQRNSTAITLGEKASDCH-LAKSYKFQNEKVLLQIINSVLGEHN--WKNRRSPKLDAAII 305

Query: 299 YSLGFMGQLTLLKEHIAVRWGITELGASLATEVNEVPPSPEVLIAIFTSFASHQ-EVTLG 357
           YSLG++GQ  L+++++   W  ++       E  +  P+ ++L+A+ TS+   +  +  G
Sbjct: 306 YSLGYLGQTDLIEKYVNRTWSPSK------DEGVKTNPNSDLLVAVLTSYCVKEGNMRKG 359

Query: 358 LRLMDAFITKYSEINLDIVFWRRLFQWTNLVWDVKTDPRGDLSRGCWRVMTEWHEKGSKK 417
           L ++D FI  Y E+ LD +FWRRL Q ++L+WD K D +  LS GCW +M +WH +  +K
Sbjct: 360 LEVLDRFIRDYPEVELDPLFWRRLLQLSSLLWDKKRDRKATLSHGCWTIMKQWHAQRQRK 419

Query: 418 LQPDTTLLNERYFVLAQTNNYKEALTVISQSFPQLYEKP--TLSSKEMAIVQKYSKLVLK 475
           +  D  ++ E Y +  +T N   AL VI++SF   + +P  T+   E++++ KY + +LK
Sbjct: 420 IPYDYGIMKELYPIFVRTKNKNGALEVITKSFFGAFIQPEFTIRPNELSLLCKYQRFILK 479

Query: 476 SMAELGYYHKPLTFITEWSPNKAVEDSLRVYFKKHRDGFTXXXXXXXXXXXXXQNTYDDE 535
            +A  G YHK   F  EWS +   +  L+ YF K R                 Q  YD+ 
Sbjct: 480 MIALKGNYHKGFEFCQEWSFSSTNKFELQSYFMKWRGIHEQRRTSQSKQKAALQEKYDEM 539

Query: 536 EEDNMLLGRLW 546
           EED+MLLGRLW
Sbjct: 540 EEDDMLLGRLW 550

>TPHA0I00290 Chr9 complement(55148..56857) [1710 bp, 569 aa] {ON}
           Anc_8.847 YMR282C
          Length = 569

 Score =  217 bits (553), Expect = 7e-63,   Method: Compositional matrix adjust.
 Identities = 149/481 (30%), Positives = 241/481 (50%), Gaps = 33/481 (6%)

Query: 95  KDYIKFMIELTIQSKLNSN-FSHKIFEDNLLTPNEFSTLLNGLLTERNL--STKLETVLP 151
           K  +K ++E  +Q   NS  F  ++ E   LT NEFS  LN L+  +     + +    P
Sbjct: 93  KSNLKTILEQLLQHNDNSYMFLRELLESKQLTFNEFSIFLNRLIDRKGFIYDSIVLKEFP 152

Query: 152 SVQSTEMIFGLYQTYLMTIPAGSLNPLQLHDLNSFVQYFIETAQLGKAQIVLDRILASNN 211
           + + +EM+F L+Q Y   I +  L+ L L D+N F+++FI    LG+A+IVL  +L    
Sbjct: 153 NGKHSEMVFKLFQLYGNAIGSDKLSLLSLRDMNLFIEFFINEGHLGRAEIVLTFVLNKTR 212

Query: 212 DQLPC-DTTTGIHYLQLRCGALPRNWKV------------FDSRVG-HSCRLGSHRNKSQ 257
             L   D  T  HYLQLRCGALPR W              F +R+  +  RLG  +N + 
Sbjct: 213 SILDLYDVDTVTHYLQLRCGALPRYWMFQNKSAELAYKDKFGNRLSKYKTRLG-RKNFAV 271

Query: 258 PVSHTYKALDQSSVLEFVN-VLNDENSEWFHKKSPTLEAAVIYSLGFMGQLTLLKEHIAV 316
            +++ YK LD   VL+  N ++ D+  +W    S  L+A V+YSL + GQL+ +  +I  
Sbjct: 272 KLTNRYKILDPLGVLKIANKIITDD--KWKSNHSAKLDATVVYSLCYSGQLSNIPSYINS 329

Query: 317 RW--------GITELGASLATEVNEVPPSPEVLIAIFTSFA-SHQEVTLGLRLMDAFITK 367
           RW        G +++G  ++ E ++  PS EV+ AI +S++   + +   + ++D  +  
Sbjct: 330 RWNVDISMSDGNSDVGTQISNEASKPLPS-EVMEAILSSYSYDDKSIERAINIIDKIMNS 388

Query: 368 YSEINLDIVFWRRLFQWTNLVWDVKTDPRGDLSRGCWRVMTEWHEKGSKKLQPDTTLLNE 427
           Y  + L+  FWRRL QW+ L WD K D +G L  GC++ + ++HE  S ++  D  LL E
Sbjct: 389 YPNLELNQQFWRRLMQWSVLCWDHKLDRKGSLVYGCFKTLKKYHEMRSIRINFDEGLLQE 448

Query: 428 RYFVLAQTNNYKEALTVISQSFPQLYEKPT--LSSKEMAIVQKYSKLVLKSMAELGYYHK 485
            Y ++  T N + A  V+S+  PQ + K +  ++  E  ++  + K  +  M     Y  
Sbjct: 449 LYTLVYYTKNSRIAAEVVSEFMPQFFYKRSDEITFGERKLLFYFQKRSIDGMLGKKDYFT 508

Query: 486 PLTFITEWSPNKAVEDSLRVYFKKHRDGFTXXXXXXXXXXXXXQNTYDDEEEDNMLLGRL 545
              FI +WS +   ++ L  Y+K                    +   D  +ED+ LLGRL
Sbjct: 509 ASNFIEKWSMDNQNKEELFKYYKDSIAKKLQKVRRNSLQQKIKEKLEDHSDEDDTLLGRL 568

Query: 546 W 546
           W
Sbjct: 569 W 569

>Kpol_1068.3 s1068 (4295..5995) [1701 bp, 566 aa] {ON} (4295..5995)
           [1701 nt, 567 aa]
          Length = 566

 Score =  216 bits (550), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 152/488 (31%), Positives = 238/488 (48%), Gaps = 30/488 (6%)

Query: 86  NRLRSLLNTKDYIKFMIELTIQSKLNSNFSHKIFEDNLLTPNEFSTLLNGLLTERNLSTK 145
           N  R+ L   +  KF + L    + + +F   +F+   LT NE S  +N +        K
Sbjct: 82  NIWRNYLKNNEIDKFTLHLLASLRGDDDFVKNLFKSGDLTYNELSIFINRIYKSNGHDIK 141

Query: 146 LETVLP---SVQSTEMIFGLYQTYLMTIPAGS----LNPLQLHDLNSFVQYFIETAQLGK 198
              V+    S+  TE+I+ +++ Y  TIP  S    LN L L DLN F+  FI+ AQL K
Sbjct: 142 --RVIQNHHSLSYTELIYEIFELYTSTIPKESGIIKLNALHLKDLNLFITIFIKEAQLSK 199

Query: 199 AQIVLDRIL-ASNNDQLPCDTTTGIHYLQLRCGALPRNWKV------FDSRVGHSCRLGS 251
           AQ VL  I+ A  + +   D  T +++L+LRCG LP+ W V         +   + RL S
Sbjct: 200 AQNVLQYIIDAEGSIEKITDHDTMVNFLRLRCGGLPKFWLVPQASYAVTKQTKKNSRLSS 259

Query: 252 HRNKSQPVSHTYKALDQSSVLEFVNVLNDENSEWFHKKSPTLEAAVIYSLGFMGQLTLLK 311
           +   ++  S     +  + + E +N++ ++   W  K S  L++ ++YSL    Q  ++ 
Sbjct: 260 NSPNTRFPSSYKSTVPNTVLFEVINMILNKKV-WKSKHSGILDSTIVYSLAHTFQKQMMD 318

Query: 312 EHIAVRWGITELGASLATEVNE----VPPSPEVLIAIFTSFA-SHQEVTLGLRLMDAFIT 366
             I   WGI+  G  L   + +      PS E+LIAI +S+    + +   ++++D FI 
Sbjct: 319 GFIKEHWGISSHGDPLDLFIKKKKVASAPSNEILIAIMSSYIYKDRNIDGAMKILDKFIR 378

Query: 367 KYSEINLDIVFWRRLFQWTNLVWDVKTDPRGDLSRGCWRVMTEWHEKGSKK---LQPDTT 423
            Y +I+LD +FWRRL QW N +WD K D +G    GCW +M  W+  G+ K   L  D  
Sbjct: 379 MYPDISLDNMFWRRLIQWCNRLWDPKIDRQGTFGYGCWNMMKNWNGAGTGKDVVLPYDFQ 438

Query: 424 LLNERYFVLAQTNNYKEALTVISQSF-PQLYEKPTLSSK-EMAIVQKYSKLVLKSMAELG 481
           +  E Y +  +TNN K A  ++S    P L EK     K E+ ++ KY  L +  + E  
Sbjct: 439 IYEEFYRLFKRTNNGKIAAEIVSNVLIPHLSEKNVAVKKAELNLLNKYQTLAMNWLIERR 498

Query: 482 YYHKPLTFITEWSPNKAVEDSLRVYFKKHRDGFTXXXX---XXXXXXXXXQNTYDDEEED 538
            + K   FI EWS ++     LR  FKK +                    Q+ YD+ EE+
Sbjct: 499 QFKKAAFFIEEWSIDRNNRIQLREAFKKRKQLMLRKLSTRDKKSQSQKKRQDRYDEMEEE 558

Query: 539 NMLLGRLW 546
           +M++GRLW
Sbjct: 559 DMIIGRLW 566

>Ecym_4618 Chr4 complement(1210600..1212183) [1584 bp, 527 aa] {ON}
           similar to Ashbya gossypii ABL119C
          Length = 527

 Score =  204 bits (520), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 122/401 (30%), Positives = 202/401 (50%), Gaps = 12/401 (2%)

Query: 124 LTPNEFSTLLNGLLTERNLSTKLETVLPSVQSTEMIFGLYQTYLMTI---PAGSLNPLQL 180
           ++  EFS   N LL     S  L+  +P      +   LYQ Y+  +         P++L
Sbjct: 97  MSSEEFSIFFNRLLPTSGSSFSLKEAIPENMVVPLANKLYQFYMAILEREKKTRFTPMEL 156

Query: 181 HDLNSFVQYFIETAQLGKAQIVLDRIL-ASNNDQLPCDTTTGIHYLQLRCGALPRNWKVF 239
           HDLN F  +F+   +L  A+ VL +IL  + ++QLP D  T + Y QL  G+L   W   
Sbjct: 157 HDLNKFSNWFLNENKLKLARKVLQQILRQTGSEQLPRDHQTLVTYFQLYLGSLASLWPT- 215

Query: 240 DSRVGHSCRLGSHRNKSQPVSHTYKALDQSSVLEFVNVLNDENSEWFHKKSPTLEAAVIY 299
             +V  +C     R   +P    Y +L +  + + +  L  EN +W H +S  L+A ++Y
Sbjct: 216 -PKVQSACYDKLVRGSRRPKYVVYNSLPEGIMYDVLQKLL-ENDDWKHLRSSELDAKILY 273

Query: 300 SLGFMGQLTLLKEHIAVRWGITELGASLATEV-----NEVPPSPEVLIAIFTSFASHQEV 354
           SL    ++ L +  +   WGI +    +  EV     +   P  EVLIAI TSF+   ++
Sbjct: 274 SLCHYNRMDLFEGFMERAWGIVDHPKKVEKEVPVDISSGTYPGSEVLIAIVTSFSYRNDL 333

Query: 355 TLGLRLMDAFITKYSEINLDIVFWRRLFQWTNLVWDVKTDPRGDLSRGCWRVMTEWHEKG 414
              +RL+DAF+ KY +++L   FW +LF WT +++D K DP G L + CW  M  W++  
Sbjct: 334 EKAVRLVDAFLNKYPQMDLRTEFWEKLFLWTRVMFDRKLDPLGSLQKACWLRMLSWYKSR 393

Query: 415 SKKLQPDTTLLNERYFVLAQTNNYKEALTVISQSFPQLYEKPTLSSKEMAIVQKYSKLVL 474
            + +   + L + RY +L QT+NYK+A+ +       +Y K   +   + +V+KY K V+
Sbjct: 394 GESVPYSSYLASCRYEILKQTSNYKDAMAMFPDYMSAVYAKSAAAKHNLTVVRKYQKFVI 453

Query: 475 KSMAELGYYHKPLTFITEWSPNKAVEDSLRVYFKKHRDGFT 515
           + ++  G       FI +W  N+  E  L+  F++H + +T
Sbjct: 454 RELSARGKRDACTQFIEQWRFNEENEKELQDTFQRHWNKYT 494

>Skud_13.454 Chr13 complement(806601..808343) [1743 bp, 580 aa] {ON}
           YMR282C (REAL)
          Length = 580

 Score =  184 bits (466), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 138/442 (31%), Positives = 214/442 (48%), Gaps = 71/442 (16%)

Query: 152 SVQSTEMIFGLYQTYL---------MTIPAGSLNPLQLHDLNSFVQYFIETAQLGKAQIV 202
           +V+ +E  F L+  Y          + +   +L+  ++ DLN  ++ FIE  QL KAQ +
Sbjct: 163 NVKYSEFWFKLFSLYAEKVDTRRDQVNLRNTALDSCEIFDLNLLIKNFIELGQLSKAQKI 222

Query: 203 LDRILASNNDQL----PCDTTTGIHYLQLRCGALPRNWKVFDS------RVGHSCRLGSH 252
           L  IL  N D L      D  T +H+LQLRCGAL   WK+ D+      ++    RLG+ 
Sbjct: 223 LSFILDRNPDILLSPRNADIGTIVHFLQLRCGALTAYWKIPDNSGRKQNQLRRMVRLGA- 281

Query: 253 RNKSQPVSHTYKALDQSSVLEFVN-VLNDE---NSEWFHKKSPTLEAAVIYSLGFMGQLT 308
           +N S  +S TYKA+D  ++L+  + VL D+   NSE        L + +I S G +GQ  
Sbjct: 282 KNTSIRLSSTYKAMDHQTLLKIADLVLQDKRFLNSE-------DLLSTLIQSFGHLGQTQ 334

Query: 309 LLKEHIAVRWGIT--ELGASLATEVNEVPPSPEVLIAIFTSF-ASHQEVTLGLRLMDAFI 365
           +L+  I   W I+  E  + +A +     PS ++LI+I  SF  + +++  GL ++D+FI
Sbjct: 335 ILERCIEHIWQISSQEFPSHVAIKPRGCYPSSKILISILVSFHLNDKDLHRGLSILDSFI 394

Query: 366 TKYSEINLDIVFWRRLFQWTNLVWDVKTDPRGDLSRGCWRVMTEWHEKGSKKLQP--DTT 423
             Y E+ LD +FWRRL Q ++  W    D R      CW +M  W+E  SK+L P  D  
Sbjct: 395 KHYPEVKLDALFWRRLLQLSHFAWTPVNDKRAASIVKCWHLMKHWYE--SKELSPSVDYE 452

Query: 424 LLNERYFVLAQTNNYKEALTVISQSFPQLYEKPTLSSKEM--AIVQKYSKLVLKSMAELG 481
            L + Y V+ +T N+   + V+ +SF    EK   ++ E   AI+ KY K ++K +   G
Sbjct: 453 TLRQLYEVMKKTGNFSLGIDVL-KSFKSGIEKMRTANPEKLEAILIKYQKCIIKQLVNRG 511

Query: 482 YYHKPLTFITEWSPNKAVEDSLRVYF-----------------KKHRDGFTXXXXXXXXX 524
                  FI ++  N+     L ++                  KK RDG           
Sbjct: 512 KISAARKFIGDFGFNRRAAKDLNIFCSNRIFSRSKKIKNDIENKKKRDGLA--------- 562

Query: 525 XXXXQNTYDDEEEDNMLLGRLW 546
                  YDD+E+D M++G LW
Sbjct: 563 ----PGNYDDDEDDGMIIGSLW 580

>Smik_13.495 Chr13 complement(816375..818105) [1731 bp, 576 aa] {ON}
           YMR282C (REAL)
          Length = 576

 Score =  181 bits (458), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 134/458 (29%), Positives = 221/458 (48%), Gaps = 44/458 (9%)

Query: 122 NLLTPNEFSTLLNGLLTERNLSTKLETVLPSVQSTEMIFGLYQTYLMTIPAG-------- 173
           N L+  E S LLN L + R    +       V+ +E  F ++  Y   + A         
Sbjct: 130 NSLSLAELSFLLNKLYSLR-FQIRGICRDIKVKYSEFWFKIFSLYAEKVDAKRNHINLRN 188

Query: 174 -SLNPLQLHDLNSFVQYFIETAQLGKAQIVLDRILASNNDQL----PCDTTTGIHYLQLR 228
            +L+  ++ D+N  ++ FIE  QLGKAQ +L  I+  N D L      D  T +H+L+LR
Sbjct: 189 TTLDACEIFDINLLIRNFIELGQLGKAQKILTFIIDRNPDILLSPNNADIGTMVHFLKLR 248

Query: 229 CGALPRNWKVFDS------RVGHSCRLGSHRNKSQPVSHTYKALDQSSVLEFVNVLNDEN 282
           CGAL   WK+ D+      ++    RLG+ +N S  +S TYK +D  ++L+  +++    
Sbjct: 249 CGALAAYWKIPDNSGQDQKQLRKIVRLGA-KNTSIRLSSTYKVMDHQTLLKIADLV---- 303

Query: 283 SEWFHKK----SPTLEAAVIYSLGFMGQLTLLKEHIAVRWGIT--ELGASLATEVNEVPP 336
               H+K    S  L + +I S G +GQ  +L+  I   W IT  E  + +A +     P
Sbjct: 304 ---LHEKRFLNSEDLLSTLIQSFGHLGQTQILERCIEHIWHITTQEFPSHVAIKPRGCYP 360

Query: 337 SPEVLIAIFTSFA-SHQEVTLGLRLMDAFITKYSEINLDIVFWRRLFQWTNLVWDVKTDP 395
           S ++LI+I  SF  +  ++  GL ++D+FI  Y E+ LD +FWRRLFQ +N  W    D 
Sbjct: 361 SSKILISILVSFHYNDNDLHRGLSILDSFIKHYPEVKLDALFWRRLFQLSNFAWTPAKDK 420

Query: 396 RGDLSRGCWRVMTEWHEKGSKKLQPDTTLLNERYFVLAQTNNYKEALTVISQSFPQLYE- 454
           +      CW +M +WH      L  D   L + Y ++ +T N+   + V+ +SF    E 
Sbjct: 421 KATSVIRCWHLMKQWHVSKGLSLSVDYETLRQLYDIMKKTGNFPLGIDVL-KSFKSGIER 479

Query: 455 -KPTLSSKEMAIVQKYSKLVLKSMAELGYYHKPLTFITEWSPNKAVEDSLRVYFKKHRDG 513
            + T S K   ++ KY K ++K + + G       FI ++  ++ +  +L + F  +R  
Sbjct: 480 LRETNSDKLNIVLIKYQKYIIKQLVDRGRISAVREFINDFGFDRTITKNLNI-FCTNRLL 538

Query: 514 FTXXXXXXXXXXXXXQNT-----YDDEEEDNMLLGRLW 546
                          +N      +DD+E+D M++G LW
Sbjct: 539 LRSKKNKSKIENKKERNKLEPSGFDDDEDDGMIIGSLW 576

>Suva_13.471 Chr13 complement(816054..817799) [1746 bp, 581 aa] {ON}
           YMR282C (REAL)
          Length = 581

 Score =  168 bits (426), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 127/410 (30%), Positives = 204/410 (49%), Gaps = 36/410 (8%)

Query: 124 LTPNEFSTLLNGLLTERNLSTKLETVLPSVQSTEMIFGLYQTYL---------MTIPAGS 174
           L+  + S LLN L ++R    K+   + +V+ +E  F L+  Y          + +   +
Sbjct: 137 LSLEDLSFLLNNLYSQRFEIKKICKDI-NVRYSEFWFKLFSLYAEKVDVKRNQINLRNTA 195

Query: 175 LNPLQLHDLNSFVQYFIETAQLGKAQIVLDRILASNNDQL----PCDTTTGIHYLQLRCG 230
           L+  ++ D+N  ++ FIE  QLGKAQ VL  IL  N+D L      D  T IH+LQLRCG
Sbjct: 196 LDSSEIFDMNLIIKNFIELGQLGKAQKVLSFILDRNSDILLSPKNADIGTIIHFLQLRCG 255

Query: 231 ALPRNWKVFD-SRVGHS---CRLGSHRNKSQPVSHTYKALDQSSVLEFVN-VLNDE---N 282
           AL   WK+ D S   +S    RLG+ +N S  ++ +YKA+D  ++L+  + VL  E   N
Sbjct: 256 ALAAYWKMPDNSEQKYSRKMVRLGA-KNTSIRITSSYKAMDHQTLLKIADLVLQKERLLN 314

Query: 283 SEWFHKKSPTLEAAVIYSLGFMGQLTLLKEHIAVRWGIT----ELGASLATEVNEVPPSP 338
           SE        L + +I S G +GQ  +L+  I   W I+       A++  +     PS 
Sbjct: 315 SE-------DLLSTLIQSFGHLGQTQILERCIEHIWQISLQEFPSHATIKPKTRGCCPSS 367

Query: 339 EVLIAIFTSF-ASHQEVTLGLRLMDAFITKYSEINLDIVFWRRLFQWTNLVWDVKTDPRG 397
           ++LI+I  SF  +  ++  GL ++D+FI  Y E+ +D +FWRRLFQ ++  W    D R 
Sbjct: 368 KILISILVSFHLNDNDLHRGLSILDSFIKHYPEVKVDELFWRRLFQLSHFAWTPTHDKRA 427

Query: 398 DLSRGCWRVMTEWHEKGSKKLQPDTTLLNERYFVLAQTNNYKEALTVISQSFPQLYEKPT 457
                CW +M +WHE     L  D   L + Y +  +T NY   + V+    P +     
Sbjct: 428 TSIVRCWHLMKQWHESKGFSLSVDYETLRQLYDLTKKTGNYSLGIDVLQNFKPGITRTSA 487

Query: 458 LSSKEM-AIVQKYSKLVLKSMAELGYYHKPLTFITEWSPNKAVEDSLRVY 506
           + ++++  IV K+ K ++K +   G       FI ++S +      L V+
Sbjct: 488 MKTEKINGIVIKHQKYIIKQLVNRGKTSAAREFINDFSFDIGAVKELNVF 537

>YMR282C Chr13 complement(833356..835098) [1743 bp, 580 aa] {ON}
           AEP2Mitochondrial protein, likely involved in
           translation of the mitochondrial OLI1 mRNA; exhibits
           genetic interaction with the OLI1 mRNA 5'-untranslated
           leader
          Length = 580

 Score =  164 bits (415), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 117/410 (28%), Positives = 203/410 (49%), Gaps = 32/410 (7%)

Query: 122 NLLTPNEFSTLLNGLLTERNLSTKLETVLPSVQSTEMIFGLYQTYLMTIPAG-------- 173
           ++L+  + S LL+ L T+R    ++   + + + +E  F L+  Y   + A         
Sbjct: 134 DVLSLEDLSFLLSKLYTQRFQIRRICRDI-NAKYSEFWFKLFSLYAEKVDAKRNQVNLRN 192

Query: 174 -SLNPLQLHDLNSFVQYFIETAQLGKAQIVLDRILASNNDQL----PCDTTTGIHYLQLR 228
             L+  ++ D N  ++ FIE  QLGKAQ +L  IL  N D L      D +T +H+LQLR
Sbjct: 193 TKLDACEIFDANLMIKNFIELGQLGKAQKILSFILDRNPDILLSPKNADISTIVHFLQLR 252

Query: 229 CGALPRNWKVFDSR------VGHSCRLGSHRNKSQPVSHTYKALDQSSVLEFVNVLNDEN 282
           CGAL   WK+ D+       +    RLG+ +N S  +S TYKA+D  ++L+  ++   E 
Sbjct: 253 CGALAPYWKIPDNSEQKQGFLRKMVRLGA-KNTSIRLSSTYKAMDHQTLLKIADLALQEK 311

Query: 283 SEWFHKKSPTLEAAVIYSLGFMGQLTLLKEHIAVRWGIT--ELGASLATEVNEVPPSPEV 340
                  S  L + +I S G +GQ  +L+  I   W I+  E  + +  +     PS ++
Sbjct: 312 KLL---NSEDLLSTLIQSFGHLGQTQILERCIEHIWQISPQEFPSHVVIKHRGCYPSSKI 368

Query: 341 LIAIFTSFA-SHQEVTLGLRLMDAFITKYSEINLDIVFWRRLFQWTNLVWDVKTDPRGDL 399
           L++I  SF  +  ++  GL ++D+FI  Y ++ LD +FWRRLFQ ++  W    D +   
Sbjct: 369 LVSILVSFYFNDHDLHRGLSILDSFIKHYPDVKLDALFWRRLFQLSHFAWTPANDKKATS 428

Query: 400 SRGCWRVMTEWHEKGSKKLQP--DTTLLNERYFVLAQTNNYKEALTVISQSFPQLYE-KP 456
              CW +M +W+   SK+L+P  D   L + Y ++ +T N+   + V+    P +   + 
Sbjct: 429 VVRCWHLMKQWY--ASKRLRPSVDYETLRQLYDIMKKTGNFPLGIDVLRSFKPGIERTRA 486

Query: 457 TLSSKEMAIVQKYSKLVLKSMAELGYYHKPLTFITEWSPNKAVEDSLRVY 506
             + K   I+ KY K ++K +   G +     FI  +  ++ +   L ++
Sbjct: 487 ENAGKVNNIIIKYQKCIIKELVNRGRFSAVREFIDSYGFDRKMTKDLNIF 536

>CAGL0M03069g Chr13 complement(347584..349230) [1647 bp, 548 aa]
           {ON} weakly similar to uniprot|P22136 Saccharomyces
           cerevisiae YMR282c AEP2 required for the expression of
           subunit-9 of atp synthase
          Length = 548

 Score =  142 bits (357), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 124/454 (27%), Positives = 205/454 (45%), Gaps = 38/454 (8%)

Query: 117 KIFEDNLLTPNEFSTLLNGLLTERNLSTKLETVLPSVQSTEMIFGLYQTYLMTIPAGSLN 176
           ++ +D+ ++  EFS+++  +L   NL  K      S      +  +Y +   T   GS++
Sbjct: 109 QLLQDSNVSIQEFSSMIQPVLNRTNLVGKYHMGYLS-----KLMQIYISLTRTHNGGSVD 163

Query: 177 PLQLHDLNSFVQYFIETAQLGKAQIVLDRILASNNDQLP------CDTTTGIHYLQLRCG 230
            L   D+N F++ FIE +QL +AQ  L  +L    ++         D  T  H+L LR G
Sbjct: 164 ALNKDDMNKFIKRFIEGSQLKRAQTALQFLLDGYKERGEDLLGPYGDKQTIAHFLMLRSG 223

Query: 231 ALPRNWKVFDSRVGHSCRL------GSHRNKSQPVSHTYKALDQSSVLEFVNVLNDENSE 284
           AL   WK+ D   G++ +       GSHRN    V  TY  LD   + E V  +   N +
Sbjct: 224 ALQDLWKI-DVSNGNNKKQAFYKINGSHRN----VKSTYNVLDSVKLFEIVRYILRYNDK 278

Query: 285 WFHKKSPTLEAA----VIYSLGFMGQLTLLKEHIAVRWGITELGASLATEVNEVPPSPEV 340
             H +    +      VI  LG++GQ TL+++ I   W   EL +        +  + ++
Sbjct: 279 DNHSQPVYFDEGILKNVILCLGYVGQTTLIEDIINKIW---ELDSVSVPPKYNITVTSDL 335

Query: 341 LIAIFTSFA-SHQEVTLGLRLMDAFITKYSEINLDIVFWRRLFQWTNLVWDVKTDPRGDL 399
           L AI ++++   + +  GL + D F  K   I +   FW  L +W N++   K     DL
Sbjct: 336 LTAIVSAYSKCGKSIQPGLVIADKFFGKIPNIIVKDDFWINLQKW-NIILPNKWRSTIDL 394

Query: 400 SRGCWRVMTEWHEKGSKK--LQPDTTLLNERYFVLA----QTNNYKEALTVISQSFPQLY 453
           S+  W +M  W    +    +  +   LN  Y VL+    +  + +    +   S   LY
Sbjct: 395 SKRTWELMKSWRNSTNNGGFITANVEFLNLVYKVLSSDYIKLKDLEWIYDIFQHSLVTLY 454

Query: 454 EKPTLSSKEMAIVQKYSKLVLKSMAELGYYHKPLTFITEWSPNKAVEDSLRVYFKKHRDG 513
            K +L+  E+ +++K+    +K M   G+Y K L FI EWS + A +  L   F   R+ 
Sbjct: 455 SKNSLTVDEIKLLKKFQIFTIKKMVYFGHYSKCLQFIKEWSYDAANKQQLTNLFVVLRNR 514

Query: 514 FTXXX-XXXXXXXXXXQNTYDDEEEDNMLLGRLW 546
           +               Q  YD+EE+++MLLG LW
Sbjct: 515 YLQKRGYNQEKEMTKVQKKYDEEEQEDMLLGGLW 548

>KAFR0B03970 Chr2 complement(830202..831626) [1425 bp, 474 aa] {ON}
           Anc_8.847 YMR282C
          Length = 474

 Score =  139 bits (350), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 108/429 (25%), Positives = 192/429 (44%), Gaps = 52/429 (12%)

Query: 127 NEFSTLLNGLLTERNLSTKLETVLPSVQSTEMIFGLYQTYLMTIPAGS-LNPLQLHDLNS 185
           N F+ L+N  L+E+    +++   P     E+IF L++TY+  I +   L  LQ+ D+N 
Sbjct: 89  NRFARLINIALSEKYNIQRIKERRP-----EIIFQLFETYVKLISSHEELTILQVEDMNK 143

Query: 186 FVQYFIETAQLGKAQIVLDR-ILASNNDQLPCDTTTGIHYLQLRCGALPR----NWKVFD 240
           F+ YF+E  QL KAQ+V+   IL S       D +T  +YL+L CGA       N+K+FD
Sbjct: 144 FINYFVEFKQLKKAQLVMKYLILKSPRVLEKYDVSTTRNYLKLNCGACHELWYTNYKIFD 203

Query: 241 SRVGHSCRLGSHRNKSQPVSHTYKALDQSSVLEFVNV-LNDENSEWFHKKSPTLEAAVIY 299
                                     + +++ + V   L+++   W        +  +I+
Sbjct: 204 -------------------------FNNTTLDKLVKYSLDNKIGYW--------DVEIIH 230

Query: 300 SLGFMGQLTLLKEHIAVRWGITELGASLATEVNEVPPSPEVLIAIFTSF-ASHQEVTLGL 358
           SLG+ G++  L+++I  +WGI+    +     NE P S EVL AI   F    + +   +
Sbjct: 231 SLGYSGRIRSLEDYILKKWGISLCDRAQVNTTNEAPES-EVLEAIINGFFYRDKRMFRAI 289

Query: 359 RLMDAFITKYSEINLDIVFWRRLFQWTNLVWDVKTDPRGDLSRGCWRVMTEWHEKGSKKL 418
           ++++ F+  Y ++NL I FW+         WD K D +G +    W  M  W+   ++++
Sbjct: 290 KILNEFVNVYPDLNLKITFWKTFMNNCIKEWDEKVDQKGVVIVEYWETMKRWYTVHNRRI 349

Query: 419 QPDTTLLNERYFVLAQTNNYKEALTVISQSFPQLYEKPT-LSSKEMAIVQKYSKLVLKSM 477
             +   L        + NN   A  +    F   Y   T ++  E+ ++++Y   +L  +
Sbjct: 350 PFNINFLKVMRTCFKKNNNLVLATDIFQNCFHNFYFCATRMNDSELNVIKEYQNFILSRL 409

Query: 478 AELGYYHKPLTFITEWSPNKAVEDSLRVYFKKHRDGFTXXXXXXXXXXXXXQNTYDDEEE 537
            E   +   LTFI +   +   +  L  Y+     G               + TYDD  E
Sbjct: 410 IEKKGFSNALTFINDHCFSLENKRQLMNYY----HGRKEHKLKKMTRNENLEKTYDDMVE 465

Query: 538 DNMLLGRLW 546
           ++ ++G+LW
Sbjct: 466 EDFIIGKLW 474

>KLLA0D01408g Chr4 (120712..122268) [1557 bp, 518 aa] {ON} weakly
           similar to uniprot|P22136 Saccharomyces cerevisiae
           YMR282C AEP2 Mitochondrial protein likely involved in
           translation of the mitochondrial OLI1 mRNA exhibits
           genetic interaction with the OLI1 mRNA 5'- untranslated
           leader
          Length = 518

 Score =  139 bits (349), Expect = 9e-35,   Method: Compositional matrix adjust.
 Identities = 114/469 (24%), Positives = 220/469 (46%), Gaps = 27/469 (5%)

Query: 53  TMADAFQDKTKGLICATNIHQAESPSSDTTQGMNRLRSLLNTKDYIKFMIELTIQSKLNS 112
           T+ D+ Q     +   +NI     P+++          LL +K  IK +  L  ++ L  
Sbjct: 34  TLEDSLQSILSDIQDGSNIVTPNKPNTN----------LLTSKQPIKALKHLQWKTNLRV 83

Query: 113 NFSHKI--FEDNLLTPNEFSTLLNGLLTERNLSTKLETVLPSVQSTEMIFGLYQTYLMTI 170
             + ++  + +  LTP ++S  +N L+   ++ +K   +L   +  + ++ +Y+ +++  
Sbjct: 84  KKTTRLLKYSNEKLTPEDYSVFVNQLM---DVYSKDIELLNKTEVWKSLYHIYRVFVVN- 139

Query: 171 PAGSLNPLQLHDLNSFVQYFIETAQLGKAQIVLDRILA-SNNDQLPCDTTTGIHYLQLRC 229
                N + L+DLN FV+ FI    L  A+ V   IL  S N ++P D  T   YL+L C
Sbjct: 140 AVDDGNAMVLYDLNQFVRMFINLNDLPLARNVFQLILKNSKNGEIPKDVQTICMYLRLYC 199

Query: 230 GALPRNWKVFDSRVGHSCRLGS--HRNKSQPVSHTYKALDQSSVLEFVNVLND--ENSEW 285
           GAL   W    SR  +   +GS    N S     ++ A     V +F  +L    E+ E+
Sbjct: 200 GALSELWTTQTSRNFYQDLIGSLSGSNASSIRIPSHIAYPTIGVPQFQLLLRKLVEDPEY 259

Query: 286 FHKKSPTLEAAVIYSLGFMGQLTLLKEHIAVRWGITELGASLATE--VNEVPPSPEVLIA 343
              ++  +++ +I +LG   ++  LK++I++ +GI E      T   + ++ P  ++L +
Sbjct: 260 SKLRNTEMDSLIIQALGHYKEVPFLKQYISIFYGIDENVTITETHPGIKKLTPDSQLLKS 319

Query: 344 IFTSFASHQEVTLGLRLMDAFITKYSEINLDIVFWRRLFQWTNLVWDVKTDPRGDLSRGC 403
           + +++  +  +T G+ ++ +F+ KY E+NLD  FWR    W+   W+   D +G   +  
Sbjct: 320 VISAYGHNNNITSGMTVIGSFMEKYPEMNLDKSFWRTTIYWSLREWNKYKDSKGSQPKKA 379

Query: 404 WRVMTEWHEKGSKKLQPDTTLLNERYFVLAQTNNYKEALTVISQSFPQLY---EKPTLSS 460
           W +M  W+    K +  D  ++  R   L    ++  A+  + Q F +++   EK T   
Sbjct: 380 WNLMLNWYATIGKAVPFDQKIMLYRLSFLKSRKDHNAAIRDVQQVFKRIFIKTEKNTFIV 439

Query: 461 KEMAIVQKYSKLVLKSMAELGYYHKPLTFITEWSPNKAVEDSLRVYFKK 509
            E  ++  Y + ++K++       K + FI EW  +      L  YFK+
Sbjct: 440 -ERLVLYAYQRFIIKNLVNQNENAKCVDFINEWRIDFENGRYLERYFKE 487

>NCAS0C00370 Chr3 (54433..55920) [1488 bp, 495 aa] {ON} Anc_8.847
           YMR282C
          Length = 495

 Score =  124 bits (310), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 117/435 (26%), Positives = 201/435 (46%), Gaps = 51/435 (11%)

Query: 124 LTPNEFSTLLNGLLTERNLSTKLETVLPSVQSTEMIFGLYQTYL-MTIPAGSLNPLQLHD 182
            T  E+S  L  +L+ ++          S  +  ++F L++ Y  M    GSLN LQ++D
Sbjct: 100 FTLEEYSLFLGKVLSMKD----------SDVNVNVVFQLFEIYARMYCGEGSLNALQIYD 149

Query: 183 LNSFVQYFIETAQLGKAQIVLDRILAS----NNDQLPCDTTTGIHYLQLRCGALPRNWKV 238
           LN  ++YFI+  QL + QIVLD I+       N     D  +  ++L+L+ G+L ++WK 
Sbjct: 150 LNKLIKYFIKRDQLKQGQIVLDFIIMKYGGIENMIAHRDLISLNNHLKLKNGSLVKDWK- 208

Query: 239 FDSRVGHSCRLGSHRNKSQPVSHTYKALDQSSVLEFVN-VLNDENSEWFHKKSPTLEAAV 297
           F+   G + R    R         YK LD  S+L+  + VLND       K    L  ++
Sbjct: 209 FE---GKNLRYLQSRQGRL----NYKFLDGWSLLKIADLVLNDP-----MKCQNVLTNSI 256

Query: 298 IYSLGFMGQLTLLKEHIAVRWGITELGASLATEVNEVPPSPEVLIAIFTSFA-SHQEVTL 356
           IYSLG + Q+ LL   I   W               + P    +IAI TS+  ++  +  
Sbjct: 257 IYSLGHLRQVELLDHFIDQMW-----MQETRPRNGLLYPDTNNIIAIITSYCYNYGNMDK 311

Query: 357 GLRLMDAFITKYSEINLDIVFWRRLFQWTNLVWDVKTDP---RGDLSRGCWRVMTEWHEK 413
              ++D  + KYS +  D  FWRRLFQW  L     T+P   +G +   CW +M +    
Sbjct: 312 SFDVLDRILEKYSGLKFDKFFWRRLFQWCIL-----TEPNANKGFILGQCWSLMEK---- 362

Query: 414 GSKKLQPDTTLLNERYFVLAQTNNYKEALTVISQSFPQLYEKPTLSSKEMAIVQKYSKLV 473
             +K++ D  LL      + +  +   AL V+     +L +   ++  +M ++ KY K V
Sbjct: 363 -QEKVEFDGVLLELLREKIVKVRDVPLALRVLKMIVIELKKVNFINELDMELLLKYQKFV 421

Query: 474 LKSMAELGYYHKPLTFIT--EWSPNKAVEDSLRVYFKKHRDGFTXXXXXXXXXXXXXQNT 531
              + E+    K +  ++  +++ NK  +  +R Y+ +++                 Q  
Sbjct: 422 FSKLGEINKTVKAMELLSCDDYTINKENKAFMRAYYFENKRE-KRKKNKRSNQYDDLQRK 480

Query: 532 YDDEEEDNMLLGRLW 546
           YD+ +E++M++G+LW
Sbjct: 481 YDEMDEEDMIIGKLW 495

>TBLA0B03310 Chr2 complement(772555..774396) [1842 bp, 613 aa] {ON}
           Anc_8.847 YMR282C
          Length = 613

 Score =  122 bits (307), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 110/449 (24%), Positives = 213/449 (47%), Gaps = 61/449 (13%)

Query: 96  DYIKFMIELTIQSKLNSNFSHKIFEDNLLTPNEFSTLLNGLLTERNLSTKLETVLPSVQS 155
           +Y KF+ EL     L++   +K+   +L   N  S ++N L+   +   K    L     
Sbjct: 124 NYKKFVDELIQWHYLDAKALNKLVNKHLNDMN-LSIVINLLVKYNHFQPKDSDRLSFKSH 182

Query: 156 TEMIFGLYQTYLMTI-------------------PAGSLNPLQLHDLNSFVQYFIETAQL 196
           +E+IF +YQ Y+  I                    +  LNP+QL+DLN  + +FI+  QL
Sbjct: 183 SELIFKVYQIYIERIEHPILNSNNNSHIQSIAEHSSTPLNPIQLYDLNKVITWFIKAGQL 242

Query: 197 GKAQIVLDRILASNND---QLPCDTTTGIHYLQLRCGALPRNWKV-------FDSRVGHS 246
            KA   L  IL   N    Q+P D+ T I++L+L CG LP NW++         ++   S
Sbjct: 243 KKATTALMYILKRYNAEIFQIP-DSKTIINFLKLYCGGLPTNWRIEPINHRFIKNQGKRS 301

Query: 247 CRLGSHRNKSQPVSHTYKALDQSSVLEFVNVLNDENSEW------FH-KKSPTLEAAVIY 299
            +LG++ +  + +  +YKA+ +   ++ V  +    ++       FH  ++   ++ +IY
Sbjct: 302 FKLGNNSSYYR-LPSSYKAVYEKVPIQIVEHIKKNTNDMKLSGKLFHFIRTGEFDSTLIY 360

Query: 300 SLGFMGQLTLLKEHIAVRWGITELGASLATEVNEVPPSPEVLIAIFTSFA--SHQEVTLG 357
           SL  +G+  L +++    W        L+   ++V  + +++IAIF+S+   +   +   
Sbjct: 361 SLTSLGRFDLAEQYFKDNW--------LSDSCDDVELTSDIVIAIFSSYVYNNSNNIEKA 412

Query: 358 LRLMDAFITKYSEINLDIVFWRRLFQWTNLVWDVKTDPRGDLSRGCWRVMTEWHEK---- 413
            +L+   I +Y +++L+I  W R+ +W   +WD  TD  G++    +  M  ++      
Sbjct: 413 NKLIQEIIKRYPDLHLNISTWCRIIRWNIQMWDTTTDFNGEIPYDSFYTMLTYYSNYCSR 472

Query: 414 ----GSKKLQPDTTLLNERYFVLAQTNNYKEALTVISQSFPQ-LYEKPT-LSSKEMAIVQ 467
                S  +  +  LL + Y +     +  + L ++   F + L++ P+ +++K+  I+ 
Sbjct: 473 NSTFKSCHIPYNKMLLGDLYHLFNTKISLNKCLFIMDNCFKKSLFKTPSKVTTKDYQILL 532

Query: 468 KYSKLVLKSMAELGYY--HKPLTFITEWS 494
           KY K++LK +        +KPL FI ++S
Sbjct: 533 KYQKMILKYLINDRKLTSNKPLDFIEKYS 561

>NDAI0K00340 Chr11 complement(64928..66802) [1875 bp, 624 aa] {ON}
           Anc_8.847 YMR282C
          Length = 624

 Score =  119 bits (299), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 114/432 (26%), Positives = 184/432 (42%), Gaps = 75/432 (17%)

Query: 172 AGSLNPLQLHDLNSFVQYFIETAQLGKAQIVLDRILA--SNNDQL--PCDTTTGIHYLQL 227
              LNPL ++DLN F++YF+   QL KAQ+VLD I+      +QL    D TT  ++L+L
Sbjct: 211 TNQLNPLMVYDLNQFIKYFLREGQLKKAQLVLDYIIDRFGGIEQLIKSKDLTTLDNHLKL 270

Query: 228 RCGALPRNWKVFDSRVGHSCRLGSHRNKSQPVSH------TYKALDQSSVLEFVNVLNDE 281
           + GA+ +NWK        S     +R   +  SH       YK LD  S+L+ ++++  +
Sbjct: 271 KNGAIYKNWKPLTD--SESNTFLQYRLSLEDKSHNFKGFKNYKFLDGWSLLKIIDMVLTD 328

Query: 282 NSEWFHKKSPTLEAAVIYSLGFMGQLTLLKEHIAVRWGITELGASLATEVNE------VP 335
            +   +     L  +++YSLG + Q+  ++  I   W +    A    E N       +P
Sbjct: 329 KTHCLN----ILNESILYSLGTLRQIEFMEHFIKQIWDVHPDDA--VEERNHQLDKYNLP 382

Query: 336 PSPEVLIAIFTSFA-SHQEVTLGLRLMDAFITKYSE-----INLDIVFWRRLFQWTNLVW 389
           P    LIAI TS+  +++ +     L+D  I KY E     +N D  FW ++ QW   + 
Sbjct: 383 PDTNELIAILTSYCQTYKSMDRAFLLLDKLIQKYPEPMKSRLN-DNKFWIKMLQWGIKIA 441

Query: 390 DVK-TDPRGDLSRGCWRVMTEWHEKGSKKLQPD---------TTLLNERYFVLAQTNNYK 439
           D    +  G     C  +M EW  KG KK   +         + L+N  + ++ +  N  
Sbjct: 442 DKNGNNVNGTTIDNCLEIMEEWFLKGKKKTALEHWKIDDDYGSILINLLHNIMKERKNVD 501

Query: 440 EALTVISQSFPQLYEKPTLSSKEMAIVQKY------------SKLVLKSMAELGYYHKPL 487
             L  I     +L         ++  V KY             K + + +AE G Y+K L
Sbjct: 502 IGLKAIENFVQKL---------KLGSVNKYYERNLTHVLYGLQKCIFRKIAESGSYNKGL 552

Query: 488 TFITE--WSPNKAVEDSLRVYF-----------KKHRDGFTXXXXXXXXXXXXXQNTYDD 534
             I    ++ N  VE  LR Y+            +     +             Q  YD+
Sbjct: 553 ALIDNGAYTQNSGVESMLREYYITTVKEIRSKRSRRNKAQSNIQDREQDEFEKLQQKYDE 612

Query: 535 EEEDNMLLGRLW 546
            EE+ M++G+LW
Sbjct: 613 IEEEGMIIGKLW 624

>KNAG0J00230 Chr10 (30660..32084) [1425 bp, 474 aa] {ON} Anc_8.847
           YMR282C
          Length = 474

 Score =  117 bits (292), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 99/412 (24%), Positives = 183/412 (44%), Gaps = 56/412 (13%)

Query: 116 HKIFEDNLLTPN--EFSTLLNGLLTERNLSTKLETVLPSVQSTEMIFGLYQTY--LMTIP 171
           H +F  N+L+P   +FS LLN +L  +N        L S ++ E  F ++  Y   + + 
Sbjct: 77  HNVF--NILSPTAMQFSVLLNRVLASQNYRH-----LDSKENVEKFFAIFMRYKGAIALQ 129

Query: 172 AGSLNPLQLHDLNSFVQYFIETAQLGKAQIVLDRILASNNDQLPCDTTTGIHYLQLRCGA 231
           +  L  +QLHD N    YFI   QL KAQ+++D +L  +   +  D     +Y +LRC  
Sbjct: 130 SNKLTQIQLHDFNLMCDYFIACNQLKKAQLIMDFLLQQD---VKFDVFMIKNYTKLRC-- 184

Query: 232 LPRNWKVFDSRVGHSCRLGSHRNKSQPVSHTYKALDQSSVLEFVNVLNDENSEWFHKKSP 291
                             GS   K    +  YK  DQ++V + +  +  +      +K  
Sbjct: 185 ------------------GSSFGKQTLNNKAYKVFDQNTVFQLIGKVEAD------RKFA 220

Query: 292 TLEAAVIYSLGFMGQLTLLKEHIAVRWGIT-------ELGASLATEVNEVPPSPEVLIAI 344
                ++ SLG+   +TL++ +I   W I+        +      + + + PS +VL  I
Sbjct: 221 FWNNEIVSSLGYTNNITLMEIYIWDLWRISIHDHSTENIKIDHLQQGDAMYPSSKVLATI 280

Query: 345 FTSFASH-QEVTLGLRLMDAFITKYSEINLDIVFWRRLFQWTNLVWDVKTDPRGDLSR-- 401
            +S+A H Q +   + +++ F   Y ++ L++ FW  L         +K     D S+  
Sbjct: 281 VSSYARHDQTMKRAVDIVERFAKSYPKLLLNVHFWSTLLNCA-----IKCGGSKDPSQFL 335

Query: 402 GCWRVMTEWHEKGSKKLQPDTTLLNERYFVLAQTNNYKEALTVISQSFPQLY-EKPTLSS 460
            CW +M +WH + SK +   + LL      + QT+N    + ++      LY ++  +  
Sbjct: 336 ACWNLMKKWHTQRSKLMPFQSALLVTILRYMRQTSNLHGTVDILQYWLGPLYLKRGNIPE 395

Query: 461 KEMAIVQKYSKLVLKSMAELGYYHKPLTFITEWSPNKAVEDSLRVYFKKHRD 512
            E  ++ KY K +L+ + +   Y+    FI +WS + + ++ L  +++   D
Sbjct: 396 FERDVLIKYQKQILRKLVDKRKYNWCTAFIDQWSIDASNKEDLEAFYESRVD 447

>ABL119C Chr2 complement(175840..177453) [1614 bp, 537 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR282C
           (AEP2)
          Length = 537

 Score = 84.3 bits (207), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 85/395 (21%), Positives = 177/395 (44%), Gaps = 31/395 (7%)

Query: 129 FSTLLNGLLTERNLSTKLETVLP---SVQSTEMIFGLYQTYLMTIPAGSLNPLQLHDLNS 185
           FS  ++ LL     S+ L+ ++    ++   + ++G Y+      P G  +P +LHD NS
Sbjct: 133 FSVFIHRLLPTYTPSSDLKHLVSKDGTIALLQKLYGFYREQFADAPIGRPSPGRLHDANS 192

Query: 186 FVQYFIETAQLGKAQIVLDRILASNND--QLPCDTTTGIHYLQLRCGALPRNWKVFDSRV 243
           F ++F+  ++L  A+ V   ++ +  +  +LP DT T I  LQL  GA    W+   + V
Sbjct: 193 FARWFMAESKLRLARTVFAELVGNPTELAKLPRDTETIITLLQLHLGAKHIFWRDPGNSV 252

Query: 244 GHSCRLGSHRNKSQPVSHTYKALDQSSVLEFVNVLNDENSEWFHKKSPTLEAAVIYSLGF 303
           G   +L +  + +  V   Y +L + ++L  + +L   + +W    SP L+  +I +L F
Sbjct: 253 GRGGQLFTPAHMA--VVTAYNSLGEETLLRLLRLLQ-SDPQWKSVCSPDLDRNIILALAF 309

Query: 304 MGQLTLLKEHIAVRWGITELGASLATEVNEVPPSPEVLIAIFTSFASHQEVTLGLRLMDA 363
             +L L+    A  +     G  L +    + P   ++ A+ T+FA   ++  GL +   
Sbjct: 310 HNRLDLVHAQAARYYAPAAPGHGLPS--TPLLPDGALVGAVVTAFAFKHQLAQGLAIAYQ 367

Query: 364 FITKYSEINLDIVFWRRLFQWTNLVWDVKTDPRGD----LSRGCWRVM-TEWHEKGSKKL 418
           F+ +++ +  +   W+ +F W       +  P G     L    W  M T + E G    
Sbjct: 368 FLDRFTHLPNEHELWKIIFTWL-----ARRHPTGSQGAALYDEAWSKMRTRYAEHG---- 418

Query: 419 QP---DTTLLNERYFVLAQTNNYKEALTVISQSFPQLYEKPTLSSKEMAIVQKYSKLVLK 475
           QP   D ++    Y ++ + ++ +    +++     LY++P ++ ++  ++ K    ++ 
Sbjct: 419 QPTPYDYSIARASYRIVRRDSSLRRVRALLNDYMSPLYQQPAVAPRDRLLLLKCQAHIVG 478

Query: 476 SMAELGYYHKPLTFITEWSPNKAVEDSLRVYFKKH 510
            +           F+ +W    A++   R +  +H
Sbjct: 479 RLVRARRNSAAADFVDQW----ALDSEARSHLLEH 509

>Smik_6.24 Chr6 (39520..41154) [1635 bp, 544 aa] {ON} YMR279C (REAL)
          Length = 544

 Score = 36.2 bits (82), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 34/128 (26%), Positives = 57/128 (44%), Gaps = 11/128 (8%)

Query: 262 TYKALDQSSVLEFVNVLNDENSEWFHKKSPTLEAAV-IYSLGFMGQLTLLKEHIAVRWGI 320
           T+  +   SV+ F    N EN   F KK   ++A   + SL F+G L  +   I +  G+
Sbjct: 190 TFAVMSLISVIAFFFTYNVEN---FDKKPQKIQAQTSVKSLDFIGSLIFVAGSILIVVGL 246

Query: 321 TELGASLATEVNEVPPSPEVLI--AIFTSFASHQEVTLGLRLMDAFITKYSE-----INL 373
           TE G S    V  V     +L+    F    ++ ++  G+R +    +KY E     I +
Sbjct: 247 TEGGESWNRPVTYVTLIIGILLFFGFFVWNCTYAKIVRGIRFVGIDTSKYFEKVQLLIPV 306

Query: 374 DIVFWRRL 381
           D++F +  
Sbjct: 307 DVLFMKNF 314

>Kwal_27.10865 s27 complement(532303..534243) [1941 bp, 646 aa] {ON}
           YBL061C (SKT5) - Probable Ca++ binding membrane protein
           (prenylated) [contig 33] FULL
          Length = 646

 Score = 34.7 bits (78), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 27/47 (57%), Gaps = 2/47 (4%)

Query: 180 LHDLNSFVQYFIETAQLG--KAQIVLDRILASNNDQLPCDTTTGIHY 224
           + D+   ++ FI+ A LG  +A   L +I  + N+ +P DT+  +HY
Sbjct: 372 IPDMKYAMELFIQAASLGNVQAAAALGKIYEAGNEVVPADTSLSVHY 418

>KLLA0A02959g Chr1 (260627..262306) [1680 bp, 559 aa] {ON} similar
           to uniprot|Q02206 Saccharomyces cerevisiae YKR008W RSC4
           One of 15 subunits of the 'Remodel the Structure of
           Chromatin' (RSC) complex found in close proximity to
           nucleosomal DNA displaced from the surface of
           nucleosomal DNA after chromatin remodeling
          Length = 559

 Score = 33.1 bits (74), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 30/60 (50%), Gaps = 1/60 (1%)

Query: 433 AQTNNYKEALTVISQSFPQLYEKPTLSSKEMAIVQKYSKLVLKSMAELGYYHKPLTFITE 492
           A  NN  + L  I Q F +L +K      E  I    S  ++K+  ELGYYHK   FIT+
Sbjct: 212 ASNNNLDDTLN-ICQPFLELVDKDEYPEYEEVIRLPNSLNLVKNNLELGYYHKIYDFITD 270

>NCAS0B08080 Chr2 complement(1532527..1544853) [12327 bp, 4108 aa]
           {ON} Anc_1.216 YKR054C
          Length = 4108

 Score = 33.1 bits (74), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 29/55 (52%), Gaps = 9/55 (16%)

Query: 396 RGDLSRGCWRVMTEWHEKGSKKLQPDTTLLNERYFVLAQTNNYKEALTVISQSFP 450
           R DL R    + +EW E       PD + L+ RY +L Q  N+K+ L V  +SFP
Sbjct: 602 RQDLQRI---LGSEWQET------PDGSALDHRYSLLEQNLNFKDVLGVWIKSFP 647

>KLTH0G10274g Chr7 complement(868108..869787) [1680 bp, 559 aa] {ON}
           similar to uniprot|P46678 Saccharomyces cerevisiae
           YNL039W BDP1 Essential subunit of RNA polymerase III
           transcription factor (TFIIIB) which is involved in
           transcription of genes encoding tRNAs 5S rRNA U6 snRNA
           and other small RNAs
          Length = 559

 Score = 32.3 bits (72), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 27/51 (52%), Gaps = 2/51 (3%)

Query: 91  LLNTKDYIKFMIELTIQSKLNSNFSHKIFE--DNLLTPNEFSTLLNGLLTE 139
            +N +     MIEL ++SKL  NF H   E    L+T  +F+T L GL  E
Sbjct: 435 FVNEEKKHPVMIELALRSKLPPNFDHYCTEIRKELITLEDFNTKLQGLQKE 485

>Kpol_526.49 s526 (113065..114498) [1434 bp, 477 aa] {ON}
           (113065..114498) [1434 nt, 478 aa]
          Length = 477

 Score = 30.8 bits (68), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 28/58 (48%), Gaps = 2/58 (3%)

Query: 387 LVWDVKTDPRGDLSRGCWRVMTEWHEKGSKKLQPDTTLLNERYFVLAQTNNYKEALTV 444
           L +D+  D   D+ +G W+   +        L  DTTL+N++ F L    NY  A+ +
Sbjct: 124 LAYDIVQDKNNDI-KGTWKFFNQSSFMDEYGLN-DTTLINDKIFKLVHNQNYWFAINI 179

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.132    0.390 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 57,262,037
Number of extensions: 2421549
Number of successful extensions: 7131
Number of sequences better than 10.0: 35
Number of HSP's gapped: 7274
Number of HSP's successfully gapped: 36
Length of query: 546
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 431
Effective length of database: 40,294,809
Effective search space: 17367062679
Effective search space used: 17367062679
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)